Cafe | CZS22MSKSS | manual | Cafe CZS22MSKSS Manual

Cafe CZS22MSKSS Manual
Profile Side by Side
Refrigerators
GEAppliances.com
Safety Instructions . . . . . . . . . . . .2–4
Operating Instructions
Automatic Ice maker . . . . . . . . . . . 15, 16
Care and Cleaning . . . . . . . . . . . . . 18, 19
ClimateKeeper2™ . . . . . . . . . . . . . . . . . . . . 6
Crispers and Pans . . . . . . . . . . . . . . . . . .14
CustomCool™ . . . . . . . . . . . . . . . . . . . . .7, 9
Ice and Water Dispenser . . . . . . . 17–18
Quick Ice. . . . . . . . . . . . . . . . . . . . . . . . . . .17
Refrigerator Doors . . . . . . . . . . . . . . . . .13
Replacing the Light Bulbs . . . . . . . . . . .20
Set Features . . . . . . . . . . . . . . . . . . . . . . . . 6
Shelves and Bins . . . . . . . . . . . . . . . 11, 12
Temperature Controls . . . . . . . . . . . . . . . 5
TurboCool™ . . . . . . . . . . . . . . . . . . . . . . . . . 6
Water Filter . . . . . . . . . . . . . . . . . . . . . . . .10
Installation Instructions
Installing the Refrigerator. . . . . . . 30–33
Moving the Refrigerator . . . . . . . . 26–29
Preparing to Install
the Refrigerator . . . . . . . . . . . . . . . . . . . .25
Trim Kits and Panels . . . . . . . . . . . . 21–24
Water Line Installation . . . . . . . . . 34–36
Owner’s Manual
and Installation
Models 22, 23, 25, 26, 27 and 29
Profile Côte à Côte
Réfrigérateurs
Manuel d’utilisation
et d’installation
La section française commence à la page 47
Profile Lado a Lado
Refrigeradores
Manual del propietario
e instalación
La sección en español empieza en la página 93
Troubleshooting Tips . . . . . . 38–40
Normal Operating Sounds . . . . . . . . . .37
Consumer Support
Performance Data Sheets . . . . . . 43, 44
Warranty (U.S.) . . . . . . . . . . . . . . . . . . . . .42
Write the model and serial numbers
here:
Model # _________________________
Serial # __________________________
Find these numbers on a label inside
the refrigerator compartment at the
top on the right side.
200D8074P052
49-60647-4
10-14 GE
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
SAFETY
GE Appliances website
For more information on your refrigerator’s operation, visit www.GEAppliances.com or
call 800.GECARES (800.432.2737). In Canada visit GEAppliances.ca or call 800.561.3344.
REFRIGERATOR SAFETY INFORMATION
This is the safety alert symbol. This symbol alerts you to potential hazards that can kill or hurt you and others. All safety
messages will follow the safety alert symbol and the word “DANGER”, “WARNING”, or “CAUTION”. These words are defined as:
DANGER
Indicates a hazardous situation which, if not avoided, will result in death or serious injury.
WARNING Indicates a hazardous situation which, if not avoided, could result in death or serious injury.
CAUTION
Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of fire, explosion, electric shock, or injury when using your
WARNING
refrigerator follow these basic safety precautions:
„ This refrigerator must be properly installed and located in
accordance with the Installation Instructions before it is used.
„ Unplug the refrigerator before making repairs, replacing a light
bulb, or cleaning.
Note: Power to the refrigerator cannot be disconnected by any
setting on the control panel.
Note: Repairs must be performed by a qualified service
professional.
„ Replace all parts and panels before operating.
„ Do not store or use gasoline or other flammable vapors and
liquids in the vicinity of this or any other appliance.
CAUTION
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of injury when using your refrigerator, follow these basic
safety precautions.
„ Do not clean glass shelves or covers with warm water when
they are cold. Glass shelves and covers may break if exposed
to sudden temperature changes or impact, such as bumping
or dropping. Tempered glass is designed to shatter into many
small pieces if it breaks.
„ Keep fingers out of the “pinch point” areas; clearances
between the doors and between the doors and cabinet are
necessarily small. Be careful closing doors when children are in
the area.
„ Always clean the CustomCool™ Tray after thawing food.
2
„ Because of potential safety hazards under certain conditions,
we strongly recommend against the use of an extension cord.
However, if you must use an extension cord, it is absolutely
necessary that it be a UL-listed (in the United States) or a
CSA certified (in Canada), 3-wire grounding type appliance
extension cord having a grounding type plug and outlet and
that the electrical rating of the cord be 15 amperes (minimum)
and 120 volts.
„ To prevent suffocation and entrapment hazards to children,
remove the fresh food and freezer doors from any refrigerator
before disposing of it or discontinuing its use.
„ Do not allow children to climb, stand or hang on the door
handles or the shelves in the refrigerator. They could seriously
injure themselves.
„ Do not touch the cold surfaces in the freezer compartment
when hands are damp or wet, skin may stick to these
extremely cold surfaces.
„ Do not refreeze frozen foods which have thawed completely.
„ In refrigerators with automatic icemakers, avoid contact with
the moving parts of the ejector mechanism, or with the heating
element that releases the cubes. Do not place fingers or hands
on the automatic ice making mechanism while the refrigerator
is plugged in.
GEAppliances.com
SAFETY
(CONT.)
INSTALLATION
WARNING
Explosion Hazard.
Keep flammable materials and vapors, such as gasoline, away from refrigerator. Failure to do so can
result in fire, explosion, or death.
CONNECTING ELECTRICITY
WARNING
Electrical Shock Hazard.
Plug into a grounded 3-prong outlet
Do not remove the ground prong
Do not use an adapter
Failure to follow these instructions can result in death, fire, or electrical shock.
Do not, under any circumstances, cut or remove the third (ground) prong from the power cord.
For personal safety, this appliance must be properly grounded.
The power cord of this appliance is equipped with a
3-prong (grounding) plug which mates with a standard
3-prong (grounding) wall outlet to minimize the
possibility of electric shock hazard from this appliance.
Have the wall outlet and circuit checked by a qualified
electrician to make sure the outlet is properly
grounded.
Where a standard 2-prong wall outlet is encountered,
it is your personal responsibility and obligation to have
it replaced with a properly grounded 3-prong wall
outlet. Do not use an adapter.
The refrigerator should always be plugged into its own
individual electrical outlet which has a voltage rating
that matches the rating plate.
A 115 Volt AC, 60 Hz, 15- or 20-amp fused, grounded
electrical supply is required. This provides the best
performance and also prevents overloading house
wiring circuits which could cause a fire hazard from
overheated wires.
Never unplug your refrigerator by pulling on the power
cord. Always grip plug firmly and pull straight out from
the outlet.
Repair or replace immediately all power cords that
have become frayed or otherwise damaged. Do not
use a cord that shows cracks or abrasion damage
along its length or at either end.
When moving the refrigerator away from the wall, be
careful not to roll over or damage the power cord.
PROPER DISPOSAL OF YOUR OLD REFRIGERATOR
WARNING Suffocation and child entrapment hazard.
Remove fresh-food and freezer doors from the refrigerator, prior to disposal. Failure to do so can result
in child entrapment which can lead to death or brain damage.
IMPORTANT:
Child entrapment and suffocation are not problems
of the past. Junked or abandoned refrigerators are
still dangerous even if they will sit for “just a few
days.” If you are getting rid of your old refrigerator,
please follow the instructions below to help prevent
accidents.
Refrigerants
All refrigeration products contain refrigerants,
which under federal law must be removed prior
to product disposal. If you are getting rid of an old
refrigeration product, check with the company
handling the disposal about what to do.
Before You Throw Away Your Old Refrigerator or
Freezer:
„ Take off the fresh food and freezer doors.
„ Leave the shelves in place so that children may
not easily climb inside.
READ AND FOLLOW THIS SAFETY INFORMATION CAREFULLY.
SAVE THESE INSTRUCTIONS
3
About the temperature controls.
Not all features are on all models. Your controls may be similar to the following:
>
>
To change the Refrigerator temperature:
Tactile-LED Dispenser Control
The temperature controls can display both the SET temperature as well
as the actual temperature in the refrigerator and freezer. The actual
temperature may vary slightly from the SET temperature based on
usage and operating environment.
„ On some models, setting both controls to the warmest setting until
the display flashes (off) will stop cooling in both the freezer and
refrigerator compartments.
„ On other models, setting either control to the warmest setting
until the display flashes (off) will stop the cooling to the freezer and
refrigerator.
„ NOTE: Turning the refrigerator off via the controls on the touch
panel does not shut off electrical power to the refrigerator.
NOTE: The refrigerator is shipped with protective film covering the
temperature controls. If this film was not removed during installation,
remove it now.
Touch-LED Dispenser Control:
To change the temperature, press and release the FREEZER
TEMP/FRIDGE TEMP pad. The SET light will come on and
the display will show the set temperature. To change the
temperature, tap either the
or
pad until the desired
temperature is displayed.
Performance Air Flow System
The Performance Air-Flow System is designed to maximize
temperature control in the refrigerator and freezer
compartments. This unique special feature consists of the
Air Tower along the back wall of the refrigerator and the Air
Tunnel on the bottom portion of the freezer rear wall. Placing
food in front of the louvers on these components will not affect
performance. Although the Air Tower and the Air Tunnel can
be removed, doing so will affect temperature performance.
(For removal instructions, on-line, contact us at ge.com or call
800.GE.CARES. In Canada, contact us at geappliances.ca or call
1.800.561.3344.)
4
Tactile LED Dispenser Control.
Once the desired temperature has been set, the temperature
display will return to the actual refrigerator and freezer
temperatures after 5 seconds. Several adjustments may be
required. Each time you adjust the controls, allow 24 hours for
the refrigerator to reach the temperature you have set.
The temperature controls can display both the SET temperature as well
as the actual temperature in the refrigerator and freezer. The actual
temperature may vary slightly from the SET temperature based on
usage and operating environment.
Turning the cooling system off: Tactile-LED Dispenser Control
„ On some models, setting both controls to the warmest setting until
the display flashes (off) will stop cooling in both the freezer and
refrigerator compartments.
„ On other models, setting either control to the warmest setting
until the display flashes (off) will stop the cooling to the freezer and
refrigerator.
„ NOTE: Turning the refrigerator off via the controls on the touch
panel does not shut off electrical power to the refrigerator.
Touch-LED Dispenser Control:
Press and release the FREEZER TEMP/FRIDGE TEMP pad.
Press to set freezer temperature to 5. The display will
show OFF. To turn the unit back on, press the FREEZER
TEMP/FRIDGE TEMP pad. Press
to set the freezer and
refrigerator temperatures to the preset points of 0°F (-18°C)
for the freezer and 37°F (3°C) for the refrigerator.
When the unit is turned back on, it will take up to 24 hours
to stabilize.
>
The temperature controls are preset in the factory at 37°F (3°C) for the
refrigerator compartment and 0°F (-18°C) for the freezer compartment.
Allow 24 hours for the temperature to stabilize to the preset
recommended settings.
Refrigerator temperatures can be adjusted between 34°F and 46°F
(1°C to 8°C), and the freezer temperatures can be adjusted between –6°F
and +8°F (–21°C to –13°C).
>
Touch-LED Dispenser Control
NOTE: The refrigerator is shipped with
protective film covering the temperature
controls. If this film was not removed
during installation, remove it now.
About Set Features.
This pad is used to select the following features:
TurboCool, Quick Ice, Door Alarm and Water
Filter.
GEAppliances.com
Pressing SET FEATURES repeatedly will cycle
through all of the available features and then
exit the mode. If no key is pressed, the mode
will exit and return to displaying features
currently set.
About TurboCool.™
How it Works
OR
TurboCool ™ rapidly cools the refrigerator
compartment in order to more quickly
cool foods. Use TurboCool™ when adding
a large amount of food to the refrigerator
compartment, putting away foods after they
have been sitting out at room temperature or
when putting away warm leftovers. It can also
be used if the refrigerator has been without
power for an extended period.
Once activated, the compressor will turn
on immediately and the fans will cycle on
and off at high speed as needed for eight
hours. The compressor will continue to run
until the refrigerator compartment cools to
approximately 34°F (1°C), then it will cycle on
and off to maintain this setting. After 8 hours, or
if TurboCool™ is pressed again, the refrigerator
compartment will return to the original setting.
How to Use
Tactile LED Dispenser Control:
Press TurboCool™. The TurboCool temperature
display will show Tc and the LED will be activated.
After TurboCool™ is complete, the TurboCool™
indicator light will go out.
NOTES: The refrigerator temperature cannot be
changed during TurboCool™.
The freezer temperature is not affected
during TurboCool™.
When opening the refrigerator door during
TurboCool™, the fans will continue to run if
they have cycled on.
Touch-LED Dispenser Controls:
Press SET FEATURES. The refrigerator
temperature display will show TurboCool™
and/or TC. Press ON/OFF.
After TurboCool™ is complete, the refrigerator
compartment will return to the original setting.
NOTES:
The refrigerator temperature cannot be changed
during TurboCool™.
The freezer temperature is not affected during
TurboCool™.
When opening the refrigerator door during
TurboCool™, the fans will continue to run if they
have cycled on.
About ClimateKeeper2.™ (on some models)
How it Works
The ClimateKeeper2 ™ is the industry’s most
advanced refrigeration system, delivering
optimum temperature and humidity
performance to keep food garden fresh longer
and reduce freezer burn.
The ClimateKeeper2™ system features two
HYDSRUDWRUV³RQHIRUWKHUHIULJHUDWRUDQGRQH
for the freezer.
This provides two separate cooling systems,
and separates the airflow between the fresh
food and freezer compartments during normal
cooling operations.*
This ensures that the humidity levels in the
fresh food compartment are significantly higher
than in a conventional system,** allowing fresh
produce and other unsealed foods to retain
their moisture content and freshness longer.
Moisture sensitive foods such as fresh fruit,
salads, rice, etc., can now be stored on open
shelves without excessive moisture loss.
Due to the higher humidity in the refrigerator,
you may on occasion experience fog or
small amounts of moisture in the refrigerator
compartment. This is normal and may
come and go as different food loads and
environmental conditions change. Wipe dry
with a paper towel if desired.
The separate airflow system minimizes the
mixing of air between the two compartments,
which reduces fresh food odor transfer to
improve the taste of ice.
The ClimateKeeper2™ system also reduces
the number of defrosting cycles in the freezer
evaporator, thereby reducing freezer burn.
*Freezer air is used in the CustomCool feature.
**Testing shows a higher level of humidity in
the Fresh Food section in ClimateKeeper2™
refrigerators versus conventional units.
5
About CustomCool.™ (on some models)
How it Works
Touch LED Dispenser Control
The CustomCool ™ feature is used to quickly
chill items, thaw items or hold the pan at a
specific temperature. This feature is a system of
dampers, a fan, a temperature thermistor and
a heater.
The pan is tightly sealed to prevent temperature
fluctuations in the rest of the refrigerator.
The controls for this pan are located on the
dispenser with the temperature controls.
How to Use
Empty the pan. Place the Chill/Thaw tray in
the pan. Place the items on the tray and
close the pan completely.
ExpressThaw™
Touch LED Dispenser Control:
Select the ExpressThaw™, ExpressChill™
or SelectTemp™ pad. The display and SET
light will come on. Tap the pad until the light
appears next to the desired setting.
Use the following chart to determine the
best setting to use.
„ ExpressChill can be set to 15, 30 or 45
minutes. The default is 15 minutes.
„ To stop a feature before it is finished:
tap that feature’s pad until no options are
selected and the display is off.
ExpressChill ™
6
„ During ExpressThaw and ExpressChill, the
display on the controls will count down the
time in the cycle (on some models).
„ After the ExpressThaw cycle is complete,
the pan will reset to the MEAT setting (32°F
[0°C]) to help preserve thawed items until
they are used.
„ The displayed actual temperature of the
CustomCool pan may vary slightly from
the SET temperature based on usage and
operating environment.
NOTE: For food safety reasons, it is
recommended that foods be wrapped in plastic
wrap when using ExpressThaw. This will help
contain meat juices and improve thawing
performance.
About ExpressChill.™(on some models)
GEAppliances.com
How it Works
The ExpressChill™ feature is a system of
dampers, a fan and a temperature thermistor.
The pan is tightly sealed to prevent the pan’s
temperature from causing temperature
fluctuations in the rest of the refrigerator.
The controls for this pan are located in the top
of the refrigerator or on the dispenser with the
temperature controls.
How to Use
ExpressChill ™
Empty the pan. Place the Chill tray in the
pan. Place the items on the tray and close
the pan completely.
Select the ExpressChill ™ pad. On some
models, you can then select the chill time
(use chart to determine best setting). Other
models will only have one option (45
minutes). On models with multiple settings,
tap the pad until the light appears next to
the desired setting.
„To stop a feature before it is finished, tap
that feature’s pad until no options are
selected and the display is off.
„ During ExpressChill, the display on the
controls will count down the time in the
cycle.
How to Remove and Replace the Drawer
To remove:
Pull the drawer out to the stop position.
Lock all four swing locks by rotating them
to the lock position.
Rotate all four swing locks to the unlock
position.
Lift the front of the drawer up and out.
To replace:
Make sure all four swing locks are in the
unlock position.
Place the sides of the drawer into the
drawer supports, making sure the swing
locks fit on the drawer slots.
7
About CustomCool.™ (on some models)
CustomCool ™ Chart
NOTE: Results may vary depending on packaging, starting temperature and other food traits.
ExpressThaw™
0.5 Lb. (4 hours)
„ Hamburger Patties (0.5 lb)
„ Individually Wrapped
Filet Mignon (0.5 lb)
1.0 Lb. (6 hours)
„ Chicken Breasts (1.0 lb)
„ Ground Beef (1.0 lb)
„ Steak (1.0 lb)
2.0 Lbs. (10 hours)
„ Chicken Breasts (2.0 lbs)
„ Ground Beef (2.0 lbs)
„ Steak (2.0 lbs)
3.0 Lbs. (12 hours)
„ Chicken Breasts (3.0 lbs)
„ Ground Beef (3.0 lbs)
„ Steak (3.0 lbs)
8
ExpressChill™
15 Minutes
„ 1 Beverage Can (12 oz)
„ 2 Small Juice Boxes (6–8 oz each)
30 Minutes
„ 2 to 6 Beverage Cans (12 oz each)
„ 2 Plastic 20 oz Bottles of Beverage
„ 4 to 6 Small Juice Boxes
(6–8 oz each)
„ 3 Foil Juice Packets
„
Wine (750 ml bottle)
45 Minutes
„ 2 Liter of Beverage
„ 1/2 Gallon of Juice
„ Gelatin–1 package
SelectTemp™
Citrus Setting (43°F [6°C])
„ Oranges, Lemons, Limes, Pineapple,
Cantaloupe
„ Beans, Cucumbers, Tomatoes,
Peppers, Eggplant, Squash
Produce Setting (35°F [2°C])
„ Strawberries, Raspberries, Kiwifruit,
Pears, Cherries, Blackberries, Grapes,
Plums, Nectarines, Apples
„ Asparagus, Broccoli, Corn,
Mushrooms, Spinach, Cauliflower,
Kale, Green Onion, Beets, Onions
Meat Setting (32°F [0°C])
„ Raw Meat, Fish and Poultry
About the water filter. (on some models)
GEAppliances.com
Water Filter Cartridge
The water filter cartridge is located in the back upper right
corner of the refrigerator compartment.
When to Replace the Filter on Models With a
Replacement Indicator Light
There is a replacement indicator light for the water filter
cartridge on the dispenser. This light will turn orange to tell you
that you need to replace the filter soon.
The filter cartridge should be replaced when the replacement
indicator light turns red or if the flow of water to the dispenser or
ice maker decreases.
Cartridge
Holder
Run water from the dispenser 1-1/2 gallons (about three
minutes) to clear the system and prevent sputtering.
Press and hold the WATER FILTER pad (on some models) on
the dispenser for 3 seconds.
When to Replace the Filter on Models Without a
Replacement Indicator Light
The filter cartridge should be replaced every six months or
earlier if the flow of water to the water dispenser or ice maker
decreases.
Removing the Filter Cartridge
If you are replacing the cartridge, first remove the old one by
slowly turning it to the left. Do not pull down on the cartridge. A
small amount of water may drip down.
Installing the Filter Cartridge
NOTE: A newly-installed water filter cartridge may cause water
to spurt from the dispenser upon first use.
Filter Bypass Plug
You must use the filter bypass plug when a replacement filter
cartridge is not available. The dispenser and the ice maker will
not operate without the filter or filter bypass plug.
If you are replacing a SmartWater cartridge with an
adapter, it must be removed before installing the cartridge.
To remove the adapter, turn it to the left about 1/4 turn.
If you are replacing a Water by Culligan cartridge, leave the
adapter in place. This adapter will stay in the refrigerator when
you replace future cartridges.
Filter
Bypass
Plug
SmartWater
Filter
Bypass
Plug
Water by Culligan
To use the filter bypass plug on Water by Culligan models, you
must first remove the filter adapter from the cartridge holder by
turning it to the left.
With adapter
Without adapter
(appearance may vary)
Some models
use this type of
water filter.
On models without a replacement indicator light, apply the
month and year sticker to the new cartridge to remind you
to replace the filter in six months.
Fill the replacement cartridge with water from the tap to
allow for better flow from the dispenser immediately after
installation.
Line up the arrow on the cartridge and the cartridge holder.
Place the top of the new cartridge up inside the holder. Do
not push it up into the holder.
Slowly turn it to the right until the filter cartridge stops.
DO NOT OVERTIGHTEN. As you turn the cartridge, it will
automatically raise itself into position. The cartridge will
move about 1/2 turn.
For the maximum benefit of your filtration system, GE
recommends the use of GE branded SmartWater filters only.
Using GE branded filters in GE and Hotpoint refrigerators
provides optimal performance and reliability. GE branded
SmartWater filters are always the right choice because they
are patented and designed specifically for GE products. GE
SmartWater filters meet rigorous industry NSF standards for
safety and quality that are important for products that are
filtering your water. GE has not qualified non-GE branded
filters for use in GE and Hotpoint refrigerators and there is no
assurance that non-GE branded filters meet GE’s standards for
quality, performance and reliability.
,I\RXKDYHTXHVWLRQV³YLVLWRXU:HEVLWHDWGEAppliances.com, or
call 1.800.GE.CARES (1.800.432.2737).
Replacement filters:
To order additional filter cartridges in the United States,
visit our Website at GEAppliances.com, or call GE Parts and
Accessories, 800.626.2002.
See filter label for type of filter to order (MWF or MSWF).
Customers in Canada should consult the yellow pages for the
nearest Mabe Service Center.
9
About the shelves and bins.
Not all features are on all models.
Snugger
Refrigerator Door Bins and Freezer Door Tilt-Out Bins
Bins
The larger refrigerator door bins and freezer
tilt-out door bins are adjustable.
Top Freezer Bins
Do not block
To remove: Lift the front of the bin straight up,
then lift up and out.
Refrigerator bin
To replace or relocate: Engage the back side
of the bin in the molded supports on the door.
Then push down on the front of the bin. Bin will
lock in place.
The snugger helps prevent tipping, spilling or
sliding of small items stored on the door shelf.
Place a finger on either side of the snugger
near the rear and move it back and forth
to fit your needs.
NOTE:
Be careful when
placing items in
the top bin. Make
sure that items
do not block or
fall into the ice
chute.
Top freezer bin
Do not block
Freezer tilt-out bin
NOTE:
Part must be in
place as shown
for proper ice
dispensing. Food
cannot be stored
in this location.
Top freezer bin (on some models)
Slide-Out Spillproof Shelf
The slide-out spillproof shelf allows you to
reach items stored behind others. The special
edges are designed to help prevent spills from
dripping to lower shelves.
Press tab and pull shelf forward
to remove
To remove:
Slide the shelf out until it reaches the stop,
then press down on the tab and slide the shelf
straight out.
To replace or relocate:
Line the shelf up with the supports and slide
it into place. The shelf can be repositioned
when the door is at 90° or more. To reposition
the shelf, slide the shelf past the stops and
angle downward. Slide shelf down to the
desired position, line up with the supports and
slide into place.
Make sure you push the shelves all the way
back in before you close the door.
QuickSpace™ Shelf
This shelf splits in half and slides under itself for
storage of tall items on the shelf below.
This shelf can be removed and replaced or
relocated just like Slide-Out Spillproof Shelves.
10
On some models, this shelf cannot be used in
the lowest position.
GEAppliances.com
Not all features are on all models.
Freezer Baskets
To remove, push the basket all the way to the
back of the freezer. Lift up until the back pins
are disengaged. Lift the entire basket up and
pull out.
Make sure you push the baskets all the way
back in before you close the door.
Slide-Out Freezer Shelves
To remove, slide out to the stop position, lift the
front past the stop position and slide out.
Make sure you push the shelves all the way
back in before you close the door.
Fixed Freezer Shelves
There are two types of fixed freezer shelves.
To remove this type of shelf:
Lift the shelf up at the left side.
NOTE FOR DISPENSER MODELS: In order to
take full advantage of the tilt-out ice bin, only
store items on the shelf below the ice bin that
are no taller than the lowest point on the bin.
Bring the shelf out.
To remove this type of shelf:
Lift up the left side of the shelf and slide it
left into the center of the shelf supports.
Rotate the right side of the shelf up and out
of the shelf supports.
Door Wine/Beverage Rack (on some models)
This rack holds up to 5 cans or one bottle of
wine.
The rack hangs from the sides of the dairy bin.
To remove:
Empty the wine/beverage rack.
To replace:
Reattach the rack to the sides of the bin.
Engage the back side of the bin in the
molded supports on the door. Then push
down on the front of the bin. The bin will
lock into place.
Holding the bottom of the dairy bin, lift the
front straight up, then lift up and out.
To detach the rack from the dairy bin, pull
the rack’s side wires out of the holes on
each side of the dairy bin.
11
About the refrigerator doors.
Refrigerator Doors
The refrigerator doors may feel different than
the ones you are used to. The special door
opening/closing feature makes sure the doors
close all the way and are securely sealed.
The resistance you feel at the stop position will
be reduced as the door is loaded with food.
When opening and closing the door, you will
notice a stop position. If the door is opened
past this stop point, the door will remain open
to allow you to load and unload food more
easily. When the door is only partially open, it
will automatically close.
When the door is only partially open,
it will automatically close.
Beyond this stop the door will stay
open.
Door Alignment
If doors are uneven, adjust the refrigerator
door.
Using a 7/16” wrench, turn the door
adjusting screw to the right to raise the
door, to the left to lower it. (A nylon plug,
imbedded in the threads of the pin,
prevents the pin from turning unless a
wrench is used.)
7/16” Wrench
Raise
12
After one or two turns of the wrench,
open and close the refrigerator door and
check the alignment at the top of the
doors.
About the crispers and pans.
GEAppliances.com
Not all features are on all models.
Fruit and Vegetable Crispers
Excess water that may accumulate in
the bottom of the drawers should be
wiped dry.
On some models, the bottom drawer has
full extension slides that allow full access
to the drawer.
HI
LO
Adjustable Humidity Crispers
Slide the control all the way to the HI setting to
provide high humidity recommended for most
vegetables.
Slide the control all the way to the LO
setting to provide lower humidity levels
recommended for most fruits.
Convertible Deli Pan
T
ES
LD
O
CO
LD
C
The convertible deli pan has its own cold
air duct to allow a stream of cold air from
the freezer compartment or fresh food
compartment to flow to the pan.
The variable temperature control regulates
the air flow from the Climate Keeper Air Tower.
Set the control to the coldest setting to store
fresh meats.
Set the control to cold to convert the pan
to normal refrigerator temperature and provide
extra vegetable storage space.
The cold air duct is turned off. Variable settings
between these extremes can
be selected.
About crisper removal.
Not all features are on all models.
Crisper Removal
Crispers can easily be removed by pulling the
drawer straight out and lifting the drawer up
and over the stop location.
If the door prevents you from taking out the
drawers, first try to remove the door bins.
If this does not offer enough clearance, the
refrigerator will need to be rolled forward
until the door opens enough to slide the
drawers out. In some cases, when you roll the
refrigerator out, you will need to move the
refrigerator to the left or right as you roll it out.
13
About the automatic ice maker.
A newly installed refrigerator may take 12 to 24 hours to begin making ice.
Automatic Ice maker
7KHLFHPDNHUZLOOSURGXFHVHYHQFXEHVSHUF\FOH³
approximately 100–130 cubes in a 24-hour period, depending
on freezer compartment temperature, room temperature,
number of door openings and other use conditions.
If the refrigerator is operated before the water connection is
made to the ice maker, set the power switch in the OFF position.
When the refrigerator has been connected to the water supply,
set the power switch to the ON position.
The ice maker will fill with water when it cools to 15°F (–10°C).
A newly installed refrigerator may take 12 to 24 hours to begin
making ice cubes.
You will hear a buzzing sound each time the ice maker fills with
water.
Special note about dispenser models:
„ Some models have a tilt-out ice bin. The bin can be tilted out
as shown in the illustrations, and it will hold itself up while you
take ice out or turn the ice maker power switch on and off. Be
sure to put the bin back in place before closing the door.
„ To restore your ice level from an empty bucket stage, the
following steps are recommended:
12 hours after the first batch of ice has fallen into the bin,
dispense 3 to 4 cubes.
After an additional 6 hours, dispense 3 to 4 cubes again.
These steps will restore your ice level in the shortest amount of
time.
Power
Ice maker Switch
Throw away the first few batches of ice to allow the water line
to clear.
Ice maker
Be sure nothing interferes with the sweep of the feeler arm.
When the bin fills to the level of the feeler arm, the ice maker will
stop producing ice. It is normal for several cubes to be joined
together.
If ice is not used frequently, old ice cubes will become cloudy,
taste stale and shrv
CAUTION
Avoid contact with the moving parts of
the ejector mechanism, or with the heating element (located
on the bottom of the ice maker) that releases the cubes.
Do not place fingers or hands on the automatic ice making
mechanism while the refrigerator is plugged in.
14
Power
Switch
Feeler Arm
(on some models)
Green
Power Light
Feeler Arm
(on some models)
NOTE:
In homes with lower than average water pressure, you
may hear the ice maker cycle multiple times when making
one batch of ice.
About the automatic ice maker. (cont)
Accessing Ice and Reaching the Power Switch on
Dispenser Models
GEAppliances.com
Models with a shelf above the ice bin
There are two types of ice storage bins on dispenser models.
One has a shelf above the bin, the other does not.
Special note for models with tilt-out ice bin:
„ These models have a tilt-out ice bin. The bin can be tilted
out as shown in the illustrations, and it will hold itself up
while you take ice out or turn the icemaker power switch
on and off. Be sure to put the bin back in place before
closing the door.
Shelf
Shelf
Ice Bin
Ice Bin
To reach the power switch, pull the
shelf straight out. Always be sure to
replace the shelf.
NOTE: In order to take full advantage of the tilt-out ice bin, only store items
on the shelf below the ice bin that are no taller than the lowest point on the
bin.
To access ice, pull the bin forward.
Models with tilt out ice bin
On some models, to access ice or reach the power switch:
To access ice and reach the icemaker power switch:
Lift the bin, then pull it forward
until the bin stops.
Lower the bin to access ice or
reach the power switch.
Pull the bin forward until the
bin stops.
Lower the bin to access ice or
reach the power switch.
Removing Ice Bin (dispenser models)
CAUTION
The ice bin is heavy when full.
Set the power switch to the OFF position before removing the
bin.
Rotate
When replacing the bin, be sure to press it firmly into place. If
it does not go all the way back, remove it and rotate the drive
mechanism 1/4 turn. Then push the bin back again.
Drive
Mechanism
Dispenser Models only
15
About the ice and water dispenser. (on some models)
To Use the Dispenser
Spill Shelf
Select CUBED, CRUSHED or WATER.
Press the glass gently against the top of the
dispenser cradle.
The spill shelf is not self-draining. To reduce
water spotting, the shelf and its grille should be
cleaned regularly.
If no water is dispensed when the refrigerator is
first installed, there may be air in the water line
system. Press the dispenser arm for at least two
minutes to remove trapped air from the water
line and to fill the water system. To flush out
impurities in the water line, throw away the first
six glassfuls of water.
CAUTION
Never put fingers or any other
objects into the ice crusher discharge opening.
Locking the Dispenser
Press the LOCK or LOCK CONTROLS pad for 3
seconds to lock the dispenser and control panel.
To unlock, press and hold the pad again for 3
seconds.
Door Alarm
Use Door Alarm to sound if either door is open
for more than 3 minutes. The alarm will stop
once the door is closed. For LCD models, a popup
screen will appear. The alarm can be silenced by
touching the LCD screen.
Touch LED Dispenser Control:
Press the SET FEATURES pad once and DOOR
ALARM will blink. Press ON/OFF and the door
alarm will be set and the icon will turn solid. Press
ON/OFF again to turn the alarm off.
Door Alarm (on Tactile LED Dispenser Control
model)
To set the alarm, press this pad until the indicator
light comes on. This alarm will sound if either
door is open for more than 3 minutes. The light
goes out and the beeping stops when you close
the door.
Dispenser Light
The LIGHT pad turns the light in the dispenser
on and off. The light also comes on when the
dispenser cradle is pressed. For models with a
bulb, if the light burns out, it should be replaced
with a 6 watt 12V maximum bulb. For LED
models contact Factory Service.
Quick Ice
When you need to speed up ice production, use the
Quick Ice feature. While this feature is turned on,
the freezer fan runs continuously for 48 hours, or
until the feature is turned OFF. During this period, ice
production will increase up to 40%. Models with the
integrated ice feature system require at FIRST USE at
least half an 8 oz. glass of ice to be dispensed every 6
to 12 hours. This will help the ice maker fill the bucket
properly so that dispensing is better.
16
How to Use
Touch LED Dispenser Control:
Press the SET FEATURES pad twice and QUICK ICE
will blink. Press ON/OFF to turn the feature on, then
again to turn it off.
Quick Ice (on Tactile LED Dispenser Control
model)
When you need ice in a hurry, press this pad
to speed up ice production. This will increase
ice production for the following 48 hours or
until you press the pad again.
GEAppliances.com
Precise Fill (on some models)
Press the PRECISE FILL pad again to toggle
between cups and ounces.
>
>
If you selected OUNCES, press the
or pad to
select the number of ounces you would like to have
dispensed between 2–99 ounces. The default is 8
ounces.
>
If you selected CUPS, press the or pad to
select the amount you would like to have dispensed.
They are displayed as 1/4, 1/3, 1/2, 2/3 and 3/4, with
the highest amount being 16 3/4 cups. The default
is 1 cup.
Press the cup against the cradle and water will
begin dispensing. It will automatically stop when
the amount set has been dispensed. The display
will show the amount of water dispensed, beep,
then reset after 5 seconds.
NOTE: Do not leave the dispenser unattended when
water is being dispensed.
If you would like to stop dispensing water
before the specified amount has been
dispensed, just remove the cup from the cradle.
The display will show the amount that has been
dispensed for 5 seconds. If the cup switch is
pressed again within that time, the dispenser
will continue up to the set amount. If not, the
display will return to the set amount.
>
This water dispenser is equipped with a feature
called “precise fill.” This feature allows you to choose
a precise amount of water (cups or ounces) that
you would like dispensed. Pints and Liters are also
available for LCD models.
Touch LED Dispenser Control
Press the PRECISE FILL CUPS/OZ pad. The
WATER pad will light and the CRUSHED and
CUBED ice pads will turn off. The last unit used
will be displayed.
Important Facts About Your Dispenser
„ Do not add ice from trays or bags to
the storage drawer. It may not crush or
dispense well.
„ Avoid overfilling glass with ice and use of
narrow glasses. Backed-up ice can jam
the chute or cause the door in the chute
to freeze shut. If ice is blocking the chute,
poke it through with a wooden spoon.
„ Beverages and foods should not be
quick-chilled in the ice storage drawer.
Cans, bottles or food packages in the
storage drawer may cause the ice maker
or auger to jam.
„ To keep dispensed ice from missing the
glass, put the glass close to, but not
touching, the dispenser opening.
„ Some crushed ice may be dispensed
even though you selected CUBED. This
happens occasionally when a few cubes
accidentally get directed to the crusher.
„ After crushed ice is dispensed, some
water may drip from the chute.
„ Sometimes a small mound of snow will
form on the door in the ice chute. This
condition is normal and usually occurs
when you have dispensed crushed ice
repeatedly. The snow will eventually
evaporate.
17
Care and cleaning of the refrigerator.
Cleaning the Outside
Dispenser drip area.
The dispenser drip area, beneath the grille,
should be wiped dry. Water left in this area
may leave deposits. Remove the deposits by
adding undiluted vinegar to the well. Soak
until the deposits disappear or become loose
enough to rinse away.
The dispenser cradle. Before cleaning, lock
the dispenser by pressing and holding the
LOCK or LOCK CONTROLS pad for 3 seconds.
Clean with warm water and baking soda
VROXWLRQ³DERXWDWDEOHVSRRQ PO RI
baking soda to a quart (1 liter) of water. Rinse
thoroughly and wipe dry.
The door handles and trim. Clean with a
cloth dampened with soapy water. Dry with
a soft cloth.
Do not use appliance wax or polish on the
stainless steel.
Keep the outside clean. Wipe with a
clean cloth lightly dampened with kitchen
appliance wax or mild liquid dish detergent.
Dry and polish with a clean, soft cloth.
Do not wipe the refrigerator with a soiled
dish cloth or wet towel. These may leave
a residue that can erode the paint. Do not
use scouring pads, powdered cleaners,
bleach or cleaners containing bleach
because these products can scratch and
weaken the paint finish.
The stainless steel doors and door handles
(on some models) can be cleaned with
a commercially available stainless steel
cleaner. Cleaners with oxalic acid such
as Bar Keepers Friend Soft Cleanser™ will
remove rust, tarnish and small blemishes.
Use only a liquid cleanser free of grit and
rub in the direction of the brush lines with a
damp soft sponge.
Cleaning the Inside
To help prevent odors, leave an open box
of baking soda in the fresh food and freezer
compartments.
Unplug the refrigerator before cleaning. If
this is not practical, wring excess moisture
out of sponge or cloth when cleaning around
switches, lights or controls.
8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³
about a tablespoon (15 ml) of baking soda to
a quart (1 liter) of water. This both cleans and
neutralizes odors. Rinse and wipe dry.
Use of any cleaning solution other than
that which is recommended, especially
those that contain petroleum distillates,
can crack or damage the interior of the
refrigerator.
18
CAUTION
Do not clean glass
shelves or covers with warm water
when they are cold. Glass shelves and
covers may break if exposed to sudden
temperature changes or impact such as
bumping or dropping. Tempered glass is
designed to shatter into many small pieces
if it breaks.
Do not wash any plastic refrigerator parts
in the dishwasher.
The chill/thaw tray is dishwasher safe.
GEAppliances.com
Behind the Refrigerator
Be careful when moving the refrigerator away
from the wall. All types of floor coverings can
be damaged, particularly cushioned coverings
and those with embossed surfaces.
When pushing the refrigerator back, make
sure you don’t roll over the power cord or ice
maker supply line.
Pull the refrigerator straight out and return it
to position by pushing it straight in. Moving the
refrigerator in a side direction may result in
damage to the floor covering or refrigerator.
Preparing for Vacation
For long vacations or absences, remove food
and unplug the refrigerator. Clean the interior
with a baking soda solution of one tablespoon
(15 ml) of baking soda to one quart (1 liter) of
water. Leave the doors open.
If the temperature can drop below freezing,
have a qualified servicer drain the water supply
system to prevent serious property damage
due to flooding.
Set the ice maker power switch to the O (off)
position and shut off the water supply to the
refrigerator.
Preparing to Move
Secure all loose items such as shelves and
drawers by taping them securely in place to
prevent damage.
When using a hand truck to move the
refrigerator, do not rest the front or back of the
refrigerator against the hand truck. This could
damage the refrigerator. Handle only from the
sides of the refrigerator.
Be sure the refrigerator stays in an upright
position during moving.
19
Replacing the light bulbs.(on some models)
WARNING Before replacing a burned-out light bulb, the refrigerator should be unplugged in order to avoid contact with a
live wire filament. (A burned-out light bulb may break when being replaced.)
Turning the control to the OFF position does not remove power to the light circuit.
Your light shield will look like
one of the following:
Tabs
OR
5HIULJHUDWRU&RPSDUWPHQW³8SSHU/LJKW
Unplug the refrigerator.
The bulbs are located at the top of the
compartment, inside the light shield. On some
models, a screw at the front of the light shield
will have to be removed. On other models, the
screw is located in the pocket located at the
back of the light shield.
To remove the light shield, on some models,
press in on the tabs on the sides of the shield
and slide forward and out. On other models,
just slide the shield forward and out.
After replacing the bulb with an appliance
bulb of the same or lower wattage, replace
the light shield and screws (on some models).
When replacing the light shield, make sure
that the tabs at the back of the shield fit into
the slots at the back of the light shield
housing.
Plug the refrigerator back in.
Pocket
5HIULJHUDWRU&RPSDUWPHQW³/RZHU/LJKW
This light is located above the top drawer.
T
ES
LD
O
CO
LD
C
Unplug the refrigerator.
Remove the convertible meat drawer
control knob by pulling straight out.
After replacing the bulb with an appliance
bulb of the same or lower wattage, replace
the shield and the knob.
Plug the refrigerator back in.
Lift the light shield up and pull it out.
Freezer Compartment
Unplug the refrigerator.
Remove the shelf just above the light shield.
(The shelf will be easier to remove if it is
emptied first.) On some models, a screw at
the top of the light shield will need to be
removed.
To remove the light shield, press in on the
sides, and lift up and out.
20
Replace the bulb with an appliance bulb
of the same or lower wattage, and
reinstall the light shield. When
reinstalling the light shield, make sure
the top tabs snap securely into place.
Replace the screw (on some models).
Reinstall the shelf and plug the
refrigerator back in.
GEAppliances.com
WARNING Before replacing a burned-out light bulb, the refrigerator should be unplugged in order to avoid contact with a
live wire filament. (A burned-out light bulb may break when being replaced.)
