GE Profile | PHP9036DJBB | Use and Care Manual | GE Profile PHP9036DJBB Use and Care Manual

Electronic Induction
Cooktop
GEAppliances.com
Safety Information . . . . . . . . . . . . 2
Warranty . . . . . . . . . . . . . . . . . . . . . . . . 4
Assistance /
Parts and Accessories . . . . . . . . . 5
Owner’s Manual
PHP9030
PHP9036
Using The Cooktop
Cooktop Features . . . . . . . . . . . . . . . . . . 6
Operating The Cooking Elements . . . 7
Turn Burner(s) Off . . . . . . . . . . . . . . . . . . 7
Selecting Cooktop Settings . . . . . . . . . 8
How To Synchronize Left Elements . . 8
Power Sharing . . . . . . . . . . . . . . . . . . . . . 9
Cooktop Lockout . . . . . . . . . . . . . . . . . . . 9
Timer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Hot Light Indicator . . . . . . . . . . . . . . . .10
Pan Detection Removal . . . . . . . . . . . .10
How Induction Cooking Works . . . . .11
Cooking Noise . . . . . . . . . . . . . . . . . . . .11
Choosing The Correct
Cookware To Use . . . . . . . . . . . . . . . .12
Griddle (optional accessory) . . . . . . .14
Care and Cleaning
Cleaning The Cooktop . . . . . . . . . . . . .15
Troubleshooting Tips . . . . . . . . .20
Write the model and serial
numbers here:
Model # ______________________
Serial # _______________________
You can find them on a label under
the cooktop.
49-80742 02-15 GE
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING
5HDGDOOVDIHW\LQVWUXFWLRQVEHIRUHXVLQJWKHSURGXFW)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQILUH
HOHFWULFDOVKRFNVHULRXVLQMXU\RUGHDWK
WARNING GENERAL SAFETY INSTRUCTIONS
Ŷ 8VHWKLVFRRNWRSRQO\IRULWVLQWHQGHGSXUSRVHDV
GHVFULEHGLQWKLV2ZQHU¶V0DQXDO
Ŷ %HVXUH\RXUFRRNWRSLVSURSHUO\LQVWDOOHGDQG
JURXQGHGE\DTXDOLILHGLQVWDOOHULQDFFRUGDQFH
ZLWKWKHSURYLGHGLQVWDOODWLRQLQVWUXFWLRQV
Ŷ 'RQRWDWWHPSWWRUHSDLURUUHSODFHDQ\
SDUWRI\RXUFRRNWRSXQOHVVLWLVVSHFLILFDOO\
UHFRPPHQGHGLQWKLVPDQXDO$OORWKHUVHUYLFLQJ
VKRXOGEHSHUIRUPHGE\DTXDOLILHGWHFKQLFLDQ
Ŷ %HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKH
FRRNWRSRUGLVFRQQHFWWKHSRZHUVXSSO\DWWKH
KRXVHKROGGLVWULEXWLRQSDQHOE\UHPRYLQJWKH
IXVHRUVZLWFKLQJRIIWKHFLUFXLWEUHDNHU
Ŷ 'RQRWOHDYHFKLOGUHQDORQH²FKLOGUHQVKRXOGQRW
EHOHIWDORQHRUXQDWWHQGHGLQDQDUHDZKHUHWKH
FRRNWRSLVLQXVH7KH\VKRXOGQHYHUEHDOORZHG
WRFOLPEVLWRUVWDQGRQDQ\SDUWRIWKHFRRNWRS
Ŷ
CAUTION
:'RQRWVWRUHLWHPVRI
LQWHUHVWWRFKLOGUHQDERYHWKHFRRNWRS²FKLOGUHQ
FOLPELQJRQWKHFRRNWRSWRUHDFKLWHPVFRXOGEH
VHULRXVO\LQMXUHG
Ŷ 8VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW
KROGHUVRQKRWVXUIDFHVPD\UHVXOWLQEXUQVIURP
VWHDP'RQRWOHWSRWKROGHUVWRXFKKRWVXUIDFH
XQLWVRUKHDWLQJHOHPHQWV'RQRWXVHDWRZHORU
RWKHUEXON\FORWKLQSODFHRISRWKROGHUV
Ŷ 1HYHUXVH\RXUFRRNWRSIRUZDUPLQJRUKHDWLQJ
WKHURRP
Ŷ 'RQRWWRXFKVXUIDFHHOHPHQWV7KHVHVXUIDFHV
PD\EHKRWHQRXJKWREXUQHYHQWKRXJKWKH\
DUHGDUNLQFRORU'XULQJDQGDIWHUXVHGRQRW
WRXFKRUOHWFORWKLQJRURWKHUIODPPDEOHPDWHULDOV
FRQWDFWWKHVXUIDFHHOHPHQWVRUDUHDVQHDUE\WKH
VXUIDFHHOHPHQWVDOORZVXIILFLHQWWLPHIRUFRROLQJ
ILUVW
Ŷ 3RWHQWLDOO\KRWVXUIDFHVLQFOXGHWKHFRRNWRSDQG
DUHDVIDFLQJWKHFRRNWRS
Ŷ 'RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH
FRXOGEXLOGXSDQGWKHFRQWDLQHUFRXOGEXUVW
FDXVLQJDQLQMXU\
Ŷ &RRNPHDWDQGSRXOWU\WKRURXJKO\²PHDWWR
DWOHDVWDQLQWHUQDOWHPSHUDWXUHRIƒ)DQG
SRXOWU\WRDWOHDVWDQLQWHUQDOWHPSHUDWXUHRI
ƒ)&RRNLQJWRWKHVHWHPSHUDWXUHVXVXDOO\
SURWHFWVDJDLQVWIRRGERUQHLOOQHVV
KEEP FLAMMABLE MATERIALS AWAY FROM THE COOKTOP
WARNING Failure
to do so may result in fire or personal injury.
Ŷ 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVQHDU
Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH
WKHFRRNWRSLQFOXGLQJSDSHUSODVWLFSRWKROGHUV
PDWHULDOVDFFXPXODWHLQRUQHDUWKHFRRNWRS
OLQHQVZDOOFRYHULQJVFXUWDLQVGUDSHVDQG
*UHDVHRQWKHFRRNWRSPD\LJQLWH
JDVROLQHRURWKHUIODPPDEOHYDSRUVDQGOLTXLGV
Ŷ 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH
XVLQJWKHFRRNWRS7KHVHJDUPHQWVPD\LJQLWHLI
WKH\FRQWDFWKRWVXUIDFHVFDXVLQJVHYHUHEXUQV
2
READ AND SAVE THESE INSTRUCTIONS
49-80742
Ŷ ,QWKHHYHQWRIDILUHGRQRWXVHZDWHURUJUHDVHRQ Ŷ 7RDYRLGVSLOORYHUDQGILUHXVHDPLQLPXPDPRXQW
ILUHV1HYHUSLFNXSDIODPLQJSDQ7XUQWKHFRQWUROV
RIRLOZKHQVKDOORZSDQIU\LQJDQGDYRLGFRRNLQJ
RII6PRWKHUDIODPLQJSDQRQDVXUIDFHXQLWE\
IUR]HQIRRGVZLWKH[FHVVLYHDPRXQWVRILFH
FRYHULQJWKHSDQFRPSOHWHO\ZLWKDZHOOILWWHGOLG
Ŷ 8VHWKHSURSHUSDQVL]HVHOHFWFRRNZDUH
FRRNLHVKHHWRUIODWWUD\8VHDPXOWLSXUSRVHGU\
KDYLQJIODWERWWRPVODUJHHQRXJKWRFRYHUWKH
FKHPLFDORUDIRDPW\SHILUHH[WLQJXLVKHU
VXUIDFHKHDWLQJHOHPHQW7KHXVHRIXQGHUVL]HG
FRRNZDUHZLOOH[SRVHDSRUWLRQRIWKHVXUIDFH
Ŷ 1HYHUOHDYHWKHVXUIDFHXQLWVXQDWWHQGHGDWPHGLXP
XQLWWRGLUHFWFRQWDFWDQGPD\UHVXOWLQLJQLWLRQ
RUKLJKKHDWVHWWLQJV%RLORYHUVFDXVHVPRNLQJDQG
RIFORWKLQJ3URSHUUHODWLRQVKLSRIFRRNZDUHWR
JUHDV\VSLOORYHUVWKDWPD\FDWFKRQILUH
VXUIDFHXQLWZLOODOVRLPSURYHHIILFLHQF\
Ŷ 1HYHUOHDYHRLOXQDWWHQGHGZKLOHIU\LQJ,IDOORZHG
Ŷ 7RPLQLPL]HWKHSRVVLELOLW\RIEXUQVLJQLWLRQRI
WRKHDWEH\RQGLWVVPRNLQJSRLQWRLOPD\LJQLWH
UHVXOWLQJLQILUHWKDWPD\VSUHDGWRVXUURXQGLQJ
IODPPDEOHPDWHULDOVDQGVSLOODJHWKHKDQGOHRID
FDELQHWV8VHDGHHSIDWWKHUPRPHWHUZKHQHYHU
FRQWDLQHUVKRXOGEHWXUQHGWRZDUGWKHFHQWHURIWKH
SRVVLEOHWRPRQLWRURLOWHPSHUDWXUH
UDQJHZLWKRXWH[WHQGLQJRYHUQHDUE\VXUIDFHXQLWV
SAFETY INFORMATION
WARNING COOKTOP SAFETY INSTRUCTIONS
WARNING INDUCTION COOKTOP SAFETY INSTRUCTIONS
Ŷ 8VHFDUHZKHQWRXFKLQJWKHFRRNWRS7KHJODVV
WKHFRRNWRS:DLWXQWLOWKHFRRNWRSFRROVDQGWKH
VXUIDFHRIWKHFRRNWRSZLOOUHWDLQKHDWDIWHUWKH
LQGLFDWRUOLJKWJRHVRXWEHIRUHFOHDQLQJ$ZHW
FRQWUROVKDYHEHHQWXUQHGRII
VSRQJHRUFORWKRQDKRWVXUIDFHFDQFDXVHVWHDP
EXUQV6RPHFOHDQHUVFDQSURGXFHQR[LRXVIXPHV
Ŷ 'RQRWFRRNRQDEURNHQFRRNWRS,IWKHJODVV
LIDSSOLHGWRDKRWVXUIDFH5HDGDQGIROORZDOO
FRRNWRSVKRXOGEUHDNFOHDQLQJVROXWLRQVDQG
LQVWUXFWLRQVDQGZDUQLQJVRQWKHFOHDQLQJFUHDP
VSLOORYHUVPD\SHQHWUDWHWKHEURNHQFRRNWRSDQG
ODEHONOTE:6XJDU\VSLOOVDUHDQH[FHSWLRQ7KH\
FUHDWHDULVNRIHOHFWULFVKRFN&RQWDFWDTXDOLILHG
VKRXOGEHVFUDSHGRIIZKLOHVWLOOKRWXVLQJDQRYHQ
WHFKQLFLDQLPPHGLDWHO\
PLWWDQGDVFUDSHU6HHWKH&OHDQLQJWKHJODVV
Ŷ $YRLGVFUDWFKLQJWKHJODVVFRRNWRS7KHFRRNWRS
FRRNWRSVHFWLRQIRUGHWDLOHGLQVWUXFWLRQV
FDQEHVFUDWFKHGZLWKLWHPVVXFKDVNQLYHV
VKDUSLQVWUXPHQWVULQJVRURWKHUMHZHOU\DQG
Ŷ
:3HUVRQVZLWKDSDFHPDNHU
ULYHWVRQFORWKLQJ
RUVLPLODUPHGLFDOGHYLFHVKRXOGH[HUFLVHFDXWLRQ
Ŷ 'RQRWSODFHRUVWRUHLWHPVWKDWFDQPHOWRUFDWFK
ZKHQXVLQJRUVWDQGLQJQHDUDQLQGXFWLRQFRRNWRS
ILUHRQWKHJODVVFRRNWRSHYHQZKHQLWLVQRWEHLQJ
ZKLOHLWLVLQRSHUDWLRQ7KHHOHFWURPDJQHWLFILHOG
XVHG,IWKHFRRNWRSLVLQDGYHUWHQWO\WXUQHGRQWKH\
PD\DIIHFWWKHZRUNLQJRIWKHSDFHPDNHURU
PD\LJQLWH+HDWIURPWKHFRRNWRSRURYHQYHQW
VLPLODUPHGLFDOGHYLFH,WLVDGYLVDEOHWRFRQVXOW
DIWHULWLVWXUQHGRIIPD\FDXVHWKHPWRLJQLWHDOVR
\RXUGRFWRURUWKHSDFHPDNHUPDQXIDFWXUHUDERXW
®
\RXUSDUWLFXODUVLWXDWLRQ
Ŷ 8VH&(5$0$%5<7( FHUDPLF&RRNWRS&OHDQHU
®
DQG&(5$0$%5<7( &OHDQLQJ3DGWRFOHDQ
CAUTION
WARNING RADIO FREQUENCY INTERFERENCE
7KLVXQLWKDVEHHQWHVWHGDQGIRXQGWRFRPSO\
ZLWKWKHOLPLWVIRUDFODVV%GLJLWDOGHYLFHSXUVXDQW
WR3DUWRIWKH)&&UXOHV7KHVHOLPLWVDUH
GHVLJQHGWRSURYLGHUHDVRQDEOHSURWHFWLRQDJDLQVW
KDUPIXOLQWHUIHUHQFHLQDUHVLGHQWLDOLQVWDOODWLRQ
7KLVXQLWJHQHUDWHVXVHVDQGFDQUDGLDWHUDGLR
IUHTXHQF\HQHUJ\DQGLIQRWLQVWDOOHGDQGXVHG
LQDFFRUGDQFHZLWKWKHLQVWUXFWLRQVPD\FDXVH
KDUPIXOLQWHUIHUHQFHWRUDGLRFRPPXQLFDWLRQV
+RZHYHUWKHUHLVQRJXDUDQWHHWKDWLQWHUIHUHQFH
ZLOOQRWRFFXULQDSDUWLFXODULQVWDOODWLRQ,IWKLV
XQLWGRHVFDXVHKDUPIXOLQWHUIHUHQFHWRUDGLRRU
WHOHYLVLRQUHFHSWLRQZKLFKFDQEHGHWHUPLQHGE\
WXUQLQJWKHXQLWRIIDQGRQWKHXVHULVHQFRXUDJHG
WRWU\WRFRUUHFWWKHLQWHUIHUHQFHE\RQHRUPRUHRI
WKHIROORZLQJPHDVXUHV
Ŷ 5
HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQDH
Ŷ ,QFUHDVHWKHGLVWDQFHEHWZHHQWKHXQLWDQG
UHFHLYHU
Ŷ &RQQHFWWKHXQLWLQWRDQRXWOHWRUDFLUFXLWGLIIHUHQW
IURPWKDWWRZKLFKWKHUHFHLYHULVFRQQHFWHG
READ AND SAVE THESE INSTRUCTIONS
49-80742
3
WARRANTY
Thank You! ... for your purchase of a GE Brand appliance.
Register Your Appliance: 5HJLVWHU\RXUQHZDSSOLDQFHRQOLQHDW\RXUFRQYHQLHQFH
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWUHJLVWHU
7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRUHQKDQFHGFRPPXQLFDWLRQDQGSURPSWVHUYLFHXQGHUWKHWHUPVRI\RXUZDUUDQW\
VKRXOGWKHQHHGDULVH<RXPD\DOVRPDLOLQWKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO
GE Electric Cooktop Warranty
GEAppliances.com
$OOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH®WHFKQLFLDQ
7RVFKHGXOHVHUYLFHRQOLQHYLVLWXVDWZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWRUFDOO*(&$5(6
3OHDVHKDYHVHULDOQXPEHUDQGPRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
6HUYLFLQJ\RXUDSSOLDQFHPD\UHTXLUHWKHXVHRIWKHRQERDUGGDWDSRUWIRUGLDJQRVWLFV7KLVJLYHVD*(IDFWRU\
VHUYLFHWHFKQLFLDQWKHDELOLW\WRTXLFNO\GLDJQRVHDQ\LVVXHVZLWK\RXUDSSOLDQFHDQGKHOSV*(LPSURYHLWVSURGXFWV
E\SURYLGLQJ*(ZLWKLQIRUPDWLRQRQ\RXUDSSOLDQFH,I\RXGRQRWZDQW\RXUDSSOLDQFHGDWDWREHVHQWWR*(SOHDVH
DGYLVH\RXUWHFKQLFLDQQRWWRVXEPLWWKHGDWDWR*(DWWKHWLPHRIVHUYLFH
)RUWKHSHULRGRIRQH\HDUIURPWKHGDWHRIWKHRULJLQDOSXUFKDVH*(ZLOOSURYLGHDQ\SDUWRIWKHFRRNWRSZKLFK
IDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS'XULQJWKLVOLPLWHGRQH\HDUZDUUDQW\*(ZLOODOVRSURYLGHIUHHRI
FKDUJHDOOODERUDQGLQKRPHVHUYLFHWRUHSODFHWKHGHIHFWLYHSDUW
6WDSOH\RXUUHFHLSWKHUH3URRIRIWKHRULJLQDOSXUFKDVH
GDWHLVQHHGHGWRREWDLQVHUYLFHXQGHUWKHZDUUDQW\
What GE will not cover:
Ŷ 6HUYLFHWULSVWR\RXUKRPHWRWHDFK\RXKRZWRXVH
WKHSURGXFW
Ŷ ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
Ŷ )DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHG
PRGLILHGRUXVHGIRURWKHUWKDQWKHLQWHQGHGSXUSRVH
RUXVHGFRPPHUFLDOO\
Ŷ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
EUHDNHUV
Ŷ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH
IORRGVRUDFWVRI*RG
Ŷ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
SRVVLEOHGHIHFWVZLWKWKLVDSSOLDQFH
Ŷ 'DPDJHFDXVHGDIWHUGHOLYHU\
Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
Ŷ 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU
/('ODPSV
EXCLUSION OF IMPLIED WARRANTIES
<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG:DUUDQW\$Q\LPSOLHGZDUUDQWLHV
LQFOXGLQJWKHLPSOLHGZDUUDQWLHVRIPHUFKDQWDELOLW\RUILWQHVVIRUDSDUWLFXODUSXUSRVHDUHOLPLWHGWRRQH\HDURUWKH
VKRUWHVWSHULRGDOORZHGE\ODZ
7KLVZDUUDQW\LVH[WHQGHGWRWKHRULJLQDOSXUFKDVHUDQGDQ\VXFFHHGLQJRZQHUIRUSURGXFWVSXUFKDVHGIRUKRPHXVH
ZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($XWKRUL]HG6HUYLFHULVQRWDYDLODEOH\RX
PD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG*(6HUYLFHORFDWLRQ
IRUVHUYLFH,Q$ODVNDWKHZDUUDQW\H[FOXGHVWKHFRVWRIVKLSSLQJRUVHUYLFHFDOOVWR\RXUKRPH
6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\JLYHV\RX
VSHFLILFOHJDOULJKWVDQG\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH7RNQRZZKDW\RXUOHJDOULJKWV
DUHFRQVXOW\RXUORFDORUVWDWHFRQVXPHUDIIDLUVRIILFHRU\RXUVWDWH¶V$WWRUQH\*HQHUDO
Warrantor: General Electric Company. Louisville, KY 40225
Extended Warranties:3XUFKDVHD*(H[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH
\RXUZDUUDQW\LVVWLOOLQHIIHFW<RXFDQSXUFKDVHLWRQOLQHDQ\WLPH
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*(&RQVXPHU+RPH6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXU
ZDUUDQW\H[SLUHV
4
49-80742
7U\WKH*($SSOLDQFHV:HEVLWH www.geappliances.com/service_and_support/ KRXUVDGD\DQ\GD\RIWKH
\HDU)RUJUHDWHUFRQYHQLHQFHDQGIDVWHUVHUYLFH\RXFDQQRZGRZQORDG2ZQHU¶V0DQXDOVRUGHUSDUWVRUHYHQ
VFKHGXOHVHUYLFHRQOLQH
Schedule Service: ([SHUW*(UHSDLUVHUYLFHLVRQO\RQH
Real Life Design Studio: *(VXSSRUWVWKH8QLYHUVDO
VWHSDZD\IURP\RXUGRRU*HWRQOLQHDQGVFKHGXOH\RXU 'HVLJQFRQFHSWRISURGXFWVVHUYLFHVDQGHQYLURQPHQWV
VHUYLFHDWZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUW
WKDWFDQEHXVHGE\SHRSOHRIDOODJHVVL]HVDQG
2UFDOO*(&$5(6 GXULQJQRUPDO
FDSDELOLWLHV:HUHFRJQL]HWKHQHHGWRGHVLJQIRUDZLGH
EXVLQHVVKRXUV
UDQJHRISK\VLFDODQGPHQWDODELOLWLHVDQGLPSDLUPHQWV
Parts and Accessories: ,QGLYLGXDOVTXDOLILHGWRVHUYLFH )RUGHWDLOVRI*(¶V8QLYHUVDO'HVLJQDSSOLFDWLRQV
WKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQW LQFOXGLQJNLWFKHQGHVLJQLGHDVIRUSHRSOHZLWKGLVDELOLWLHV
GLUHFWO\WRWKHLUKRPHV 9,6$0DVWHU&DUGDQG'LVFRYHU FKHFNRXWRXU:HEVLWHWRGD\)RUWKHKHDULQJLPSDLUHG
SOHDVHFDOO7''*($& FDUGVDUHDFFHSWHG 2UGHURQOLQHWRGD\KRXUV
HYHU\GD\RUE\SKRQHDWGXULQJQRUPDO
EXVLQHVVKRXUV
,QVWUXFWLRQVFRQWDLQHGLQWKLVPDQXDOFRYHUSURFHGXUHV
WREHSHUIRUPHGE\DQ\XVHU2WKHUVHUYLFLQJJHQHUDOO\
VKRXOGEHUHIHUUHGWRTXDOLILHGVHUYLFHSHUVRQQHO&DXWLRQ
PXVWEHH[HUFLVHGVLQFHLPSURSHUVHUYLFLQJPD\FDXVH
XQVDIHRSHUDWLRQ
Contact Us: ,I\RXDUHQRWVDWLVILHGZLWKWKHVHUYLFH\RX
UHFHLYHIURP*(FRQWDFWXVRQRXU:HEVLWHZLWKDOOWKH
GHWDLOVLQFOXGLQJ\RXUSKRQHQXPEHURUZULWHWR
General Manager, Customer Relations
GE Appliances, Appliance Park Louisville, KY 40225
Parts and Accessories
7RSODFHDQRUGHUYLVLWXVRQOLQHDW
www.GEApplianceParts.com 86 RUwww.GEAppliances.ca &DQDGD RUFDOO800.626.2002 86 800.661.1616 &DQDGD
7KHIROORZLQJSDUWVDUHDYDLODEOH
Parts
*ULGGOH
ASSISTANCE / PARTS AND ACCESSORIES
Have a question or need assistance with your appliance?
-;*5,'/
6RXV9LGH.LW
-;62869
6WDLQOHVV6WHHO&OHDQHUDQG3ROLVKHU
30;
How to Remove Protective Shipping Film and Packaging Tape
&DUHIXOO\JUDVSDFRUQHURIWKHSURWHFWLYHVKLSSLQJILOP
ZLWK\RXUILQJHUVDQGVORZO\SHHOLWIURPWKHDSSOLDQFH
VXUIDFH'RQRWXVHDQ\VKDUSLWHPVWRUHPRYHWKHILOP
5HPRYHDOORIWKHILOPEHIRUHXVLQJWKHDSSOLDQFHIRUWKH
ILUVWWLPH
49-80742
7RDVVXUHQRGDPDJHLVGRQHWRWKHILQLVKRIWKH
SURGXFWWKHVDIHVWZD\WRUHPRYHWKHDGKHVLYHIURP
SDFNDJLQJWDSHRQQHZDSSOLDQFHVLVDQDSSOLFDWLRQRI
DKRXVHKROGOLTXLGGLVKZDVKLQJGHWHUJHQW$SSO\ZLWKD
VRIWFORWKDQGDOORZWRVRDN
NOTE: 7KHDGKHVLYHPXVWEHUHPRYHGIURPDOOSDUWV,W
FDQQRWEHUHPRYHGLILWLVEDNHGRQ
5
USING THE COOKTOP: Cooktop Features
Cooktop Features
Throughout this manual, features and appearance may vary from your model.