Turning the control to the OFF position does not remove power to the light circuit.
Dispenser (on some models)
Unplug the refrigerator.
The bulb is located on the dispenser under
the control panel. Remove the light bulb by
turning it counterclockwise.
Replace the bulb with a bulb of the same
size and wattage.
Plug the refrigerator back in.
Refrigerator Compartment (on models with LED lighting)
LED Lighting
Display
Some models may have LED lighting display
on the top and/or sides of the fresh food
compartment and in the rear and side of the
freezer compartment
If this assembly needs to be replaced, call GE
Service at 1.800.432.2737 in the United States
or 1.800.561.3344 in Canada.
LED Lighting
Display
21
Trim kits and decorator panels.
For CustomStyle™ models
Read these instructions completely and carefully.
Before You Begin
Some models are equipped with trim kits that allow you to install door panels. You can order pre-cut black, white,
bisque or stainless steel decorator panels from GE Parts and Accessories, 800.626.2002, or you can add wood
panels to match your kitchen cabinets.
Panels less than 1/4” (6 mm) thick
When installing wood panels less than 1/4” (6 mm) thick, you need to create a filler panel, such as 1/8” cardboard, that will fit
between the face of the door and the wood panel. If you are installing the pre-cut decorator panels, pre-cut filler panels are included
in the kit. The combined thickness of the decorator or wood panel and the filler panel should be 1/4” (6 mm).
Panels 1/4” thick or less
1/4” max
3/4” (19 mm) or Raised Panel
A raised panel design screwed or glued to a 1/4” (6 mm) thick backing, or a 3/4” (19 mm) routed board can be used. The raised
portion of the panel must be fabricated to permit clearances of at least 2” (5.1 cm) from the handle side for fingertip clearance.
Panels thicker than 1/4” (6 mm), up to 3/4” (19 mm) max, will require that the outer 5/16” (8 mm) of panel perimeter be no thicker
than 1/4” (6 mm).
Weight limitations for custom panels:
Fresh Food 38 lbs. (17 kg) max.
Freezer Door 28 lbs. (13 kg) max.
Panels thicker than 1/4” (6 mm)
1/4” (6 mm)
Thick Backing
5/16” (8 mm)
1/4” (6 mm) max
3/4” (19 mm)
22
2” (5.1 cm)
Clearance
Handle Side
Appearance
Panel
3/4”
(19 mm)
Refrigerator
Door
Trim kits and decorator panels.
GEAppliances.com
23‘ Dimensions for Custom Wood Panels
The areas at the top of the panels need to be cut out of the panels.
Freezer Panel
Freezer Panel
Without Dispenser
With Dispenser
1/8” (3 mm)
Cutout
1/8” (3 mm)
Cutout
Fresh Food Panel
1/8” (3 mm)
Cutout
5/16”
(8 mm)
5/16”
(8 mm)
5/16”
(8 mm)
177ø8”
(45.4 cm)
679ø32”
(170.9 cm)
679ø32”
(170.9 cm)
FRONT
FRONT
FRONT
1415ø32”
(36.8 cm)
1415ø32”
(36.8 cm)
1915ø32”
(49.5 cm)
335ø8”
(85.4 cm)
25‘ CustomStyle™ Dimensions for Custom Wood Panels
The areas at the top of the panels need to be cut out of the panels.
Freezer Panel
Without Dispenser
Cutout
1/8” (3 mm)
5/16”
(8 mm)
Freezer Panel
With Dispenser
Cutout
1/8” (3 mm)
Fresh Food Panel
1/8” (3 mm)
Cutout
5/16”
(8 mm)
5/16”
(8 mm)
17”
(43.2 cm)
69”
(175.3 cm)
69”
(175.3 cm)
FRONT
FRONT
FRONT
14 ø ”
(36.8 cm)
1415ø32”
(36.8 cm)
1915ø32”
(49.5 cm)
15 32
361ø4”
(92.0 cm)
23
Inserting the door panels.
Read these instructions completely and carefully.
Insert the Freezer Panel and Fresh Food Panel.
Carefully push the freezer panel in until it slides
into the slot behind the door handle. Push the filler
panel (required with some door panels) in behind the
decorator panel. Repeat for fresh food panel.
If your model has a dispenser, this step only applies to
the fresh food panel and top freezer panel.
Insert the Bottom Freezer Panel (on dispenser models).
Carefully push the panel in until it slides into the slot
behind the door handle. Push the filler panel (required
with some door panels) in behind the decorator panel.
Attach the Top Trim on the Freezer and Fresh Food Doors.
The Top Trim can be found inside the refrigerator
compartment.
Hand tighten only. Make sure that the top of each panel
fits snugly behind the lip of the Top Trim.
With a T-20 Torxdriver, attach the Top Trim, using two
screws on each Top Trim piece, to the top of each door.
Top Trim Screws
Cut-Out
Top Trim Screws
Cut-Out
Top
Freezer
Panel
Fresh
Food
Panel
Bottom
Freezer
Panel
Side Trim
Side Trim
24
GEAppliances.com
Install the Side Trim.
These pieces are tucked inside the refrigerator door
handle.
Do not remove the protective film on the outside of the
Side Trim until the Side Trim is installed.
Hold the Side Trim against the front face of the decorator
panels and fit the Side Trim under the Top Trim. Make sure
the magnetically attached Side Trim is fitted correctly and
that you are satisfied with the appearance of all the parts.
Fit the bottom of the Side Trim under the Bottom Trim as
illustrated.
Top Trim
Side
Trim
Side
Trim
Bottom Trim
25
Installation
Instructions
Refrigerator
Models 22, 23, 25, 26, 27 and 29
Questions? Call 800.GE.CARES (800.432.2737) or Visit our Website at: ge.com
In Canada, call 1.800.561.3344 or Visit our Website at: geappliances.ca
BEFORE YOU BEGIN
PREPARATION
WATER SUPPLY TO THE ICE MAKER
Read these instructions completely
and carefully.
•
If the refrigerator has an ice maker, it will have
to be connected to a cold water line. A GE water
supply kit (containing tubing, shutoff valve, fittings
and instructions) is available at extra cost from your
dealer, by visiting our Website at ge.com (in Canada
at geappliances.ca) or from Parts and Accessories,
800.626.2002 (in Canada 1.888.261.3055).
IMPORTANT ³ Save these instructions
for local inspector’s use.
•
IMPORTANT ³ Observe all governing
codes and ordinances.
• Note to Installer – Be sure to leave these
instructions with the Consumer.
• Note to Consumer – Keep these instructions
for future reference.
• Skill level – Installation of this appliance requires
basic mechanical skills.
• Completion time – Refrigerator Installation
30 minutes
Water Line Installation
30 minutes
• Proper installation is the responsibility of
the installer.
• Product failure due to improper installation is not
covered under the Warranty.
If the refrigerator has already been installed,
remove the base grille (see Step 2 in Moving
the Refrigerator), then skip to Step 5 in Installing
the Refrigerator.
TOOLS YOU WILL NEED
3/8” and 5/16” Socket
1/2” and 7/16” Wrench
1/8” Hex Wrench
Plastic Putty Knife
Phillips Head Screwdriver
26
Installation Instructions
MOVING THE REFRIGERATOR
1 LOADING THE REFRIGERATOR
If the refrigerator must go through
DQ\HQWUDQFHWKDWLVOHVVWKDQ”ZLGH
the doors must be removed. Proceed
to Step 3.
DO NOT remove the handles.
,IDOOHQWUDQFHVDUHPRUHWKDQ”ZLGH
skip to Installing the Refrigerator.
ONTO A HAND TRUCK
Leave all tape and door pads on doors until
the refrigerator is in its final location.
To move the refrigerator, use a padded hand
truck. Center the refrigerator on the hand truck
and secure the strap around the refrigerator.
DO NOT OVERTIGHTEN THE STRAP.
3 DISCONNECT THE WATER COUPLING
(on some models)
If the refrigerator has a water dispenser,
there is a water line from the cabinet into
the bottom hinge on the freezer door that
must be disconnected.
To disconnect, push in on the white collar
of the coupling and pull out the tubing.
White collar
2 REMOVE THE BASE GRILLE
Remove the grille by removing the two Phillips
head screws.
Bottom
freezer
hinge
27
Installation Instructions
MOVING THE REFRIGERATOR (CONT.)
4 DISCONNECT THE POWER COUPLING
6 CLOSE THE FREEZER AND
(on some models)
REFRIGERATOR DOORS
If the refrigerator has a water dispenser,
there is a power line (harness) from the cabinet
into the bottom hinge on the freezer door that
must be disconnected.
To disconnect, pull apart at the coupling.
Bottom
freezer
hinge
7 REMOVE THE FREEZER DOOR
A Remove the freezer door top hinge cover
(if equipped) by either squeezing it and pulling it
up or by prying it off with a plastic putty knife.
5 DISCONNECT THE ELECTRICAL
CONNECTORS (on some models)
If the refrigerator has a refreshment center,
there are electrical connectors (harnesses)
from the cabinet into the bottom hinge
on the refrigerator door that must be
disconnected.
To disconnect, pull apart each connector.
B Remove the two 5/16” or 1/8” hex head screws,
then lift the hinge straight up to free the hinge pin.
5/16” or 1/8” hex head
C Open the freezer door to 90.°
Bottom
refrigerator
hinge
90°
28
Installation Instructions
7 REMOVE THE FREEZER DOOR (cont.)
8 REMOVE THE REFRIGERATOR DOOR
D As one person slowly lifts the freezer door up
and off the bottom hinge, the second person
should carefully guide the water line and power
line (harness) through the bottom hinge.
B Remove the two 5/16” or 1/8” hex head screws,
then lift the hinge straight up to free the hinge
pin.
(cont.)
5/16” or 1/8” hex head
C Open the refrigerator door to 90.°
90°
E
Set the door on a non-scratching surface with
the inside up.
8 REMOVE THE REFRIGERATOR DOOR
A Remove the refrigerator door top hinge cover
(if equipped) by either squeezing it and pulling it
up or by prying it off with a plastic putty knife.
90°
29
Installation Instructions
MOVING THE REFRIGERATOR (CONT.)
8 REMOVE THE REFRIGERATOR DOOR
9 REPLACING THE DOORS
(cont.)
To replace the doors, simply reverse steps
3 through 8.
D Lift the refrigerator door up and off the bottom
hinge.
If the refrigerator has a refreshment center,
one person should slowly lift the door up and
off the bottom hinge and the second person
should carefully guide the electrical lines
(harnesses) through the bottom hinge.
However, please note the following:
• When lowering the doors onto the bottom
hinges, make sure the second person
carefully guides the tube and harnesses
through the holes in the hinges.
• When connecting the water line, make sure
you insert the tubing all the way to the mark.
Mark
90°
• Do not pinch the tubing and harnesses when
placing the doors on the bottom hinges.
• When connecting the power line and the
electrical lines (refreshment center models
only), be sure that the connectors are seated
together fully.
Refreshment Center Models Only
E
Set the door on a non-scratching surface with
the inside up.
30
Installation Instructions
INSTALLING THE REFRIGERATOR
REFRIGERATOR LOCATION
DIMENSIONS AND SPECIFICATIONS
(for 23‘ CustomStyle™ models)
• Do not install the refrigerator where the
temperature will go below 60°F (16°C) because
it will not run often enough to maintain proper
temperatures.
• Do not install the refrigerator where the
temperature will go above 100°F (37°C) because
it will not perform properly.
• Do not install the refrigerator in a location exposed
to water (rain, etc.) or direct sunlight.
• Install it on a floor strong enough to support it
fully loaded.
701ø4” (178.4 cm)
36”
(91.4 cm)
CLEARANCES
Allow the following clearances for ease
of installation, proper air circulation and plumbing
and electrical connections:
Sides
Top
Back
23‘/25‘
CustomStyle™
1/8” (4 mm)
1” (25 mm)
1/2” (13 mm)
24” (61 cm)
23‘ (33” wide),
25‘, 26‘, 27‘, 29‘
1/8” (4 mm)
1” (25 mm)
1” (25 mm)
DIMENSIONS AND SPECIFICATIONS
(for 25‘ CustomStyle™ models)
DIMENSIONS AND SPECIFICATIONS
Water
24” (61 cm)
Cabinet
3/4” (19 mm)
Airspace
(1/2” [13 mm] Gap
+ 1/4” [6 mm] Wall
Plates)
Electrical
25” (63.5 cm)
Countertop
721ø4” (183.5 cm)*
36”
(91.4 cm)
24” (61 cm)
*721/4” (183.5 cm) required for full adjustment
of mobility wheels. If cabinets installed above
refrigerator have doors that are flush to the
top of the opening for the refrigerator, then
an additional 1/8” may be required to provide
clearance for cabinet doors to open freely.
31
Installation Instructions
INSTALLING THE REFRIGERATOR (CONT.)
1 CONNECTING THE REFRIGERATOR
C Fasten the tubing into the clamp provided to
hold it in position. You may need to pry open
the clamp.
TO THE HOUSE WATER LINE
(ice maker and dispenser models)
A cold water supply is required for automatic
ice maker and dispenser operation. If there
is not a cold water supply, you will need to
provide one. See Installing the Water Line
section.
1/4” Tubing
Tubing Clamp
1/4”
Compression Nut
Ferrule
(sleeve)
NOTES:
• Before making the connection to the
refrigerator, be sure the refrigerator power
cord is not plugged into the wall outlet.
• If your refrigerator does not have a water
filter, we recommend installing one if your
water supply has sand or particles that
could clog the screen of the refrigerator’s
water valve. Install it in the water line near
the refrigerator. If using GE SmartConnect™
Refrigerator Tubing Kit, you will need an
additional tube (WX08X10002) to connect the
filter. Do not cut plastic tube to install filter.
A If you are using copper tubing, place a
compression nut and ferrule (sleeve) onto the
end of the tubing coming from the house cold
water supply.
If you are using the GE SmartConnect™
tubing, the nuts are already assembled to the
tubing.
B If you are using copper tubing, insert the end
of the tubing into the refrigerator connection,
at the back of the refrigerator, as far as
possible. While holding the tubing, tighten the
fitting.
If you are using GE SmartConnect™ tubing,
insert the molded end of the tubing into the
refrigerator connection, at the back of the
refrigerator, and tighten the compression nut
until it is hand tight. Then tighten one additional
turn with a wrench. Overtightening may cause
leaks.
Refrigerator
Connection
SmartConnect™ Tubing
Option 2
2 TURN ON THE WATER SUPPLY
Turn the water on at the shutoff valve (house
water supply) and check for any leaks.
3 PLUG IN THE REFRIGERATOR
Before plugging in the
refrigerator, make sure
the ice maker power
switch is set to the O (off)
position.
See the grounding
information attached to
the power cord.
32
Installation Instructions
5 LEVEL THE REFRIGERATOR (cont.)
4 PUT THE REFRIGERATOR IN PLACE
Move the refrigerator to its final location.
To adjust
the rollers on 23‘/25‘
CustomStyle™ models:
5 LEVEL THE REFRIGERATOR
Turn the front roller
adjusting screws
clockwise to raise
the refrigerator,
Roller adjusting screws
counterclockwise
to lower it. Use a 3/8” hex
wrench with extension, or an adjustable wrench.
The refrigerator can be leveled by adjusting
the rollers located near the bottom hinges.
These models also have rear adjustable
rollers so you can align the refrigerator with
your kitchen cabinets. Use a 3/8” hex wrench
with extension to turn the screws for the rear
UROOHUV³clockwise to raise the refrigerator,
counterclockwise to lower it.
Raise
Rollers
Rollers have three purposes:
• Rollers adjust so the door closes easily when
opened about halfway. (Raise the front about
5/8” [16 mm] from the floor.)
• Rollers adjust so the refrigerator is firmly
positioned on the floor and does not wobble.
• Rollers allow you to move the refrigerator
away from the wall for cleaning.
6 LEVEL THE DOORS
Adjust the refrigerator door to make the doors
even at the top.
To align:
A Using a 7/16” wrench, turn the door adjusting
screw to the right to raise the door, to the left
to lower it.
NOTE:
A nylon plug, imbedded in the threads
of the pin, prevents the pin from turning
unless a wrench is used.
To adjust the rollers on 23‘ (33” wide), 25‘, 26‘,
27‘ and 29‘ models:
• Turn the roller adjusting screws clockwise
to raise the
refrigerator,
counterclockwise
to lower it. Use
a 3/8” hex socket
or wrench, or an
adjustable wrench.
B After one or two turns of the wrench, open
and close the refrigerator door and check
the alignment at the top of the doors.
Doors should be even at top
Roller adjusting screw
Raise
7/16” wrench
33
Installation Instructions
INSTALLING THE REFRIGERATOR (CONT.)
7 REPLACE THE BASE GRILLE
9 START THE Ice maker
Replace the grille by installing the two Phillips
head screws.
Set the ice maker power switch to the
I (on) position. The ice maker will not begin
to operate until it reaches its operating
temperature of 15°F (–9°C) or below. It will then
begin operation automatically. It will take 2–3
days to fill the ice bin.
Power
switch
Power
switch
8 SET THE CONTROLS
NOTE:
In lower water pressure conditions, the water
valve may turn on up to 3 times to deliver
enough water to the ice maker.
Set the controls to the recommended setting.
34
Installation Instructions
INSTALLING THE WATER LINE (ICE MAKER & DISPENSER MODELS)
WHAT YOU WILL NEED
BEFORE YOU BEGIN
Recommended copper water supply kits are WX8X2,
WX8X3 or WX8X4, depending on the amount of tubing
you need. Approved plastic water supply lines are GE
SmartConnect™ Refrigerator Tubing (WX08X10006,
WX08X10015 and WX08X10025).
• Copper or GE SmartConnect™ Refrigerator
Tubing kit, 1/4” outer diameter to connect the
refrigerator to the water supply. If using copper,
be sure both ends of the tubing are cut square.
To determine how much tubing you need:
measure the distance from the water valve on
the back of the refrigerator to the water supply
pipe. Be sure there is sufficient extra tubing to allow
the refrigerator to move out from the wall after
installation.
GE SmartConnect™ Refrigerator Tubing Kits are
available in the following lengths:
8’ (2.4 m) – WX08X10006
15’ (4.6 m) – WX08X10015
25’ (7.6 m) – WX08X10025
When connecting your refrigerator to a GE Reverse
Osmosis Water System, the only approved installation
is with a GE RVKit. For other reverse osmosis water
systems, follow the manufacturer’s recommendations.
If the water supply to the refrigerator is from
a Reverse Osmosis Water Filtration System
AND the refrigerator also has a water filter,
use the refrigerator’s filter bypass plug. Using
the refrigerator’s water filtration cartridge in
conjunction with the RO filter can result in hollow
ice cubes and slower water flow from the water
dispenser.
This water line installation is not warranted by the
refrigerator or ice maker manufacturer. Follow
these instructions carefully to minimize the risk of
expensive water damage.
Water hammer (water banging in the pipes) in
house plumbing can cause damage to refrigerator
parts and lead to water leakage or flooding. Call a
qualified plumber to correct water hammer before
installing the water supply line to the refrigerator.
To prevent burns and product damage, do not hook
up the water line to the hot water line.
If you use your refrigerator before connecting the
water line, make sure the ice maker power switch is
in the O (off) position.
Do not install the ice maker tubing in areas where
temperatures fall below freezing.
When using any electrical device (such as a power
drill) during installation, be sure the device is double
insulated or grounded in a manner to prevent the
hazard of electric shock, or is battery powered.
All installations must be in accordance with local
plumbing code requirements.
35
Installation Instructions
INSTALLING THE WATER LINE (CONT.)
WHAT YOU WILL NEED (CONT.)
Install the shutoff valve on the nearest frequently
used drinking water line.
NOTE: The only GE approved plastic tubing is that
supplied in GE SmartConnect™ Refrigerator Tubing
kits. Do not use any other plastic water supply line
because the line is under pressure at all times.
Certain types of plastic will crack or rupture with
age and cause water damage to your home.
• A GE water supply kit (containing tubing, shutoff
valve and fittings listed below) is available
at extra cost from your dealer or from Parts
and Accessories, 800.626.2002 (in Canada
1.888.261.3055).
• A cold water supply. The water pressure must be
between 20 and 120 p.s.i. (1.4–8.1 bar).
1 SHUT OFF THE MAIN WATER SUPPLY
Turn on the nearest faucet long enough to clear
the line of water.
2 CHOOSE THE VALVE LOCATION
Choose a location for the valve that is easily
accessible. It is best to connect into the side of
a vertical water pipe. When it is necessary to
connect into a horizontal water pipe, make the
connection to the top or side, rather than at the
bottom, to avoid drawing off any sediment from
the water pipe.
• Power drill.
• 1/2” or adjustable wrench.
• Straight and Phillips blade
screwdriver.
• Two 1/4” outer diameter compression nuts and 2
IHUUXOHV VOHHYHV ³to connect the copper tubing to
the shutoff valve and the refrigerator water valve.
OR
• If you are using a GE SmartConnect™
Refrigerator Tubing kit, the
necessary fittings are preassembled
to the tubing.
• If your existing copper water line has a flared
fitting at the end, you will need an adapter
(available at plumbing supply stores) to connect
the water line to the refrigerator OR you can cut
off the flared fitting with a tube cutter and then
use a compression fitting. Do not cut formed end
from GE SmartConnect™ Refrigerator tubing.
3 DRILL THE HOLE FOR THE VALVE
Drill a 1/4” hole in the water pipe (even if using
a self-piercing valve), using a sharp bit. Remove
any burrs resulting from drilling the hole in the
pipe.
Take care not to allow water to drain into the
drill.
Failure to drill a 1/4” hole may result in reduced
ice production or smaller cubes.
• Shutoff valve to connect to the cold water line.
The shutoff valve should have a water inlet with a
PLQLPXPLQVLGHGLDPHWHURI”DWWKHSRLQWRI
connection to the COLD WATER LINE. Saddle-type
shutoff valves are included in many water supply
kits. Before purchasing, make sure a saddle-type
valve complies with your local plumbing codes.
36
Installation Instructions
4 FASTEN THE SHUTOFF VALVE
7 CONNECT THE TUBING TO THE VALVE
Fasten the shutoff valve to the cold water pipe
with the pipe clamp.
Place the compression nut and ferrule (sleeve)
for copper tubing onto the end of the tubing and
connect it to the shutoff valve.
Pipe Clamp
Make sure the tubing is fully inserted into the
valve. Tighten the compression nut securely.
For plastic tubing from a GE SmartConnect™
Refrigerator Tubing kit, insert the molded end
of the tubing into the shutoff valve and tighten
compression nut until it is hand tight, then
tighten one additional turn with a wrench.
Overtightening may cause leaks.
Vertical Cold Water Pipe
Saddle-Type
Shutoff Valve
NOTE: Commonwealth of Massachusetts
Plumbing Codes 248CMR shall be adhered to.
Saddle valves are illegal and use is not permitted
in Massachusetts. Consult with your licensed
plumber.
Saddle-Type
Shutoff Valve
SmartConnect™
Tubing
Packing Nut
5 TIGHTEN THE PIPE CLAMP
Tighten the clamp screws until the sealing
washer begins to swell.
NOTE: Do not overtighten or you may crush
the tubing.
Outlet Valve
Ferrule (sleeve)
NOTE: Commonwealth of Massachusetts
Plumbing Codes 248CMR shall be adhered to.
Saddle valves are illegal and use is not permitted
in Massachusetts. Consult with your licensed
plumber.
Washer
Pipe Clamp
Compression Nut
Inlet End
Clamp
Screw
8 FLUSH OUT THE TUBING
Turn the main water supply on and flush out the
tubing until the water is clear.
Shut the water off at the water valve after about
one quart (1 liter) of water has been flushed
through the tubing.
6 ROUTE THE TUBING
Route the tubing between the cold water line
and the refrigerator.
Route the tubing through a hole drilled in the
wall or floor (behind the refrigerator or adjacent
base cabinet) as close to the wall as possible.
NOTE: Be sure there is sufficient extra tubing
to allow the refrigerator to move out from
the wall after installation.
To complete the installation of the refrigerator, go back
to Step 1 in Installing the Refrigerator.
37
Normal operating sounds.
Newer refrigerators sound different from older
refrigerators. Modern refrigerators have more features
and use newer technology.
Do you hear what I hear? These sounds are normal.
HUMMM...
WHOOSH...
„ The new high efficiency compressor may run faster and
longer than your old refrigerator and you may hear a
high-pitched hum or pulsating sound while
it is operating.
„ Sometimes the refrigerator runs for an extended period,
especially when the doors are opened frequently. This
means that the Frost Guard™ feature is working to prevent
freezer burn and improve food preservation.
„ You may hear a whooshing sound when the doors close.
This is due to pressure equalizing within the refrigerator.
„ You may hear the fans spinning at high speeds.
This happens when the refrigerator is first plugged in,
when the doors are opened frequently or when a large
amount of food is added to the refrigerator or freezer
compartments. The fans are helping to maintain the
correct temperatures.
„ If either door is open for over 3 minutes, you may hear
the fans come on in order to cool the light bulbs.
„ The fans change speeds in order to provide optimal
cooling and energy savings.
„ You may hear the fans running after selecting
QuickFreeze™ or one of the CustomCool™ settings.
CLICKS, POPS,
CRACKS and CHIRPS
„ You may hear cracking or popping sounds when
the refrigerator is first plugged in. This happens as
the refrigerator cools to the correct temperature.
„ Electronic dampers click open and closed to provide
optimal cooling and energy savings.
„ The compressor may cause a clicking or chirping sound
when attempting to restart (this could take
up to 5 minutes).
WATER SOUNDS
„ The flow of refrigerant through the freezer cooling coils
may make a gurgling noise like boiling water.
„ Water dropping on the defrost heater can cause a
sizzling, popping or buzzing sound during the defrost
cycle.
„ A water dripping noise may occur during the defrost
cycle as ice melts from the evaporator and flows into
the drain pan.
„ The electronic control board may cause a clicking sound
when relays activate to control refrigerator components. „ Closing the door may cause a gurgling sound due to
pressure equalization.
„ Expansion and contraction of cooling coils during and
after defrost can cause a cracking or popping sound.
For additional information on normal ice
„ On models with an ice maker, after an icemaking cycle,
maker and dispenser operating sounds,
you may hear the ice cubes dropping into the ice bucket.
see the About the automatic ice maker
and About the ice and water dispenser
sections.
38
Before you call for service…
GEAppliances.com
Troubleshooting Tips
Save time and money! Review the charts on the following
pages first and you may not need to call for service.
Problem
Possible Causes
What To Do
Refrigerator does not
operate
Refrigerator in defrost cycle.
• Wait about 30 minutes for defrost cycle to end.
Either or both controls set to OFF. • Set the controls to a temperature setting.
Refrigerator is unplugged.
• Push the plug completely into the outlet.
The fuse is blown/circuit
breaker is tripped.
• Replace fuse or reset the breaker.
The refrigerator is in
showroom mode.
• Unplug the refrigerator and plug it back in.
Vibration or rattling
(slight vibration
is normal)
Rollers need adjusting.
• See Rollers.
Motor operates for long
periods or cycles on and
off frequently. (Modern
refrigerators with more
storage space and
a larger freezer require
more operating time.
They start and stop
often to maintain even
temperatures.)
Normal when refrigerator
is first plugged in.
• Wait 24 hours for the refrigerator to completely
cool down.
Often occurs when large
amounts of food are
placed in refrigerator.
• This is normal.
Door left open.
• Check to see if package is holding door open.
Hot weather or frequent
door openings.
• This is normal.
Temperature controls set
at the coldest setting.
• See About the controls.
Refrigerator or freezer
compartment too warm
Temperature control not set
cold enough.
• See About the controls.
Warm weather or frequent
door openings.
• Set the temperature control one step colder.
See About the controls.
Door left open.
• Check to see if package is holding door open.
Frost or ice crystals
on frozen food
(frost within package
is normal)
Door left open.
• Check to see if package is holding door open.
Divider between
refrigerator and freezer
compartments
feels warm
Automatic energy saver
system circulates warm
liquid around front edge
of freezer compartment.
• This helps prevent condensation on the outside.
Automatic ice maker
does not work
Ice maker power switch
is in the off position.
Water supply turned off or
not connected.
Freezer compartment too warm.
• Set the power switch to the on position.
Piled up cubes in the storage
bin cause the ice maker
to shut off.
• Level cubes by hand.
Ice cubes stuck in ice maker.
(Green power light on
ice maker blinking).
• Turn off the ice maker, remove cubes and turn
the ice maker back on.
Too frequent or too long
door openings.
• See Installing the water line.
• Wait 24 hours for the refrigerator to completely cool down.
39
Before you call for service…
Problem
Possible Causes
Frequent “buzzing” sound
Ice maker power switch is in the
• Set the power switch to the O (off) position. Keeping it in
I (on) position, but the water supply the I (on) position will damage the water valve.
to the refrigerator has not been
connected.
Ice cubes have odor/taste
Ice storage bin needs cleaning.
• Empty and wash bin. Discard old cubes.
Food transmitting odor/taste
to ice cubes.
• Wrap foods well.
Interior of refrigerator
needs cleaning.
• See Care and cleaning.
Small or hollow cubes
Water filter clogged.
• Replace filter cartridge with new cartridge or with plug.
Slow ice cube freezing
Door left open.
• Check to see if package is holding door open.
Temperature control not set
cold enough.
• See About the controls.
Ice maker turned off or
water supply turned off.
• Turn on ice maker or water supply.
An item is blocking or has fallen
into the ice chute inside the
top door bin of the freezer.
• Remove any item that might be blocking, or has fallen into
the chute.
Ice cubes are frozen to
ice maker feeler arm.
• Remove cubes.
Irregular ice clumps in
storage container.
• Break up with fingertip pressure and discard remaining clumps.
• Freezer may be too warm. Adjust the freezer control to a
colder setting, one position at a time, until clumps do not form.
Dispenser is LOCKED.
• Press and hold the LOCK or LOCK CONTROLS pad for 3 seconds.
Cube dispenser
does not work
What To Do
Water has poor taste/odor Water dispenser has not been
used for a long time.
• Dispense water until all water in system is replenished.
Water in first glass
is warm
Normal when refrigerator
is first installed.
• Wait 24 hours for the refrigerator to completely cool down.
Water dispenser has not been
used for a long time.
• Dispense water until all water in system is replenished.
Water system has been drained.
• Allow several hours for replenished supply to chill.
Water supply line turned
off or not connected.
• See Installing the water line.
Water filter clogged.
• Replace filter cartridge or remove filter and install plug.
Water dispenser
does not work
Air may be trapped in the water system. • Press the dispenser arm for at least two minutes.
Dispenser is LOCKED.
• Press and hold the LOCK or LOCK CONTROLS pad for 3 seconds.
Water spurting from
dispenser
Newly-installed filter cartridge.
• Run water from the dispenser for 3 minutes
(about one and a half gallons).
Water is not dispensed
but ice maker is working
Water in reservoir is
frozen.
• Call for service.
Refrigerator control setting
is too cold.
• Set to a warmer setting.
No water or ice cube
production
CUBED ice was selected but
CRUSHED ice was dispensed
40
Supply line or shutoff valve is clogged. • Call a plumber.
Water filter clogged.
• Replace filter cartridge or remove filter and install plug.
Dispenser is LOCKED.
• Press and hold the LOCK or LOCK CONTROLS pad for 3 seconds.
Last setting was CRUSHED.
• A few cubes were left in the crusher from the previous
setting. This is normal.
GEAppliances.com
Problem
Possible Causes
What To Do
Orange glow in the freezer
Refrigerator has odor
Defrost heater is on.
Foods transmitting odor
to refrigerator.
• This is normal.
• Foods with strong odors should be tightly wrapped.
• Keep an open box of baking soda in the refrigerator;
replace every three months.
• See Care and cleaning.
• Apply petroleum jelly to the face of the gasket.
Door not closing
properly
Moisture forms on
outside of refrigerator
Moisture collects inside
(in humid weather, air
carries moisture into
refrigerator when doors
are opened)
Interior light does
not work
Water on kitchen floor
or on bottom of freezer
Hot air from bottom
of refrigerator
Refrigerator never
shuts off but the
temperatures are OK
Refrigerator beeping
Food isn’t thawing/
chilling
Actual temperature not
equal to Set temperature
SelectTemp or Beverage
Center feature is not
working
While QuickFreeze™ is
enabled, the actual
freezer temperature
may drop as low as
–3°F (–19°C)
Interior needs cleaning.
Door gasket on hinge side
sticking or folding over.
A door bin is hitting a shelf
inside the refrigerator.
Not unusual during periods
of high humidity.
Too frequent or too long
door openings.
Due to the higher humidity in the
refrigerator, you may on occasion
experience fog or small amounts
of moisture in the refrigerator
compartment.
No power at outlet.
Light bulb burned out.
For LED lights
Cubes jammed in chute.
Normal air flow cooling motor.
In the refrigeration process, it is
normal that heat be expelled in
the area under the refrigerator.
Some floor coverings are sensitive
and will discolor at these normal
and safe temperatures.
Adaptive defrost keeps
compressor running during
door openings.
Door open.
Packaging.
Wrong weight selected.
Item with high fat content.
Not using Chill/Thaw tray.
• Move the door bin up one position.
• Wipe surface dry.
• This is normal for the beverage center.
• This is normal and may come and go as different food
loads and environmental conditions change. Wipe dry
with a paper towel if desired.
• Replace fuse or reset the breaker.
• See Replacing the light bulbs.
• Call Service
• Poke ice through with a wooden spoon.
• This is normal. The refrigerator will cycle off after the door
remains closed for 2 hours.
• Close door.
• Increase time or re-package in plastic.
• Select a larger weight.
• Select a larger weight.
• Place items on tray and allow space in between items for
better airflow.
Unit just plugged in.
• Allow 24 hours for system to stabilize.
Door open for too long.
• Allow 24 hours for system to stabilize.
Warm food added to refrigerator. • Allow 24 hours for system to stabilize.
Defrost cycle is in process.
• Allow 24 hours for system to stabilize.
Refrigerator compartment
• This is normal. In order to minimize energy usage,
temperature control is set
the SelectTemp and Beverage Center features are
at warmest setting.
disabled when the refrigerator temperature control
is set at the warmest setting.
Beverage Center feature
• Press Beverage Center pad to restart.
turns off after six months
of continuous operation.
• This is normal.
41
Refrigerator Warranty.
For US Customers, all warranty service provided by our Factory Service
Centers, or an authorized Customer Care® technician. To schedule
service, visit us online at GEAppliances.com, or call 800.GE.CARES
(800.432.2737). Please have serial number and model number available
when calling for service. In Canada, call 800.561.3344.
For the Period of:
Staple your receipt here.
Proof of the original
purchase date is needed
to obtain service under the
warranty.
GE Will Replace
GE, GE PROFILE and GE Cáfe MODELS:
One Year
From the date of the original
purchase
Any part of the refrigerator which fails due to a defect in materials or workmanship.
During the limited one-year warranty, GE will also provide, free of charge, all labor and related
service to replace the defective part.
Thirty Days
(Water filter, if included)
From the original purchase
date of the refrigerator
Any part of the water filter cartridge which fails due to a defect in materials or workmanship. During
this limited thirty-day warranty, GE will also provide, free of charge, a replacement water filter
cartridge.
GE PROFILE and GE Cáfe MODELS ONLY:
Five Years
From the date of the
purchase
Any part of the sealed refrigerating system (the compressor, condenser, evaporator an all
connecting tubing) which fails due to a defect in materials or workmanship.
During this limited five-year sealed refrigerating system warranty, GE will also provide, free of
charge, all labor and related service to replace the defective part in the sealed refrigerating system.
What GE Will Not Cover:
„
Service trips to your home to teach you how to use the
product.
„
Improper installation, delivery or maintenance.
„ Failure of the product if it is abused, misused, or used for other
than the intended purpose or used commercially.
„ Loss of food due to spoilage.
„ Replacement of house fuses or resetting of circuit breakers.
„ Damage to finish, such as surface rust, tarnish, or small
blemishes not reported within 48 hours of delivery.
„ Damage caused by a non-GE brand water filter.
„ Replacement of the water filter cartridge, if included, due to
water pressure that is outside the specified operating range
or due to excessive sediment in the water supply.
„ Replacement of the light bulbs, if included, or water filter
cartridge, if included, other than as noted above.
„ Damage to the product caused by accident, fire, floods or acts
of God.
„ Incidental or consequential damage caused by possible
defects with this appliance.
„ Product not accessible to provide required service.
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV
Limited Warranty. Any implied warranties, including the implied warranties of merchantability or fitness for a
particular purpose, are limited to one year or the shortest period allowed by law.
For US Customers: This warranty is extended to the original purchaser and any succeeding owner for products
purchased for home use within the USA. If the product is located in an area where service by a GE Authorized
Servicer is not available, you may be responsible for a trip charge or you may be required to bring the product
to an Authorized GE Service location for service. In Alaska, the warranty excludes the cost of shipping or service
calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives
you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: General Electric Company. Louisville, KY 40225
For Customers in Canada: This warranty is extended to the original purchaser and any succeeding owner for
products purchased in Canada for home use within Canada. In-home warrant service will be provided in areas
where it is available and deemed reasonable by Mabe to provide.
Warrantor Canada: MC Commercial, Burlington, Ontario, L7R 5B6
42
43
Performance Data Sheet
SmartWater™ Filtration System³GE MWF Cartridge
Performance Data Information
Capacity: 300 Gallons (1,135 Liters)
7KHFRQFHQWUDWLRQRIWKHFRQWDPLQDQWVWHVWHGIRUWKLV¿OWHULQZDWHUHQWHULQJWKHV\VWHPZDVUHGXFHGWR
DFRQFHQWUDWLRQOHVVWKDQRUHTXDOWRWKHSHUPLVVLEOHOLPLWIRUZDWHUOHDYLQJWKHV\VWHPDVVSHFL¿HGLQ
16)$16,6WDQGDUGDQG6WDQGDUG6\VWHPWHVWHGDQGFHUWL¿HGE\16),QWHUQDWLRQDODJDLQVW16)
ANSI Standard 42 and Standard 53.
Please see geappliances.com for complete listing of the contaminants tested and the amounts reduced.
The following pharmaceutical reduction claims have not been certi¿ed by NSF International or the state of California.
Claims tested and veri¿ed by independent laboratory:
Contaminant
Reduction
Atenolol
Fluoxetine
Ibuprofen
Progesterone
Trimethoprim
AvHUDJH,Q¾XHQW
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
16)VSHFL½HG
Challenge Concentration
N/A
N/A
N/A
N/A
N/A
Avg %
Reduction
99.5%
99.4%
94.1%
99.5%
99.5%
Average Product
Water
Concentration
5.0 ng/L
5.4 ng/L
52.3 ng/L
5.0 ng/L
2.0 ng/L
Max Permissible
Product Water NSF Reduction
Concentration Requirements
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
NSF
Test Report
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Application Guidelines/Water Supply Parameters
Service Flow
Water Supply
0.5 gpm (21.9 lpm)
Potable Water
Water Pressure
Water Temperature
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
It is essential that the manufacturer’s recommended installation, maintenance and filter replacement requirements be carried out for the product to perform as advertised.
See Installation Manual for Warranty information.
Note: While the testing was performed under standard laboratory conditions,
actual performance may vary.
Replacement Cartridge: MWF. For estimated costs of replacement elements
please call 1-800-626-2002 or visit our website at www.geapplianceparts.com.
WARNING
To reduce the risk associated with ingestion of contaminants:
• Do not use with water that is microbiologically unsafe or of unknown quality
without adequate disinfection before and after the system. Systems certL¿ed
for cyst reduction may be used on disinfected water that may contain ¿lterable
cysts. EPA Establishment Number 10350-MN-005.
For conditions of use, health claims certified by the California Department of Public
Health, and replacements, see performance data sheet. California Department
of Public Health Certification #05-1698. The contaminants or other substances
removed or reduced by this water filter are not necessarily in all users’ water.
REPLACEMENT
ELEMENT
44
Tested and cerWL½ed by NSF International
against NSF/ANSI Standard 42 and
Standard 53 in model GE MWF for the
reduction of the claims speci½Hd on the
performance data sheet.
NOTICE
To reduce the risk associated with property damage due to water leakage:
• Read and follow use instructions before installation and use of this system.
• Installation and use MUST comply with all state and local plumbing codes.
• Do not install if water pressure exceeds 120 psi (8.2 bar). If your water pressure
exceeds 80 psi, you must install a pressure-limiting valve. Contact a plumbing
professional if you are uncertain how to check your water pressure.
• Do not install where water hammer conditions may occur. If water hammer
conditions exist you must install a water hammer arrester. Contact a plumbing
professional if you are uncertain how to check for this condition.
• Do not install on hot water supply lines. The maximum operating water
temperature of this ¿lter system is 100º F (38º C).
• Protect ¿lter from freezing. Drain ¿lter when temperatures drop
below 33ºF (0.6ºC).
•
must be replaced every 6 months at the
rated capacity, or sooner if a noticeable reduction in ÀRw rate occurs.
Notes...
GEAppliances.com
45
Notes...
46
Mesures de sécurité . . . . . . . . . . . . . . . . 48, 49
Fonctionnement
Clayettes et bacs. . . . . . . . . . . . . . . . . . . . . . . . 56, 57
ClimateKeeper2™. . . . . . . . . . . . . . . . . . . . . . . . . . . . 51
CustomCool ™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52
Enlèvement des contenants . . . . . . . . . . . . . . . . 59
Entretien et nettoyage
du réfrigérateur . . . . . . . . . . . . . . . . . . . . . . . . . 63, 64
Le distributeur d’eau et de glaçons . . . . . 62–63
Le filtre à eau . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55
Les commandes . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
Les portes du réfrigérateur. . . . . . . . . . . . . . . . . . 58
Les tiroirs et contenants à légume . . . . . . . . . . 59
Machine à glaçons automatique. . . . . . . . 60, 61
Quick Ice . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62
Remplacement des ampoules . . . . . . . . . . . . . . 65
Set Features . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51
TurboCool™™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51
Installation
Déménagement du réfrigérateur . . . . . . . 71–74
Ensembles de moulures et de
panneaux décoratifs . . . . . . . . . . . . . . . . . . . . 66–69
Installation de la conduite d’eau . . . . . . . . .79-81
Installation du réfrigérateur . . . . . . . . . . . . . 75–78
Préparation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70
Conseils de dépannage . . . . . . . . . . . . .83-86
Bruits normaux de fonctionnement . . . . . . . . . 82
Soutien au consommateur
Feuillet de données relatives à la
performance de la cartouche . . . . . . . . . . . .88-89
Garantie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87
Soutien au consommateur . . . . . . . . . . . . . . . . . 92
Transcrivez les numéros de modèle et de série ici:
# de modèle _____________________________
# de série _______________________________
Ils figurent sur l’étiquette qui se trouve à l’interieur
du compartiment réfrigérateur en haute à droite.
47
MESURES DE SÉCURITÉ IMPORTANTES.
LISEZ D’ABORD TOUTES LES DIRECTIVES.
SÉCURITÉ
Site Internet d’Électroménagers GE
Pour de plus amples informations sur le fonctionnement de votre réfrigérateur, consultez le
site www.electromenagersge.ca ou composez le 800.561.3344.
CONSIGNES DE SÉCURITÉ POUR LE RÉFRIGÉRATEUR
Ce symbole représente une alerte de sécurité. Ce symbole vous avise de dangers possibles pouvant causer
la mort, des blessures ou autres. Tous les messages de sécurité seront précédés du symbole d’alerte de sécurité
ainsi que des mots « DANGER », « AVERTISSEMENT » ou « MISE EN GARDE ». Ces messages sont les suivants :
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
. un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
AVERTISSEMENT Signale une situation qui présente
blessures graves, voire la mort.
MISE EN GARDE Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures mineures ou graves.
DANGER
AVERTISSEMENT
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque d’incendie, d’explosion, de choc électrique ou de blessures
lorsque vous utilisez votre réfrigérateurde , veuillez suivre ces consignes de sécurité :
„ Ce réfrigérateur doit être correctement installé conformément
aux Consignes d’Installation avant toute utilisation.
„ Débranchez le réfrigérateur avant d’effectuer une réparation,
de remplacer une ampoule ou de le nettoyer.
Remarque : L’alimentation du réfrigérateur ne peut être
déconnectée par aucune des fonctions sur le panneau de
commande.
Remarque : Les réparations doivent être effectuées par un
professionnel qualifié.
„ Remettez toutes les pièces et panneaux en place avant
d’utiliser l’appareil.
„ Ne stockez pas ou n’utilisez pas d’essence ou d’autres vapeurs
et liquides inflammables à proximité de cet appareil ou de tout
autre appareil électroménager.
„ Nous déconseillons fortement l’utilisation d’une rallonge
à cause des risques potentiels dans certaines conditions.
Cependant, si l’utilisation d’un cordon prolongateur est
nécessaire, ce dernier doit obligatoirement être homologué UL
(aux USA) ou CSA (au Canada), à trois brins avec mise à la terre
pour appareil électroménager et doit être équipé d’une fiche et
d’une prise femelle avec terre. Les caractéristiques électriques
du cordon prolongateur doivent être de 15 ampères (minimum)
et de 120 volts.
„ Pour éviter les risques d’asphyxie et d’enfermement pour
les enfants. Démontez les portes du congélateur et du
compartiment de réfrigération avant de le mettre au rebut ou
d’interrompre son utilisation.
„ Ne laissez pas les enfants grimper, se mettre debout ou se
suspendre aux poignées de portes dans le réfrigérateur ou aux
clayettes du réfrigérateur. Ils pourraient se blesser gravement.
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque de blessures lorsque vous utilisez votre réfrigérateurde , veuillez
ATTENTION suivre ces consignes de sécurité.
„ Ne nettoyez pas les clayettes ou les couvercles en verre avec
de l’eau tiède quand ceux-ci sont froids. Les clayettes et
couvercles en verre peuvent se casser s’ils sont exposés à des
changements soudains de température ou si vous les cognez
ou les faites tomber. Le verre trempé est conçu pour se briser
en petits morceaux en cas de casse
„ Éloignez les doigts des parties du congélateur où l’on peut
facilement se pincer : les espaces entre les portes, et entre
les portes et les placards sont toujours étroits. Soyez prudent
lorsque vous fermez les portes en présence d’enfants.
48
„ Ne touchez pas les surfaces froides du congélateur lorsque
vous avez les mains humides ou mouillées. La peau risque
d’adhérer à ces surfaces extrêmement froides.
„ Ne recongelez pas les aliments surgelés qui ont complètement
dégelé.
„ Si votre réfrigérateur est doté d’une machine à glaçons
automatique, évitez le contact avec les pièces mobiles du
mécanisme éjecteur, ou avec l’élément chauffant qui libère les
glaçons. Ne posez pas les doigts ou les mains sur le mécanisme
de la machine à glaçons automatique pendant que le
réfrigérateur est branché.
www.electromenagersge.ca
SÉCURITÉ
(CONT.)
INSTALLATION
Risque d’explosion.
Conservez les matériaux et vapeurs inflammables tels que l’essence à l’écart de votre réfrigérateur.
Une explosion, un incendie voire la mort pourrait en résulter.
AVERTISSEMENT
BRANCHEMENTS ÉLECTRIQUES
Risque de choc électrique.
Branchez l’appareil dans une prise triple avec terre.
Ne retirez pas la broche de terre.
N’utilisez pas d’adaptateur.
Le non-respect de ces instructions peut entraîner des risques d’incendies, des chocs électriques ou la mort.
AVERTISSEMENT
Ne coupez pas ou n’enlevez pas, sous aucun prétexte, la troisième broche de mise à la terre du cordon
d’alimentation. Pour des raisons de sécurité, cet appareil doit être correctement mis à la terre.
Le cordon d’alimentation de cet appareil est équipé d’une fiche
à trois broches (pour une mise à la terre) qui s’adapte à la prise
de courant standard à 3 broches (pour une mise à la terre) pour
minimiser les risques de chocs électriques par cet appareil.
Faites vérifier la prise murale et le circuit électrique par
un électricien qualifié pour s’assurer que le système est
correctement mis à la terre.
Dans le cas d’une prise biphasée, l’installateur a la
responsabilité et l’obligation de la remplacer par une
prise triphasée correctement mise à la terre. N’utilisez pas
d’adaptateur.
Le réfrigérateur doit toujours être branché à sa propre prise
électrique d’une tension nominale correspondant à celle
indiquée sur sa plaque signalétique.
Une alimentation électrique à 115 volts CA, 60 Hz, avec
un fusible de 15 ou 20 ampères et une mise à la terre est
nécessaire. Ceci permet d’obtenir un meilleur rendement et
évite de surcharger les circuits électriques du domicile qui
risque d’occasionner un incendie en surchauffant.
Ne débranchez jamais le réfrigérateur en tirant sur le cordon
d’alimentation. Prenez toujours fermement la fiche en main et
tirez pour la sortir de la prise.
Réparez ou remplacez immédiatement tout cordon électrique
usé ou endommagé. N’utilisez pas un cordon fissuré ou
présentant des dommages dus aux frottements soit sur sa
longueur ou aux extrémités.
Lorsque vous éloignez votre réfrigérateur du mur, faites
attention à ne pas le faire rouler sur le cordon d’alimentation
afin de ne pas l’endommager.
MISE AU REBUT APPROPRIÉE DE VOTRE ANCIEN RÉFRIGÉRATEUR
Un enfant risque de suffoquer ou d’y être emprisonné.
Démontez les portes du compartiment de réfrigération et du compartiment de congélation du
réfrigérateur, avant mettre celui-ci au rebut. Le non-respect de cette recommandation peut entraîner
l’enfermement d’un enfant qui peut entraîner la mort ou des lésions cérébrales.
AVERTISSEMENT
IMPORTANT:
Les enfants pris au piège ou morts d’asphyxie sont
toujours d’actualité. Les réfrigérateurs jetés ou
abandonnés restent dangereux même si vous ne
les laissez au rebut que pour « quelques jours ». Si
vous voulez jeter votre ancien réfrigérateur, suivez les
instructions suivantes pour empêcher les accidents.
Avant de jeter votre ancien réfrigérateur ou
congélateur:
„ Démontez les portes du compartiment de
réfrigération et du compartiment de congélation.
„ Laissez les clayettes en place, pour éviter que des
enfants puissent facilement grimper dans votre
réfrigérateur.
Fluides frigorigènes
Les appareils réfrigérants contiennent des fluides
frigorigènes qui conformément à la législation
fédérale doivent être retirés avant la mise au
rebut de l’appareil. Si vous mettez au rebut
un ancien réfrigérateur contenant des fluides
frigorigènes, vérifiez la procédure à suivre auprès
de la compagnie responsable de l’élimination.
LISEZ ET SUIVEZ SOIGNEUSEMENT CES MESURES DE SÉCURITÉ.
CONSERVEZ CES INSTRUCTIONS
49
Les commandes.
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles. Les commandes ressemblent à l’une des illustrations suivantes :
>
>
Pour modifier la température du réfrigérateur : LED Distributeur de
contrôle tactile
Les commandes de températures peuvent afficher les températures
SET (fixées) ainsi que les températures réelles à l’intérieur du
réfrigérateur et du congélateur. La température actuelle peut
légèrement varier de la température SET (fixée) suivant les conditions
d’utilisation et de fonctionnement.
„ Sur certains modèles, en mettant les deux commandes sur la
température la plus élevée, le refroidissement est arrêté dans les
compartiments de congélation et de réfrigération.
„ Sur d’autres modèles, en mettant une des commandes sur la
température la plus élevée jusqu’à ce que l’affichage clignote (off), le
refroidissement est arrêté dans les compartiments de congélation
et de réfrigération.
„ REMARQUE: En éteignant le réfrigérateur à l’aide des commandes
sur le panneau à touches tactiles, l’alimentation électrique de
l’appareil n’est pas coupée.
REMARQUE : Le réfrigérateur est livré avec un film protecteur sur les
commandes de températures. Si le film n’a pas été retiré pendant
l’installation, retirez-le maintenant.
Touch LED Dispenser Control :
Pour modifier la température, appuyez sur la touche FREEZER
TEMP/FRIDGE TEMP et relâchez-la. Le voyant SET s’allumera et la
température de réglage sera affichée. Pour modifier la température,
appuyez sur la touche ou la touche
jusqu’à ce que la
température désirée soit affichée.
Une fois que la température désirée a été réglée, l’écran affichera à
nouveau les températures réelles des compartiments réfrigérateur
et congélateur après 5 secondes. Plusieurs réglages peuvent être
Modèles avec écran ACL
nécessaires. Chaque fois que vous réglez les températures, attendez 24
heures pour permettre au réfrigérateur d’atteindre les températures de
réglage.
Le réglage de température peut indiquer la température SET (réglée)
ainsi que la température réelle dans le compartiment réfrigération et
dans le compartiment congélation. La température SET (réglée) peut
varier légèrement de la température réelle, selon l’utilisation et les
conditions de fonctionnement.
Pour éteindre le système de refroidissement :LED Distributeur de
contrôle tactile
Modèles avec écran ACL : Le réglage à OFF (arrêt) du système
de refroidissement arrête le refroidissement à la fois dans
le compartiment réfrigérateur et dans le compartiment congélateur,
sans mettre hors tension le réfrigérateur.
„ Sur certains modèles, en mettant les deux commandes sur la
température la plus élevée, le refroidissement est arrêté dans les
compartiments de congélation et de réfrigération.
„ Sur d’autres modèles, en mettant une des commandes sur la
température la plus élevée jusqu’à ce que l’affichage clignote (off), le
refroidissement est arrêté dans les compartiments de congélation
et de réfrigération.
„ REMARQUE : En éteignant le réfrigérateur à l’aide des commandes
sur le panneau à touches tactiles, l’alimentation électrique de
l’appareil n’est pas coupée.
Touch Control LED Distributeur:
Appuyez sur la touche FREEZER TEMP/FRIDGE TEMP et relâchez-la.
Appuyez sur pour régler la température du congélateur à 5. OFF
s’affichera. Pour remettre l’appareil à ON, appuyez sur la touche
FREEZER TEMP/FRIDGE TEMP. Appuyez sur pour régler le
congélateur et le réfrigérateur aux températures prédéfinies de
-18°C (0°F) et 3°C (37°F) respectivement.
Lorsque le système est remis en marche, il faudra attendre
jusqu’à 24 heures avant que la température soit stable.
>
La temperature est pré-réglée à l’usine au numéro 3°C (37°F) pour
le compartiment réfrigérateur et –18°C (0°F) pour le compartiment
congélateur. Attendez 24 heures que la température se stabilise aux
temperatures recommandées pré-réglées.
On peut régler la température du réfrigérateur entre 1°C et 8°C (34°F et 46°F) et
la température du congélateur, entre –21°C et –13°C (–6°F et +8°F).
>
Touch Control LED Distributeur
NOTE : Le réfrigérateur est expédié avec
une pellicule de protection couvrant les
commandes de température. Si cette
pellicule n’a pas été retirée au cours de
l’installation faites-le maintenant.
Système de circulation d’air
Ce système est conçu pour maximiser le rendement dans les
compartiments du réfrigérateur et du congélateur. Ce concept unique
consiste en une canalisation d’air fixée au long des parois arrières
du réfrigérateur et d’un tunnel à air au bas de la paroi arrière du
compartiment du congélateur. Le rangement d’aliments en avant
des persiennes de ces compartiments n’affecte pas le rendement
50
de l’appareil. Bien qu’il soit possible d’enlever la canalisation d’air et
le tunnel à air, une telle opération affectera le rendement en ce qui
concerne la température. (Pour recevoir les instructions de démontage
de ces éléments en ligne, veuillez contacter GE sur le site Web
electromenagersge.ca ou appelez le 1.800.561.3344.)
Au sujet de Set Features.
Cette touche sert à sélectionner les fonctions
suivantes : TurboCool™, Quick Ice, Door Alarm
et Water Filter.
electromenagersge.ca
Une pression à répétition sur SET FEATURES fera
défiler toutes les fonctions puis quitter
le mode. Aucune pression de touche fera quitter
le mode et afficher les fonctions déjà réglées.
Au sujet de TurboCool™
Fonctionnement
OR
La commande TurboCool™ accélère le
refroidissement du compartiment réfrigération
afin de refroidir plus rapidement les aliments.
Utilisez TurboCool™ quand vous ajoutez une
grande quantité d’aliments dans le compartiment
réfrigération, quand vous mettez de côté des
aliments après les avoir laissés reposer à la
température de la pièce ou quand vous mettez de
côté des restes d’aliments chauds. Vous pouvez
également l’utiliser après que le réfrigérateur soit
resté débranché pendant une période prolongée.
Une fois activé, le compresseur se met
immédiatement en route et les ventilateurs se
mettent en marche et s’arrêtent à haute vitesse
pendant huit heures, en suivant leur cycle. Le
compresseur continue à marcher jusqu’à ce que
le compartiment réfrigération se refroidisse à
environ 1° C (34° F), puis il se met en marche et
s’arrête selon son propre cycle pour maintenir
cette température. Après 8 heures ou si vous
pressez à nouveau sur le bouton TurboCool™, le
compartiment réfrigération revient à son réglage
original.
Utilisation
Mode d’emploi
Appuyez sur la touche TurboCool™. L’écran de la
température TurboCool™ affichera Tc et le voyant à
DEL s’allumera.
Quand le TurboCool™ est terminé, le voyant
lumineux TurboCool™ s’éteint.
REMARQUES : La température du réfrigérateur ne
peut être modifiée pendant un cycle TurboCool™.
La température du congélateur n’est pas affectée
pendant le TurboCool™.
Lorsque vous ouvrez la porte du réfrigérateur
pendant un cycle TurboCool™, les ventilateurs
continuent à fonctionner si leur cycle le demande.
Touch Control LED Distributeur:
Appuyez sur la touche SET FEATURES. L’écran
d’affichage de la température du réfrigérateur
indiquera TurboCool™ et/ou TC. Appuyez sur la
touche ON/OFF.
Quand la commande TurboCool™ cesse de
fonctionner, le compartiment réfrigération revient
à son réglage original.
NOTES :
Vous ne pouvez pas changer la température
du réfrigérateur pendant que la commande
TurboCool™ fonctionne.
Le TurboCool™ n’a pas d’effet sur la température
du congélateur.
Quand vous ouvrez la porte du réfrigérateur
pendant l’action de la commande TurboCool™, les
ventilateurs continuent à fonctionner si leur cycle
le demande.
Au sujet de ClimateKeeper2.™ (sur certains modèles)
Fonctionnement
Le système ClimateKeeper2™ est le système de
réfrigération le plus avancé qui soit permettant
l’obtention de conditions de température et
d’humidité optimales dans le réfrigérateur.
Le système ClimateKeeper2™ est équipé de deux
pYDSRUDWHXUV³XQSRXUOHUpIULJpUDWHXUHWXQSRXU
le congélateur.
L’appareil est ainsi équipé de deux systèmes
de refroidissement séparé. Le flux d’air est ainsi
séparé entre les aliments frais et le compartiment
congélateur pendant le cycle de refroidissement
normal
Ceci permet d’avoir un taux d’humidité beaucoup
plus élevé dans le compartiment de réfrigération
que dans un système classique, ** permettant
aux aliments de conserver plus longtemps leur
taux d’humidité et leur fraîcheur. Les aliments
sensibles à l’humidité ambiante tels que les fruits
frais, les salades, le riz, etc. peuvent maintenant
être stockés sur des clayettes ouvertes sans perte
d’humidité excessive. A cause du taux d’humidité
plus important dans le réfrigérateur, la présence
de légers brouillards ou de condensation dans
le compartiment de réfrigération est possible.
C’est un phénomène normal dont l’apparition
dépend des différentes quantités d’aliments et
des conditions environnementales. Si nécessaire,
essuyez avec un chiffon sec.
Les flux d’air séparés minimisent le mélange
d’air entre les deux compartiments, réduisent le
transfert d’odeurs des aliments frais et permettent
d’améliorer le goût des glaçons.
Le système ClimateKeeper2™ permet également
de réduire le nombre de cycle de dégivrage de
l’évaporateur du congélateur réduisant ainsi les
brûlures de congélation.
* l’air du congélateur est utilisé dans le cycle
CustomCool™.
**Les essais démontrent un niveau d’humidité
plus élevé dans la partie Aliment Frais dans les
réfrigérateurs équipés du ClimateKeeper2™
comparés aux appareils classiques.
51
Au sujet de CustomCool.™ (sur certains modèles)
Fonctionnement
Touch Control LED Distributeur
Le dispositif CustomCool™ est utilisée pour rafraîchir
rapidement les aliments, pour les dégeler ou pour
maintenir le contenant à une température donnée. Ce
dispositif consiste en un système de modérateurs, d’un
ventilateur, d’une thermistance de température et d’un
réchauffeur.
Le contenant est rendu étanche afin de prévenir
sa température de causer des variations de
température dans le reste du réfrigérateur.
Les commandes de cet écran sont situées
sur le distributeur avec les commandes
de la température.
Modèles avec écran ACL seulement
Utilisation
Videz le contenant. Placez le plateau Chill/Thaw à
l’intérieur du contenant. Placez les aliments sur le
plateau et fermez le contenant complètement.
ExpressThaw™
ExpressChill ™
52
Touch Control LED Distributeur:
Appuyez sur l’une des touches ExpressThaw™,
ExpressChill™ ou SelectTemp™. L’affichage et le
voyant SET s’allumeront. Appuyez sur la touche
jusqu’à ce que la lumière s’allume face au réglage
désiré.
Servez-vous du tableau suivant pour choisir le
réglage approprié.
„ ExpressChill™ peut se régler à 15, 30 ou 45
minutes. La durée par défaut est de 15 minutes.
„ Pour mettre fin à l’activation d’une fonction
avant qu’elle ne se termine : appuyez sur la
touche de la fonction jusqu’à ce qu’il n’y ait
aucune option sélectionnée et que l’affichage
s’éteigne.
„ Pendant le cycle de ExpressThaw ™ (dégel
rapide) ou de ExpressChill ™ (gel rapide), le
réglage indique le compte à rebours du cycle
(sur certains modèles).
„ À la fin du cycle ExpressThaw,™ le réglage
du bac retourne automatiquement à la
température MEAT (viande) (0° C [32° F]), pour
aider à conserver les articles dégelés jusqu’à leur
utilisation finale.
„ La température affichée du contenant de
CustomCool™ peut varier un peu par rapport
à la température SET (choisie) compte tenu de
l’utilisation et des conditions de fonctionnement.
NOTE: Pour des raisons de sécurité, il est recommandé
d’envelopper les aliments dans un emballage en
plastique lors de l’utilisation du cycle ExpressThaw.™
Cette précaution minimisera l’écoulement du jus de
viande et améliorera le dégel.
ExpressChill™ (sur certains modèles)
electromenagersge.ca
Fonctionnement
Le fonction ExpressChill ™ comporte un système
de registres, un ventilateur et une thermistance.
Le bac est scellé hermétiquement afin d’empêcher
les variations de température dans le reste du
réfrigérateur.
Les commandes pour ce bac sont situées sur le
haut du réfrigérateur ou au niveau du distributeur
avec les commandes de température.
Mode d’emploi
Videz le bac. Placez le plateau Chill
(refroidissement) dans le bac. Placez les
aliments sur le plateau et fermez
complètement le bac.
ExpressChill ™
Appuyez sur la touche ExpressChill™. Sur
certains modèles, vous pouvez sélectionner la
durée de refroidissement (utilisez le tableau
pour déterminer le meilleur réglage). Sur
d’autres modèles, vous n’avez qu’une seule
option (45 minutes). Sur les modèles à
possibilités de réglages multiples, appuyez sur
la touche jusqu’à ce que le voyant lumineux
apparaisse à côté du réglage souhaité.
„ Pour désactiver une fonction avant que le
cycle ne soit terminé, appuyez sur la touche
correspondant à cette fonction jusqu’à ce
qu’aucune option ne soit sélectionnée et
que l’écran s’éteigne.
„ Pendant le cycle de ExpressChill ™
le compte à rebours est affiché.
Retrait et remise en place du bac
Pour le retirer :
Tirez le bac jusqu’à la butée.
Fermez les verrous en les faisant tourner en
position de verrouillage.
Faites tourner les quatre verrous jusqu’à leur
position déverrouillée.
Soulevez l’avant du bac puis faites le sortir en
tirant.
Pour le remettre en place:
Assurez-vous que les quatre verrous soient en
position de déverrouillage.
Placez les côtés du bac dans les supports du
bac en vous assurant que les verrous soient
positionnés sur les encoches du tiroir.
53
Au sujet de CustomCool.™ (sur certains modèles)
Tableau CustomCool ™
NOTE: les résultats peuvent varier en fonction de l’emballage, de la température initiale et les particularités des autres
aliments.
ExpressThaw™
0,5 Lb. (4 heures)
„
Hamburger en galettes (0,5 lb)
„
Filet mignon emballé individuellement
(0,5 lb)
1,0 Lb. (6 heures)
„
Poitrines de poulet (1,0 lb)
„
Boeuf haché (1,0 lb)
„
Bifteck (1,0 lb)
2,0 Lbs. (10 heures)
„
Poitrines de poulet (2,0 lbs)
„
Boeuf haché (2,0 lbs)
„
Bifteck (2,0 lbs)
3,0 Lbs. (12 heures)
„
Poitrines de poulet (3,0 lbs)
„
Boeuf haché (3,0 lbs)
„
Bifteck (3,0 lbs)
54
ExpressChill™
15 Minutes
„
1 canette de boisson (12 oz)
„
2 petites boîtes de jus (6–8 oz chacune)
30 Minutes
„
2 à 6 canettes de boisson
(12 oz chacune)
„
2 bouteilles en plastique de 20 oz
de boisson
„
4 à 6 boîtes de jus (6 à 8 oz chacune)
„
3 Emballage cartonné étanche
„
Vin (bouteille de 750 ml)
45 Minutes
„
2 litre bouteille de boisson
„
1/2 gallon de jus
„
1 paquet de gélatine
SelectTemp™
Réglage pour agrumes 6° C (43° F)
„
Oranges, citrons, limes, ananas,
melon cantaloup
„
Haricots, concombres, tomates,
poivrons, aubergines, courge
Réglage pour fruits et légumes 2° C
(35° F)
„
Fraises, framboises, kiwi, poires,
cerises, mûres, raisins, prunes,
nectarines, pommes
„
Asperges, brocoli, maïs,
champignons, épinard, chou-fleur,
chou frisé, échalottes, betteraves,
oignons
Réglage pour les viandes 0° C (32° F)
„
Viande crue, volaille et poissons
Le filtre à eau. (sur certains modèles)
www.electromenagersge.ca
Cartouche du filtre à eau
La cartouche du filtre à eau se trouve dans le coin droit arrière
supérieur du compartiment réfrigérateur, juste
au-dessous des commandes de température.
À quel moment remplacer le filtre sur les modèles
avec indicateur lumineux de remplacement
Une lumière indique la nécessité de remplacer la cartouche du
filtre à eau sur le distributeur. Cette lumière devient orange pour
vous avertir de remplacer bientôt le filtre.
Vous devez remplacer la cartouche de filtre quand
la lumière de l’indicateur devient rouge ou quand le débit
de l’eau qui va au distibuteur d’eau ou au distributeur
de glace diminue.
Portecartouche
Faites couler l’eau du distributeur pendant 3 minutes
(environ 6 litres) afin de dégager le système et empêcher le
bredouillement.
Pressez et maintenez appuyée la touche WATER FILTER
(filtre à eau) sur le distributeur pendant 3 secondes (sur
certains modèles).
À quel moment remplacer le filtre sur les modèles
sans indicateur lumineux de remplacement
La cartouche du filtre doit être remplacée tous
les six mois ou moins si le débit d’eau du distributeur
d’eau ou du distributeur de glace diminue.
Retrait de la cartouche du filtre
S’il s’agit d’une cartouche de remplacement, enlevez
d’abord l’ancienne en la tournant lentement vers la gauche. Ne
tirez pas sur la cartouche. Un peu d’eau peut s’écouler.
Installation de la cartouche du filtre à eau
Si vous remplacez une cartouche SmartWater avec un
adaptateur, il doit être retiré avant l’installation de la
cartouche. Pour retirer l’adaptateur, faites-le pivoter vers la
gauche d’environ un quart de tour.
Si vous remplacez une cartouche Water by Culligan, laissez
l’adaptateur en place. Cet adaptateur demeurera dans le
réfrigérateur lorsque que vous remplacerez les futures
cartouches.
Avec adaptateur Sans adaptateur
(l’apparence peut varier)
Certains modèles
utilisent ce type
de filtre à eau
Sur les modèles sans indicateur lumineux de remplacement,
appliquer l’autocollant du mois et de l’année à la nouvelle
cartouche pour vous rappeler de remplacer le filtre dans six mois.
Remplissez la cartouche de remplacement d’eau du robinet
immédiatement après l’installation afin de permettre un
meilleur débit du distributeur.
Alignez la flèche de la cartouche avec celle de support de
cartouche. Placez le haut de la nouvelle cartouche à l’intérieur
du support. Ne l’enfoncez pas dans le porte-cartouche.
Tournez la cartouche lentement vers la droite jusqu’au point
où la cartouche s’arrête. NE SERREZ PAS TROP FORT.
Lorsque vous la tournez, elle se lèvera en position
automatiquement. La cartouche fera approximativement
une 1/2 rotation.
REMARQUE: Une cartouche de remplacement qui vient d’être
installée peut faire jaillir l’eau du distributeur.
Bouchon de dérivation du filtre
Il faut utiliser le bouchon de dérivation du filtre lorsqu’une
cartouche de remplacement n’est pas disponible. Le distributeur
et la machine à glaçons ne peuvent pas fonctionner sans le filtre
ou sans le bouchon de dérivation du filtre.
Bouchon
de
dérivation
du filtre
SmartWater
Bouchon
de
dérivation
du filtre
Water by Culligan
Pour utiliser la prise de dérivation du filtre sur les modèles Water
by Culligan, vous devez d’abord retirer l’adaptateur du filtre du
support de la cartouche en le faisant pivoter vers la gauche.
Pour obtenir des résultats optimums de votre système de
filtration, GE vous recommande d’utiliser uniquement des filtres
GE SmartWater. L’utilisation de filtres GE dans les réfrigérateurs
GE et Hotpoint vous garantit une performance optimale et une
bonne fiabilité. Les filtres SmartWater de GE restent le bon choix
parce qu’ils sont spécifiquement conçus et brevetés pour les
produits GE. Les filtres GE SmartWater respectent les normes
rigoureuses de sécurité et de qualité NSF qui sont primordiales
lors de la filtration d’eau. GE n’a pas agréé des filtres de
marques différentes pour une utilisation dans les réfrigérateurs
GE et Hotpoint. Aucune assurance n’est donnée que les filtres
d’autres marques puissent respecter la qualité, performance et
fiabilité exigées par GE.
6LYRXVDYH]GHVTXHVWLRQV³YLVLWH]QRWUHVLWH:HEjO’adresse
www.electromenagersge.ca ou appelez le 1.888.261.2133.
Filtres de remplacement:
Pour commander des cartouches supplémentaires aux
États-Unis, visitez notre site Web à l’adresse ge.com, ou appelez
le Service des pièces et accessoires GE au 800.626.2002.
Voir l’étiquette du filtre pour le type de filtre à l’ordre (MWF ou MSWF)
Les clients au Canada devraient consulter les pages jaunes pour
connaître la succursale Mabe la plus près.See filter label for type
of filter to order (MWF or MSWF). Customers in Canada should
consult the yellow pages for the nearest Mabe Service Center.
55
Clayettes et bacs.
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
L’ergot
Bacs de porte de réfrigérateur et bacs basculants de porte de congélateur.
Bacs
Vous pouvez régler les plus grands bacs de
porte de réfrigérateur et les bacs basculants de
porte de congélateur.
Enlèvement : Soulevez l’avant du bac droit vers
le haut, puis soulevez et enlevez.
Bac de porte de réfrigérateur
Bac basculant de porte
de congélateur
Remise en place ou relocalisation :
Engagez l’arrière du bac dans les soutiens
moulés sur la porte. Puis poussez vers le bas
l’avant du bac. Le bac se fixe en place.
L’ergot aide à empêcher que de petits
articles placés sur la clayette de la porte
se renversent, coulent ou glissent. Mettez
un doigt de chaque côté de l’ergot près
de l’arrière et faites bouger la clayette vers
l’avant ou vers l’arrière selon vos besoins.
Bacs supérieurs de porte de congélateur
NOTE : Soyez
Ne pas obstruer
prudents lorsque vous
placez des articles
dans le bac supérieur.
Assurez-vous
qu’aucun objet
ne bloque ou tombe
dans la chute à
glaçons.
Bac supérieur de porte
de congélateur
Do not block
NOTE :
La pièce doit être en
place conformément
à la figure pour bien
distribuer les glaçons.
Vous ne pouvez
pas conserver
d’aliments dans cet
emplacement.
Bac supérieur de porte de
congélateur (sur certains modèles)
Clayette coulissante anti-déversement
Grâce à la clayette glissante anti-déversement,
vous pouvez atteindre des articles placés
derrière d’autres. Ses bords spéciaux sont
conçus pour empêcher tout déversement aux
clayettes inférieures.
Appuyez sur le taquet et tirez
la clayette vers l’avant pour l’enlever
Enlèvement :
Faites glisser la clayette vers l’extérieur jusqu’à
ce qu’elle atteigne son point d’arrêt, puis
appuyez le taquet vers le bas et faites glisser la
clayette directement vers l’extérieur.
Remise en place ou relocalisation :
Alignez la clayette avec les supports et
faites glisser en place. L’étagère peut être
repositionnée lorsque la porte est ouverte
à 90° ou plus. Pour ce faire, faites glisser
l’étagère au delà des butées et inclinez-la
vers le bas. Faites la glisser vers le bas
dans la position désirée, alignez-la avec
les supports et glissez-la en place.
Prenez soin de pousser la clayette jusqu’au
fond pour refermer la porte.
Clayette QuickSpace™
Vous pouvez diviser en deux cette clayette et
faire coulisser sa partie avant sous sa partie
arrière pour ranger des articles de haute taille
sur la clayette du dessous.
Vous pouvez enlever cette clayette
et la remettre en place ou la placer comme une
clayette coulissante anti-déversement.
56
Dans certains modèles, vous ne pouvez pas
utiliser cette clayette dans la position la plus
basse.
electromenagersge.ca
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Paniers du congélateur
Pour enlever, repousser le panier
complètement vers l’arrière du congélateur.
Soulevez-le jusqu’à ce que les broches arrière
soient dégagées. Soulevez le panier au complet
et retirez-le.
Prenez soin de pousser les paniers jusqu’au
fond pour refermer la porte.
Clayettes de congélateur à retrait par coulissement
Pour enlever, faites glisser jusqu’à la position
d’arrêt, soulevez l’avant au delà de la position
d’arrêt et faites sortir en glissant.
Prenez soin de pousser les clayettes jusqu’au
fond pour refermer la porte.
Clayettes de congélateur fixes
Il existe deux types de clayettes fixes :
Pour enlever ce type de clayette :
Soulevez la clayette par le côté gauche.
Faites-la sortir.
NOTE CONCERNANT LES MODÈLES
AVEC DISTRIBUTEUR: Afin de tirer pleinement
avantage du tiroir basculant, la taille des
articles déposés sur la clayette en dessous du
tiroir à glaçons ne doit pas excéder le point le
plus bas de ce tiroir.
Pour enlever ce type de clayette :
Soulevez le côté gauche de la clayette et
faites-le glisser vers la gauche au centre
des supports de la clayette.
Soulevez le côté droit de la clayette puis
sortez-le des supports de la clayette.
Support à bouteilles de vin/boissons (sur certains modèles)
Ce support peut contenir jusqu’à 5 canettes ou
une bouteille de vin.
Le support est accroché aux côtés du bac
à produits laitiers.
Pour enlever :
Videz le support.
Pour replacer :
Accrochez le support aux côtés du bac.
Engagez la partie arrière du bac dans
les supports moulés de la porte. Poussez
ensuite la partie avant du bac vers le bas.
Le bac se verrouillera en place.
En tenant la partie inférieure du bac à
produits laitiers, soulevez sa partie avant en
ligne droite, puis tirez vers le haut et
l’extérieur.
Pour dégager le support du bac à produits
laitiers, tirez sur les tiges latérales du
support pour les retirer des trous situés sur
les côtés du bac.
57
Les portes du réfrigérateur.
Portes du réfrigérateur
Les portes de votre réfrigérateur ne sont
pas tout à fait comme celles dont vous
avez l’habitude. Un système spécial
d’ouverture/fermeture assure que les portes
ferment complètement et hermétiquement.
L’impression de résistance que vous ressentez
à la position d’arrêt diminue lorsque des
aliments sont rangés dans la porte.
Lorsque vous ouvrez et fermez les portes, vous
remarquerez qu’elles sont munies
d’une position d’arrêt. Si vous ouvrez la porte
au delà de cette position d’arrêt, elle restera
ouverte afin de vous permettre de ranger
et de prendre vos aliments plus facilement.
Lorsque la porte est partiellement ouverte, elle
se ferme automatiquement.
Lorsque la porte est partiellement ouverte,
elle se ferme automatiquement.
Au delà de cette position d’arrêt la porte
restera ouverte.
Alignement des portes
Si les portes ne soient pas alignées, réglez
la porte du compartiment réfrigérateur.
À l’aide d’une clé de 7/16 po, tournez
la vis de réglage de la porte vers la droite
pour relever la porte, ou vers la gauche
pour l’abaisser. (Une douille de nylon,
encastrée dans les filets de l’axe,
empêchera celui-ci de tourner
si l’on ne se sert pas d’une clé.)
Clé de 7/16 po
Relevez
58
Après avoir tourné la clé une ou deux
fois, ouvrez et fermez la porte du
compartiment réfrigérateur et vérifiez
l’alignement des portes à la partie
supérieure.
Les tiroirs et contenants à légume.
electromenagersge.ca
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Contenants à fruits et légumes
Si une quantité d’eau excessive s’accumule
dans le fond des tiroirs, essuyez-les.
Sur certains modèles, le tiroir inférieur
est muni de coulisses pleine extension
permettant l’accès à l’ensemble du tiroir.
HI
LO
Contenants avec humidité variable
Réglez la commande à HI pour que le tiroir
conserve un degré d’humidité élevé pour
la conservation des légumes.
Réglez la commande à LO pour abaisser
le degré d’humidité dans le tiroir pour
la conservation des fruits.
Clayette déli transformable
T
ES
LD
O
CO
LD
C
Le Clayette déli transformable a sa propre
arrivée d’air froid pour permettre à
un courant d’air en provenance du
compartiment congélateur ou compartiment
des aliments frais d’arriver au contenant.
Le réglage de temperature variable
contrôle la circulation d’air en provenance
de la canalisation d’air du régulateur de
température.
Réglez la temperature à la position froid
maximum pour conserver des viandes fraiches.
Réglez la temperature à la position froid pour
ramener le contenant à une temperature
normale de refrigeration et l’utiliser comme
espace supplémentaire pour les legumes. Cela
coupe l’entrée d’air froid. Vous pouvez choisir
une température intermédiaire entre ces deux
extrêmes.
Enlèvement des contenants.
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Enlèvement des contenants
Vous pouvez facilement enlever les tiroirs en les
tirant droit et en les soulevant au dessus de leur
position d’arrêt.
Si la porte vous empêche d’enlever les tiroirs,
essayez d’abord d’enlever les bacs à porte.
Si la porte n’offre pas assez d’espace libre, vous
devez rouler le réfrigérateur vers l’avant jusqu’à
ce que la porte s’ouvre suffisamment pour vous
permettre d’enlever les tiroirs. Parfois, pour faire
sortir le réfrigérateur, vous devez le faire aller
vers la gauche ou vers la droite en le roulant.
59
Machine à glaçons automatique.
Il faut prévoir entre 12 et 24 heures avant qu’un réfrigérateur nouvellement installé commence à produire des glaçons.
Machine à glaçons automatique
/DPDFKLQHjJODoRQVSURGXLUDHQYLURQJODoRQVSDUF\FOH³
VRLWHQYLURQ²JODoRQVWRXWHVOHVKHXUHV³VHORQ
la température du congélateur, la température ambiante,
la fréquence d’ouverture des portes et d’autres conditions
d’utilisation.
Si vous mettez votre réfrigérateur en marche avant que
la machine à glaçons ne soit alimentée en eau, mettez
l’interrupteur d’alimentation à la position OFF (arrêt).
Lorsque la conduite d’eau est raccordée au réfrigérateur, mettez
l’interrupteur d’alimentation à la position ON (marche).
La machine à glaçons se remplit d’eau lorsqu’elle atteint le point
de –10° C (15° F). Il faut prévoir entre 12 et 24 heures avant
qu’un réfrigérateur nouvellement installé commence à produire
des glaçons.
Vous entendrez un bourdonnement chaque fois que la machine
à glaçons se remplit d’eau.
Jetez les premiers lots de glaçons afin d’éliminer les impuretés
provenant de la conduite d’eau.
Remarque particulière au sujet des modèles
avec distributeur :
„
Les modèles avec distributeur sont munis d’un tiroir à glace
basculant. Le tiroir peut basculer comme indiqué sur les
illustrations, et il se maintiendra en position élevée lorsque vous
prendrez de la glace ou mettrez l’interrupteur de la machine
à glaçons en position Marche ou Arrêt. Assurez-vous de
remettre le tiroir en place avant de fermer la porte.
„
Pour restaurer votre niveau de glaçons lorsque le seau est
vide, nous recommandons de suivre les étapes suivantes :
12 heures après la première chute de glaçons dans le tiroir,
distribuez 3 à 4 cubes.
Après une autre période de 6 heures, distribuez 3 à 4 cubes
de nouveau.
Cette procédure restaurera votre niveau de glaçons dans la plus
brève période possible.
Machine à glaçons
Interrupteur
d’alimentation
Machine à glaçons
Assurez-vous que rien ne gêne le mouvement du bras
régulateur.
Si le bac à glaçons est plein jusqu’au niveau du bras régulateur,
la machine à glaçons s’arrêt de produire des glaçons. Il est
normal que plusieurs glaçons soient collés entre eux.
Lorsque vous n’utilisez pas souvent de glaçons, les vieux glaçons
perdent leur transparence, prennent un goût désagréable, et
diminuent de taille.
ATTENTION
Évitez le contact avec les pièces mobiles
GXPpFDQLVPHG·pMHFWLRQHWO·pOpPHQWFKDXȺDQW VLWXpGDQVOH
bas de la machine à glaçons) qui libère les cubes. Ne placez
ni les doigts ni les mains sur le mécanisme de production de
glace automatique lorsque le réfrigérateur est branché.
60
Interrupteur
d’alimentation Bras régulateur
(sur certains modèles)
Bras
régulateur
Bras régulateur
(sur certains modèles)
REMARQUE: Dans les maisons où la pression de l’eau est plus
faible que la normale, vous entendrez la machine à glaçon se
remettre en marche à plusieurs reprises pour fabriquer un lot de
glaçons.
electromenagersge.ca
Accès à la glace et à l’interrupteur sur les
modèles avec distributeur
Il existe deux types de tiroirs à glace sur les modèles avec
distributeur. Un type est doté d’une clayette au-dessus du tiroir,
l’autre type n’en a pas.
Remarque particulière au sujet des modèles avec distributeur
sans clayette au-dessus du tiroir à glace :
„ Ces modèles sont munis d’un tiroir à glace basculant. Le
tiroir peut basculer comme indiqué sur les illustrations, et il
se maintiendra en position élevée lorsque vous prendrez de
la glace ou mettrez l’interrupteur de la machine à glaçons en
position Marche ou Arrêt. Assurez-vous de remettre le tiroir
en place avant de fermer la porte.
Modèles avec clayette au-dessus du tiroir à glace
REMARQUE : Afin de pouvoir bénéficiez pleinement du tiroir à glace
inclinable, vous ne devriez ranger que des article, sur la clayette sous le tiroir,
moins hauts que le point le plus bas du tiroir.
Pour avoir accès à la glace, tirez
sur le tiroir en avant.