1
2
30” wide cooktop
3
6
8
7
4
5
User Interface Controls
1
2
36” wide cooktop
3
6
8
7
4
5
User Interface Controls
1. Cooking Element(s):6HHSDJH
2. Element On/Off:6HHSDJH
3. Sync Burners:6HHSDJH
4. All Off:6HHSDJH
5. Lock:6HHSDJH
6. Timer On/Off:6HHSDJH
7. Display:6HHSDJH
8. Start Timer:6HHSDJH
6
49-80742
7XUQ%XUQHU V 2Q7RXFKDQGKROGOn/OffSDGDERXW
KDOIDVHFRQG$FKLPHFDQEHKHDUGZLWKHDFKWRXFKWR
DQ\SDG
3RZHUOHYHOFDQEHVHOHFWHGLQWKHIROORZLQJZD\V
7RXFK+RU–SDGVWRDGMXVWSRZHUOHYHORU
6KRUWFXWWR+L,PPHGLDWHO\DIWHUWXUQLQJXQLWRQWRXFK
WKH+SDGRU
6KRUWFXWWR/RZ,PPHGLDWHO\DIWHUWXUQLQJXQLWRQ
WRXFKWKH-SDG
Turn Burner(s) Off
7RXFKOn/OffSDGIRUDQLQGLYLGXDOEXUQHURUWRXFKWKH
All OffSDG
49-80742
USING THE COOKTOP: Operating The Cooking Elements / Turn Burner(s) Off
Operating The Cooking Elements
7
USING THE COOKTOP: Selecting Cooktop Settings / How To Synchronize Left Elements
8
Selecting Cooktop Settings
CAUTION
&KRRVHWKHHOHPHQWEXUQHUWKDWLVEHVWILWWRWKH
: 'RQRWSODFHDQ\FRRNZDUH
FRRNZDUHVL]H(DFKHOHPHQWEXUQHURQ\RXUQHZ
XWHQVLOVRUOHDYHH[FHVVZDWHUVSLOOVRQFRQWURONH\SDGV
FRRNWRSKDVLWVRZQSRZHUOHYHOVUDQJLQJIURPORZWR
7KLVPD\UHVXOWLQXQUHVSRQVLYHWRXFKSDGVDQGWXUQLQJ
KLJK3RZHUOHYHOVHWWLQJVQHFHVVDU\IRUFRRNLQJZLOOYDU\
RIIWKHFRRNWRSLISUHVHQWIRUVHYHUDOVHFRQGV
GHSHQGLQJRQWKHFRRNZDUHEHLQJXVHGWKHW\SHDQG
TXDQWLW\RIIRRGDQGWKHGHVLUHGRXWFRPH,QJHQHUDOXVH
ORZHUVHWWLQJVIRUPHOWLQJKROGLQJDQGVLPPHULQJDQG
Hi
boiling quickly
XVHKLJKHUVHWWLQJVIRUKHDWLQJTXLFNO\VHDULQJDQGIU\LQJ
frying
:KHQNHHSLQJIRRGVZDUPFRQILUPVHOHFWHGVHWWLQJLV
VXIILFLHQWWRPDLQWDLQIRRGWHPSHUDWXUHDERYHƒ)
searing
/DUJHUHOHPHQWVDQGHOHPHQWVPDUNHG³.HHS:DUP´DUH
QRWUHFRPPHQGHGIRUPHOWLQJ
reducing
+LLVWKHKLJKHVWSRZHUOHYHOGHVLJQHGIRUODUJHTXDQWLW\
simmering
UDSLGFRRNLQJDQGERLOLQJ+LZLOORSHUDWHIRUDPD[LPXP
RIPLQXWHV+LPD\EHUHSHDWHGDIWHUWKHLQLWLDO
holding
PLQXWHF\FOHE\SUHVVLQJWKH+SDG
Low
melting
How To Synchronize Left Elements
To Turn On
To Turn Off
+ROGWKHSync BurnersSDGIRUDERXWKDOIDVHFRQG
WRFRQQHFWWKHWZREXUQHUV2SHUDWHHLWKHUHOHPHQWDV
GHVFULEHGRQSDJHWRDGMXVWSRZHUOHYHO
7RXFKWKHOn/OffSDGRQHLWKHUEXUQHUWRWXUQRIIWKH
6\QF%XUQHUV
RU
7RXFKWKHSync BurnersWRWXUQERWKEXUQHUVRII
49-80742
$´FRRNWRSKDVFRRNLQJ]RQHVDQGD´FRRNWRS
KDVFRRNLQJ]RQHV,IWZRHOHPHQWVLQWKHVDPH]RQH
DUHLQXVHDQGDWOHDVWRQHHOHPHQWLVDWWKHPD[LPXP
SRZHUOHYHO +L WKH+LVHWWLQJZLOORSHUDWHDWDUHGXFHG
Left Zone
Right Zone
30” Wide cooktop.
SRZHUOHYHO1RWHWKDWWKHGLVSOD\ZLOOQRWFKDQJH7KLVLV
KRZSRZHULVVKDUHGEHWZHHQWZRHOHPHQWVLQWKHVDPH
FRRNLQJ]RQH
Left Zone
Center Zone
Right Zone
36” Wide cooktop.
Cooktop Lockout
Lock
+ROGFRQWUROORFNSDGIRUVHFRQGV
Unlock
+ROGFRQWUROORFNSDG
Cooktop Lockout: locks operation of the controls
Timer
To Turn On
7RXFKWKHTimer On/OffSDG7RXFKWKH+RU-SDGVWR
FKRRVHWKHGHVLUHGQXPEHURIPLQXWHV3UHVVWKHStart
TimerSDGWRVWDUWWLPHU
To Turn Off
+ROGTimer On/OffSDGWRFDQFHOWLPHU
49-80742
NOTE: 8VHWKHNLWFKHQWLPHUWRPHDVXUHFRRNLQJWLPH
RUDVDUHPLQGHU7KHNLWFKHQWLPHUGRHVQRWFRQWUROWKH
FRRNLQJHOHPHQWV7LPHUWXUQVRIILIWKHUHLVQRDFWLYLW\
IRUVHFRQGV
USING THE COOKTOP: Power Sharing / Cooktop Lockout / Timer
Power Sharing
9
USING THE COOKTOP: Hot Light Indicator / Pan Detection Removal
10
Hot Light Indicator
$KRWVXUIDFHLQGLFDWRUOLJKW RQHIRUHDFKFRRNLQJ
HOHPHQW ZLOOJORZZKHQWKHJODVVVXUIDFHLVKRWDQGZLOO
UHPDLQRQXQWLOWKHVXUIDFHKDVFRROHGWRDWHPSHUDWXUH
WKDWLVVDIHWRWRXFK
Hot Surface
Indicator Light
Pan Detection Removal
:KHQDSDQLVUHPRYHGIURPWKHFRRNWRSVXUIDFH
EXUQHUOHYHOWXUQVRII2Q2))SDGVWDUWVWREOLQN,ID
SDQLVQRWGHWHFWHGIRUVHFRQGVWKHFRQWUROWXUQVRII
DXWRPDWLFDOO\OLJKWVWXUQRII
On/OFF pad blinks
49-80742
7KHHOHPHQWVEHQHDWKWKHFRRNLQJVXUIDFHSURGXFHD
PDJQHWLFILHOGWKDWFDXVHVWKHHOHFWURQVLQWKHIHUURXV
PHWDOSDQWRYLEUDWHDQGSURGXFHKHDW
7KHFRRNLQJVXUIDFHLWVHOIGRHVQRWKHDW+HDWLV
SURGXFHGLQWKHFRRNLQJSDQDQGFDQQRWEHJHQHUDWHG
XQWLODSDQLVSODFHGRQWKHFRRNLQJVXUIDFH
7KHFRRNWRSZLOOQRWRSHUDWHLIDYHU\VPDOOVWHHORULURQ
XWHQVLO OHVVWKDQWKHPLQLPXPVL]HDFURVVWKHERWWRP LVSODFHGRQWKHFRRNLQJVXUIDFHZKHQWKHXQLWLVWXUQHG
RQ²LWHPVVXFKDVVWHHOVSDWXODVFRRNLQJVSRRQV
NQLYHVDQGRWKHUVPDOOXWHQVLOV
0DJQHWLFLQGXFWLRQFRRNLQJUHTXLUHVWKHXVHRIFRRNZDUH
PDGHRIIHUURXVPHWDOV²PHWDOVWRZKLFKPDJQHWVZLOO
VWLFNVXFKDVLURQRUVWHHO
8VHSDQVWKDWILWWKHHOHPHQWVL]H7KHSDQPXVW
EHODUJHHQRXJKIRUWKHVDIHW\VHQVRUWRDFWLYDWHDQ
HOHPHQW
M
in
.S
ize
:KHQWKHHOHPHQWLVDFWLYDWHGWKHSDQEHJLQVWRKHDW
LPPHGLDWHO\DQGLQWXUQKHDWVWKHFRQWHQWVRIWKHSDQ
Use the minimum size pan for the element. The pan
material is correct if a magnet sticks to the bottom.
Cooking Noise
Cookware “noise”
6OLJKWVRXQGVPD\EHSURGXFHGE\GLIIHUHQWW\SHV
RIFRRNZDUH+HDYLHUSDQVVXFKDVHQDPHOHGFDVW
LURQSURGXFHOHVVQRLVHWKDQDOLJKWHUZHLJKWPXOWLSO\
VWDLQOHVVVWHHOSDQ7KHVL]HRIWKHSDQDQGWKHDPRXQW
RIFRQWHQWVFDQDOVRFRQWULEXWHWRWKHVRXQGOHYHO
:KHQXVLQJDGMDFHQWHOHPHQWVWKDWDUHVHWDWFHUWDLQ
SRZHUOHYHOVHWWLQJVPDJQHWLFILHOGVPD\LQWHUDFWDQG
SURGXFHDORZZKLVWOHRULQWHUPLWWHG³KXP´7KHVH
QRLVHVFDQEHUHGXFHGRUHOLPLQDWHGE\ORZHULQJRU
UDLVLQJWKHSRZHUOHYHOVHWWLQJVRIRQHRUERWKRIWKH
HOHPHQWV3DQVWKDWFRPSOHWHO\FRYHUWKHHOHPHQWULQJ
ZLOOSURGXFHOHVVQRLVH
49-80742
$ORZ³KXPPLQJ´QRLVHLVQRUPDOSDUWLFXODUO\RQKLJK
VHWWLQJV
6RXQGV\RXPD\KHUH<RXPD\KHDUDVOLJKW³%X]]´
ZKHQFRRNLQJZLWK+LPRGH7KLVLVQRUPDO7KHVRXQG
GHSHQGVRQWKHW\SHRISRWEHLQJXVHG6RPHSRWVZLOO
³%X]]´ORXGHUGHSHQGLQJRQWKHPDWHULDO$³%X]]´VRXQG
PD\EHKHDUGLIWKHSDQFRQWHQWVDUHFROG$VWKHSDQ
KHDWVWKHVRXQGZLOOGHFUHDVH,IWKHSRZHUOHYHOLV
UHGXFHGWKHVRXQGOHYHOZLOOJRGRZQ
USING THE COOKTOP: How Induction Cooking Works / Cooking Noise
How Induction Cooking Works
11
USING THE COOKTOP: Choosing The Correct Cookware To Use
Choosing The Correct Cookware To Use
Using the correct size cookware
3DQVWKDWDUHQRWIHUURXVRUDUHWRRVPDOOZLOOQRWDOORZ
WKHLQGXFWLRQHOHPHQWWRWXUQRQDQGWKH21LQGLFDWRUIRU
WKDWHOHPHQWORFDWLRQZLOOIODVKIRUVHFRQGVDQGWKHQ
WXUQRII,IDSDQLVUHPRYHGIRUPRUHWKDQVHFRQGV
WKHSRZHUZLOOEHVKXWRII
&RRNZDUHODUJHUWKDQWKHHOHPHQWULQJPD\EHXVHG
KRZHYHUKHDWZLOORQO\RFFXUDERYHWKHHOHPHQW
)RUEHVWUHVXOWVWKHFRRNZDUHPXVWPDNH)8//FRQWDFW
ZLWKWKHJODVVVXUIDFH
'RQRWDOORZWKHERWWRPRIWKHSDQRUFRRNZDUHWRWRXFK
WKHVXUURXQGLQJPHWDOFRRNWRSWULPRUWRRYHUODSWKH
FRRNWRSFRQWUROV
)RUEHVWSHUIRUPDQFHPDWFKWKHSDQVL]HWRWKHHOHPHQW
VL]H8VLQJDVPDOOHUSRWRQDODUJHUEXUQHUZLOOJHQHUDWH
OHVVSRZHUDWDQ\JLYHQVHWWLQJ
5” Min. Dia.
Pan Size
4-1/2” Min.
Dia. Pan Size
7” Min. Dia.
Pan Size
5” Min. Dia.
Pan Size
30” wide cooktop.
Use the minimum recommended size pan shown
for each cooking element.
Suitable Cookware
8VHTXDOLW\FRRNZDUHZLWKKHDYLHUERWWRPVIRUEHWWHU
KHDWGLVWULEXWLRQDQGHYHQFRRNLQJUHVXOWV&KRRVH
FRRNZDUHPDGHRIPDJQHWLFVWDLQOHVVVWHHOHQDPHO
FRDWHGFDVWLURQHQDPHOHGVWHHODQGFRPELQDWLRQVRI
WKHVHPDWHULDOV
6RPHFRRNZDUHLVVSHFLILFDOO\LGHQWLILHGE\WKH
PDQXIDFWXUHUIRUXVHZLWKLQGXFWLRQFRRNWRSV8VHD
PDJQHWWRWHVWLIWKHFRRNZDUHZLOOZRUN
)ODWERWWRPHGSDQVJLYHEHVWUHVXOWV3DQVZLWKULPVRU
VOLJKWULGJHVFDQEHXVHG
5RXQGSDQVJLYHEHVWUHVXOWV3DQVZLWKZDUSHGRU
FXUYHGERWWRPVZLOOQRWKHDWHYHQO\
)RUZRNFRRNLQJXVHDIODWERWWRPHGZRN'RQRWXVHD
ZRNZLWKDVXSSRUWULQJ
5” Min. Dia.
Pan Size
5” Min. Dia.
Pan Size
7” Min. Dia.
Pan Size
4-1/2” Min.
Dia. Pan Size
5-1/4” Min. Dia.
Pan Size
36” wide cooktop.
Use the minimum recommended size pan shown
for each cooking element.
Use flat-bottomed pans.
Use a griddle.
Use a flat-bottomed wok.
12
49-80742
Cookware recommendations
INCORRECT
CORRECT
Cookware not centered on
cooking element surface.
Cookware centered correctly
on cooking element surface.
Curved or warped pan bottoms
or sides.
Flat pan bottom.
Pan does not meet the minimum
size required for the cooking
element used.
Pan size meets or exceeds the
recommended minimum size
for the cooking element used.
Pan bottom rests on cooktop trim
or does not rest completely on the
cooktop surface.
Pan bottom rests completely on
the cooktop surface.
Heavy handle tilts pan.
Pan is properly balanced.
Pan is partially magnetic
on the bottom.
Pan is completely magnetic
on the bottom.
&RRNZDUHPXVWIXOO\FRQWDFWWKHVXUIDFHRIWKHFRRNLQJ
HOHPHQW
8VHIODWERWWRPHGSDQVVL]HGWRILWWKHFRRNLQJHOHPHQW
DQGDOVRWRWKHDPRXQWRIIRRGEHLQJSUHSDUHG
,QGXFWLRQLQWHUIDFHGLVNVDUH127UHFRPPHQGHG
49-80742
USING THE COOKTOP: Choosing The Correct Cookware To Use
Choosing The Correct Cookware To Use
13
USING THE COOKTOP: Griddle (optional accessory)
14
Griddle (optional accessory)
Using the Griddle
CAUTION
Burn Hazard
Ŷ Griddle surfaces may be hot enough to cause burns during and after use. Place and remove the griddle
when it is cool and all surface units are off. Use oven mitts if you will touch the griddle while hot.
Failure to do so can result in burns.
Ŷ Place and remove the griddle only when griddle is cool and all surface burners are turned OFF.
%HIRUHXVLQJWKLVFRRNZDUHIRUWKHILUVWWLPHZDVKLWWRPDNHVXUHLWLVFOHDQ7KHQVHDVRQLWOLJKWO\UXEELQJFRRNLQJ
RLORQWRWKHFRRNLQJVXUIDFH
How To Place The Griddle
IMPORTANT:$OZD\VSODFHDQGXVH\RXUJULGGOHDWWKH
GHVLJQDWHGORFDWLRQRQWKHFRRNWRS
Type of Food
Cook Setting
:DUPLQJ7RUWLOODV
0HG/R
3DQFDNHV
0HG/R
+DPEXUJHUV
)ULHG(JJV
%UHDNIDVW6DXVDJH/LQNV
+RW6DQGZLFKHV VXFKDV*ULOOHG&KHHVH
0HG
0HG/R
0HG
0HG/R
*ULGGOHVHWWLQJVDUHLQWHQGHGWREHDJXLGHOLQHDQGPD\QHHGWREH
DGMXVWHGEDVHGRQLQGLYLGXDOFRRNLQJSUHIHUHQFHV
Griddle Operation
7RWXUQRQWKHVXUIDFHXQLWVIRUWKHHQWLUHJULGGOHXVH
WKH6\QF%XUQHUFRQWUROIHDWXUH7RXFKWKHSync Burner
SDGDQGWKHQDGMXVWSRZHUOHYHOWRGHVLUHGVHWWLQJDV
GHVFULEHGRQSDJH
IMPORTANT NOTES:
Ŷ &OHDQWKHJULGGOHZLWKDVSRQJHDQGPLOGGHWHUJHQW
LQZDUPZDWHU'2127XVHEOXHRUJUHHQVFUXEELQJ
SDGVRUVWHHOZRRO
Ŷ $YRLGFRRNLQJH[WUHPHO\JUHDV\IRRGVDQGEHFDUHIXO
RIJUHDVHVSLOORYHUZKLOHFRRNLQJ
Ŷ 1HYHUSODFHRUVWRUHDQ\LWHPVRQWKHJULGGOHHYHQ
ZKHQLWLVQRWLQXVH7KHJULGGOHFDQEHFRPHKHDWHG
ZKHQXVLQJWKHVXUURXQGLQJVXUIDFHXQLWV
Ŷ $YRLGXVLQJPHWDOXWHQVLOVZLWKVKDUSSRLQWVRUURXJK
HGJHVZKLFKPLJKWGDPDJHWKHJULGGOH'RQRWFXW
IRRGVRQWKHJULGGOH
Ŷ 'RQRWXVHFRRNZDUHDVDVWRUDJHFRQWDLQHUIRUIRRGRU
RLO3HUPDQHQWVWDLQLQJDQGRUFUD]HOLQHVFRXOGUHVXOW
Ŷ <RXUJULGGOHZLOOGLVFRORURYHUWLPHZLWKXVH
Ŷ 'RQRWFOHDQWKHJULGGOHLQDVHOIFOHDQLQJRYHQ
Ŷ $OZD\VDOORZWKHFRRNZDUHWRFRROEHIRUHLPPHUVLQJLQ
ZDWHU
Ŷ 'RQRWRYHUKHDWWKHJULGGOH
49-80742
Normal Daily Use Cleaning
21/<XVH&(5$0$%5<7(®&HUDPLF&RRNWRS&OHDQHU
RQWKHJODVVFRRNWRS2WKHUFUHDPVPD\QRWEHDV
HIIHFWLYH
7RPDLQWDLQDQGSURWHFWWKHVXUIDFHRI\RXUJODVV
FRRNWRSIROORZWKHVHVWHSV
%HIRUHXVLQJWKHFRRNWRSIRUWKHILUVWWLPHFOHDQLW
ZLWK&(5$0$%5<7(®&HUDPLF&RRNWRS&OHDQHU
7KLVKHOSVSURWHFWWKHWRSDQGPDNHVFOHDQXSHDVLHU
'DLO\XVHRI&(5$0$%5<7(®&HUDPLF&RRNWRS
&OHDQHUZLOOKHOSNHHSWKHFRRNWRSORRNLQJQHZ
6KDNHWKHFOHDQLQJFUHDPZHOO$SSO\DIHZGURSVRI
&(5$0$%5<7(®&HUDPLF&RRNWRS&OHDQHUGLUHFWO\
WRWKHFRRNWRS
8VHDSDSHUWRZHORU
&(5$0$%5<7(®&OHDQLQJ
3DGIRU&HUDPLF&RRNWRSV
WRFOHDQWKHHQWLUHFRRNWRS
VXUIDFH
8VHDGU\FORWKRUSDSHUWRZHO
WRUHPRYHDOOFOHDQLQJUHVLGXH
1RQHHGWRULQVH
NOTE:,WLVYHU\LPSRUWDQWWKDW
\RX'2127KHDWWKHFRRNWRS
Clean your cooktop after each
XQWLOLWKDVEHHQFOHDQHG
spill. Use CERAMA BRYTE®
WKRURXJKO\
Ceramic Cooktop Cleaner.
Burned-On Residue
NOTE:'$0$*(WR\RXUJODVVVXUIDFHPD\RFFXULI\RX
XVHVFUXESDGVRWKHUWKDQWKRVHUHFRPPHQGHG
$OORZWKHFRRNWRSWRFRRO
6SUHDGDIHZGURSVRI&(5$0$%5<7(®&HUDPLF
&RRNWRS&OHDQHURQWKHHQWLUHEXUQHGUHVLGXHDUHD
8VLQJWKHLQFOXGHG&(5$0$%5<7(®&OHDQLQJ3DG
IRU&HUDPLF&RRNWRSVUXEWKHUHVLGXHDUHDDSSO\LQJ
SUHVVXUHDVQHHGHG
,IDQ\UHVLGXHUHPDLQVUHSHDWWKHVWHSVOLVWHGDERYH
DVQHHGHG
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOOUHVLGXHKDVEHHQ
UHPRYHGSROLVKWKHHQWLUHVXUIDFHZLWK&(5$0$
%5<7(®&HUDPLF&RRNWRS&OHDQHUDQGDSDSHUWRZHO
Use a CERAMA BRYTE® Cleaning
Pad for Ceramic Cooktops.
Heavy, Burned-On Residue
$OORZWKHFRRNWRSWRFRRO
8VHDVLQJOHHGJHUD]RUEODGHVFUDSHUDWDSSUR[LPDWHO\
DƒDQJOHDJDLQVWWKHJODVVVXUIDFHDQGVFUDSHWKH
VRLO,WZLOOEHQHFHVVDU\WRDSSO\SUHVVXUHWRWKHUD]RU
VFUDSHULQRUGHUWRUHPRYHWKHUHVLGXH
$IWHUVFUDSLQJZLWKWKHUD]RUVFUDSHUVSUHDGD
IHZGURSVRI&(5$0$%5<7(®&HUDPLF&RRNWRS
&OHDQHURQWKHHQWLUHEXUQHGUHVLGXHDUHD8VHWKH
&(5$0$%5<7(®&OHDQLQJ3DGWRUHPRYHDQ\
UHPDLQLQJUHVLGXH
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOOUHVLGXHKDVEHHQ
UHPRYHGSROLVKWKHHQWLUHVXUIDFHZLWK&(5$0$
%5<7(®&HUDPLF&RRNWRS&OHDQHUDQGDSDSHUWRZHO
49-80742
CARE AND CLEANING: Cleaning the Glass Cooktop
Cleaning the Glass Cooktop
The CERAMA BRYTE® Ceramic Cooktop Scraper and all
recommended supplies are available through our Parts Center.
See instructions under “Assistance / Accessories” section.
NOTE: Do not use a dull or nicked blade.
15
CARE AND CLEANING: Cleaning the Glass Cooktop
16
Cleaning the Glass Cooktop (Cont.)