Modèles sans clayette au-dessus du tiroir à glace
Clayette
Clayette
Tiroir à glaçe
Tiroir à glaçe
Pour atteindre l’interrupteur, tirez
sur la clayette en ligne droite.
Assurez-vous de toujours remettre
la clayette en place.
Dans le cas des modèles avec distributeur, pour atteindre
la glace ou l’interrupteur :
Pour accéder à la glace ou l’interrupteur :
Soulevez le tiroir, puis tirez vers
l’avant jusqu’à son arrêt.
Abaissez le tiroir pour avoir accès
aux glaçons ou pour atteindre
le commutateur de marche.
Soulevez le tiroir, puis tirez
vers l’avant jusqu’à son arrêt.
Abaissez le tiroir pour avoir
accès aux glaçons ou pour
atteindre le commutateur de
marche.
Enlèvement du tiroir à glace (modèles avec distributeur)
ATTENTION
la glace pèse lourd quand le tiroir est plein.
Réglez le bouton de réglage en position OFF (arrêt) avant
d’enlever le tiroir.
Quand vous remettez le tiroir, assurez-vous de le presser
fermement en place. S’il ne va pas jusqu’au fond, enlevez-le
et faites tourner le mécanisme de mise en place d’1/4 de tour.
Repoussez alors le tiroir en place à nouveau.
Faites
tourner
Le mécanisme
de mise en place
Modèles avec distributeur seulement
61
Le distributeur d’eau et de glaçons. (sur certains modèles)
Pour utiliser le distributeur
Spill Shelf
Sélectionnez CUBED (glaçons), CRUSHED (glace
concassée) ou WATER (eau).
Appuyez doucement le verre contre le haut du
bras de distribution.
La clayette de trop-plein n’est pas munie d’un
système d’écoulement. Pour réduire les taches
d’eau, vous devez nettoyer régulièrement la
clayette et sa grille.
S’il n’y a pas d’eau distribuée lorsque le
réfrigérateur est initialement installé, il y a peut-être
de l’air dans la conduite d’eau. Appuyez sur la
commande de distribution pendant deux minutes
au minimum pour expulser l’air de la conduite
d’eau et remplir le réservoir d’eau. Afin d’éliminer
les éventuelles impuretés provenant de la conduite
d’eau, jetez les six premiers verres d’eau.
ATTENTION
Ne mettez jamais les doigts ou
d’autres objets dans l’ouverture du distributeur.
Verrouillage du distributeur
Appuyez sur la touche LOCK (verrouillage) ou
LOCK CONTROLS (verrouillage de commandes)
pendant 3 secondes pour verrouiller le distributeur
et le panneau de réglage. Pour déverrouiller,
appuyez sur la touche et tenez-la enfoncée
pendant encore 3 secondes.
Lumière du distributeur
La touche LIGHT (lumière) allume et éteint la
lumière du distributeur. Vous allumez également
la lumière en appuyant sur le bras de distribution.
Sur certains modèles, si cette ampoule brûle,
vous devez la remplacer par une ampoule d’au
maximum 6 watts, 12V.
Door Alarm (alarme de porte ouverte)
Utilisez la fonction Door Alarm pour vous avertir
si l’une des portes reste ouverte plus de trois
minutes. L’alarme s’éteint dès que la porte est
refermée. Pour les modèles à écran ACL, une
fenêtre contextuelle sera affichée. On peut
éteindre l’alarme en appuyant sur l’écran ACL.
Touch Control LED Distributeur:Appuyez sur la
touche SET CARACTERISTIQUES fois ALARME DE
PORTE clignote. Appuyez sur ON / OFF et l’alarme
de porte seront fixées et l’icône devient solide.
Appuyez sur ON / OFF pour éteindre l’alarme.
Alarme de porte (sur
le modèle tactile LED
Distributeur de contrôle)
Pour régler l’alarme, appuyez
sur cette touche jusqu’à ce
que le voyant s’allume. Cette
alarme sonore retentit si l’une porte est ouverte
pendant plus de 3 minutes. La lumière s’éteint et
le signal sonore s’arrête quand vous fermez la
porte.
Quick Ice
Si vous souhaitez accélérer la production de
glaçons, utilisez la fonction Quick Ice. Lorsque
cette fonction est mise en marche, le ventilateur
du congélateur fonctionnera sans interruption
pendant 48 heures ou jusqu’à ce que cette
fonction soit mise à OFF (arrêt).
Au cours de cette période, la production de
glaçons augmentera jusqu’à 40 %. Les modèles
avec la fonction glaçons intégrée doivent être
réglés, lors de la PREMIÈRE UTILISATION, à une
production minimale équivalant à un demi-verre
de 227 ml (8 oz) de glaçons toutes les 6 à 12
heures. Cela permettra à la machine à glaçons de
mieux remplir le bac et d’assurer une meilleure
distribution.
62
Mode d’emploi
Touch Control LED Distributeur:
Appuyez sur la touche SET CARACTERISTIQUES
deux fois et QUICK ICE se met à clignoter. Appuyez
sur ON / OFF pour activer cette fonction, puis de
nouveau pour l’éteindre.
Glace rapide (sur le modèle tactile LED Distributeur
de contrôle)
Lorsque vous avez besoin de glace rapidement,
appuyez sur cette touche pour accélérer la
production de glace. Cela permettra d’accroître la
production de glace pour les 48 heures suivantes
ou jusqu’à ce que vous appuyez sur la touche à
nouveau.
electromenagersge.ca
Precise Fill (sur certains modèles)
>
Si vous avez choisi OUNCES, appuyez sur ou
pour choisir le nombre d’onces à distribuer, soit
entre 2 et 99. La quantité par défaut est 8 onces.
>
Si vous avez choisi CUPS, appuyez sur
ou
pour choisir la quantité à distribuer. Les fractions
1/4, 1/3, 1/2, 2/3 et 3/4 sont affichées et la quantité
maximale est de 16 3/4 tasses. La quantité par
défaut est 1 tasse.
>
Ce distributeur d’eau est doté d’une fonction connue
sous le nom de « distribution précise ». Cette
fonction vous permet de choisir une quantité précise
d’eau (en tasses ou onces) que vous souhaitez
distribuer. Les modèles à écran ACL permettent
aussi les mesures en litres ou en chopines.
Touch Control LED Distributeur:
Appuyez sur la touche PRECISE FILL CUPS/OZ.
La touche WATER s’allumera et les touches
CRUSHED et CUBED s’éteindront. La dernière
unité utilisée s’affichera.
Appuyez sur PRECISE FILL de nouveau pour
basculer entre tasses et onces.
Appuyez la tasse contre le bras de distribution
pour faire couler l’eau. L’écoulement ’arrêtera
une fois versée la quantité choisie. L’affichage
indique la quantité versée, émet un bip puis se
réinitialise au bout de 5 secondes.
REMARQUE : Ne laissez pas le distributeur sans
surveillance lorsque l’eau est versée.
>
Pour arrêter l’écoulement avant la distribution
de toute la quantité choisie, cessez d’appuyer la
tasse contre le bras de distribution. L’affichage
indiquera pendant 5 secondes la quantité qui a
été versée. Appuyez de nouveau sur le bras
pendant ce délai pour compléter le versement
de la quantité choisie. Sinon, la quantité choisie
s’affichera de nouveau.
Renseignements importants concernant votre distributeur
„
N’ajoutez pas dans le bac à glaçons des glaçons
non fabriqués par votre machine
à glaçons. Ils risquent d’être difficiles
à concasser ou à distribuer.
„
Évitez de trop remplir les verres de glaçons
et d’utiliser des verres étroits ou très hauts.
Le conduit peut se bloquer et le volet peut geler et
coincer. S’il y a des glaçons qui bloquent
le conduit, faites-les passer au moyen d’une
cuillère en bois.
„
Ne placez pas de boissons ou d’aliments dans
le bac à glaçons pour les rafraîchir. Les boîtes,
bouteilles et paquets alimentaires peuvent
coincer la machine à glaçons ou la vis sans fin.
„
Afin que la glace distribuée ne puisse manquer
le verre, placer le verre à proximité mais sans
toucher l’ouverture du distributeur.
„
Même si vous avez sélectionné CUBED (glaçons),
il est possible que de la glace concassée tombe
dans votre verre. Cela
se produit de temps à autre lorsque plusieurs
glaçons sont acheminés vers le broyeur.
„
Après distribution de la glace concassée,
de l’eau peut s’écouler du conduit.
„
Parfois, un peu de givre se forme sur le volet
du conduit à glace. Ce phénomène est normal
et se produit en général après des distributions
répétées de glace concassée. Le givre va
éventuellement évaporer.
Entretien et nettoyage du réfrigérateur.
Nettoyage de l’extérieur
Zone de ramasse-gouttes
du répartiteur.
Le bac de trop-plein du distributeur devrait
être soigneusement essuyé. Vous pouvez
éliminer les dépôts calcaires laissés par les
taches d’eau
en trempant le bac dans du vinaigre non dilué.
Laissez tremper jusqu’à ce que les dépôts
disparaissent ou soient suffisamment ramollis
pour être éliminés par rinçage.
Le bras de distribution. Avant nettoyage,
appuyez pendant 3 secondes sur la touche
LOCK ou LOCK CONTROLS. Nettoyez-la au
moyen d’une solution d’eau et de bicarbonate
de soude– environ 15 ml (une cuillère à soupe)
de bicarbonate de soude par litre (une pinte)
d’eau. Rincez bien et essuyez.
Les poignées de porte et leur garniture.
Nettoyez-les au moyen d’un linge humecté
d’eau savonneuse. Séchez avec un linge doux.
Vous pouvez nettoyer les portes et les
poignées de porte en acier inoxydable (sur
certains modèles) avec un nettoyant d’acier
inoxydable vendu sur le marché. Les nettoyants
qui contiennent de l’acide oxalique, tels que
Bar Keepers Friend Soft Cleanser™, éliminent
la rouille, le ternissement et les petites taches.
Utilisez uniquement un nettoyant liquide
exempt d’abrasif et frottez dans la direction des
lignes de brossage à l’aide d’une éponge souple
imbibée.
N’utilisez pas de cire pour appareils ménagers
sur l’acier inoxydable.
Gardez l’extérieur du réfrigérateur
propre. Essuyez-le avec un linge propre
légèrement humecté de cire pour appareils
électroménagers ou d’un détergent liquide
doux pour la vaisselle. Séchez et polissez avec
un linge doux et propre.
N’essuyez pas le réfrigérateur avec un linge
à vaisselle sale ou une serviette humide :
ils pourraient laisser un résidu qui pourra
endommager la peinture. N’utilisez pas de
tampons à récurer, de produits nettoyants en
poudre, de javellisants ou de produits nettoyants
contenant un javellisant, car ces produits
peuvent égratigner la peinture et la rendre
moins résistante.
Nettoyage de l’intérieur
Pour éviter les mauvaises odeurs, laissez
une boîte ouverte de bicarbonate de soude
dans les compartiments réfrigérateur et
congélateur.
Débranchez le réfrigérateur avant de le
nettoyer.
S’il est trop difficile de le faire, essorez bien
votre linge ou votre éponge pour enlever
l’excès d’eau lorsque vous nettoyez autour des
interrupteurs, des lampes ou des commandes.
Utilisez une solution d’eau tiède et de
bicarbonate de soude–environ 15 ml (une
cuillère à soupe) de bicarbonate de soude par
litre (une pinte) d’eau–afin de nettoyer tout en
neutralisant les odeurs. Rincez et essuyez bien.
L’utilisation de solutions nettoyantes autres
que celles que nous recommandons,
plus particulièrement celles contenant
des distillats de pétrole peut fissurer ou
endommager l’intérieur du réfrigérateur.
64
ATTENTION
Ne nettoyez pas les
tablettes ou couvercles en verre avec de l’eau
chaude lorsqu’ils sont froids. Les tablettes
et couvercles en verre peuvent se briser s’ils
sont exposés à une variation de température
soudaine, ou soumis à un impact s’ils sont
heurtés ou échappés. S’il se brise, le verre
trempé est conçu pour se fracturer en un grand
nombre de petits éclats.
Ne lavez aucune pièce de plastique du
réfrigérateur au lave-vaisselle.
Le plateau refroidissement/dégel peut aller au
lave-vaisselle.
electromenagersge.ca
Derrière le réfrigérateur
Prenez un soin particulier lorsque vous éloignez
le réfrigérateur du mur. Tous
les types de revêtements de sol peuvent être
endommagés, particulièrement ceux qui sont
coussinés ou dont la surface est gaufrée.
Lorsque vous remettez le réfrigérateur
en place en le poussant, veillez à ne pas
le faire rouler sur le cordon d’alimentation ou
sur la conduite d’eau de la machine
à glaçons.
Tirez le réfrigérateur en ligne droite et, lorsque
vous le remettez en place, poussez-le vers le
mur en ligne droite. Les déplacements latéraux
du réfrigérateur pourraient endommager le
revêtement de sol ou le réfrigérateur.
Départ en vacances
Lorsque vous vous absentez pendant une
période prolongée, videz et débranchez le
réfrigérateur. Nettoyez l’intérieur avec une
solution d’eau et de bicarbonate de soude,
à raison 15 ml (d’une cuillère à soupe) de
bicarbonate par litre (1 pinte) d’eau. Laissez les
portes ouvertes.
Si la température risque de descendre sous
le point de congélation, demandez à un
réparateur de vidanger la conduite d’eau
afin d’éviter les dégâts sérieux causés par les
inondations.
Mettez l’interrepteur d’alimentation de la
machine à glaçons à la position O (arrêt) et
fermez l’alimentation d’eau au réfrigérateur.
Déménagement
Immobilisez tous les éléments amovibles, tels
que les clayettes et les bacs, à l’aide de ruban
gommé pour éviter de les endommager.
Assurez-vous que le réfrigérateur demeure
debout pendant son déménagement.
Si vous utilisez un charriot pour déménager
le réfrigérateur, ne laissez jamais le devant
ou le derrière du réfrigérateur reposer contre
le charriot. Cela pourrait endommager le
réfrigérateur. Ne transportez le réfrigérateur
que par les côtés.
65
Remplacement des ampoules. (sur certains modèles)
AVERTISSEMENT
Avant de remplacer une ampoule grillée, le réfrigérateur doit être débranché afin d’éviter le contact avec un
filament sous tension. (Une ampoule grillée peut se briser lors de son remplacement.)
Le courant du circuit de la lampe n’est pas interrompu même en tournant le bouton de la commande de température vers la
position OFF (arrêt).
Votre pare-lumière
rassemblera une des suivantes
Taquets
OU
Poche
&RPSDUWLPHQWUpIULJpUDWHXU³ODPSHVXSpULHXUH
Débranchez le réfrigérateur.
Les ampoules se trouvent en haut du
compartiment, à l’intérieur du pare-lumière.
Sur certains modèles, vous devez enlever
une vis qui se trouve à l’avant de l’écran.
Sur autres modèles, enlever la vis dans la
poche qui se trouve à l’arrière du parelumière.
Pour enlever l’écran à lumière, sur certains
modèles, appuyez sur les taquets situés de
côté de l’écran et faites sortir en faisant
glisser vers l’avant. Sur d’autres modèles
faites simplement glisser le pare-lumière
vers l’avant et faites sortir.
Après avoir remplacé l’ampoule par
une ampoule d’appareil électro-ménager
de même puissance ou de puissance
inférieure, remettez le pare-lumière
et les vis (sur certains modèles). Pour
remettre le pare-lumière, assurez-vous que
les taquets qui se trouvent à l’arrière du
pare-lumière aillent dans les trous qui se
trouvent à l’arrière du boîtier.
Rebranchez le réfrigérateur.
&RPSDUWLPHQWUpIULJpUDWHXU³ODPSHLQIpULHXUH
Cette lumière se trouve au dessus du tiroir
d’en haut.
T
ES
LD
O
CO
LD
C
Débranchez le réfrigérateur.
Enlevez le bouton de réglage du tiroir
à viande transformable en le tirant droit.
Après avoir remplacé l’ampoule
par une ampoule d’appareil
électro-ménager de même puissance ou
de puissance inférieure, remettez
le pare-lumière et le bouton.
Rebranchez le réfrigérateur.
Soulevez le pare-lumière et enlevez-le en
tirant.
Compartiment congélateur
Débranchez le réfrigérateur.
Enlevez la clayette qui se trouve juste au
dessus du pare-lumière (vous pouvez
enlever cette clayette plus facilement après
l’avoir vidée). Sur certains modèles, vous
devez enlever une vis qui se trouve en haut
du pare-lumière.
Pour enlever le pare-lumière, appuyez sur
les côtés et enlevez en soulevant.
66
Remplacez l’ampoule par une ampoule
d’appareil électro-ménager de même
puissance ou de puissance inférieure,
puis remontez le pare-lumière. Pour
remonter le pare-lumière, assurez-vous
que les taquets du haut soient
solidement fixés en place. Remettez la
vis (sur certains modèles).
Remontez la clayette et rebranchez
le réfrigérateur.
electromenagersge.ca
AVERTISSEMENT
Avant de remplacer une ampoule grillée, le réfrigérateur doit être débranché afin d’éviter le contact avec un
filament sous tension. (Une ampoule grillée peut se briser lors de son remplacement.)
Le courant du circuit de la lampe n’est pas interrompu même en tournant le bouton de la commande de température vers la
position OFF (arrêt).
Distributeur (sur certains modèles)
Débranchez le réfrigérateur.
L’ampoule se trouve sur le distributeur
sous le panneau de réglage. Enlevez
l’ampoule en la faisant tourner dans le
sens opposé à celui des aiguilles d’une
montre.
Remplacez l’ampoule par une ampoule de
même taille et de même puissance.
Rebranchez le réfrigérateur.
Compartiment réfrigérateur (sur les modèles avec éclairage LED)
Affichage à
LED Lighting
Certains modèles peuvent avoir éclairage à LED
affichage sur le dessus et / ou sur les côtés de
la compartiment des aliments frais et à l’arrière
et le côté du compartiment congélateur
Si cette assemblée doit être remplacé,
composez le Service GE au 1.800.432.2737 aux
Etats-Unis États ou 1.800.561.3344 au Canada.
Affichage
DEL
67
Ensembles de moulures et de panneaux décoratifs.
Pour les modèles «CustomStyle™»
Veuillez lire toutes les directives attentivement.
Avant de commencer
Certains modèles sont munis de garnitures qui vous permettent de monter des panneaux de porte. Vous pouvez
commander des panneaux de décoration pré-découpés des couleurs suivantes : noir, blanc, bisque ou acier inoxydable au
service de Pièces et accessoires 1.888.261.3055, ou vous pouvez ajouter des panneaux de bois qui vont avec votre cuisine.
Panneaux de moins de 6 mm (1/4 po) d’épaisseur
Lorsque vous installez des panneaux de bois ayant moins de 6 mm (1/4 po) d’épaisseur, vous aurez besoin d’un panneau de
remplissage entre la porte et le panneau de bois, tel que du carton de 3 mm (1/8 po). Si vous installez un panneau décoratif
pré-coupé, un panneau de remplissage pré-coupé est fourni dans l’ensemble. L’épaisseur totale du panneau décoratif ou de bois
avec le panneau de remplissage doit être de 6 mm (1/4 po).
Les panneaux qui ont plus de 6 mm (1/4 po)
6 mm (1/4
po) max
Panneau de 19 mm (3/4 po) ou surélevé
Vous pouvez utiliser un panneau surélevé vissé ou collé sur un panneau de base de 6 mm (1/4 po) d’épaisseur, ou un panneau
fraisé de 19 mm (3/4 po). La partie surélevée du panneau doit être fabriquée de façon à offrir un dégagement pour les doigts d’au
moins 5,1 cm (2 po) du côté de la poignée.
Les panneaux qui ont plus de 6 mm (1/4 po) d’épaisseur, jusqu’à 19 mm (3/4 po), nécessitent que le panneau extérieur de périmètre
de 8 mm (5/16 po) ne soit pas plus épais que 6 mm (1/4 po).
Limites de poids pour les panneaux personnalisés :
Réfrigérateur : 38 livres (17 kg) max.
Congélateur : 28 livres (13 kg) max.
Les panneaux qui ont plus de 6 mm (1/4 po) d’épaisseur
Panneau de base de 6 mm (1/4 po)
8 mm (5/16 po)
6 mm (1/4 po) max
19 mm (3/4 po)
68
Dégagement
de 5,1 cm (2 po)
du côté de
la poignée
Panneau décoratif
19 mm (3/4 po)
Porte du réfrigérateur
electromenagersge.ca
23‘ Dimensions pour les panneaux de bois sur mesure
Les parties supérieures des panneaux doivent être découpées dans les panneaux.
Panneau du
congélateur sans
distributeur
Panneaux du
congélateur avec
distributeur
3 mm (1/8 po)
3 mm (1/8 po)
Découpez
Découpez
8 mm
(5/16 po)
Panneau du
compartiment
des aliments frais
3 mm (1/8 po)
8 mm
(5/16 po)
Découpez
8 mm
(5/16 po)
45,4 cm
(177ø8 po)
170,9 cm
(679ø32 po)
170,9 cm
(679ø32 po)
DEVANT
DEVANT
36,8 cm
(1415ø32 po)
36,8 cm
(1415ø32 po)
DEVANT
49,5 cm
(1915ø32 po)
85,4 cm
(335ø8 po)
25‘ Dimensions « CustomStyle™ » pour les panneaux de bois sur mesure
Les parties supérieures des panneaux doivent être découpées dans les panneaux.
Panneau du
congélateur sans
distributeur
Découpez
3 mm (1/8 po)
8 mm
(5/16 po)
Panneaux du
congélateur avec
distributeur
Découpez
3 mm (1/8 po)
Panneau du
compartiment
des aliments frais
3 mm (1/8 po)
Découpez
8 mm
(5/16 po)
8 mm
(5/16 po)
43,2 cm
(17 po)
175,3 cm
(69 po)
DEVANT
36,8 cm
(1415ø32 po)
175,3 cm
(69 po)
DEVANT
36,8 cm
(1415ø32 po)
DEVANT
49,5 cm
(1915ø32 po)
92,0 cm
(361ø4 po)
69
Installation des panneaux de porte.
Veuillez lire toutes les directives attentivement.
Insérez les panneaux du congélateur et du réfrigérateur.
Poussez délicatement sur le panneau supérieur du
congélateur jusqu’à ce qu’il soit inséré dans la rainure
derrière la poignée de porte. Poussez le panneau de
remplissage (nécessaire avec certains panneaux de
porte) derrière le panneau décoratif. Faites la même
chose avec le panneau du réfrigérateur.
Si votre modèle est doté d’un distributeur, cette étape
ne s’applique qu’au panneau du réfrigérateur et au
panneau supérieur du congélateur.
Insérez le panneau inférieur du congélateur (sur les modèles à distributeur).
Poussez délicatement sur le panneau jusqu’à ce qu’il
soit inséré dans la rainure derrière la poignée de porte.
Poussez le panneau de remplissage (nécessaire avec
certains panneaux de porte) derrière le panneau
décoratif.
Attachez la moulure supérieure de la porte du congélateur et du réfrigérateur.
La moulure supérieure se trouve à l’intérieur du
compartiment du réfrigérateur.
À l’aide d’une clé à torsion T-20, fixez les moulures
supérieures en utilisant deux vis en haut de chaque
moulure. Serrez à la main seulement. Assurez-vous
que le haut de chaque panneau est bien aligné sous le
rebord de sa moulure supérieure.
Vis de la moulure supérieure
Vis de la moulure supérieure
Découpure
Découpure
Panneau
supérieur
du
congélateur
Panneau du
réfrigérateur
Panneau
inférieur du
congélateur
Moulure
latérale
70
Moulure
latérale
electromenagersge.ca
Installez la moulure latérale.
Ces pièces se trouvent à l’intérieur de la poignée de porte
du compartiment réfrigérateur.
N’enlevez pas la pellicule protectrice qui se trouve à
l’extérieur de la moulure latérale avant d’avoir installé la
moulure latérale.
Tenez la moulure latérale contre la partie avant des
panneaux décoratifs, puis installez la moulure latérale
sous la moulure supérieure. Assurez-vous que la moulure
latérale magnétiquement fixée est correctement installée
et que vous êtes satisfait de l’aspect général des pièces.
Insérez la partie inférieure de la moulure latérale sous la
moulure inférieure comme illustré.
Moulure supérieure
Moulure
latérale
Moulure
latérale
Moulure inférieure
71
Instructions
d’installation
Réfrigérateur
Modèles 22, 23, 25, 26, 27 et 29
Questions? Appelez le 1.800.561.3344 ou Visitez notre site Web à l’adresse : electromenagersge.ca
AVANT DE COMMENCER
PREPARATION
Veuillez lire toutes les directives attentivement.
ALIMENTATION D’EAU DE LA MACHINE À
GLAÇONS
•
IMPORTANT ³ Conservez ces instructions
Si votre réfrigérateur a une machine à glaçons,
il faut le brancher à une conduite d’eau froide.
Vous pouvez acheter une trousse d’alimentation
d’eau GE (contenant la tuyauterie, le robinet d’arrêt,
les joints et les instructions) chez votre revendeur
ou en vous adressant à notre site Web à l’adresse
electromenagersge.ca ou à notre service de Pièces et
accessoires au numéro de téléphone 1.888.261.3055.
pour l’inspecteur local.
•
IMPORTANT ³ Respectez toutes
les ordonnances et les codes locaux.
• Note à l’installateur – Assurez-vous de laisser
ces instructions au consommateur.
• Note au consommateur – Conservez
ces instructions pour référence future.
• Niveau de compétence – L’installation de
cet appareil nécessite des compétences
mécaniques de base.
• Temps d’installation – Installation du réfrigérateur
30 minutes
Installation de la conduite
d’eau
30 minutes
• L’installateur est responsable de bien installer
ce réfrigérateur.
• Toute panne du produit due à une mauvaise
installation n’est pas couverte par la garantie.
Si le réfrigérateur a déjà été installé, enlevez
la grille de base (voir l’étape 2 de la section
Déménagement du réfrigérateur), puis sautez
à l’étape 5 de la section Installation du réfrigérateur.
OUTILS REQUIS
Clé à douille, 3/8 po et 5/16 po
Clé, 1/2 et 7/16 po
Clé hexagonale de 1/8 po
Couteau à mastiquer
en plastique
Tournevis cruciforme
72
Instructions d’installation
DÉMÉNAGEMENT DU RÉFRIGÉRATEUR
1 CHARGEMENT DU RÉFRIGÉRATEUR
Si le réfrigérateur doit passer par une
ouverture de moins de 38 po de largeur,
ses portes doivent être enlevées. Passez
à l’étape 3.
N’ENLEVEZ PAS les poignées.
Si toutes les ouvertures ont plus de
38 po de largeur, sautez à la section
Installation du réfrigérateur.
SUR UN CHARIOT MANUEL
Laissez le ruban et les protecteurs sur les
portes jusqu’à ce que le réfrigérateu r arrive à
destination.
Pour transporter le réfrigérateur, utilisez
un chariot manuel rembourré. Centrez le
réfrigérateur sur le chariot et entourez-le
d’une courroie. NE SERREZ PAS LA COURROIE
3 DÉBRANCHEZ LE RACCORD
D’ALIMENTATION D’EAU
(sur certains modèles)
Si le compartiment réfrigération est doté d’un
rafraîchisseur d’eau, alors il faut débrancher
la conduite d’eau qui part de la carosserie et
s’insère dans la charnière inférieure de la porte
du compartiment congélation.
Pour débrancher, poussez sur le collet blanc du
raccord puis tirez sur le tube.
Collet blanc
EXCESSIVEMENT.
2 ENLEVEZ LA GRILLE DE BASE
Enlevez la grille en retirant les deux vis à tête
cruciforme.
Charnière
inférieure du
compartiment
congélation
73
Instructions d’installation
DÉMÉNAGEMENT DU RÉFRIGÉRATEUR (SUITE)
4 DÉBRANCHEZ LE RACCORD
6 FERMEZ LES PORTES DES COMPARTIMENTS
D’ALIMENTATION ÉLECTRIQUE
(sur certains modèles)
CONGÉLATION ET RÉFRIGÉRATION
Si le compartiment réfrigération est
doté d’un rafraîchisseur d’eau, alors
il faut débrancher la conduite électrique
(faisceau) qui part de la carosserie et s’insère
dans la charnière inférieure de la porte
du compartiment congélation.
Pour débrancher, tirez de chaque côté
du raccord.
7 ENLEVEZ LA PORTE DU
COMPARTIMENT CONGÉLATION
A Enlevez le couvercle de la charnière supérieure
(si ainsi équipé) de la porte du compartiment
congélation, soit en le pressant et le tirant
vers le haut, soit en le dégageant à l’aide
d’un couteau à mastiquer en plastique.
Charnière
inférieure du
compartiment
congélation
5 DÉBRANCHEZ LES CONNECTEURS
ÉLECTRIQUES (sur certains modèles)
Si le compartiment réfrigération est doté
d’un centre de rafraîchissement, alors il
faut débrancher les connecteurs électriques
(faisceaux) qui partent de la carosserie
et s’insèrent dans la charnière inférieure
du compartiment réfrigération.
Pour débrancher, tirez de chaque côté
des connecteurs.
B Enlevez les deux vis à tête hexagonale 5/16 po
ou 1/8 po, puis soulevez la charnière en ligne
droite pour dégager l’axe de charnière.
Tête hexagonale 5/16 po ou 1/8 po
C Ouvrez la porte du compartiment congélation
à 90.°
Charnière
inférieure du
compartiment
réfrigération
90°
74
Instructions d’installation
7 ENLEVEZ LA PORTE DU
8 ENLEVEZ LA PORTE DU
D Pendant qu’une personne soulève lentement
la porte du compartiment congélation pour
la dégager de la charnière inférieure,
une deuxième personne doit minutieusement
guider la conduite d’eau et la conduite électrique
(faisceau) à travers la charnière inférieure.
B Enlevez les deux vis à tête hexagonale 5/16 po
ou 1/8 po, puis soulevez la charnière en ligne
droite pour dégager l’axe de charnière.
COMPARTIMENT CONGÉLATION
(suite)
COMPARTIMENT RÉFRIGÉRATION
(suite)
Tête hexagonale 5/16 po ou 1/8 po
C Ouvrez la porte du compartiment réfrigération
à 90.°
90°
E
Placez la porte sur une surface lisse pour
la protéger des égratignures, l’intérieur vers
le haut.
8 ENLEVEZ LA PORTE DU
A
90°
COMPARTIMENT RÉFRIGÉRATION
Enlevez le couvercle de la charnière supérieure
(si ainsi équipé) de la porte du compartiment
réfrigération, soit en le pressant et le tirant
vers le haut, soit en le dégageant à l’aide
d’un couteau à mastiquer en plastique.
75
Instructions d’installation
DÉMÉNAGEMENT DU RÉFRIGÉRATEUR (SUITE)
9 REMISE EN PLACE DES PORTES
8 ENLEVEZ LA PORTE DU
COMPARTIMENT RÉFRIGÉRATION
(suite)
Pour replacer les portes, inversez simplement
les étapes 3 à 8.
Veuillez cependant noter les points suivants :
• Au moment d’abaisser les portes sur
les charnières inférieures, une deuxième
personne doit guider minutieusement
le tube et les faisceaux électriques à travers
les ouvertures des charnières.
• Lorsque vous branchez la conduite d’eau,
assurez-vous d’insérer le tube jusqu’à
la marque.
D Soulevez la porte du compartiment
réfrigération pour la dégager de la charnière
inférieure.
Si le compartiment réfrigération
est doté d’un centre de rafraîchissement,
une personne doit soulever lentement la porte
pour la dégager de la charnière inférieure,
pendant qu’une deuxième personne guide
minutieusement les conduites électriques
(faisceaux) à travers la charnière inférieure.
Marque
• Ne pincez pas le tube et les faisceaux
électriques lorsque vous placez les portes
sur les charnières inférieures.
• Lorsque vous branchez la ou les conduites
électriques (plusieurs conduites seulement
sur les modèles dotés d’un centre de
rafraîchissement), assurez-vous que
les connecteurs sont complètement
imbriqués.
90°
Modèles dotés d’un centre de refraîchissement seulement
E
Placez la porte sur une surface lisse pour
la protéger des égratignures, l’intérieur vers
le haut.
76
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR
EMPLACEMENT DU RÉFRIGÉRATEUR
DIMENSIONS ET SPÉCIFICATIONS
• N’installez jamais votre réfrigérateur dans
un emplacement où la température ambiante
sera inférieure à 16° C (60° F). Il ne se mettra pas
en marche suffisamment souvent pour maintenir
des températures convenables.
• N’installez jamais votre réfrigérateur dans
un emplacement où la température ambiante
sera supérieure à 37° C (100° F). Il ne
fonctionnera pas bien.
• N’installez pas le réfrigérateur dans un endroit
exposé à l’eau (pluie, etc.) ou directement aux
rayons solaires.
• Installez votre réfrigérateur sur un plancher
suffisamment solide pour le porter lorsqu’il est
plein.
(pour les modèles « CustomStyle™ » de 23¢)
701ø4” (178.4 cm)
36”
(91.4 cm)
24” (61 cm)
DÉGAGEMENTS
Prévoyez les dégagements suivants pour
faciliter l’installation, la bonne circulation d’air
et les raccordements de plomberie et d’électricité :
Côtés
Dessus
Arrière
CustomStyle™
de 23¢/25¢
23¢ (33 po de largeur),
25¢, 26¢, 27¢ et 29¢
4 mm (1/8 po)
25 mm (1 po)
13 mm (1/2 po)
4 mm (1/8 po)
25 mm (1 po)
25 mm (1 po)
DIMENSIONS ET SPÉCIFICATIONS
(pour les modèles « CustomStyle™ » de 25¢)
DIMENSIONS ET SPÉCIFICATIONS
Eau
Électricité
721ø4” (183.5 cm)*
Armoire
de 61 cm (24 po)
Dégagement de 19
mm (3/4 po) (jeu de
13 mm [1/2 po] +
plaques murales de
6 mm [1/4 po])
36”
(91.4 cm)
Dessus du comptoir
de 63,5 cm (25 po)
24” (61 cm)
*183,5 cm (721/4 po) sont nécessaires pour
bien régler les roues de mobilité. Si les armoires
placées sur le réfrigérateur ont des portes
qui sont alignées au sommet de l’ouverture du
réfrigérateur, vous pouvez avoir besoin de 1/8 po
d’espace libre supplémentaire pour permettre
une bonne ouverture des portes de l’armoire.
77
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR (SUITE)
1 BRANCHEMENT DU RÉFRIGÉRATEUR
C Fixez le tuyau dans le collet (fourni) pour
le maintenir en position. Il est possible que
vous deviez écarter le collet.
À LA CONDUITE D’EAU DE LA MAISON
(modèles avec machine à glaçons
et distributeur)
Collet à tuyau
Une alimentation d’eau froide est requise
pour faire fonctionner la machine à glaçons
et le distributeur. Vous devrez en fournir
une si elle n’existe pas. Voir la section
Installation de la conduite d’eau.
Tuyau 1/4 po
Écrou à
compression
1/4 po
Bague
(manchon)
NOTES :
• Avant de brancher la conduite au
réfrigérateur, assurez-vous que le cordon
d’alimentation électrique n’est pas branché
à la prise murale.
• Si votre réfrigérateur n’est pas équipé
de filtre à eau, nous recommandons
d’en monter un si votre alimentation d’eau
contient du sable ou des particules qui
peuvent boucher la grille du robinet d’eau
du réfrigérateur. Installez-le sur la conduite
d’eau près du réfrigérateur. Si vous utilisez
une trousse GE SmartConnect™ Refrigerator
Tubing, vous aurez besoin d’un tuyau
additionnel (WX08X10002) pour brancher
le filtre. Ne coupez pas le tuyau de plastique
pour installer le filtre.
A Si vous utilisez un tuyau de cuivre,
placez un écrou de compression et une bague
(manchon) à l’extrémité du tuyau qui vient
de l’alimentation d’eau froide de la maison.
Si vous utilisez un tuyau GE SmartConnect,™
les écrous sont déjà assemblés au tuyau.
B Si vous utilisez un tuyau de cuivre, insérez
aussi loin que possible l’extrémité du tuyau
dans le raccord à l’arrière du réfrigérateur.
Tout en tenant le tuyau, serrez le raccord.
Si vous utilisez un tuyau GE SmartConnect,™
insérez l’extrémité moulée du tuyau dans
le raccord à l’arrière du réfrigérateur, puis
serrez l’écrou à compression à la main.
Serrez ensuite un autre tour à l’aide d’une clé.
Un serrage excessif pourrait occasionner
des fuites.
Raccord du
réfrigérateur
Tuyau SmartConnect™
Option 2
2 OUVREZ L’ALIMENTATION D’EAU
Ouvrez l’alimentation d’eau au niveau
du robinet d’arrêt (l’alimentation d’eau
de la maison)
et vérifiez la
présence de
fuites.
3 BRANCHEZ LE CORDON
DU RÉFRIGÉRATEUR DANS LA PRISE
Avant de brancher le réfrigérateur, assurez-vous
que l’interrupteur de la machine à glaçons est à la
position O (arrêt).
Lisez létiquette
concernant la mise à la
terre qui est attachée au
cordon d’alimentation.
78
Instructions d’installation
5 METTEZ LE RÉFRIGÉRATEUR
4 PLACEZ LE RÉFRIGÉRATEUR
DE NIVEAU
(suite)
DANS SON EMPLACEMENT
Transportez le réfrigérateur jusqu’à sa
destination.
Pour ajuster
les roulettes
sur les modèles
CustomStyle™
de 23’ / 25’ :
Vis de réglage
Tournez les vis de réglage
des roulettes dans le sens des aiguilles d’une
montre pour faire monter le réfrigérateur,
dans le sens opposé à celui des aiguilles d’une
montre pour le faire descendre. Utilisez une clé
hexagonale de 3/8 po avec extension ou une clé
anglaise.
Ces modèles ont aussi des roulettes arrières
réglables, pour vous permettre d’aligner le
réfrigérateur aux armoires de cuisine. Utilisez une
clé hexagonale de 3/8 po. avec extension pour
tourner les vis pour les roulettes arrières, dans
le sens des aiguilles d’une montre pour faire
monter le réfrigérateur, dans le sens opposé à
celui des aiguilles d’une montre pour le faire
descendre.
5 METTEZ LE RÉFRIGÉRATEUR
DE NIVEAU
La mise à niveau du réfrigérateur s’effectue
en ajustant les roulettes situées près
des charnières inférieures.
Relevez
Roulettes
Les roulettes de nivellement jouent trois rôles :
• Elles peuvent être réglées pour que les portes
se referment automatiquement lorsqu’elles
sont à moitié ouvertes. (Réglez le bord
inférieur avant du réfrigérateur à 16 mm
[5/8 po] du sol.)
• Elles peuvent être réglées de manière à permettre
à l’appareil de reposer solidement sur le sol
et l’empêcher ainsi de branler.
• Elles vous permettent d’éloigner
le réfrigérateur du mur pour le nettoyage.
6 ALIGNEZ LES PORTES
Réglez les portes du réfrigérateur pour qu’elles
soient bien alignées à la partie supérieure.
Pour aligner les portes :
A À l’aide d’une clé de 7/16 po, tournez la vis de
réglage de la porte vers la droite pour relever
la porte, ou vers la gauche pour l’abaisser.
NOTE :
Une douille de nylon, encastrée dans les filets
de l’axe, empêchera celui-ci de tourner si l’on
ne se sert pas d’une clé.
Après avoir tourné la clé une ou deux fois,
B ouvrez et fermez la porte du réfrigérateur
et vérifiez l’alignement des portes à la partie
supérieure.
Pour ajuster les roulettes sur les modèles
de les roulettes sur les modèles 23’
(33 po de largeur) 25’, 26’, 27’ et 29’ :
• Tournez les vis de réglage des roulettes dans
le sens des aiguilles d’une montre pour
faire monter le
réfrigérateur, dans
le sens opposé à
celui des aiguilles
d’une montre pour
le faire descendre.
Utilisez une douille
hexagonale ou une
clé de 3/8 po, ou
une clé anglaise.
Portes doivent être alignées
à la partie
supérieure
Relevez
Vis de réglage
Clé 7/16 po
79
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR (SUITE)
7 REPLACEZ LA GRILLE DE BASE
9 METTEZ EN MARCHE
LA MACHINE À GLAÇONS
Replacez la grille de base en installant
les deux vis à tête cruciforme (Phillips).
Mettez le commutateur de la machine
à glaçons en position l (marche). La machine
à glaçons ne se met en marche que lorsqu’elle
atteint une température de fonctionnement
de –9° C (15° F) ou moins. Elle commence
immédiatement à fonctionner. Il faudra
2 à 3 jours pour remplir le bac à glaçons.
interrupteur
d’alimentation
interrupteur
d’alimentation
8 RÉGLEZ LES COMMANDES
Réglez les commandes selon les
recommandations.
NOTE :
Si votre pression d’eau est trop faible,
le robinet peut se remettre en marche jusqu’à
trois fois pour envoyer suffisamment d’eau
à la machine à glaçons.
80
Instructions d’installation
INSTALLATION DE LA CONDUITE D’EAU (MODÈLES AVEC MACHINE À
GLAÇONS ET DISTRIBUTEUR)
CE DONT VOUS AUREZ BESOIN
AVANT DE COMMENCER
Nous recommandons les trousses d’alimentation
d’eau en cuivre WX8X2, WX8X3, WX8X4, selon
le montant de conduite dont vous avez besoin.
Nous approuvons les conduites d’eau en matière
plastique GE SmartConnect™ Refrigerator Tubing
(WX08X10006, WX08X10015 et WX08X10025).
Si vous installez un système d’eau GE Reverse
Osmosis dans votre réfrigérateur, la seule
installation approuvée est celle de la trousse
GE RVKIT. Pour les autres systèmes d’osmose de
l’eau, suivez les recommandations du fabricant.
Si l’alimentation d’eau à votre réfrigérateur vient
d’un système de filtration d’osmose inversée ET
si votre réfrigérateur a également un filtre d’eau,
utilisez le bouchon de dérivation du filtre de votre
réfrigérateur. Si vous utilisez la cartouche de
filtration de votre réfrigérateur en conjonction avec
le filtre d’osmose inversée, vous pouvez produire
des glaçons creux et ralentir l’alimentation
en eau de votre machine à glaçons.
Cette installation de conduite d’eau n’est pas
garantie par le fabricant de réfrigérateur ou
de machine à glaçons. Suivez soigneusement
ces instructions pour minimiser le risque de
dommages onéreux d’inondation.
Les coups de bélier (eau qui donne des coups
dans les tuyaux) dans la tuyauterie de la maison
peut occasionner des dommages aux pièces de
votre réfrigérateur, ainsi que des fuites ou des
inondations. Appelez un plombier certifié pour
corriger les coups de bélier avant d’installer
la conduite d’eau de votre réfrigérateur.
Pour prévenir toute brûlure et tout dommage
à votre réfrigérateur, ne branchez jamais
la conduite d’eau à une canalisation d’eau chaude.
Si vous utilisez votre réfrigérateur avant de
brancher la conduite d’eau, assurez-vous de laisser
le commutateur de la machine à glaçon en position
O (arrêt).
N’installez jamais les tuyaux de la machine à glaçon
dans des endroits où la température risque de
descendre en dessous du point de congélation.
Si vous utilisez un outil électrique (comme
une perceuse électrique) pendant l’installation,
assurez-vous que l’isolement ou le câblage de cet
outil empêche tout danger de secousse électrique.
Vous devez procéder à toutes vos installations
conformément aux exigences de votre code local
de plomberie.
• Tuyaux en cuivre ou trousse GE SmartConnect™
Refrigerator Tubing, diamètre extérieur de 1/4
po pour brancher le réfrigérateur à l’alimentation
d’eau. Si vous utilisez un tuyau en cuivre,
assurez-vous que les deux extrémités
du tuyau soient coupées bien droit.
Pour trouver la longueur de tuyau dont vous
aurez besoin : mesurez la distance qui va du robinet
d’eau situé derrière le réfrigérateur jusqu’au tuyau
d’alimentation d’eau. Assurez-vous qu’il y ait assez
de tuyau en trop pour vous permettre de décoller
le réfrigérateur du mur après l’installation.
Les trousses GE SmartConnect™ Refrigerator Tubing
sont disponibles dans les dimensions suivantes :
2,4 m (8 pi) – WX08X10006
4,6 m (15 pi) – WX08X10015
7,6 m (25 pi) – WX08X10025
81
Instructions d’installation
INSTALLATION DE LA CONDUITE D’EAU (SUITE)
Installez le robinet d’arrêt sur la canalisation d’eau
potable la plus fréquemment utilisée.
CE DONT VOUS AUREZ BESOIN (SUITE)
• Une alimentation d’eau froide potable.
La pression de l’eau doit être
entre 20 et 120 p.s.i. (1,4 et 8,1
bar).
• Une perceuse électrique.
• Une clé de 1/2 po ou une clé anglaise.
• Un tournevis à lame plate
un tournevis Phillips.
1 FERMEZ L’ALIMENTATION
PRINCIPALE D’EAU
Ouvrez le robinet le plus proche suffisamment
longtemps pour purger le tuyau.
et
2 CHOISISSEZ L’EMPLACEMENT
DU ROBINET
• Deux écrous à compression d’un diamètre
H[WpULHXUGHSRHWGHX[EDJXHV PDQFKRQV ³
pour brancher le tuyau en cuivre au robinet d’arrêt
et au robinet d’eau du réfrigérateur.
OU
• Si vous utilisez une trousse
d’alimentation d’eau GE avec tuyau
en matière plastique, les garnitures
nécessaires sont déjà montées au tuyau.
• Si votre canalisation d’eau actuelle a
un raccord évasé à une extrémité, vous aurez
besoin d’un adaptateur (que vous trouverez
dans votre magasin de matériel de plomberie)
pour brancher le tuyau d’eau au réfrigérateur,
OU BIEN vous pouvez couper le raccord évasé
à l’aide d’un coupe-tube, puis utiliser un raccord
à compression.
Ne coupez jamais
l’extrémité
finie d’un tuyau de la
trousse GE SmartConnect™ Refrigerator Tubing.
Choisissez pour le robinet un emplacement
facilement accessible. Il vaut mieux le brancher
de côté à un tuyau vertical. Si vous devez
le brancher à un tuyau horizontal, faites
le branchement en haut ou de côté, plutôt
qu’en bas du tuyau, pour éviter de recevoir
des sédiments du tuyau d’alimentation d’eau.
3 PERCEZ UN TROU POUR LE ROBINET
Percez un trou de 1/4 po dans le tuyau d’eau,
à l’aide d’un foret dur. Enlevez toute barbure
due au perçage du trou dans le tuyau.
• Un robinet d’arrêt pour brancher le tuyau d’eau
froide. Le robinet d’arrêt doit avoir une entrée
d’eau avec un diamètre intérieur minimal de 5/32
po au point de jonction avec le TUYAU D’EAU
FROIDE. Des robinets d’arrêt à étrier sont souvent
inclus dans les trousses d’alimentation d’eau.
Avant d’acheter, assurez-vous que le robinet
à étrier se conforme à vos codes de plomberie
locaux.
Faites attention de ne pas laisser de l’eau
couler dans votre perceuse électrique.
Si vous ne percez pas un trou de 1/4 po,
vous obtiendrez une alimentation d’eau réduite
et des glaçons plus petits.
82
Instructions d’installation
4 FIXEZ LE ROBINET D’ARRÊT
7 BRANCHEZ LE TUYAU AU ROBINET
Fixez le robinet d’arrêt au tuyau d’eau froide
à l’aide du collier de serrage.
Placez un écrou de compression et une bague
(manchon) à l’extrémité du tuyau et branchez-les
au robinet d’arrêt.
Collier de serrage
Assurez-vous que le tuyau soit bien inséré dans
le robinet. Serrez fort l’écrou de compression.
Pour le tuyau en matière plastique d’une trousse
GE SmartConnect™ Refrigerator Tubing, insérez
l’extrémité moulée du tuyau dans le robinet
d’arrêt et serrez l’écrou de compression à la
main, puis serrez un autre demi tour avec
une clé. Si vous serrez trop fort, vous pouvez
occasionner des fuites.
Tuyau vertical
d’eau froide
Robinet d’arrêt
à étrier
NOTE: Vous devez vous conformer aux Codes
de plomberie 248CMR du Commonwealth
of Massachusetts. Les robinets d’arrêt à étrier
sont illégaux et leur utilisation n’est pas
autorisée au Massachusetts. Consultez votre
plombier local.
Robinet d’arrêt
à étrier
Tuyau
SmartConnect™
Presse-joint
5 SERREZ LE COLLIER DE SERRAGE
Robinet de sortie
Serrez les vis du collier jusqu’à ce que la rondelle
d’étanchéité commence à enfler.
Bague (manchon)
NOTE: Vous devez vous conformer aux Codes
de plomberie 248CMR du Commonwealth of
Massachusetts. Les robinets d’arrêt à étrier sont
illégaux et leur utilisation n’est pas autorisée au
Massachusetts. Consultez votre plombier local.
NOTE: Ne serrez pas trop. Vous risquez d’écraser
le tuyau de cuivre.
Rondelle
Collier de serrage
Écrou de compression
Entrée
Vis du
collier
8 PURGEZ LE TUYAU
Ouvrez le robinet d’alimentation principale
d’eau et purgez le tuyau jusqu’à ce que l’eau
soit claire.
Fermez l’eau au niveau du robinet d’eau après
écoulement d’environ 1 litre (1 quart) d’eau
par le tuyau.
6 ACHEMINEZ LE TUYAU
Acheminez le tuyau du tuyau d’eau froide
au réfrigérateur.
Faites passer le tuyau par un trou percé dans
le mur ou le plancher (derrière le réfrigérateur
ou au niveau de l’armoire de cuisine adjacente),
aussi près du mur que possible.
NOTE : Assurez-vous qu’il y ait assez de tuyau
en trop pour vous permettre de décoller
le réfrigérateur du mur après l’installation.
Pour compléter l’installation du réfrigérateur, retournez
à l’étape 1 de la section Installation du réfrigérateur.
83
Bruits normaux de fonctionnement.
Les réfrigérateurs plus récents font des bruits différents de ceux des anciens.
Les réfrigérateurs modernes présentent plus de fonctions et sont plus avancés
sur le plan technologique.
Entendez-vous ce que j’entends ? Ces bruits sont normaux.
HUMMM...
WHOOSH...
„
Le nouveau compresseur à rendement élevé peut
fonctionner plus longtemps et plus vite que votre
ancien réfrigérateur et vous pouvez entendre
un son modulé ou un ronflement aigu pendant
son fonctionnement.
„
Parfois le réfrigérateur fonctionne pendant une période
prolongée, surtout lorsque les portes sont ouvertes
fréquemment. Cela signifie que la fonction Frost Guard ™
est active pour empêcher la brûlure de congélation et
améliorer la conservation des aliments.
„
Vous pouvez entendre un sifflement lorsque les portes
se ferment. Cela vient de l’équilibrage de pression dans
le réfrigérateur.
OUIR !
„
Vous pouvez entendre les ventilateurs tourner à
hautes vitesses. Cela se produit lorsque le réfrigérateur
vient d’être branché, lorsque les portes sont ouvertes
fréquemment ou lors de l’ajout d’une grande quantité
d’aliments dans les compartiments congélateur ou
réfrigérateur. Les ventilateurs permettent de maintenir
les bonnes températures.
„
Si une des portes est ouverte pendant plus de
3 minutes, vous pouvez entendre l’activation des
ventilateurs permettant de refroidir les ampoules.
„
Les ventilateurs changent de vitesses pour assurer des
économies d’énergie et un refroidissement optimaux.
„
Il est possible que vous entendez les ventilateurs
marcher apres avoir choisi QuickFreeze™ ou
une des fonctions de CustomCool™.
CLICS, CLAQUEMENTS,
CRAQUEMENTS et
GRÉSILLEMENTS
„
Vous pouvez entendre des craquements ou des
claquements lorsque le réfrigérateur est branché pour
la première fois. Cela se produit lorsque le réfrigérateur
se refroidit à la bonne température.
„
Les registres électroniques s’ouvrent et se ferment pour
assurer des économies d’énergie et un refroidissement
optimaux.
„
Le compresseur peut causer un clic ou un grésillement
lors de la tentative de redémarrage (cela peut prendre
5 minutes).
„
Le tableau de commande électronique peut causer
un clic lorsque les relais s’activent pour commander
les composants du réfrigérateur.
BRUITS D’EAU
„
Le passage de l’agent frigorifique dans les serpentins
de refroidissement du congélateur peut être
accompagné d’un gargouillement semblable
à celui de l’eau en ébullition.
„
L’eau tombant sur l’élément chauffant de dégivrage
peut faire un bruit de grésillement, de claquement
ou de bourdonnement pendant le cycle de dégivrage.
„
Un bruit de suintement d’eau peut être entendu
pendant le cycle de dégivrage lorsque la glace
de l’évaporateur fond et tombe dans le bac
de récupération.
„
Fermer la porte peut causer un gargouillement
en raison de l’équilibrage de pression.
„
L’expansion et la contraction des serpentins de
refroidissement pendant et après le dégivrage peuvent
causer un craquement ou un claquement.
„
Sur les modèles équipés d’une machine à glaçons,
après un cycle de fabrication de glaçons, vous pouvez
entendre les glaçons tomber dans le bac.
84
Pour obtenir plus d’information sur
les bruits normaux de fonctionnement
de la machine à glaçons et le distributeur
d’eau et de glaçons, veuillez consultez
les sections Machine à glaçons
automatique et Le distributeur
d’eau et de glaçons.
Before you call for service…
electromenagersge.ca
Conseils de dépannage–Économisez du temps et de l’argent! Consultez d’abord les tableaux qui suivent et
vous pourrez peut-être éviter de faire appel à un réparateur.
Problème
Causes possibles
Correctifs
Le réfrigérateur
ne fonctionne pas
Le cycle de dégivrage
est peut-être en cours.
• Attendez environ 30 minutes afin que le cycle de
dégivrage puisse terminer.
Les commandes de température
sont réglées sur OFF (arrêt).
• Réglez les commandes de température sur un réglage
de température.
Le réfrigérateur est débranché.
• Enfoncez la fiche de l’appareil dans la prise murale.
Le disjoncteur ou le fusible
peut avoir sauté.
• Remplacez le fusible ou réenclenchez le disjoncteur.
Le réfrigérateur se trouve
• Débranchez le réfrigérateur et rebranchez-le.
sur le mode “salle d’exposition”.
Vibration ou bruit
métallique (une légère
vibration est normale)
Le moteur fonctionne
pendant de longues
périodes ou démarre et
s’arrête fréquemment.
(Les réfrigérateurs
modernes et leurs
congélateurs étant
plus grands, leur
moteur doit fonctionner
plus longtemps. Ils
démarrent et s’arrêtent
afin de maintenir des
températures uniformes.)
Température trop élevée
dans le congélateur ou
le réfrigérateur
Givre sur les aliments
surgelés (il est normal
que du givre se forme
à l’intérieur du paquet)
Les roulettes de nivellement
avant doivent être réglées.
• Consultez Roulettes.
Ceci est normal lorsque le
• Attendez 24 heures pour que le réfrigérateur refroidisse
réfrigérateur vient d’être branché. complètement.
Une grande quantité d’aliments
a été mise au réfrigérateur.
• C’est normal.
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche
la porte de fermer.
Temps chaud ou ouverture
fréquente des portes.
• C’est normal.
Les commandes de température
ont été réglées à la température
la plus froide.
• Consultez Les commandes.
La commande de température
n’a pas été réglée à une
température assez basse.
• Consultez Les commandes.
Temps chaud ou ouverture
fréquente des portes.
• Abaissez la commande de température d’une position.
Consultez Les commandes.
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche
la porte de fermer.
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche
la porte de fermer.
Les portes ont été ouvertes
trop souvent ou pendant trop
longtemps.
La séparation entre
le réfrigérateur et le
congélateur est chaude
Le système automatique
d’économie d’énergie fait
circuler du liquide chaud autour
du rebord avant du congélateur.
• Ceci empêche la formation de condensation
sur l’extérieur du réfrigérateur.
Formation lente des
glaçons
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche
la porte de fermer.
La commande de température
du congélateur n’est pas réglée
à une température assez froide.
• Consultez Les commandes.
Le distributeur d’eau n’a pas été
utilisé depuis longtemps.
• Faites couler l’eau jusqu’à ce que l’eau du système soit
remplacée par de l’eau fraîche.
Mauvais goût/odeur
de l’eau
85
Avant d’appeler un réparateur…
Problème
Causes possibles
Correctifs
La machine à glaçons
ne fonctionne pas
L’interrupteur d’alimentation
de la machine à glaçons est
à la position d’arrêt.
• Réglez l’interrupteur d’alimentation à la position
de marche.
L’alimentation en eau est coupée • Consultez Installation de la conduite d’eau.
ou n’est pas raccordée.
Le compartiment congélateur
est trop chaud.
• Attendez 24 heures pour que la température
du réfrigérateur se stabilise.
Un amas de glaçons dans le bac
provoque l’arrêt de la machine
à glaçons.
• Nivelez les glaçons à la main.
Cubes de glace sont coincés
dans le distributeur. (La lumière
d’alimentation verte clignote).
• Débranchez le distributeur, enlevez les cubes
et rebranchez le distributeur.
Bourdonnement
fréquent
Le commutateur de marche de
la machine à glaçons est dans
la position I (marche), mais
l’arrivée d’eau au réfrigérateur
n’a pas été raccordée.
• Réglez le commutateur de marche sur la position
O (arrêt), car le garder dans la position I (marche)
endommagera le robinet d’eau.
Odeur/saveur
anormale des
glaçons
Il faut nettoyer le bac à glaçons.
• Videz et lavez le bac à glaçons. Jetez les vieux glaçons.
Des aliments ont transmis leur
odeur/goût aux glaçons.
• Emballez bien les aliments.
Il faut nettoyer l’intérieur du
réfrigérateur.
• Consultez Entretien et nettoyage.
Petits glaçons ou glaçons Le filtre à eau est bouché.
creux à l’intérieur
Le distributeur de
glaçons ne fonctionne
pas
L’eau versée dans
le premier verre est
chaude
86
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
La machine à glaçons est éteinte ou • Mettez en marche la machine à glaçons ou rétablissez
l’alimentation en eau a été coupée. l’alimentation en eau.
Un objet bloque ou est tombé
dans la chute à glace située
à l’intérieur du bac supérieur
de la porte du compartiment
congélation.
• Enlevez tout objet qui bloque ou est tombé
dans la chute.
Des glaçons sont collés au bras
régulateur.
• Retirez les glaçons.
Distributeur est VERROUILLÉ.
• Appuyez et maintenez enfoncée la touche LOCK
(réglage du verrouillage) ou LOCK CONTROLS
(verrouillage de commandes) pendant 3 secondes.
Blocs de glace irréguliers dans
le bac à glaçons.
• Brisez-en autant que possible avec vos doigts et jetez ceux
qui restent.
• Le congélateur est peut-être trop chaud. Réglez
la commande du congélateur sur une température plus
basse, en abaissant la commande d’une position à la fois
jusqu’à ce que les blocs de glace disparaissent.
Normal lorsque le réfrigérateur
est initialement installé.
• Attendez 24 heures pour que la température
du réfrigérateur se stabilise.
Le distributeur d’eau n’a pas été
utilisé depuis longtemps.
• Faites couler l’eau jusqu’à ce que l’eau du système soit
remplacée par de l’eau fraîche.
Le réservoir d’eau vient
d’être vidangé.
• Attendez plusieurs heures pour que l’eau refroidisse.
electromenagersge.ca
Problème
Causes possibles
Correctifs
Le distributeur d’eau
ne fonctionne pas
L’alimentation en eau est
coupée ou n’est pas raccordée.
Le filtre à eau est bouché.
• Consultez Installation de la conduite d’eau.
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Il y a de l’air dans la conduite
• Appuyez sur le bras de distribution pendant
d’eau.
au moins deux minutes.
Distributeur est VERROUILLÉ.
• Appuyez et maintenez enfoncée la touche LOCK
(réglage du verrouillage) ou LOCK CONTROLS
(verrouillage de commandes) pendant 3 secondes.
L’eau jaillit du distributeur La cartouche du filtre vient d’être • Faites couler l’eau du distributeur pendant 3 minutes
installée.
(environ 6 litres).
La machine à glaçons
L’eau du réservoir est gelée.
• Appelez un réparateur.
fonctionne, mais ne
Le réglage de commande est
• Réglez le commande de température sur un réglage
distribue pas d’eau
trop froid.
plus chaud.
La machine à glaçons
La conduite d’eau ou
• Appelez un plombier.
ne distribue ni eau
le robinet d’arrêt est bouché.
ni glaçons
Le filtre à eau est bouché.
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Distributeur est VERROUILLÉ.
• Appuyez et maintenez enfoncée la touche LOCK
(réglage du verrouillage) ou LOCK CONTROLS
(verrouillage de commandes) pendant 3 secondes.
CUBED (cubes de
Le réglage précédent était
• Quelques cubes sont restés et ont été concassés à cause
glace) était choisi mais
CRUSHED.
du réglage précédent. C’est normal.
CRUSHED (glace
concassée) a été
distribuée
Odeur dans
Des aliments ont transmis
• Les aliments à odeur forte doivent être emballés
le réfrigérateur
leur odeur au réfrigérateur.
hermétiquement.
• Gardez une boîte ouverte de bicarbonate de soude dans
le réfrigérateur.
Il faut nettoyer l’intérieur.
• Consultez Entretien et nettoyage.
De la condensation
Cela n’est pas inhabituel pendant • Essuyez bien la surface extérieure.
s’accumule à l’extérieur
les périodes de forte humidité.
De la condensation
Les portes sont ouvertes trop
• C’est normal pour le centre de boissons.
s’accumule à l’intérieur
fréquemment ou pendant trop
(par temps humide,
longtemps.
l’ouverture des portes
donné le taux d’humidité
• Ce phénomène est normal et son apparition sera
laisse entrer de l’humidité) Étant
plus élevé dans le compartiment
fonction des variations de la charge d’aliments et des
du réfrigérateur, il est possible
conditions ambiantes. Sécher à l’aide d’un essuie-tout
d’y déceler la présence de
si désiré.
brouillard ou de petites quantités
de buée de temps à autre.
L’éclairage intérieur
Il n’y a pas de courant au niveau • Remplacez le fusible ou réenclenchez le disjoncteur.
ne fonctionne pas
de la prise.
L’ampoule est grillée.
• Consultez Remplacement des ampoules.
•
Appel de service
Pour les feux de LED
Eau sur le sol ou au fond Il y a des glaçons bloqués dans
• Faites passer les glaçons à l’aide d’une cuillère en bois.
du congélateur
le conduit.
Air chaud à la base
Courant d’air normal provenant du moteur.
du réfrigérateur
Pendant le processus de réfrigération,
il est normal que de la chaleur soit expulsée
à la base du réfrigérateur. Certains revêtements
de sol sont sensibles et peuvent se décolorer
sous l’effet de cette température de
fonctionnement normale qui est sans danger.
Lueur orange dans
Le cycle de dégivrage est
• C’est normal.
le congélateur
en cours.
87
Avant d’appeler un réparateur…
Problème
Causes possibles
Correctifs
Le réfrigérateur
ne s’arrête jamais mais
les températures sont
normales
La fonction de dégivrage
maintient le compresseur en
marche au cours de l’ouverture
des portes.
• Ceci est normal. Le réfrigérateur passe sur cycle
d’arrêt lorsque les portes ont été fermées pendant
2 heures.
Le réfrigérateur émet
un signal sonore
La porte est ouverte.
• Fermez la porte.
Les aliments
ne se dégèlent pas/
ne se refroidissent pas
Emballage.
• Augmentez le temps ou remballez dans du plastique.
Poids erroné sélectionné.
• Sélectionnez un poids plus grand.
Article à haute teneur en gras.
• Sélectionnez un poids plus grand.
Non utilisation du plateau
Chill/Thaw (refroidissement/
dégel).
• Placez les articles sur le plateau et ménagez un espace
entre les différents articles pour assurer une meilleure
circulation d’air.
L’appareil vient d’être branché.
• Pour stabiliser le système, laissez 24 heures s’écouler.
La porte est restée ouverte trop
longtemps.
• Pour stabiliser le système, laissez 24 heures s’écouler.
Des aliments chauds ont été
placés dans le réfrigérateur.
• Pour stabiliser le système, laissez 24 heures s’écouler.
Cycle de dégivrage en cours.
• Pour stabiliser le système, laissez 24 heures s’écouler.
La commande de température
du compartiment du
réfrigérateur est placée
sur la valeur la plus élevée.
• Ceci est normal. Afin de minimiser la consommation
d’énergie, la fonction de SelectTemp (sélection de
température) et Beverage Center (centre de boissons)
est neutralisée lorsque la commande est placée sur
la valeur la plus élevée.
La température présente
n’est pas égale à celle
affichée
La commande
de SelectTemp ou
Beverage Center
(centre de boissons)
ne fonctionne pas
• Appuyez sur la touche Beverage Center
Le Beverage Center (centre de
boissons s’arrête de fonctionner
(centre de boissons) pour remettre en marche.
après six mois de fonctionnement
continu.
La porte ne se ferme
pas correctement
Lorsque la fonction
QuickFreeze est activée,
la température ambiante
dans le compartiment
congélateur peut
descendre aussi
bas que –19 °C (–3 °F)
88
Le joint de la porte du côté des
charnières est collé ou replié.
• Mettre gelée de pétrole sur le joint de la porte.
Un des contenants de porte
touche une étagère dans
le réfrigérateur.
• Remontez le contenant d’un cran.
• C’est normal.
Garantie du réfrigérateur.
Toutes les réparations en vertu de la garantie sont fournis par nos Centre
de Service d’Usine ou par un technicien autorisé Customer Care®. Pour
prévoir une réparation, consultez notre site GEAppliances.com ou appelez le
800.GE.CARE5 (800.432.2737). Veuillez avoir votre numéro de série et votre
numéro de modèle à portée de main lorsque vous appelez pour obtenir un
service. Au Canada, appelez le 800.561.3344.
Pendant la période de
garantie de :
Agrafez votre facture ici.
Pour bénéficier du service
de réparation sous garantie,
une preuve de la date d’achat
initial est nécessaire.
GE remplacera :
GE, GE PROFILE et GE Cáfe MODÈLES UNIQUEMENT :
Un An
A compter de la date d’achat
initial
Toute pièce du réfrigérateur qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée d’un an, GE fournira également
gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse.
Trente jours
Toute pièce de la cartouche filtrante qui ne fonctionne pas à cause d’un vice de matériau ou de main
(filtre à eau, si inclus) A compter de d’œuvre. Pendant la validité de la présente garantie limitée de 30 jours, GE fournira gratuitement une
la date d’achat initial
cartouche filtrante de remplacement.
GE PROFILE et GE Cáfe MODÈLES UNIQUEMENT :
Cinq Ans
Toute pièce du système fermé du réfrigérateur (compresseur, condenseur, évaporateur et tous
A compter de la date d’achat les tuyaux de raccordement) qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée de cinq an, GE fournira également
gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse dans le système fermé
du réfrigérateur.
Ce qui n’est pas couvert par GE :
■ Les déplacements à votre domicile pour vous expliquer
l’utilisation de ce produit
■ Une installation, livraison ou maintenance défectueuse.
■ Une panne du produit par abus d’utilisation, par mauvaise
utilisation, par modification ou s’il a été utilisé dans un but autre
que celui pour lequel il a été fabriqué.
■ Détérioration des aliments.
■ Le remplacement des fusibles ou le réenclenchement du
disjoncteur du domicile.
■ Les dommages à la finition, tels que rouille de surface,
ternissement ou petites taches, non signalés dans un délai de
48 heures suivant la livraison.
■ Dommages causés par l’utilisation d’un filtre qui n’est pas de
marque GE.
■ Le remplacement de la cartouche filtrante, si incluse, à cause
d’une pression d’eau en dehors de la gamme de fonctionnement
recommandée ou à cause d’une concentration excessive de
sédiments dans l’eau d’alimentation.
■ Le remplacement des ampoules, si incluses, ou la cartouche
filtrante, si incluse, et dans des conditions autres que celles
susmentionnées.
■ Tout dommage causé par accident, incendie, inondation ou une
catastrophe naturelle.
■ Tout dommage fortuit ou indirect causé par des défauts
éventuels de cet appareil.
■ Le service s’il est impossible d’avoir accès au produit.
EXCLUSION DES GARANTIES TACITES - Votre recours exclusif est l’échange du produit suivant les modalités de
la Garantie Limitée. Toutes garanties tacites, y compris les garanties de valeurs marchandes ou d’adéquation
à des fins particulières, sont limitées à une durée d’un an ou à la durée la plus courte autorisée par la loi.
Pour les clients des États-Unis : Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants
pour tout produit acheté pour une utilisation domestique aux États-Unis. Si le produit est installé dans une
région où ne se trouve aucun réparateur autorisé GE, vous devrez peut-être assumer les frais de transport ou
apporter l’appareil à un centre de service autorisé GE. En Alaska, cette garantie exclut le coût d’expédition ou de
dépannage à votre domicile.
Certains états n’acceptent pas d’exclusion ou de limites aux dommages indirects consécutifs. Certains droits
particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres droits qui
varient selon votre lieu de résidence. Pour connaître vos droits juridiques, veuillez consulter le bureau local ou le
bureau d’état des affaires aux consommateurs ou le Procureur Général de votre état.
Garant : États-Unis : General Electric Company. Louisville, KY 40225
Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants pour tout produit acheté aux
Canada pour une utilisation domestique aux Canada.Le service à domicile en vertu de la garantie sera fourni
dans les régions où il est disponible et où Mabe estime raisonnable de le fournir.
Garant Canada: MC Commercial, Burlington, Ontario, L7R 5B6
89
Données de performance
Système de Filtration à Cartouche ® MSWF
Ce système a été testé et certifié pour le modèle GE MWF conformément aux Normes NSF/ANSI n°42 et 53 pour la réduction des substances indiquées ci-dessous.
La concentration des substances indiquées dans l’eau alimentant le système a été réduite à une concentration inférieure ou égale à la limite autorisée pour l'eau
en sortie du système, telle que l’exigent les normes NSF/ANSI 42 et 53.* (Un coefficient de sécurité est ajouté au système pour les utilisations sans compteur).
Standard No. 42: Aesthetic effects
Paramètre
Chlorine Taste & Odor
Particules**
USEPA MCL
—
—
Qualité
influent Concentration
2.0 mg/L ± 10%
at least 10,000 particles/
mL
Moyenne
0.06 mg/L
408,333
Effluent
Maximum
0.10 mg/L
670,000
% Reduction
Moyenne
Maximum
97%
9.1%
95.5%
89.4%
Réduction exigeante Min.
≥ 50%
≥ 85%
% Reduction
Moyenne
Maximum
96.5%
95.4%
> 99.99%
> 99.99%
99.3%
99.3%
98.0%
95.5%
94.0%
89.6%
88.4%
73.7%
> 99.0%
> 99.0%
> 93.9%
> 94.3%
96.0%
82.0%
> 92.9%
> 92.9%
> 96.8%
> 97.0%
> 98.7%
> 98.7%
> 99.7%
> 99.8%
> 99%
> 99%
Concentration (mg/l) permise
pour l’eau le système
0.5 NTU
99.95%
0.010 mg/L
0.010 mg/L
0.002 mg/L
0.002 mg/L
0.0002 mg/L
0.003 mg/L
0.070 mg/L
0.003 mg/L
0.005 mg/L
0.040 mg/L
0.075 mg/L
99% Reduction
Standard No. 53: Health effects
Parameter
Turbidité
Spores***
Plomb au pH 6.5
Plomb au pH 8.5
Mercure at pH 6.5
Mercure at pH 8.5
Lindane
Atrazine
2, 4-D
Toxaphene
Benzene
Carbofuran
P-Dichlorobenzène
Asbestos
USEPA MCL
1 NTU****
99.95% Reduction
0.010 mg/L
0.010 mg/L
0.002 mg/L
0.002 mg/L
0.0002 mg/L
0.003 mg/L
0.070 mg/L
0.003 mg/L
0.005 mg/L
0.040 mg/L
0.075 mg/L
99% Reduction
Qualité
influent Concentration
11 ± 1 NTU****
Minimum 50,000 L
0.15 mg/L ± 10%
0.15 mg/L ± 10%
0.006 mg/L ± 10%
0.006 mg/L ± 10%
0.002 mg/L ± 10%
0.009 mg/L ± 10%
0.210 mg/L ± 10%
0.015 mg/L ± 10%
0.015 mg/L ± 10%
0.080 mg/L ± 10%
0.225 mg/L ± 10%
10 7 to 10 8 fibers/L;
fibers > 10μm in length
Effluent
Moyenne
0.38 NTU
< 1 #/L
< 1 ppb
3.1 ppb
0.34 ppb
0.66 ppb
< 0.02 ppb
< 0.5 ppb
7.7 ppb
< 1 ppb
< 0.5 ppb
< 1 ppb
< 0.5 ppb
< 0.17 MF/L
Maximum
0.5 NTU
4 #/L
< 1 ppb
9.0 ppb
0.7 ppb
1.5 ppb
< 0.02 ppb
< 0.05 ppb
35 ppb
< 1 ppb
< 0.5 ppb
1 ppb
< 0.5 ppb
< 0.17 MF/L
*Tested using pressure of 60 psig; pH of 7.5 ± 0.5; temp of 68º ± 5ºF (20º ± 2.5ºC).
**Measurement in Particles/mL. Particles used were 0.5-1 microns.
***Basé sur l’utillisation des oocystes de Cryptosporidium parvum.
****NTU=Nephelometric Turbidité Units
Capacité 300 gallons (1,135 liters). reduction de la contamination détermined par des tests NSF.
Directives d’utilisation/Paramètres de l’eau d’alimentation
Débit fourni
Alimentation en eau
0,9 gpm (3,14 lpm)
Eau potable
Pression d’alimentation
Température de l’eau
40-120 bar (40–120 lb/po²)
33ºF–100ºF (0,6ºC–38ºC)
ce produit soient respectées.
Consultez le manuel d’installation pour toute information sur la garantie
Spécifications d’utilisation
• Les substances contaminantes qui peuvent être réduites ou éliminées
par votre système de traitement d’eau ne sont pas obligatoirement présentes
dans votre eau.
Exigences d’installation / de fonctionnement/ de maintenance
• Vérifiez la conformité aux règlements et à la législation locale ou nationale.
• Il est à noter que ces essais ont été effectués dans des conditions
• Rincez la nouvelle cartouche à plein débit avec 6 litres d’eau
standards de laboratoire, la performance réelle peut varier.
(environ trois minutes) pour libérer l’air.
Les systèmes doivent être installés et utilisés conformément aux
•Remplacez la cartouche lorsque le débit devient trop faible.
procédures et directives données par le fabricant.
• Protégez contre le gel en retirant la cartouche si la température risque de
descendre en dessous de 40°F (4.4°C). N’installez pas ces systèmes dans des • L’installation et l’utilisation DOIVENT être conformes à tous les codes locaux et
nationaux de plomberie. Ne procédez pas à l’installation si la pression de l’eau
pièces où la température ambiante risque de dépasser 100°F (38°C) ou d’être
dépasse 120 lb/po². Si votre pression d’eau dépasse 80 lb/po² (552 kPa),
inférieure à 40°F (4.4°C). Ne connectez pas le système à une alimentation
il est nécessaire d’installer un système de limitation de pression.
d’eau chaude.
Contactez un plombier professionnel si n’êtes pas sûr de la méthode
Informations particulières
permettant de vérifier votre pression d’eau.
• La notice d’installation est fournie avec le produit.
• N’installez pas le système s’il y a des possibilités de coups de bélier. En cas de coup
• Le système d’eau potable doit être entretenu conformément aux instructions
de bélier, vous devez installer un dispositif anti-bélier. Contactez un plombier
du fabricant. Ceci inclut le remplacement des cartouches de filtre.
professionnel si n’êtes pas sûr de la méthode permettant de vérifier la présence
• N’utilisez jamais votre système de filtration avec une eau microbiologiquement
insalubre ou de qualité inconnue sans avoir un dispositif de désinfection adéquate
de ce problème.
en amont ou en aval de votre système. Les systèmes des spores peuvent
• Si votre système est équipé d’un dispositif anti-refoulement, un dispositif de contrôle
de pression due à la dilatation thermique doit être installé.
être utilisés sur une eau désinfectée pouvant contenir des spores filtrables.
• Pression requise : 40-120 lb/po² (2,8–8,2 bar), à l’épreuve des coups de bélier
• Température : 33–100°F (0,6–38°C)
• Débit : 0,9 gpm (3,14 lpm)
Testé et certifié par NSF International en conformité avec les normes ANSI/NSF 42 et 53 pour le modèle GE MWF pour la réduction de:
Norme n°42 : Paramètres esthétiques
Norme n°53 : Effets sur la santé
• Filtration mécanique
• Chimique
• Réduction chimique
– Réduction des particules, Class I
– Goût et odeur de chlore
– Réduction de l’atrazine
– Réduction de l’Endrine
– Réduction du benzène et du Carbofuran
– Réduction du 1,4 Dichlorobenzène et du
GE
2,4-D
– Réduction du plomb et du lindane
– Réduction du mercure et du Toxaphène
• Filtration mécanique
– Réduction des spores et de l’amiante
Appliances
Appliance Park
Louisville, KY 40225
geapplianceparts.com
REPLACEMENT
ELEMENT
© 2010 GE Company
90
PC61278B
Fiche technique de performance
Système de filtration SmartWaterMC - Cartouche MWF de GE
Données relatives au rendement
Capacité : 300 gallons (1135 litres)
/DFRQFHQWUDWLRQGHVFRQWDPLQDQWVWHVWpVSRXUFH¿OWUHGDQVO·HDXHQWUDQWGDQVOHV\VWqPHD
été réduite à une valeur inférieure ou égale à la limite admissible dans l’eau sortant du système,
FRQIRUPpPHQWDX[QRUPHVHWGHOD16)$16,/HV\VWqPHDpWpWHVWpHWFHUWL¿pSDU16)
International conformément aux normes 42 et 53 de la NSF/ANSI.
Veuillez visiter geappliances.com pour connaître la liste complète des contaminants testés et des
concentrations réduites.
Les énoncés de réduction pharmaceutiques n’ont pas été certifiés par la NSF International ou l’état de la Californie.
Énoncés éprouvés et vérifiés par un laboratoire indépendant :
Réduction
de contaminant
Aténolol
Fluoxétine
Ibuprofène
Progestérone
Triméthoprime
Moyenne pour l’eau
d’alimentation
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
Concentration d’amorce
spécifiée par NSF
N/A
N/A
N/A
N/A
N/A
Concentration
Concentration
% réduction
moyenne de
max permissible
moyenne
substance en sortie
en sortie
99.5%
5.0 ng/L
N/A
99.4%
5.4 ng/L
N/A
94.1%
52.3 ng/L
N/A
99.5%
5.0 ng/L
N/A
99.5%
2.0 ng/L
N/A
Exigences de
réduction NSF
N/A
N/A
N/A
N/A
N/A
Rapport
d’essai NSF
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Directives et paramètres de l’alimentation en eau
Débit fourni
Alimentation en eau
0.5 gpm (21.9 lpm)
Eau potable
Pression d’eau
Température de l’eau
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
Il est impératif que les méthodes d’installation, d’entretien et de remplacement du filtre recommandées par le fabricant de ce produit soient respectées.
Consultez le manuel d’installation pour connaître les renseignements de la garantie.
Remarque : Bien que les essais aient été effectués dans des conditions normales
de laboratoire, la performance actuelle peut varier.
Cartouche de rechange : MWF. Pour connaître les coûts évalués des articles de
rechange, veuillez appeler au 1-800-626-2002 ou visitez notre site internet au
www.geapplianceparts.com.
AVIS
Pour réduire le risque associé aux dommages matériels causés par des fuites d’eau :
• Lisez et suivez les instructions avant de procéder à l’installation et d’utiliser votre système.
• L’installation et l’utilisation DOIVENT être conformes à tous les codes locaux
et nationaux de plomberie.
• Ne procédez pas à l’installation si la pression de l’eau dépasse 120 lb/po² (8,2 bars).
AVERTISSEMENT
Si votre pression d’eau dépasse 80 lb/po² (552 kPa), il est nécessaire d’installer un système
Pour réduire le risqué associé à l’ingestion de contaminants :
de limitation de pression. Communiquez avec un plombier professionnel si vous n’êtes
• N’utilisez pas l’eau dont la salubrité microbiologique est inconnue ou
pas sûr de la méthode de vérification de la pression d’eau.
dangereuse sans avoir effectué une désinfection des composants d’arrivée
• N’installez pas le système s’il y a des possibilités de coups de bélier. En cas de coup
et de sortie du système. Les systèmes certifiés pour la réduction de kystes
de bélier, vous devez installer un dispositif anticoup de bélier. Communiquez avec un
peuvent être utilisés pour de l’eau désinfectée contenant des kystes filtrables.
plombier professionnel si n’êtes pas sûr de la méthode permettant de vérifier cette condition.
Établissement EPA no 10350-MN-005.
• Ne raccordez pas le système à des conduites d’alimentation d’eau chaude.
Consultez la fiche technique de performance pour connaître les conditions d’utilisation, La température de service maximale de ce système de filtre est de 38 °C (100 °F).
les énoncés de santé certifiés par le service de santé publique de la Californie et les
• Protégez le filtre contre le gel. Vidangez l’eau du filtre lorsque la température se situe
remplacements. Certification du service de santé publique de la Californie
sous 0,6 °C (33 °F).
no 05-1698. Les contaminants qui peuvent être réduits ou éliminés par ce filtre à eau • La cartouche du filtre jetable doit être remplacée tous les six (6) mois ou moins si
ne sont pas obligatoirement présents dans votre eau.
le débit d’eau du distributeur d’eau ou du distributeur de glace diminue.
ARTICLE
DE RECHANGE
Mis à l’essai et certifié par NSF International
conformément aux normes 42 et 53 de la
ANSI/NSF du modèle MWF de GE pour les
énoncés de réductions mentionnés à la
fiche technique de performance.
91
Soutien au consommateur.
Site Web appareils électroménagers GE
electromenagersge.ca
Vous avez une question ou vous avez besoin d’aide pour votre appareil électroménager? Contactez-nous par
Internet au site electromenagersge.ca, tous les jours de l’année.
Service de réparations
1.800.561.3344
Service de réparations GE est tout près de vous.
Pour faire réparer votre électroménager GE, il suffit de nous téléphoner.
Studio de conception réaliste
Sur demande, GE peut fournir une brochure sur l’aménagement d’une cuisine pour les personnes
à mobilité réduite.
Écrivez: Directeur, Relations avec les consommateurs, Mabe Canada Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Prolongation de garantie
electromenagersge.ca
Achetez un contrat d’entretien GE avant que votre garantie n’expire et bénéficiez d’un rabais substantiel.
Ainsi le service après-vente GE sera toujours là après expiration de la garantie.
Visitez notre site Web ou appelez-nous au 1.800.461.3636.
Pièces et accessoires
Ceux qui désirent réparer eux-mêmes leurs électroménagers peuvent recevoir pièces et accessoires
directement à la maison (cartes VISA, MasterCard et Discover acceptées).
Les directives stipulées dans le présent manuel peuvent être effectuées par n’importe quel utilisateur.
Les autres réparations doivent généralement être effectuées par un technicien qualifié. Soyez prudent,
car une réparation inadéquate peut affecter le fonctionnement sécuritaire de l’appareil.
Vous trouverez dans les pages jaunes de votre annuaire le numéro du Centre de service Mabe le plus proche.
Autrement, appelez-nous au 1.888.261.3055.
Contactez-nous
Si vous n’êtes pas satisfait du service après-vente dont vous avez bénéficié :
Premièrement, communiquez avec les gens qui ont réparé votre appareil.