Metal Marks and Scratches
%HFDUHIXOQRWWRVOLGHSRWVDQGSDQVDFURVV\RXU
FRRNWRS,WZLOOOHDYHPHWDOPDUNLQJVRQWKHFRRNWRS
VXUIDFH
7KHVHPDUNVDUHUHPRYDEOHXVLQJWKH&(5$0$
%5<7(®&HUDPLF&RRNWRS&OHDQHUZLWKWKH&(5$0$
%5<7(®&OHDQLQJ3DGIRU&HUDPLF&RRNWRSV
,ISRWVZLWKDWKLQRYHUOD\RIDOXPLQXPRUFRSSHU
DUHDOORZHGWRERLOGU\WKHRYHUOD\PD\OHDYHEODFN
GLVFRORUDWLRQRQWKHFRRNWRS
7KLVVKRXOGEHUHPRYHGLPPHGLDWHO\EHIRUHKHDWLQJ
DJDLQRUWKHGLVFRORUDWLRQPD\EHSHUPDQHQW
NOTE:&DUHIXOO\FKHFNWKHERWWRPRISDQVIRUURXJKQHVV
WKDWZRXOGVFUDWFKWKHFRRNWRS
Damage from Sugary Spills and Melted Plastic
6SHFLDOFDUHVKRXOGEHWDNHQZKHQUHPRYLQJKRWVXEVWDQFHVto avoid permanent damage of the glass surface
6XJDU\VSLOORYHUV VXFKDVMHOOLHVIXGJHFDQG\V\UXSV RUPHOWHGSODVWLFVFDQFDXVHSLWWLQJRIWKHVXUIDFHRI\RXU
FRRNWRS QRWFRYHUHGE\WKHZDUUDQW\ XQOHVVWKHVSLOOLVUHPRYHGZKLOHVWLOOKRW6SHFLDOFDUHVKRXOGEHWDNHQZKHQ
UHPRYLQJKRWVXEVWDQFHV
%HVXUHWRXVHDQHZVKDUSUD]RUVFUDSHU
'RQRWXVHDGXOORUQLFNHGEODGH
7XUQRIIDOOVXUIDFHXQLWV5HPRYHKRWSDQV
:HDULQJDQRYHQPLWW
D8VHDVLQJOHHGJHUD]RUEODGHVFUDSHU &(5$0$
%5<7(®&HUDPLF&RRNWRS6FUDSHU WRPRYHWKH
VSLOOWRDFRRODUHDRQWKHFRRNWRS
E5HPRYHWKHVSLOOZLWKSDSHUWRZHOV
$Q\UHPDLQLQJVSLOORYHUVKRXOGEHOHIWXQWLOWKHVXUIDFH
RIWKHFRRNWRSKDVFRROHG
'RQ¶WXVHWKHVXUIDFHXQLWVDJDLQXQWLODOORIWKH
UHVLGXHKDVEHHQFRPSOHWHO\UHPRYHG
NOTE:,ISLWWLQJRULQGHQWDWLRQLQWKHJODVVVXUIDFHKDV
DOUHDG\RFFXUUHGWKHFRRNWRSJODVVZLOOKDYHWREH
UHSODFHG,QWKLVFDVHVHUYLFHZLOOEHQHFHVVDU\
49-80742
Notes
49-80742
17
Notes
18
49-80742
Notes
49-80742
19
TROUBLESHOOTING TIPS
Troubleshooting tips ... Before you call for service
6DYHWLPHDQGPRQH\5HYLHZWKHFKDUWVRQWKHIROORZLQJSDJHVILUVWDQG\RXPD\QRWQHHGWRFDOOIRUVHUYLFH,IDQHUURU
RFFXUVLQWKHFRQWURORSHUDWLRQDIDXOWFRGHZLOOIODVKLQWKHGLVSOD\5HFRUGWKHHUURUFRGHDQGFDOOIRUVHUYLFH
Problem
Possible Cause
What To Do
Surface elements will not
maintain a rolling boil or
cooking is slow
Improper cookware being used.
8VHSDQVWKDWDUHUHFRPPHQGHGIRU
LQGXFWLRQKDYHIODWERWWRPVDQGPDWFKWKH
VL]HRIWKHVXUIDFHHOHPHQW
Surface elements do not
work properly
Cooktop controls improperly set.
&KHFNWREHVXUHWKHFRUUHFWFRQWUROLVVHWIRU
WKHVXUIDFHHOHPHQW\RXDUHXVLQJ
Power arc ON indicator
blinking
Wrong pan type.
8VHDPDJQHWWRFKHFNWKDWFRRNZDUHLV
LQGXFWLRQFRPSDWLEOH
Pan is too small.
%OLQNLQJ³21´LQGLFDWRU²SDQVL]HLVEHORZ
WKHPLQLPXPVL]HIRUWKHHOHPHQW6HHWKH
8VLQJWKHFRUUHFWVL]HFRRNZDUHVHFWLRQ
Pan not positioned correctly.
&HQWHUWKHSDQLQWKHFRRNLQJULQJ
+, -, or control lock pads have been touched
before an element is turned on.
6HHWKH2SHUDWLQJWKH&RRNLQJ(OHPHQWV
VHFWLRQ
Incorrect cleaning methods being used.
8VHUHFRPPHQGHGFOHDQLQJSURFHGXUHV6HH
WKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQ
Cookware with rough bottoms being used
or coarse particles (salt or sand) were
between the cookware and the surface of
the cooktop.
Cookware has been slid across the cooktop
surface.
7RDYRLGVFUDWFKHVXVHWKHUHFRPPHQGHG
FOHDQLQJSURFHGXUHV0DNHVXUHERWWRPV
RIFRRNZDUHDUHFOHDQEHIRUHXVHDQGXVH
FRRNZDUHZLWKVPRRWKERWWRPV
Areas of discoloration on
the cooktop
Food spillovers not cleaned before next use.
6HHWKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQ
Hot surface on a model with a light-colored
glass cooktop.
7KLVLVQRUPDO7KHVXUIDFHPD\DSSHDU
GLVFRORUHGZKHQLWLVKRW7KLVLVWHPSRUDU\
DQGZLOOGLVDSSHDUDVWKHJODVVFRROV
Plastic melted to the
surface
Hot cooktop came into contact with plastic
placed on the hot cooktop.
6HHWKH*ODVVVXUIDFH±SRWHQWLDOIRU
SHUPDQHQWGDPDJHVHFWLRQLQWKH&OHDQLQJ
WKHJODVVFRRNWRSVHFWLRQ
Pitting (or indentation) of
the cooktop
Hot sugar mixture spilled on the cooktop.
&DOODTXDOLILHGWHFKQLFLDQIRUUHSODFHPHQW
Unresponsive keypad
Keypad is dirty.
&OHDQWKHNH\SDG
A fuse in your home may be blown or the
circuit breaker tripped.
5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU
Improper cookware being used.
8VHDIODWLQGXFWLRQFDSDEOHSDQWKDWPHHWV
WKHPLQLPXPVL]HIRUWKHHOHPHQWEHLQJ
XVHG6HHWKH8VLQJ7KH&RUUHFW6L]H
&RRNZDUHVHFWLRQ
Pan is improperly placed.
0DNHVXUHWKHSDQLVFHQWHUHGRQWKH
FRUUHVSRQGLQJVXUIDFHHOHPHQW
Cooktop control improperly set.
&KHFNWRVHHWKDWWKHFRQWUROLVVHWSURSHUO\
Sounds you may hear: Buzzing, whistling
and humming.
7KHVHVRXQGVDUHQRUPDO6HH&RRNLQJ
1RLVHVHFWLRQ
Scratches on cooktop
glass surface
Pan detection/sizing not
working properly
Noise
20
49-80742
À Induction Électronique
Table de cuisson
GEAppliances.com
Consignes De Sécurité . . . . . . . . . . . . . . .2
Garantie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
Assistance /
Pièces et accessoires . . . . . . . . . . . . . . . . .5
Manuel du Propriétaire
PHP9030
PHP9036
Utilisation de la table de cuisson
Fonctions de la table de cuisson . . . . . . . . . . .6
Fonctionnement des éléments de cuisson . .7
Extinction d’un ou de plusieurs brûleurs . . . .7
Sélection des réglages de la table
de cuisson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8
Comment synchroniser les éléments
de gauche . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .8
Partage De Puissance . . . . . . . . . . . . . . . . . . . . .9
Verrouillage de la table de cuisson . . . . . . . . .9
Minuterie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9
Témoin lumineux de surface chaude . . . . . 10
Détection de l’enlèvement
d’une casserole . . . . . . . . . . . . . . . . . . . . . . . 10
Fonctionnement De
La Cuisson À Induction . . . . . . . . . . . . . . . . 11
Bruit de cuisson . . . . . . . . . . . . . . . . . . . . . . . . . 11
Choix De La Bonne Batterie
De Cuisine À Utiliser . . . . . . . . . . . . . . . . . . . 12
Plaque chauffante (accessoire en option). . 14
Entretien et nettoyage
Nettoyage de la vitre
de la table de cuisson . . . . . . . . . . . . . . . . . 15
Trucs de dépannage . . . . . . . . . . . . . . . . 20
Inscrivez ci-dessous les numéros de
modèle et de série
N° de modèle __________________
N° de série ____________________
Ils se trouvent sur une étiquette sous
la table de cuisson.
49-80742 02-15 GE
CONSIGNES DE SÉCURITÉ
CONSIGNES DE SÉCURITÉ IMPORTANTES.
VEUILLEZ LIRE TOUTES LES CONSIGNES AVANT D’UTILISER L’APPAREIL.
AVERTISSEMENT!
Veuillez lire toutes les consignes avant d’utiliser ce produit. Le non-respect de ces instructions pourrait entraîner un
incendie, un choc électrique, une blessure grave voire la mort.
AVERTISSEMENT! CONSIGNES GÉNÉRALES DE SÉCURITÉ
Ŷ 8WLOLVH]FHWWHWDEOHGHFXLVVRQXQLTXHPHQWDX[ILQV
DX[TXHOOHVHOOHDpWpGHVWLQpHHWGHODIDoRQGpFULWH
dans le présent manuel d’utilisation.
Ŷ $VVXUH]YRXVTXHYRWUHWDEOHGHFXLVVRQHVW
FRUUHFWHPHQWLQVWDOOpHHWIL[pHDXVROSDUXQLQVWDOOHXU
TXDOLILpVHORQOHVLQVWUXFWLRQVG¶LQVWDOODWLRQIRXUQLHV
Ŷ 1¶HVVD\H]SDVGHUpSDUHUQLGHUHPSODFHUXQH
pièce de votre table de cuisson, à moins que
FHODQHVRLWVSpFLILTXHPHQWUHFRPPDQGpGDQVFH
PDQXHO7RXWHDXWUHUpSDUDWLRQGRLWrWUHHIIHFWXpH
SDUXQWHFKQLFLHQTXDOLILp
Ŷ $YDQWG¶HIIHFWXHUTXHOTXHUpSDUDWLRQGpEUDQFKH]OD
table de cuisson ou coupez l’alimentation électrique
au panneau de distribution électrique du domicile en
UHWLUDQWOHIXVLEOHRXHQGpVDUPDQWOHGLVMRQFWHXU
Ŷ 1HODLVVH]SDVOHVHQIDQWVVDQVVXUYHLOODQFH/HV
HQIDQWVQHGRLYHQWSDVrWUHODLVVpVVHXOVQLVDQV
surveillance dans la zone d’utilisation de la table de
FXLVVRQ,OVQHGRLYHQWMDPDLVJULPSHUV¶DVVHRLURXVH
tenir debout sur la table de cuisson.
Ŷ
MISE EN GARDE
: 1HUDQJH]SDV
G¶DUWLFOHVDWWUD\DQWVSRXUOHVHQIDQWVDXGHVVXVGH
ODWDEOHGHFXLVVRQOHVHQIDQWVTXLJULPSHQWVXU
la table pour atteindre les articles risquent de se
blesser gravement.
Ŷ 8WLOLVH]XQLTXHPHQWGHVSRLJQpHVVqFKHVO¶XWLOLVDWLRQ
de poignées humides ou mouillées pourrait entraîner
GHVEU€OXUHVSDUYDSHXU1HODLVVH]SDVOHVSRLJQpHV
HQWUHUHQFRQWDFWDYHFOHVpOpPHQWVFKDXIIDQWV
Ŷ 1¶XWLOLVH]MDPDLVYRWUHWDEOHGHFXLVVRQSRXU
UpFKDXIIHURXFKDXIIHUXQHVDOOH
Ŷ 1HWRXFKH]SDVDX[pOpPHQWVGHVXUIDFH0rPH
V¶LOVSUpVHQWHQWXQHFRXOHXUIRQFpHFHVpOpPHQWV
peuvent devenir chauds au point de brûler la peau.
'XUDQWHWDSUqVO¶XWLOLVDWLRQpYLWH]GHWRXFKHUDX[
pOpPHQWVGHVXUIDFHHWQHODLVVH]SDVGHYrWHPHQWV
QLG¶DXWUHVPDWLqUHVLQIODPPDEOHVDXFRQWDFWRXj
SUR[LPLWpGHFHVpOpPHQWVFKDXIIDQWVDOORXH]G¶DERUG
VXIILVDPPHQWGHWHPSVSRXUOHXUUHIURLGLVVHPHQW
Ŷ (QSOXVGHODWDEOHGHFXLVVRQOHVVXUIDFHV\IDLVDQW
IDFHSHXYHQWDXVVLGHYHQLUWUqVFKDXGHV
Ŷ 1HIDLWHVSDVFKDXIIHUGHFRQWHQDQWVGHQRXUULWXUH
IHUPpV/DSUHVVLRQSRXUUDLWIDLUHH[SORVHUOH
contenant et ainsi causer des blessures.
Ŷ )DLWHVELHQFXLUHODYLDQGHHWODYRODLOOHjF°XU
la viande doit atteindre une température interne
PLQLPDOHGHƒ& ƒ) ODYRODLOOHGHƒ&
ƒ) /DFXLVVRQjFHVWHPSpUDWXUHVHVW
QRUPDOHPHQWVXIILVDQWHSRXUYRXVSURWpJHUGHV
LQWR[LFDWLRQVDOLPHQWDLUHV
AVERTISSEMENT! GARDER LES MATÉRIAUX INFLAMMABLES À
L’ÉCART DE LA TABLE DE CUISSON
Le non-respect de ces instructions pourrait entraîner un incendie ou une blessure.
Ŷ 1HUDQJH]QLQ¶XWLOLVH]GHPDWpULDX[LQIODPPDEOHV
jO¶LQWpULHXURXjSUR[LPLWpGHODWDEOHGHFXLVVRQ\
compris du papier, du plastique, des poignées, des
QDSSHVGHVUHYrWHPHQWVPXUDX[GHVULGHDX[GHV
stores ainsi que de l’essence ou d’autres vapeurs ou
OLTXLGHVLQIODPPDEOHV
Ŷ 1HSRUWH]MDPDLVGHYrWHPHQWVDPSOHVORUVTXH
vous utilisez cette table de cuisson. Ces vêtements
SRXUUDLHQWV¶HQIODPPHUV¶LOVHQWUHQWHQFRQWDFWDYHF
GHVVXUIDFHVFKDXGHVFHTXLSRXUUDLWHQWUDvQHUGHV
brûlures graves.
2
Ŷ 1
HODLVVH]SDVV¶DFFXPXOHUODJUDLVVHGHFXLVVRQRX
DXWUHVPDWLqUHVLQIODPPDEOHVVXUODWDEOHGHFXLVVRQ
RXjSUR[LPLWpGHFHOXLFL&HWWHJUDLVVHSRXUUDLW
V¶HQIODPPHU
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
49-80742
Ŷ '
DQVO¶pYHQWXDOLWpG¶XQLQFHQGLHQ¶XWLOLVH]SDVG¶HDX
SRXUWHQWHUG¶pWHLQGUHXQIHXFDXVpSDUGHODJUDLVVH
1¶HPSRLJQH]MDPDLVXQHSRrOHHQIHXeWHLJQH]OHV
FRPPDQGHV 2II 3RXUpWRXIIHUOHVIODPPHVG¶XQH
SRrOHHQIHXVXUXQpOpPHQWGHVXUIDFHFRXYUH]
celle-ci complètement avec un couvercle bien adapté,
XQHW{OHjELVFXLWVRXXQSODWHDXSODW8WLOLVH]XQ
H[WLQFWHXUjSRXGUHRXjPRXVVHG¶XVDJHVPXOWLSOHV
Ŷ 1HODLVVH]MDPDLVOHVpOpPHQWVGHVXUIDFHVDQV
VXUYHLOODQFHV¶LOVVRQWUpJOpVjPR\HQQHRXKDXWH
température. Les débordements par bouillonnement
HQJHQGUHQWGHODIXPpHHWGHO¶pFRXOHPHQWGHJUDLVVH
TXLSHXWSUHQGUHIHX
Ŷ 1HODLVVH]MDPDLVGHO¶KXLOHVDQVVXUYHLOODQFHHQ
FRXUVGHIULWXUH/¶KXLOHTXLFKDXIIHDXGHOjGHVRQ
SRLQWG¶pEXOOLWLRQSHXWSUHQGUHIHXHWHQIODPPHUOHV
DUPRLUHVHQYLURQQDQWHV8WLOLVH]XQWKHUPRPqWUHj
matière grasse le plus souvent possible pour surveiller
la température de l’huile.
AVERTISSEMENT!
Ŷ 3RXUpYLWHUXQUHQYHUVHPHQWG¶KXLOHHWO¶LQIODPPDWLRQ
XWLOLVH]XQHTXDQWLWpG¶KXLOHPLQLPDOHORUVG¶XQHIULWXUH
GDQVXQHSRrOHSHXSURIRQGHHWpYLWH]GHFXLUH
des aliments congelés qui contiennent une grande
proportion de glace.
Ŷ 8WLOLVH]XQHSRrOHGHWDLOOHDSSURSULpH²&KRLVLVVH]
GHVXVWHQVLOHVGHFXLVLQHjIRQGSODWVXIILVDPPHQW
JUDQGVSRXUFRXYULUODVXUIDFHGHO¶pOpPHQWFKDXIIDQW
$XWUHPHQWXQHSDUWLHGHO¶pOpPHQWGHVXUIDFH
VHUDGLUHFWHPHQWH[SRVpSRVDQWDLQVLXQULVTXH
G¶LQIODPPDWLRQGHVYrWHPHQWV8QHERQQHDGDSWDWLRQ
GHO¶XVWHQVLOHjO¶pOpPHQWGHVXUIDFHDPpOLRUHDXVVL
O¶HIILFDFLWpGHODFXLVVRQ
Ŷ 3RXUUpGXLUHOHVULVTXHVGHEU€OXUHG¶DOOXPDJHGH
PDWLqUHVLQIODPPDEOHVHWGHGpERUGHPHQWODSRLJQpH
de l’ustensile doit être orientée vers le centre de la
table de cuisson sans se prolonger au-dessus des
pOpPHQWVGHVXUIDFHDGMDFHQWV
CONSIGNES DE SÉCURITÉ
AVERTISSEMENT! &216,*1(6'(6e&85,7e³7$%/('(&8,6621
CONSIGNES DE SÉCURITÉ RELATIVES À LA TABLE
DE CUISSON À INDUCTION
Ŷ )
DLWHVDWWHQWLRQORUVGXFRQWDFWDYHFODWDEOHGH
FXLVVRQ/DVXUIDFHYLWUpHGHODWDEOHGHFXLVVRQ
FRQVHUYHUDODFKDOHXUDSUqVO¶H[WLQFWLRQGHV
commandes.
Ŷ 1HFXLVLQH]SDVVXUXQHWDEOHGHFXLVVRQ
HQGRPPDJpH$GYHQDQWOHEULVGHODWDEOHGHFXLVVRQ
HQYLWURFpUDPLTXHOHVVROXWLRQVGHQHWWR\DJHHWOHV
débordements pourraient pénétrer dans la table de
cuisson et générer un risque de décharge électrique.
&RQWDFWH]VXUOHFKDPSXQWHFKQLFLHQTXDOLILp
Ŷ eYLWH]GHUD\HUODYLWUHGHODWDEOHGHFXLVVRQ/D
WDEOHGHFXLVVRQHVWVXVFHSWLEOHG¶rWUHpUDIOpHSDUOHV
FRXWHDX[OHVLQVWUXPHQWVSRLQWXVOHVDQQHDX[RX
DXWUHVELMRX[HWOHVULYHWVSUpVHQWVVXUOHVYrWHPHQWV
Ŷ 1HPHWWH]HWQHUDQJH]SDVG¶REMHWVTXLSRXUUDLHQW
IRQGUHRXSUHQGUHHQIHXVXUODWDEOHGHFXLVVRQHQ
vitrocéramique, et ce, même lorsque vous ne l’utilisez
SDV,OVSRXUUDLHQWSUHQGUHIHXVLODWDEOHGHFXLVVRQ
est activée accidentellement. De plus, la chaleur
provenant de la table de cuisson ou de la ventilation
GXIRXUSRXUUDLWDYRLUOHPrPHHIIHW
Ŷ 3RXUQHWWR\HUODWDEOHGHFXLVVRQXWLOLVH]OH
QHWWR\DQWSRXUWDEOHjFXLVVRQHQYLWURFpUDPLTXH
&(5$0$%5<7(®HWOHWDPSRQGHQHWWR\DJH
&(5$0$%5<7(®$YDQWGHSURFpGHUDXQHWWR\DJH
DWWHQGH]TXHODWDEOHGHFXLVVRQVRLWUHIURLGLHHWTXH
OHWpPRLQOXPLQHX[VHVRLWpWHLQW8QHpSRQJHRX
XQFKLIIRQKXPLGHVXUXQHVXUIDFHFKDXGHULVTXH
de causer des blessures dues à la vapeur. Certains
QHWWR\DQWVSHXYHQWSURGXLUHGHVIXPpHVWR[LTXHV
GDQVOHFDVG¶XQHDSSOLFDWLRQVXUXQHVXUIDFH
chaude. Lisez et respectez toutes les instructions
et avertissements sur les étiquettes des crèmes de
QHWWR\DJHREMARQUE : Les dégâts de matières
VXFUpHVFRQVWLWXHQWXQHH[FHSWLRQ,OIDXWOHVJUDWWHU
alors qu’ils sont encore chauds à l’aide de gants
GHFXLVLQHHWG¶XQJUDWWRLU3RXUREWHQLUGHSOXV
amples renseignements, consultez la section sur le
QHWWR\DJHGHODWDEOHGHFXLVVRQHQYLWURFpUDPLTXH
Ŷ
MISE EN GARDE
: Les personnes qui
vivent avec un stimulateur cardiaque ou un appareil
PpGLFDOVLPLODLUHGRLYHQWIDLUHSUHXYHGHSUXGHQFH
ORUVTX¶HOOHVXWLOLVHQWRXTX¶HOOHVVHWLHQQHQWjSUR[LPLWp
G¶XQHWDEOHGHFXLVVRQHQIRQFWLRQ/HFKDPS
pOHFWURPDJQpWLTXHSHXWDIIHFWHUODERQQHPDUFKHGX
VWLPXODWHXUFDUGLDTXHRXGXGLVSRVLWLIPpGLFDOVLPLODLUH
Il est conseillé de consulter votre médecin ou le
IDEULFDQWGXVWLPXODWHXUVXUYRWUHVLWXDWLRQSDUWLFXOLqUH
AVERTISSEMENT! PERTURBATION RADIOÉLECTRIQUE
&HWDSSDUHLODpWpWHVWpHWLOHVWFRQIRUPHDX[OLPLWHV
G¶XQGLVSRVLWLIQXPpULTXHGHFODVVH%FRQIRUPpPHQWj
ODSDUWLHGHVUqJOHV)&&&HVOLPLWHVVRQWFRQoXHV
SRXUIRXUQLUXQHSURWHFWLRQUDLVRQQDEOHFRQWUHOHV
LQWHUIpUHQFHVQRFLYHVGDQVXQHLQVWDOODWLRQGRPHVWLTXH
Cet appareil génère, utilise et peut émettre de l’énergie
VRXVODIRUPHGHIUpTXHQFHUDGLRHWV¶LOQ¶HVWSDV
LQVWDOOpHWXWLOLVpHQFRQIRUPLWpDYHFOHVLQVWUXFWLRQV
LOSHXWSURYRTXHUGHVLQWHUIpUHQFHVQRFLYHVVXUOHV
FRPPXQLFDWLRQVUDGLR&HSHQGDQWLOQ¶H[LVWHDXFXQH
JDUDQWLHTXHGHVLQWHUIpUHQFHVVHSURGXLURQWGDQVXQH
installation particulière. Si cet appareil provoque des
LQWHUIpUHQFHVQRFLYHVVXUODUpFHSWLRQUDGLRRXWpOpYLVLRQ
ce qui peut être détecté en mettant l’appareil sous
HWKRUVWHQVLRQO¶XWLOLVDWHXUHVWHQFRXUDJpjHVVD\HU
GHFRUULJHUFHVLQWHUIpUHQFHVHQDSSOLTXDQWO¶XQHRX
plusieurs des mesures suivantes :
Ŷ 5pRULHQWH]RXGpSODFH]O¶DQWHQQHUpFHSWULFH
Ŷ $XJPHQWH]ODGLVWDQFHHQWUHO¶DSSDUHLOHWOHUpFHSWHXU
Ŷ %UDQFKH]O¶DSSDUHLOGDQVXQHSULVHRXXQFLUFXLW
GLIIpUHQWGHFHOXLVXUOHTXHOHVWEUDQFKpOHUpFHSWHXU
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
49-80742
3
GARANTIE
Merci ... d’avoir acheté un appareil GE !
Enregistrez votre appareil : (QUHJLVWUH]YRWUHQRXYHODSSDUHLOHQOLJQHjWRXWPRPHQW
www.geappliances.com/service_and_support/register/
Si vous enregistrez votre produit sans délai, la communication sera meilleure et le service plus rapide en vertu des conditions de votre
JDUDQWLHVLVRQXWLOLVDWLRQV¶DYqUHQpFHVVDLUH9RXVSRXYH]pJDOHPHQWHQYR\HUSDUODSRVWHODFDUWHG¶HQUHJLVWUHPHQWSUpLPSULPpH
LQFOXVHGDQVOHVPDWpULDX[G¶HPEDOODJH
Garantie couvrant la table de cuisson électrique GE
GEAppliances.com
7RXWHQWUHWLHQRXUpSDUDWLRQHQYHUWXGHODJDUDQWLHHVWIRXUQLSDUQRV&HQWUHVG¶HQWUHWLHQHWGHUpSDUDWLRQGHO¶XVLQH
ou par un technicien autorisé de Customer Care®3RXUIL[HUXQUHQGH]YRXVHQOLJQHFRQVXOWH]QRWUHVLWH
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWRXWpOpSKRQH]DX*(&$5(6 9HXLOOH]DYRLUYRV
numéros de série et de modèle à portée de main lors de l’appel.
/¶HQWUHWLHQGHYRWUHDSSDUHLOSRXUUDLWQpFHVVLWHUO¶XWLOLVDWLRQG¶XQDFFqVDX[GRQQpHVHPEDUTXpHVSRXUOHGLDJQRVWLF
&HODSHUPHWDXWHFKQLFLHQGHO¶DWHOLHUGHUpSDUDWLRQ*(GHGLDJQRVWLTXHUUDSLGHPHQWWRXWHGpIDLOODQFHGHYRWUH
pOHFWURPpQDJHUHWj*(G¶DPpOLRUHUODTXDOLWpGHVHVSURGXLWV6LYRXVQHVRXKDLWH]SDVWUDQVPHWWUHOHVGRQQpHVGH
YRWUHDSSDUHLOj*(YHXLOOH]DYLVHUYRWUHWHFKQLFLHQGHV¶HQDEVWHQLUDXPRPHQWGHODYLVLWHGHVHUYLFH
'XUDQWXQHSpULRGHGHXQ DQjSDUWLUGHODGDWHG¶DFKDWLQLWLDO*(UHPSODFHUDWRXWHSLqFHGpIHFWXHXVHHQUDLVRQ
G¶XQYLFHGHPDWLqUHRXGHIDEULFDWLRQ'XUDQWFHWWHJDUDQWLHOLPLWpHGHXQ DQ*(DVVXPHUDDXVVLWRXVOHVIUDLVGH
PDLQG¶°XYUHHWGHVHUYLFHjGRPLFLOHYLVDQWjUHPSODFHUODSLqFHGpIHFWXHXVH
$JUDIH]LFLYRWUHUHoX8QHSUHXYHGHO¶DFKDWRULJLQDOHVWUHTXLVH
SRXUO¶DFFqVjOµHQWUHWLHQHWDX[UpSDUDWLRQVHQYHUWXGHODJDUDQWLH
Ce que GE ne couvre pas :
Ŷ /
¶HQYRLG¶XQWHFKQLFLHQFKH]YRXVSRXUYRXVPRQWUHU
comment utiliser le produit.
Ŷ 8QHLQVWDOODWLRQXQHOLYUDLVRQRXXQHQWUHWLHQ
inadéquats.
Ŷ 8QHSDQQHGXSURGXLWVXLWHjXQHXWLOLVDWLRQDEXVLYHRX
LQDGpTXDWHXQHPRGLILFDWLRQXQXVDJHDXWUHTXHFHOXL
auquel il a été destiné ou un usage commercial.
Ŷ /HUHPSODFHPHQWGHVIXVLEOHVGHYRWUHUpVLGHQFHRXOH
UpHQFOHQFKHPHQWGHVGLVMRQFWHXUV
Ŷ /
HVGRPPDJHVDXSURGXLWFDXVpVSDUXQDFFLGHQWXQ
incendie, une inondation ou une catastrophe naturelle.
Ŷ /
HVGRPPDJHVLQGLUHFWVRXDFFLGHQWHOVFDXVpVSDUGHV
GpIDLOODQFHVSRVVLEOHVGHFHWDSSDUHLO
Ŷ /
HVGRPPDJHVVXUYHQXVDSUqVODOLYUDLVRQ
Ŷ /
HVHUYLFHV¶LOHVWLPSRVVLEOHG¶DYRLUDFFqVDXSURGXLW
Ŷ /
HVHUYLFHSRXUUpSDUHURXUHPSODFHUOHVDPSRXOHVj
O¶H[FHSWLRQGHVODPSHV'(/
EXCLUSION DES GARANTIES IMPLICITES
Votre seul et unique recours est la réparation du produit selon les dispositions de la présente garantie limitée. Toutes
JDUDQWLHVLPSOLFLWHV\FRPSULVOHVJDUDQWLHVLPSOLFLWHVGHTXDOLWpPDUFKDQGHHWG¶DGpTXDWLRQjXQXVDJHVSpFLILTXH
sont limitées à un an ou à la plus courte période permise par la loi.
&HWWHJDUDQWLHHVWRIIHUWHjO¶DFKHWHXULQLWLDOHWjWRXWSURSULpWDLUHVXEVpTXHQWG¶XQSURGXLWDFKHWpDX[eWDWV8QLVjGHV
ILQVG¶XVDJHGRPHVWLTXH6LOHSURGXLWHVWVLWXpGDQVXQHORFDOLWpRXQUpSDUDWHXUDXWRULVp*(Q¶HVWSDVGLVSRQLEOH
YRXVSRXUULH]HQFRXULUGHVIUDLVGHGpSODFHPHQWRXGHYRLUDFKHPLQHUOHSURGXLWjXQUpSDUDWHXUDXWRULVp*(SRXU
IDLUHUpSDUHUO¶DSSDUHLO(Q$ODVNDFHWWHJDUDQWLHH[FOXWOHVIUDLVG¶H[SpGLWLRQHWOHVYLVLWHVGHVHUYLFHjYRWUHGRPLFLOH
&HUWDLQVeWDWVRXSURYLQFHVQHSHUPHWWHQWSDVO¶H[FOXVLRQRXODUHVWULFWLRQGHVGRPPDJHVDFFHVVRLUHVRXLQGLUHFWV
Certains droits particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres
GURLWVTXLYDULHQWVHORQYRWUHOLHXGHUpVLGHQFH3RXUFRQQDvWUHODQDWXUHH[DFWHGHYRVGURLWVFRQVXOWH]O¶RUJDQLVPH
GHSURWHFWLRQGXFRQVRPPDWHXUGHYRWUHUpJLRQRXHQFRUHOHEXUHDXGXSURFXUHXUJpQpUDOGHO¶eWDW
Garant : General Electric Company. Louisville, KY 40225
Prolongation de garantie :$FKHWH]XQFRQWUDWG¶HQWUHWLHQ*(HWLQIRUPH]YRXVGHVUDEDLVVSpFLDX[HQYLJXHXU
pendant toute la durée de votre garantie. Vous pouvez vous le procurer en tout temps sur
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP
RXHQFRPSRVDQWOHGXUDQWOHVKHXUHVQRUPDOHVGHEXUHDX/HVVHUYLFHVjGRPLFLOH*(VHURQWWRXMRXUV
GLVSRQLEOHVDSUqVO¶H[SLUDWLRQGHODJDUDQWLH
4
49-80742
&RQVXOWH]OHVLWHLQWHUQHWGHVDSSDUHLOV*( www.geappliances.com/service_and_support/ KHXUHVVXU
MRXUVVXU3RXUXQHSOXVJUDQGHFRPPRGLWpHWSRXUXQVHUYLFHSOXVUDSLGHYRXVSRXYH]PDLQWHQDQWWpOpFKDUJHUOHV
PDQXHOVG¶XWLOLVDWLRQFRPPDQGHUFHUWDLQHVSLqFHVHWPrPHIL[HUXQUHQGH]YRXVSRXUO¶HQWUHWLHQHQOLJQH
Rendez-vous pour l’entretien : Le service de réparation
SDUXQH[SHUWGH*(QHVHWURXYHTX¶jXQSDVGHYRWUH
SRUWH&RQQHFWH]YRXVj,QWHUQHWHWIL[H]YRWUHUHQGH]
vous sur www.geappliances.com/service_and_support/
RXDSSHOH]OH*(&$5(6 SHQGDQW
les heures de bureau.
Pièces et accessoires : /HVSHUVRQQHVTXDOLILpHVSRXU
entretenir leur propre appareil peuvent recevoir des pièces
RXGHVDFFHVVRLUHVGLUHFWHPHQWFKH]HX[ OHVFDUWHV9LVD
0DVWHU&DUGHW'LVFRYHUVRQWDFFHSWpHV &RPPDQGH]
HQOLJQHGqVDXMRXUG¶KXLKHXUHVVXURXDSSHOH]DX
SHQGDQWOHVKHXUHVGHEXUHDX
Les instructions qui se trouvent dans le présent manuel
FRXYUHQWOHVSURFpGXUHVGHYDQWrWUHHIIHFWXpHVSDU
n’importe quel utilisateur. L’entretien et les réparations qui
QHVHWURXYHQWSDVLFLGRLYHQWJpQpUDOHPHQWrWUHFRQILpV
jGXSHUVRQQHOTXDOLILp,OHVWQpFHVVDLUHGHIDLUHSUHXYH
de prudence, un entretien inapproprié pourrait entraîner
une utilisation non-sécuritaire de l’appareil.
Contactez-nous : 6LYRXVQ¶rWHVSDVVDWLVIDLWGXVHUYLFH
TXHYRXVUHFHYH]GH*(FRQWDFWH]QRXVDXPR\HQGH
QRWUHVLWHLQWHUQHWHQQRXVIRXUQLVVDQWWRXVOHVGpWDLOV
QpFHVVDLUHV\FRPSULVYRWUHQXPpURGHWpOpSKRQHRX
écrivez à :
General Manager, Customer Relations
GE Appliances, Appliance Park Louisville, KY 40225
Pièces et accessoires
3RXUSDVVHUFRPPDQGHFRQVXOWH]QRWUHVLWHLQWHUQHWjO¶DGUHVVHVXLYDQWH
www.GEApplianceParts.com 86 RXwww.GEAppliances.ca &DQDGD ou composez le 800.626.2002 86 800.661.1616 &DQDGD
Les pièces suivantes sont disponibles :
Pièces
3ODTXHFKDXIIDQWH
-;*5,'/
7URXVVHVRXVYLGH
-;62869
1HWWR\DQWHWSROLVVHXUSRXUDFLHULQR[\GDEOH
30;
ASSISTANCE / PIÈCES ET ACCESSOIRES
Vous avez une question ou vous avez besoin d’assistance avec votre appareil ?
Comment retirer le film protecteur d’expédition et le ruban adhésif d’emballage
6DLVLVVH]GpOLFDWHPHQWXQFRLQGXILOPSURWHFWHXU
G¶H[SpGLWLRQDYHFYRVGRLJWVHWOHGpFROOHUOHQWHPHQWGHOD
VXUIDFHGHO¶DSSDUHLO1¶XWLOLVH]SDVG¶REMHWVSRLQWXVSRXU
UHWLUHUOHILOP5HWLUH]FRPSOqWHPHQWOHILOPDYDQWG¶XWLOLVHU
O¶DSSDUHLOSRXUODSUHPLqUHIRLV
49-80742
3RXUDVVXUHUQHSDVHQGRPPDJHUODILQLWLRQGXSURGXLW
ODIDoRQODSOXVV€UHSRXUHQOHYHUOHUXEDQDGKpVLI
GHO¶HPEDOODJHVXUOHVQRXYHDX[DSSDUHLOVFRQVLVWHj
appliquer un détergent à vaisselle liquide à l’aide d’un
FKLIIRQGRX[HWjODLVVHUWUHPSHU
REMARQUE : /HUXEDQDGKpVLIGRLWrWUHUHWLUpGHWRXWHV
les pièces. Il ne pourra pas être retiré après cuisson.
5
UTILISATION DE LA TABLE DE CUISSON: Fonctions de la table de cuisson
6
Fonctions de la table de cuisson
Dans le présent manuel, les caractéristiques et leur apparence peuvent être différentes de celles de votre modèle.
1
2
Table de cuisson de 30 po
3
6
8
7
4
5
Commandes de l’interface utilisateur
1
2
Table de cuisson de 36 po
3
6
8
7
4
5
Commandes de l’interface utilisateur
1. Cooking Element(s) (élément(s) de cuisson) :9RLUOD)LJXUH
2. Element On/Off (Touche marche/arrêt):9RLUOD)LJXUH
3. Sync Burners (synchronisation des brûleurs) :9RLUOD)LJXUH
4. All Off (tous éteints) :9RLUOD)LJXUH
5. Lock (verrouillage) :9RLUOD)LJXUH
6. Timer On/Off (Activation/désactivation de la minuterie) :9RLUOD)LJXUH
7. Display (affichage) :9RLUOD)LJXUH
8. Start Timer (Pour activer la minuterie) :9RLUOD)LJXUH
49-80742
0LVHHQPDUFKHG¶XQRXGHSOXVLHXUVEU€OHXUV$SSX\H]VXU
la touche On/Off (marche/arrêt)HWPDLQWHQH]ODHQIRQFpH
SHQGDQWHQYLURQXQHGHPLHVHFRQGH&KDTXHIRLVTXHYRXV
DSSX\H]VXUXQHWRXFKHYRXVHQWHQGUH]XQVRQ
Vous pouvez sélectionner le niveau de puissance de n’importe
laquelle des manières suivantes :
$SSX\H]VXUOHVWRXFKHV+ ou - pour régler le niveau de
puissance, ou;
3RXUSDVVHUUDSLGHPHQWjODSXLVVDQFHpOHYpH +L Immédiatement après avoir mis l’élément en marche,
DSSX\H]VXUODWRXFKH+ ou;
3RXUSDVVHUUDSLGHPHQWjODEDVVHWHPSpUDWXUH /R Immédiatement après avoir mis l’élément en marche,
DSSX\H]VXUODWRXFKH-.
Extinction d’un ou de plusieurs brûleurs
$SSX\H]VXUODWRXFKHOn/Off pour éteindre un seul brûleur ou
sur la touche All Off pour les éteindre tous.
49-80742
UTILISATION DE LA TABLE DE CUISSON: Fonctionnement des éléments de cuisson / Extinction d’un ou de plusieurs brûleurs
Fonctionnement des éléments de cuisson
7
UTILISATION DE LA TABLE DE CUISSON: Sélection des réglages de la table de cuisson / Comment synchroniser les éléments de gauche
8
Sélection des réglages de la table de cuisson
Choisissez l’élément/brûleur qui est le plus adéquat pour la
taille de l’ustensile de cuisine. Chaque élément/brûleur de
votre nouvelle table de cuisson possède son propre niveau de
puissance variant d’une chaleur basse à élevée. Les réglages
du niveau de puissance pour la cuisson varieront selon
O¶XVWHQVLOHGHFXLVLQHXWLOLVpOHW\SHHWODTXDQWLWpGHVDOLPHQWV
HWOHUpVXOWDWVRXKDLWp'HIDoRQJpQpUDOHXWLOLVH]OHVUpJODJHV
LQIpULHXUVSRXUIDLUHIRQGUHPDLQWHQLUODWHPSpUDWXUHRXIDLUH
PLMRWHUHWXWLOLVHUOHVUpJODJHVVXSpULHXUVSRXUIDLUHFKDXIIHU
UDSLGHPHQWJULOOHUHWIULUH/RUVTXHYRXVVRXKDLWH]PDLQWHQLU
des aliments chauds, assurez-vous que le réglage choisi est
VXIILVDQWSRXUPDLQWHQLUODWHPSpUDWXUHGHVDOLPHQWVDXGHOj
GHƒ)/HVpOpPHQWVSOXVJUDQGVHWFHX[SRXUOHVTXHOV
LOHVWLQGLTXp©.HHS:DUPª JDUGHUFKDXG QHVRQWSDV
UHFRPPDQGpVSRXUIDLUHIRQGUHGHVDOLPHQWV
©+LªFRUUHVSRQGDXQLYHDXGHSXLVVDQFHOHSOXVpOHYpLOHVW
FRQoXSRXUODFXLVVRQUDSLGHGHJUDQGHVTXDQWLWpVHWSRXU
DPHQHUjpEXOOLWLRQ/HUpJODJH©+LªIRQFWLRQSHQGDQWDX
PD[LPXPPLQXWHV,OHVWSRVVLEOHGHUpSpWHUOHUpJODJH©+Lª
DSUqVOHF\FOHGHPLQXWHVLQLWLDOHQDSSX\DQWVXUODWRXFKH+.
MISE EN GARDE :
1HSODFH]QLXVWHQVLOH
GHFXLVLQHQLFDVVHUROHVXUOHVWRXFKHVGHFRPPDQGHHWQ¶\
laissez aucune accumulation d’eau. Si une de ces situations
GXUHSOXVLHXUVVHFRQGHVLO\DULVTXHGHUHQGUHOHVWRXFKHV
inopérantes et d’éteindre la table de cuisson.
Hi (haut)
ébullition rapide
frire
griller
réduire
frémir
maintenir
Low (bas)
fondre
Comment synchroniser les éléments de gauche
Pour activer
Pour désactiver
0DLQWHQH]ODWRXFKHSync BurnersHQIRQFpHSHQGDQWHQYLURQ
XQHGHPLVHFRQGHSRXUEUDQFKHUOHVGHX[EU€OHXUV3RXUUpJOHU
le niveau de puissance, utilisez l’un ou l’autre des éléments
comme décrit à la page 7.
3RXUGpVDFWLYHUODV\QFKURQLVDWLRQGHVEU€OHXUVDSSX\H]
sur la touche On/Off sur l’un ou l’autre des brûleurs.
ou
3RXUGpVDFWLYHUOHVGHX[EU€OHXUVDSSX\H]VXUODWRXFKH
Sync Burners.
49-80742
/DWDEOHGHFXLVVRQGHSRGLVSRVHGH]RQHVGHFXLVVRQ
HWFHOOHGHSRHQD6LGHX[pOpPHQWVGDQVODPrPH
zone sont en cours d’utilisation et qu’au moins un élément
HVWDXQLYHDXGHSXLVVDQFHPD[LPXP +L OHUpJODJH©+Lª
Zone de gauche
Zone de droite
IRQFWLRQQHUDjXQQLYHDXGHSXLVVDQFHUpGXLW9HXLOOH]QRWHUTXH
O¶DIILFKDJHQHFKDQJHUDSDV9RLOjFRPPHQWODSXLVVDQFHHVW
SDUWDJpHHQWUHGHX[pOpPHQWVGDQVODPrPH]RQHGHFXLVVRQ
Zone de gauche
Table de cuisson de 30 po.
Zone centrale
Zone de droite
Table de cuisson de 36 po.
Verrouillage de la table de cuisson
Verrouillage
0DLQWHQH]ODWRXFKHGHYHUURXLOODJHHQIRQFpHSHQGDQW
secondes.
Déverrouillage
0DLQWHQH]ODWRXFKHGHYHUURXLOODJHHQIRQFpH
Verrouillage de la table de cuisson verrouillage des commandes
Minuterie
Pour activer
Pour désactiver
Touchez la touche On/Off (marche/arrêt) de la minuterie.
Touchez les touches + ou - pour sélectionner le nombre de
minutes souhaité. Touchez la touche Start Timer pour activer
la minuterie.
0DLQWHQH]ODWRXFKHOn/Off (marche/arrêt) de la minuterie
pour désactiver la minuterie.
49-80742
REMARQUE : 8WLOLVH]ODPLQXWHULHGHFXLVLQHSRXUPHVXUHUOH
temps de cuisson ou comme rappel. La minuterie de cuisine ne
contrôle pas les éléments de cuisson. La minuterie se désactive
V¶LOQ¶\DDXFXQHDFWLYLWpSHQGDQWSOXVGHVHFRQGHV
UTILISATION DE LA TABLE DE CUISSON: Partage De Puissance / Verrouillage de la table de cuisson / Minuterie
Partage De Puissance
9
UTILISATION DE LA TABLE DE CUISSON: Témoin lumineux de surface chaude / Détection de l’enlèvement d’une casserole
10
Témoin lumineux de surface chaude
8QWpPRLQOXPLQHX[GHVXUIDFHFKDXGH XQSRXUFKDFXQGHV
pOpPHQWVGHFXLVVRQ V¶DOOXPHORUVTXHODVXUIDFHHQYLWUHHVW
FKDXGHHWHOOHGHPHXUHFKDXGHMXVTX¶jFHTXHODVXUIDFHVH
VRLWUHIURLGLHjXQSRLQWRLOHVWVpFXULWDLUHG¶\WRXFKHU
Témoin
lumineux de
surface chaude
Détection de l’enlèvement d’une casserole
/RUVTX¶RQUHWLUHXQHFDVVHUROHGHODVXUIDFHGHFXLVVRQ
le niveau de puissance du brûleur est désactivé; La
WRXFKH2Q2II PDUFKHDUUrW FRPPHQFHjFOLJQRWHU6LDXFXQH
FDVVHUROHQ¶HVWGpWHFWpHSHQGDQWVHFRQGHVODFRPPDQGH
est automatiquement désactivée et les témoins s’éteignent.
La touche On/OFF (marche/arrêt) clignote
49-80742
/HVpOpPHQWVVLWXpVVRXVODVXUIDFHGHFXLVVRQSURGXLVHQWXQ
FKDPSPDJQpWLTXHTXLIDLWYLEUHUOHVpOHFWURQVGDQVOHUpFLSLHQW
HQPpWDOIHUUHX[SURGXLVDQWGHODFKDOHXU
/DVXUIDFHGHFXLVVRQHOOHPrPHQHFKDXIIHSDV/DFKDOHXUHVW
produite dans le récipient de cuisson et ne peut être générée
WDQWTXHOHUpFLSLHQWQ¶HVWSDVSODFpVXUODVXUIDFHGHFXLVVRQ
/DWDEOHGHFXLVVRQQHIRQFWLRQQHUDSDVVLXQWUqVSHWLW
XVWHQVLOHHQDFLHURXHQIHU LQIpULHXUjODWDLOOHPLQLPDOHHQ
ODUJHXU HVWSODFpVXUODVXUIDFHGHFXLVVRQORUVTXHO¶DSSDUHLO
HVWHQIRQFWLRQQHPHQW²FRPPHXQHVSDWXOHHQDFLHUGHV
FXLOOqUHVGHVFRXWHDX[HWG¶DXWUHVSHWLWVLQVWUXPHQWV
La cuisson par induction magnétique nécessite d’utiliser une
EDWWHULHGHFXLVLQHIDEULTXpHjSDUWLUGHPpWDX[IHUUHX[²GHV
PpWDX[VXUOHVTXHOVXQDLPDQWVHFROOHFRPPHOHIHURXO¶DFLHU
8WLOLVH]GHVUpFLSLHQWVGRQWODWDLOOHFRUUHVSRQGjFHOOHGH
O¶pOpPHQW/HUpFLSLHQWGRLWrWUHVXIILVDPPHQWJUDQGSRXUTXHOH
capteur de sécurité active l’élément.
T
m aille
in
.
/RUVTXHO¶pOpPHQWHVWDFWLYpOHUpFLSLHQWFRPPHQFHjFKDXIIHU
LPPpGLDWHPHQWHWVRQFRQWHQXVHUpFKDXIIH
Utilisez un récipient de la taille minimale pour chaque
élément. Le matériau du récipient est correct si un
aimant se colle sur son fond.
Bruit de cuisson
Batterie de cuisine « bruyante »
'LIIpUHQWVW\SHVGHEDWWHULHGHFXLVLQHSURGXLVHQWGHOpJHUV
VRQV/HVUpFLSLHQWVPDVVLIVFRPPHFHX[HQIRQWHpPDLOOpH
produisent moins de bruit que les récipients en acier
LQR[\GDEOHPXOWLFRXFKHSOXVOpJHUV/DWDLOOHGXUpFLSLHQWHWOD
quantité d’aliments, peuvent aussi contribuer au niveau sonore.
/RUVGHO¶XWLOLVDWLRQG¶pOpPHQWVDGMDFHQWVDYHFXQFHUWDLQ
niveau de puissance, les champs magnétiques peuvent
LQWHUDJLUHQWUHHX[HWSURGXLUHXQIDLEOHVLIIOHPHQWRXXQ
« bourdonnement » intermittent. Ces bruits peuvent être
réduits ou éliminés en diminuant ou en augmentant le niveau
de puissance de l’un ou de l’ensemble des éléments. Les
récipients qui recouvrent entièrement le cercle de l’élément
produiront moins de bruit.
49-80742
8QIDLEOHEUXLWGH©ERXUGRQQHPHQWªHVWQRUPDOQRWDPPHQW
avec une puissance élevée.
Sons que vous pourriez entendre : Il est possible que
vous entendiez un léger bourdonnement lorsque vous
FXLVLQH]HQPRGH+L&¶HVWQRUPDO/HVRQGpSHQGGXW\SH
d’ustensile de cuisine utilisé. Certains ustensiles produiront un
ERXUGRQQHPHQWSOXVIRUWVHORQOHPDWpULDXGDQVOHTXHOLOVVRQW
IDEULTXpV,OHVWSRVVLEOHG¶HQWHQGUHXQERXUGRQQHPHQWVLOH
FRQWHQXGHO¶XVWHQVLOHHVWIURLG3OXVO¶XVWHQVLOHVHUDFKDXGHW
plus le son diminuera. Sil le niveau de puissance est réduit, le
niveau sonore diminuera.
UTILISATION DE LA TABLE DE CUISSON: Fonctionnement De La Cuisson À Induction / Bruit de cuissona
Fonctionnement De La Cuisson À Induction
11
UTILISATION DE LA TABLE DE CUISSON: Choix De La Bonne Batterie De Cuisine À Utiliser
12
Choix De La Bonne Batterie De Cuisine À Utiliser
Utilisation d’une batterie de cuisine à la taille correcte
/HVFDVVHUROHVQRQIHUUHXVHVRXWURSSHWLWHVQHSHUPHWWURQWSDV
à l’élément à induction de se mettre en marche, et le témoin
21SRXUFHWpOpPHQWFOLJQRWHUDSHQGDQWVHFRQGHVSXLV
V¶pWHLQGUD6LXQHFDVVHUROHHVWUHWLUpHSHQGDQWSOXVGH
secondes, l’alimentation sera coupée.
8QUpFLSLHQWSOXVJUDQGTXHOHFHUFOHGHO¶pOpPHQWSHXW
rWUHXWLOLVpFHSHQGDQWODFKDOHXUVHGLIIXVHUDXQLTXHPHQW
au-dessus de l’élément.
3RXUGHPHLOOHXUVUpVXOWDWVOHUpFLSLHQWGRLWrWUHHQFRQWDFW
727$/DYHFODVXUIDFHYLWUpH
1HODLVVH]SDVOHIRQGGXUpFLSLHQWWRXFKHUODERUGXUH
métallique de la table de cuisson ou chevaucher les
commandes de la table de cuisson.
3RXUGHPHLOOHXUHVSHUIRUPDQFHVIDLWHVFRUUHVSRQGUHODWDLOOH
du récipient avec la taille de l’élément. L’utilisation d’un petit
récipient sur un grand brûleur générera moins de puissance à
n’importe quel niveau.
Diamètre
minimal du
récipient
12,7 cm (5”)
Diamètre
minimal du
récipient
11,4 cm
(4-1/2”)
Diamètre
minimal du
récipient
12,7 cm (5”)
Diamètre
minimal du
récipient
17,8 cm (7”)
Table de cuisson d’une largeur de 76,2 cm (30”). Utilisez la dimension de
casserole minimum recommandée pour chacun des éléments de cuisson.
Batterie de cuisine adaptée
8WLOLVH]XQHEDWWHULHGHFXLVLQHGHTXDOLWpjIRQGPDVVLISRXU
une meilleure répartition de la chaleur et même de meilleurs
résultats de cuisson. Choisissez une batterie de cuisine
IDEULTXpHHQDFLHULQR[\GDEOHDLPDQWpHQIRQWHpPDLOOpHHQ
DFLHUpPDLOOpRXDYHFXQHFRPELQDLVRQGHFHVPDWpULDX[
&HUWDLQHVEDWWHULHVGHFXLVLQHVRQWVSpFLDOHPHQWLGHQWLILpHV
SDUOHIDEULFDQWSRXUXQHXWLOLVDWLRQDYHFOHVWDEOHVGHFXLVVRQ
jLQGXFWLRQ8WLOLVH]XQDLPDQWSRXUWHVWHUODYDOLGLWpG¶XQH
batterie de cuisine.
/HVUpFLSLHQWVjIRQGSODWGRQQHQWOHVPHLOOHXUVUpVXOWDWV/HV
récipients à bord ou striés peuvent être utilisés.
Les récipients ronds donnent de meilleurs résultats. Les
UpFLSLHQWVjIRQGFRXUEHRXLQFOLQpQHFKDXIIHURQWOHVDOLPHQWV
de manière homogène.
3RXUODFXLVLQHDXZRNXWLOLVH]XQZRNjIRQGSODW1¶XWLOLVH]
SDVGHZRNSRVpVXUXQVRFOHFLUFXODLUH
Diamètre
minimal du
récipient
12,7 cm (5”)
Diamètre
minimal du
récipient
12,7 cm (5”)
Diamètre
minimal du
récipient
17,8 cm (7”)
Diamètre
minimal du
récipient
11,4 cm
(4-1/2”)
Diamètre
minimal du
récipient
13,3 cm (5-1/4”)
Table de cuisson d’une largeur de 91,4 cm (36”). Utilisez la dimension de
casserole minimum recommandée pour chacun des éléments de cuisson.
Utilisez des récipients à fond plat.
Utilisez une plaque chauffante.
Utilisez un wok à fond plat.
49-80742
Recommandations sur la batterie de cuisine
INCORRECTE
CORRECTE
Le récipient n’est pas centré sur la
surface de l’élément de cuisson.
Le récipient est correctement
centré sur la surface de l’élément
de cuisson.
Le fond ou les côtés du récipient
sont recourbés ou inclinés.
Le fond du récipient est plat.
Le récipient ne correspond pas
à la taille minimale requise par
l’élément de cuisson utilisé.
Le récipient correspond à ou
dépasse la taille minimale requise
par l’élément de cuisson utilisé.
Le fond du récipient repose sur la
bordure de la table de cuisson ou
ne repose pas complètement sur
la surface de l’élément de cuisson.
Le fond du récipient repose
entièrement sur la surface de
l’élément de cuisson.
Un manche trop lourd incline le
récipient.
Le récipient est correctement
équilibré.
Le fond du récipient est
partiellement magnétique.
Le fond du récipient est
entièrement magnétique.
/DEDWWHULHGHFXLVLQHGRLWrWUHHQFRQWDFWWRWDODYHFODVXUIDFH
de l’élément de cuisson.
8WLOLVH]GHVUpFLSLHQWVjIRQGSODWGRQWODWDLOOHFRUUHVSRQGj
l’élément de cuisson et à la quantité d’aliments à préparer.
/HVSODTXHVSRXUFXLVVRQjLQGXFWLRQ1(VRQW3$6
recommandées.
49-80742
UTILISATION DE LA TABLE DE CUISSON: Choix De La Bonne Batterie De Cuisine À Utiliser
Choix De La Bonne Batterie De Cuisine À Utiliser
13
UTILISATION DE LA TABLE DE CUISSON: Plaque chauffante
14
Plaque chauffante (accessoire en option)
Utilisation de la plaque chauffante
MISE EN GARDE Risque de brûlure
Ŷ Il est possible que la surface de la plaque chauffante soit suffisamment chaude pour vous causer des brûlures
pendant et après son utilisation. Mettez en place et retirez la plaque chauffante lorsqu’elle est froide et que tous les
éléments de la surface sont désactivés. Utilisez des gants de cuisine si vous devez toucher la plaque chauffante
lorsqu’elle est chaude. Dans le cas contraire, vous pourriez vous brûler.
Ŷ Mettez en place et retirez la plaque chauffante uniquement lorsqu’elle est froide et que tous les brûleurs de la
surface sont désactivés.
$YDQWG¶XWLOLVHUFHWXVWHQVLOHGHFXLVLQHSRXUODSUHPLqUHIRLVODYH]OHSRXUYRXVDVVXUHUTX¶LOHVWSURSUH3XLVHQGXLVH]
OpJqUHPHQWODVXUIDFHGHFXLVVRQG¶KXLOHGHFXLVLQH
Comment positionner la plaque chauffante
IMPORTANT :3RVLWLRQQHUHWXWLOLVH]WRXMRXUVYRWUHSODTXH
FKDXIIDQWHjO¶HPSODFHPHQWGpVLJQpVXUODWDEOHGHFXLVVRQ
Type d’aliments
Selon le réglage
de cuisson
5pFKDXIIHUGHVWRUWLOODV
0R\HQEDV
Crêpes
0R\HQEDV
+DPEXUJHU
¯XIVIULWV
&KDSHOHWGHVDXFLVVHVGpMHXQHUV
6DQGZLFKVFKDXGV FRPPHXQJULOOHGFKHHVH
0R\HQ
0R\HQEDV
0R\HQ
0R\HQEDV
/HVUpJODJHVGHODSODTXHFKDXIIDQWHVRQWFRQoXVFRPPHOLJQH
directrice et il est possible que vous deviez les adapter selon les
SUpIpUHQFHVGHFXLVVRQGHFKDFXQ
Utilisation de la plaque chauffante
REMARQUES IMPORTANTES :
Ŷ 1HWWR\H]ODSODTXHFKDXIIDQWHDYHFXQHpSRQJHHWXQ
GpWHUJHQWGRX[GDQVGHO¶HDXFKDXGH1¶XWLOLVH]3$6GH
tampon à récurer bleu ou vert ni de laine d’acier.
Ŷ eYLWH]GHFXLVLQHUGHVDOLPHQWVWUqVJUDLVVHX[HWSUHQH]
soin d’éviter les débordements de graisse pendant la
cuisson.
Ŷ 1HPHWWH]HWQHUDQJH]DXFXQREMHWVXUODSODTXH
FKDXIIDQWHPrPHORUVTXHYRXVQHO¶XWLOLVH]SDV/DSODTXH
SRXUUDLWGHYHQLUFKDXGHORUVGHO¶XWLOLVDWLRQGHVVXUIDFHV
DGMDFHQWHV
Ŷ eYLWH]G¶XWLOLVHUGHVXVWHQVLOHVPpWDOOLTXHVPXQLVG¶XQH
pointe acérée ou d’un bord irrégulier qui pourraient
HQGRPPDJHUODSODTXHFKDXIIDQWH1HFRXSH]SDV
G¶DOLPHQWVVXUODSODTXHFKDXIIDQWH
Ŷ 1¶XWLOLVH]SDVG¶XVWHQVLOHGHFXLVLQHFRPPHUpFLSLHQWGH
rangement pour l’huile des aliments. Il pourrait être taché
GHIDoRQSHUPDQHQWHHWRXGHVILVVXUDWLRQVWKHUPLTXHV
pourraient en résulter.
Ŷ $YHFOHWHPSVHWO¶XWLOLVDWLRQODSODTXHFKDXIIDQWHVH
décolorera.
Ŷ 1HQHWWR\H]SDVODSODTXHFKDXIIDQWHGDQVXQIRXU
DXWRQHWWR\DQW
Ŷ /DLVVH]WRXMRXUVO¶XVWHQVLOHGHFXLVLQHVHUHIURLGLUDYDQWGH
l’immerger dans l’eau.
Ŷ 1HVXUFKDXIIH]SDVODSODTXHFKDXIIDQWH
3RXUDFWLYHUODVXUIDFHSRXUODWRWDOLWpGHODSODTXHFKDXIIDQWH
XWLOLVH]ODIRQFWLRQ6\QF%XUQHU$SSX\H]VXUODWRXFKHSync
Burner SXLVDMXVWH]OHQLYHDXGHSXLVVDQFHVHORQOHUpJODJH
VRXKDLWpFRPPHGpFULWjODSDJH
49-80742
Nettoyage Normal Quotidien
8WLOLVH]ODFUqPHQHWWR\DQWH&(5$0$%5<7(® ur votre table
de cuisson en vitrocéramique.
3RXUHQWUHWHQLUHWSURWpJHUYRWUHWDEOHGHFXLVVRQHQ
YLWURFpUDPLTXHFRQIRUPH]YRXVDX[LQVWUXFWLRQVVXLYDQWHV
$YDQWG¶XWLOLVHUYRWUHWDEOHGHFXLVVRQSRXUODSUHPLqUHIRLV
QHWWR\H]ODDYHFGHODFUqPHQHWWR\DQWH&(5$0$%5<7(®
pour table de cuisson. Cela vous aidera à la protéger et à la
conserver propre.
9RWUHWDEOHGHFXLVVRQFRQVHUYHUDVRQDVSHFWQHXIVLYRXV
XWLOLVH]FKDTXHMRXUODFUqPHQHWWR\DQWH&(5$0$%5<7(®
pour table de cuisson.
6HFRXH]ELHQOHIODFRQGHFUqPHQHWWR\DQWH9HUVH]
TXHOTXHVJRXWWHVGHFUqPHQHWWR\DQWH&(5$0$%5<7(®
directement sur votre table de cuisson.
8WLOLVH]XQHVHUYLHWWHHQSDSLHU
RXXQHpSRQJH&(5$0$
%5<7(® pour table de cuisson en
YLWURFpUDPLTXHDILQGHQHWWR\HUOD
VXUIDFHGHODWDEOHGHFXLVVRQ
8WLOLVH]XQFKLIIRQRXXQHVHUYLHWWH
HQSDSLHUSRXUQHWWR\HUWRXWHOD
VXUIDFHGHODWDEOHGHFXLVVRQ3DV
besoin de rincer.
REMARQUE :9RXVGHYH]IDLUHELHQ Nettoyez votre table de
DWWHQWLRQGHQHSDVIDLUHFKDXIIHUOD cuisson chaque fois qu’elle
WDEOHGHFXLVVRQDYDQWGHODQHWWR\HU est sale. Utilisez la crème
nettoyante CERAMA BRYTE®
complètement.
pour table de cuisson.
Résidus Calcinés
REMARQUE:9RXVSRXYH]HQGRPPDJHUYRWUHVXUIDFHHQ
vitrocéramique si vous utilisez des éponges de récurage autres
que celles comprises avec votre appareil.
/DLVVH]UHIURLGLUODWDEOHGHFXLVVRQ
9HUVH]TXHOTXHVJRXWWHVGHFUqPHQHWWR\DQWH&(5$0$
%5<7(® sur tous les résidus calcinés.
¬O¶DLGHGHO¶pSRQJHGHUpFXUDJH&(5$0$%5<7(® pour
WDEOHGHFXLVVRQHQYLWURFpUDPLTXHIURWWH]OHVUpVLGXVHQ
H[HUoDQWODSUHVVLRQQpFHVVDLUH
6¶LOUHVWHGHVUpVLGXVUpSpWH]OHVRSpUDWLRQVLQGLTXpHV
ci-dessus.
3RXUPLHX[SURWpJHUDSUqVDYRLUHQOHYpOHVUpVLGXV
SROLVVH]WRXWHODVXUIDFHDYHFODFUqPHQHWWR\DQWH
&(5$0$%5<7(® et une serviette de papier.
Utilisez une éponge CERAMA BRYTE® pour table de
cuisson en vitrocéramique.
Résidus Calcinés Difficiles À Enlever
/DLVVH]UHIURLGLUODWDEOHGHFXLVVRQ
7HQH]XQJUDWWRLUjODPHVLPSOHjXQDQJOHG¶HQYLURQž
VXUODVXUIDFHGHYLWURFpUDPLTXHHWUDFOH]OHVUpVLGXV9RXV
GHYUH]H[HUFHUGHODSUHVVLRQVXUOHJUDWWRLUjODPHSRXUOHV
enlever.
$SUqVDYRLUHQOHYpOHVUpVLGXVDYHFOHJUDWWRLUjODPH
YHUVH]TXHOTXHVJRXWWHVGHFUqPHQHWWR\DQWH&(5$0$
%5<7(® pour table de cuisson sur les résidus calcinés.
8WLOLVH]O¶pSRQJH&(5$0$%5<7(® pour enlever les
résidus restants.
3RXUPLHX[SURWpJHUDSUqVDYRLUHQOHYpOHVUpVLGXV
SROLVVH]WRXWHODVXUIDFHDYHFODFUqPHQHWWR\DQWH
&(5$0$%5<7(® et une serviette de papier.
49-80742
On peut se procurer le grattoir CERAMA BRYTE® pour table de cuisson
en vitrocéramique et tous les accessoires recommandés dans nos
Centres de pièces détachées. Consultez les instructions dans la section
« Comment commander des pièces » à la page suivante.
REMARQUE : N’utilisez jamais une lame émoussée ou ébréchée.
ENTRETIEN ET NETTOYAGE: Nettoyage de la vitre de la table de cuisson
Nettoyage de la vitre de la table de cuisson
15
ENTRETIEN ET NETTOYAGE: Nettoyage de la vitre de la table de cuisson
16
Nettoyage de la vitre de la table de cuisson
Traces De Métal Et Rayures
)DLWHVDWWHQWLRQGHQHSDVIDLUHJOLVVHUGHVXVWHQVLOHVGH
cuisine sur votre table de cuisson. Ils laisseront des traces
GHPpWDOVXUODVXUIDFHGHYLWURFpUDPLTXH
Vous pourrez enlever ces traces en appliquant la crème
QHWWR\DQWH&(5$0$%5<7(® à l’aide de l’éponge
&(5$0$%5<7(® pour table de cuisson en vitrocéramique.
6
LYRXVODLVVH]GHVFDVVHUROHVUHFRXYHUWHVG¶XQHFRXFKH
G¶DOXPLQLXPRXGHFXLYUHFKDXIIHUjVHFOHXUPpWDOSHXW
laisser des traces noires sur la table de cuisson.
Vous devez enlever ces traces immédiatement, avant de
IDLUHFKDXIIHUjQRXYHDXODWDEOHGHFXLVVRQ$XWUHPHQWOHV
traces risquent de devenir permanentes.
REMARQUE:9pULILH]WRXMRXUVOHIRQGGHYRVFDVVHUROHVSRXU
vous assurer qu’elles n’aient pas d’aspérités qui risquent de
UD\HUODWDEOHGHFXLVVRQ
Dommages causés par du sucre chaud ou des matières plastiques fondues
Vous devez porter un soin particulier à l’enlèvement des substances chaudes pour éviter des dommages permanents à la surface
en vitrocéramique/HVGpJkWVGHPDWLqUHVVXFUpHV FRPPHOHVJHOpHVOHIXGJHOHVVXFUHULHVOHVVLURSV RXOHVSODVWLTXHVIRQGXV
SHXYHQWFDXVHUGHVSLT€UHVjODVXUIDFHGHYRWUHWDEOHGHFXLVVRQ QRQFRXYHUWHVSDUODJDUDQWLH jPRLQVTXHOHGpJkWVRLWHQOHYp
DORUVTX¶LOHVWHQFRUHFKDXG2QGRLWIDLUHSUHXYHG¶XQHJUDQGHSUXGHQFHORUVGHO¶HQOqYHPHQWGHVXEVWDQFHVFKDXGHV
$VVXUH]YRXVG¶XWLOLVHUXQJUDWWRLUQHXIWUDQFKDQWFRPPHXQUDVRLU
1¶XWLOLVH]SDVGHODPHpPRXVVpHRXHQPDXYDLVpWDW
e
WHLJQH]WRXWHVOHVXQLWpVGHODWDEOHGHFXLVVRQ(QOHYH]
toutes les casseroles chaudes.
3RUWH]GHVJDQWVGHFXLVLQH
D8WLOLVH]XQJUDWWRLUjODPHVLPSOH JUDWWRLU&(5$0$
%5<7(®SRXUWDEOHGHFXLVVRQHQYLWURFpUDPLTXH SRXU
UHSRXVVHUOHVPDWLqUHVIRQGXHVVXUXQHVXUIDFHIURLGH
de la table de cuisson.
E(QOHYH]OHVPDWLqUHVIRQGXHVDYHFXQHVHUYLHWWHHQ
papier.
9
RXVGHYH]ODLVVHUWRXWHPDWLqUHIRQGXHTXHYRXVQ¶DYH]
SDVUpXVVLjHQOHYHUMXVTX¶jFHTXHODWDEOHGHFXLVVRQ
UHIURLGLVVHFRPSOqWHPHQW
1
HUpXWLOLVH]MDPDLVODWDEOHGHFXLVVRQDYDQWG¶DYRLUHQOHYp
complètement les résidus.
REMARQUE:6¶LOV¶HVWGpMjIRUPpVXUYRWUHWDEOHGHFXLVVRQ
HQYLWURFpUDPLTXHGHVFUHX[RXGHVSLT€UHVYRXVGHYUH]OD
remplacer. Dans ce cas, vous devez appeler le service.
49-80742
Remarques
49-80742
17
Remarques
18
49-80742
Remarques
49-80742
19
TRUCS DE DÉPANNAGE
Trucs de dépannage ... Avant d’appeler le service à la clientèle
eFRQRPLVH]GXWHPSVHWGHO¶DUJHQW&RQVXOWH]OHVWDEOHDX[GHVSDJHVVXLYDQWHVHWYRXVQ¶DXUH]SHXWrWUHSDVjDSSHOHUOH
VHUYLFHjODFOLHQWqOH6LXQHHUUHXUVHSURGXLWGDQVO¶XWLOLVDWLRQGHVFRPPDQGHVXQFRGHGHGpIDLOODQFHV¶DIILFKHUD1RWH]OH
code d’erreur et contactez le service.
Problème
Cause possible
Que faire?
Les éléments de surface
n’assurent pas une
ébullition continue ou la
cuisson est lente
Utilisation d’un récipient incorrect.
8WLOLVH]GHVUpFLSLHQWVUHFRPPDQGpVSRXU
O¶LQGXFWLRQjIRQGSODWHWTXLFRUUHVSRQGHQWjOD
WDLOOHGHO¶pOpPHQWGHVXUIDFH
Les éléments de surface
ne fonctionnent pas
correctement
Réglages incorrects des commandes de la
table de cuisson.
9pULILH]TXHODFRPPDQGHDSSURSULpHHVWUpJOpH
FRUUHFWHPHQWSRXUO¶pOpPHQWGHVXUIDFHXWLOLVp
Témoin de l’arc du niveau
de puissance clignotant
Type incorrect de récipient.
8WLOLVH]XQDLPDQWSRXUYpULILHUTXHOHUpFLSLHQWHVW
compatible avec l’induction.
Récipient trop petit.
7pPRLQ©21ªTXLFOLJQRWHODGLPHQVLRQGHOD
FDVVHUROHHVWLQIpULHXUHjODWDLOOHPLQLPXPGH
O¶pOpPHQW&RQVXOWH]ODVHFWLRQ8WLOLVDWLRQG¶XQH
batterie de cuisine à la taille correcte.
Mauvaise position du récipient.
Centrez le récipient sur l’anneau de cuisson.
Les touches +, - ou de verrouillage ont
été touchées avant la mise en marche de
l’élément.
&RQVXOWH]OHFKDSLWUH©)RQFWLRQQHPHQWGHV
éléments de cuisson ».
Utilisation de mauvaises méthodes de
nettoyage.
8WLOLVH]OHVSURFpGXUHVGHQHWWR\DJH
UHFRPPDQGpHV&RQVXOWH]ODVHFWLRQ1HWWR\DJHGH
la vitre de la table de cuisson.
Utilisation d’un récipient avec des aspérités
sur le fond ou présence de particules (sable
ou sel) entre le récipient et la surface de la
table de cuisson.
Quelqu’un a fait glisser récipient à la
surface de la table de cuisson.
3RXUpYLWHUOHVUD\XUHVXWLOLVH]OHVSURFpGXUHVGH
QHWWR\DJHUHFRPPDQGpHV$VVXUH]YRXVTXHOHIRQG
des récipients est propre avant utilisation et utilisez
XQHEDWWHULHGHFXLVLQHDYHFGHVIRQGVOLVVHV
Des projections alimentaires n’ont pas été
nettoyées avant l’utilisation suivante.
&RQVXOWH]ODVHFWLRQ1HWWR\DJHGHODYLWUHGHOD
table de cuisson
Surface chaude sur un modèle avec une vitre
de table de cuisson légèrement colorée.