Ensuite, si vous n’êtes toujours pas satisfait envoyez tous les détails–numéro de téléphone compris–au
Directeur, Relations avec les consommateurs, Mabe Canada Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Inscrivez votre appareil électroménager
electromenagersge.ca
Inscrivez votre appareil électroménager en direct, aussitôt que possible. Cela améliorera nos
communications et notre service après-vente. Vous pouvez également nous envoyer par la poste
le formulaire d’inscription joint à votre documentation.
92
Información de seguridad . . . . . . 94-95
Instrucciones de operación
Cuidado y limpieza del
refrigerador. . . . . . . . . . . . . . . . . . . . . . . . .109 110
ClimateKeeper2™ . . . . . . . . . . . . . . . . . . . . . . . .97
CustomCool™. . . . . . . . . . . . . . . . . . . . 98, 100
El dispensador de agua y de hielo. . . . . . 108
El dispositivo automático
para hacer hielo . . . . . . . . . . . . . . . . . . . . . . . . 107
El filtro de agua . . . . . . . . . . . . . . . . . . . . . . . . 101
ExpressChill™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . .99
Funciones Configuradas. . . . . . . . . . . . . . . . . .97
Sobre los cajones y recipientes . . . . . . . . . 105
Los controles del refrigerador . . . . . . . . . . . .96
Los entrepaños y recipientes
del refrigerador. . . . . . . . . . . . . . . . . . . . 102, 103
Puertas del refrigerador . . . . . . . . . . . . . . . . 104
Reemplazo de bombillas . . . . . . . . . . 111, 112
TurboCool™ . . . . . . . . . . . . . . . . . . . . . . . . . .97
Instrucciones de instalación
Cómo instalar el refrigerador. . . .122–125
Cómo mover el refrigerador . . . . .118–121
Instalación de la tubería de agua. . 126–128
Molduras y paneles decorativos. . . .113-116
Preparación para
instalar el refrigerador. . . . . . . . . . . . . . . . . . 117
Solucionar problemas . . . . . . . . 130–133
Sonidos normales de la operación . . . . . 129
Servicio al consumidor
Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134
Hoja de datos de funcionamiento 135, 136
Servicio al consumidor . . . . . . . . . . . . . . . . . 136
Anote aquí los números de modelo y de
serie:
No._________________________________
No._________________________________
Usted los verá en una etiqueta en el interior
del compartimiento de refrigerador en la parte
superior en el lado derecho.
93
INFORMACIONES IMPORTANTES DE SEGURIDAD.
LEA PRIMERO TODAS LAS INSTRUCCIONES.
SEGURIDAD
Sitio Web de Electrodomésticos de GE
Para más información sobre el funcionamiento de su refrigerador, visite www.
GEAppliances.com o comuníquese al 1-800-GECARES (432-2737).
INFORMACIÓN DE SEGURIDAD DEL REFRIGERADOR
Éste es el símbolo de alerta de seguridad. El mismo alerta sobre potenciales riesgos de muerte o lesiones tanto para usted
con para otras personas. Todos los mensajes de seguridad estarán a continuación del símbolo de alerta de seguridad y con la
palabra “PELIGRO”, “ADVERTENCIA” o “PRECAUCIÓN”. Estas palabras se definen como:
PELIGRO
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
ADVERTENCIA
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures graves, voire la mort. .
PRECAUCIÓN Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures mineures ou graves.
ADVERTENCIA
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
A fin de reducir el riesgo de incendio, explosión, descargas eléctricas o lesiones al usar
su refrigerador, siga estas precauciones básicas de seguridad:
„ Este refrigerador se deberá instalar y ubicar adecuadamente
de acuerdo con las Instrucciones de Instalación antes de ser
usado.
„ Desenchufe el refrigerador antes de hacer reparaciones, reemplazar
una lámpara de luz o hacer una limpieza.
Nota: La corriente que va al refrigerador no puede ser
desconectada por ninguna configuración del panel de control.
Nota: Las reparaciones deberán ser realizadas por un Profesional
del Servicio Técnico calificado.
„ Reemplace todas las piezas y paneles antes del uso.
„ No guarde ni use gasolina u otros vapores inflamables y líquidos
cerca de este u otros electrodomésticos.
„ Debido a los posibles riesgos sobre la seguridad bajo ciertas
condiciones, recomendamos enfáticamente no usar prolongadores.
Sin embargo, si se debe usar un prolongador, es absolutamente
PRECAUCIÓN
„ A fin de evitar riesgos de que los niños sufran asfixia o queden
atrapados, retire las puertas de comidas frescas y del freezer de
cualquier refrigerador antes de deshacerse o dejar de usar el
mismo.
„ No permita que los niños se trepen, paren o cuelguen de
las manijas de la puerta o de los estantes del refrigerador.
Podrían sufrir lesiones graves.
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
$¿QGHUHGXFLUHOULHVJRGHOHVLRQHVDOXVDUHOUHIULJHUDGRUVLJDHVWDVSUHFDXFLRQHVEiVLFDV
„ No limpie estantes de vidrio ni tapas con agua caliente cuando
estén fríos. Los estantes de vidrio y las tapas se pueden romper si
son expuestos a cambios de temperatura repentinos o impactos,
tales como sacudones o caídas. El vidrio templado está diseñado
para destruirse en pequeñas piezas en caso de rotura.
„ Mantenga los dedos fuera de los espacios de “riesgo de
lastimaduras”; los despejes entre las puertas y entre las puertas y el
gabinete son necesariamente pequeños. Tenga el cuidado de cerrar
las puertas cuando los niños se encuentren en el área.
94
necesario que sea un prolongador para electrodoméstico de la
lista UL (en Estados Unidos) o uno certificado por CSA (en Canadá),
de 3 cables con conexión a tierra, que cuente con un enchufe con
conexión a tierra y un tomacorriente con una graduación eléctrica
del cable de 15 amperes (mínimo) y 120 volts.
„ No toque las superficies frías del compartimiento del freezer cuando
las manos estén húmedas o mojadas, ya que la piel se podrá
adherir a estas superficies extremadamente frías.
„ No vuelva a congelar comidas que hayan estado totalmente
congeladas en forma previa.
„ En refrigeradores con máquinas de hacer hielo automáticas,
evite el contacto con las partes móviles del mecanismo
eyector o con el elemento de calefacción que libera los
cubos. No coloque los dedos ni las manos en el mecanismo
de la máquina de hielo automática mientras el refrigerador
esté enchufado.
GEAppliances.com
SEGURIDAD
(CONT.)
Riesgo de Explosión.
Mantenga cualquier material y vapores inflamables, tales como gasolina, alejados del refrigerador. Si
no se cumple con esto se podrá producir una explosión, incendio o la muerte.
ADVERTENCIA
CONEXIÓN DE LA ELECTRICIDAD
ADVERTENCIA
Riesgo de Descarga Eléctrica.
Enchufe en un tomacorriente con conexión a tierra de 3 cables.
No elimine el cable de conexión a tierra.
No use un adaptador.
Si no se siguen estas instrucciones se podrá producir a muerte, incendios o descargas eléctricas.
Nunca, bajo ninguna circunstancia, corte o elimine el tercer cable (tierra) del cable de corriente.
Para su seguridad personal, este electrodoméstico debe estar adecuadamente conectado a tierra.
El cable de corriente de este electrodoméstico contiene un
enchufe de 3 cables (conexión a tierra) que se conecta a un
tomacorriente de pared estándar de 3 cables (conexión a
tierra) para minimizar la posibilidad de riesgos de descargas
eléctricas por parte del mismo.
Se requiere un suministro eléctrico con fusible y conexión
a tierra de 115 voltios de CA, 60 Hz, 15 o 20 amperes. Esto
garantiza el mejor funcionamiento y además previene la
sobrecarga de los circuitos del hogar, lo cual podría ocasionar
riesgos de incendio debido al recalentamiento de cables.
Contrate a un electricista calificado para que controle el
tomacorriente y el circuito eléctrico, a fin de asegurar que el
enchufe esté correctamente conectado a tierra.
Nunca desenchufe el refrigerador tirando del cable de
corriente. Siempre tome su enchufe firmemente y empuje el
mismo hacia afuera para retirarlo.
En caso de contar con un tomacorriente de pared de 2 cables,
es su responsabilidad y obligación reemplazarlo por un
tomacorriente de pared de 3 cables correctamente conectado
a tierra. No use un adaptador.
Repare o reemplace de inmediato todos los cables de corriente
pelados o con cualquier tipo de daño. No use un cable con
cortaduras o abrasión sobre su extensión o extremos.
El refrigerador debería estar siempre conectado a un enchufe
específico con un índice de voltaje equivalente al que figura en
su etiqueta de características técnicas.
Al alejar el refrigerador de la pared, se deberá tener cuidado de
que no ruede sobre ni dañe el cable de corriente.
FORMA ADECUADA DE DESCARTAR SU ANTIGUO REFRIGERADOR
: Riesgo de que los niños sufran asfixia o y queden atrapados.
Retire del refrigerador las puertas de comidas frescas y del freezer, antes de descartar el refrigerador.
Si esto no se realiza, los niños podrán quedar atrapados y ocasionar la muerte o daño cerebral.
ADVERTENCIA
IMPORTANTE:
Que un niño quede atrapado o que sufra una asfixia no
son problemas del pasado. Los refrigeradores antiguos
o abandonados aún son peligrosos, incluso aunque se
conserven por “sólo unos pocos días”. Si se deshará de su
antiguo refrigerador, siga las siguientes instrucciones a fin
de evitar accidentes.
Antes de Descartar su Antiguo Refrigerador o
Freezer:
„ Retire las puertas de comidas frescas y del freezer.
„ Deje los estantes en su lugar de modo que los niños no
puedan trepar dentro con facilidad.
Refrigerantes
Todos los productos de refrigeración cuentan con
refrigerantes, que de acuerdo con la ley federal
deberán ser eliminados antes de descartar el producto.
Si se deshará de un producto de refrigeración
antiguo, consulte a la compañía a cargo sobre cómo
deshacerse del mismo.
LEA Y SIGA ESTA INFORMACIÓN DE SEGURIDAD
CUIDADOSAMENTE.
GUARDE ESTAS INSTRUCCIONES
95
Sobre los controles de temperatura.
No todas las funciones corresponden a todos los modelos. Es posible que sus controles sean similares a los siguientes:
Dispensador táctil LED de control
NOTA: El refrigerador se envía con
película protectora que cubre la
temperatura controles. Si esta película no
se ha eliminado durante la instalación,
hágalo ahora.
Dispensador táctil LED de control:
>
>
Para cambiar la temperatura, presione y suelte el TEMPERATURA
CONGELADOR / REFRIGERADOR cojín TEMP. La luz de ajuste se
encenderá y la pantalla mostrará la temperatura programada. Para
o
hasta que la
cambiar la temperatura, toque la almohadilla
temperatura deseada. Una vez que la temperatura deseada se ha
establecido, la pantalla volverá a la temperatura del refrigerador y
del congelador real después de 5 segundos. Varios ajustes que sean
necesarios. Cada vez que ajustar los controles, espere 24 horas para
que el refrigerador alcance la temperatura que ha fijado.
Los controles de temperatura puede mostrar la temperatura fijada
así como la temperatura real en el refrigerador y el congelador. La
temperatura real puede variar ligeramente de la temperatura fijada
sobre la base de condiciones de uso y funcionamiento.
Performance Air Flow System
The Performance Air-Flow System is designed to maximize
temperature control in the refrigerator and freezer
compartments. This unique special feature consists of the
Air Tower along the back wall of the refrigerator and the Air
Tunnel on the bottom portion of the freezer rear wall. Placing
food in front of the louvers on these components will not affect
performance. Although the Air Tower and the Air Tunnel can
be removed, doing so will affect temperature performance.
(For removal instructions, on-line, contact us at ge.com or call
800.GE.CARES. In Canada, contact us at geappliances.ca or call
1.800.561.3344.)
96
Los controles de temperatura fueron configurados previamente en la
fábrica en 37°F para el compartimiento del refrigerador y en 0°F para el
compartimiento del freezer. Espere 24 horas hasta que la temperatura se
estabilice hasta los ajustes de preconfiguración recomendados
„ En algunos modelos, ajustar ambos controles en la configuración más
caliente hasta que la pantalla titile (apagado) detendrá el enfriamiento en
los compartimientos del freezer y del refrigerador.
„ En algunos modelos, ajustar ambos controles en la configuración más
caliente hasta que la pantalla titile (apagado) detendrá el enfriamiento del
freezer y del refrigerador.
„ NOTA: Apagar el refrigerador a través de los controles del panel táctil no
apaga la corriente eléctrica del refrigerador.
Dispensador táctil LED de control:
>
Pulse y suelte el TEMP CONGELADOR / REFRIGERADOR cojín TEMP.
para ajustar la temperatura del congelador a 5. La
Pulse
pantalla mostrará OFF. Para activar de nuevo la unidad, pulse
el CONGELADOR TEMP / cojín TEMP FRIGORÍFICO. Pulse para
ajustar el congelador y temperaturas de refrigeración a los puntos
preestablecidos de 0 ° F (-18 ° C) para el congelador y 37 ° F (3 ° C) para
el refrigerador. Cuando la unidad se vuelve a encender, se tardará
hasta 24 horas se estabilice.
>
Los controles de temperatura fueron configurados previamente en la
fábrica en 37°F para el compartimiento del refrigerador y en 0°F para el
compartimiento del freezer. Espere 24 horas hasta que la temperatura se
estabilice hasta los ajustes de preconfiguración recomendados
Es posible que los controles de temperatura muestren la temperatura en
SET (Ajustada) y la temperatura real en el refrigerador y en el freezer. La
temperatura real puede variar levemente de la temperatura en SET (Ajustada)
en base al uso y al ambiente donde se usa.
„ En algunos modelos, ajustar ambos controles en la configuración más
caliente hasta que la pantalla titile (apagado) detendrá el enfriamiento en
los compartimientos del freezer y del refrigerador.
„ En algunos modelos, ajustar ambos controles en la configuración más
caliente hasta que la pantalla titile (apagado) detendrá el enfriamiento del
freezer y del refrigerador.
„ NOTA: Apagar el refrigerador a través de los controles del panel táctil no
apaga la corriente eléctrica del refrigerador.
NOTA: El refrigerador se envía con una envoltura que protege los controles de
temperatura. Si esta envoltura no fue retirada durante la instalación, retire la
misma ahora.
Tactile LED Dispenser Control.
Sobre las Funciones Configuradas.
Esta tecla se usa para seleccionar las siguientes funciones:
TurboCool (Turbo Frío), Quick Ice (Hielo Rápido), Door Alarm
(Alarma de la Puerta) y Water Filter (Filtro de Agua).
GEAppliances.com
Al presionar SET FEATURES (Funciones Configuradas) en forma
repetida hará un ciclo por todas las funciones disponibles y
luego abandonará el modo. Si no se presiona ninguna tecla, el
modo saldrá y volverá a exhibir las características actualmente
configuradas.
Sobre el TurboCool™
Cómo funciona
La función TurboCool™ rápidamente enfría el
compartimiento del refrigerador, a fin de enfriar
las comidas de forma más rápida. Use la función
TurboCool™ al agregar una gran cantidad de comida
al compartimiento del refrigerador, guardando las
comidas que estuvieron a temperatura ambiente o al
guardar restos de comida calientes. También se puede
usar si el refrigerador estuvo sin corriente por un período
prolongado.
OR
Una vez activado, el compresor se encenderá de
inmediato y los ventiladores se encenderán y apagarán
a alta velocidad según sea necesario durante ocho
horas. El compresor continuará funcionando hasta que
el compartimiento del refrigerador alcance un frío de
34°F (1°C); luego se encenderá y apagará para mantener
esta configuración. Luego de 8 horas, o si nuevamente se
presiona TurboCool™, el compartimiento del refrigerador
regresará a la configuración original.
Cómo Usar
Presione TurboCool™. La pantalla de temperatura de la
función TurboCool™ mostrará Tc y el LED se activará.
Una vez que el funcionamiento del TurboCool™ se haya
completado, la luz indicadora del TurboCool™ se apagará.
La temperatura del freezer no se verá afectada
durante el TurboCool™.
Cuando abra la puerta del refrigerador durante
TurboCool™, los ventiladores continuarán
funcionando si han hecho el ciclo de encendido.
Controles del Dispensador Táctil LED:
Presione SET FEATURES (Funciones
Configuradas). La pantalla de temperatura del
refrigerador exhibirá TurboCool™ y/o TC. Press
ON/OFF.
Una vez que TurboCool™ esté completo, el
compartimiento del refrigerador regresará a la
configuración original.
NOTAS:
La temperatura del refrigerador no podrá ser
modificada durante TurboCool™.
La temperatura del freezer no se ve afectada
durante TurboCool™.
Al abrir la puerta del refrigerador durante
TurboCool™, los ventiladores continuarán
funcionando si estuvieron activados.
NOTAS: La temperatura del refrigerador no se podrá
modificar cuando esté funcionando el
TurboCool™.
Sobre ClimateKeeper2™ (en algunos modelos)
Cómo Funciona
El ClimateKeeper2™ es el sistema de
refrigeración más avanzado de la industria,
brindando un funcionamiento óptimo de la
temperatura y humedad, a fin de mantener la
comida fresca durante más tiempo y de reducir
quemaduras por congelación.
El sistema ClimateKeeper2™ cuenta con dos
evaporadores; uno para el refrigerador y uno
para el freezer.
Esto provee dos sistemas de enfriamiento
separados, y separa el flujo de aire entre los
compartimientos de comida fresca y del freezer
durante operaciones de congelación normal.*
Esto asegura que los niveles de humedad
del compartimiento de comida fresca son
significativamente más altos que el sistema
convencional,** permitiendo que los productos
frescos y otras comidas no selladas retengan
su contenido de humedad y frescura por más
tiempo. Las comidas sensibles a la humedad
tales como frutas frescas, ensaladas, arroz, etc.
ahora se pueden guardar en estantes abiertos
sin pérdida excesiva de la humedad. Debido
al alto nivel de humedad en el refrigerador,
es posible que ocasionalmente se empañe o
que se produzcan pequeñas cantidades de
humedad en el compartimiento del refrigerador.
Esto es normal y puede variar dependiendo
de las cantidades de comida y condiciones
climáticas. Seque con una toalla de papel si lo
desea.
El sistema de flujo de aire separado minimiza la
mezcla de aire entre los dos compartimientos,
lo cual reduce la transferencia de olor de la
comida fresca, para mejorar el gusto del hielo.
El sistema ClimateKeeper2™ también reduce
el número de ciclos de descongelación del
evaporador del freezer, reduciendo así las
quemaduras por congelación.
*Se utiliza aire del freezer en la función
CustomCool™.
**TPruebas muestran un nivel más alto de
humedad en la sección de Comida Fresca de
refrigeradores ClimateKeeper2 con relación a
las unidades convencionales.
97
Acerca de CustomCool.™ (en algunos modelos)
Cómo funciona?
Modelos con pantalla de LCD solamente
La característica de CustomCool™ es usada para
rápidamente refrigerar artículos, descongelador alimentos
o mantener la cacerola a una temperatura específica.
Esta característica es un sistema compuesto por
un regulador de tiro, un ventilador, una resistencia variable
con la temperatura o termistor y un calentador.
La cacerola está sellada herméticamente para prevenir
fluctuaciones en la temperatura en el resto del refrigerador.
Los controles de esta cacerola se ubican sobre el
dispensador con los controles de la temperatura.
Cómo usar
Vacíe la cacerola. Coloque la bandeja de Enfriar/
Descongelar en la cacerola. Coloque los artículos en
la bandeja y cierre la cacerola por completo.
En el caso de los modelos con pantalla de LCD:
Vaya a Home, luego a Options, luego a Refrigerator
Options y por último a CustomCool ™ Pan
ExpressThaw™
(Descongelación expresa)
„ ExpressChill (Refrigeración expresa) se puede
ajustar en 15, 30 o 45 minutos. La configuración
por omisión es de 15 minutos.
„ Para detener una función antes de que se
active:
En el caso de los modelos con pantalla de LCD:
Vaya al menú de funciones y presione el botón
OFF.
Táctil LED de control del dispensador:
ExpressChill ™
(Refrigeración expresa)
98
Pulse el botón de esa característica hasta que no hay
opciones son seleccionados y la pantalla está apagada.
„ Durante ExpressThaw (Descongelación Expresa) y
ExpressChill™ (Refrigeración Expresa), la visualización
en los controles contará regresivamente el tiempo del
ciclo (en algunos modelos).
„ Después de que el ciclo ExpressThaw se complete,
la cacerola volverá al nivel MEAT (32°F [0°C]) para
ayudar a conservar los alimentos descongelados
hasta su uso.
„ La temperatura real que se muestra en la pantalla
de la cacerola de CustomCool™ puede que varíe
ligeramente en la relación a la temperatura del SET
que está basada en el uso y operación ambientales.
NOTA: Para fines de seguridad de los alimentos,
se recomienda que los alimentos se envuelvan
en envoltura plástica al usar ExpressThaw
(Descongelación expresa). Esto ayudará a retener
los jugos de las carnes y mejorar el proceso de
descongelamiento.
Sobre ExpressChill™ (en algunos modelos)
GEAppliances.com
Cómo Funciona
La función ExpressChill™ es un sistema para
humedecer, un ventilador y un termistor.
El recipiente de comida está fuertemente sellado
para evitar que éste produzcan fluctuaciones de
temperatura en el resto del refrigerador.
Los controles de este recipiente se encuentran
ubicados en la parte superior del refrigerador o en
el dispensador con los controles de temperatura.
Cómo usar
ExpressChill ™
(Refrigeración expresa)
Vacíe el recipiente. Coloque la bandeja de
Frío en el recipiente. Coloque los productos
en la bandeja y cierre el recipiente
completamente.
Seleccione la tecla ExpressChill™. En algunos
modelos, puede entonces seleccionar el
tiempo de congelación (use el cuadro para
determinar la mejor configuración). Otros
modelos sólo tendrán una opción (45
minutos). En modelos con configuraciones
múltiples, presione la tecla hasta que la luz
aparezca junto a la configuración deseada.
„ Para detener la función antes de que
finalice, presione la tecla de dicha
configuración hasta que no haya opciones
seleccionadas y la pantalla esté apagada.
„ Durante ExpressChill, la pantalla de los
controles realizará una cuenta regresiva
en el ciclo.
Cómo Retirar y Reemplazar el Cajón
Para retirar:
Empuje el cajón fuera de su posición final.
Bloquee los cuatro cierres balanceables,
rotando los mismos sobre la posición de
bloqueo.
Gire los cuatro cierres balanceables hasta la
posición de desbloqueo.
Levante la parte frontal del cajón hacia arriba
y hacia afuera.
Para reemplazar:
Asegúrese de que los cuatro cierres
balanceables se encuentren en la posición de
desbloqueo.
Coloque los lados del cajón sobre los
soportes, asegurando que los cierres
balanceables se ajusten en las ranuras del
cajón.
99
Acerca de CustomCool.™ (en algunos modelos)
Tabla para CustomCool ™
NOTA: Los resultados pueden variar dependiendo del empaque, de la temperatura inicial y otras características
de los alimentos.
ExpressThaw™
ExpressChill™
SelectTemp™
0,5 Lb. (4 horas)
„ Hamburguesas (0,5 lb)
„ Envoltura individual de filete
de miñón (0,5 lb)
15 minutos
„ 1 lata de bebida (12 onzas)
„ 2 cajas pequeñas de jugo
(6–8 onzas cada una)
Niveles para cítricos (43°F [6°C])
„ Naranjas, limones, limas, piñas, melones
„ Frijoles, pepinos, tomates, pimientos,
berenjenas, calabazas
1,0 Lb. (6 horas)
„ Pechugas de pollo (1,0 lb)
„ Carne molida (1,0 lb)
„ Bistec (1,0 lb)
2,0 Lbs. (10 horas)
„ Pechugas de pollo (2,0 lbs)
„ Carne molida (2,0 lbs)
„ Bistec (2,0 lbs)
30 minutos
„ 2–6 latas de bebida
(12 onzas cada una)
„ 2 botellas plásticas de 20 onzas
de bebida
„ 4–6 cajas pequeñas de jugo
(6–8 onzas cada una)
„ 3 Paquetes de jugo enlatado
„ Vino (botella de 750 ml)
Niveles para productos frescos (35°F [2°C])
„ Fresas, frambuesas, kiwi, peras, cerezas,
moras, uvas, ciruelas, melocotones,
manzanas
„ Espárragos, brócoli, maíz, champiñones,
espinacas, coliflor, coles, cebolla verde,
remolacha, cebolla
3,0 Lbs. (12 horas)
„ Pechugas de pollo (3,0 lbs)
„ Carne molida (3,0 lbs)
„ Bistec (3,0 lbs)
45 minutos
„ Botella de bebida de 2 litros
„ 1/2 galón de juego
„ Gelatina–1 paquete
100
Nivel para carnes (32°F [0°C])
„ Carne, pescado y pollo crudos
El filtro de agua (en algunos modelos)
GEAppliances.com
Cartucho del filtro de agua
El cartucho del filtro de agua está ubicado en la esquina superior
derecha trasera del compartimento del refrigerador.
Cuándo reemplazar el filtro en los modelos con luz
indicadora de recambio
En el dispensador hay una luz de indicación de recambio del
cartucho del filtro del agua. Esta luz se volverá anaranjada para
advertirle que necesita reemplazar el filtro pronto.
El cartucho del filtro debería reemplazarse cuando la luz
indicadora de recambio se vuelva roja o si la salida de agua al
dispensador o al dispositivo para hacer hielo disminuyera.
Soporte
del cartucho
Deje correr el agua desde el dispensador por 3 minutos
(aprox. 11ø2 galons) para aclarar el sistema y para prevenir
salpicaduras.
Presione la tecla WATER FILTER en el dispensador y manténgala
presionada durante tres segundos (en algunos modelos).
Cuándo reemplazar el filtro en los modelos sin luz
indicadora de recambio
El cartucho del filtro se debe reemplazar cada seis meses,
o antes, si disminuye el flujo de agua al dispensador o al
dispositivo para hacer hielo.
Cómo retirar el cartucho del filtro
Si está cambiando el cartucho, remueva primero el viejo
girándolo lentamente hacia la izquierda. No jale el cartucho
directamente hacia abajo. Un poco de agua puede gotear.
Instalar el cartucho del filtro
Si va a reemplazar un cartucho SmartWater con un
adaptador, debe retirar el adaptador antes de instalar
el cartucho. Para retirar el adaptador, gírelo hacia
la izquierda aproximadamente 1/4 de giro.
Si va a reemplazar un cartucho Water by Culligan, deje el
adaptador colocado. Este adaptador permanecerá en el
refrigerador cuando reemplace cartuchos en el futuro.
NOTA: Un cartucho de filtro de agua recién instalado puede
causar el agua de chorrear del dispensador.
Tapón de derivación del filtro
Se debe usar el tapón de derivación del filtro cuando un
cartucho de filtro de reemplazamiento no se puede encontrar.
El dispensador y el dispositivo para hacer hielo no pueden
funcionar sin el filtro o sin el tapón de derivación del filtro.
Tapón de
derivación
del filtro
SmartWater
Tapón de
derivación
del filtro
Water by Culligan
Para usar el tapón de derivación del filtro en los modelos Water
by Culligan, primero debe quitar el adaptador del filtro del
soporte del cartucho girándolo hacia la izquierda.
Sin adaptador
Con adaptador
(el aspecto puede variar)
Algunos modelos
cuentan con este
tipo de filtro de
agua.
En los modelos sin luz indicadora de recambio, pegue la
etiqueta con el mes y el año al nuevo cartucho para que se
recuerde de cambiar el filtro en seis meses.
Llene el cartucho de reemplazo con agua de la llave para
permitir que ocurra un mejor flujo a partir del dispensador
inmediatamente después de la instalación.
Alinee la flecha del cartucho y del soporte del cartucho.
Coloque la parte superior del nuevo cartucho hacia arriba
dentro del soporte. No empuje el cartucho hacia arriba a
dentro del soporte.
Gire el cartucho lentamente hacia la derecha hasta que el
cartucho se pare. NO APRETAR MUY FUERTE. Mientras está
girándolo, el se alzará por sí mismo en su posición. El
cartucho rotará aproximadamente 1/2 de vuelta.
Para obtener el máximo beneficio de su sistema de filtración,
GErecomienda que use los filtros de la marca SmartWater de
GEúnicamente. El uso de filtros de la marca GE en refrigeradores
GE y Hotpoint brinda un óptimo funcionamiento y confiabilidad.
Los filtros de la marca SmartWater de GE siempre son la
eleccióncorrecta, ya que están patentados y diseñados
específicamente para los productos GE. Los filtros SmartWater
de GE cumplen conrigurosos estándares NSF de la industria
sobre seguridad y calidad, que son importantes para los
productos que están filtrando su agua.GE no posee filtros de la
marca GE que no estén calificados para suuso en refrigeradores
GE y Hotpoint, y no existe seguridad de quelos filtros que no son
de la marca GE cumplan con los estándares deGE en relación a
calidad, funcionamiento y confiabilidad.
Si tiene preguntas, visite nuestro sitio web en GEAppliances.com,
o llame al 1.800.GE.CARES (1.800.432.2737).
Filtros de recambio:
Para pedir cartuchos adicionales en los Estados Unidos,
visite nuestro sitio Web, GEAppliances.com, o llame a GE para
partes y accesorios al 800.626.2002.
Consulte la etiqueta del filtro para el tipo de filtro a fin de (MWF
o MSWF)
Los clientes en Canadá deben consultar las páginas amarillas
más cercana para el Centro de Servicio de Mabe.
101
Los entrepaños y recipientes del refrigerador.
No todos los modelos tienen todas las características.
Snugger
Recipientes de puerta del refrigerador y recipientes inclinables de puerta
de congelador
Recipientes
Los recipientes de la puerta del refrigerador
y los recipientes inclinables de puerta de
congelador más grandes son ajustables.
Refrigerator bin
No bloquee
Para extraerlos: Levante la parte frontal
del recipiente hacia arriba, luego levántelo
y sáquelo.
Para reemplazarlos o reubicarlos: Ajuste la
parte trasera del recipiente en los soportes
moldeados de la puerta. Luego presione hacia
abajo en la parte frontal del recipiente. El
recipiente se ajustará
en su sitio.
Freezer tilt-out bin
Recipiente superior del congelador
NOTA: Tenga cuidado
cuando reemplace
artículos en
el recipiente superior.
Cerciórese de que
ningún artículo
bloquee o caiga en el
vertedor de hielo.
Bin congelador superior
No bloquee
La tapa deslizante ayuda a prevenir que un
golpecito haga derramarse algo o que las
cosas pequeñas guardadas en el interior del
entrepaño de la puerta se caigan o resbalen.
Ponga un dedo en cada lado de la tapa
deslizante hacia la parte trasera y muévala
hacia delante y hacia atrás para que se ajuste
a sus necesidades..
NOTA:
La pieza deberá estar
en la ubicación tal
como se muestra para
que se dispense hielo
de forma adecuada.
La comida no puede
ser guardada en esta
ubicación.
Bin congelador superior (en
algunos modelos)
Entrepaño deslizable a prueba de derramamientos
El entrepaño deslizable permite alcanzar
artículos guardados atrás de otros. Los bordes
especiales están diseñados para ayudar
a prevenir derramamientos o goteos a los
entrepaños que se encuentran más abajo.
Presione la lengüeta y jale hacia
delante del entrepaño para sacarlo.
Para sacarlos:
Deslice el entrepaño hacia fuera hasta que
llegue al punto donde se atranca, luego apriete
la lengüeta hacia abajo y deslice el entrepaño
directamente hacia fuera.
Para reemplazarlos o reubicarlos:
Sitúe el entrepaño a la altura de las guías
y deslícelo hacia su lugar. El entrepaño puede
VHUUHFRORFDGRFXDQGRODSXHUWDHVWpDÛ
o más. Para recolocar el entrepaño, deslice
el entrepaño más allá de los topes y dele un
ángulo hacia abajo. Deslice el entrepaño hacia
abajo hasta llegar a la posición deseada,
colóquelo en línea con los soportes y deslícelo
en su lugar.
Asegúrese de haber empujado los
entrepaños hasta el fondo antes de cerrar la
puerta.
Entrepaño QuickSpace™ (en algunos modelos)
Este entrepaño se divide en dos y la mitad
se desliza debajo de sí mismo para guardar
artículos muy altos ubicados en el entrepaño
que se encuentra más abajo.
Este entrepaño se puede sacar y cambiar
y también puede reubicarse igual que
los entrepaños deslizables a prueba de
derramamientos.
102
En algunos modelos, este entrepaño no puede
usarse en la posición más baja.
GEAppliances.com
No todos los modelos tienen todas las características.
Cestas de congelador
Para remover, empuje la canasta totalmente
hacia la parte posterior del congelador. Levante
hasta que los pasadores posteriores sean
desenganchados. Levante la canasta completa
hacia arriba y hacia afuera.
Asegúrese de haber empujado las cestas
hasta el fondo antes de cerrar la puerta.
Entrepaños deslizantes del congelador
Para remover, deslícelo hasta la posición tope,
levante el frente más allá de la posición de
tope, y deslícelo hacia afuera.
Asegúrese de haber empujado los
entrepaños hasta el fondo antes de cerrar la
puerta.
Entrepaños fijos del congelador
Hay dos tipos de entrepaños fijos del
congelador.
NOTA PARA LOS MODELOS CON
DISPENSADORES:
Para remover este estilo de entrepaño:
Levante el entrepaño del lado izquierdo.
Para aprovechar al máximo la inclinación para
sacar el hielo del cubo, solamente almacene
artículos en entrepaño debajo del cubo de
hielo que no sean más altos que el punto
inferior en el cubo.
Extráigalo.
Para remover este estilo de entrepaño:
Levante el lado izquierdo del entrepaño
y deslícelo hacia la izquierda en el centro
de los apoyos de los entrepaños.
Rote el lado derecho del entrepaño hacia
arriba y hacia afuera de los apoyos
de los entrepaños.
Estante de vino/bebidas en la puerta (en algunos modelos)
Este estante sostiene hasta 5 latas, una botella
de vino o una botella (2 litros) de refresco.
El estante cuelgan de los lados de la sección de
productos lácteos.
Para remover:
Vacíe el estante de vino/bebidas.
Para reemplazar:
Pegue otra vez el estante a los lados
de la sección de productos lácteos.
Encaje el lado posterior en los apoyos
moldeados en la puerta. Luego empuje
hacia abajo en el frente de la sección. La
sección encajará en su lugar.
Sosteniendo el fondo de la sección
de productos lácteos, levante el frente
directamente hacia arriba, entonces
levante y extraiga.
Para separar el estante de la sección de
productos lácteos, extraiga los alambres
laterales del estante por los agujeros en
cada lado de la sección de productos
lácteos.
103
Puertas del refrigerador.
Puertas del refrigerador
Es posible que Ud. note una diferencia entre el
manejo de las puertas de su antiguo y nuevo
refrigerador. La característica especial de
abertura y cierre de las puertas asegura que
estas cierren por completo y permanezcan
selladas firmemente.
La resistencia que Ud. puede notar en la
posición de tope de parada es menor a medida
que la puerta es cargada con alimentos.
Cuando Ud. abre o cierre las puertas, notará
una posición de tope de parada. Si la puerta es
abierta más allá de este punto, permanecerá
abierta permitiéndole así de meter y sacar
alimentos del refrigerador con más facilidad.
La puerta se cerrará automáticamente sólo
cuando está parcialmente abierta.
La puerta se cerrará automáticamente
sólo cuando está parcialmente abierta.
Más allá de la posición de tope de parada,
la puerta permanecerá abierta.
Alineación de las puertas
Si las puertas no están niveladas, ajuste
le puerta de los alimentos frescos.
Usando una llave de cubo de
7/16”, gire el tornillo de ajuste
de la puerta hacia la derecha
para elevar la puerta; gírelo hacia
la izquierda para hacerla descender. (Un
tapón de nylon está encajado
Llave de cubo de 7/16”
Levantar
104
en la rosca del pin para impedir que el
pin gire a menos de que se use
una llave.)
Después de una o dos vueltas con la
llave, abra y cierre la puerta de los
alimentos frescos y luego controle la
alineación superior de las puertas.
Sobre los cajones y recipientes.
GEAppliances.com
No todas las funciones corresponden a todos los modelos.
Cajones de Frutas y Verduras
El exceso de agua que se puede acumular en la
parte inferior de los cajones se deberá limpiar.
En algunos modelos,el cajón inferior se puede
deslizar hasta alcanzar una extensión completa
que permite un acceso completo al cajón.
HI
LO
Cajones de Humedad Ajustables
Deslice el control hasta la configuración HI
(Alto) a fin de brindar el alto nivel de humedad
recomendado para la mayoría de las verduras.
Deslice el control hasta la configuración LO
(Bajo) a fin de brindar el bajo nivel de humedad
recomendado para la mayoría de las frutas.
Recipiente de Embutidos Convertible
T
ES
LD
O
CO
LD
C
El recipiente de embutidos convertible
cuenta con su propio conducto de aire frío,
a fin de permitir que una corriente de aire
frío del compartimiento del freezer o del
compartimiento del refrigerador fluya hasta el
recipiente.
El control de temperatura variable regula
el flujo de aire de la función Climate Keeper
(Mantención del Clima).
Ajuste el control en la configuración más fría
para guardar carnes frescas.
Configure el control en frío para convertir
el recipiente a temperatura normal del
refrigerador y proveer espacio adicional para
verduras. El conducto de aire frío está apagado.
Se pueden seleccionar configuraciones
variables entre estos extremos.
Sobre cómo retirar el cajón.
No todas las funciones corresponden a todos los modelos.
Cómo Retirar el Cajón
El cajón se puede retirar fácilmente, empujando
hacia afuera y levantando el mismo en la
ubicación de detención.
Si la puerta le impide retirar los cajones,
primero intente retirar los estantes de la
puerta. Si esto no ofrece el espacio suficiente,
el refrigerador se deberá girar hacia adelante
hasta que la puerta se abra lo suficiente como
para deslizar los cajones hacia afuera. En
algunos casos, al girar el refrigerador hacia
afuera, es posible que necesite mover el mismo
hacia la izquierda o la derecha mientras lo
hace girar.
105
Acerca de la máquina automática.
Un refrigerador recién instalado puede necesitar entre 12 y 24 horas para empezar a hacer hielo.
Máquina para hacer hielo automática
La máquina de hielo producirá siete cubos
por ciclo-aproximadamente 100-130 cubos
en un período de 24 horas, dependiendo de la temperatura del
congelador, la emperatura ambiente, el número de aperturas de
puertas y las condiciones de otro uso.
Si el refrigerador se usa antes de la toma de agua se hace a la
máquina de hielo, ponga el interruptor en la posición OFF.
Cuando el refrigerador está conectado al suministro de agua,
ponga el interruptor en la posición ON.
La máquina de hacer hielo se llenará de agua cuando se enfría a
15 ° F (-10 ° C). Un refrigerador recién instalado puede necesitar
entre 12 y 24 horas para empezar a hacer hielo.
Usted escuchará un zumbido cada vez que la máquina de hielo
se llena de agua.
Nota especial sobre los modelos de dispensadores
„ Algunos modelos tienen una inclinación de hielo-un
contenedor de basura bin.The puede ser inclinado hacia
afuera como se muestra en las ilustraciones, y se sostendrá
por sí solo mientras usted extrae hielo o encienda la máquina
de hielo encienden y se apagan. Asegúrese de poner la
bandeja en su sitio antes de cerrar la puerta.
„ Para restaurar el nivel de hielo a partir de un envase vacío,
los pasos que se recomiendan las siguientes:
12 horas después de la primera tanda de hielo ha caído en
el cubo, dispensa de 3 a 4 cubos.
Después de un adicional de 6 horas, dispensa de 3 a 4
cubos de nuevo.
Estos pasos se restaurará el nivel de hielo en el menor
tiempoposible.
Deseche las primeras tandas de hielo para permitir que la línea
de agua para limpiar.
HIELO
Interruptor de
alimentación
HIELO
Asegúrese de que nada interfiera con el movimiento del brazo
detector.
Cuando el contenedor se llene al nivel del brazo de llenado, la
máquina de hielo dejará de producir hielo. Es normal que varios
cubos para unirse entre sí.
Si el hielo no se usa con frecuencia, los cubos de hielo viejos se
opacan, adquieren un sabor rancio y se contraen.
PRECAUCIÓN
Evite el contacto con las partes en
movimiento del mecanismo expulsor o con el elemento de
calefacción (ubicado en la parte inferior de la máquina de
hielos) que expulsa los cubos. No coloque los dedos ni las
manos en el mecanismo de la máquina de hielos automática
mientras el refrigerador esté enchufado.
106
Interruptor de
alimentación
Brazo
(en algunos modelos)
Luz verde de
encendido
Brazo
(en algunos modelos)
NOTA:
En los hogares con menores que la presión promedio
del agua, es posible que escuche el ciclo de máquina de
hielo varias veces al hacer un lote de hielo.
GEAppliances.com
Acceso al hielo y el logro de el interruptor de
alimentación en los modelos dispensador
Hay dos tipos de estanterías de almacenamiento de hielo en
los modelos con dispensador. Uno tiene un estante encima de
el depósito, el otro no.
Nota especial para los modelos con depósito de hielo de
inclinación de salida:
„ Estos modelos tienen un depósito de hielo de inclinación
hacia fuera. El contenedor puede ser inclinado hacia afuera
como se muestra en las ilustraciones, y se sostendrá por sí
mientras que extrae hielo o gire el interruptor de la máquina
de hielos dentro y fuera. Asegúrese de poner la bandeja en
su sitio antes de cerrar la puerta.
NOTA: ICon el fin de aprovechar al máximo el depósito de hielo de
inclinación hacia fuera, sólo artículos de la tienda en el estante debajo del
cubo de hielo que no sean más altos que el punto más bajo de la bandeja.
Los modelos con un estante encima del cubo de hielo
Estante
Estante
Cubo de hielo
Cubo de hielo
Para tener acceso al hielo, tire
hacia adelante.
Para alcanzar el interruptor de
alimentación, tire de la plataforma
en línea recta. Siempre asegúrese
de reemplazar la plataforma.
En algunos modelos, para acceder a hielo o para alcanzar
el interruptor de encendido:
Los modelos con inclinación a cabo el depósito de hielo
Para acceder a hielo y llegar al interruptor de la máquina de hielos :
Tire de la bandeja hasta que el
cubo se detenga.
Levante el cubo, entonces tírelo
hacia afuera hasta que el cubo
se detenga.
Baje la bandeja de acceso al
hielo o alcanzar el interruptor.
Baje la bandeja de acceso al
hielo o para alcanzar el
interruptor de encendido.
Remueva el cubo de hielo (modelos de dispensadores)
PRECAUCIÓN El cubo de hielo es pesado cuando está lleno.
Coloque el interruptor en la posición OFF (apagado) antes de
remover el cubo.
Cuando reemplace el cubo, cerciórese de presionarlo
firmemente en su lugar. Si no entra hasta el máximo, remuévalo
y rote el mecanismo de accionamiento con una vuelta de 1/4.
Entonces empuje el cubo hacia atrás otra vez.
Rote
Mecanismo de
accionamiento
Modelos con dispensador solamente
107
El dispensador de agua y de hielo (en algunos modelos).
Para usar el dispensador
Seleccione CUBED ICE (cubos
de hielo), CRUSHED ICE (hielo
triturado) o WATER (agua).
Presione el vaso suavemente
contra el brazo del dispensador.
El recogedor no se vacía solo.
Para evitar las manchas de
agua, el recogedor y la parrilla se
deberán limpiar regularmente.
Si no hay distribución de agua
cuando el refrigerador está
Recogedor
primeramente instalado, hay
posibilidad de aire en el sistema de la línea de agua. Oprima
el brazo del dispensador durante al menos dos minutos para
eliminar el aire atrapado de la línea de agua y llenar el sistema.
Para eliminar las impurezas de la línea de agua, deseche los
primeros seis vasos de agua.
PRECAUCIÓN
No introduzca nunca los dedos ni otros
objetos en la apertura del dispensador de hielo triturado.
Dispenser Light (Luz del dispensador)
La tecla LIGHT (Luz) enciende y apaga la luz del dispensador. La
luz también se enciende al presionar el brazo del dispensador. En
algunos modelos, Para los modelos con una bombilla, si la luz se
quema, debe ser sustituida por una bombilla de un máximo de
6 vatios 12V. Para los modelos LED, en contacto con servicio de
fábrica
Door Alarm (Alarma de puerta)
Use la alarma de la puerta para escuchar un sonido si la puerta
se queda abierta durante más de tres minutos. La alarma se
detendrá una vez que cierre la puerta. En el caso de los modelos
con pantalla de LCD, aparecerá una pantalla emergente. La alarma
se detendrá cuando toque la pantalla de LCD.
Control del Dispensador Táctil LED:
Presione la tecla SET FEATURES (Configurar Funciones) una
vez y DOOR ALARM (Alarma de la Puerta) titilará. Presione ON/
OFF (Encender/ Apagar)) y la alarma de la puerta se activará y
el icono se volverá sólido. Presione ON/OFF (Encender/ Apagar))
nuevamente para apagar la alarma.
Door Alarm (Alarma de puerta) (en
algunos modelos)
Para ajustar la alarma, presione esta tecla
hasta que la luz indicadora se encienda.
Esta alarma sonará si cualquiera de
la puerta estuviera abierta por más
de 3 minutos. La luz y el sonido cesan
automáticamente al cerrarse la puerta.
Quick Ice (Hielo rápido) (en algunos modelos)
Cuando necesite acelerar el proceso de fabricación de hielo, use la función Quick
Ice (Hielo rápido). Cuando esta función está encendida, el ventilador del freezer
funciona de manera constante durante 48 horas, o hasta que la función se
APAGA (OFF). Durante este tiempo, la fabricación de hielo aumentará hasta un
40%. Los modelos con el sistema integrado de función de hielo requieren, en el
PRIMER USO, que se dispense, como mínimo, medio vaso de 8 oz. con hielo cada 6
a 12 horas. Esto ayudará a que la máquina de hielo llene correctamente el balde y
se dispense mejor el hielo fabricado.
Cómo Usar
Control del Dispensador Táctil LED:
Presione la tecla SET FEATURES (Configurar Funciones) dos veces y
QUICK ICE (Hielo Rápido) titilará. Presione ON/OFF (Encender/ Apagar)
para encender la función, y luego una vez más para apagar la misma.
Quick Ice (Hielo Rápido) (en el modelo con Control del
Dispensador Táctil LED)
Cuando necesite hielo rápidamente,
presione esta tecla para acelerar la
producción de hielo. Esto incrementará la
producción de hielo durante las próximas
48 horas o hasta que vuelva a presionar la
tecla.
Precise Fill (Llenado Preciso) (en algunos modelos)
Control del Dispensador Táctil LED:
Presione la tecla PRECISE FILL (Llenar la Taza en Forma
Precisa/Oz). La tecla WATER (Agua) se iluminará y las teclas de
hielo CRUSHED (Picado)) y CUBED (En Cubos)) se apagarán. La
última unidad usada aparecerá en la pantalla.
Presione la tecla PRECISE FILL (Llenado Preciso) nuevamente
para alternar entre tazas y onzas.
>
108
>
Si seleccionó ONZAS, presione la tecla
o para seleccionar el número de
onzas que desea introducir entre 2 y 99 onzas. La configuración por omisión es
de 8 onzas.
>
o
para seleccionar la cantidad
Si seleccionó TAZAS, presione la tecla
que desea introducir. Las mismas se exhiben como 1/4, 1/3, 1/2, 2/3 y 3/4,
siendo la cantidad máxima 16 3/4 tazas. La configuración por omisión es de 1
taza.
>
Este dispensador de agua tiene una función que se llama “llenado preciso”.
Esta función le permite seleccionar la cantidad precisa de agua (tazas u onzas)
que desea servir. Los modelos con pantalla de LCD tienen capacidad para
medios litros y litros también.
Presione la taza contra el soporte y el agua se comenzará a verter. Se
detendrá en forma automática una vez completada la cantidad
configurada. La pantalla mostrará la cantidad de agua vertida, hará un
pitido y se reiniciará luego de 5 segundos.
NOTA: No pierda de vista el dispensador cuando se esté vertiendo agua.
Si desea que se deje de verter agua antes de que la cantidad
especificada haya sido vertida, simplemente retire la taza del soporte. La
pantalla mostrará la cantidad que se vertió durante
5 segundos. Si se presiona el interruptor para tazas nuevamente durante
ese tiempo, el dispensador continuará hasta la cantidad configurada. En
caso contrario, la pantalla regresará a la cantidad configurada.
GEAppliances.com
Datos importantes de su dispensador
„ No agregue hielo de charolas o de
bolsas en el recipiente. Podría provocar
que no salga bien o que no se triture
adecuadamente.
„ Evite los vasos demasiado llenos de hielo
y el uso de vasos estrechos o demasiado
altos. El hielo amontonado podría obstruir
el orificio o hacer que se congele la puerta
del orifico de manera que no se pueda
abrir. Si hubiera hielo bloqueándolo,
desprenda con una cuchara de madera.
„ Las bebidas y los alimentos no se deberán
enfriar rápidamente en el recipiente del
hielo. Las latas, botellas o paquetes de
comida en el recipiente de hielos podrían
causar la obstrucción del dispositivo para
hacer hielo o del recipiente.
„ Para evitar que el hielo dispensado caiga
fuera del vaso, ponga el vaso cerca, pero
sin tocar, la apertura del dispensador.
„ Un poco de hielo triturado puede surtir
aunque había seleccionado CUBED ICE
(cubos de hielo). Esto sucede en ocasiones
cuando algunos cubos se canalizan en el
triturador.
„ Después de usar hielo triturado, un poco
de agua puede gotear del vertedero.
„ A veces, se formará un pequeño montón
de nieve en la salida del hielo situada
en la puerta. Esto es normal y, por regla
general, sucede cuando ha dispensado
hielo picado repetidamente. La nieve se
evaporará por sí misma.
Cuidado y limpieza del refrigerador.
Limpiar el exterior
Área de goteo del dispensador
El pozo del dispensador, por debajo
de la parrilla, se debe mantener limpio y seco.
El agua que se queda en el pozo puede dejar
depósitos. Quite los depósitos agregando
vinagre sin diluir al pozo. Remoje hasta que
desaparezcan los depósitos o hasta que
se desprendan lo suficiente para quitarlos.
El brazo del dispensador. Antes de limpiar,
oprima y detenga la tecla LOCK (Bloqueo)
durante 3 segundos. Se limpia con
una solución de agua tibia y bicarbonato
de sodio–aproximadamente una cucharada
(15 ml) de bicarbonato de sodio por
cada cuarto (1 litro) de agua. Enjuague
completamente con agua y seque.
Las manijas de la puerta y los ornamentos.
Se limpian con un paño humedecido con
una solución de detergente suave y agua.
Seque con un paño suave.
Los puertas y las manijas de las puertas
de acero inoxidable (en algunos modelos)
pueden ser limpiados con un limpiador para
acero inoxidable para usos comerciales. Los
limpiadores con ácido oxálico tales como Bar
Keepers Friend Soft Cleanser™ eliminarán el
óxido, deslustres y pequeñas manchas. Use
sólo un limpiador líquido libre de material
abrasivo y frote en la dirección de las líneas
del cepillo con una esponja suave y húmeda.
No utilice cera para electrodomésticos sobre
el acero inoxidable.
Mantenga limpio el terminado. Limpie con
un paño limpio ligeramente humedecido
con cera para aparatos de cocina o un
detergente suave y agua. Seque y pula con
un paño limpio y suave.
No limpie el refrigerador con un paño sucio
para trastes ni con un paño húmedo. Estos
podrían dejar residuos que afecten a la
pintura. No use estropajos, limpiadores
en polvo, blanqueadores ni limpiadores
que contengan blanqueador, ya que estos
productos podrían rayar y desprender el
terminado de pintura.
109
Cuidado y limpieza del refrigerador
Limpiar el interior
Para evitar olores, deje una caja abierta de
bicarbonato de sodio en los compartimientos de
alimentos frescos y del congelador.
Desconecte el refrigerador antes de limpiarlo.
Si no fuera posible, exprima el exceso de
humedad de la esponja o del paño cuando
se limpie alrededor de botones, bombillas o
controles.
Use agua caliente y una solución de bicarbonato
de sodio–aproximadamente una cucharada (15
ml) de bicarbonato de sodio por cada cuarto (1
litro) de agua. Esta solución limpia y neutraliza
olores. Enjuague y seque.
El uso de cualquier solución de limpieza que
no sea la recomendada, especialmente aquella
que contienen destilados del petróleo, pueden
agrietar o dañar el interior del refrigerador.
PRECAUCIÓN No limpie estantes de
vidrio ni tapas con agua caliente cuando
estén fríos. Los estantes de vidrio y las
tapas se pueden romper si son expuestos
a cambios de temperatura repentinos o
impactos tales como sacudones o caídas.
El vidrio templado está diseñado para
destruirse en pequeñas piezas en caso de
rotura.
No lave ninguna parte plástica del
refrigerador en la lavadora de platos.
La bandeja de Enfriar/Descongelar se puede lavar
en el lavaplatos.
Atrás del refrigerador
Se deberá tener cuidado al retirar el
refrigerador de la pared. Todos los tipos de
recubrimiento de pisos se pueden dañar, sobre
todo los recubrimientos acojinados y los que
tienen superficies repujadas.
Al empujar el refrigerador a su lugar, asegúrese
de no pasar sobre el cable eléctrico ni sobre la
línea de alimentación del dispositivo para hacer
hielos (en algunos modelos).
Jale el refrigerador en forma recta y empuje
nuevamente para devolverlo a su posición.
Mover el refrigerador en dirección lateral puede
causar daños al recubrimiento del piso o al
refrigerador.
Preparación para vacaciones
En el caso de vacaciones o ausencias
prolongadas, quite los alimentos y desenchufe
el refrigerador. Limpie el interior con solución
de bicarbonato de una cucharada (15 ml) de
bicarbonato por un cuarto (1 litro) de agua.
Deje abiertas las puertas.
Si la temperatura pueda llegar al punto de
congelación, haya una persona calificada para
desaguar el sistema del suministro de agua
(en algunos modelos) para evitar daños a la
propiedad causados por inundación.
Coloque el interruptor de alimentación eléctrica
del dispositivo automático para hacer hielo en
la posición OFF (apagado) y cierre el suministro
de agua al refrigerador.
En caso de mudanza
Asegure todos los elementos sueltos
como entrepaños y recipientes pegándolos con
cinta adhesiva en su lugar para evitar daños.
Al usar una carretilla para mover el
refrigerador, no haga descansar la parte frontal
o trasera del refrigerador contra la carretilla.
Esto podría dañar el refrigerador. Manéjelo sólo
desde los laterales del refrigerador.
110
Asegúrese de que el refrigerador se coloque
en posición vertical durante la mudanza.
Reemplazo de bombillas (en algunos modelos)
GEAppliances.com
ADVERTENCIA
Antes de reemplazar una lámpara quemada, el refrigerador deberá ser desenchufado a fin de evitar el contacto
con el filamento de un cable con corriente. (Existe riesgo de que una lámpara quemada se rompa durante su reemplazo).
Girar el control a la posición OFF no desconecta la corriente del circuito de la luz.
Su cubierta de la luz paracerse
a una de las siguentes:
Lengüetas
O
Bolsa
&RPSDUWLPHQWRGHOUHIULJHUDGRU³/X]VXSHULRU
Desenchufe el refrigerador.
Las bombillas están situadas en la parte
superior del compartimento, dentro de la
cubierta de la luz. En algunos modelos, es
necesario retirar un tornillo de la parte
frontal de la cubierta de
la luz. En otros modelos, retirar un tornillo en
la bolsa en la parte posterior de la cubierta.
Para quitar la cubierta de la luz, en algunos
modelos, presione las lengüetas de los
lados de la cubierta y deslícelo hacia
delante y hacia atrás. On otros modelos,
sólo deslice la cubierta de la luz hacia
delante y afuera.
Después de reemplazar la bombilla con
otra bombilla de electrodomésticos del
mismo o menos vatios, reemplace el
protector de luz y el tornillo. Al reemplazar
la cubierta de la luz, asegúrese de que las
lengüetas de la parte trasera de la cubierta
quepan en las ranuras de la parte trasera
del emplazamiento de la cubierta de la luz.
Vuelva a enchufar el refrigerador a la
corriente.
&RPSDUWLPHQWRGHOUHIULJHUDGRU³/X]LQIHULRU
T
ES
LD
O
CO
LD
C
Esta luz está situada por encima de la gaveta
superior.
Desenchufe el refrigerador.
Vuelva a enchufar el refrigerador a
la corriente.
Levante la cubierta de la luz y jale de ella.
Después de reemplazar la bombilla con
una bombilla de electrodomésticos del
mismo voltaje o inferior, reemplace la
cubierta y el mango.
Compartimento del congelador
Desenchufe el refrigerador.
Retire el entrepaño justo por encima
de la cubierta de luz. (El entrepaño será
más fácil de quitar si se vacía primero.)
Remueva los tornillos de la parte superior
del protector superior.
Para quitar la cubierta, presione en los
lados y levántela hacia arriba y afuera.
Reemplace la bombilla con una bombilla
de electrodomésticos del mismo voltaje o
inferior, y reinstale la cubierta de la luz. Al
reinstalar la cubierta de la luz, asegúrese
de que las lengüetas superiores hacen
clic en su lugar de forma segura. Vuelva
a colocar el tornillo (en algunos modelos).
Vuelva a instalar el entrepaño y enchufe
el refrigerador de nuevo.
111
Reemplazo de bombillas (en algunos modelos) (Cont.)
ADVERTENCIA
Antes de reemplazar una lámpara quemada, el refrigerador deberá ser desenchufado a fin de evitar el contacto
con el filamento de un cable con corriente. (Existe riesgo de que una lámpara quemada se rompa durante su reemplazo).
Girar el control a la posición OFF no desconecta la corriente del circuito de la luz.
Dispensador (en algunos modelos)
Desenchufe el refrigerador.
La bombilla está situada en el dispensador
bajo el panel de control. Quite la bombilla
girándola en sentido contrario a las agujas
del reloj.
Cambie la bombilla por una bombilla del
mismo tamaño y voltaje.
Vuelva a enchufar el refrigerador a
la corriente.
Compartimento del refrigerador (en algunos modelos)
Pantalla con
Luz LED
Pantalla con
Luz LED
112
Hay un despliegue de luces LED en la parte
superior y los lados del compartimiento de
alimentos frescos y en la parte trasera y
laterales del compartimiento del congelador en
algunos modelos. ListenRead phonetically
Si esta asamblea debe ser sustituida, llame
al servicio de GE en el 1.800.432.2737 en los
Estados Unidos o en Canadá al 1.800.561.3344.
Molduras y paneles decorativos.
GEAppliances.com
Para los modelos “CustomStyle™”
Lea las instrucciones completamente y debidamente.
Antes de que empiece
Algunos modelos están equipados con molduras que le permiten instalar paneles en las puertas. Puede usted
ordenar los paneles decorativos precortados en negro, blanco, bisqué o de acero inoxidable en GE Parts and
Accessories (partes y accesorios), 800.626.2002 o puede añadir paneles de madera para que hagan juego con los
gabinetes de su cocina.
Paneles de menos de 1/4 ” (6 mm) de espesor
Cuando instale paneles de madera de menos de 1/4” (6 mm) de espesor, necesita crear un panel de relleno, tal como un cartón
de 1/8” (3 mm) de espesor, que se ajuste entre el frente de la puerta y el panel de madera para obtener un ajuste apropiado. Si
usted está instalando los paneles decorativos precortados, los paneles precortados de relleno se incluyen en el juego. El espesor
combinado del panel decorativo o de madera y del panel de relleno debe ser de 1/4” (6 mm).
Paneles de 1/4” (6 mm) de grosor o menos
1/4” (6 mm) Máx.
Panel de 3/4 ” (19 mm) o panel levantado
Puede utilizarse un diseño de panel levantado, atornillado o pegado a un soporte posterior de 1/4”
(6 mm) de espesor, o una tabla guía de 3/4” (19 mm). La porción levantada del panel debe fabricarse
de manera que permita un espacio de por lo menos 2” (5.1 cm) desde el lado de la manija para permitir
que entren las puntas de los dedos.
Los paneles más gruesos de 1/4” (6 mm), y hasta 3/4” (19 mm) requerirán que el perímetro de panel exterior de 5/16” (8 mm) no sea
más grueso de 1/4” (6 mm).
Limitaciones de peso para los paneles sobre medida:
Alimentos frescos 38 libras (17 kg) máximo
Puerta del congelador 28 libras (13 kg) máximo
Paneles más gruesos que 1/4” (6 mm)
Soporte posterior de 1/4” (6 mm)
de espesor
5/16” (8 mm)
1/4” (6 mm) Máx.
3/4” (19 mm)
Espacio de 2”
(5,1 cm) desde
el lado de
la manija
Panel
aparente
3/4” (19 mm)
Puerta del
refrigerador
113
Molduras y paneles decorativos. (Cont.)
23‘ Dimensiones de los paneles precortados
Las áreas superiores de los paneles necesitan recortarse.
Panel del
Paneles del
congelador
congelador
sin dispensador
con dispensador
1/8” (3 mm)
Corte
1/8” (3 mm)
Corte
Panel de los
alimentos frescos
1/8” (3 mm)
Corte
5/16”
(8 mm)
5/16”
(8 mm)
5/16”
(8 mm)
177ø8”
(45,4 cm)
679ø32”
(170,9 cm)
679ø32”
(170,9 cm)
FRENTE
FRENTE
1415ø32”
(36,8 cm)
1415ø32”
(36,8 cm)
FRENTE
1915ø32”
(49,5 cm)
335ø8”
(85,4 cm)
25‘ Dimensiones CustomStyle™ de los paneles precortados
Las áreas superiores de los paneles necesitan recortarse.
Panel del
congelador
sin dispensador
Corte
1/8” (3 mm)
Paneles del
congelador
con dispensador
Corte
1/8” (3 mm)
Panel de los
alimentos frescos
1/8” (3 mm)
5/16”
(8 mm)
5/16”
(8 mm)
17”
(43,2 cm)
69”
(175,3 cm)
FRENTE
14 ø ”
(36,8 cm)
15 32
69”
(175,3 cm)
FRENTE
1415ø32”
(36,8 cm)
361ø4”
(92,0 cm)
114
FRENTE
1915ø32”
(49,5 cm)
Corte
5/16”
(8 mm)
Cómo insertar los paneles de la puerta.
GEAppliances.com
Lea las instrucciones completamente y debidamente.
Inserte el panel del congelador y panel de los alimentos frescos.
Con cuidado empuje el panel superior del congelador
hasta que se deslice en la ranura detrás de la manija
de la puerta. Presione el panel de relleno hacia dentro
detrás del panel decorativo (esto se requiere
en algunos de los paneles para puerta). Repita
la operación para el panel de los alimentos frescos.
Si su modelo tiene un dispensador, este paso es
aplicable sólo para el panel de alimentos frescos
y el panel superior del congelador.
Inserte el panel inferior del congelador (en modelos con dispensadores).
Con cuidado presione el panel hasta que éste
se deslice en la ranura detrás de la manija de
la puerta. Presione el panel de relleno detrás
del panel decorativo (esto se requiere en algunos
de los paneles para puerta).
Sujete la moldura superior de las puertas del congelador y de los alimentos frescos.
La moldura superior puede encontrarse en el interior
del compartimento del refrigerador.
Con un Torxdriver T-20, sujete la moldura superior,
usando dos tornillos en cada parte de la moldura
superior, en la parte superior de cada puerta. Apriete
solamente con las manos. Cerciórese de que la parte
superior de cada panel ajusta cómodamente detrás de
la tapa de la moldura superior.
Tornillos de la moldura superior
Corte
Tornillos de la
moldura superior
Corte
Panel
superior del
congelador
Panel de
alimentos
frescos
Panel
inferior del
congelador
Moldura lateral
Moldura
lateral
115
Cómo insertar los paneles de la puerta. (Cont.)
Instalación de la moldura lateral.
Estas piezas quedan dentro de la manija de la puerta
de los alimentos frescos.
No retire la película protectora al exterior de
la moldura lateral sino hasta que haya quedado
instalada la moldura lateral.
Acomode la parte inferior de la moldura lateral debajo
de la moldura de la parte inferior como se ilustra.
Moldura
superior
Moldura
lateral
Moldura
lateral
Moldura inferior
116
Sujete la moldura lateral contra la cara delantera
de los paneles decorativos y sujete la moldura lateral
debajo de la moldura superior. Asegúrese de que
la moldura lateral magnéticamente pegada tenga
el relleno adecuado y que quede satisfecho con
el aspecto de todas las partes.
Instrucciones para
la Instalación
Refrigerador
Modelos 22, 23, 25, 26, 27 & 29
¿Preguntas? Llame a 800.GE.CARES (800.432.2737) o Visite nuestro sitio web en: GEAppliances.com.
En Canadá, llame al 1.800.561.3344 o Visite nuestro Sitio Web en: www.geappliances.ca
PREPARACIÓN
SUMINISTRO DE AGUA PARA LA
MÁQUINA DE HACER HIELO
ANTES DE COMENZAR
Lea estas instrucciones completamente y
cuidadosamente.
•
Si el refrigerador cuenta con una máquina de
hacer hielo, deberá ser conectada al suministro
de agua fría. Un kit de suministro de agua de GE
(que contenga tubería, válvula de cierre, uniones
e instrucciones) está disponible por un costo
adicional a nivel minorista, visitando nuestro
sitio web en GEAppliances.com (en Canadá en
www.geappliances.ca) o en Piezas y Accesorios
(Parts and Accessories), 800.626.2002 (en Canadá
1.800.661.1616).
IMPORTANTE ³&RQVHUYHHVWDV
instrucciones para uso del inspector local.
•
IMPORTANTE
³&XPSODFRQWRGRVORV
códigos y ordenanzas gubernamentales.
• Nota para el Instalador – Asegúrese de que el
Comprador conserve estas instrucciones.
• Nota para el Comprador – Conserve estas
instrucciones para referencia futura.
• Nivel de habilidad – La instalación de este
electrodoméstico requiere un nivel básico de
habilidades mecánicas.
• Tiempo de Instalación – Instalación del
Refrigerador30 minutos
– Instalación del
Suministro de Agua30
minutos
• La correcta instalación del producto es
responsabilidad del instalador.
• Si se producen fallas en el producto debido
a una instalación inadecuada la Garantía no
cubrirá las mismas.
Si el refrigerador ya fue instalado, retire la parrilla
de la base (consulte el Paso 2 en Cómo Mover el
Refrigerador), luego consulte el Paso 5 en Cómo
Instalar el Refrigerador.
HERRAMIENTAS NECESARIAS
Cubos de 3/8” y 5/16”
Llaves de 1/2” y 7/16”
Llave hexagonal de 1/8”
Espátula de Plástico
Destornillador con Cabeza Phillips
117
Instrucciones para la instalación
CÓMO MOVER EL REFRIGERADOR
1 CÓMO CARGAR EL REFRIGERADOR EN
Si el refrigerador debe pasar por alguna
entrada menor de 38” de ancho,
entonces las puertas pueden ser
removidas. Proceda al paso 3.
NO REMUEVA las manijas.
Si todas las entradas son más anchas de
38” pase a Cómo instalar el refrigerador.
UNA CARRETILLA DE MANO
Deje toda la cinta adhesiva y las almohadillas
hasta que el refrigerador llegue a su destino
final.
Para mover el refrigerador use una carretilla de
mano con almohadillas. Coloque el refrigerador
en el centro de la carretilla y asegúrelo con
un cinturón de seguridad alrededor del
refrigerador. NO LA APRIETE DEMASIADO.
3 DESCONECTE EL ACOPLAMIENTO DE
AGUA (en algunos modelos)
Si el refrigerador tiene un dispensador
de agua, eso significa que hay una línea de
agua que viene desde el gabinete hacia la
bisagra del fondo de la puerta del congelador
que debe ser desconectada.
Para desconectarla, empuje hacia adentro
sobre el collarín blanco del acoplamiento y
entonces extraiga la tubería.
Collarín blanco
2 REMUEVA LA BASE DE LA PARRILLA
Remueva la parrilla removiendo los dos
tornillos de cabeza Phillips.
Bisagra del
fondo del
congelador
118
Instrucciones para la instalación
6 CIERRE LAS PUERTAS DEL
4 DESCONECTE EL ACOPLAMIENTO
CONGELADOR Y DEL REFRIGERADOR
ENERGÉTICO (en algunos modelos)
Si el refrigerador tiene un dispensador
de agua, entonces hay una línea de suministro
eléctrico (alambrado) que va desde el gabinete
hacia la bisagra del fondo de la puerta que
debe ser desconectado.
Para desconectar, separe el acoplador.
Bisagra del
fondo del
congelador
7 REMUEVA LA PUERTA DEL
CONGELADOR
A Remueva la cubierta de la bisagra de
la puerta del congelador apretándola y
levantándola o simplemente levantándola por
uno de sus costados con una cuchilla plástica
de masilla.
5 DESCONECTE LOS CONECTADORES
ELÉCTRICOS (en algunos modelos)
Si el refrigerador tiene un centro para refrescar,
entonces hay conectadores eléctricos
(alambrados), que van desde el gabinete hasta
la bisagra del fondo del refrigerador, que deben
ser desconectados.
Para desconectar, separe cada conectador.
B Remueva los dos tornillos a la cabeza
hexagonal de 5/16,” entonces levante la
bisagra hacia arriba para liberarla del pasador
de la bisagra.
5/16” or 1/8” hex head
Bisagra del
fondo del
refrigerador
C Abra la puerta del congelador a 90.°
90°
119
Instrucciones para la instalación
CÓMO MOVER EL REFRIGERADOR (CONT.)
7 REMUEVA LA PUERTA DEL
D
8 REMUEVA LA PUERTA DEL
CONGELADOR (cont.)
REFRIGERADOR (cont.)
Mientras una persona levanta lentamente la
puerta del congelador y la libera de la bisagra
del fondo, una segunda persona debe, con
cuidado, guiar la línea de agua y la línea
energética (alambrado) a través de la bisagra
del fondo.
B Remueva los dos tornillos de cabeza hexagonal
de 5/16”, entonces levante la bisagra hacia
arriba para liberarla del pasador de la bisagra.
5/16” or 1/8” hex head
C Abra la puerta del refrigerador a 90.°
90°
E
Coloque la puerta en una superficie donde no
se ralle con la parte interna hacia arriba.
8 REMUEVA LA PUERTA DEL
90°
REFRIGERADOR
A Remueva la cubierta de la bisagra de
la puerta del refrigerador apretándola y
levantándola o levantándola por uno de sus
costados con una cuchilla plástica de masilla.
120
Instrucciones para la instalación
8 REMUEVA LA PUERTA
9 CÓMO REEMPLAZAR LAS PUERTAS
DEL REFRIGERADOR (cont.)
Para reemplazar las puertas simplemente de
reversa a los pasos del 3 al 8.
D Levante la puerta del refrigerador y libérela de
bisagra del fondo.
Si el refrigerador tiene un centro para refrescar,
una persona levanta lentamente la puerta del
congelador y la libera de la bisagra del fondo,
mientras una segunda persona, con cuidado,
guia la línea de agua y la línea energética
(alambrados) a través de la bisagra del fondo.
Sin embargo, note lo siguiente:
• Cuando se encuentre bajando las puertas
hacia la bisagra del fondo, cerciórese de
que una segunda persona guíe, con mucho
cuidado, la tubería y el alambrado a través
de los agujeros de las bisagras.
• Cuando se encuentre conectando la línea de
agua, cerciórese de insertar la tubería hasta
el máximo indicado por la marca.
90°
Marca
Modelos con Centro para Refrescar solamente
E
• No pellizque la tubería o el alambrado
mientras se encuentre remplazando las
puertas en las bisagras del fondo.
• Cuando se encuentre conectando
la línea energética, (en los modelos
con centro para refrescar solamente),
cerciórese de que los conectadores están
todos asentados juntos.
Coloque la puerta en una superficie donde no
se ralle con la parte interna hacia arriba.
121
Instrucciones para la instalación
CÓMO INSTALAR EL REFRIGERADOR
LOCALIZACIÓN DEL REFRIGERADOR
DIMENSIONES Y ESPECIFICACIONES
(de 23 ‘CustomStyle modelos ™)
• No coloque el refrigerador donde la temperatura
esté por debajo de 60° F (16° C) porque no
operará con la suficiente frecuencia como para
mantener las temperaturas apropiadas.
• No instale el refrigerador donde la temperatura
esté por encima de 100° F (37° C) porque no
funcionará apropiadamente.
• No instale el refrigerador en una ubicación
expuesta al agua (lluvia, etc.) o en contacto directo
con la luz solar.
• Instálelo en un piso suficientemente resistente
como para soportar todo su peso.
701ø4” (178.4 cm)
36”
(91.4 cm)
ESPACIO
Permita los siguientes espacios para
lograr una instalación fácil, una circulación
apropiada del aire y conexiones eléctricas
y de plomería.
Sides
Top
Back
23‘/25‘
CustomStyle™
1/8” (4 mm)
1” (25 mm)
1/2” (13 mm)
24” (61 cm)
23‘ (33” wide),
25‘, 26‘, 27‘, 29‘
1/8” (4 mm)
1” (25 mm)
1” (25 mm)
DIMENSIONES Y ESPECIFICACIONES
(de 23 ‘CustomStyle modelos ™)
DIMENSIONES Y ESPECIFICACIONES
el agua
24” (61 cm)
gabinete
eléctrica
3/4” (19 mm) del
espacio aéreo
(1/2” [13 mm] brecha
+ 1/4” [6 mm] placas
de pared)
721ø4” (183.5 cm)*
25” (63.5 cm)
mostrador
36”
(91.4 cm)
24” (61 cm)
* 72 1/4 “(183.5 cm) para un ajuste completo de las
ruedas de la movilidad. Si los gabinetes instalados
por encima del refrigerador con puertas que están
al ras de la parte superior de la apertura a la
nevera, a continuación, un adicional de 8.1 “puede
ser necesaria para proveer espacio para puertas
de armarios para abrir libremente.
122
Instrucciones para la instalación
1 CÓMO CONECTAR EL REFRIGERADOR
C Apriete la tubería en la abrazadera
proporcionada para sostenerla en su posición.
Es posible que usted necesite levantar la
abrazadera haciendo palanca.
A LA LÍNEA DE AGUA DE LA CASA
(en los modelos con máquina
de hielos y dispensador)
Abrazadera
de la tubería
Tuerca de
compresión
de 1/4”
Se requiere un suministro de agua
fría para la operación de la máquina de hielos
y el dispensador. Si no existe un suministro de
agua fría, usted necesitará hacer una. Ver la
sección Cómo instalar una línea de agua fría.
Tubería de 1/4”
Férula
(manga))
NOTAS:
• Antes de hacer la conexión, cerciórese de
que el cable eléctrico del refrigerador no esté
conectado al interruptor de la pared.
• Si el refrigerador no tiene un filtro de agua,
recomendamos que instale uno
si su suministro de agua tiene arena o
partículas que pudieran obstruir la pantalla
de la válvula de agua del refrigerador.
Instálelo en la línea de agua cerca del
refrigerador. Si usted está usando un kit de
tubería de refrigeración GE SmartConnect™,
usted necesitará una tubería adicional
(WX08X10002) para conectar el filtro. No use
tuberías plásticas para instalar
el filtro.
Si usted está usando tubería de cobre, coloque
una tuerca de compresión y un casquillo
(manga) en el extremo de la tubería que viene
del suministro de agua fría de la casa.
A Si se encuentra usando tuberías de GE
SmartConnect™, las tuercas están ya
ensambladas a la tubería.
Si está usando una tubería de cobre, inserte
el extremo de la tubería en la conexión
del refrigerador, en la parte posterior del
refrigerador, hasta donde sea posible. Mientras
sostiene la tubería, apriete el accesorio.
B Si se encuentra usando tuberías de GE
SmartConnect™, inserte el extremo moldeado
de la tubería en la conexión del refrigerador en
la parte posterior del refrigerador, y apriete la
tuerca de compresión hasta que esté apretada
a mano. Entonces apriete una vuelta adicional
con una llave. Si la aprieta demasiado causará
fugas.
Conexión del
refrigerador
Tubería SmartConnect™
Opción 2
2 ACTIVE LA CONEXIÓN DE AGUA
Haga pasar la corriente de agua en la válvula
de cierre (el suministro de agua de la casa) e
inspeccione en busca de fugas.
3 CONECTE EL REFRIGERADOR
Antes del conectar el refrigerador cerciórese de
que el interruptor de la máquina de hielos está
colocada en la posición OFF (apagado).
Ver la información adjunta sobre la conexión a
tierra del cable eléctrico.
123
Instrucciones para la instalación
CÓMO INSTALAR EL REFRIGERADOR (CONT.)
5 CÓMO NIVELAR EL
4 COLOQUE EL REFRIGERADOR EN SU
REFRI GERAD O R (cont.)
LUGAR
Para ajustar las ruedas en 23 ‘/ 25’ CustomStyle
modelos ™ :
Mueva el refrigerador a su destino final.
Gire el rodillo delantero
tornillos de ajuste
hacia la derecha
para aumentar la
el refrigerador, a la
izquierda para bajarlo.
Rodillo de los tornillos de
El uso de 3 / 8 “llave
hexagonal con extensión o ajuste
una llave ajustable.
Estos modelos también tienen rodillos ajustables
posteriores para que pueda alinear el refrigerador
con los gabinetes de su cocina. El uso de 3 /
8 “llave hexagonal con extensión para girar
los tornillos de la parte trasera rodillos hacia
la izquierda para levantar el refrigerador, a la
izquierda para bajarlo.
5 CÓMO NIVELAR EL REFRIGERADOR
El refrigerador puede nivelarse ajustando
los rodillos localizados cerca de las bisagras
inferiores.
Rodillos
6 NIVELES LAS PUERTAS
Levante
Los rodillos tienen tres propósitos:
• Los rodillos se ajustan para que la puerta
cierre con facilidad cuando
esté medio abierta. (Levante el frente
aproximadamente 5/8” [16 mm]
del piso.)
• Los rodillos se ajustan para que el
refrigerador esté colocado firmemente en el
piso y no tambalee.
• Los rodillos se ajustan para que el
refrigerador pueda ser alejado de la pared en
momentos de limpieza.
Ajuste la puerta del refrigerador para que las
puertas estén niveladas en la parte superior.
Para linear:
A Usando una llave de 7/16”, gire el tornillo ajustable
de la puerta hacia la derecha para levantar la
puerta, y a la izquierda para bajarla.
NOTA:
Un tapón de nilón, empotrado en las roscas del
pasador, evita que el pasador gire a no ser que se
use una llave.
B Después de una o dos vueltas de la llave, abra y
cierre la puerta del refrigerador y cerciórese de que
están alineadas en la parte superior.
Para ajustar los rodillos:
• Gire los tornillos de ajuste del rodillo en
sentido de las agujas
del reloj para levantar
el refrigerador, y en
contra de las agujas
del reloj para bajarlo.
Use una llave o un cubo
de cabeza hexagonal
de 3/8” o una llave
ajustable.
Las puertas deben estar alineadas en
la parte superior
Levantar
Llave de 7/16”
Tornillo de ajuste del
rodillo
124
Installation Instructions
7 REEMPLACE LA PARRILLA
9 INICIE LA MÁQUINA DE HIELOS
DE LA BASE
Fije el interruptor de la máquina de hielos
en la posición ON (encendido). La máquina
de hielos no empezará a operar hasta que
alcance su temperatura de operación de
15° F (–9° C) o menor. Luego, empezará a operar
automáticamente. Será necesario de 2 a 3 días
para que se llene el cubo de hielo.
Reemplace la parrilla de la base instalando los
dos tornillos de cabeza Phillips.
Interruptor de
encendido
Interruptor de
encendido
8 AJUSTE LOS CONTROLES
Ajuste los controles donde se recomienda.
NOTA:
En condiciones de menor presión de agua, el
agua válvula puede encenderse hasta 3 veces
para suministrar suficiente agua para la máquina
de hielo.
125
Installation Instructions
CÓMO INSTALAR LA LÍNEA DE AGUA
(EN MODELOS CON MÁQUINA DE HIELOS Y DISPENSADOR)
LO QUE USTED NECESITARÁ
ANTES DE COMENZAR
Los kits de cobre recomendados para el suministro de agua
son WX8X2, WX8X3 o WX8X4, dependiendo de la cantidad
de tubería necesaria. Las tuberías plásticas aprobadas para
el suministro de agua son las tuberías para el refrigerador
SmartConnect™ de GE (WX08X10006, WX08X10015 y
WX08X10025).
Cuando se encuentre conectado el refrigerador a un Sistema
de Osmosis de agua reverso de GE, el único kit de instalación
aprobado es el RVKit. Para otros sistemas de osmosis de
agua reversos, siga las instrucciones en el manual del
fabricante.
Si el suministro de agua del refrigerador es de un Sistema
de Filtración de Osmosis de Agua Reverso Y el refrigerador
también tiene un filtro de agua, use el tapón de bypass
del filtración. Usar el cartucho de filtración de agua del
refrigerador además del filtro RO podría resultar en la
formación de cubos de hielo huecos y en un flujo de agua
más lento a partir del dispensador de agua.
Esta instalación de la línea de agua no está garantizada por
el fabricante del refrigerador o
de la máquina de hielos. Siga estas instrucciones
cuidadosamente para minimizar el riesgo de daños
causados por el agua que puedan ser costosos.
Martilleo de agua (agua golpeando en las tuberías)
en la plomería de la casa podría dañar las partes
del refrigerador y traer consigo fugas de agua e inundación.
Llame a un plomero calificado para que corrija este
problema de martilleo antes de instalar la línea de suministro
de agua hacia el refrigerador.
Para evitar quemaduras y daños al producto, no conecte la
línea de agua fría con la línea de agua caliente.
Si usted usa su refrigerador antes de conectar la
línea de agua, cerciórese de que el interruptor de la máquina
de hielos está en la posición OFF (apagado).
No instale la tubería de la máquina de hielos en
áreas donde la temperatura baja por debajo de la
temperatura de congelamiento.
Cuando use cualquier dispositivo eléctrico (como
una taladradora, por ejemplo), durante la instalación,
cerciórese de que tal dispositivo esté aislado doblemente o
conectado a tierra de forma tal
que se evite el peligro de electrocución, u operado
por batería.
Todas las instalaciones deben ser hechas de acuerdo con los
códigos y requisitos locales e plomería.
• El kit de cobre o de tubería de refrigeración o
GE SmartConnect™, de 1/4” de diámetro para
conectar el suministro de agua al refrigerador. Si
se encuentra usando un kit de tuberías de cobre,
cerciórese de que ambos extremos de la tubería
son cuadrados.
Para determinar cuánta tubería necesitará: mida
la distancia desde la válvula de agua hasta la
parte posterior del refrigerador hasta el tubo de
suministro de agua. Cerciórese de que existe
suficiente tubería adicional para permitir el
movimiento a partir de la pared.
Los kits GE SmartConnect™ de tubería de
refrigerador están disponibles en las longitudes
siguientes:
8’ (2,4 m) – WX08X10006
15’ (4,6 m) – WX08X10015
25’ (7,6 m) – WX08X10025
126
Instrucciones para la instalación
LO QUE USTED NECESITARÁ (CONT.)
Instale la válvula de cierre en la línea de agua de
tomar más cercana
NOTA: La única tubería plástica aprobada por GE es
la que proporcionamos con el Kit SmartConnect™ para
refrigeradores. No use ninguna otra tubería plástica
para el suministro porque la línea estará bajo presión
en todo momento. Ciertos tipos de tuberías plásticas se romperán
y al pasar el tiempo desarrollarán grietas y el agua podría causar
daños a la casa.