&¶HVWQRUPDO/DVXUIDFHSHXWDSSDUDvWUHGpFRORUpH
lorsqu’elle est chaude. C’est un phénomène
WHPSRUDLUHTXLGLVSDUDvWUDORUVTXHODYLWUHUHIURLGLUD
Plastique fondu sur la
surface
La table de cuisson chaude est entrée en
contact avec un plastique posé sur la table
de cuisson chaude.
&RQVXOWH]ODVHFWLRQ6XUIDFHYLWUpH±SRVVLELOLWp
G¶XQGRPPDJHGpILQLWLIGDQVODVHFWLRQ1HWWR\DJH
de la vitre de la table de cuisson.
Trou (ou échancrure) dans
la table de cuisson
Un mélange sucré chaud a été projeté sur
la table de cuisson.
&RQWDFWH]XQWHFKQLFLHQTXDOLILpSRXUXQ
remplacement.
Touches du clavier
inopérantes
Le clavier est sale.
1HWWR\H]OHFODYLHU
Un fusible de votre domicile peut avoir
grillé ou le disjoncteur a sauté.
5HPSODFH]OHIXVLEOHRXUpLQLWLDOLVH]OHGLVMRQFWHXU
La détection/mesure
de taille du récipient
ne fonctionne pas
correctement
Utilisation d’une batterie de cuisine
incorrecte.
8WLOLVH]XQUpFLSLHQWSODWFRPSDWLEOHDYHFO¶LQGXFWLRQ
et qui correspond à la taille minimale requise par
O¶pOpPHQWXWLOLVp&RQVXOWH]ODVHFWLRQ8WLOLVDWLRQ
d’une batterie de cuisine à la taille correcte.
Mauvais positionnement du récipient.
$VVXUH]YRXVTXHOHUpFLSLHQWHVWFHQWUpVXU
O¶pOpPHQWGHVXUIDFHFRUUHVSRQGDQW
Réglages incorrects des commandes de la
table de cuisson.
9pULILH]OHUpJODJHFRUUHFWGHODFRPPDQGH
Des bruits peuvent être entendus :
bourdonnement, sifflement et ronflement
&HVEUXLWVVRQWQRUPDX[&RQVXOWH]ODVHFWLRQ%UXLW
de cuisson.
Rayures sur la surface
vitrée de la table de
cuisson
Zones décolorées sur la
table de cuisson
Bruit
20
49-80742
Por Inducción Electrónica
Estufa
GEAppliances.com
Información De Seguridad . . . . 2
Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Asistencia /
Piezas y Accesorios . . . . . . . . . . . . . 5
Manual del Propietario
PHP9030
PHP9036
Uso de la placa de cocción
Funciones de la Placa de Cocción . . . 6
Uso de los Elementos de Cocción . . . 7
Apagado del Quemador(es) . . . . . . . . . 7
Selección de las Configuraciones
de la Placa de Cocción. . . . . . . . . . . . 8
Cómo Sincronizar los Elementos
Izquierdos . . . . . . . . . . . . . . . . . . . . . . . . 8
Distribución De Energía . . . . . . . . . . . . 9
Bloqueo de la Placa de Cocción . . . . . 9
Temporizador . . . . . . . . . . . . . . . . . . . . . . 9
Indicador Luminoso de Calor . . . . . .10
Detección de Retiro del
Recipiente de Cocción . . . . . . . . . . .10
Cómo Funciona La Cocción
Por Inducción . . . . . . . . . . . . . . . . . . .11
Ruido de la Cocción . . . . . . . . . . . . . . .11
Cómo Elegir El Mejor
Recipiente De Cocción . . . . . . . . . . .12
Plancha (accesorio opcional). . . . . . .14
Cuidado Y Limpieza
Cómo Limpiar la Estufa de Vidrio. . .15
Consejos para la Solución
de Problemas . . . . . . . . . . . . . . . .20
Escriba el modelo y los números de
serie a continuación:
Modelo No: ___________________
Serial No: _____________________
Los puede encontrar en la etiqueta
que está debajo de la superficie de
la estufa.
49-80742 02-15 GE
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA
/HDWRGDVODVLQVWUXFFLRQHVGHVHJXULGDGDQWHVGHXWLOL]DUHVWHSURGXFWR1RVHJXLUHVWDVLQVWUXFFLRQHVSXHGHJHQHUDUXQ
LQFHQGLRXQDGHVFDUJDHOpFWULFDOHVLRQHVFRUSRUDOHVRODPXHUWH
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD
Ŷ 8VHHVWDSODFDGHFRFFLyQVyORFRQHOREMHWLYRSDUDHO
TXHIXHFUHDGRFRPRVHGHVFULEHHQHVWH0DQXDOGHO
3URSLHWDULR
Ŷ $VHJ~UHVHGHTXHXQWpFQLFRFDOLILFDGRUHDOLFHXQD
FRUUHFWDLQVWDODFLyQ\SXHVWDDWLHUUDGHODSODFD
GHFRFFLyQGHDFXHUGRFRQODVLQVWUXFFLRQHVGH
LQVWDODFLyQSURYLVWDV
Ŷ 1RLQWHQWHUHSDUDURFDPELDUQLQJXQDSLH]DGHOD
SODFDGHFRFFLyQDPHQRVTXHHVWpHVSHFtILFDPHQWH
UHFRPHQGDGRHQHVWHPDQXDO&XDOTXLHURWURVHUYLFLR
GHEHUHDOL]DUORXQWpFQLFRFDOLILFDGR
Ŷ $QWHVGHUHDOL]DUFXDOTXLHUFODVHGHUHSDUDFLyQ
GHVHQFKXIHODSODFDGHFRFFLyQRGHVFRQHFWHHO
VXPLQLVWURHOpFWULFRGHVGHHOSDQHOGHGLVWULEXFLyQ
GRPpVWLFRTXLWDQGRHOIXVLEOHRGHVFRQHFWDQGRHO
LQWHUUXSWRUGHFLUFXLWRV
Ŷ 1RGHMHDORVQLxRVVRORVpVWRVQRGHEHQTXHGDU
VRORVRVLQDWHQFLyQHQXQiUHDGRQGHXQDSODFDGH
FRFFLyQHVWpHQXVR1XQFDGHEHSHUPLWLUVHTXHVH
VXEDQVLHQWHQRSDUHQHQFXDOTXLHUSDUWHGHODSODFD
GHFRFFLyQ
Ŷ
PRECAUCIÓN
:1RDOPDFHQH
HOHPHQWRVGHLQWHUpVSDUDQLxRVVREUHODSODFDGH
FRFFLyQORVQLxRVTXHVHWUHSHQDODFRFLQDSDUD
DOFDQ]DUHOHPHQWRVSXHGHQUHVXOWDUJUDYHPHQWH
KHULGRV
ADVERTENCIA
MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA PLACA DE COCCIÓN
Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios.
Ŷ 1RDOPDFHQHRXWLOLFHPDWHULDOHVLQIODPDEOHVFHUFD
GHODSODFDGHFRFFLyQWDOHVFRPRSDSHOSOiVWLFR
DJDUUDGHUDVWHODVUHFXEULPLHQWRVGHSDUHGFRUWLQDV
\JDVROLQDXRWURVYDSRUHV\OtTXLGRVLQIODPDEOHV
Ŷ 1XQFDXVHYHVWLPHQWDVKROJDGDVRDPSOLDVPLHQWUDV
XWLOLFHODSODFDGHFRFFLyQ(VWDVYHVWLPHQWDVSXHGHQ
SUHQGHUVHIXHJRVLHQWUDQHQFRQWDFWRFRQVXSHUILFLHV
FDOLHQWHVSURYRFDQGRTXHPDGXUDVJUDYHV
2
Ŷ 6yORXVHDJDUUDGHUDVVHFDVODVDJDUUDGHUDV
K~PHGDVRPRMDGDVFRORFDGDVHQVXSHUILFLHV
FDOLHQWHVSXHGHQSURYRFDUTXHPDGXUDVGHYDSRU1R
SHUPLWDTXHODVDJDUUDGHUDVHQWUHQHQFRQWDFWRFRQ
XQLGDGHVGHVXSHUILFLHRORVHOHPHQWRVFDOHQWDGRUHV
FDOLHQWHV1RXWLOLFHWRDOODVXRWUDVWHODVJUXHVDVHQ
OXJDUGHXQDDJDUUDGHUD
Ŷ 1XQFDXVHODSODFDGHFRFFLyQSDUDFDOHQWDUOD
KDELWDFLyQ
Ŷ 1RWRTXHORVHOHPHQWRVGHODVXSHUILFLH(VWDV
VXSHUILFLHVSXHGHQHVWDUWDQFDOLHQWHVFRPRSDUD
TXHPDUDXQTXHHVWpQGHFRORURVFXUR'XUDQWH\
GHVSXpVGHVXXVRQRODVWRTXHQLSHUPLWDTXHDOJ~Q
SDxRXRWURPDWHULDOLQIODPDEOHHQWUHHQFRQWDFWR
FRQORVHOHPHQWRVGHODVXSHUILFLHRFRQODViUHDV
FHUFDQDVDORVHOHPHQWRVGHODVXSHUILFLHGHMH
VXILFLHQWHWLHPSRSDUDTXHVHHQIUtHQSULPHUR
Ŷ /DV]RQDVSRWHQFLDOPHQWHFDOLHQWHVVRQODVXSHUILFLH
GHODHVWXID\ODViUHDVDOIUHQWH
Ŷ 1RFDOLHQWHUHFLSLHQWHVFHUUDGRVGHDOLPHQWRV3RGUtD
KDEHUXQDDFXPXODFLyQGHSUHVLyQHQHOUHFLSLHQWH\
pVWHSRGUtDH[SORWDUSURYRFDQGROHVLRQHV
Ŷ &RFLQHFDUQHVGHUHV\GHDYHSRUFRPSOHWR/DV
FDUQHVGHUHVKDVWDDOFDQ]DUXQDWHPSHUDWXUDLQWHUQD
GHSRUORPHQRVƒ) ƒ& \ODVFDUQHVGHDYHD
XQDWHPSHUDWXUDLQWHUQDGHSRUORPHQRVƒ) ƒ& /DFRFFLyQDHVWDVWHPSHUDWXUDVJHQHUDOPHQWHSURWHJH
GHHQIHUPHGDGHVWUDQVPLWLGDVSRUORVDOLPHQWRV
Ŷ 1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURV
PDWHULDOHVLQIODPDEOHVVHDFXPXOHQGHQWURGHOD
FRFLQDRHQVXFHUFDQtD/DJUDVDVREUHODSODFDGH
FRFFLyQSXHGHHQFHQGHUVH
LEA Y GUARDE ESTAS INSTRUCCIONES
49-80742
Ŷ (
QFDVRGHLQFHQGLRQRXWLOLFHDJXDHQLQFHQGLRVGH
JUDVD1XQFDOHYDQWHXQDVDUWpQHQOODPDV$SDJXH
ORVFRQWUROHV$SDJXHXQDVDUWpQHQOODPDVVREUHXQD
XQLGDGGHVXSHUILFLHFXEULHQGRODVDUWpQSRUFRPSOHWR
FRQXQDWDSDTXHDMXVWHELHQXQDSODQFKDSDUD
JDOOHWDVRXQDEDQGHMDSODQD8WLOLFHXQTXtPLFRVHFR
PXOWLXVRRXQH[WLQWRUGHLQFHQGLRVGHHVSXPD
Ŷ 1XQFDGHMHODVXQLGDGHVGHVXSHUILFLHVLQDWHQFLyQHQ
FRQILJXUDFLRQHVGHFDORUPHGLDRDOWD/RVDOLPHQWRV
TXHKLHUYHQ\VHGHUUDPDQSXHGHQSURYRFDUKXPR\
GHUUDPHVJUDVRVRVTXHSXHGHQSUHQGHUVHIXHJR
Ŷ 1XQFDGHMHDFHLWHVLQDWHQFLyQPLHQWUDVIUtH6LVH
GHMDFDOHQWDUPiVDOOiGHOSXQWRGHKXPHRHODFHLWH
SXHGHHQFHQGHUVHSURYRFDQGRXQLQFHQGLRTXH
SRGUtDSURSDJDUVHDORVJDELQHWHVFHUFDQRV8WLOLFH
XQWHUPyPHWURSDUDJUDVDFXDQGRVHDSRVLEOHSDUD
FRQWURODUODWHPSHUDWXUDGHODFHLWH
ADVERTENCIA
Ŷ 3DUDHYLWDUHOGHUUDPHGHDFHLWH\XQLQFHQGLRXWLOLFH
XQDFDQWLGDGPtQLPDGHDFHLWHFXDQGRIUtDHQVDUWHQHV
SRFRSURIXQGDV\HYLWHODFRFFLyQGHDOLPHQWRV
FRQJHODGRVFRQXQDFDQWLGDGH[FHVLYDGHKLHOR
Ŷ 8WLOLFHHOWDPDxRGHUHFLSLHQWHDGHFXDGR(OLMD
UHFLSLHQWHVFRQEDVHVSODQDVORVXILFLHQWHPHQWH
JUDQGHVSDUDFXEULUHOHOHPHQWRFDOHQWDGRUGH
VXSHUILFLH/DXWLOL]DFLyQGHUHFLSLHQWHVPiVSHTXHxRV
GHMDUiH[SXHVWDXQDSRUFLyQGHODXQLGDGGH
VXSHUILFLHDOFRQWDFWRGLUHFWRORTXHSXHGHSURYRFDU
HOHQFHQGLGRGHVXVYHVWLPHQWDV8QDUHODFLyQ
DGHFXDGDGHOUHFLSLHQWHFRQODXQLGDGGHVXSHUILFLH
WDPELpQPHMRUDUiODHILFLHQFLD
Ŷ 3DUDPLQLPL]DUODSRVLELOLGDGGHTXHPDGXUDVHO
HQFHQGLGRGHPDWHULDOHVLQIODPDEOHV\ORVGHUUDPHV
ODPDQLMDGHOUHFLSLHQWHGHEHJLUDUVHKDFLDHOFHQWUR
GHODHVWXIDVLQVREUHSDVDUVHDQLQJ~QHOHPHQWRGH
VXSHUILFLHFHUFDQR
INFORMACIÓN DE SEGURIDAD
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DE LA ESTUFA
INSTRUCCIONES DE SEGURIDAD DE LA COCINA POR INDUCCIÓN
Ŷ 7
HQJDFXLGDGRDOWRFDUODHVWXID/DVXSHUILFLHGH
HVSHUHKDVWDTXHODSODFDGHFRFFLyQVHHQIUtH\
YLGULRGHODHVWXIDUHWHQGUiFDORUGHVSXpVGHTXHORV
TXHODOX]LQGLFDGRUDVHDSDJXH8QDHVSRQMDR
FRQWUROHVVHKD\DQDSDJDGR 2)) WHODPRMDGDVREUHXQDVXSHUILFLHFDOLHQWHSXHGH
FDXVDTXHPDGXUDVGHYDSRU$OJXQRVOLPSLDGRUHV
Ŷ 1RFRFLQHHQXQDFRFLQDURWD6LODFRFLQDVXIUH
SXHGHQSURGXFLUKXPRVWy[LFRVVLVHORVDSOLFDD
URWXUDVORVSURGXFWRVGHOLPSLH]D\ORVGHUUDPHV
XQDVXSHUILFLHFDOLHQWH/HD\FXPSODFRQWRGDVODV
SRGUiQSHQHWUDUVREUHGLFKDVURWXUDVFUHDQGR
LQVWUXFFLRQHV\DGYHUWHQFLDVGHODVHWLTXHWDVGH
ULHVJRVGHGHVFDUJDVHOpFWULFDV&RPXQtTXHVHFRQXQ
ODVFUHPDVGHOLPSLH]DNOTA:/RVGHUUDPHVGH
WpFQLFRFDOLILFDGRGHLQPHGLDWR
SURGXFWRVD]XFDUDGRVVRQXQDH[FHSFLyQ6HGHEHQ
Ŷ (YLWHUD\DUODHVWXIDGHYLGULR/DHVWXIDSXHGH
HOLPLQDUUDVSDQGRPLHQWUDVD~QHVWiQFDOLHQWHV
VXIULUUD\RQHVFRQDUWtFXORVWDOHVFRPRFXFKLOORV
XWLOL]DQGRXQJXDQWHSDUDKRUQRRXQDHVSiWXOD
LQVWUXPHQWRVSXQWLDJXGRVDQLOORVXRWUDVMR\DV\
3DUDDFFHGHUDLQVWUXFFLRQHVGHWDOODGDVFRQVXOWHOD
DEURMRVGHYHVWLPHQWDV
VHFFLyQGHOLPSLH]DGHODSODFDGHFRFFLyQGHYLGULR
Ŷ 1RFRORTXHQLJXDUGHDUWtFXORVTXHVHSXHGDQGHUUHWLU
RLQFHQGLDUHQODSODFDGHFRFFLyQLQFOXVRFXDQGRQR
Ŷ
:/DVSHUVRQDVTXH
HVWpVLHQGRXVDGD6LODFRFLQDHVHQFHQGLGDGHIRUPD
XWLOLFHQXQPDUFDSDVRVRXQGLVSRVLWLYRPpGLFRVLPLODU
LQYROXQWDULDGLFKRVDUWtFXORVVHSRGUiQLQFHQGLDU(O
GHEHQWHQHUFXLGDGRFXDQGRXWLOLFHQ\VHHQFXHQWUHQ
FDORUGHODSODFDGHFRFFLyQRGHODYHQWLODFLyQGHO
FHUFDGHXQDSODFDGHFRFFLyQSRULQGXFFLyQPLHQWUDV
KRUQROXHJRGHTXHIXHDSDJDGRWDPELpQSXHGHQ
HVWiHQRSHUDFLyQ(OFDPSRHOHFWURPDJQpWLFRSXHGH
KDFHUTXHGLFKRVDUWtFXORVVHLQFHQGLHQ
DIHFWDUHOIXQFLRQDPLHQWRGHOPDUFDSDVRVRGHO
GLVSRVLWLYRPpGLFRVLPLODU(VUHFRPHQGDEOHFRQVXOWDU
Ŷ 8
VHHO/LPSLDGRUSDUD3ODFDVGH&RFFLyQGH
DVXPpGLFRRDOIDEULFDQWHGHOPDUFDSDVRVVREUHVX
FHUiPLFD&(5$0$%5<7(®\OD$OPRKDGLOOD
VLWXDFLyQSDUWLFXODU
GH/LPSLH]D&(5$0$%5<7(®SDUDOLPSLDUOD
SODFDGHFRFFLyQ$QWHVGHUHDOL]DUODOLPSLH]D
PRECAUCIÓN
ADVERTENCIA INTERFERENCIA DE LA FRECUENCIA RADIAL
(VWDXQLGDGVHKDSXHVWRDSUXHED\VHKDGHWHUPLQDGR
TXHFXPSOHFRQORVOtPLWHVGHXQGLVSRVLWLYRGLJLWDOGH
FODVH%GHFRQIRUPLGDGFRQOD3DUWHGHODVQRUPDV
GHOD)&&(VWRVOtPLWHVHVWiQGLVHxDGRVSDUDEULQGDU
XQDSURWHFFLyQUD]RQDEOHFRQWUDLQWHUIHUHQFLDGDxLQD
GHQWURGHXQDLQVWDODFLyQUHVLGHQFLDO(VWDXQLGDG
JHQHUDXWLOL]D\SXHGHLUUDGLDUHQHUJtDGHIUHFXHQFLD
GHUDGLR\VLQRVHLQVWDOD\XVDGHDFXHUGRFRQODV
LQVWUXFFLRQHVSXHGHSURYRFDUXQDLQWHUIHUHQFLDGDxLQD
DODVFRPXQLFDFLRQHVGHUDGLR6LQHPEDUJRQRKD\
JDUDQWtDGHTXHQRKD\DLQWHUIHUHQFLDHQXQDLQVWDODFLyQ
GHWHUPLQDGD6LODXQLGDGSURYRFDLQWHUIHUHQFLDQRFLYD
DODUHFHSFLyQGHUDGLR\WHOHYLVLyQORTXHSXHGH
GHWHUPLQDUVHHQFHQGLHQGR\DSDJDQGRODXQLGDGHO
XVXDULRSXHGHFRUUHJLUODLQWHUIHUHQFLDDWUDYpVGHXQDR
PiVGHODVVLJXLHQWHVPHGLGDV
Ŷ 5HRULHQWHRFDPELHODSRVLFLyQGHODVDQWHQDV
UHFHSWRUDV
Ŷ ,QFUHPHQWHODGLVWDQFLDHQWUHODXQLGDG\HOUHFHSWRU
Ŷ &RQHFWHODXQLGDGDXQWRPDFRUULHQWHRXQFLUFXLWR
GLIHUHQWHGHOTXHHVWiXVDQGRHOUHFHSWRU
LEA Y GUARDE ESTAS INSTRUCCIONES
49-80742
3
GARANTÍA
¡Gracias! ... por su compra de un electrodoméstico de la Marca GE
Registre su Electrodoméstico: £5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWUHJLVWHU
8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUiXQDPHMRUFRPXQLFDFLyQ\XQVHUYLFLRPiVSXQWXDOGHDFXHUGRFRQORVWpUPLQRVGHVX
JDUDQWtDHQFDVRGHVXUJLUODQHFHVLGDG7DPELpQSXHGHHQYLDUXQDFDUWDHQODWDUMHWDGHLQVFULSFLyQSUHLPSUHVDTXHVHLQFOX\HFRQ
HOPDWHULDOHPEDODGR
Garantía de la Placa de Cocción Eléctrica de GE
GEAppliances.com
7RGRHOVHUYLFLRGHJDUDQWtDHVSURYLVWRSRUQXHVWURV&HQWURVGH6HUYLFLRGH)DEULFDRXQWpFQLFRDXWRUL]DGRGH6HUYLFLRDO&OLHQWH
&XVWRPHU&DUHŠ 3DUDSURJUDPDUXQDYLVLWDGHOVHUYLFLRWpFQLFRDWUDYpVGH,QWHUQHWYLVtWHQRVHQZZZJHDSSOLDQFHVFRP
VHUYLFHBDQGBVXSSRUWROODPHDO*(&$5(6 &XDQGROODPHSDUDVROLFLWDUHOVHUYLFLRWHQJDORVQ~PHURVGH
VHULDO\GHPRGHORGLVSRQLEOHV
3DUDUHDOL]DUHOVHUYLFLRWpFQLFRGHVXHOHFWURGRPpVWLFRVHSRGUiUHTXHULUHOXVRGHGDWRVGHOSXHUWRGHDERUGDMHSDUDVX
GLDJQyVWLFR(VWRGDDOWpFQLFRGHOVHUYLFLRGHIiEULFDGH*(ODKDELOLGDGGHGLDJQRVWLFDUGHIRUPDUiSLGDFXDOTXLHUSUREOHPDFRQ
VXHOHFWURGRPpVWLFR\GHD\XGDUD*(DPHMRUDUVXVSURGXFWRVDOEULQGDUOHD*(ODLQIRUPDFLyQVREUHVXHOHFWURGRPpVWLFR6LQR
GHVHDTXHORVGDWRVGHVXHOHFWURGRPpVWLFRVHDQHQYLDGRVD*(VROLFLWDPRVTXHOHLQGLTXHDVXWpFQLFRQRHQWUHJDUORVGDWRVD
*(HQHOPRPHQWRGHOVHUYLFLR
'XUDQWHHOSHUtRGRGHXQDxRGHVGHODIHFKDRULJLQDOGHFRPSUD*(OHEULQGDUiFXDOTXLHUSDUWHGHODSODFDGHFRFFLyQTXHIDOOH
GHELGRDXQGHIHFWRHQORVPDWHULDOHVRODIDEULFDFLyQ'XUDQWHHVWDJDUDQWtDOLPLWDGDGHXQDxR*(WDPELpQSURYHHUiVLQFRVWR
WRGRHOWUDEDMR\HOVHUYLFLRHQHOKRJDUUHODFLRQDGRFRQHOUHHPSOD]RGHODSDUWHTXHSUHVHQWHGHIHFWRV
$EURFKHVXUHFLERDTXt3DUDDFFHGHUDOVHUYLFLRWpFQLFRGHDFXHUGRFRQ
ODJDUDQWtDGHEHUiFRQWDUFRQODSUXHEDGHODIHFKDRULJLQDOGHFRPSUD
Qué no cubrirá GE:
Ŷ 9LDMHVGHOWpFQLFRGHOVHUYLFLRDVXKRJDUSDUDHQVHxDUOH
VREUHFyPRXVDUHOSURGXFWR
Ŷ ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV
Ŷ )DOODVGHOSURGXFWRHQFDVRGHDEXVRPDOXVRPRGLILFDFLyQ
RXVRSDUDSURSyVLWRVGLIHUHQWHVDORULJLQDORXVRFRPHUFLDO
Ŷ 5HHPSOD]RGHIXVLEOHVGHODFDVDRUHLQLFLRGHGLV\XQWRUHV
Ŷ 'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH
LQFHQGLRLQXQGDFLRQHVRFDWiVWURIHVQDWXUDOHV
Ŷ 'DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV
GHIHFWRVVREUHHVWHSURGXFWR
Ŷ 'DxRFDXVDGRGHVSXpVGHODHQWUHJD
Ŷ 3URGXFWRQRDFFHVLEOHSDUDEULQGDUHOVHUYLFLRUHTXHULGR
Ŷ 6ROLFLWHHOVHUYLFLRWpFQLFRSDUDUHSDUDURUHHPSOD]DUODV
OiPSDUDVH[FHSWRODVOiPSDUDV/('
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS
6X~QLFD\H[FOXVLYDDOWHUQDWLYDHVODUHSDUDFLyQGHOSURGXFWRFRPRVHLQGLFDHQOD*DUDQWtD/LPLWDGD/DVJDUDQWtDVLPSOtFLWDV
LQFOX\HQGRJDUDQWtDVLPSOtFLWDVGHFRPHUFLDELOLGDGRFRQYHQLHQFLDVREUHXQSURSyVLWRSDUWLFXODUVHOLPLWDQDXQDxRRDOSHUtRGR
PiVFRUWRSHUPLWLGRSRUODOH\
(VWDJDUDQWtDVHH[WLHQGHDOFRPSUDGRURULJLQDO\DFXDOTXLHUGXHxRVXEVLJXLHQWHGHSURGXFWRVFRPSUDGRVSDUDXVRKRJDUHxR
GHQWURGH((886LHOSURGXFWRHVWiHQXQiUHDGRQGHQRVHHQFXHQWUDGLVSRQLEOHXQ3URYHHGRU$XWRUL]DGRGHO6HUYLFLR7pFQLFR
GH*(XVWHGVHUiUHVSRQVDEOHSRUHOFRVWRGHXQYLDMHRVHSRGUiUHTXHULUTXHWUDLJDHOSURGXFWRDXQDXELFDFLyQGHO6HUYLFLR
7pFQLFRGH*($XWRUL]DGRSDUDUHFLELUHOVHUYLFLR(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRDVX
KRJDU
$OJXQRVHVWDGRVQRSHUPLWHQODH[FOXVLyQROLPLWDFLyQGHGDxRVIRUWXLWRVRFRQVHFXHQWHV(VWDJDUDQWtDOHGDGHUHFKRVOHJDOHV
HVSHFtILFRV\HVSRVLEOHTXHWHQJDRWURVGHUHFKRVOHJDOHVTXHYDUtDQHQWUHXQHVWDGR\RWUR3DUDFRQRFHUFXiOHVVRQVXV
GHUHFKRVOHJDOHVFRQVXOWHDODRILFLQDGHDVXQWRVGHOFRQVXPLGRUORFDORHVWDWDORDO)LVFDOGHVXHVWDGR
Garante: General Electric Company. Louisville, KY 40225
Garantías Extendidas:$GTXLHUDXQDJDUDQWtDH[WHQGLGDGH*(\DSUHQGDVREUHGHVFXHQWRVHVSHFLDOHVTXHHVWiQGLVSRQLEOHV
PLHQWUDVVXJDUDQWtDD~QHVWiYLJHQWH/DSXHGHDGTXLULUHQFXDOTXLHUPRPHQWRDWUDYpVGH,QWHUQHWHQ
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP
ROODPDQGRDOGXUDQWHHOKRUDULRFRPHUFLDOKDELWXDO/RV6HUYLFLRVSDUDHO&RQVXPLGRU+RJDUHxRGH*(D~QHVWDUiQ
DOOtFXDQGRVXJDUDQWtDFDGXTXH
4
49-80742
£&RQVXOWHHO6LWLR:HEGH(OHFWURGRPpVWLFRVGH*( www.geappliances.com/service_and_support/ GXUDQWHODVKRUDVFXDO
TXLHUGtDGHODxR3DUDPD\RUFRQYHQLHQFLD\XQVHUYLFLRPiVUiSLGRDKRUDSXHGHGHVFDUJDUHO0DQXDOGHO3URSLHWDULRRUGHQDU
SLH]DVRLQFOXVRSURJUDPDUHOVHUYLFLRWpFQLFRDWUDYpVGH,QWHUQHW
Servicio Programado: (OVHUYLFLRGHUHSDUDFLyQGHH[SHUWRVGH
*(HVWiDVyORXQSDVRGHVXSXHUWD(QWUHD,QWHUQHW\SURJUDPH
VXVHUYLFLRHQZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWR
OODPHDO*(&$5(6 GXUDQWHHOKRUDULRGH
DWHQFLyQFRPHUFLDO
Piezas y Accesorios: $TXHOODVSHUVRQDVFDOLILFDGDVSDUDUHDOL]DU
HOVHUYLFLRWpFQLFRVREUHVXVSURSLRVHOHFWURGRPpVWLFRVSRGUiQ
VROLFLWDUHOHQYtRGHSLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXV
KRJDUHV VHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU 2UGHQHDWUDYpVGH,QWHUQHWKR\GXUDQWHODVKRUDVRHQIRUPD
WHOHIyQLFDDOGXUDQWHHOKRUDULRGHDWHQFLyQFRPHUFLDO
/DVLQVWUXFFLRQHVTXHILJXUDQHQHVWHPDQXDOFXEUHQORV
SURFHGLPLHQWRVTXHVHUiQUHDOL]DGRVSRUFXDOTXLHUXVXDULR
2WURVVHUYLFLRVWpFQLFRVJHQHUDOPHQWHGHEHUtDQVHUGHULYDGRV
DSHUVRQDOFDOLILFDGRGHOVHUYLFLR6HGHEHUiWHQHUFXLGDGR\D
TXHXQDUHSDUDFLyQLQGHELGDSRGUiKDFHUTXHHOIXQFLRQDPLHQWR
QRVHDVHJXUR
Estudio de Diseño de la Vida Real: *(DSR\DHOFRQFHSWR
GH'LVHxR8QLYHUVDOHQSURGXFWRVVHUYLFLRV\DPELHQWHVTXH
SXHGHQVHUXVDGRVSRUSHUVRQDVGHWRGDVODVHGDGHVWDPDxRV
\FDSDFLGDGHV5HFRQRFHPRVODQHFHVLGDGGHUHDOL]DUGLVHxRV
SDUDXQDDPSOLDJDPDGHKDELOLGDGHVHLQFDSDFLGDGHVItVLFDV\
PHQWDOHV3DUDPiVGHWDOOHVVREUHODVDSOLFDFLRQHVGH'LVHxR
8QLYHUVDOGH*(LQFOX\HQGRLGHDVGHGLVHxRGHFRFLQDVSDUD
SHUVRQDVFRQLQFDSDFLGDGHVYLVLWHQXHVWURVLWLRZHEKR\6REUH
FDVRVGHLQFDSDFLGDGDXGLWLYDFRPXQtTXHVHDO7''*($&
Contáctenos: 6LQRVHHQFXHQWUDVDWLVIHFKRFRQHOVHUYLFLR
TXHUHFLELyGH*(FRPXQtTXHVHFRQQRVRWURVDWUDYpVGH
QXHVWURVLWLRZHEFRQWRGRVORVGHWDOOHVLQFOX\HQGRVXQ~PHUR
WHOHIyQLFRRHVFULEDD
General Manager, Customer Relations
GE Appliances, Appliance Park Louisville, KY 40225
Piezas y Accesorios
3DUDUHDOL]DUXQDRUGHQYLVtWHQRVDWUDYpVGH,QWHUQHWHQ
www.GEApplianceParts.com ((88 RHQwww.GEAppliances.ca &DQDGi ROODPHDO800.626.2002 ((88 800.661.1616 &DQDGi
ASISTENCIA / PIEZAS Y ACCESORIOS
¿Desea realizar una consulta o necesita ayuda con su electrodoméstico?
/DVVLJXLHQWHVSLH]DVHVWiQGLVSRQLEOHV
Piezas
3ODQFKD
-;*5,'/
.LWGH6RXV9LGH
-;62869
/LPSLDGRU\3XOLGRUGH$FHUR,QR[LGDEOH
30;
Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje
&RQFXLGDGRWRPHXQH[WUHPRGHODSHOtFXODSURWHFWRUDGHHQYtR
FRQORVGHGRV\OHQWDPHQWHUHWLUHODPLVPDGHODVXSHUILFLHGHO
HOHFWURGRPpVWLFR1RXWLOLFHQLQJ~QSURGXFWRILORVRSDUDUHWLUDUOD
SHOtFXOD5HWLUHWRGDODSHOtFXODDQWHVGHXVDUHOHOHFWURGRPpVWLFR
SRUSULPHUDYH]
3DUDDVHJXUDUTXHQRKD\DGDxRVVREUHHODFDEDGRGHO
SURGXFWRODIRUPDPiVVHJXUDGHUHWLUDUHODGKHVLYRGHODFLQWD
GHHPEDODMHHQHOHFWURGRPpVWLFRVQXHYRVHVDSOLFDQGRXQ
GHWHUJHQWHOtTXLGRKRJDUHxRSDUDODYDUSODWRV$SOLTXHFRQXQD
WHODVXDYH\GHMHTXHVHVHTXH
NOTA: (ODGKHVLYRGHEHUiVHUHOLPLQDGRGHWRGDVODVSDUWHV
1RVHSXHGHUHWLUDUVLVHKRUQHDFRQpVWHGHQWUR
49-80742
5
USO DE LA PLACA DE COCCIÓN: Funciones de la Placa de Cocción
Funciones de la Placa de Cocción
Es posible que las funciones y apariencias varíen con relación a su modelo a lo largo del manual.
1
2
Placa de cocción de 30”
3
6
8
7
4
5
Controles de la Interfase del Usuario
1
2
Placa de cocción de 36”
3
6
8
7
4
5
Controles de la Interfase del Usuario
1. Cooking Element(s) (Elemento(s) de Cocción):&RQVXOWHODSiJLQD
2. Element On/Off (Elemento Encendido/ Apagado):&RQVXOWHODSiJLQD
3. Sync Burners (Quemadores Sincronizados):&RQVXOWHODSiJLQD
4. All Off (Todo Apagado):&RQVXOWHODSiJLQD
5. Lock (Bloqueo):&RQVXOWHODSiJLQD
6. Timer On/Off (Temporizador Encendido/ Apagado):&RQVXOWHODSiJLQD
7. Display (Pantalla):&RQVXOWHODSiJLQD
7. Start Timer (Temporizador de Inicio):&RQVXOWHODSiJLQD
6
49-80742
(QFLHQGDHO4XHPDGRU HV 0DQWHQJDSUHVLRQDGDODWHFODOn/
Off (Encendido/ Apagado)GXUDQWHDSUR[LPDGDPHQWHPHGLR
VHJXQGR6HSRGUiHVFXFKDUXQUHSLTXHFDGDYH]TXHVH
SUHVLRQHXQDWHFOD
(OQLYHOGHSRWHQFLDSXHGHVHUVHOHFFLRQDGRGHFXDOTXLHUDGH
ODVVLJXLHQWHVIRUPDV
3UHVLRQHODVWHFODVR±SDUDDMXVWDUHOQLYHOGHSRWHQFLDR
$WDMRKDVWD+L $OWR ,QPHGLDWDPHQWHOXHJRGHHQFHQGHUOD
XQLGDGSUHVLRQHODWHFODR
$WDMRKDVWD/RZ %DMR ,QPHGLDWDPHQWHOXHJRGHHQFHQGHU
ODXQLGDGSUHVLRQHODWHFOD
Apague el Quemador(es)
3UHVLRQHODWHFODOn/Off (Encender/ Apagar)SDUDXVDU
XQTXHPDGRULQGLYLGXDORSUHVLRQHODWHFODAll Off (Todo
Apagado)
49-80742
USO DE LA PLACA DE COCCIÓN: Uso de los Elementos de Cocción/ Apagado de los Quemadores
Uso de los Elementos de Cocción
7
USO DE LA PLACA DE COCCIÓN: Selección de las Configuraciones de la Placa de Cocción/ Cómo Sincronizar los Elementos Izquierdos
8
Selección de las Configuraciones de la Placa de Cocción
(OLMDHOHOHPHQWRTXHPDGRUTXHPHMRUVHDGHFXHDOWDPDxR
GHOXWHQVLOLR&DGDHOHPHQWRTXHPDGRUGHVXQXHYDSODFDGH
FRFFLyQFXHQWDFRQVXVSURSLRVQLYHOHVGHSRWHQFLDGHVGHEDMR
KDVWDDOWR/DVFRQILJXUDFLRQHVGHOQLYHOGHSRWHQFLDQHFHVDULD
SDUDODFRFFLyQYDUtDQGHSHQGLHQGRGHOXWHQVLOLRXVDGRHO
WLSR\FDQWLGDGGHFRPLGD\HOUHVXOWDGRGHVHDGR(QJHQHUDO
XVHODVFRQILJXUDFLRQHVEDMDVSDUDGHUUHWLUPDQWHQHURKHUYLU
DIXHJROHQWR\XVHODVFRQILJXUDFLRQHVDOWDVSDUDFDOHQWDU
UiSLGRVRDVDU\IUHtU$OPDQWHQHUODVFRPLGDVFDOLHQWHV
FRQILUPHTXHODFRQILJXUDFLyQVHOHFFLRQDGDHVVXILFLHQWHSDUD
PDQWHQHUODWHPSHUDWXUDGHODFRPLGDSRUHQFLPDGHORVž)
3DUDGHUUHWLUQRVHUHFRPLHQGDHOXVRGHORVHOHPHQWRVPiV
JUDQGHV\GHDTXHOORVFRQODPDUFD³0DQWHQHU&DOLHQWH´
+L $OWR HVHOQLYHOGHSRWHQFLDPiVDOWRGLVHxDGRSDUD
FRFLQDU\KHUYLUFDQWLGDGHVJUDQGHVGHIRUPDUiSLGD+L $OWR IXQFLRQDUiGXUDQWHXQWLHPSRPi[LPRGHPLQXWRV+L
$OWR SXHGHVHUUHSHWLGROXHJRGHOFLFORLQLFLDOGHPLQXWRV
SUHVLRQDQGRODWHFOD+
PRECAUCIÓN
: 1RFRORTXHQLQJ~QXWHQVLOLR
FXELHUWRQLGHMHGHUUDPHVH[FHVLYRVGHDJXDHQODVWHFODVGHO
FRQWURO'HHVWDUSUHVHQWHSRUYDULRVVHJXQGRVHVWRSRGUi
KDFHUTXHODVWHFODVWiFWLOHVQRUHVSRQGDQ\TXHVHDSDJXHOD
VXSHUILFLHGHFRFFLyQ
Hi (Alto)
hervir rápido
freir
soasar
reducir
hervir lento
mantener
Low (Bajo)
derretir
Cómo Sincronizar los Elementos Izquierdos
Para Encender
Para Apagar
0DQWHQJDODWHFODSync Burners (Quemadores Sincronizados)
SRUDSUR[LPDGDPHQWHPHGLRVHJXQGRSDUDFRQHFWDUORVGRV
TXHPDGRUHV8WLOLFHFXDOTXLHUDGHHVWRVHOHPHQWRVFRPRVH
GHVFULEHHQODSiJLQDSDUDDMXVWDUHOQLYHOGHSRWHQFLD
3UHVLRQHODWHFODOn/ Off (Encender/ Apagar)GHXQRGH
ORVTXHPDGRUHVSDUDDSDJDUODIXQFLyQSync Burners
(Quemadores Sincronizados)
R
3UHVLRQHSync Burners (Quemadores Sincronizados)
SDUDDSDJDUDPERVTXHPDGRUHV
49-80742
8QDSODFDGHFRFFLyQGH´FXHQWDFRQ]RQDVGHFRFFLyQ\
XQDSODFDGHFRFFLyQGH´FXHQWDFRQ]RQDVGHFRFFLyQ6L
GRVHOHPHQWRVGHODPLVPD]RQDHVWiQHQXVR\SRUORPHQRV
XQHOHPHQWRVHHQFXHQWUDHQHOQLYHOGHSRWHQFLDPi[LPR
Zona Izquierda
+L $OWR ODFRQILJXUDFLyQ+L $OWR IXQFLRQDUiHQXQQLYHO
GHSRWHQFLDUHGXFLGR6HGHEHREVHUYDUTXHODSDQWDOODQR
FDPELDUieVWDHVODIRUPDHQTXHODSRWHQFLDHVFRPSDUWLGD
HQWUHGRVHOHPHQWRGHODPLVPD]RQDGHFRFFLyQ
Zona Derecha
Zona Izquierda
Placa de cocción de 30” de Ancho.
Zona Central
Zona Derecha
Placa de cocción de 36” de Ancho
Bloqueo de la Placa de Cocción
Bloquear
0DQWHQJDSUHVLRQDGDODWHFODGHEORTXHRGHOFRQWUROGXUDQWH
VHJXQGRV
Desbloquear
0DQWHQJDSUHVLRQDGDODWHFODGHEORTXHRGHOFRQWURO
Bloqueo de la Placa de Cocción: bloquea
el funcionamiento de los controles
Temporizador
Para Encender
Para Apagar
3UHVLRQHODWHFODTimer On/Off (Temporizador Encendido/
Apagado)3UHVLRQHODVWHFODV+R-SDUDHOHJLUHOQ~PHUR
GHVHDGRGHPLQXWRV3UHVLRQHODWHFODStart Timer
(Temporizador de Inicio)SDUDLQLFLDUHOWHPSRUL]DGRU
0DQWHQJDSUHVLRQDGDODWHFODTimer On/Off (Temporizador
Encendido/ Apagado)SDUDFDQFHODUHOWHPSRUL]DGRU
49-80742
NOTA: 8VHHOWHPSRUL]DGRUGHODFRFLQDSDUDPHGLUHOWLHPSR
GHFRFFLyQRFRPRUHFRUGDWRULR(OWHPSRUL]DGRUGHODFRFLQD
QRFRQWURODORVHOHPHQWRVGHFRFFLyQ(OWHPSRUL]DGRUVHDSDJD
VLQRKD\DFWLYLGDGSRUVHJXQGRV
USO DE LA PLACA DE COCCIÓN: Distribución De Energía/ Bloqueo de la Placa de Cocción/ Temporizador
Distribución De Energía
9
USO DE LA PLACA DE COCCIÓN: Indicador Luminoso de Calor/ Detección de Retiro del Recipiente de Cocción
10
Indicador Luminoso de Calor
8QDOX]LQGLFDGRUDGHVXSHUILFLHFDOLHQWH XQDSDUDFDGD
HOHPHQWRGHFRFFLyQ EULOODUiFXDQGRODVXSHUILFLHGHYLGULR
HVWpFDOLHQWH\SHUPDQHFHUiHQFHQGLGDKDVWDTXHODVXSHUILFLH
KD\DEDMDGRVXWHPSHUDWXUDKDVWDXQDWHPSHUDWXUDTXHVHD
VHJXUDDOWDFWR
Luz Indicadora
de Superficie
Caliente
Detección de Retiro del Recipiente de Cocción
&XDQGRXQDFDFHURODHVUHWLUDGDGHODVXSHUILFLHGHODSODFD
GHFRFFLyQGHOQLYHOGHOTXHPDGRUVHDSDJDODWHFOD2Q
2II (QFHQGHU$SDJDU FRPLHQ]DDWLWXODU6LQRVHGHWHFWD
XQDFDFHURODGXUDQWHVHJXQGRVHOFRQWUROVHDSDJD
DXWRPiWLFDPHQWH\ODVOXFHVVHDSDJDQ
La tecla On/Off (Encender/ Apagar) titila.
49-80742
/DVXSHUILFLHGHFRFFLyQPLVPDQRVHFDOLHQWD(OFDORUVH
SURGXFHHQHOUHFLSLHQWHGHFRFFLyQ\QRSXHGHJHQHUDUVH
KDVWDTXHVHFRORTXHHOUHFLSLHQWHHQODVXSHUILFLHGHFRFFLyQ
&XDQGRVHDFWLYDHOHOHPHQWRHOUHFLSLHQWHFRPLHQ]DD
FDOHQWDUVHGHLQPHGLDWR\DVXYH]FDOLHQWDHOFRQWHQLGRGHO
UHFLSLHQWH
/DFRFFLyQSRULQGXFFLyQPDJQpWLFDUHTXLHUHHOXVRGH
UHFLSLHQWHVGHFRFFLyQKHFKRVGHPHWDOHVIHUURVRVPHWDOHVD
ORVTXHVHDGKLHUHQORVLPDQHVFRPRKLHUURRDFHUR
8WLOLFHUHFLSLHQWHVTXHVHDMXVWHQDOWDPDxRGHOHOHPHQWR
(OUHFLSLHQWHGHEHVHUORVXILFLHQWHPHQWHJUDQGHSDUDTXHHO
VHQVRUGHVHJXULGDGSXHGDDFWLYDUXQHOHPHQWR
/DSODFDGHFRFFLyQQRIXQFLRQDUiVLXQXWHQVLOLRSHTXHxRGH
DFHURRKLHUUR PHQRUDOWDPDxRPtQLPRGHODSDUWHLQIHULRU VH
FRORFDVREUHODVXSHUILFLHGHFRFFLyQFXDQGRVHHQFLHQGHOD
XQLGDG²HOHPHQWRVWDOHVFRPRHVSiWXODVGHDFHURFXFKDUDV
FXFKLOORVXRWURVXWHQVLOLRVSHTXHxRV
Ta
m
M añ
ín o
.
/RVHOHPHQWRVXELFDGRVGHEDMRGHODVXSHUILFLHGHFRFFLyQ
SURGXFHQXQFDPSRPDJQpWLFRORTXHKDFHTXHHOUHFLSLHQWH
GHPHWDOIHUURVRYLEUH\SURGX]FDFDORU
Utilice el recipiente de tamaño mínimo para el
elemento. El material del recipiente de cocción es el
correcto si un imán puede pegarse a la base.
Ruido de la Cocción
“Ruidos” de recipientes de cocción
'LIHUHQWHVWLSRVGHUHFLSLHQWHVGHFRFFLyQSXHGHQSURGXFLU
VRQLGRVVXDYHV/RVUHFLSLHQWHVPiVSHVDGRVFRPRORV
GHKLHUURIXQGLGRHVPDOWDGRSURGXFHQPHQRVUXLGRTXH
ORVUHFLSLHQWHVPiVOLYLDQRVGHDFHURLQR[LGDEOHGHFDSDV
P~OWLSOHV(OWDPDxRGHOUHFLSLHQWH\ODFDQWLGDGGHFRQWHQLGRV
WDPELpQSXHGHQFRQWULEXLUDOQLYHOGHVRQLGR
&XDQGRVHXVDQHOHPHQWRVFHUFDQRVTXHHVWiQSURJUDPDGRV
HQFRQILJXUDFLRQHVGHHQHUJtDGHWHUPLQDGDVORVFDPSRV
PDJQpWLFRVSXHGHQLQWHUDFWXDU\SURGXFLUXQVLOELGREDMRR
XQ³]XPELGR´LQWHUPLWHQWH(VWRVUXLGRVSXHGHQUHGXFLUVHR
HOLPLQDUVHEDMDQGRRVXELHQGRODVFRQILJXUDFLRQHVGHQLYHOGH
HQHUJtDGHXQRRDPERVHOHPHQWRV/RVUHFLSLHQWHVTXHFXEUHQ
SRUFRPSOHWRHODQLOORGHOHOHPHQWRSURGXFHQPHQRVUXLGR
49-80742
8Q³]XPELGR´EDMRUHVXOWDQRUPDOSDUWLFXODUPHQWHHQ
FRQILJXUDFLRQHVDOWDV
6RQLGRVTXHSRGUiHVFXFKDUHVSRVLEOHTXHHVFXFKHXQ
³=XPELGR´VXDYHDOFRFLQDUHQHOPRGR+L $OWR (VWRHV
QRUPDO(OVRQLGRGHSHQGHGHOWLSRGHFDFHURODTXHVHXVH
$OJXQDVFDFHURODV³=XPEDUiQ´PiVIXHUWHGHSHQGLHQGRGHO
WLSRGHPDWHULDO8QVRQLGRGH³=XPELGR´VHSRGUiHVFXFKDU
VLORVFRQWHQLGRVGHODFDFHURODHVWiQIUtRV$PHGLGDTXH
ODFDFHURODVHFDOLHQWHHOVRQLGRGHFUHFHUi6LHOQLYHOGH
SRWHQFLDHVUHGXFLGRHOQLYHOGHVRQLGRVHUHGXFLUi
USO DE LA PLACA DE COCCIÓN: Cómo Funciona La Cocción Por Inducción / Ruido de la Cocción
Cómo Funciona La Cocción Por Inducción
11
USO DE LA PLACA DE COCCIÓN: Cómo Elegir El Mejor Recipiente De Cocción
Cómo Elegir El Mejor Recipiente De Cocción
Cómo usar el tamaño correcto de recipiente
/DVFDFHURODVTXHQRVRQIHUURVDVRTXHVRQGHPDVLDGR
SHTXHxDVQRSHUPLWLUiQTXHHOHOHPHQWRGHLQGXFFLyQVH
HQFLHQGD\HOLQGLFDGRU21 (QFHQGHU SDUDODXELFDFLyQ
GHGLFKRHOHPHQWRWLWLODUiGXUDQWHVHJXQGRV\OXHJRVH
DSDJDUi6LXQDFDFHURODHVUHWLUDGDSRUPiVGHVHJXQGRV
HOHQFHQGLGRVHDSDJDUi
3XHGHQXWLOL]DUVHUHFLSLHQWHVGHFRFFLyQPiVJUDQGHVTXHHO
DQLOORGHOHOHPHQWRVLQHPEDUJRHOFDORUVHJHQHUDUiVyORSRU
HQFLPDGHOHOHPHQWR
3DUDPHMRUHVUHVXOWDGRVHOUHFLSLHQWHGHEHKDFHUFRQWDFWR
727$/FRQODVXSHUILFLHGHYLGULR
1RSHUPLWDTXHODSDUWHLQIHULRUGHOUHFLSLHQWHGHFRFFLyQWRTXH
ORVUHERUGHVGHPHWDOTXHURGHDQODHVWXIDRTXHTXHGHQ
VREUHORVFRQWUROHVGHODHVWXID
3DUDXQPHMRUGHVHPSHxRDMXVWHHOWDPDxRGHOUHFLSLHQWHDO
WDPDxRGHOHOHPHQWR8VDUXQDROODPiVSHTXHxDVREUHXQ
TXHPDGRUPiVJUDQGHJHQHUDPHQRVHQHUJtDHQFXDOTXLHU
FRQILJXUDFLyQ
Recipientes de cocción adecuados
8WLOLFHUHFLSLHQWHVGHFRFFLyQGHFDOLGDGFRQEDVHVPiV
SHVDGDVSDUDORJUDUXQDPHMRUGLVWULEXFLyQGHOFDORU\
UHVXOWDGRVGHFRFFLyQXQLIRUPH(OLMDUHFLSLHQWHVGHFRFFLyQ
KHFKRVGHDFHURLQR[LGDEOHPDJQpWLFRKLHUURIXQGLGR
HVPDOWDGRDFHURHVPDOWDGR\FRPELQDFLRQHVGHHVWRV
PDWHULDOHV
$OJXQRVUHFLSLHQWHVGHFRFFLyQHVWiQHVSHFtILFDPHQWH
LGHQWLILFDGRVSRUHOIDEULFDQWHSDUDXWLOL]DUFRQHVWXIDVGH
LQGXFFLyQ8WLOLFHXQLPiQSDUDFRPSUREDUTXHHOUHFLSLHQWH
VHDHODGHFXDGR
/RVUHFLSLHQWHVGHEDVHSODQDGDQORVPHMRUHVUHVXOWDGRV
3XHGHQXWLOL]DUVHUHFLSLHQWHVFRQERUGHVRSHTXHxRVUHERUGHV
/RVUHFLSLHQWHVUHGRQGRVGDQORVPHMRUHVUHVXOWDGRV/RV
UHFLSLHQWHVFRQEDVHVWRUFLGDVRFXUYDGDVQRFDOHQWDUiQGH
PDQHUDXQLIRUPH
3DUDFRFLQDUFRQZRNXWLOLFHXQRFRQEDVHSODQD1RXWLOLFHXQ
ZRNFRQXQDQLOORGHVRSRUWH
5” Min. Dia.
Tamaño del
recipiente
4-1/2”
Min. Dia.
Tamaño del
recipiente
7” Min. Dia.
Tamaño del
recipiente
5” Min. Dia.
Tamaño del
recipiente
Estufa de 30” de ancho. Use el tamaño mínimo de cacerola recomendado,
como se muestra para cada elemento de cocción.
5” Min. Dia.
Tamaño del
recipiente
5” Min. Dia.
Tamaño del
recipiente
7” Min. Dia.
Tamaño del
recipiente
4-1/2”
Min. Dia.
Tamaño del
recipiente
5-1/4” Min. Dia.
Tamaño del
recipiente
Estufa de 36” de ancho. Use el tamaño mínimo de cacerola recomendado,
como se muestra para cada elemento de cocción.
Utilice recipientes de base plana.
Utilice una plancha.
Utilice un wok de base plana.
12
49-80742
Recomendaciones sobre recipientes de cocción
INCORRECTO
CORRECTO
El recipiente de cocción no está
centrado en la superficie del
elemento de cocción.
El recipiente de cocción está
centrado correctamente en la
superficie del elemento de cocción.
Bases o lados del recipiente de
cocción curvados o torcidos.
Base de recipiente plana.
El recipiente no cumple con el
tamaño mínimo requerido para el
elemento de cocción utilizado.
El tamaño del elemento
cumple con el tamaño mínimo
recomendado, o lo supera, para el
elemento de cocción utilizado.
La base del recipiente está
apoyada sobre un reborde de la
estufa o no se apoya por completo
sobre la superficie de la estufa.
La base del recipiente se apoya
completamente sobre la superficie
de la estufa.
Una manija pesada inclina el
recipiente.
El recipiente está bien equilibrado.
La cacerola es parcialmente
magnética en su parte inferior.
La cacerola es completamente
magnética en su parte inferior.
/RVUHFLSLHQWHVGHEHQKDFHQFRQWDFWRWRWDOVREUHODVXSHUILFLH
GHOHOHPHQWRGHFRFFLyQ
8WLOLFHUHFLSLHQWHVGHEDVHSODQDGHOWDPDxRDGHFXDGRSDUDHO
HOHPHQWRGHFRFFLyQ\WDPELpQDGHFXDGRSDUDODFDQWLGDGGH
DOLPHQWRVTXHVHHVWiQSUHSDUDQGR
12VHUHFRPLHQGDHOXVRGHGLVFRVGHLQWHUIDFHGHLQGXFFLyQ
49-80742
USO DE LA PLACA DE COCCIÓN: Cómo Elegir El Mejor Recipiente De Cocción
Cómo Elegir El Mejor Recipiente De Cocción
13
USO DE LA PLACA DE COCCIÓN: Plancha
14
Plancha (accesorio opcional)
Uso de la Plancha
PRECAUCIÓN
Peligro De Quemaduras
Ŷ Las superficies de la plancha pueden estar lo suficientemente calientes como para provocar quemaduras durante
y después del uso. Coloque y quite la plancha cuando esté fría y todas las unidades de superficie estén apagadas.
Utilice agarraderas si toca la plancha cuando está caliente. No hacerlo puede provocar quemaduras.
Ŷ Coloque y retire la plancha sólo cuando todas las parrillas y la plancha estén frías y todas las unidades superficiales
estén en OFF (Apagado).
$QWHVGHXWLOL]DUHVWHUHFLSLHQWHGHFRFFLyQSRUSULPHUDYH]OiYHORSDUDDVHJXUDUVHGHTXHHVWpOLPSLR/XHJRF~UHOROLJHUDPHQWH
IURWDQGRDFHLWHGHFRFFLyQVREUHODVXSHUILFLHGHFRFFLyQ
Cómo Colocar La Plancha
IMPORTANTE:6LHPSUHFRORTXH\XWLOLFHODSODQFKDHQOD
XELFDFLyQGHVLJQDGDVREUHODHVWXID
Tipo de Comida
&yPR&DOHQWDU7RUWLOODV
3DQTXHFDV
+DPEXUJXHVDV
+XHYRV)ULWRV
(PEXWLGRVSDUDHO'HVD\XQR
6iQGZLFKHV&DOLHQWHV 7DOHV
FRPRFRQ4XHVRDOD3ODQFKD
Configuración de Cocción
0HG%DMR 0HG/R
0HG%DMR 0HG/R
0HG
0HG%DMR 0HG/R
0HG
0HG%DMR 0HG/R
/DVFRQILJXUDFLRQHVGHODSODQFKDIXQFLRQDQFRPRXQDJXtD\
SXHGHVHUQHFHVDULRDMXVWDUODVHQEDVHDODVSUHIHUHQFLDVGH
FRFFLyQLQGLYLGXDO
Funcionamiento de la Plancha
NOTAS IMPORTANTES:
Ŷ /LPSLHODSODQFKDFRQXQDHVSRQMD\GHWHUJHQWHVXDYHHQ
DJXDWLELD12XWLOLFHHVSRQMLOODVGHIUHJDUD]XOHVRYHUGHV
RODQDGHDFHUR
Ŷ 1RFRFLQHDOLPHQWRVH[WUHPDGDPHQWHJUDVRVRV\WHQJD
FXLGDGRFRQORVGHUUDPHVGHJUDVDPLHQWUDVFRFLQD
Ŷ 1XQFDFRORTXHRDOPDFHQHHOHPHQWRVVREUHODSODQFKD
D~QFXDQGRQRHVWpHQXVR/DSODQFKDSXHGHFDOHQWDUVH
FXDQGRVHXWLOL]DQODVXQLGDGHVGHVXSHUILFLHFHUFDQDV
Ŷ 1RXVHXWHQVLOLRVPHWiOLFRVFRQSXQWDVDILODGDVRERUGHV
iVSHURVSRUTXHSXHGHQGDxDUODSODQFKD1RFRUWH
DOLPHQWRVVREUHODSODQFKD
Ŷ 1RXVHUHFLSLHQWHVGHFRFFLyQSDUDHODOPDFHQDPLHQWRGH
DOLPHQWRVRDFHLWH3XHGHQSURYRFDUVHPDQFKDV\RJULHWDV
SHUPDQHQWHV
Ŷ /DSODQFKDLUiSHUGLHQGRHOFRORUFRQHOWLHPSRGHELGRDOXVR
Ŷ 1ROLPSLHODSODQFKDHQHOKRUQRDXWROLPSLDQWH
Ŷ 6LHPSUHHVSHUHDTXHHOUHFLSLHQWHGHFRFFLyQVHHQIUtH
DQWHVGHVXPHUJLUORHQDJXD
Ŷ 1RVREUHFDOLHQWHODSODQFKD
3DUDHQFHQGHUODVXQLGDGHVGHODVXSHUILFLHGHWRGDOD
SODQFKDXVHODIXQFLyQGHOFRQWUROGH6\QF%XUQHU 4XHPDGRU
6LQFURQL]DGR 3UHVLRQHODWHFODSync Burner (Quemador
Sincronizado)\OXHJRDMXVWHHOQLYHOGHSRWHQFLDDOD
FRQILJXUDFLyQGHVHDGDFRPRVHGHVFULEHHQODSiJLQD
49-80742
Limpieza Normal De Uso Diario
8VHOLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$%5<7(®HQVX
HVWXIDGHYLGULR
3DUDPDQWHQHU\SURWHJHUODVXSHUILFLHGHVXHVWXIDGHYLGULR
VLJDHVWRVSDVRV
$QWHVGHXVDUODHVWXIDSRUSULPHUDYH]OtPSLHORFRQ
OLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$%5<7(®(VWR
D\XGDDSURWHJHUODHVWXID\KDFHODOLPSLH]DPiVVHQFLOOD
(OXVRGLDULRGHOOLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$
%5<7(®D\XGDUiDPDQWHQHUHODUWHIDFWRFRPRQXHYR
6DFXGDELHQODFUHPDGHOLPSLH]D$SOLTXHXQDVJRWDV
GHOLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$%5<7(®
GLUHFWDPHQWHVREUHODHVWXID
8WLOLFHXQDWRDOODGHSDSHORXQSDxR
GHOLPSLH]DSDUDHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®SDUDOLPSLDUWRGD
ODVXSHUILFLHGHODHVWXID
8VHXQSDxRVHFRRXQDWRDOODGH
SDSHOSDUDTXLWDUORVUHVWRVGHO
OLPSLDGRU1RKDFHIDOWDHQMXDJDU
NOTA:(VPX\LPSRUWDQWHTXH12
&$/,(17(ODHVWXIDKDVWDTXHORKD\D
OLPSLDGRSRUFRPSOHWR
Limpie la estufa después
de cada derrame. Utilice
el limpiador de estufas de
cerámica CERAMA BRYTE®.
Residuos Pegados
NOTA:8VWHGSXHGHGDxDUODVXSHUILFLHGHYLGULRVLXWLOL]D
HVSRQMLOODVTXHQRVHDQODVUHFRPHQGDGDV
'HMHHQIULDUODHVWXID
&RORTXHXQDVJRWDVGHOLPSLDGRUGHHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®VREUHWRGDHOiUHDGHUHVLGXRVSHJDGRV
8WLOL]DQGRHOSDxRGHOLPSLH]DSDUDHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®LQFOXLGDIURWHHOiUHDVXFLDDSOLFDQGR
SUHVLyQVHJ~QVHDQHFHVDULR
6LTXHGDQUHVWRVUHSLWDORVSDVRVLQGLFDGRVFRQ
DQWHULRULGDG
3DUDSURWHFFLyQDGLFLRQDOGHVSXpVGHKDEHUTXLWDGRWRGRV
ORVUHVWRVSXODWRGDODVXSHUILFLHFRQOLPSLDGRUGHHVWXIDV
GHFHUiPLFD&(5$0$%5<7(®\XQDWRDOODGHSDSHO
Utilice un paño de limpieza para estufas de cerámica
CERAMA BRYTE®.
Residuos Pegados Rebeldes
'HMHHQIULDUODHVWXID
8WLOLFHODUDVTXHWDGHILOR~QLFRDXQiQJXORDSUR[LPDGR
GHƒFRQWUDODVXSHUILFLHGHOYLGULR\UDVTXHODVXFLHGDG
3XHGHVHUQHFHVDULRDSOLFDUSUHVLyQDODUDVTXHWDSDUD
TXLWDUODVXFLHGDG
'HVSXpVGHUDVFDUFRQODUDVTXHWDGHILORFRORTXH
XQDVJRWDVGHOLPSLDGRUGHHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®VREUHHOiUHDGHVXFLHGDGTXHPDGD
8WLOLFHHOSDxRGHOLPSLH]DSDUDHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®SDUDTXLWDUODVXFLHGDGUHVWDQWH
3DUDSURWHFFLyQDGLFLRQDOGHVSXpVGHKDEHUTXLWDGRWRGRV
ORVUHVWRVSXODWRGDODVXSHUILFLHFRQOLPSLDGRUGHHVWXIDV
GHFHUiPLFD&(5$0$%5<7(®\XQDWRDOODGHSDSHO
49-80742
CUIDADO Y LIMPIEZA: Cómo Limpiar la Estufa de Vidrio
Cómo Limpiar la Estufa de Vidrio
La rasqueta de estufas de cerámica CERAMA BRYTE® y todos los
insumos recomendados se encuentran disponibles en nuestro
Centro de Repuestos. Ver instrucciones bajo la sección “Para solicitar
repuestos” en la página siguiente.
NOTA: No utilice hojas desafiladas o dañadas.
15
CUIDADO Y LIMPIEZA: Cómo Limpiar la Estufa de Vidrio
16
Cómo Limpiar la Estufa de Vidrio
Marcas De Metal Y Rayones
7HQJDFXLGDGRGHQRGHVOL]DUROODV\VDUWHQHVDWUDYpVGHVX
HVWXID'HMDUiPDUFDVGHPHWDOVREUHODVXSHUILFLHGHODHVWXID
(VWDVPDUFDVSXHGHQTXLWDUVHXWLOL]DQGRHOOLPSLDGRUGH
HVWXIDVGHFHUiPLFD&(5$0$%5<7(®FRQHOSDxRGH
OLPSLH]DSDUDHVWXIDVGHFHUiPLFD&(5$0$%5<7(®
6
LVHSHUPLWHTXHROODVFRQXQDFDSDILQDGHDOXPLQLR
RFREUHKLHUYDQHQVHFRODFDSDSXHGHGHMDUXQD
GHFRORUDFLyQQHJUDHQODHVWXID
(VWRGHEHTXLWDUVHGHLQPHGLDWRDQWHVGHFDOHQWDUGH
QXHYRRODGHFRORUDFLyQSXHGHOOHJDUDVHUSHUPDQHQWH
NOTAS:9HULILTXHFRQFXLGDGRTXHODEDVHGHODVROODVQRVHD
iVSHUDSDUDQRUD\DUODHVWXID
Daños por derrames azucarados y plástico derretido
6HGHEHUiWHQHUHVSHFLDOFXLGDGRDOUHWLUDUVXVWDQFLDVFDOLHQWHVa fin de evitar daños permanentes sobre la superficie
de vidrio./RVGHUUDPHVGHSURGXFWRVD]XFDUDGRV WDOHVFRPRJHODWLQDVFDUDPHORFRQD]~FDUGXOFHV\MDUDEHV RSOiVWLFRV
PH]FODGRVSXHGHQKDFHUTXHVHSLTXHODVXSHUILFLHGHVXSODFDGHFRFFLyQ QRFXELHUWRSRUODJDUDQWtD DPHQRVTXHHOGHUUDPH
VHDHOLPLQDGRFXDQGRD~QHVWpFDOLHQWH6HGHEHWHQHUHVSHFLDOFXLGDGRDOUHWLUDUVXVWDQFLDVFDOLHQWHV
$VHJ~UHVHGHXVDUXQDHVSiWXODQXHYD\FRQILOR
1RXVHXQDKRMDGHVDILODGDRURWD
$
SDJXHWRGRVORVHOHPHQWRVGHVXSHUILFLH4XLWHODVROODV
FDOLHQWHV
8WLOL]DQGRXQJXDQWHGHFRFLQD
D8VHXQDUDVTXHWDGHILOR~QLFR UDVTXHWDSDUDHVWXIDV
GHFHUiPLFD&(5$0$%5<7(® SDUDGHVSOD]DUHO
GHUUDPHDXQiUHDIUtDVREUHODHVWXID
E4XLWHHOGHUUDPHFRQWRDOODVGHSDSHO
&
XDOTXLHUGHUUDPHUHVWDQWHGHEHGHMDUVHKDVWDTXHOD
VXSHUILFLHGHODHVWXIDVHKD\DHQIULDGR
1RXVHORVHOHPHQWRVGHVXSHUILFLHGHQXHYRKDVWDTXH
WRGRVORVUHVWRVVHKD\DTXLWDGRSRUFRPSOHWR
NOTA:6LODVXSHUILFLHGHYLGULR\DKDVXIULGRPDUFDVR
KHQGLGXUDVHOYLGULRGHODHVWXIDGHEHUiUHHPSOD]DUVH(QHVWH
FDVRVHUiQHFHVDULDODDWHQFLyQGHXQWpFQLFR
49-80742
Notas
49-80742
17
Notas
18
49-80742
Notas
49-80742
19
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite
solicitar reparaciones.6LVHSURGXFHXQHUURUHQHOIXQFLRQDPLHQWRGHOFRQWUROXQFyGLJRGHIDOODWLWLODUiHQODSDQWDOOD
5HJLVWUHHOFyGLJRGHHUURU\OODPHDOVHUYLFLRWpFQLFR
Problema
Causa Posible
Qué Hacer
Los elementos de
superficie no mantienen
un hervor constante o la
cocción es lenta
Se está utilizando recipientes de cocción
inadecuados.
8VHROODVUHFRPHQGDGDVSDUDODLQGXFFLyQ
FRQEDVHVSODQDV\GHOPLVPRWDPDxRGHO
HOHPHQWRGHVXSHUILFLH
Los elementos de
superficie no funcionan
bien
Los controles de la estufa están mal configurados.
9HULILTXHSDUDHVWDUVHJXURGHTXHVHKD
FRQILJXUDGRHOFRQWUROFRUUHFWRSDUDHO
HOHPHQWRGHVXSHUILFLHTXHHVWiXWLOL]DQGR
Indicador de arco
de corriente en ON
(Encendido) titilando
Recipiente incorrecto.
8VHXQLPiQSDUDYHULILFDUTXHHOUHFLSLHQWH
VHDFRPSDWLEOHFRQODLQGXFFLyQ
El recipiente es muy pequeño.
,QGLFDGRU³21´ (QFHQGLGR 7LWLODQGR±HO
WDPDxRGHODFDFHURODHVWiSRUGHEDMRGHO
WDPDxRPtQLPRGHOHOHPHQWR9HUODVHFFLyQ
&yPRXVDUHOWDPDxRFRUUHFWRGHUHFLSLHQWH
El recipiente no está bien colocado.
&HQWUHHOUHFLSLHQWHHQHODQLOORGHFRFFLyQ
Las teclas +, -, o bloque del control fueron
presionadas antes de haber encendido un elemento.
&RQVXOWHODVHFFLyQGH8VRGHORV(OHPHQWRV
GH&RFFLyQ
Se están usando métodos de limpieza incorrectos.
8WLOLFHSURFHGLPLHQWRVGHOLPSLH]D
UHFRPHQGDGRV9HUODVHFFLyQ&yPROLPSLDU
ODHVWXIDGHYLGULR
Se están usando recipientes con bases ásperas
o hay partículas gruesas (sal o arena) entre el
recipiente y la superficie de la estufa.
Se ha deslizado un recipiente a través de la
superficie de la estufa.
3DUDHYLWDUUD\RQHVXVHORVSURFHGLPLHQWRV
GHOLPSLH]DUHFRPHQGDGRV9HULILTXHTXHODV
EDVHVGHORVUHFLSLHQWHVHVWpQOLPSLDVDQWHV
GHOXVR\XWLOLFHUHFLSLHQWHVFRQEDVHVOLVDV
No se limpiaron los derrames de alimentos antes
del uso siguiente.
9HUODVHFFLyQ&yPROLPSLDUODHVWXIDGH
YLGULR
Superficie caliente en un modelo con un estufa de
vidrio de color claro.
(VWRHVQRUPDO/DVXSHUILFLHSXHGHSDUHFHU
GHFRORUDGDFXDQGRHVWiFDOLHQWH(VWRHV
WHPSRUDO\GHVDSDUHFHUiPLHQWUDVVHHQIUtD
HOYLGULR
Plástico derretido sobre
la superficie
La estufa caliente entró en contacto con plástico.
9HUODVHFFLyQ6XSHUILFLHGHYLGULR
SRVLELOLGDGHVGHGDxRSHUPDQHQWHHQOD
VHFFLyQ&yPROLPSLDUODHVWXIDGHYLGULR
Marcas (o hendiduras)
en la estufa
Se ha derramado una mezcla azucarada caliente en
la estufa.
/ODPHDXQWpFQLFRFDOLILFDGRSDUDHO
UHHPSOD]R
Rayones en la superficie
de vidrio de la estufa
Áreas de decoloración
en la estufa
El teclado no responde
La detección/medición
de ollas no está
funcionando de manera
adecuada
Ruido
20
El teclado está sucio.
/LPSLHHOWHFODGR
El fusible puede haberse quemado o el disyuntor
puede haber saltado.
&DPELHHOIXVLEOHRYXHOYDDFRQILJXUDUHO
GLV\XQWRU
Se está utilizando recipientes de cocción
inadecuados.
8VHXQUHFLSLHQWHSODQRFRQFDSDFLGDGGH
LQGXFFLyQTXHFXPSODFRQHOWDPDxRPtQLPR
SDUDHOHOHPHQWRTXHVHHVWiXVDQGR9HU
ODVHFFLyQ&yPRXVDUHOWDPDxRFRUUHFWRGH
UHFLSLHQWH
El recipiente está mal colocado.
9HULILTXHTXHHOUHFLSLHQWHHVWpFHQWUDGRHQ
HOHOHPHQWRGHVXSHUILFLHFRUUHVSRQGLHQWH
El control de la estufa está mal configurado.
9HULILTXHTXHHOFRQWUROHVWpELHQ
FRQILJXUDGR
Sonidos que es posible que escuche: zumbidos,
pitidos y repiqueteos.
(VWRVVRQLGRVVRQQRUPDOHV&RQVXOWHOD
VHFFLyQGH5XLGRV'XUDQWHOD&RFFLyQ
49-80742
Download PDF

advertising