• Un kit de suministro de agua GE (contiene tubería, válvula de
cierre y el accesorio mostrado más adelante) está disponible
a un costo adicional si se pone en contacto con su distribuidor
o con Partes y Accesorios llamándonos al 800.626.2002 (en
Canadá 1.800.661.1616).
• Un suministro de agua caliente. La
presión del agua debe ser de entre 20 y
120 p.s.i. (1,4–8,1 bar).
• Taladradora eléctrica
• Llave ajustable o llave de 1/2”.
• Destornilladores planos y Phillips.
1 CIERRE EL SUMINISTRO DE AGUA
PRINCIPAL
Abra el grifo más cercano lo suficiente como
para aclarar la línea de agua.
2 ESCOJA LA LOCALIZACIÓN DE LA
VÁLVULA
Escoja una localización para la válvula
de fácil acceso. Es mejor conectarla a un costado
de una tubería vertical. Cuando sea necesario
conectarlo en una línea horizontal, cerciórese de
que la conexión sea hecha en la parte superior
o en el lado, en vez del fondo, para evitar la
acumulación de sedimentos de la línea de agua.
• Dos tuercas de compresión de diámetro externo de 1/4” y 2
casquillos³SDUDFRQHFWDUODWXEHUtDGHFREUH
a la válvula de cierre y a la válvula de agua del refrigerador.
O
• Si se encuentra usando un kit SmartConnect™
de GE, los accesorios necesarios están
preensamblados con la tubería.
• Si su línea de agua de cobre existente es ensanchada en
el extremo, usted necesitará un adaptador (disponible en
las tiendas de plomería) o conecte la línea de agua con el
refrigerador O usted puede cortar la parte ensanchada del
extremo del tubo con un cortador de tubos y entonces usar un
accesorio de compresión. No corte un extremo formado por GE
SmartConnect™ de la tubería del refrigerador.
3 TALADRE UN AGUJERO PARA LA
VÁLVULA
Taladre un agujero de 1/4” en la tubería
de agua (aun si está usando una válvula
autoperforadora), usando una broca filosa.
Remueva cualquier rebaba que haya resultado
del taladrado del agujero en la tubería.
Tenga cuidado de no permitir que el agua drene
hacia el agujero.
• Válvula de cierre para conectar la línea de agua fría.
La válvula de cierre debe tener una entrada de agua
con un diámetro interno mínimo de 5/32” en el punto de
conexión a la LÍNEA DE AGUA FRÍA. Válvulas de cierre tipo
corona están incluidas en muchos kits de suministro de agua.
Antes de comprar, cerciórese de que la válvula tipo corona
cumple con los códigos de plomería de su localidad.
No hacer un agujero de 1/4” podría resultar en
una producción de agua reducida o en cubos de
hielo menores.
127
Instrucciones para la instalación
CÓMO INSTALAR LA LÍNEA DE AGUA (CONT.)
4 APRIETE LA VÁLVULA DE CIERRE
7 CÓMO CONECTAR LA TUBERÍA A LA
VÁLVULA
Apriete la válvula de cierre a la tubería de agua
fría con una abrazadera de tubo.
Coloque la tuerca de compresión y el casquillo
para tubería de cobre en el extremo de la tubería y
conéctela con la válvula cierre.
Cerciórese de que la tubería está insertada
completamente en la válvula. Apriete la tuerca de
compresión con seguridad.
Para tuberías plásticas de un kit de tubería para
refrigeradores SmartConnect™ GE, inserte el
extremo moldeado de la tubería en una válvula
de cierre y apriete la tuerca de compresión hasta
que quede apretada a mano, entonces apriétela
una vuelta adicional con la llave. Si la aprieta
demasiado, causará fugas.
Abrazadera de tubo
Válvula de cierre
tipo corona
Tubería de agua fría
vertical
NOTA: Los códigos de plomería del estado de
Massachusetts 248CMR deben ser obedecidos.
Las válvulas de corona son ilegales y su uso
no es permitido en Massachusetts. Póngase en
contacto con un plomero licenciado.
Válvula de cierre
tipo corona
Tuerca de compresión
Tubería
SmartConnect™
5 APRIETE LA ABRAZADERA DE TUBO
Tuerca de cruz
Apriete los tornillos de la abrazadera hasta que
la arandela de sello comience a ensancharse.
NOTA: No la apriete demasiado o podría romper
la tubería.
Arandela
Abrazadera
de la tubería
Tornillo de
la abrazadera
Válvula de salida
Casquillo (manga)
NOTA: Los códigos de plomería del estado de
Massachusetts 248CMR deben ser obedecidos.
Las válvulas de corona son ilegales y su uso no es
permitido en Massachusetts. Póngase en contacto
con un plomero licenciado.
Extremo de
entrada
8 ENJUAGUE LA TUBERÍA
Abra el suministro principal de agua y enjuague la
tubería hasta que el agua esté totalmente limpia.
Cierre el suministro de agua en la válvula de agua
cuando aproximadamente un cuarto(1 litro) haya
salido a través de la tubería durante el enjuague.
6 CÓMO ORIENTAR LA TUBERÍA
Oriente la tubería entre la línea de agua fría y el
refrigerador.
Oriente la tubería a través de un agujero
taladrado en la pared on en el piso (detrás
del refrigerador o en la base de una gabinete
adyacente) tan cercano a la pared como sea
posible.
NOTA: Cerciórese de que existe suficiente tubería
adicional para permitir que el refrigerador se
mueva de la pared después de la instalación.
Para completar la instalación del refrigerador, regrese al
Paso 1 en Cómo instalar el refrigerador.
128
Sonidos normales de operación.
GEAppliances.com
Los refrigeradores más nuevos producen sonidos diferentes a los
modelos más antiguos. Los refrigeradores modernos tienen más
funciones y usan tecnología más reciente.
¿Usted escucha lo que yo escucho? Estos sonidos son normales.
HUMMM...
WHOOSH...
„ El nuevo compresor de alta eficiencia puede funcionar
más rápido y durar más que el de su refrigerador
anterior y puede escuchar un zumbido de tono alto o
un sonido pulsante mientras opera.
„ A veces el refrigerador funciona por un período
prolongado, especialmente cuando las puertas se
abren continuamente. Esto significa que la función
Frost Guard ™ está en operación para impedir que el
congelador se queme y mejorar la preservación
de los alimentos.
„ Puede escuchar un sonido de soplido cuando las
puertas se cierran. Esto se debe a que la presión se está
estabilizando dentro del refrigerador.
CHASQUIDOS, ESTALLIDOS,
CRUJIDO, GORJEOS
„ Puede escuchar sonidos como de crujido o
estallidos cuando el refrigerador se conecta por
primera vez. Esto pasa a medida que el refrigerador se
enfría hasta la temperatura correcta.
„ Los reguladores electrónicos se abren y se cierran para
ofrecer un enfriamiento óptimo y ahorrar energía.
„ El compresor puede causar un chasquido o un gorjeo
cuando intenta volver a arrancar (esto
puede tomar hasta 5 minutos).
„ El tablero de control electrónico puede causar
un sonido de chasquido cuando se activa el relé
para controlar los componentes del refrigerador.
„ Expansión y contracción de las bobinas durante
o después del ciclo de descongelación puede
causar sonidos como de crujido o estallidos.
„ En modelos con dispositivo de hielo, después
de completar un ciclo de hacer hielo, se pueden
escuchar los cubos de hielo cuando caen a la
bandeja de hielos.
¡WHIR!
„ Puede escuchar los ventiladores moviéndose a
gran velocidad. Esto pasa cuando el refrigerador se
conecta por primera vez, cuando las puertas se abren
frecuentemente o cuando se guarda gran cantidad de
alimentos en el refrigerador o en los compartimientos
del congelador. Los ventiladores están ayudando a
mantener las temperaturas correctas.
„ Si cualquiera de las puertas permanece abierta por
más de 3 minutos, puede escuchar los ventiladores
para enfriar los focos de luz.
„ Los ventiladores cambian la velocidad para suministrar
enfriamiento óptimo y ahorrar energía.
SONIDOS DE AGUA
„ El fluido del refrigerante a través de las bobinas
puede producir un sonido de borboteo como de agua
hirviendo.
„ El agua que cae en el calentador de descongelación
puede causar un chisporroteo, estallido o zumbido
durante el ciclo de descongelación.
„ Un ruido de agua cayendo se puede escuchar durante
el ciclo de descongelación a medida que el hielo se
derrite del evaporador y fluye hacia la bandeja de
drenaje.
„ El cierre de las puertas puede producir un sonido de
gorgoteo debido a la estabilización de la presión.
Para información adicional acerca de los
sonidos de operación de los dispositivos
de hielo o de los dispensadores, ver las
secciones Acerca del dispositivo automático
para hacer hielo y Acerca del dispensador
de hielo y agua.
129
Antes de solicitar un servicio…
Solucionar problemas ¡Ahorre tiempo y dinero! Revise las tablas en las siguientes páginas y tal vez no
necesitará de solicitar un servicio.
Problema
Causas Posibles
Qué hacer
El refrigerador no
funciona
Refrigerador en ciclo de
descongelar.
• Espere 30 minutos para que la descongelación se
termine.
Controles de temperatura
en posición OFF (apagado).
• Mueva los controles de temperatura hasta un ajuste
inferior de temperatura.
El refrigerador esté
desconectado.
• Empuje la clavija completamente en el enchufe.
Fusible fundido/
interruptor de circuito roto.
• Reemplace el fusible o reajuste el interruptor.
El refrigerador está en la
condición de exhibición.
• Desconecte el refrigerador y conéctelo otra vez.
Vibraciones o sacudidas Los rodillos requieren
(una vibración ligera
un ajuste.
es normal)
• Vea Rodillos.
El motor opera durante
períodos prolongados o
se arranca y se para con
frecuencia. (Refrigeradores
modernos con más espacio
de almacenamiento y un
congelador más grande
requieren más tiempo de
operación. Se arrancan y
se paran a para
mantener temperaturas
uniformes.)
Es normal cuando
el refrigerador es recién
instalado en su casa.
• Espere 24 horas para que el refrigerador se enfríe
completamente.
Ocurre cuando hay largas
cantidades de alimentos
en el refrigerador.
• Eso es normal.
Se dejó abierta la puerta.
• Revise si un paquete mantiene la puerta abierta.
Clima caluroso o aperturas
frecuentes de la puerta.
• Eso es normal.
Controles de temperatura
ajustados al punto más
frío.
• Vea Los controles.
El control de temperatura
no se fijó bastante frío.
• Vea Los controles.
Clima caluroso o aperturas
frecuentes de la puerta.
• Fije el control de temperatura un paso más frío.
Vea Los controles.
Se dejó abierta la puerta.
• Revise si hay un paquete que mantiene la puerta abierta.
Escarcha o cristales
de hielo en alimentos
congelados (escarcha
en paquete es normal)
Se dejó abierta la puerta.
• Revise si hay un paquete que mantiene la puerta abierta.
El divisor entre el
compartimiento de
refrigerador y el
congelador se siente tibio
Ahorro automático de energía
circula líquido tibio en la
frente del congelador.
• Eso ayuda prevenir la condensación en el exterior.
Los cubos tienen mal
olor/sabor
El recipiente para los
cubos necesita limpieza.
Alimentos transmitiendo
olor/sabor a los cubos.
El interior del refrigerador
requiere limpieza.
• Vacíe y limpie el recipiente. Deseche los cubos.
Compartimiento de
refrigerador o
congelador demasiado
cálido
130
La puerta se abre con frecuencia
o por mucho tiempo.
• Envuelva bien los alimentos.
• Vea Cuidado y limpieza.
GEAppliances.com
Problema
Causas Posibles
Qué hacer
Dispositivo automático
para hacer hielo no
funciona
El interruptor de alimentación
eléctrica del dispositivo
automático para hacer
hielo está en la posición
OFF (apagado).
• Coloque el interruptor de alimentación
eléctrica en la posición ON (encendido).
El agua está cerrada o no está
conectada.
• Vea Instalar la línea de agua.
El compartimiento del
congelador es muy cálido.
• Espere 24 horas para que se enfríe el refrigerador.
Cubos apilados en el recipiente
apaga el dispositivo para hacer
hielo.
• Nivele los cubos con la mano.
Cubos de hielo atorados en
dispositivo para hacer hielo.
• Apague el dispositivo de hielo, retire los cubos y vuelva a
poner el dispositivo en marcha.
Se dejó abierta la puerta.
• Revise si hay un paquete que mantiene la puerta abierta.
El control de temperatura
no es bastante frío.
• Vea Los controles.
Formación lenta del hielo
Cubos pequeños o huecos Filtro de agua tapado.
• Reemplace el cartucho del filtro con uno nuevo o
con el tapón.
El dispensador de hielo
no funciona (en algunos
modelos)
Dispositivo de hielo apagado
o el agua está apagado.
• Enciende el dispositivo de hielo o el agua.
Los cubos están pegados
al brazo detector.
• Remueve los cubos.
Un artículo está bloqueando o se • Remueva cualquier artículo que pueda estar
ha caído dentro del vertedor de
bloqueando, o que se haya caído dentro del vertedor.
hielo dentro de la sección del
congelador de la puerta superior.
Bloques irregulares de
hielo en el recipiente.
• Rómpalos con los dedos y deseche los cubos restantes.
• El congelador puede ser muy caliente. Ajuste el control a
una posición más fría paso por paso hasta que no se
formen bloques.
El dispensador está
BLOQUEADO (LOCKED).
• Presione la tecla LOCK (bloqueo) y manténgala
presionada durante tres segundos.
El agua tiene un
sabor/olor malo
(en algunos modelos)
El dispensador de agua no
se uso por mucho tiempo.
• Dispense el agua hasta que todo el sistema del agua se
llene de nuevo.
El agua en el primer
vaso está tibia
(en algunos modelos)
Eso es normal con un
refrigerador recién instalado.
• Espere 24 horas para que se enfríe el refrigerador.
El dispensador de agua no
se uso por mucho tiempo.
• Dispense el agua hasta que todo el sistema del agua se
llene de nuevo.
El sistema de agua se ha
desaguado.
• Espere algunas horas para que se enfríe el agua.
131
Antes de solicitar un servicio…
Problema
Causas Posibles
Qué hacer
El dispensador de agua
no funciona
(en algunos modelos)
Suministro de agua
apagado o no conectado.
• Vea Instalar la línea de agua.
Filtro de agua tapado.
• Reemplace el cartucho del filtro o remueve el filtro
y instale el tapón.
Aire atrapado en el sistema
del agua.
• Presione el brazo del dispensador por un par de
minutos.
El dispensador está
BLOQUEADO (LOCKED).
• Presione la tecla LOCK (bloqueo) y manténgala
presionada durante tres segundos.
Se seleccionó CUBED ICE La última selección fue
(HIELO EN CUBOS) pero
CRUSHED ICE (HIELO PICADO).
se dispensó CRUSHED ICE
(Hielo picado) (en algunos
modelos)
• Se quedaron unos cuantos cubos en el triturador de la
selección anterior. Esto es normal.
No sale agua pero el
dispositivo (en algunos
modelos) para hacer
hielo funciona
El agua en el depósito está
congelada.
• Llame para servicio.
El control de temperatura
demasiado frío.
• Fije el control de temperatura hasta mas cálido.
El agua chorrea del
dispensador
Cartucho del filtro recién
instalado.
• Deje correr el agua desde el dipensador por 3 minutos
(aprox. 11ø2 galóns).
No sale agua y el
dispositivo para hacer
hielo no funciona
Está tapada la línea de agua
o la llave de paso.
• Llame a un plomero.
Filtro de agua tapado.
• Reemplace el cartucho del filtro o remueve el filtro
y instale el tapón.
El dispensador está
BLOQUEADO (LOCKED)
• Presione la tecla LOCK (bloqueo) y manténgala
presionada durante tres segundos.
Alimentos transmitiendo
olores al refrigerador.
• Alimentos con olores fuertes deben estar tapados.
• Guarde una caja de bicarbonato de sodio en el
refrigerador; cámbiela cada tres meses.
El interior requiere
limpieza.
• Vea Cuidado y limpieza.
El refrigerador huele
Aire caliente a la base
del refrigerador
El aire fluye para enfriar el motor.
En el proceso de refrigeración
es normal que salga calor de la
base del refrigerador. Algunos
recubrimientos de piso estan
sensitivos y se descoloran a
estas temperaturas normales
y seguras.
Brillo anaranjado
en el congelador
Calefactor de descongelación
encendido.
• Eso es normal.
El refrigerador nunca
se apaga pero las
temperaturas están bien
El sistema de congelación
mantiene al compresor
funcionando durante la
puerta está siendo abierta.
• Esto es normal. El refrigerador se apagará si la
puerta permanece cerrada por 2 horas.
La puerta no se cierre
correctamente
El sello de la puerta en el lado de • Aplique parafina en la superficie frontal de la junta.
la bisagra está pegado o doblado.
132
GEAppliances.com
Problema
Causas Posibles
Qué hacer
Humedad en el exterior
del refrigerador
Normal en períodos con
alto grado de humedad.
• Seque la superficie.
Humedad en el interior
Se abre la puerta con
(en clima húmedo el aire
frecuencia o por mucho
lleva la humedad al interior tiempo.
del refrigerador cuando se
abren las puertas)
No funciona la luz
interior
No hay corriente en el contacto.
• Reemplace el fusible o reajuste el interruptor.
Bombilla fundida.
• Vea Reemplazar las bombillas.
Para las luces LED
• Llame al servicio
Agua en el piso de la
cocina o en el fondo
del congelador
Cubos atrapados en
el orificio.
• Empuje los cubos en el vertedero con una cuchara
de madera.
El refrigerador
está pitando
La puerta está abierta.
• Cierre la puerta.
La temperatura real no
es igual a la temperatura
establecida
La unidad recientemente
se conectó.
• Permita que transcurran 24 horas para que el sistema
se estabilice.
La puerta permacene abierta
por mucho tiempo.
• Permita que transcurran 24 horas para que el sistema
se estabilice.
Se introdujo comida tibia
al refrigerador.
• Permita que transcurran 24 horas para que el sistema
se estabilice.
El ciclo de descongelamiento
está en proceso.
• Permita que transcurran 24 horas para que el sistema
se estabilice.
133
Garantía del refrigerador.
Todos los servicios de garantía los proporcionan nuestros Centros de Reparación de Fábrica o
nuestros técnicos Customer Care ® autorizados. Para concertar una cita de reparación, en línea,
visíte nos al GEAppliances.com, o llame al 800.GE.CARES (800.432.2737). Cuando llame para
solicitar servicio, por favor tenga a mano el número de serie y el número de modelo.
Por el período de:
GE reemplazará:
MODELOS GE , GE PROFILE y GE CÁFE:
Un año
A partir de la fecha
de la compra original
Cualquier parte del refrigerador que falle debido a defectos en los materiales o en
la fabricación. Durante esta garantía limitada de un año, GE también proporcionará, sin costo
alguno, toda la mano de obra y el servicio relacionado para reemplazar partes defectuosas.
Treinta días
Cualquier parte del cartucho del filtro de agua que falle debido a defectos en los materiales o en
(Filtro de agua, si incluido) la fabricación. Durante esta garantía limitada de treinta días, GE también proporcionará, sin costo
A partir de la fecha
alguno, un cartucho de filtro de agua de repuesto.
de la compra original
del refrigerador
MODELOS DE GE PROFILE Y GE CÁFE SOLAMENTE:
Cinco años (Modelos
de GE Profile solamente)
A partir de la fecha
de la compra original
Cualquier parte del sistema sellado de refrigeración (compresor, condensador, evaporador y tuberías
de conexión) que fallen debido a defectos en los materiales o fabricación. Durante esta garantía
limitada de cinco años del sistema sellado de refrigeración, GE también proporcionará, sin costo
alguno, toda la mano de obra y el servicio relacionado para reemplazar partes defectuosas en
el sistema sellado de refrigeración.
Lo que GE no cubrirá:
„ Viajes de servicio a su hogar para enseñarle cómo usar
el producto.
„ Instalación o entrega inapropiada, o mantenimiento impropio.
„ Fallas del producto si hay abuso, mal uso, o uso para
otros propósitos que los propuestos, o uso para fines comerciales.
„ Pérdida de alimentos por averías.
„ Reemplazo de fusibles de su hogar o reajuste de interruptores de
circuito.
„ Daños sobre el acabado, tales como óxido sobre la superficie,
deslustres o manchas pequeñas no informadas dentro de las
48 horas luego de la entrega.
„ Los daños causados por un filtro de agua Marca no GE.
„ Reemplazo del cartucho del filtro de agua, si incluido, debido a
presión de agua afuera de las limites de operación especificados o
sedimento excesivo en el suministro de agua.
„ Reemplazo de las bombillas, si incluidas, o del cartucho de filtro de
agua, si incluido, diferente a como se especifica anteriormente.
„ Daño al producto causado por accidente, fuego, inundaciones o
actos de Dios.
„ Daño incidental o consecuencial causado por posibles defectos
con el aparato.
„ Producto no accesible para facilitar el servicio requerido.
(;&/86,Ï1'(*$5$17Ë$6,03/Ë&,7$6³6X~QLFR\H[FOXVLYRGHUHFKRHVODUHSDUDFLyQGHOSURGXFWRWDO\
como se indica en esta Garantía limitada. Cualquier garantía implícita, incluyendo las garantías implícitas de
comerciabilidad o adecuación para un fin determinado, están limitadas a un año o el período de tiempo más
breve permitido por la ley.
Para los clientes de EE.UU. Esta garantía se extiende al comprador original y a cualquier dueño subsiguiente de
productos comprados para uso hogareño dentro de EE.UU. Si el producto está en un área donde no se encuentra
disponible un Proveedor Autorizado del Servicio Técnico de GE, usted será responsable por el costo de un viaje o se podrá
requerir que traiga el producto a una ubicación del Servicio Técnico de GE Autorizado para recibir el servicio. En Alaska, la
garantía excluye el costo de envío o llamadas del servicio a su hogar.
Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía le da derechos
legales específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer cuáles
son sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado.
Garante: General Electric Company. Louisville, KY 40225
Para los clientes de Canadá : Esta garantía se extiende al comprador original y cualquier comprador posterior
de productos comprados en Canadá para uso residencial dentro de Canadá. El servicio a domicilio warrant será
proporcionado en las áreas donde está disponible y que se considere razonable por Mabe para ofrecer.
Mabe Canada Inc., Burlington, ON, L7R 5B6
134
Ficha Técnica de Funcionamiento
Sistema de Filtración SmartWater-Cartucho de GE® MSWF
Este sistema fue evaluado y certificado en el modelo de filtro de GE MWF, de acuerdo con los Estándares 42 y 53 de NSF/ANSI para la reducción de las sustancias
que figuran a continuación. La concentración de las sustancias indicadas en agua que ingresan al sistema fue reducida a una concentración inferior o igual al límite
tolerable de agua que puede dejar el sistema, de acuerdo con lo especificado en el Estándar es 42 y 53 de NSF/ANSI*. (Factores de seguridad incorporados para uso no mesurable).
Estándar Nº 42: Efectos estéticos
Parametros
Chlorine Taste & Odor
Particula**
USEPA MCL
—
—
Calidad del
influente Concentración
2.0 mg/L ± 10%
at least 10,000 particles/
mL
Promedio
0.06 mg/L
408,333
Effluente
Maximo
0.10 mg/L
670,000
% de reducción
Promedio
Minimo
97%
9.1%
95.5%
89.4%
Reducción
minima necesaria
≥ 50%
≥ 85%
Promedio
0.38 NTU
< 1 #/L
< 1 ppb
3.1 ppb
0.34 ppb
0.66 ppb
< 0.02 ppb
< 0.5 ppb
7.7 ppb
< 1 ppb
< 0.5 ppb
< 1 ppb
< 0.5 ppb
< 0.17 MF/L
Effluente
Maximo
0.5 NTU
4 #/L
< 1 ppb
9.0 ppb
0.7 ppb
1.5 ppb
< 0.02 ppb
< 0.05 ppb
35 ppb
< 1 ppb
< 0.5 ppb
1 ppb
< 0.5 ppb
< 0.17 MF/L
% de reduccion
Proemedio
Minimo
96.5%
95.4%
> 99.99%
> 99.99%
99.3%
99.3%
98.0%
95.5%
94.0%
89.6%
88.4%
73.7%
> 99.0%
> 99.0%
> 93.9%
> 94.3%
96.0%
82.0%
> 92.9%
> 92.9%
> 96.8%
> 97.0%
> 98.7%
> 98.7%
> 99.7%
> 99.8%
> 99%
> 99%
Concentration (mg/l) permise
pour l’eau le système
0.5 NTU
99.95%
0.010 mg/L
0.010 mg/L
0.002 mg/L
0.002 mg/L
0.0002 mg/L
0.003 mg/L
0.070 mg/L
0.003 mg/L
0.005 mg/L
0.040 mg/L
0.075 mg/L
99% Reduction
Estándar Nº 53: Efectos sobre la salud
Calidad del
influente Concentración
USEPA MCL
1 NTU****
11 ± 1 NTU****
99.95% Reduction
Minimum 50,000 L
0.010 mg/L
0.15 mg/L ± 10%
0.010 mg/L
0.15 mg/L ± 10%
0.002 mg/L
0.006 mg/L ± 10%
0.002 mg/L
0.006 mg/L ± 10%
0.0002 mg/L
0.002 mg/L ± 10%
0.003 mg/L
0.009 mg/L ± 10%
0.070 mg/L
0.210 mg/L ± 10%
0.003 mg/L
0.015 mg/L ± 10%
0.005 mg/L
0.015 mg/L ± 10%
0.040 mg/L
0.080 mg/L ± 10%
0.075 mg/L
0.225 mg/L ± 10%
7
99% Reduction
10 to 10 8 fibers/L;
fibers > 10μm in length
Parametros
Turbiditez
Quistes***
Plomo au pH 6.5
Plomo au pH 8.5
Mercurio at pH 6.5
Mercurio at pH 8.5
Lindane
Atrazine
2, 4-D
Toxaphene
Benceno
Carbofurano
P-Dichlorobenzeno
Asbestos
*Tested using pressure of 60 psig; pH of 7.5 ± 0.5; temp of 68º ± 5ºF (20º ± 2.5ºC).
**Measurement in Particles/mL. Particles used were 0.5-1 microns.
***Basé sur l’utillisation des oocystes de Cryptosporidium parvum.
****NTU=Nephelometric Turbidité Units
Capacidad de 300 gallons (1,135 liters). reducció de la contaminates determinada por la evaluación de NSF.
Pautas de Aplicación/Parámetros de Suministro de Agua
Flujo del Servicio
Suministro de Agua
0.9 gpm (3.14 lpm)
Agua Potable
Presión de Agua
Temperatura del agua
40–120 psi (2.8–8.2 barra)
33ºF–100ºF (0.6ºC–38ºC)
Es esencial que se cumpla conlas requistos de instalación, mantenimiento y reemplazo de filtros recomendados por el fabricante, a fin de que el
Productofuncione de acuerdo a como fue proocionado. Para acceder a información sobre la Garantía, consulte el Manual de Instalación.
Especificaciones de Funcionamiento
• Requisitos de presión: 40-120 psi (barra 2.8-8,2), sin descarga
• Temperatura: 33–100°F (0.6–38°C)
• Promedio de flujo: 0.9 gpm (3.14 lpm)
Instalación General/ Funcionamiento /Requisitos de Mantenimiento
• Enjuague el cartucho Nuevo con un flujo de 20 1/2 Liters
al máximo (unos cinco minutos) para purgar.
• Reemplace el cartucho cuando el flujo empiece a ser demasiado lento.
• Proteja del congelamiento retirando el cartucho del filtro cuando se espere que las
temperaturas sean inferiores a 33°F (1°C). No instale sistemas en áreas
donde la temperatura ambiente pueda ser superior a los 100º F o inferiores
a 40º F. No instale en un suministro de agua caliente.
Avisos Especiales
• Las instrucciones de instalación se incluyen con el producto cuando se envían.
• Este sistema de agua potable se deberá mantener de acuerdo con las
instrucciones del fabricante, incluyendo el reemplazo de cartuchos de filtro.
• No se deben usar con agua que no sea microbiológicamente segura o de calidad
desconocida sin una desinfección adecuada, antes o después, del sistema. Los sistemas certificados
para la reducción de quistes se podrían usar en aguas desinfectadas que puedan contener quistes filtrables.
• Los contaminantes u otras sustancias eliminadas o reducidas por este
sistema de tratamiento de agua no se encuentran necesariamente en su agua.
• Controle que se cumpla con las leyes y reglamentaciones estatales y locales
aplicables.
• Observe que aunque la evaluación se realizó de acuerdo con condiciones
estándares de laboratorio, el desempeño puede variar. Los sistemas se deben
instalar y usar de acuerdo con los procedimientos y pautas recomendados
por el fabricante.
• La instalación y uso DEBERÁN cumplir con todos los códigos de plomería estatales
y locales. No se deberá instalar si la presión del agua supera los 120 psi. Si la
presión del agua es superior a los 80 psi (552 KPa), deberá instalar una válvula
limitadora de presión. Si no está seguro sobre cómo controlar la presión del agua,
comuníquese con un plomero profesional.
• No instale cuando se puedan producir condiciones de golpe de ariete. Si existen
condiciones de golpe de ariete, deberá instalar un suspensor de golpes de ariete.
Si no está seguro sobre cómo controlar esta condición, comuníquese con un
plomero profesional.
• Cuando haya instalado un dispositivo anti retorno en el sistema de
agua, se deberá instalar un dispositivo para controlar la presión debido a la
expansión termal.
Evaluado y Certificado por NSF International en cumplimiento con los Estándares 42 y 53 de ANSI/NSF para el modelo GE MWF para la reducción de:
Estándar Nº 42: Efectos Estéticos
• Químico
– Gusto y Olor a cloro
• Filtración Mecánica
– Reducción de Partícula, Clase
GE
Estándar Nº 53: Efectos sobre la Salud
• Reducción Química
– Reducción de Plomo y Lindano
– Reducción de Atrazina
– Reducción de Mercurio y Toxafeno
– Reducción de Endrina
• Filtración Mecánica
– Reducción de Benzeno y Carbofurano – Reducción de Quistes y Asbestos
– Diclobenzeno 1,4 yReducción de 2,4 D
Appliances
Appliance Park
Louisville, KY 40225
geapplianceparts.com
DE REEMPLAZO
© 2010 GE Company
PC61278B
135
Ficha Técnica de Funcionamiento
6LVWHPDGH)LOWUDFLyQ6PDUW:DWHUŒ³&DUWXFKR*(0:)
Información de los Datos de Rendimiento
Capacidad: 300 Galones (1,135 litros)
/DFRQFHQWUDFLyQGHORVFRQWDPLQDQWHVHYDOXDGRVHQHVWH¿OWURVREUHHODJXDTXHLQJUHVDDOVLVWHPD
fue reducida a la concentración menor que o igual al límite permisible para el agua que deja el
VLVWHPDFRPRVHHVSHFL¿FDHQHO(VWiQGDU\HQHO(VWiQGDUGH16)$16,6LVWHPDHYDOXDGR\
FHUWL¿FDGRSRU16),QWHUQDWLRQDOFRQWUDHO(VWiQGDU\HO(VWiQGDUGH16)$16,
Para acceder a un listado completo de los contaminantes evaluados y las cantidades reducidas,
consulte geappliances.com.
Los siguientes reclamos de reducción farmacéutica no fueron certificados por NSF International ni por el Estado de California.
Reclamos evaluados y verificados por un laboratorio independiente:
Reducción de
contaminantes
Atenolol
Fluoxetina
Ibuprofeno
Progesterona
Trimetoprima
Concentración
Promedio
978 ng/L
QJO
QJ/
QJ/
QJ/
Concentración Máxima
Especificada por NSF
N/A
N/A
N/A
N/A
N/A
Promedio de
% Promedio Concentración del
de Reducción Agua Procesada
QJ/
QJ/
QJ/
QJ/
QJ/
Concentración Máxima Requisitos de
Reducción
Autorizada Aceptable
de Agua Procesada
de NSF
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
Informe
de Evaluación
de NSF
-
-
-
-
-
Pautas de Aplicación/ Parámetros de Suministro de Agua
)OXMRGH6HUYLFLR
Suministro de Agua
JSP OSP
Agua Potable
Presión del Agua
Temperatura del agua
SVL EDU
ƒ)ƒ) ƒ&ƒ&
Es esencial que se cumpla con los requisitos de instalación, mantenimiento y reemplazo de filtros recomendados por el fabricante, a fin de que el producto funcione de acuerdo a
como fue promocionado. Para acceder a información sobre la Garantía, consulte el Manual de Instalación.
Nota: 2EVHUYHTXHDXQTXHODHYDOXDFLyQVHUHDOL]yGHDFXHUGRFRQFRQGLFLRQHV
HVWiQGDUHVGHODERUDWRULRHOGHVHPSHxRSXHGHYDULDU&DUWXFKRGH5HHPSOD]R
0:)3DUDFRQRFHUFRVWRVHVWLPDGRVGHHOHPHQWRVGHUHHPSOD]RFRPXQtTXHVH
DORYLVLWHQXHVWURVLWLRZHEHQZZZJHDSSOLDQFHSDUWVFRP
ADVERTENCIA
A fin de reducir el riesgo asociado con la ingestión de contaminantes:
• No se deben usar con agua que no sea microbiológicamente segura o de
calidad desconocida sin una desinfección adecuada, antes o después,
del sistema. Los sistemas certificados para la reducción de quistes se pueden
XVDUHQDJXDVGHVLQIHFWDGDVTXHSXHGDQFRQWHQHUTXLVWHVILOWUDEOHV
(VWDEOHFLPLHQWRGH(3$1~PHUR01
3DUDFRQRFHUODVFRQGLFLRQHVGHXVRUHFODPRVPpGLFRVFHUWLILFDGRVSRUHO&DOLIRUQLD
'HSDUWPHQWRI3XEOLF+HDOWK 'HSDUWPHQWRGH6DOXG3~EOLFDGH&DOLIRUQLD FRQVXOWHO
DILFKDWpFQLFDGHUHQGLPLHQWR&HUWLILFDFLyQGHO&DOLIRUQLD'HSDUWPHQWRI3XEOLF+HDOWK
'HSDUWDPHQWRGH6DOXG3~EOLFDGH&DOLIRUQLD Qž/RVFRQWDPLQDQWHVXRWUDV
VXVWDQFLDVHOLPLQDGDVRUHGXFLGDVSRUHVWHILOWURGHDJXDQRHVWiQQHFHVDULDPHQWHHQ
HODJXDGHWRGRVORVXVXDULRV
ELEMENTOS
DE REEMPLAZO
136
Sistema evaluado y certificado por NSF
International contra NSF/ANSI Estándar 42
y Estándar 53 en el modelo GE MWF para
la reducción de los reclamos especificados
en la ficha técnica de rendimiento.
AVISO
A fin de reducir el riesgo asociado con daños sobre la propiedad debido a pérdidas de agua:
•
• /DLQVWDODFLyQ\XVRDEBERÁN FXPSOLUFRQWRGRVORVFyGLJRVGHSORPHUtDHVWDWDOHV\ORFDOHV
• No VHGHEHUiLQVWDODUVLODSUHVLyQGHODJXDVXSHUDORVSVL EDU 6LODSUHVLyQGHODJXD
HVVXSHULRUDORVSVLVHdeberá LQVWDODUXQDYiOYXODOLPLWDGRUDGHSUHVLyQ6LQRHVWi
VHJXURVREUHFyPRFRQWURODUODSUHVLyQGHODJXDFRPXQtTXHVHFRQXQSORPHURSURIHVLRQDO
• No LQVWDOHFXDQGRVHSXHGDQSURGXFLUFRQGLFLRQHVGHJROSHGHDULHWH6LH[LVWHQ
FRQGLFLRQHVGHJROSHGHDULHWHGHEHUi instalar XQVXVSHQVRUGHJROSHVGHDULHWH6LQR
HVWiVHJXURVREUHFyPRFRQWURODUHVWDFRQGLFLyQFRPXQtTXHVHFRQXQSORPHURSURIHVLRQDO
• No LQVWDOHHQOtQHDVGHVXPLQLVWURGHDJXDFDOLHQWH/DWHPSHUDWXUDPi[LPD
GHIXQFLRQDPLHQWRGHODJXDSDUDHVWHVLVWHPDGHILOWURHVGHƒ) ƒ& • Proteja el filtro de heladas. Drene el filtro cuando las temperaturas sean
LQIHULRUHVDž) ž& • (OFDUWXFKRGHOILOWURGHVFDUWDEOHdeberá VHUUHHPSOD]DGRFDGDPHVHVOXHJR
GHXQXVRQRUPDORDQWHVVLVHSURGXFHXQDUHGXFFLyQQRWRULDHQHOFDXGDO
Servicio al consumidor.
Página Web de GE Appliances
GEAppliances.com
¿Tiene alguna pregunta sobre su electrodoméstico? ¡Pruebe la página Web de GE Appliances, cualquier
día del año! Para mayor conveniencia y servicio más rápido, ya puede descargar los Manuales de
los Propietarios, pedir piezas o incluso hacer una cita en línea para que vengan a realizar una reparación.
Solicite una reparación
GEAppliances.com
El servicio de expertos GE está a tan sólo un paso de su puerta. ¡Entre en línea y solicite su reparación cuando
le venga bien cualquier día del año! O llame al 800.GE.CARES (800.432.2737) durante horas normales de oficina.
Real Life Design Studio (Estudio de diseño para la vida real)
GEAppliances.com
*(DSR\DHOFRQFHSWRGH'LVHxR8QLYHUVDO³SURGXFWRVVHUYLFLRV\DPELHQWHVTXHSXHGHQXVDUJHQWHGHWRGDV
las edades, tamaños y capacidades. Reconocemos la necesidad de diseñar para una gran gama de habilidades
y dificultades físicas y mentales. Para más detalles cobre las aplicaciones de GE Diseño Universal, incluyendo
ideas de diseño para la cocina para personas con discapacidades, mire nuestra página Web hoy mismo.
Para personas con dificultades auditivas, favor de llamar al 800.TDD.GEAC (800.833.4322).
Garantías ampliadas
GEAppliances.com
Compre una garantía ampliada y obtenga detalles sobre descuentos especiales disponibles mientras su garantía
está aún activa. Puede comprarla en línea en cualquier momento, o llamar al (800.626.2224) durante horas
normales de oficina. GE Consumer Home Services estará aún ahí cuando su garantía termine.
Piezas y accesorios
GEApplianceParts.com
Aquellos individuos con la calificación necesaria para reparar sus propios electrodomésticos pueden
pedir que se les manden las piezas o accesorios directamente a sus hogares (aceptamos las tarjetas
VISA, MasterCard y Discover). Haga su pedido en línea hoy, 24 horas cada día o llamar por teléfono
al 800.626.2002 durante horas normales de oficina.
Las instrucciones descritas en este manual cubren los procedimientos a seguir por cualquier usuario.
Cualquier otra reparación debería, por regla general, referirse a personal calificado autorizado. Debe
ejercerse precaución ya que las reparaciones incorrectas pueden causar condiciones de funcionamiento
inseguras.
Póngase en contacto con nosotros
GEAppliances.com
Si no está satisfecho con el servicio que recibe de GE, póngase en contacto con nosotros en nuestra
página Web indicando todos los detalles así como su número de teléfono o escríbanos a:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
Registre su electrodoméstico
GEAppliances.com
¡Registre su nuevo electrodoméstico en línea–cuando usted prefiera! El registrar su producto a tiempo
le proporcionará, si surgiera la necesidad, una mejor comunicación y un servicio más rápido bajo los términos
de su garantía. También puede enviar su tarjeta de registro pre-impresa que se incluye en el material de
embalaje o recorte y use el formulario de este Manual del Propietario.
137
Notas...
138
GEAppliances.com
139
Notas...
140
GEAppliances.com
141
Notas...
142
GEAppliances.com
143
Consumer Support.
GE Appliances Website
In the U.S.: GEAppliances.com
Have a question or need assistance with your appliance? Try the GE Appliances Website, any day of the year!
For greater convenience and faster service, you can now download Owner’s Manuals, order parts or even schedule
service on-line.
In Canada: geappliances.ca
Schedule Service
In the U.S.: GEAppliances.com
Expert GE repair service is only one step away from your door. Get on-line and schedule your service at your
convenience any day of the year! Or call 800.GE.CARES (800.432.2737) during normal business hours.
In Canada, call 1.800.561.3344
Real Life Design Studio
In the U.S.: GEAppliances.com
*(VXSSRUWVWKH8QLYHUVDO'HVLJQFRQFHSW³SURGXFWVVHUYLFHVDQGHQYLURQPHQWVWKDWFDQEHXVHGE\SHRSOHRI
all ages, sizes and capabilities. We recognize the need to design for a wide range of physical and mental abilities
and impairments. For details of GE’s Universal Design applications, including kitchen design ideas for people with
disabilities, check out our Website today. For the hearing impaired, please call 800.TDD.GEAC (800.833.4322).
In Canada, contact: Manager, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Extended Warranties
In the U.S.: GEAppliances.com
Purchase a GE extended warranty and learn about special discounts that are available while your warranty is still
in effect. You can purchase it on-line anytime, or call 800.626.2224 during normal business hours. GE Consumer Home
Services will still be there after your warranty expires. In Canada, call 1.888.261.2133
Parts and Accessories
In the U.S.: GEApplianceParts.com
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
(VISA, MasterCard and Discover cards are accepted). Order on-line today, 24 hours every day or by phone at
800.626.2002 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing generally
should be referred to qualified service personnel. Caution must be exercised, since improper servicing may cause
unsafe operation.
Customers in Canada should consult the yellow pages for the nearest Mabe service center, or call 1.888.261.3055.
Contact Us
In the U.S.: GEAppliances.com
If you are not satisfied with the service you receive from GE, contact us on our Website with all the details including your
phone number, or write to:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
In Canada: geappliances.ca, or write to: Director, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Register Your Appliance
In the U.S.: GEAppliances.com
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQH³DW\RXUFRQYHQLHQFH Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also
mail in the pre-printed registration card included in the packing material. In Canada: geappliances.ca
144
Printed in the United States
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising