GE Profile | PP9036DJBB | Use and Care Manual | GE Profile PP9036DJBB Use and Care Manual

Radiant
Cooktop
GEAppliances.com
Safety Information . . . . . . . . . . . . . . 2
Warranty . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Assistance /
Parts and Accessories . . . . . . . . . . . 5
Owner’s Manual
PP9030
PP9036
Using The Cooktop
Cooktop Features . . . . . . . . . . . . . . . . . . . . 6
Radiant Glass Cooktop . . . . . . . . . . . . . . . 7
Home Canning Tips . . . . . . . . . . . . . . . . . . 7
Cookware for Radiant
Glass Cooktop . . . . . . . . . . . . . . . . . . . . . . 8
For Best Results . . . . . . . . . . . . . . . . . . . . . . 8
Element Cycling . . . . . . . . . . . . . . . . . . . . . . 9
Operating The Cooking Elements . . . . . 9
Adjust Burner Size . . . . . . . . . . . . . . . . . . . . 9
Turn Burner(s) Off . . . . . . . . . . . . . . . . . . . 10
Selecting Cooktop Settings . . . . . . . . . . 10
How To Synchronize Left Elements . . . 10
Cooktop Lockout . . . . . . . . . . . . . . . . . . . . 11
Single Kitchen Timer. . . . . . . . . . . . . . . . . 11
Multiple Timers . . . . . . . . . . . . . . . . . . . . . . 12
Hot Light Indicator . . . . . . . . . . . . . . . . . . 12
Custom Settings . . . . . . . . . . . . . . . . . . . . 13
Griddle (optional accessory) . . . . . . . . . 14
Care and Cleaning
Cleaning The Cooktop . . . . . . . . . . . . . . . 15
Troubleshooting Tips . . . . . . . . . . . 20
Write the model and serial
numbers here:
Model # ______________________
Serial # _______________________
You can find them on a label under
the cooktop.
49-80747 02-15 GE
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
WARNING
5HDGDOOVDIHW\LQVWUXFWLRQVEHIRUHXVLQJWKHSURGXFW)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQILUH
HOHFWULFDOVKRFNVHULRXVLQMXU\RUGHDWK
WARNING GENERAL SAFETY INSTRUCTIONS
Ŷ 8VHWKLVFRRNWRSRQO\IRULWVLQWHQGHGSXUSRVHDV
GHVFULEHGLQWKLV2ZQHU¶V0DQXDO
Ŷ %HVXUH\RXUFRRNWRSLVSURSHUO\LQVWDOOHGDQG
JURXQGHGE\DTXDOLILHGLQVWDOOHULQDFFRUGDQFH
ZLWKWKHSURYLGHGLQVWDOODWLRQLQVWUXFWLRQV
Ŷ 'RQRWDWWHPSWWRUHSDLURUUHSODFHDQ\
SDUWRI\RXUFRRNWRSXQOHVVLWLVVSHFLILFDOO\
UHFRPPHQGHGLQWKLVPDQXDO$OORWKHUVHUYLFLQJ
VKRXOGEHSHUIRUPHGE\DTXDOLILHGWHFKQLFLDQ
Ŷ %HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKH
FRRNWRSRUGLVFRQQHFWWKHSRZHUVXSSO\DWWKH
KRXVHKROGGLVWULEXWLRQSDQHOE\UHPRYLQJWKH
IXVHRUVZLWFKLQJRIIWKHFLUFXLWEUHDNHU
Ŷ 'RQRWOHDYHFKLOGUHQDORQH²FKLOGUHQVKRXOGQRW
EHOHIWDORQHRUXQDWWHQGHGLQDQDUHDZKHUHWKH
FRRNWRSLVLQXVH7KH\VKRXOGQHYHUEHDOORZHG
WRFOLPEVLWRUVWDQGRQDQ\SDUWRIWKHFRRNWRS
Ŷ
CAUTION
:'RQRWVWRUHLWHPVRI
LQWHUHVWWRFKLOGUHQDERYHWKHFRRNWRS²FKLOGUHQ
FOLPELQJRQWKHFRRNWRSWRUHDFKLWHPVFRXOGEH
VHULRXVO\LQMXUHG
Ŷ 8VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW
KROGHUVRQKRWVXUIDFHVPD\UHVXOWLQEXUQVIURP
VWHDP'RQRWOHWSRWKROGHUVWRXFKKRWVXUIDFH
XQLWVRUKHDWLQJHOHPHQWV'RQRWXVHDWRZHORU
RWKHUEXON\FORWKLQSODFHRISRWKROGHUV
Ŷ 1HYHUXVH\RXUFRRNWRSIRUZDUPLQJRUKHDWLQJ
WKHURRP
Ŷ 'RQRWWRXFKVXUIDFHHOHPHQWV7KHVHVXUIDFHV
PD\EHKRWHQRXJKWREXUQHYHQWKRXJKWKH\
DUHGDUNLQFRORU'XULQJDQGDIWHUXVHGRQRW
WRXFKRUOHWFORWKLQJRURWKHUIODPPDEOHPDWHULDOV
FRQWDFWWKHVXUIDFHHOHPHQWVRUDUHDVQHDUE\WKH
VXUIDFHHOHPHQWVDOORZVXIILFLHQWWLPHIRUFRROLQJ
ILUVW
Ŷ 3RWHQWLDOO\KRWVXUIDFHVLQFOXGHWKHFRRNWRSDQG
DUHDVIDFLQJWKHFRRNWRS
Ŷ 'RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH
FRXOGEXLOGXSDQGWKHFRQWDLQHUFRXOGEXUVW
FDXVLQJDQLQMXU\
Ŷ &RRNPHDWDQGSRXOWU\WKRURXJKO\²PHDWWR
DWOHDVWDQLQWHUQDOWHPSHUDWXUHRIƒ)DQG
SRXOWU\WRDWOHDVWDQLQWHUQDOWHPSHUDWXUHRI
ƒ)&RRNLQJWRWKHVHWHPSHUDWXUHVXVXDOO\
SURWHFWVDJDLQVWIRRGERUQHLOOQHVV
KEEP FLAMMABLE MATERIALS AWAY FROM THE COOKTOP
WARNING Failure
to do so may result in fire or personal injury.
Ŷ 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVQHDU
Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH
WKHFRRNWRSLQFOXGLQJSDSHUSODVWLFSRWKROGHUV
PDWHULDOVDFFXPXODWHLQRUQHDUWKHFRRNWRS
OLQHQVZDOOFRYHULQJVFXUWDLQVGUDSHVDQG
*UHDVHRQWKHFRRNWRSPD\LJQLWH
JDVROLQHRURWKHUIODPPDEOHYDSRUVDQGOLTXLGV
Ŷ 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH
XVLQJWKHFRRNWRS7KHVHJDUPHQWVPD\LJQLWHLI
WKH\FRQWDFWKRWVXUIDFHVFDXVLQJVHYHUHEXUQV
2
READ AND SAVE THESE INSTRUCTIONS
49-80747
Ŷ ,QWKHHYHQWRIDILUHGRQRWXVHZDWHURU
Ŷ 7RDYRLGVSLOORYHUDQGILUHXVHDPLQLPXPDPRXQW
JUHDVHRQILUHV1HYHUSLFNXSDIODPLQJSDQ
RIRLOZKHQVKDOORZSDQIU\LQJDQGDYRLGFRRNLQJ
7XUQWKHFRQWUROVRII6PRWKHUDIODPLQJSDQRQ
IUR]HQIRRGVZLWKH[FHVVLYHDPRXQWVRILFH
DVXUIDFHXQLWE\FRYHULQJWKHSDQFRPSOHWHO\
Ŷ 8VHWKHSURSHUSDQVL]HVHOHFWFRRNZDUH
ZLWKDZHOOILWWHGOLGFRRNLHVKHHWRUIODW
KDYLQJIODWERWWRPVODUJHHQRXJKWRFRYHUWKH
WUD\8VHDPXOWLSXUSRVHGU\FKHPLFDORUD
VXUIDFHKHDWLQJHOHPHQW7KHXVHRIXQGHUVL]HG
IRDPW\SHILUHH[WLQJXLVKHU
FRRNZDUHZLOOH[SRVHDSRUWLRQRIWKHVXUIDFH
XQLWWRGLUHFWFRQWDFWDQGPD\UHVXOWLQLJQLWLRQ
Ŷ 1HYHUOHDYHWKHVXUIDFHXQLWVXQDWWHQGHGDW
RIFORWKLQJ3URSHUUHODWLRQVKLSRIFRRNZDUHWR
PHGLXPRUKLJKKHDWVHWWLQJV%RLORYHUVFDXVH
VXUIDFHXQLWZLOODOVRLPSURYHHIILFLHQF\
VPRNLQJDQGJUHDV\VSLOORYHUVWKDWPD\FDWFK
RQILUH
Ŷ 7
RPLQLPL]HWKHSRVVLELOLW\RIEXUQVLJQLWLRQRI
IODPPDEOHPDWHULDOVDQGVSLOODJHWKHKDQGOHRI
Ŷ 1HYHUOHDYHRLOXQDWWHQGHGZKLOHIU\LQJ,IDOORZHG
DFRQWDLQHUVKRXOGEHWXUQHGWRZDUGWKHFHQWHU
WRKHDWEH\RQGLWVVPRNLQJSRLQWRLOPD\LJQLWH
RIWKHUDQJHZLWKRXWH[WHQGLQJRYHUQHDUE\
UHVXOWLQJLQILUHWKDWPD\VSUHDGWRVXUURXQGLQJ
VXUIDFHXQLWV
FDELQHWV8VHDGHHSIDWWKHUPRPHWHUZKHQHYHU
SRVVLEOHWRPRQLWRURLOWHPSHUDWXUH
SAFETY INFORMATION
WARNING COOKTOP SAFETY INSTRUCTIONS
WARNING RADIANT COOKTOP SAFETY INSTRUCTIONS
Ŷ 2QO\FHUWDLQW\SHVRIJODVVJODVVFHUDPLF
Ŷ 'RQRWSODFHRUVWRUHLWHPVWKDWFDQPHOWRUFDWFK
HDUWKHQZDUHRURWKHUJOD]HGFRQWDLQHUVDUH
ILUHRQWKHJODVVFRRNWRSHYHQZKHQLWLVQRW
VXLWDEOHIRUFRRNWRSVHUYLFHRWKHUVPD\EUHDN
EHLQJXVHG,IWKHFRRNWRSLVLQDGYHUWHQWO\WXUQHG
EHFDXVHRIWKHVXGGHQFKDQJHLQWHPSHUDWXUH
RQWKH\PD\LJQLWH+HDWIURPWKHFRRNWRSRU
RYHQYHQWDIWHULWLVWXUQHGRIIPD\FDXVHWKHPWR
Ŷ 8VHFDUHZKHQWRXFKLQJWKHFRRNWRS7KHJODVV
LJQLWHDOVR
VXUIDFHRIWKHFRRNWRSZLOOUHWDLQKHDWDIWHUWKH
FRQWUROVKDYHEHHQWXUQHGRII
Ŷ 8VH&(5$0$%5<7(®FHUDPLF&RRNWRS
&OHDQHUDQG&(5$0$%5<7(®&OHDQLQJ3DGWR
Ŷ 'RQRWFRRNRQDEURNHQFRRNWRS,IWKHJODVV
FOHDQWKHFRRNWRS:DLWXQWLOWKHFRRNWRSFRROV
FRRNWRSVKRXOGEUHDNFOHDQLQJVROXWLRQVDQG
DQGWKHLQGLFDWRUOLJKWJRHVRXWEHIRUHFOHDQLQJ
VSLOORYHUVPD\SHQHWUDWHWKHEURNHQFRRNWRSDQG
$ZHWVSRQJHRUFORWKRQDKRWVXUIDFHFDQ
FUHDWHDULVNRIHOHFWULFVKRFN&RQWDFWDTXDOLILHG
FDXVHVWHDPEXUQV6RPHFOHDQHUVFDQSURGXFH
WHFKQLFLDQLPPHGLDWHO\
QR[LRXVIXPHVLIDSSOLHGWRDKRWVXUIDFH5HDG
Ŷ $YRLGVFUDWFKLQJWKHJODVVFRRNWRS7KHFRRNWRS
DQGIROORZDOOLQVWUXFWLRQVDQGZDUQLQJVRQWKH
FDQEHVFUDWFKHGZLWKLWHPVVXFKDVNQLYHV
FOHDQLQJFUHDPODEHONOTE:6XJDU\VSLOOV
VKDUSLQVWUXPHQWVULQJVRURWKHUMHZHOU\DQG
DUHDQH[FHSWLRQ7KH\VKRXOGEHVFUDSHGRII
ULYHWVRQFORWKLQJ
ZKLOHVWLOOKRWXVLQJDQRYHQPLWWDQGDVFUDSHU
6HHWKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQIRU
GHWDLOHGLQVWUXFWLRQV
READ AND SAVE THESE INSTRUCTIONS
49-80747
3
WARRANTY
Thank You! ... for your purchase of a GE Brand appliance.
Register Your Appliance: 5HJLVWHU\RXUQHZDSSOLDQFHRQOLQHDW\RXUFRQYHQLHQFH
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWUHJLVWHU
7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRUHQKDQFHGFRPPXQLFDWLRQDQGSURPSWVHUYLFHXQGHUWKHWHUPVRI\RXUZDUUDQW\
VKRXOGWKHQHHGDULVH<RXPD\DOVRPDLOLQWKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO
GE Electric Cooktop Warranty
GEAppliances.com
$OOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH®WHFKQLFLDQ
7RVFKHGXOHVHUYLFHRQOLQHYLVLWXVDWZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWRUFDOO*(&$5(6
3OHDVHKDYHVHULDOQXPEHUDQGPRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
6HUYLFLQJ\RXUDSSOLDQFHPD\UHTXLUHWKHXVHRIWKHRQERDUGGDWDSRUWIRUGLDJQRVWLFV7KLVJLYHVD*(IDFWRU\
VHUYLFHWHFKQLFLDQWKHDELOLW\WRTXLFNO\GLDJQRVHDQ\LVVXHVZLWK\RXUDSSOLDQFHDQGKHOSV*(LPSURYHLWVSURGXFWV
E\SURYLGLQJ*(ZLWKLQIRUPDWLRQRQ\RXUDSSOLDQFH,I\RXGRQRWZDQW\RXUDSSOLDQFHGDWDWREHVHQWWR*(SOHDVH
DGYLVH\RXUWHFKQLFLDQQRWWRVXEPLWWKHGDWDWR*(DWWKHWLPHRIVHUYLFH
)RUWKHSHULRGRIRQH\HDUIURPWKHGDWHRIWKHRULJLQDOSXUFKDVH*(ZLOOSURYLGHDQ\SDUWRIWKHFRRNWRSZKLFK
IDLOVGXHWRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS'XULQJWKLVOLPLWHGRQH\HDUZDUUDQW\*(ZLOODOVRSURYLGHIUHHRI
FKDUJHDOOODERUDQGLQKRPHVHUYLFHWRUHSODFHWKHGHIHFWLYHSDUW
6WDSOH\RXUUHFHLSWKHUH3URRIRIWKHRULJLQDOSXUFKDVH
GDWHLVQHHGHGWRREWDLQVHUYLFHXQGHUWKHZDUUDQW\
What GE will not cover:
Ŷ 6HUYLFHWULSVWR\RXUKRPHWRWHDFK\RXKRZWRXVH
WKHSURGXFW
Ŷ ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
Ŷ )DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHG
PRGLILHGRUXVHGIRURWKHUWKDQWKHLQWHQGHGSXUSRVH
RUXVHGFRPPHUFLDOO\
Ŷ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
EUHDNHUV
Ŷ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH
IORRGVRUDFWVRI*RG
Ŷ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
SRVVLEOHGHIHFWVZLWKWKLVDSSOLDQFH
Ŷ 'DPDJHFDXVHGDIWHUGHOLYHU\
Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
Ŷ 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU
/('ODPSV
EXCLUSION OF IMPLIED WARRANTIES
<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG:DUUDQW\$Q\LPSOLHGZDUUDQWLHV
LQFOXGLQJWKHLPSOLHGZDUUDQWLHVRIPHUFKDQWDELOLW\RUILWQHVVIRUDSDUWLFXODUSXUSRVHDUHOLPLWHGWRRQH\HDURUWKH
VKRUWHVWSHULRGDOORZHGE\ODZ
7KLVZDUUDQW\LVH[WHQGHGWRWKHRULJLQDOSXUFKDVHUDQGDQ\VXFFHHGLQJRZQHUIRUSURGXFWVSXUFKDVHGIRUKRPHXVH
ZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($XWKRUL]HG6HUYLFHULVQRWDYDLODEOH\RX
PD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG*(6HUYLFHORFDWLRQ
IRUVHUYLFH,Q$ODVNDWKHZDUUDQW\H[FOXGHVWKHFRVWRIVKLSSLQJRUVHUYLFHFDOOVWR\RXUKRPH
6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\JLYHV\RX
VSHFLILFOHJDOULJKWVDQG\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH7RNQRZZKDW\RXUOHJDOULJKWV
DUHFRQVXOW\RXUORFDORUVWDWHFRQVXPHUDIIDLUVRIILFHRU\RXUVWDWH¶V$WWRUQH\*HQHUDO
Warrantor: General Electric Company. Louisville, KY 40225
Extended Warranties:3XUFKDVHD*(H[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH
\RXUZDUUDQW\LVVWLOOLQHIIHFW<RXFDQSXUFKDVHLWRQOLQHDQ\WLPH
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*(&RQVXPHU+RPH6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXU
ZDUUDQW\H[SLUHV
4
49-80747
7U\WKH*($SSOLDQFHV:HEVLWH www.geappliances.com/service_and_support/ KRXUVDGD\DQ\GD\RIWKH
\HDU)RUJUHDWHUFRQYHQLHQFHDQGIDVWHUVHUYLFH\RXFDQQRZGRZQORDG2ZQHU¶V0DQXDOVRUGHUSDUWVRUHYHQ
VFKHGXOHVHUYLFHRQOLQH
Schedule Service: ([SHUW*(UHSDLUVHUYLFHLVRQO\RQH
Real Life Design Studio: *(VXSSRUWVWKH8QLYHUVDO
VWHSDZD\IURP\RXUGRRU*HWRQOLQHDQGVFKHGXOH\RXU 'HVLJQFRQFHSWRISURGXFWVVHUYLFHVDQGHQYLURQPHQWV
VHUYLFHDWZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUW
WKDWFDQEHXVHGE\SHRSOHRIDOODJHVVL]HVDQG
2UFDOO*(&$5(6 GXULQJQRUPDO
FDSDELOLWLHV:HUHFRJQL]HWKHQHHGWRGHVLJQIRUDZLGH
EXVLQHVVKRXUV
UDQJHRISK\VLFDODQGPHQWDODELOLWLHVDQGLPSDLUPHQWV
Parts and Accessories: ,QGLYLGXDOVTXDOLILHGWRVHUYLFH )RUGHWDLOVRI*(¶V8QLYHUVDO'HVLJQDSSOLFDWLRQV
WKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQW LQFOXGLQJNLWFKHQGHVLJQLGHDVIRUSHRSOHZLWKGLVDELOLWLHV
GLUHFWO\WRWKHLUKRPHV 9,6$0DVWHU&DUGDQG'LVFRYHU FKHFNRXWRXU:HEVLWHWRGD\)RUWKHKHDULQJLPSDLUHG
SOHDVHFDOO7''*($& FDUGVDUHDFFHSWHG 2UGHURQOLQHWRGD\KRXUV
HYHU\GD\RUE\SKRQHDWGXULQJQRUPDO
EXVLQHVVKRXUV
,QVWUXFWLRQVFRQWDLQHGLQWKLVPDQXDOFRYHUSURFHGXUHV
WREHSHUIRUPHGE\DQ\XVHU2WKHUVHUYLFLQJJHQHUDOO\
VKRXOGEHUHIHUUHGWRTXDOLILHGVHUYLFHSHUVRQQHO&DXWLRQ
PXVWEHH[HUFLVHGVLQFHLPSURSHUVHUYLFLQJPD\FDXVH
XQVDIHRSHUDWLRQ
Contact Us: ,I\RXDUHQRWVDWLVILHGZLWKWKHVHUYLFH\RX
UHFHLYHIURP*(FRQWDFWXVRQRXU:HEVLWHZLWKDOOWKH
GHWDLOVLQFOXGLQJ\RXUSKRQHQXPEHURUZULWHWR
General Manager, Customer Relations
GE Appliances, Appliance Park Louisville, KY 40225
Parts and Accessories
7RSODFHDQRUGHUYLVLWXVRQOLQHDW
www.GEApplianceParts.com 86 RUwww.GEAppliances.ca &DQDGD RUFDOO800.626.2002 86 800.661.1616 &DQDGD
7KHIROORZLQJSDUWVDUHDYDLODEOH
Parts
*ULGGOH
-;*5,'/
6WDLQOHVV6WHHO&OHDQHUDQG3ROLVKHU
30;
ASSISTANCE / PARTS AND ACCESSORIES
Have a question or need assistance with your appliance?
How to Remove Protective Shipping Film and Packaging Tape
&DUHIXOO\JUDVSDFRUQHURIWKHSURWHFWLYHVKLSSLQJILOP
ZLWK\RXUILQJHUVDQGVORZO\SHHOLWIURPWKHDSSOLDQFH
VXUIDFH'RQRWXVHDQ\VKDUSLWHPVWRUHPRYHWKHILOP
5HPRYHDOORIWKHILOPEHIRUHXVLQJWKHDSSOLDQFHIRUWKH
ILUVWWLPH
49-80747
7RDVVXUHQRGDPDJHLVGRQHWRWKHILQLVKRIWKH
SURGXFWWKHVDIHVWZD\WRUHPRYHWKHDGKHVLYHIURP
SDFNDJLQJWDSHRQQHZDSSOLDQFHVLVDQDSSOLFDWLRQRI
DKRXVHKROGOLTXLGGLVKZDVKLQJGHWHUJHQW$SSO\ZLWKD
VRIWFORWKDQGDOORZWRVRDN
NOTE: 7KHDGKHVLYHPXVWEHUHPRYHGIURPDOOSDUWV,W
FDQQRWEHUHPRYHGLILWLVEDNHGRQ
5
USING THE COOKTOP: Cooktop Features
Cooktop Features
Throughout this manual, features and appearance may vary from your model.
1
2
5
30” wide cooktop
3
4
6
7
User Interface Controls
1
2
5
36” wide cooktop
3
4
6
7
User Interface Controls
1. Cooking Element(s):6HHSDJH
2. Power Level Arc:6HHSDJH
3. Sync Burners:6HHSDJH
4. All Off:6HHSDJH
5. Lock:6HHSDJH
6. Timer Select:6HHSDJH
7. Display:6HHSDJH
6
49-80747
7KHUDGLDQWFRRNWRSIHDWXUHVKHDWLQJXQLWVEHQHDWKD
VPRRWKJODVVVXUIDFH
NOTE:$VOLJKWRGRULVQRUPDOZKHQDQHZFRRNWRSLV
XVHGIRUWKHILUVWWLPH,WLVFDXVHGE\WKHKHDWLQJRIQHZ
SDUWVDQGLQVXODWLQJPDWHULDOVDQGZLOOGLVDSSHDULQD
VKRUWWLPH
NOTE:7KLVFRRNWRSKDV5DSLG5HVSRQVHVXUIDFHXQLWV
7KHFRRNWRSZLOODXWRPDWLFDOO\KHDWXSRUFRROGRZQ
WRWKHGHVLUHGSRZHUOHYHOVHWWLQJLQWKHTXLFNHVWWLPH
SRVVLEOH:KLOHWKHVXUIDFHXQLWVDUHRQ\RXPD\QRW
VHHWKHPJORZUHGGXULQJFHUWDLQKHDWXSRUFRROGRZQ
FRQGLWLRQV
&RRNWRSWHPSHUDWXUHVLQFUHDVHZLWKWKHQXPEHURI
VXUIDFHXQLWVWKDWDUHRQ:LWKRUXQLWVWXUQHGRQ
VXUIDFHWHPSHUDWXUHVDUHKLJK$OZD\VXVHFDXWLRQZKHQ
WRXFKLQJWKHFRRNWRS
Never cook directly on the glass.
Always use cookware.
Always place the pan in the center of
the surface unit you are cooking on.
Do not slide cookware across the cooktop
EHFDXVHLWFDQVFUDWFKWKHJODVV³WKHJODVV
is scratch-resistant, not scratch proof.
Home Canning Tips
%HVXUHWKHFDQQHULVFHQWHUHGRYHUWKHVXUIDFHXQLW
0DNHVXUHWKHFDQQHULVIODWRQWKHERWWRP
7RSUHYHQWEXUQVIURPVWHDPRUKHDWXVHFDXWLRQZKHQ
FDQQLQJ
49-80747
8VHUHFLSHVDQGSURFHGXUHVIURPUHSXWDEOHVRXUFHV7KHVH
DUHDYDLODEOHIURPPDQXIDFWXUHUVVXFKDV%DOO®DQG.HUU®
DQGWKH'HSDUWPHQWRI$JULFXOWXUH([WHQVLRQ6HUYLFH
)ODWERWWRPHGFDQQHUVDUHUHFRPPHQGHG8VHRIZDWHU
EDWKFDQQHUVZLWKULSSOHGERWWRPVPD\H[WHQGWKHWLPH
UHTXLUHGWREULQJWKHZDWHUWRDERLO
USING THE COOKTOP: Radiant Glass Cooktop / Home Canning Tips
Radiant Glass Cooktop
7
USING THE COOKTOP: Cookware for Radiant Glass Cooktop / For Best Results
8
Cookware for Radiant Glass Cooktop
7KHIROORZLQJLQIRUPDWLRQZLOOKHOS\RXFKRRVHFRRNZDUHZKLFKZLOOJLYHJRRGSHUIRUPDQFHRQ
JODVVFRRNWRSV
Stainless Steel:
Porcelain Enamel on Steel:
UHFRPPHQGHG
QRWUHFRPPHQGHG
+HDWLQJHPSW\SDQVFDQFDXVHSHUPDQHQW
GDPDJHWRFRRNWRSJODVV7KHHQDPHOFDQ
PHOWDQGERQGWRWKHFHUDPLFFRRNWRS
Aluminum:
KHDY\ZHLJKWUHFRPPHQGHG
*RRGFRQGXFWLYLW\$OXPLQXPUHVLGXHV
VRPHWLPHVDSSHDUDVVFUDWFKHVRQWKH
Glass-ceramic:
FRRNWRSEXWFDQEHUHPRYHGLIFOHDQHG
QRWUHFRPPHQGHG
LPPHGLDWHO\%HFDXVHRILWVORZPHOWLQJSRLQW 3RRUSHUIRUPDQFH:LOOVFUDWFKWKHVXUIDFH
WKLQZHLJKWDOXPLQXPVKRXOGQRWEHXVHG
Copper Bottom:
UHFRPPHQGHG
&RSSHUPD\OHDYHUHVLGXHVZKLFKFDQ
DSSHDUDVVFUDWFKHV7KHUHVLGXHVFDQEH
UHPRYHGDVORQJDVWKHFRRNWRSLVFOHDQHG
LPPHGLDWHO\+RZHYHUGRQRWOHWWKHVHSRWV
ERLOGU\2YHUKHDWHGPHWDOFDQERQGWRJODVV
FRRNWRSV$QRYHUKHDWHGFRSSHUERWWRPSRW
ZLOOOHDYHDUHVLGXHWKDWZLOOSHUPDQHQWO\
VWDLQWKHFRRNWRSLIQRWUHPRYHGLPPHGLDWHO\
Check pans for flat
bottoms by using a
straight edge.
Stoneware:
QRWUHFRPPHQGHG
3RRUSHUIRUPDQFH0D\VFUDWFKWKHVXUIDFH
Cast Iron:
QRWUHFRPPHQGHG²XQOHVVGHVLJQHG
VSHFLILFDOO\IRUJODVVFRRNWRSV
3RRUFRQGXFWLYLW\DQGVORZWRDEVRUEKHDW
:LOOVFUDWFKWKHFRRNWRSVXUIDFH
Porcelain Enamel on Cast Iron:
UHFRPPHQGHGLIERWWRPRISDQLVFRDWHG
Pans with rounded,
curved, ridged or
warped bottoms are
not recommended.
NOTE:)ROORZDOOFRRNZDUHPDQXIDFWXUHU¶VUHFRPPHQGDWLRQVZKHQXVLQJDQ\W\SHRIFRRNZDUHRQWKHFHUDPLFFRRNWRS
For Best Results
Ŷ 3ODFHRQO\GU\SDQVRQWKHVXUIDFHHOHPHQWV'RQRW
SODFHOLGVRQWKHVXUIDFHHOHPHQWVSDUWLFXODUO\ZHWOLGV
:HWSDQVDQGOLGVPD\VWLFNWRWKHVXUIDFHZKHQFRRO
Ŷ 'RQRWXVHZRNVWKDWKDYHVXSSRUWULQJV7KLVW\SHRI
ZRNZLOOQRWKHDWRQJODVVVXUIDFHHOHPHQWV
Ŷ :HUHFRPPHQGWKDW\RXXVHRQO\DIODWERWWRPHG
ZRN7KH\DUHDYDLODEOHDW\RXUORFDOUHWDLOVWRUH7KH
ERWWRPRIWKHZRNVKRXOGKDYHWKHVDPHGLDPHWHUDV
WKHVXUIDFHHOHPHQWWRHQVXUHSURSHUFRQWDFW
Ŷ 6RPHVSHFLDOFRRNLQJSURFHGXUHVUHTXLUHVSHFLILF
FRRNZDUHVXFKDVSUHVVXUHFRRNHUVRUGHHSIDW
IU\HUV$OOFRRNZDUHPXVWKDYHIODWERWWRPVDQGEHWKH
FRUUHFWVL]H
Do not place wet pans on the
glass cooktop.
Do not use woks with support
rings on the glass cooktop.
Use flat-bottomed woks on
the glass cooktop.
49-80747
6XUIDFHHOHPHQWVZLOOF\FOHRQDQGRIIWRPDLQWDLQWKH
WHPSHUDWXUH\RXKDYHVHOHFWHG$OOUDGLDQWVXUIDFHHOHPHQWV
KDYHDWHPSHUDWXUHOLPLWHUWKDWSURWHFWVWKHJODVVFRRNWRS
IURPJHWWLQJWRRKRWWKLVLVQRUPDO7KHWHPSHUDWXUHOLPLWHU
PD\F\FOHWKHHOHPHQWVRIIPRUHIUHTXHQWO\LI
Ŷ
Ŷ
Ŷ
Ŷ
7KHSDQERLOVGU\
7KHSDQERWWRPLVQRWIODW
7KHSDQLVRIIFHQWHU
7KHUHLVQRSDQRQWKHHOHPHQW
Operating The Cooking Elements
7XUQ%XUQHU V 2Q7RXFKDQGKROGOn/OffSDGDERXW
KDOIDVHFRQG$FKLPHFDQEHKHDUGZLWKHDFKWRXFKWR
DQ\SDG
3RZHUOHYHOFDQEHVHOHFWHGLQDQ\RIWKHIROORZLQJZD\V
LED
Lights
Swipe the gray arc RQWKHJUDSKLFV WRWKHGHVLUHG
SRZHUOHYHOThere is no sensor on the LEDsRU
7RXFKAnywhere DORQJWKHJUD\DUFRU
Gray Arc Swipe Area
Gray Arc
Swipe Area
7RXFK+RU-SDGVWRDGMXVWSRZHUOHYHORU
6KRUWFXWWR+L,PPHGLDWHO\DIWHUWXUQLQJXQLWRQWRXFK
WKH+SDGRU
6KRUWFXWWR/RZ,PPHGLDWHO\DIWHUWXUQLQJXQLWRQ
WRXFKWKH-SDG
Adjust Burner Size
7KHEXUQHUULQJVL]HLVDGMXVWDEOHRQVRPHHOHPHQWV
7KHULQJVL]HFDQEHVHOHFWHGE\SUHVVLQJWKHEXUQHU
ULQJJUDSKLF
49-80747
Single Surface
Element
Dual Surface
Element
Tri-Ring Surface
Element
USING THE COOKTOP: Element Cycling / Operating The Cooking Elements / Adjust Burner Size
Element Cycling
9
USING THE COOKTOP: Turn Burner(s) Off / Selecting Cooktop Settings / How To Synchronize Left Elements
10
Turn Burner(s) Off
7RXFKOn/OffSDGIRUDQLQGLYLGXDOEXUQHURUWRXFKWKH
All OffSDG
Selecting Cooktop Settings
&KRRVHWKHHOHPHQWEXUQHUWKDWLVEHVWILWWRWKH
FRRNZDUHVL]H(DFKHOHPHQWEXUQHURQ\RXUQHZ
FRRNWRSKDVLWVRZQSRZHUOHYHOVUDQJLQJIURPORZWR
KLJK3RZHUOHYHOVHWWLQJVQHFHVVDU\IRUFRRNLQJZLOOYDU\
GHSHQGLQJRQWKHFRRNZDUHEHLQJXVHGWKHW\SHDQG
TXDQWLW\RIIRRGDQGWKHGHVLUHGRXWFRPH,QJHQHUDO
XVHORZHUVHWWLQJVIRUPHOWLQJKROGLQJDQGVLPPHULQJ
DQGXVHKLJKHUVHWWLQJVIRUKHDWLQJTXLFNO\VHDULQJ
DQGIU\LQJ:KHQNHHSLQJIRRGVZDUPFRQILUPVHOHFWHG
VHWWLQJLVVXIILFLHQWWRPDLQWDLQIRRGWHPSHUDWXUHDERYH
ƒ)/DUJHUHOHPHQWVDQGHOHPHQWVPDUNHG³.HHS
:DUP´DUHQRWUHFRPPHQGHGIRUPHOWLQJ
+LLVWKHKLJKHVWSRZHUOHYHOGHVLJQHGIRUODUJHTXDQWLW\
UDSLGFRRNLQJDQGERLOLQJ+LZLOORSHUDWHIRUDPD[LPXP
RIPLQXWHV+LPD\EHUHSHDWHGDIWHUWKHLQLWLDO
PLQXWHF\FOHE\SUHVVLQJWKH+SDG
Hi
boiling quickly
CAUTION
: 'RQRW
SODFHDQ\FRRNZDUHXWHQVLOVRU
OHDYHH[FHVVZDWHUVSLOOVRQFRQWURO
NH\SDGV7KLVPD\UHVXOWLQ
XQUHVSRQVLYHWRXFKSDGVDQGWXUQLQJ
RIIWKHFRRNWRSLISUHVHQWIRUVHYHUDO
VHFRQGV
frying
searing
reducing
simmering
holding
Low
melting
How To Synchronize Left Elements
To Turn On
To Turn Off
+ROGWKHSync BurnersSDGIRUDERXWKDOIDVHFRQG
WRFRQQHFWWKHWZREXUQHUV2SHUDWHHLWKHUHOHPHQWDV
GHVFULEHGRQSDJHWRDGMXVWSRZHUOHYHO
7RXFKWKHOn/OffSDGRQHLWKHUEXUQHUWRWXUQRIIWKH
6\QF%XUQHUV
RU
7RXFKWKHSync BurnersWRWXUQERWKEXUQHUVRII
49-80747
Lock
7RXFKControl LockSDGIRUVHFRQGV
Control Lock
Indicator/Symbol
Unlock
7RXFKControl LockSDGDJDLQIRUVHFRQGV
Cooktop Lockout: locks operation of the controls
6HH&XVWRP6HWWLQJVVHFWLRQWRDFWLYDWH$XWR/RFNIHDWXUH
Single Kitchen Timer
To Turn On
To Turn Off
7RXFKWKHTimer SelectSDG7RXFKWKH೸RUVDUURZV
WRFKRRVHWKHGHVLUHGQXPEHURIPLQXWHV7LPHU
DXWRPDWLFDOO\VWDUWVVHFRQGVDIWHUSDGLVWRXFKHG7KH
³21´/('ZLOODSSHDUDXWRPDWLFDOO\ZKHQWLPHULVVHW
+ROGTimer SelectSDGIRUVHFRQGVWRFDQFHOWLPHU
$ODUPZLOOVRXQGFRQWLQXRXVO\ZKHQWLPHLVXSXQWLOXVHU
WXUQVWLPHURII
49-80747
NOTE: 8VHWKHNLWFKHQWLPHUWRPHDVXUHFRRNLQJWLPH
RUDVDUHPLQGHU7KHNLWFKHQWLPHUGRHVQRWFRQWUROWKH
FRRNLQJHOHPHQWV7LPHUWXUQVRIILIWKHUHLVQRDFWLYLW\
IRUVHFRQGV
USING THE COOKTOP: Cooktop Lockout / Single Kitchen Timer
Cooktop Lockout
11
USING THE COOKTOP: Multiple Timers / Hot Light Indicator
Multiple Timers
Timer Mode
)RUPRUHLQIRUPDWLRQVHH&XVWRP6HWWLQJV7LPHU0RGH
VHFWLRQIRU0XOWL7LPHUIHDWXUH(DFKEXUQHUFDQEH
OLQNHGWRDWLPHU%XUQHUPXVWEHRQWRVHWWKHWLPHU
:KHQPRUHWKDQRQHEXUQHULVRQWKHRUGHURIWKHWLPHU
LVIURPOHIWWRULJKW
To Turn ON Multiple Timers
7RXFKWKHTimer SelectSDG7KHFRUUHVSRQGLQJ
EXUQHUSRZHUOHYHODQGWKHGLVSOD\ZLOOEOLQN7RXFK
WKH೸RUVDUURZVWRDGMXVWWLPH7LPHUDXWRPDWLFDOO\
VWDUWVDIWHUVHFRQGVLIWKHUHLVQRIXUWKHUDFWLRQ7KH
³21´/('ZLOOOLJKWZKHQWLPHULVRQ
7RVHWWLPHUIRUWKHQH[WEXUQHUWRXFKWKHTimer
Select SDG7KHFRUUHVSRQGLQJEXUQHUSRZHUOHYHODQG
WKHGLVSOD\ZLOOEOLQN7RXFKWKH೸RUVDUURZVWRDGMXVW
WLPH7LPHUDXWRPDWLFDOO\VWDUWVDIWHUVHFRQGVLI
WKHUHLVQRIXUWKHUDFWLRQ7KH³21´/('ZLOOOLJKWZKHQ
WLPHULVRQ5HSHDWWKHVWHSVIRUWKHUHPDLQLQJWLPHUV
To Turn OFF Multiple Timers
+ROGTimer SelectSDGIRUVHFRQGVWRFDQFHOWLPHU
7KHFRUUHVSRQGLQJEXUQHUSRZHUOHYHODQGGLVSOD\ZLOO
EOLQN:KHQWKHEXUQHUWLPHVRXWWKHFRUUHVSRQGLQJ
WLPHUDOVRWLPHVRXW
Burner Power Level
Display
Hot Light Indicator
$KRWVXUIDFHLQGLFDWRUOLJKW RQHIRUHDFKFRRNLQJ
HOHPHQW ZLOOJORZZKHQWKHJODVVVXUIDFHLVKRWDQGZLOO
UHPDLQRQXQWLOWKHVXUIDFHKDVFRROHGWRDWHPSHUDWXUH
WKDWLVVDIHWRWRXFK
Hot Surface Indicator Light
12
49-80747
3
UHVVDQGKROGAll OffSDGIRUVHFRQGVWKHQ
LPPHGLDWHO\SUHVVDQGKROGWKHTimer SelectSDGIRU
VHFRQGVWRHQWHUFXVWRPVHWWLQJV7KRVHWZRSDGV
PXVWEHSUHVVHGZLWKLQVHFRQGV$Q\RWKHUSDG
ZLOOFDQFHOPRGH
³ &´DSSHDUVRQGLVSOD\7RQDYLJDWHWKURXJKWKH
&XVWRP6HWWLQJVXVHWKH೸ XS RUV GRZQ SDGV,I
೸ XS LVVHOHFWHGWKHGLVSOD\F\FOHVWDUWVDW³&´,I
V GRZQ LVVHOHFWHGWKHGLVSOD\F\FOHVWDUWVDW³&´
7
RDFWLYDWHDQHZ&XVWRP6HWWLQJWKHXVHUZLOOWRXFK
DQGKROGWKHTimer SelectSDGIRUVHF2QO\21(
RIWKH&XVWRP6HWWLQJ&KRLFHVFDQEHDFWLYDWHGIRU
HDFK&XVWRP6HWWLQJ7KHUHG³2Q´/('ZLOOWXUQRQ
DQGDVRXQGZLOOJRRIIRQFHDQHZFXVWRPVHWWLQJLV
DFWLYDWHG
7KHFRRNWRSZLOOH[LW&XVWRP6HWWLQJVLILWLVLQDFWLYH
IRUPLQXWHV
7RH[LW&XVWRP6HWWLQJVDQGVDYHDQ\FKDQJHVWRXFK
DQGKROGWKHAll OffSDGIRUVHFRQGV
USING THE COOKTOP: Custom Settings
Custom Settings
Custom Settings Chart
Custom Settings
Custom Setting Choices
C0 (Factory Settings)
C01 - )DFWRU\5HVHW &OHDUVFXVWRPL]HGVHWWLQJVDQGUHVWRUHVGHIDXOWV
C02 - &XVWRPVHWWLQJVDFWLYDWHG 1RWYLVLEOHXQOHVVDQ\RWKHUFXVWRPVHWWLQJLVVHOHFWHG$QG
DXWRPDWLFDOO\RQZKHQDQ\RWKHUFXVWRPVHWWLQJLVVHOHFWHG1RWVHOHFWDEOHE\XVHU
C11 - 6WDQGDUG/RFN LH2QO\RQZKHQORFNEXWWRQSUHVVHGIRUVHFRQGV ,IXVLQJDWLPHU
&RQWURO/RFNLVXQDYDLODEOH
C12 - $XWR/RFN LH(QJDJHVDIWHUFRRNWRSKDVEHHQLQVWDQGE\PRGHIRUPLQXWHV 7KHXQLWVKRXOGEH
FRPSOHWHO\RIIWRJRLQWR$XWR/RFN
C21 - )XOOLOOXPLQDWLRQ
C22 - 0HGLXPLOOXPLQDWLRQ
C23 - /RZHVWLOOXPLQDWLRQ
C31 - $OOVRXQGVDFWLYDWHGDW )RUDODUPVRXQGV :KDWHYHUOHYHOLVVHWLQF
C32 - %XWWRQVRXQGOHYHOUHGXFHGE\$ODUPVRXQGVDW
C33 - %XWWRQVRXQGVGHDFWLYDWHG$ODUPVRXQGVDFWLYDWHGDW
C41 - +LJK
C42 - /RZ
C51 - ,QGHILQLWH LHDODUPFRQWLQXHVXQWLOFDQFHOOHGE\XVHU C52 - $ODUPVRXQGVIRUVHFRQGV
C53 - $ODUPVRXQGVIRUVHFRQGV
C54 - $ODUPVRXQGVIRUVHFRQGV
C61 - 6LQJOH.LWFKHQ7LPH ,QGHSHQGHQWRIHOHPHQWV
C62 - 0XOWL7LPHU 7LHGWRHDFKHOHPHQW
C1 (Control Lock)
C2 (LED light level)
C3 (Button Loudness)
C4 (Timer Alarm Loudness)
C5 (Timer Alarm Duration)
C6 (Timer Mode)
2SWLRQVLQJUH\DUHGHIDXOWVHWWLQJV
49-80747
13
USING THE COOKTOP: Griddle
Griddle (optional accessory)
Using the Griddle
CAUTION
Burn Hazard
Ŷ Griddle surfaces may be hot enough to cause burns during and after use. Place and remove the griddle
when it is cool and all surface units are off. Use oven mitts if you will touch the griddle while hot.
Failure to do so can result in burns.
Ŷ Place and remove the griddle only when griddle is cool and all surface burners are turned OFF.
%HIRUHXVLQJWKLVFRRNZDUHIRUWKHILUVWWLPHZDVKLWWRPDNHVXUHLWLVFOHDQ7KHQVHDVRQLWOLJKWO\UXEELQJFRRNLQJ
RLORQWRWKHFRRNLQJVXUIDFH
How To Place The Griddle
IMPORTANT:$OZD\VSODFHDQGXVH\RXUJULGGOHDWWKH
GHVLJQDWHGORFDWLRQRQWKHFRRNWRS
Type of Food
Cook Setting
:DUPLQJ7RUWLOODV
0HG/R
3DQFDNHV
0HG/R
+DPEXUJHUV
)ULHG(JJV
%UHDNIDVW6DXVDJH/LQNV
+RW6DQGZLFKHV VXFKDV*ULOOHG&KHHVH
0HG
0HG/R
0HG
0HG/R
*ULGGOHVHWWLQJVDUHLQWHQGHGWREHDJXLGHOLQHDQGPD\QHHGWREH
DGMXVWHGEDVHGRQLQGLYLGXDOFRRNLQJSUHIHUHQFHV
Griddle Operation
7RWXUQRQWKHVXUIDFHXQLWVIRUWKHHQWLUHJULGGOHXVH
WKH6\QF%XUQHUFRQWUROIHDWXUH7RXFKWKHSync Burner
SDGDQGWKHQDGMXVWSRZHUOHYHOWRGHVLUHGVHWWLQJDV
GHVFULEHGRQSDJH
IMPORTANT NOTES:
Ŷ &OHDQWKHJULGGOHZLWKDVSRQJHDQGPLOGGHWHUJHQW
LQZDUPZDWHU'2127XVHEOXHRUJUHHQVFUXEELQJ
SDGVRUVWHHOZRRO
Ŷ $YRLGFRRNLQJH[WUHPHO\JUHDV\IRRGVDQGEHFDUHIXO
RIJUHDVHVSLOORYHUZKLOHFRRNLQJ
Ŷ 1HYHUSODFHRUVWRUHDQ\LWHPVRQWKHJULGGOHHYHQ
ZKHQLWLVQRWLQXVH7KHJULGGOHFDQEHFRPHKHDWHG
ZKHQXVLQJWKHVXUURXQGLQJVXUIDFHXQLWV
Ŷ $YRLGXVLQJPHWDOXWHQVLOVZLWKVKDUSSRLQWVRUURXJK
HGJHVZKLFKPLJKWGDPDJHWKHJULGGOH'RQRWFXW
IRRGVRQWKHJULGGOH
Ŷ 'RQRWXVHFRRNZDUHDVDVWRUDJHFRQWDLQHUIRUIRRGRU
RLO3HUPDQHQWVWDLQLQJDQGRUFUD]HOLQHVFRXOGUHVXOW
Ŷ <RXUJULGGOHZLOOGLVFRORURYHUWLPHZLWKXVH
Ŷ 'RQRWFOHDQWKHJULGGOHLQDVHOIFOHDQLQJRYHQ
Ŷ $OZD\VDOORZWKHFRRNZDUHWRFRROEHIRUHLPPHUVLQJLQ
ZDWHU
Ŷ 'RQRWRYHUKHDWWKHJULGGOH
14
49-80747
Normal Daily Use Cleaning
21/<XVH&(5$0$%5<7(®&HUDPLF&RRNWRS&OHDQHU
RQWKHJODVVFRRNWRS2WKHUFUHDPVPD\QRWEHDV
HIIHFWLYH
7RPDLQWDLQDQGSURWHFWWKHVXUIDFHRI\RXUJODVV
FRRNWRSIROORZWKHVHVWHSV
%HIRUHXVLQJWKHFRRNWRSIRUWKHILUVWWLPHFOHDQLW
ZLWK&(5$0$%5<7(®&HUDPLF&RRNWRS&OHDQHU
7KLVKHOSVSURWHFWWKHWRSDQGPDNHVFOHDQXSHDVLHU
'DLO\XVHRI&(5$0$%5<7(®&HUDPLF&RRNWRS
&OHDQHUZLOOKHOSNHHSWKHFRRNWRSORRNLQJQHZ
6KDNHWKHFOHDQLQJFUHDPZHOO$SSO\DIHZGURSVRI
&(5$0$%5<7(®&HUDPLF&RRNWRS&OHDQHUGLUHFWO\
WRWKHFRRNWRS
8VHDSDSHUWRZHORU
&(5$0$%5<7(®&OHDQLQJ
3DGIRU&HUDPLF&RRNWRSV
WRFOHDQWKHHQWLUHFRRNWRS
VXUIDFH
8VHDGU\FORWKRUSDSHUWRZHO
WRUHPRYHDOOFOHDQLQJUHVLGXH
1RQHHGWRULQVH
NOTE:,WLVYHU\LPSRUWDQWWKDW
\RX'2127KHDWWKHFRRNWRS
Clean your cooktop after each
XQWLOLWKDVEHHQFOHDQHG
spill. Use CERAMA BRYTE®
WKRURXJKO\
Ceramic Cooktop Cleaner.
Burned-On Residue
NOTE:'$0$*(WR\RXUJODVVVXUIDFHPD\RFFXULI\RX
XVHVFUXESDGVRWKHUWKDQWKRVHUHFRPPHQGHG
$OORZWKHFRRNWRSWRFRRO
6SUHDGDIHZGURSVRI&(5$0$%5<7(®&HUDPLF
&RRNWRS&OHDQHURQWKHHQWLUHEXUQHGUHVLGXHDUHD
8VLQJWKHLQFOXGHG&(5$0$%5<7(®&OHDQLQJ3DG
IRU&HUDPLF&RRNWRSVUXEWKHUHVLGXHDUHDDSSO\LQJ
SUHVVXUHDVQHHGHG
,IDQ\UHVLGXHUHPDLQVUHSHDWWKHVWHSVOLVWHGDERYH
DVQHHGHG
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOOUHVLGXHKDVEHHQ
UHPRYHGSROLVKWKHHQWLUHVXUIDFHZLWK&(5$0$
%5<7(®&HUDPLF&RRNWRS&OHDQHUDQGDSDSHUWRZHO
Use a CERAMA BRYTE® Cleaning
Pad for Ceramic Cooktops.
Heavy, Burned-On Residue
$OORZWKHFRRNWRSWRFRRO
8VHDVLQJOHHGJHUD]RUEODGHVFUDSHUDWDSSUR[LPDWHO\
DƒDQJOHDJDLQVWWKHJODVVVXUIDFHDQGVFUDSHWKH
VRLO,WZLOOEHQHFHVVDU\WRDSSO\SUHVVXUHWRWKHUD]RU
VFUDSHULQRUGHUWRUHPRYHWKHUHVLGXH
$IWHUVFUDSLQJZLWKWKHUD]RUVFUDSHUVSUHDGD
IHZGURSVRI&(5$0$%5<7(®&HUDPLF&RRNWRS
&OHDQHURQWKHHQWLUHEXUQHGUHVLGXHDUHD8VHWKH
&(5$0$%5<7(®&OHDQLQJ3DGWRUHPRYHDQ\
UHPDLQLQJUHVLGXH
)RUDGGLWLRQDOSURWHFWLRQDIWHUDOOUHVLGXHKDVEHHQ
UHPRYHGSROLVKWKHHQWLUHVXUIDFHZLWK&(5$0$
%5<7(®&HUDPLF&RRNWRS&OHDQHUDQGDSDSHUWRZHO
49-80747
CARE AND CLEANING: Cleaning the Glass Cooktop
Cleaning the Glass Cooktop
The CERAMA BRYTE® Ceramic Cooktop Scraper and all
recommended supplies are available through our Parts Center.
See instructions under “Assistance / Accessories” section.
NOTE: Do not use a dull or nicked blade.
15
CARE AND CLEANING: Cleaning the Glass Cooktop
16
Cleaning the Glass Cooktop (Cont.)
Metal Marks and Scratches
%HFDUHIXOQRWWRVOLGHSRWVDQGSDQVDFURVV\RXU
FRRNWRS,WZLOOOHDYHPHWDOPDUNLQJVRQWKHFRRNWRS
VXUIDFH
7KHVHPDUNVDUHUHPRYDEOHXVLQJWKH&(5$0$
%5<7(®&HUDPLF&RRNWRS&OHDQHUZLWKWKH&(5$0$
%5<7(®&OHDQLQJ3DGIRU&HUDPLF&RRNWRSV
,ISRWVZLWKDWKLQRYHUOD\RIDOXPLQXPRUFRSSHU
DUHDOORZHGWRERLOGU\WKHRYHUOD\PD\OHDYHEODFN
GLVFRORUDWLRQRQWKHFRRNWRS
7KLVVKRXOGEHUHPRYHGLPPHGLDWHO\EHIRUHKHDWLQJ
DJDLQRUWKHGLVFRORUDWLRQPD\EHSHUPDQHQW
NOTE:&DUHIXOO\FKHFNWKHERWWRPRISDQVIRUURXJKQHVV
WKDWZRXOGVFUDWFKWKHFRRNWRS
Damage from Sugary Spills and Melted Plastic
6SHFLDOFDUHVKRXOGEHWDNHQZKHQUHPRYLQJKRWVXEVWDQFHVto avoid permanent damage of the glass surface
6XJDU\VSLOORYHUV VXFKDVMHOOLHVIXGJHFDQG\V\UXSV RUPHOWHGSODVWLFVFDQFDXVHSLWWLQJRIWKHVXUIDFHRI\RXU
FRRNWRS QRWFRYHUHGE\WKHZDUUDQW\ XQOHVVWKHVSLOOLVUHPRYHGZKLOHVWLOOKRW6SHFLDOFDUHVKRXOGEHWDNHQZKHQ
UHPRYLQJKRWVXEVWDQFHV
%HVXUHWRXVHDQHZVKDUSUD]RUVFUDSHU
'RQRWXVHDGXOORUQLFNHGEODGH
7XUQRIIDOOVXUIDFHXQLWV5HPRYHKRWSDQV
:HDULQJDQRYHQPLWW
D8VHDVLQJOHHGJHUD]RUEODGHVFUDSHU &(5$0$
%5<7(®&HUDPLF&RRNWRS6FUDSHU WRPRYHWKH
VSLOOWRDFRRODUHDRQWKHFRRNWRS
E5HPRYHWKHVSLOOZLWKSDSHUWRZHOV
$Q\UHPDLQLQJVSLOORYHUVKRXOGEHOHIWXQWLOWKHVXUIDFH
RIWKHFRRNWRSKDVFRROHG
'RQ¶WXVHWKHVXUIDFHXQLWVDJDLQXQWLODOORIWKH
UHVLGXHKDVEHHQFRPSOHWHO\UHPRYHG
NOTE:,ISLWWLQJRULQGHQWDWLRQLQWKHJODVVVXUIDFHKDV
DOUHDG\RFFXUUHGWKHFRRNWRSJODVVZLOOKDYHWREH
UHSODFHG,QWKLVFDVHVHUYLFHZLOOEHQHFHVVDU\
49-80747
Notes
49-80747
17
Notes
18
49-80747
Notes
49-80747
19
TROUBLESHOOTING TIPS
20
Troubleshooting tips ... Before you call for service
6DYHWLPHDQGPRQH\5HYLHZWKHFKDUWVRQWKHIROORZLQJSDJHVILUVWDQG\RXPD\QRWQHHGWRFDOOIRUVHUYLFH,IDQHUURU
RFFXUVLQWKHFRQWURORSHUDWLRQDIDXOWFRGHZLOOIODVKLQWKHGLVSOD\5HFRUGWKHHUURUFRGHDQGFDOOIRUVHUYLFH
Problem
Possible Cause
What To Do
Surface elements will not
maintain a rolling boil or
cooking is slow
Improper cookware being used.
8VHSDQVWKDWDUHDEVROXWHO\IODWDQGPDWFK
WKHGLDPHWHURIWKHVXUIDFHXQLWVHOHFWHG
Surface elements do not
work properly
Cooktop controls improperly set.
&KHFNWREHVXUHWKHFRUUHFWFRQWUROLVVHWIRU
WKHVXUIDFHHOHPHQW\RXDUHXVLQJ
Power arc ON
indicator blinking
+, -, or control lock pads have been touched
before an element is turned on.
6HHWKH2SHUDWLQJWKH&RRNLQJ(OHPHQWV
VHFWLRQ
Scratches on cooktop
glass surface
Incorrect cleaning methods being used.
8VHUHFRPPHQGHGFOHDQLQJSURFHGXUHV6HH
WKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQ
Cookware with rough bottoms being used
or coarse particles (salt or sand) were
between the cookware and the surface of
the cooktop. Cookware has been slid across
the cooktop surface.
7RDYRLGVFUDWFKHVXVHWKHUHFRPPHQGHG
FOHDQLQJSURFHGXUHV0DNHVXUHERWWRPV
RIFRRNZDUHDUHFOHDQEHIRUHXVHDQGXVH
FRRNZDUHZLWKVPRRWKERWWRPV
Areas of discoloration on
the cooktop
Food spillovers not cleaned before next use.
6HHWKH&OHDQLQJWKHJODVVFRRNWRSVHFWLRQ
Hot surface on a model with a light-colored
glass cooktop.
7KLVLVQRUPDO7KHVXUIDFHPD\DSSHDU
GLVFRORUHGZKHQLWLVKRW7KLVLVWHPSRUDU\
DQGZLOOGLVDSSHDUDVWKHJODVVFRROV
Plastic melted to the
surface
Hot cooktop came into contact with plastic
placed on the hot cooktop.
6HHWKH*ODVVVXUIDFH±SRWHQWLDOIRU
SHUPDQHQWGDPDJHVHFWLRQLQWKH&OHDQLQJ
WKHJODVVFRRNWRSVHFWLRQ
Pitting (or indentation) of
the cooktop
Hot sugar mixture spilled on the cooktop.
&DOODTXDOLILHGWHFKQLFLDQIRUUHSODFHPHQW
Unresponsive keypad
Keypad is dirty.
&OHDQWKHNH\SDG
A fuse in your home may be blown or the
circuit breaker tripped.
5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU
49-80747
Radiante
Table de cuisson
GEAppliances.com
Consignes De Sécurité . . . . . . . . . . . . . . .2
Garantie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
Assistance /
Pièces et accessoires . . . . . . . . . . . . . . . . .5
Manuel du Propriétaire
PP9030
PP9036
Utilisation de la table de cuisson
Fonctions de la table de cuisson . . . . . . . . . . .6
Table de cuisson en verre à
éléments radiants . . . . . . . . . . . . . . . . . . . . . . .7
Conseils pour la mise en conserve . . . . . . . . .7
Batterie de cuisine pour table de
cuisson en verre radiant . . . . . . . . . . . . . . . . .8
Pour des résultats optimums . . . . . . . . . . . . . .8
Cycle de l’élément . . . . . . . . . . . . . . . . . . . . . . . . .9
Fonctionnement des éléments de cuisson . .9
Réglage du brûleur . . . . . . . . . . . . . . . . . . . . . . . .9
Extinction d’un ou de plusieurs brûleurs . . 10
Sélection des réglages de la table
de cuisson . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
Comment synchroniser les éléments
de gauche . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
Verrouillage de la table de cuisson . . . . . . . 11
Minuterie de cuisine simple . . . . . . . . . . . . . . 11
Minuteries multiples . . . . . . . . . . . . . . . . . . . . . 12
Témoin lumineux de surface chaude . . . . . 12
Réglages personnalisés . . . . . . . . . . . . . . . . . 13
Plaque chauffante (accessoire en option) . . 14
Entretien et nettoyage
Nettoyage de la vitre
de la table de cuisson . . . . . . . . . . . . . . . . . 15
Trucs de dépannage . . . . . . . . . . . . . . . . 20
Inscrivez ci-dessous les numéros de
modèle et de série
N° de modèle __________________
N° de série ____________________
Ils se trouvent sur une étiquette sous
la table de cuisson.
49-80747 02-15 GE
CONSIGNES DE SÉCURITÉ
CONSIGNES DE SÉCURITÉ IMPORTANTES.
VEUILLEZ LIRE TOUTES LES CONSIGNES AVANT D’UTILISER L’APPAREIL.
AVERTISSEMENT!
Veuillez lire toutes les consignes avant d’utiliser ce produit. Le non-respect de ces instructions pourrait entraîner un
incendie, un choc électrique, une blessure grave voire la mort.
AVERTISSEMENT! CONSIGNES GÉNÉRALES DE SÉCURITÉ
Ŷ 8WLOLVH]FHWWHWDEOHGHFXLVVRQXQLTXHPHQWDX[ILQV
DX[TXHOOHVHOOHDpWpGHVWLQpHHWGHODIDoRQGpFULWH
dans le présent manuel d’utilisation.
Ŷ $VVXUH]YRXVTXHYRWUHWDEOHGHFXLVVRQHVW
FRUUHFWHPHQWLQVWDOOpHHWIL[pHDXVROSDUXQLQVWDOOHXU
TXDOLILpVHORQOHVLQVWUXFWLRQVG¶LQVWDOODWLRQIRXUQLHV
Ŷ 1¶HVVD\H]SDVGHUpSDUHUQLGHUHPSODFHUXQH
pièce de votre table de cuisson, à moins que
FHODQHVRLWVSpFLILTXHPHQWUHFRPPDQGpGDQVFH
PDQXHO7RXWHDXWUHUpSDUDWLRQGRLWrWUHHIIHFWXpH
SDUXQWHFKQLFLHQTXDOLILp
Ŷ $YDQWG¶HIIHFWXHUTXHOTXHUpSDUDWLRQGpEUDQFKH]OD
table de cuisson ou coupez l’alimentation électrique
au panneau de distribution électrique du domicile en
UHWLUDQWOHIXVLEOHRXHQGpVDUPDQWOHGLVMRQFWHXU
Ŷ 1HODLVVH]SDVOHVHQIDQWVVDQVVXUYHLOODQFH/HV
HQIDQWVQHGRLYHQWSDVrWUHODLVVpVVHXOVQLVDQV
surveillance dans la zone d’utilisation de la table de
FXLVVRQ,OVQHGRLYHQWMDPDLVJULPSHUV¶DVVHRLURXVH
tenir debout sur la table de cuisson.
Ŷ
MISE EN GARDE
: 1HUDQJH]SDV
G¶DUWLFOHVDWWUD\DQWVSRXUOHVHQIDQWVDXGHVVXVGH
ODWDEOHGHFXLVVRQOHVHQIDQWVTXLJULPSHQWVXU
la table pour atteindre les articles risquent de se
blesser gravement.
Ŷ 8WLOLVH]XQLTXHPHQWGHVSRLJQpHVVqFKHVO¶XWLOLVDWLRQ
de poignées humides ou mouillées pourrait entraîner
GHVEU€OXUHVSDUYDSHXU1HODLVVH]SDVOHVSRLJQpHV
HQWUHUHQFRQWDFWDYHFOHVpOpPHQWVFKDXIIDQWV
Ŷ 1¶XWLOLVH]MDPDLVYRWUHWDEOHGHFXLVVRQSRXU
UpFKDXIIHURXFKDXIIHUXQHVDOOH
Ŷ 1HWRXFKH]SDVDX[pOpPHQWVGHVXUIDFH0rPH
V¶LOVSUpVHQWHQWXQHFRXOHXUIRQFpHFHVpOpPHQWV
peuvent devenir chauds au point de brûler la peau.
'XUDQWHWDSUqVO¶XWLOLVDWLRQpYLWH]GHWRXFKHUDX[
pOpPHQWVGHVXUIDFHHWQHODLVVH]SDVGHYrWHPHQWV
QLG¶DXWUHVPDWLqUHVLQIODPPDEOHVDXFRQWDFWRXj
SUR[LPLWpGHFHVpOpPHQWVFKDXIIDQWVDOORXH]G¶DERUG
VXIILVDPPHQWGHWHPSVSRXUOHXUUHIURLGLVVHPHQW
Ŷ (QSOXVGHODWDEOHGHFXLVVRQOHVVXUIDFHV\IDLVDQW
IDFHSHXYHQWDXVVLGHYHQLUWUqVFKDXGHV
Ŷ 1HIDLWHVSDVFKDXIIHUGHFRQWHQDQWVGHQRXUULWXUH
IHUPpV/DSUHVVLRQSRXUUDLWIDLUHH[SORVHUOH
contenant et ainsi causer des blessures.
Ŷ )DLWHVELHQFXLUHODYLDQGHHWODYRODLOOHjF°XU
la viande doit atteindre une température interne
PLQLPDOHGHƒ& ƒ) ODYRODLOOHGHƒ&
ƒ) /DFXLVVRQjFHVWHPSpUDWXUHVHVW
QRUPDOHPHQWVXIILVDQWHSRXUYRXVSURWpJHUGHV
LQWR[LFDWLRQVDOLPHQWDLUHV
AVERTISSEMENT! GARDER LES MATÉRIAUX INFLAMMABLES À
L’ÉCART DE LA TABLE DE CUISSON
Le non-respect de ces instructions pourrait entraîner un incendie ou une blessure.
Ŷ 1HUDQJH]QLQ¶XWLOLVH]GHPDWpULDX[LQIODPPDEOHV
jO¶LQWpULHXURXjSUR[LPLWpGHODWDEOHGHFXLVVRQ\
compris du papier, du plastique, des poignées, des
QDSSHVGHVUHYrWHPHQWVPXUDX[GHVULGHDX[GHV
stores ainsi que de l’essence ou d’autres vapeurs ou
OLTXLGHVLQIODPPDEOHV
Ŷ 1HSRUWH]MDPDLVGHYrWHPHQWVDPSOHVORUVTXH
vous utilisez cette table de cuisson. Ces vêtements
SRXUUDLHQWV¶HQIODPPHUV¶LOVHQWUHQWHQFRQWDFWDYHF
GHVVXUIDFHVFKDXGHVFHTXLSRXUUDLWHQWUDvQHUGHV
brûlures graves.
2
Ŷ 1
HODLVVH]SDVV¶DFFXPXOHUODJUDLVVHGHFXLVVRQRX
DXWUHVPDWLqUHVLQIODPPDEOHVVXUODWDEOHGHFXLVVRQ
RXjSUR[LPLWpGHFHOXLFL&HWWHJUDLVVHSRXUUDLW
V¶HQIODPPHU
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
49-80747
Ŷ '
DQVO¶pYHQWXDOLWpG¶XQLQFHQGLHQ¶XWLOLVH]SDVG¶HDX
SRXUWHQWHUG¶pWHLQGUHXQIHXFDXVpSDUGHODJUDLVVH
1¶HPSRLJQH]MDPDLVXQHSRrOHHQIHXeWHLJQH]OHV
FRPPDQGHV 2II 3RXUpWRXIIHUOHVIODPPHVG¶XQH
SRrOHHQIHXVXUXQpOpPHQWGHVXUIDFHFRXYUH]
celle-ci complètement avec un couvercle bien adapté,
XQHW{OHjELVFXLWVRXXQSODWHDXSODW8WLOLVH]XQ
H[WLQFWHXUjSRXGUHRXjPRXVVHG¶XVDJHVPXOWLSOHV
Ŷ 1HODLVVH]MDPDLVOHVpOpPHQWVGHVXUIDFHVDQV
VXUYHLOODQFHV¶LOVVRQWUpJOpVjPR\HQQHRXKDXWH
température. Les débordements par bouillonnement
HQJHQGUHQWGHODIXPpHHWGHO¶pFRXOHPHQWGHJUDLVVH
TXLSHXWSUHQGUHIHX
Ŷ 1HODLVVH]MDPDLVGHO¶KXLOHVDQVVXUYHLOODQFHHQ
FRXUVGHIULWXUH/¶KXLOHTXLFKDXIIHDXGHOjGHVRQ
SRLQWG¶pEXOOLWLRQSHXWSUHQGUHIHXHWHQIODPPHUOHV
DUPRLUHVHQYLURQQDQWHV8WLOLVH]XQWKHUPRPqWUHj
matière grasse le plus souvent possible pour surveiller
la température de l’huile.
AVERTISSEMENT!
Ŷ 3
RXUpYLWHUXQUHQYHUVHPHQWG¶KXLOHHWO¶LQIODPPDWLRQ
XWLOLVH]XQHTXDQWLWpG¶KXLOHPLQLPDOHORUVG¶XQHIULWXUH
GDQVXQHSRrOHSHXSURIRQGHHWpYLWH]GHFXLUH
des aliments congelés qui contiennent une grande
proportion de glace.
Ŷ 8WLOLVH]XQHSRrOHGHWDLOOHDSSURSULpH²&KRLVLVVH]
GHVXVWHQVLOHVGHFXLVLQHjIRQGSODWVXIILVDPPHQW
JUDQGVSRXUFRXYULUODVXUIDFHGHO¶pOpPHQWFKDXIIDQW
$XWUHPHQWXQHSDUWLHGHO¶pOpPHQWGHVXUIDFH
VHUDGLUHFWHPHQWH[SRVpSRVDQWDLQVLXQULVTXH
G¶LQIODPPDWLRQGHVYrWHPHQWV8QHERQQHDGDSWDWLRQ
GHO¶XVWHQVLOHjO¶pOpPHQWGHVXUIDFHDPpOLRUHDXVVL
O¶HIILFDFLWpGHODFXLVVRQ
Ŷ 3RXUUpGXLUHOHVULVTXHVGHEU€OXUHG¶DOOXPDJHGH
PDWLqUHVLQIODPPDEOHVHWGHGpERUGHPHQWODSRLJQpH
de l’ustensile doit être orientée vers le centre de la
table de cuisson sans se prolonger au-dessus des
pOpPHQWVGHVXUIDFHDGMDFHQWV
CONSIGNES DE SÉCURITÉ CONCERNANT LES ÉLÉMENTS RADIANTS
Ŷ &
HUWDLQVW\SHVGHFRQWHQDQWVHQYHUUH
vitrocéramique, grès ou vernis sont adaptés à cette
WDEOHGHFXLVVRQ/HVDXWUHVPDWpULDX[SHXYHQW
d’endommager à cause du changement brusque de
température.
Ŷ )
DLWHVDWWHQWLRQORUVGXFRQWDFWDYHFODWDEOHGH
FXLVVRQ/DVXUIDFHYLWUpHGHODWDEOHGHFXLVVRQ
FRQVHUYHUDODFKDOHXUDSUqVO¶H[WLQFWLRQGHV
commandes.
Ŷ 1
HFXLVLQH]SDVVXUXQHWDEOHGHFXLVVRQ
HQGRPPDJpH$GYHQDQWOHEULVGHODWDEOHGH
cuisson en vitrocéramique, les solutions de
QHWWR\DJHHWOHVGpERUGHPHQWVSRXUUDLHQWSpQpWUHU
dans la table de cuisson et générer un risque de
décharge électrique. Contactez sur le champ un
WHFKQLFLHQTXDOLILp
Ŷ e
YLWH]GHUD\HUODYLWUHGHODWDEOHGHFXLVVRQ/D
WDEOHGHFXLVVRQHVWVXVFHSWLEOHG¶rWUHpUDIOpHSDU
OHVFRXWHDX[OHVLQVWUXPHQWVSRLQWXVOHVDQQHDX[
RXDXWUHVELMRX[HWOHVULYHWVSUpVHQWVVXUOHV
vêtements.
Ŷ 1
HPHWWH]HWQHUDQJH]SDVG¶REMHWVTXLSRXUUDLHQW
IRQGUHRXSUHQGUHHQIHXVXUODWDEOHGHFXLVVRQ
en vitrocéramique, et ce, même lorsque vous ne
O¶XWLOLVH]SDV,OVSRXUUDLHQWSUHQGUHIHXVLODWDEOH
de cuisson est activée accidentellement. De plus, la
chaleur provenant de la table de cuisson ou de la
YHQWLODWLRQGXIRXUSRXUUDLWDYRLUOHPrPHHIIHW
Ŷ 3RXUQHWWR\HUODWDEOHGHFXLVVRQXWLOLVH]OH
QHWWR\DQWSRXUWDEOHjFXLVVRQHQYLWURFpUDPLTXH
&(5$0$%5<7(®HWOHWDPSRQGHQHWWR\DJH
&(5$0$%5<7(®$YDQWGHSURFpGHUDXQHWWR\DJH
DWWHQGH]TXHODWDEOHGHFXLVVRQVRLWUHIURLGLHHWTXH
OHWpPRLQOXPLQHX[VHVRLWpWHLQW8QHpSRQJHRX
XQFKLIIRQKXPLGHVXUXQHVXUIDFHFKDXGHULVTXH
de causer des blessures dues à la vapeur. Certains
QHWWR\DQWVSHXYHQWSURGXLUHGHVIXPpHVWR[LTXHV
GDQVOHFDVG¶XQHDSSOLFDWLRQVXUXQHVXUIDFH
chaude. Lisez et respectez toutes les instructions
et avertissements sur les étiquettes des crèmes de
QHWWR\DJH5(0$548(/HVGpJkWVGHPDWLqUHV
VXFUpHVFRQVWLWXHQWXQHH[FHSWLRQ,OIDXWOHVJUDWWHU
alors qu’ils sont encore chauds à l’aide de gants
GHFXLVLQHHWG¶XQJUDWWRLU3RXUREWHQLUGHSOXV
amples renseignements, consultez la section sur le
QHWWR\DJHGHODWDEOHGHFXLVVRQHQYLWURFpUDPLTXH
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
49-80747
CONSIGNES DE SÉCURITÉ
AVERTISSEMENT! &216,*1(6'(6e&85,7e³7$%/('(&8,6621
3
GARANTIE
Merci ... d’avoir acheté un appareil GE !
Enregistrez votre appareil : (QUHJLVWUH]YRWUHQRXYHODSSDUHLOHQOLJQHjWRXWPRPHQW
www.geappliances.com/service_and_support/register/
6LYRXVHQUHJLVWUH]YRWUHSURGXLWVDQVGpODLODFRPPXQLFDWLRQVHUDPHLOOHXUHHWOHVHUYLFHSOXVUDSLGHHQYHUWXGHVFRQGLWLRQVGHYRWUH
JDUDQWLHVLVRQXWLOLVDWLRQV¶DYqUHQpFHVVDLUH9RXVSRXYH]pJDOHPHQWHQYR\HUSDUODSRVWHODFDUWHG¶HQUHJLVWUHPHQWSUpLPSULPpH
LQFOXVHGDQVOHVPDWpULDX[G¶HPEDOODJH
Garantie couvrant la table de cuisson électrique GE
GEAppliances.com
7RXWHQWUHWLHQRXUpSDUDWLRQHQYHUWXGHODJDUDQWLHHVWIRXUQLSDUQRV&HQWUHVG¶HQWUHWLHQHWGHUpSDUDWLRQGHO¶XVLQH
ou par un technicien autorisé de Customer Care®3RXUIL[HUXQUHQGH]YRXVHQOLJQHFRQVXOWH]QRWUHVLWH
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWRXWpOpSKRQH]DX*(&$5(6 9HXLOOH]DYRLUYRV
numéros de série et de modèle à portée de main lors de l’appel.
/¶HQWUHWLHQGHYRWUHDSSDUHLOSRXUUDLWQpFHVVLWHUO¶XWLOLVDWLRQG¶XQDFFqVDX[GRQQpHVHPEDUTXpHVSRXUOHGLDJQRVWLF
&HODSHUPHWDXWHFKQLFLHQGHO¶DWHOLHUGHUpSDUDWLRQ*(GHGLDJQRVWLTXHUUDSLGHPHQWWRXWHGpIDLOODQFHGHYRWUH
pOHFWURPpQDJHUHWj*(G¶DPpOLRUHUODTXDOLWpGHVHVSURGXLWV6LYRXVQHVRXKDLWH]SDVWUDQVPHWWUHOHVGRQQpHVGH
YRWUHDSSDUHLOj*(YHXLOOH]DYLVHUYRWUHWHFKQLFLHQGHV¶HQDEVWHQLUDXPRPHQWGHODYLVLWHGHVHUYLFH
'XUDQWXQHSpULRGHGHXQ DQjSDUWLUGHODGDWHG¶DFKDWLQLWLDO*(UHPSODFHUDWRXWHSLqFHGpIHFWXHXVHHQUDLVRQ
G¶XQYLFHGHPDWLqUHRXGHIDEULFDWLRQ'XUDQWFHWWHJDUDQWLHOLPLWpHGHXQ DQ*(DVVXPHUDDXVVLWRXVOHVIUDLVGH
PDLQG¶°XYUHHWGHVHUYLFHjGRPLFLOHYLVDQWjUHPSODFHUODSLqFHGpIHFWXHXVH
$JUDIH]LFLYRWUHUHoX8QHSUHXYHGHO¶DFKDWRULJLQDOHVWUHTXLVH
SRXUO¶DFFqVjOµHQWUHWLHQHWDX[UpSDUDWLRQVHQYHUWXGHODJDUDQWLH
Ce que GE ne couvre pas :
Ŷ /
¶HQYRLG¶XQWHFKQLFLHQFKH]YRXVSRXUYRXVPRQWUHU
comment utiliser le produit.
Ŷ 8QHLQVWDOODWLRQXQHOLYUDLVRQRXXQHQWUHWLHQ
inadéquats.
Ŷ 8QHSDQQHGXSURGXLWVXLWHjXQHXWLOLVDWLRQDEXVLYHRX
LQDGpTXDWHXQHPRGLILFDWLRQXQXVDJHDXWUHTXHFHOXL
auquel il a été destiné ou un usage commercial.
Ŷ /HUHPSODFHPHQWGHVIXVLEOHVGHYRWUHUpVLGHQFHRXOH
UpHQFOHQFKHPHQWGHVGLVMRQFWHXUV
Ŷ /
HVGRPPDJHVDXSURGXLWFDXVpVSDUXQDFFLGHQWXQ
incendie, une inondation ou une catastrophe naturelle.
Ŷ /
HVGRPPDJHVLQGLUHFWVRXDFFLGHQWHOVFDXVpVSDUGHV
GpIDLOODQFHVSRVVLEOHVGHFHWDSSDUHLO
Ŷ /
HVGRPPDJHVVXUYHQXVDSUqVODOLYUDLVRQ
Ŷ /
HVHUYLFHV¶LOHVWLPSRVVLEOHG¶DYRLUDFFqVDXSURGXLW
Ŷ /
HVHUYLFHSRXUUpSDUHURXUHPSODFHUOHVDPSRXOHVj
O¶H[FHSWLRQGHVODPSHV'(/
EXCLUSION DES GARANTIES IMPLICITES
Votre seul et unique recours est la réparation du produit selon les dispositions de la présente garantie limitée. Toutes
JDUDQWLHVLPSOLFLWHV\FRPSULVOHVJDUDQWLHVLPSOLFLWHVGHTXDOLWpPDUFKDQGHHWG¶DGpTXDWLRQjXQXVDJHVSpFLILTXH
sont limitées à un an ou à la plus courte période permise par la loi.
&HWWHJDUDQWLHHVWRIIHUWHjO¶DFKHWHXULQLWLDOHWjWRXWSURSULpWDLUHVXEVpTXHQWG¶XQSURGXLWDFKHWpDX[eWDWV8QLVjGHV
ILQVG¶XVDJHGRPHVWLTXH6LOHSURGXLWHVWVLWXpGDQVXQHORFDOLWpRXQUpSDUDWHXUDXWRULVp*(Q¶HVWSDVGLVSRQLEOH
YRXVSRXUULH]HQFRXULUGHVIUDLVGHGpSODFHPHQWRXGHYRLUDFKHPLQHUOHSURGXLWjXQUpSDUDWHXUDXWRULVp*(SRXU
IDLUHUpSDUHUO¶DSSDUHLO(Q$ODVNDFHWWHJDUDQWLHH[FOXWOHVIUDLVG¶H[SpGLWLRQHWOHVYLVLWHVGHVHUYLFHjYRWUHGRPLFLOH
&HUWDLQVeWDWVRXSURYLQFHVQHSHUPHWWHQWSDVO¶H[FOXVLRQRXODUHVWULFWLRQGHVGRPPDJHVDFFHVVRLUHVRXLQGLUHFWV
Certains droits particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres
GURLWVTXLYDULHQWVHORQYRWUHOLHXGHUpVLGHQFH3RXUFRQQDvWUHODQDWXUHH[DFWHGHYRVGURLWVFRQVXOWH]O¶RUJDQLVPH
GHSURWHFWLRQGXFRQVRPPDWHXUGHYRWUHUpJLRQRXHQFRUHOHEXUHDXGXSURFXUHXUJpQpUDOGHO¶eWDW
Garant : General Electric Company. Louisville, KY 40225
Prolongation de garantie :$FKHWH]XQFRQWUDWG¶HQWUHWLHQ*(HWLQIRUPH]YRXVGHVUDEDLVVSpFLDX[HQYLJXHXU
pendant toute la durée de votre garantie. Vous pouvez vous le procurer en tout temps sur
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP
RXHQFRPSRVDQWOHGXUDQWOHVKHXUHVQRUPDOHVGHEXUHDX/HVVHUYLFHVjGRPLFLOH*(VHURQWWRXMRXUV
GLVSRQLEOHVDSUqVO¶H[SLUDWLRQGHODJDUDQWLH
4
49-80747
&RQVXOWH]OHVLWHLQWHUQHWGHVDSSDUHLOV*( www.geappliances.com/service_and_support/ KHXUHVVXU
MRXUVVXU3RXUXQHSOXVJUDQGHFRPPRGLWpHWSRXUXQVHUYLFHSOXVUDSLGHYRXVSRXYH]PDLQWHQDQWWpOpFKDUJHUOHV
PDQXHOVG¶XWLOLVDWLRQFRPPDQGHUFHUWDLQHVSLqFHVHWPrPHIL[HUXQUHQGH]YRXVSRXUO¶HQWUHWLHQHQOLJQH
Rendez-vous pour l’entretien : Le service de réparation
SDUXQH[SHUWGH*(QHVHWURXYHTX¶jXQSDVGHYRWUH
SRUWH&RQQHFWH]YRXVj,QWHUQHWHWIL[H]YRWUHUHQGH]
vous sur www.geappliances.com/service_and_support/
RXDSSHOH]OH*(&$5(6 SHQGDQW
les heures de bureau.
Pièces et accessoires : /HVSHUVRQQHVTXDOLILpHVSRXU
entretenir leur propre appareil peuvent recevoir des pièces
RXGHVDFFHVVRLUHVGLUHFWHPHQWFKH]HX[ OHVFDUWHV9LVD
0DVWHU&DUGHW'LVFRYHUVRQWDFFHSWpHV &RPPDQGH]
HQOLJQHGqVDXMRXUG¶KXLKHXUHVVXURXDSSHOH]DX
SHQGDQWOHVKHXUHVGHEXUHDX
Les instructions qui se trouvent dans le présent manuel
FRXYUHQWOHVSURFpGXUHVGHYDQWrWUHHIIHFWXpHVSDU
n’importe quel utilisateur. L’entretien et les réparations qui
QHVHWURXYHQWSDVLFLGRLYHQWJpQpUDOHPHQWrWUHFRQILpV
jGXSHUVRQQHOTXDOLILp,OHVWQpFHVVDLUHGHIDLUHSUHXYH
de prudence, un entretien inapproprié pourrait entraîner
une utilisation non-sécuritaire de l’appareil.
Contactez-nous : 6LYRXVQ¶rWHVSDVVDWLVIDLWGXVHUYLFH
TXHYRXVUHFHYH]GH*(FRQWDFWH]QRXVDXPR\HQGH
QRWUHVLWHLQWHUQHWHQQRXVIRXUQLVVDQWWRXVOHVGpWDLOV
QpFHVVDLUHV\FRPSULVYRWUHQXPpURGHWpOpSKRQHRX
pFULYH]j
General Manager, Customer Relations
GE Appliances, Appliance Park Louisville, KY 40225
Pièces et accessoires
3RXUSDVVHUFRPPDQGHFRQVXOWH]QRWUHVLWHLQWHUQHWjO¶DGUHVVHVXLYDQWH
www.GEApplianceParts.com 86 RXwww.GEAppliances.ca &DQDGD ou composez le 800.626.2002 86 800.661.1616 &DQDGD
/HVSLqFHVVXLYDQWHVVRQWGLVSRQLEOHV
Pièces
3ODTXHFKDXIIDQWH
-;*5,'/
1HWWR\DQWHWSROLVVHXUSRXUDFLHULQR[\GDEOH
30;
ASSISTANCE / PIÈCES ET ACCESSOIRES
Vous avez une question ou vous avez besoin d’assistance avec votre appareil ?
Comment retirer le film protecteur d’expédition et le ruban adhésif d’emballage
6DLVLVVH]GpOLFDWHPHQWXQFRLQGXILOPSURWHFWHXU
G¶H[SpGLWLRQDYHFYRVGRLJWVHWOHGpFROOHUOHQWHPHQWGHOD
VXUIDFHGHO¶DSSDUHLO1¶XWLOLVH]SDVG¶REMHWVSRLQWXVSRXU
UHWLUHUOHILOP5HWLUH]FRPSOqWHPHQWOHILOPDYDQWG¶XWLOLVHU
O¶DSSDUHLOSRXUODSUHPLqUHIRLV
49-80747
3RXUDVVXUHUQHSDVHQGRPPDJHUODILQLWLRQGXSURGXLW
ODIDoRQODSOXVV€UHSRXUHQOHYHUOHUXEDQDGKpVLI
GHO¶HPEDOODJHVXUOHVQRXYHDX[DSSDUHLOVFRQVLVWHj
appliquer un détergent à vaisselle liquide à l’aide d’un
FKLIIRQGRX[HWjODLVVHUWUHPSHU
REMARQUE : /HUXEDQDGKpVLIGRLWrWUHUHWLUpGHWRXWHV
les pièces. Il ne pourra pas être retiré après cuisson.
5
UTILISATION DE LA TABLE DE CUISSON: Fonctions de la table de cuisson
6
Fonctions de la table de cuisson
Dans le présent manuel, les caractéristiques et leur apparence peuvent être différentes de celles de votre modèle.
1
2
5
Table de cuisson de 30 po
3
4
6
7
Commandes de l’interface utilisateur
1
2
5
Table de cuisson de 36 po
3
4
6
7
Commandes de l’interface utilisateur
1. Cooking Element(s) (élément(s) de cuisson) :9RLUOD)LJXUH
2. Power Level Arc (arc du niveau de puissance) :9RLUOD)LJXUH
3. Sync Burners (synchronisation des brûleurs) :9RLUOD)LJXUH
4. All Off (tous éteints) :9RLUOD)LJXUH
5. Lock (verrouillage) :9RLUOD)LJXUH
6. Timer Select (sélection de la minuterie) :9RLUOD)LJXUH
7. Display (affichage) :9RLUOD)LJXUH
49-80747
/DVXUIDFHGHFXLVVRQUDGLDQWHHVWGRWpHG¶pOpPHQWVFKDXIIDQWV
VLWXpVVRXVODVXUIDFHGHFXLVVRQHQYHUUH
REMARQUE : Il est normal de sentir une légère odeur lorsque
ODVXUIDFHGHFXLVVRQQHXYHHVWXWLOLVpHSRXUODSUHPLqUH
IRLV&HWWHRGHXUHVWDWWULEXDEOHDX[QRXYHOOHVSLqFHVHWDX[
PDWpULDX[LVRODQWVTXLFKDXIIHQWHWGLVSDUDvWUDUDSLGHPHQW
REMARQUE :/HVpOpPHQWVGHVXUIDFHGHODWDEOHGHFXLVVRQ
réagissent rapidement. Les éléments de la table de cuisson
FKDXIIHURQWRXVHUHIURLGLURQWOHSOXVUDSLGHPHQWSRVVLEOHVHORQ
le niveau de réglage de puissance choisi.
La température de la table de cuisson augmente selon le
nombre d’éléments en marche. La température sera élevée
VLRXpOpPHQWVVRQWHQPDUFKH6R\H]SUXGHQWWRXMRXUV
lorsque vous êtes en contact avec la table de cuisson.
Ne faites jamais cuire d’aliments
directement sur la surface en verre. Utilisez
toujours un ustensile de cuisson.
Placez toujours l’ustensile de cuisson
au centre de l’élément sur lequel vous
effectuez la cuisson.
Ne faites jamais glisser d’ustensiles sur
la surface de cuisson car vous risquez
d’égratigner le verre. Bien qu’elle soit
résistante, la surface en verre n’est pas à
l’épreuve des égratignures.
Conseils pour la mise en conserve
3ODFH]OHFXLVHXUVRXVSUHVVLRQDXFHQWUHGHO¶pOpPHQWGH
VXUIDFH
$VVXUH]YRXVTXHVRQIRQGHVWSODW
3RXUpYLWHUOHVEU€OXUHVFDXVpHVSDUODYDSHXURXODFKDOHXU
VR\H]SUXGHQWORUVTXHYRXVIDLWHVGHVFRQVHUYHV
49-80747
6XLYH]GHVUHFHWWHVHWGHVSURFpGXUHVGHVRXUFHVILDEOHV
9RXVSRXYH]YRXVOHVSURFXUHUDXSUqVGHIDEULFDQWVFRPPH
%DOO® et Kerr®DLQVLTXHGXPLQLVWqUHGHO¶$JULFXOWXUH
/HVFXLVHXUVjSUHVVLRQjIRQGSODWVRQWUHFRPPDQGpV
/HVEDLQVPDULHjIRQGRQGXOpSHXYHQWDOORQJHUOHWHPSV
nécessaire pour que l’eau atteigne le point d’ébullition.
UTILISATION DE LA TABLE DE CUISSON: Table de cuisson en verre à éléments radiants / Conseils pour la mise en conserve
Table de cuisson en verre à éléments radiants
7
UTILISATION DE LA TABLE DE CUISSON: Batterie de cuisine pour table de cuisson en verre radiant / Pour des résultats optimums
8
Batterie de cuisine pour table de cuisson en verre radiant
/HVUHQVHLJQHPHQWVTXLVXLYHQWYRXVDLGHURQWjFKRLVLUXQXVWHQVLOHGHFXLVVRQRIIUDQWXQERQ
UHQGHPHQWVXUXQHVXUIDFHGHFXLVVRQHQYHUUH
Acier inoxydable :
Émail vitrifié sur acier :
recommandé
non recommandé
6LO¶XVWHQVLOHYLGHVXUFKDXIIHLOSRXUUDLWFDXVHU
GHVGRPPDJHVSHUPDQHQWVjODVXUIDFH
GHFXLVVRQHQYHUUH/¶pPDLOYLWULILpSHXW
IRQGUHHWDGKpUHUjODVXUIDFHGHFXLVVRQHQ
vitrocéramique.
Aluminum :
épais – recommandé
%RQQHFRQGXFWLYLWp6XUODVXUIDFHGHFXLVVRQ
O¶DOXPLQLXPODLVVHSDUIRLVGHVUpVLGXVTXL
ressemblent à des égratignures. Ces résidus
SHXYHQWGLVSDUDvWUHVLODVXUIDFHHVWQHWWR\pH
LPPpGLDWHPHQW(QUDLVRQGHVRQSRLQWGHIXVLRQ
peu élevé, il n’est pas recommandé d’utiliser
l’aluminium mince.
Fond en cuivre :
recommandé
Le cuivre laisse des résidus qui ressemblent
jGHVpJUDWLJQXUHV9RXVSRXYH]OHVIDLUH
GLVSDUDvWUHHQQHWWR\DQWLPPpGLDWHPHQWODVXUIDFH
GHFXLVVRQ&HSHQGDQWpYLWH]GHIDLUHFKDXIIHU
FHVXVWHQVLOHVjYLGH/HPpWDOVXUFKDXIIpSHXW
DGKpUHUjODVXUIDFHGHYHUUH8QXVWHQVLOHGRQW
OHIRQGHQFXLYUHDpWpVXUFKDXIIpODLVVHXQUpVLGX
TXLWDFKHUDGHIDoRQSHUPDQHQWHODVXUIDFHGH
FXLVVRQVLYRXVQHIDLWHVSDVGLVSDUDvWUHOHUpVLGX
immédiatement.
Vérifiez à l’aide d’une
règle si le fond de votre
ustensile est plat.
Vitrocéramique :
non recommandée
5HQGHPHQWPpGLRFUHeJUDWLJQHUDODVXUIDFHGH
cuisson.
Grès :
non recommandé
5HQGHPHQWPpGLRFUH3HXWpJUDWLJQHUODVXUIDFH
Fonte :
QRQUHFRPPDQGpH²jPRLQVTXHO¶XVWHQVLOHVRLW
VSpFLDOHPHQWFRQoXSRXUOHVVXUIDFHVGHFXLVVRQ
en verre
)DLEOHFRQGXFWLYLWpHWDEVRUSWLRQOHQWHGHOD
FKDOHXUeJUDWLJQHUDODVXUIDFHGHFXLVVRQ
Émail vitrifié sur fonte :
UHFRPPDQGpVLOHIRQGGHO¶XVWHQVLOHHVWpPDLOOp
Il n’est pas recommandé
d’utiliser un ustensile dont
le fond est bombé, incurvé,
ondulé ou déformé.
REMARQUE :2EVHUYH]WRXWHVOHVUHFRPPDQGDWLRQVGXIDEULFDQWGHO¶XVWHQVLOHGHFXLVVRQORUVTXHYRXVXWLOLVH]XQW\SH
TXHOFRQTXHG¶XVWHQVLOHVVXUODVXUIDFHGHFXLVVRQHQYLWURFpUDPLTXH
Pour des résultats optimums
Ŷ 1HSODFH]TXHGHVXVWHQVLOHVGHFXLVVRQELHQVHFVVXUOHV
pOpPHQWVFKDXIIDQWV1HGpSRVH]SDVGHFRXYHUFOHVVXU
OHVpOpPHQWVFKDXIIDQWVSDUWLFXOLqUHPHQWORUVTX¶OVVRQW
mouillés.
Ŷ 1¶XWLOLVH]SDVGHZRNVVRXWHQXVDXPR\HQG¶XQDQQHDX
&HVZRNVQHFKDXIIHQWSDVVXUOHVpOpPHQWVGHODVXUIDFH
de cuisson en verre.
Ŷ 1RXVYRXVUHFRPPDQGRQVG¶XWLOLVHUVHXOHPHQWXQZRN
jIRQGSODW9RXVWURXYHUH]FHW\SHGHZRNFKH]YRWUH
GpWDLOODQWORFDO/HIRQGGXZRNGRLWDYRLUOHPrPHGLDPqWUH
TXHO¶pOpPHQWGHVXUIDFHSRXUSHUPHWWUHXQERQFRQWDFW
Ŷ &HUWDLQHVWHFKQLTXHVGHFXLVVRQH[LJHQWXQXVWHQVLOH
VSpFLDOSDUH[HPSOHXQDXWRFXLVHXUXQHIULWHXVHHWF
7RXVFHVXVWHQVLOHVGRLYHQWDYRLUXQIRQGSODWHWrWUHGH
dimensions appropriées.
Ne placez pas d’ustensiles de cuisson mouillés
sur la surface de cuisson en verre.
N’utilisez pas sur la surface de cuisson en
verre un wok soutenu par un anneau.
Utilisez un wok à fond plat sur la surface de
cuisson en verre.
49-80747
/HVpOpPHQWVGHVXUIDFHFKDXIIHURQWHWV¶pWHLQGURQWDILQGH
maintenir la température choisie. Tous les éléments radiants de
VXUIDFHVRQWpTXLSpVG¶XQOLPLWHXUGHWHPSpUDWXUHDILQG¶pYLWHUXQH
WHPSpUDWXUHWURSpOHYpHGHODWDEOHGHFXLVVRQ&HF\FOHHVWQRUPDO
/HOLPLWHXUGHWHPSpUDWXUHpWHLQWOHVpOpPHQWVSOXVVRXYHQWORUVTXH
Ŷ
Ŷ
Ŷ
Ŷ
/DFDVVHUROHVHYLGH
/HIRQGGHODFDVVHUROHQ¶HVWSDVSODW
/DFDVVHUROHQ¶HVWSDVFHQWUpH
6¶LOQ¶\DSDVGHFDVVHUROHVXUO¶pOpPHQW
Fonctionnement des éléments de cuisson
0LVHHQPDUFKHG¶XQRXGHSOXVLHXUVEU€OHXUV$SSX\H]VXU
la touche On/Off (marche/arrêt)HWPDLQWHQH]ODHQIRQFpH
SHQGDQWHQYLURQXQHGHPLHVHFRQGH&KDTXHIRLVTXHYRXV
DSSX\H]VXUXQHWRXFKHYRXVHQWHQGUH]XQVRQ
Vous pouvez sélectionner le niveau de puissance de n’importe
ODTXHOOHGHVPDQLqUHVVXLYDQWHV
Lumières
DEL
1. Réalisez un glissement sur l’arc gris VXUO¶LPDJH MXVTX¶DXQLYHDXGHSXLVVDQFHVRXKDLWpIl n’y a aucun
capteur sur les DEL, ou;
$SSX\H]VXUn’importe quel endroit de l’arc gris, ou;
Zone de glissement - arc gris
Zone de
glissement arc gris
3RXUUpJOHUOHQLYHDXGHSXLVVDQFHDSSX\H]VXU+ ou -, ou;
5DFFRXUFLSRXUOHUpJODJH+L FKDOHXUpOHYpH Immédiatement après avoir mis l’appareil en marche,
DSSX\H]VXUODWRXFKH+, ou;
5DFFRXUFLSRXUOHUpJODJH/RZ FKDOHXUEDVVH Immédiatement après avoir mis l’appareil en marche,
DSSX\H]VXU-.
Réglage du brûleur
Certains éléments sont équipés d’arc de brûleur réglable.
$SSX\H]VXUO¶LPDJHGHO¶DUFGXEU€OHXUSRXUFKRLVLUVD
dimension.
49-80747
Élément de
surface simple
Élément de
surface double
Élément de
surface triple
UTILISATION DE LA TABLE DE CUISSON: Cycle de l’élément / Fonctionnement des éléments de cuisson / Réglage du brûleur
Cycle de l’élément
9
UTILISATION DE LA TABLE DE CUISSON: Extinction d’un ou de plusieurs brûleurs / Sélection des réglages de la table de cuisson / Comment synchroniser les éléments de gauche
10
Extinction d’un ou de plusieurs brûleurs
$SSX\H]VXUODWRXFKHOn/Off pour éteindre un seul brûleur ou
sur la touche All Off pour les éteindre tous.
Sélection des réglages de la table de cuisson
Choisissez l’élément/brûleur qui est le plus adéquat pour la
taille de l’ustensile de cuisine. Chaque élément/brûleur de
votre nouvelle table de cuisson possède son propre niveau de
puissance variant d’une chaleur basse à élevée. Les réglages
du niveau de puissance pour la cuisson varieront selon
O¶XVWHQVLOHGHFXLVLQHXWLOLVpOHW\SHHWODTXDQWLWpGHVDOLPHQWV
HWOHUpVXOWDWVRXKDLWp'HIDoRQJpQpUDOHXWLOLVH]OHVUpJODJHV
LQIpULHXUVSRXUIDLUHIRQGUHPDLQWHQLUODWHPSpUDWXUHRXIDLUH
PLMRWHUHWXWLOLVHUOHVUpJODJHVVXSpULHXUVSRXUIDLUHFKDXIIHU
UDSLGHPHQWJULOOHUHWIULUH/RUVTXHYRXVVRXKDLWH]PDLQWHQLU
des aliments chauds, assurez-vous que le réglage choisi est
VXIILVDQWSRXUPDLQWHQLUODWHPSpUDWXUHGHVDOLPHQWVDXGHOj
GHƒ)/HVpOpPHQWVSOXVJUDQGVHWFHX[SRXUOHVTXHOV
LOHVWLQGLTXp©.HHS:DUPª JDUGHUFKDXG QHVRQWSDV
UHFRPPDQGpVSRXUIDLUHIRQGUHGHVDOLPHQWV
©+LªFRUUHVSRQGDXQLYHDXGHSXLVVDQFHOHSOXVpOHYpLOHVW
FRQoXSRXUODFXLVVRQUDSLGHGHJUDQGHVTXDQWLWpVHWSRXU
DPHQHUjpEXOOLWLRQ/HUpJODJH©+LªIRQFWLRQSHQGDQWDX
PD[LPXPPLQXWHV,OHVWSRVVLEOHGHUpSpWHUOHUpJODJH©+Lª
DSUqVOHF\FOHGHPLQXWHVLQLWLDOHQDSSX\DQWVXUODWRXFKH+.
MISE EN GARDE :
Hi (haut)
1HSODFH]QLXVWHQVLOHGHFXLVLQHQL
casserole sur les touches de commande
HWQ¶\ODLVVH]DXFXQHDFFXPXODWLRQ
G¶HDX6LXQHGHFHVVLWXDWLRQVGXUH
SOXVLHXUVVHFRQGHVLO\DULVTXHGH
rendre les touches inopérantes et
d’éteindre la table de cuisson.
ébullition rapide
frire
griller
réduire
frémir
maintenir
Low (bas)
fondre
Comment synchroniser les éléments de gauche
Pour activer
Pour désactiver
0DLQWHQH]ODWRXFKHSync BurnersHQIRQFpHSHQGDQWHQYLURQ
XQHGHPLVHFRQGHSRXUEUDQFKHUOHVGHX[EU€OHXUV3RXUUpJOHU
le niveau de puissance, utilisez l’un ou l’autre des éléments
comme décrit à la page 7.
3RXUGpVDFWLYHUODV\QFKURQLVDWLRQGHVEU€OHXUVDSSX\H]
sur la touche On/Off sur l’un ou l’autre des brûleurs.
ou
3RXUGpVDFWLYHUOHVGHX[EU€OHXUVDSSX\H]VXUODWRXFKH
Sync Burners.
49-80747
Verrouillage
$SSX\H]VXUODWRXFKHGHverrouillageSHQGDQWVHFRQGHV
Symbole/témoin
de verrouillage
des commandes
Déverrouillage
$SSX\H]GHQRXYHDXVXUODWRXFKHGHverrouillageSHQGDQW
secondes.
Verrouillage de la table de cuisson verrouillage des commandes
3RXUDFWLYHUODIRQFWLRQGHYHUURXLOODJHDXWRPDWLTXHFRQVXOWH]
ODVHFWLRQ5pJODJHVSHUVRQQDOLVpV
Minuterie de cuisine simple
Pour activer
Pour désactiver
$SSX\H]VXUODWRXFKHTimer Select3RXUFKRLVLUOHQRPEUHGH
PLQXWHVVRXKDLWpDSSX\H]VXUOHVIOqFKHV೸ ou V. La minuterie
GpPDUUHDXWRPDWLTXHPHQWVHFRQGHVDSUqVDYRLUDSSX\pVXU
ODWRXFKH/D'(/©21ª DFWLYp V¶DIILFKHUDDXWRPDWLTXHPHQW
ORUVTXHODPLQXWHULHHVWFRQILJXUpH
3RXUDQQXOHUODPLQXWHULHPDLQWHQH]ODWRXFKHTimer Select
HQIRQFpHSHQGDQWVHFRQGHV/¶DODUPHVHIHUDHQWHQGUHGH
IDoRQFRQWLQXHORUVTXHOHWHPSVVHVHUDpFRXOpHWFHMXVTX¶j
ce que la minuterie soit désactivée.
49-80747
REMARQUE : 8WLOLVH]ODPLQXWHULHGHFXLVLQHSRXUPHVXUHUOH
temps de cuisson ou comme rappel. La minuterie de cuisine ne
contrôle pas les éléments de cuisson. La minuterie se désactive
V¶LOQ¶\DDXFXQHDFWLYLWpSHQGDQWSOXVGHVHFRQGHV
UTILISATION DE LA TABLE DE CUISSON: Verrouillage de la table de cuisson / Minuterie de cuisine simple
Verrouillage de la table de cuisson
11
UTILISATION DE LA TABLE DE CUISSON: Minuteries multiples / Témoin lumineux de surface chaude
12
Minuteries multiples
Mode de minuterie
3RXUHQVDYRLUSOXVFRQVXOWH]OHVIRQFWLRQV5pJODJHV
SHUVRQQDOLVpV0RGHGHPLQXWHULHHW0LQXWHULHVPXOWLSOHV,OHVW
SRVVLEOHGHOLHUFKDTXHEU€OHXUjXQHPLQXWHULH3RXUSRXYRLU
GpILQLUODPLQXWHULHOHEU€OHXUGRLWrWUHHQPDUFKH/RUVTXHSOXV
d’un brûleur est en marche, l’ordre de la minuterie s’établit de
gauche à droite.
3RXUFRQILJXUHUODPLQXWHULHSRXUOHEU€OHXUVXLYDQW
DSSX\H]VXUODWRXFKHTimer Select. Le niveau de
SXLVVDQFHGXEU€OHXUFRUUHVSRQGDQWHWO¶DIILFKDJHFOLJQRWHQW
$SSX\H]VXUOHVIOqFKHV೸ ou VSRXUDMXVWHUOHWHPSV/D
PLQXWHULHGpPDUUHDXWRPDWLTXHPHQWDSUqVVHFRQGHVVL
YRXVQHUpDOLVH]DXFXQHDFWLRQVXSSOpPHQWDLUH/D'(/
©21ª DFWLYp V¶DOOXPHORUVTXHODPLQXWHULHHVWDFWLYpH
3RXUOHVPLQXWHULHVUHVWDQWHVUpSpWH]FHVpWDSHV
Pour activer des minuteries multiples
$SSX\H]VXUODWRXFKHTimer Select. Le niveau de
SXLVVDQFHGXEU€OHXUFRUUHVSRQGDQWHWO¶DIILFKDJHFOLJQRWHQW
$SSX\H]VXUOHVIOqFKHV೸ ou VSRXUDMXVWHUOHWHPSV/D
PLQXWHULHGpPDUUHDXWRPDWLTXHPHQWDSUqVVHFRQGHVVL
YRXVQHUpDOLVH]DXFXQHDFWLRQVXSSOpPHQWDLUH/D'(/
©21ª DFWLYp V¶DOOXPHORUVTXHODPLQXWHULHHVWDFWLYpH
Pour désactiver des minuteries multiples
3RXUDQQXOHUODPLQXWHULHPDLQWHQH]ODWRXFKHTimer Select
HQIRQFpHSHQGDQWVHFRQGHV/HQLYHDXGHSXLVVDQFHGX
EU€OHXUFRUUHVSRQGDQWHWO¶DIILFKDJHFOLJQRWHQW/RUVTXHOD
GXUpHGHIRQFWLRQQHPHQWGXEU€OHXUHVWpFRXOpHFHOOHGHOD
minuterie l’est également.
Niveau de puissance du brûleur
Affichage
Témoin lumineux de surface chaude
8QWpPRLQOXPLQHX[GHVXUIDFHFKDXGH XQSRXUFKDFXQ
GHVpOpPHQWVGHFXLVVRQ V¶DOOXPHORUVTXHODVXUIDFHHQ
YLWUHHVWFKDXGHHWHOOHGHPHXUHFKDXGHMXVTX¶jFHTXH
ODVXUIDFHVHVRLWUHIURLGLHjXQSRLQWRLOHVWVpFXULWDLUH
G¶\WRXFKHU
Témoin lumineux de surface chaude
49-80747
$
SSX\H]VXUODWRXFKHAll OffHWPDLQWHQH]ODHQIRQFpH
SHQGDQWVHFRQGHVSXLVDSSX\H]LPPpGLDWHPHQWVXUOD
touche Timer SelectHWPDLQWHQH]ODHQIRQFpHSHQGDQW
secondes pour entrer les réglages personnalisés. On doit
DSSX\HUVXUFHVWRXFKHVGDQVXQLQWHUYDOOHGHVHFRQGHV
6LO¶RQDSSXLHVXUWRXWHDXWUHWRXFKHOHPRGHVHUDDQQXOp
³&´V¶DIILFKH8WLOLVH]OHVWRXFKHV೸ KDXW RXV EDV SRXU
QDYLJXHUGDQVOHVUpJODJHVSHUVRQQDOLVpV6L೸ KDXW HVW
VpOHFWLRQQpOHF\FOHG¶DIILFKDJHFRPPHQFHj©&ª6LV
EDV HVWVpOHFWLRQQpOHF\FOHG¶DIILFKDJHFRPPHQFHj©&ª
3
RXUDFWLYHUXQQRXYHDXUpJODJHSHUVRQQDOLVpO¶XWLOLVDWHXUGRLW
DSSX\HUVXUODWRXFKHTimer SelectHWODPDLQWHQLUHQIRQFpH
SHQGDQWVHF6HXO81GHVFKRL[GHUpJODJHSHUVRQQDOLVp
peut être activé pour chacun des réglages personnalisés.
/D'(/©2QªV¶DOOXPHHWXQVRQVHIHUDHQWHQGUHXQHIRLV
qu’un nouveau réglage personnalisé aura été activé.
/DVXUIDFHGHFXLVVRQTXLWWHUDOHVUpJODJHVSHUVRQQDOLVpVVL
HOOHHVWLQDFWLYHSHQGDQWPLQXWHV
3RXUVRUWLUGHVUpJODJHVSHUVRQQDOLVpVHWHQUHJLVWUHUWRXW
FKDQJHPHQWDSSX\H]VXUODWRXFKHAll Off et maintenez-la
HQIRQFpHSHQGDQWVHFRQGHV
Tableau des réglages personnalisés
Réglages personnalisés
Choix de réglage personnalisé
C0 (Réglages d’usine)
C01 - 5pLQLWLDOLVDWLRQDX[UpJODJHVG¶XVLQH SHUPHWG¶HIIDFHUOHVUpJODJHVSHUVRQQDOLVpVHWGHUHVWDXUHUOHVYDOHXUVSDUGpIDXW
C02 - 5pJODJHVSHUVRQQDOLVpVDFWLYpV QRQYLVLEOHVjPRLQVTXHWRXWDXWUHUpJODJHSHUVRQQDOLVpVRLWVpOHFWLRQQp'HSOXVLOHVW
DXWRPDWLTXHPHQWDFWLYpORUVTXHWRXWDXWUHUpJODJHSHUVRQQDOLVpHVWVpOHFWLRQQp/¶XWLOLVDWHXUQHSHXWVpOHFWLRQQHUFHUpJODJH C1 (Verrouillage des commandes)
C11 - 9HUURXLOODJHVWDQGDUG FjGXQLTXHPHQWORUVTXHOHERXWRQGHYHUURXLOODJHHVWHQIRQFpSHQGDQWVHFRQGHV 6LYRXV
XWLOLVH]XQHPLQXWHULH /HVRSWLRQVHQJULVVRQWOHVSDUDPqWUHVSDVGpIDXW/HYHUURXLOODJHGHVFRPPDQGHVQ¶HVWSDVGLVSRQLEOH
C12 - 9HUURXLOODJHDXWRPDWLTXH FjGTX¶LOV¶HQJDJHORUVTXHODWDEOHGHFXLVVRQHVWLQDFWLYHSHQGDQWPLQXWHV L’appareil doit être entièrement désactivé pour passer en mode de verrouillage automatique.
C2 (Niveau de luminosité des DEL)
C21 - Illumination complète
C22 - ,OOXPLQDWLRQPR\HQQH
C23 - ,OOXPLQDWLRQODSOXVIDLEOH
C3 (Niveau sonore des boutons)
C31 - 7RXVOHVVRQVDFWLYpVj 3RXUOHVVRQVG¶DODUPH VLOHQLYHDXHVWUpJOpGDQVF
C32 - Le niveau sonore des boutons est réduit de 50 %, sons d’alarme à 100 %
C33 - Les sons des boutons sont désactivés, les sons d’alarmes sont activés à 100 %
C4 (Niveau sonore de l’alarme
de minuterie)
UTILISATION DE LA TABLE DE CUISSON: Réglages personnalisés
Réglages personnalisés
C41 - eOHYp
C42 - %DV
C5 (durée d’alarme de la minuterie) C51 - ,QGpILQLH FjGTXHO¶DODUPHFRQWLQXHMXVTX¶jFHTX¶HOOHVRLWDQQXOpHSDUO¶XWLOLVDWHXU C52 - 6RQVG¶DODUPHSHQGDQWVHFRQGHV
C53 - 6RQVG¶DODUPHSHQGDQWVHFRQGHV
C54 - 6RQVG¶DODUPHSHQGDQWVHFRQGHV
C6 (Mode de minuterie)
C61 - 0LQXWHULHGHFXLVLQHVLPSOH LQGpSHQGDQWHGHVpOpPHQWV
C62 - 0LQXWHULHPXOWLSOH OLpHjFKDFXQGHVpOpPHQWV
/HVRSWLRQVHQJULVVRQWGHVUpJODJHVSDUGpIDXW
49-80747
13
UTILISATION DE LA TABLE DE CUISSON: Plaque chauffante
14
Plaque chauffante (accessoire en option)
Utilisation de la plaque chauffante
MISE EN GARDE Risque de brûlure
Ŷ Il est possible que la surface de la plaque chauffante soit suffisamment chaude pour vous causer des brûlures
pendant et après son utilisation. Mettez en place et retirez la plaque chauffante lorsqu’elle est froide et que tous les
éléments de la surface sont désactivés. Utilisez des gants de cuisine si vous devez toucher la plaque chauffante
lorsqu’elle est chaude. Dans le cas contraire, vous pourriez vous brûler.
Ŷ Mettez en place et retirez la plaque chauffante uniquement lorsqu’elle est froide et que tous les brûleurs de la
surface sont désactivés.
$YDQWG¶XWLOLVHUFHWXVWHQVLOHGHFXLVLQHSRXUODSUHPLqUHIRLVODYH]OHSRXUYRXVDVVXUHUTX¶LOHVWSURSUH3XLVHQGXLVH]
OpJqUHPHQWODVXUIDFHGHFXLVVRQG¶KXLOHGHFXLVLQH
Comment positionner la plaque chauffante
IMPORTANT :3RVLWLRQQHUHWXWLOLVH]WRXMRXUVYRWUHSODTXH
FKDXIIDQWHjO¶HPSODFHPHQWGpVLJQpVXUODWDEOHGHFXLVVRQ
Type d’aliments
Selon le réglage
de cuisson
5pFKDXIIHUGHVWRUWLOODV
0R\HQEDV
Crêpes
0R\HQEDV
+DPEXUJHU
¯XIVIULWV
&KDSHOHWGHVDXFLVVHVGpMHXQHUV
6DQGZLFKVFKDXGV FRPPHXQJULOOHGFKHHVH
0R\HQ
0R\HQEDV
0R\HQ
0R\HQEDV
/HVUpJODJHVGHODSODTXHFKDXIIDQWHVRQWFRQoXVFRPPHOLJQH
directrice et il est possible que vous deviez les adapter selon les
SUpIpUHQFHVGHFXLVVRQGHFKDFXQ
Utilisation de la plaque chauffante
REMARQUES IMPORTANTES :
Ŷ 1HWWR\H]ODSODTXHFKDXIIDQWHDYHFXQHpSRQJHHWXQ
GpWHUJHQWGRX[GDQVGHO¶HDXFKDXGH1¶XWLOLVH]3$6GH
tampon à récurer bleu ou vert ni de laine d’acier.
Ŷ eYLWH]GHFXLVLQHUGHVDOLPHQWVWUqVJUDLVVHX[HWSUHQH]
soin d’éviter les débordements de graisse pendant la
cuisson.
Ŷ 1HPHWWH]HWQHUDQJH]DXFXQREMHWVXUODSODTXH
FKDXIIDQWHPrPHORUVTXHYRXVQHO¶XWLOLVH]SDV/DSODTXH
SRXUUDLWGHYHQLUFKDXGHORUVGHO¶XWLOLVDWLRQGHVVXUIDFHV
DGMDFHQWHV
Ŷ eYLWH]G¶XWLOLVHUGHVXVWHQVLOHVPpWDOOLTXHVPXQLVG¶XQH
pointe acérée ou d’un bord irrégulier qui pourraient
HQGRPPDJHUODSODTXHFKDXIIDQWH1HFRXSH]SDV
G¶DOLPHQWVVXUODSODTXHFKDXIIDQWH
Ŷ 1¶XWLOLVH]SDVG¶XVWHQVLOHGHFXLVLQHFRPPHUpFLSLHQWGH
rangement pour l’huile des aliments. Il pourrait être taché
GHIDoRQSHUPDQHQWHHWRXGHVILVVXUDWLRQVWKHUPLTXHV
pourraient en résulter.
Ŷ $YHFOHWHPSVHWO¶XWLOLVDWLRQODSODTXHFKDXIIDQWHVH
décolorera.
Ŷ 1HQHWWR\H]SDVODSODTXHFKDXIIDQWHGDQVXQIRXU
DXWRQHWWR\DQW
Ŷ /DLVVH]WRXMRXUVO¶XVWHQVLOHGHFXLVLQHVHUHIURLGLUDYDQWGH
l’immerger dans l’eau.
Ŷ 1HVXUFKDXIIH]SDVODSODTXHFKDXIIDQWH
3RXUDFWLYHUODVXUIDFHSRXUODWRWDOLWpGHODSODTXHFKDXIIDQWH
XWLOLVH]ODIRQFWLRQ6\QF%XUQHU$SSX\H]VXUODWRXFKHSync
Burner SXLVDMXVWH]OHQLYHDXGHSXLVVDQFHVHORQOHUpJODJH
VRXKDLWpFRPPHGpFULWjODSDJH
49-80747
Nettoyage Normal Quotidien
8WLOLVH]ODFUqPHQHWWR\DQWH&(5$0$%5<7(® ur votre table
de cuisson en vitrocéramique.
3RXUHQWUHWHQLUHWSURWpJHUYRWUHWDEOHGHFXLVVRQHQ
YLWURFpUDPLTXHFRQIRUPH]YRXVDX[LQVWUXFWLRQVVXLYDQWHV
$YDQWG¶XWLOLVHUYRWUHWDEOHGHFXLVVRQSRXUODSUHPLqUHIRLV
QHWWR\H]ODDYHFGHODFUqPHQHWWR\DQWH&(5$0$%5<7(®
pour table de cuisson. Cela vous aidera à la protéger et à la
conserver propre.
9RWUHWDEOHGHFXLVVRQFRQVHUYHUDVRQDVSHFWQHXIVLYRXV
XWLOLVH]FKDTXHMRXUODFUqPHQHWWR\DQWH&(5$0$%5<7(®
pour table de cuisson.
6HFRXH]ELHQOHIODFRQGHFUqPHQHWWR\DQWH9HUVH]
TXHOTXHVJRXWWHVGHFUqPHQHWWR\DQWH&(5$0$%5<7(®
directement sur votre table de cuisson.
8WLOLVH]XQHVHUYLHWWHHQSDSLHU
RXXQHpSRQJH&(5$0$
%5<7(® pour table de cuisson en
YLWURFpUDPLTXHDILQGHQHWWR\HUOD
VXUIDFHGHODWDEOHGHFXLVVRQ
8WLOLVH]XQFKLIIRQRXXQHVHUYLHWWH
HQSDSLHUSRXUQHWWR\HUWRXWHOD
VXUIDFHGHODWDEOHGHFXLVVRQ3DV
besoin de rincer.
REMARQUE :9RXVGHYH]IDLUHELHQ Nettoyez votre table de
DWWHQWLRQGHQHSDVIDLUHFKDXIIHUOD cuisson chaque fois qu’elle
WDEOHGHFXLVVRQDYDQWGHODQHWWR\HU est sale. Utilisez la crème
nettoyante CERAMA BRYTE®
complètement.
pour table de cuisson.
Résidus Calcinés
REMARQUE:9RXVSRXYH]HQGRPPDJHUYRWUHVXUIDFHHQ
vitrocéramique si vous utilisez des éponges de récurage autres
que celles comprises avec votre appareil.
/DLVVH]UHIURLGLUODWDEOHGHFXLVVRQ
9HUVH]TXHOTXHVJRXWWHVGHFUqPHQHWWR\DQWH&(5$0$
%5<7(® sur tous les résidus calcinés.
¬O¶DLGHGHO¶pSRQJHGHUpFXUDJH&(5$0$%5<7(® pour
WDEOHGHFXLVVRQHQYLWURFpUDPLTXHIURWWH]OHVUpVLGXVHQ
H[HUoDQWODSUHVVLRQQpFHVVDLUH
6¶LOUHVWHGHVUpVLGXVUpSpWH]OHVRSpUDWLRQVLQGLTXpHV
ci-dessus.
3RXUPLHX[SURWpJHUDSUqVDYRLUHQOHYpOHVUpVLGXV
SROLVVH]WRXWHODVXUIDFHDYHFODFUqPHQHWWR\DQWH
&(5$0$%5<7(® et une serviette de papier.
Utilisez une éponge CERAMA BRYTE® pour table de
cuisson en vitrocéramique.
Résidus Calcinés Difficiles À Enlever
/DLVVH]UHIURLGLUODWDEOHGHFXLVVRQ
7HQH]XQJUDWWRLUjODPHVLPSOHjXQDQJOHG¶HQYLURQž
VXUODVXUIDFHGHYLWURFpUDPLTXHHWUDFOH]OHVUpVLGXV9RXV
GHYUH]H[HUFHUGHODSUHVVLRQVXUOHJUDWWRLUjODPHSRXUOHV
enlever.
$SUqVDYRLUHQOHYpOHVUpVLGXVDYHFOHJUDWWRLUjODPH
YHUVH]TXHOTXHVJRXWWHVGHFUqPHQHWWR\DQWH&(5$0$
%5<7(® pour table de cuisson sur les résidus calcinés.
8WLOLVH]O¶pSRQJH&(5$0$%5<7(® pour enlever les
résidus restants.
3RXUPLHX[SURWpJHUDSUqVDYRLUHQOHYpOHVUpVLGXV
SROLVVH]WRXWHODVXUIDFHDYHFODFUqPHQHWWR\DQWH
&(5$0$%5<7(® et une serviette de papier.
49-80747
On peut se procurer le grattoir CERAMA BRYTE® pour table de cuisson
en vitrocéramique et tous les accessoires recommandés dans nos
Centres de pièces détachées. Consultez les instructions dans la section
« Comment commander des pièces » à la page suivante.
REMARQUE : N’utilisez jamais une lame émoussée ou ébréchée.
ENTRETIEN ET NETTOYAGE: Nettoyage de la vitre de la table de cuisson
Nettoyage de la vitre de la table de cuisson
15
ENTRETIEN ET NETTOYAGE: Nettoyage de la vitre de la table de cuisson
16
Nettoyage de la vitre de la table de cuisson
Traces De Métal Et Rayures
)DLWHVDWWHQWLRQGHQHSDVIDLUHJOLVVHUGHVXVWHQVLOHVGH
cuisine sur votre table de cuisson. Ils laisseront des traces
GHPpWDOVXUODVXUIDFHGHYLWURFpUDPLTXH
Vous pourrez enlever ces traces en appliquant la crème
QHWWR\DQWH&(5$0$%5<7(® à l’aide de l’éponge
&(5$0$%5<7(® pour table de cuisson en vitrocéramique.
6
LYRXVODLVVH]GHVFDVVHUROHVUHFRXYHUWHVG¶XQHFRXFKH
G¶DOXPLQLXPRXGHFXLYUHFKDXIIHUjVHFOHXUPpWDOSHXW
laisser des traces noires sur la table de cuisson.
Vous devez enlever ces traces immédiatement, avant de
IDLUHFKDXIIHUjQRXYHDXODWDEOHGHFXLVVRQ$XWUHPHQWOHV
traces risquent de devenir permanentes.
REMARQUE:9pULILH]WRXMRXUVOHIRQGGHYRVFDVVHUROHVSRXU
vous assurer qu’elles n’aient pas d’aspérités qui risquent de
UD\HUODWDEOHGHFXLVVRQ
Dommages causés par du sucre chaud ou des matières plastiques fondues
Vous devez porter un soin particulier à l’enlèvement des substances chaudes pour éviter des dommages permanents à la surface
en vitrocéramique/HVGpJkWVGHPDWLqUHVVXFUpHV FRPPHOHVJHOpHVOHIXGJHOHVVXFUHULHVOHVVLURSV RXOHVSODVWLTXHVIRQGXV
SHXYHQWFDXVHUGHVSLT€UHVjODVXUIDFHGHYRWUHWDEOHGHFXLVVRQ QRQFRXYHUWHVSDUODJDUDQWLH jPRLQVTXHOHGpJkWVRLWHQOHYp
DORUVTX¶LOHVWHQFRUHFKDXG2QGRLWIDLUHSUHXYHG¶XQHJUDQGHSUXGHQFHORUVGHO¶HQOqYHPHQWGHVXEVWDQFHVFKDXGHV
$VVXUH]YRXVG¶XWLOLVHUXQJUDWWRLUQHXIWUDQFKDQWFRPPHXQUDVRLU
1¶XWLOLVH]SDVGHODPHpPRXVVpHRXHQPDXYDLVpWDW
e
WHLJQH]WRXWHVOHVXQLWpVGHODWDEOHGHFXLVVRQ(QOHYH]
toutes les casseroles chaudes.
3RUWH]GHVJDQWVGHFXLVLQH
D8WLOLVH]XQJUDWWRLUjODPHVLPSOH JUDWWRLU&(5$0$
%5<7(®SRXUWDEOHGHFXLVVRQHQYLWURFpUDPLTXH SRXU
UHSRXVVHUOHVPDWLqUHVIRQGXHVVXUXQHVXUIDFHIURLGH
de la table de cuisson.
E(QOHYH]OHVPDWLqUHVIRQGXHVDYHFXQHVHUYLHWWHHQ
papier.
9
RXVGHYH]ODLVVHUWRXWHPDWLqUHIRQGXHTXHYRXVQ¶DYH]
SDVUpXVVLjHQOHYHUMXVTX¶jFHTXHODWDEOHGHFXLVVRQ
UHIURLGLVVHFRPSOqWHPHQW
1
HUpXWLOLVH]MDPDLVODWDEOHGHFXLVVRQDYDQWG¶DYRLUHQOHYp
complètement les résidus.
REMARQUE:6¶LOV¶HVWGpMjIRUPpVXUYRWUHWDEOHGHFXLVVRQ
HQYLWURFpUDPLTXHGHVFUHX[RXGHVSLT€UHVYRXVGHYUH]OD
remplacer. Dans ce cas, vous devez appeler le service.
49-80747
Remarques
49-80747
17
Remarques
18
49-80747
Remarques
49-80747
19
TRUCS DE DÉPANNAGE
Trucs de dépannage ... Avant d’appeler le service à la clientèle
eFRQRPLVH]GXWHPSVHWGHO¶DUJHQW&RQVXOWH]OHVWDEOHDX[GHVSDJHVVXLYDQWHVHWYRXVQ¶DXUH]SHXWrWUHSDVjDSSHOHUOH
VHUYLFHjODFOLHQWqOH6LXQHHUUHXUVHSURGXLWGDQVO¶XWLOLVDWLRQGHVFRPPDQGHVXQFRGHGHGpIDLOODQFHV¶DIILFKHUD1RWH]OH
code d’erreur et contactez le service.
Problème
Cause possible
Que faire?
Les éléments de surface
n’assurent pas une
ébullition continue ou la
cuisson est lente
Utilisation d’un récipient incorrect.
8WLOLVH]VHXOHPHQWGHVFDVVHUROHVGRQWOHIRQG
est plat et adaptée à la dimension de l’élément de
VXUIDFHFKRLVL
Les éléments de surface
ne fonctionnent pas
correctement
Réglages incorrects des commandes de la
table de cuisson.
9pULILH]TXHODFRPPDQGHDSSURSULpHHVWUpJOpH
FRUUHFWHPHQWSRXUO¶pOpPHQWGHVXUIDFHXWLOLVp
Témoin de l’arc du niveau
de puissance clignotant
Les touches +, - ou de verrouillage ont
été touchées avant la mise en marche de
l’élément.
&RQVXOWH]OHFKDSLWUH©)RQFWLRQQHPHQWGHV
éléments de cuisson ».
Rayures sur la surface
vitrée de la table de
cuisson
Utilisation de mauvaises méthodes de
nettoyage.
8WLOLVH]OHVSURFpGXUHVGHQHWWR\DJH
UHFRPPDQGpHV&RQVXOWH]ODVHFWLRQ1HWWR\DJHGH
la vitre de la table de cuisson.
Utilisation d’un récipient avec des
aspérités sur le fond ou présence de
particules (sable ou sel) entre le récipient
et la surface de la table de cuisson.
Quelqu’un a fait glisser récipient à la
surface de la table de cuisson.
3RXUpYLWHUOHVUD\XUHVXWLOLVH]OHVSURFpGXUHVGH
QHWWR\DJHUHFRPPDQGpHV$VVXUH]YRXVTXHOHIRQG
des récipients est propre avant utilisation et utilisez
XQHEDWWHULHGHFXLVLQHDYHFGHVIRQGVOLVVHV
Des projections alimentaires n’ont pas été
nettoyées avant l’utilisation suivante.
&RQVXOWH]ODVHFWLRQ1HWWR\DJHGHODYLWUHGHOD
table de cuisson.
Surface chaude sur un modèle avec une
vitre de table de cuisson légèrement colorée.
&¶HVWQRUPDO/DVXUIDFHSHXWDSSDUDvWUHGpFRORUpH
lorsqu’elle est chaude. C’est un phénomène
WHPSRUDLUHTXLGLVSDUDvWUDORUVTXHODYLWUHUHIURLGLUD
Plastique fondu sur la
surface
La table de cuisson chaude est entrée en
contact avec un plastique posé sur la table
de cuisson chaude.
&RQVXOWH]ODVHFWLRQ6XUIDFHYLWUpH±SRVVLELOLWp
G¶XQGRPPDJHGpILQLWLIGDQVODVHFWLRQ1HWWR\DJH
de la vitre de la table de cuisson.
Trou (ou échancrure) dans
la table de cuisson
Un mélange sucré chaud a été projeté sur
la table de cuisson.
&RQWDFWH]XQWHFKQLFLHQTXDOLILpSRXUXQ
remplacement.
Touches du clavier
inopérantes
Le clavier est sale.
1HWWR\H]OHFODYLHU
Un fusible de votre domicile peut avoir
grillé ou le disjoncteur a sauté.
5HPSODFH]OHIXVLEOHRXUpLQLWLDOLVH]OHGLVMRQFWHXU
Zones décolorées sur la
table de cuisson
20
49-80747
Radiante
Estufa
GEAppliances.com
Información De Seguridad . . . . 2
Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Asistencia /
Piezas y Accesorios . . . . . . . . . . . . . 5
Manual del Propietario
PP9030
PP9036
Uso de la placa de cocción
Funciones de la Placa de Cocción . . . 6
Estufa de Vidrio Radiante . . . . . . . . . . . 7
Consejos para Productos
Enlatados en el Hogar . . . . . . . . . . . . 7
Utensilio para Placa de
Cocción para Vidrio Radiante . . . . . 8
Para Mejores Resultados . . . . . . . . . . . 8
Ciclos de los Elementos . . . . . . . . . . . . . 9
Uso de los Elementos de Cocción . . . 9
Ajuste del Tamaño del Quemador . . . 9
Apagado del Quemador(es) . . . . . . . .10
Selección de las Configuraciones
de la Placa de Cocción. . . . . . . . . . .10
Cómo Sincronizar los
Elementos Izquierdos . . . . . . . . . . . .10
Bloqueo de la Placa de Cocción . . . .11
Temporizador Único de la Cocina . .11
Temporizadores Múltiples . . . . . . . . .12
Indicador Luminoso de Calor . . . . . .12
Configuraciones Especiales . . . . . . . .13
Plancha (accesorio opcional). . . . . . .14
Cuidado Y Limpieza
Cómo Limpiar la Estufa de Vidrio. . .15
Consejos para la Solución
de Problemas . . . . . . . . . . . . . . . .20
Escriba el modelo y los números de
serie a continuación:
Modelo No: ___________________
Serial No: _____________________
Los puede encontrar en la etiqueta
que está debajo de la superficie de
la estufa.
49-80747 02-15 GE
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA
/HDWRGDVODVLQVWUXFFLRQHVGHVHJXULGDGDQWHVGHXWLOL]DUHVWHSURGXFWR1RVHJXLUHVWDVLQVWUXFFLRQHVSXHGHJHQHUDUXQ
LQFHQGLRXQDGHVFDUJDHOpFWULFDOHVLRQHVFRUSRUDOHVRODPXHUWH
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD
Ŷ 8VHHVWDSODFDGHFRFFLyQVyORFRQHOREMHWLYRSDUDHO
TXHIXHFUHDGRFRPRVHGHVFULEHHQHVWH0DQXDOGHO
3URSLHWDULR
Ŷ $VHJ~UHVHGHTXHXQWpFQLFRFDOLILFDGRUHDOLFHXQD
FRUUHFWDLQVWDODFLyQ\SXHVWDDWLHUUDGHODSODFD
GHFRFFLyQGHDFXHUGRFRQODVLQVWUXFFLRQHVGH
LQVWDODFLyQSURYLVWDV
Ŷ 1RLQWHQWHUHSDUDURFDPELDUQLQJXQDSLH]DGHOD
SODFDGHFRFFLyQDPHQRVTXHHVWpHVSHFtILFDPHQWH
UHFRPHQGDGRHQHVWHPDQXDO&XDOTXLHURWURVHUYLFLR
GHEHUHDOL]DUORXQWpFQLFRFDOLILFDGR
Ŷ $QWHVGHUHDOL]DUFXDOTXLHUFODVHGHUHSDUDFLyQ
GHVHQFKXIHODSODFDGHFRFFLyQRGHVFRQHFWHHO
VXPLQLVWURHOpFWULFRGHVGHHOSDQHOGHGLVWULEXFLyQ
GRPpVWLFRTXLWDQGRHOIXVLEOHRGHVFRQHFWDQGRHO
LQWHUUXSWRUGHFLUFXLWRV
Ŷ 1RGHMHDORVQLxRVVRORVpVWRVQRGHEHQTXHGDU
VRORVRVLQDWHQFLyQHQXQiUHDGRQGHXQDSODFDGH
FRFFLyQHVWpHQXVR1XQFDGHEHSHUPLWLUVHTXHVH
VXEDQVLHQWHQRSDUHQHQFXDOTXLHUSDUWHGHODSODFD
GHFRFFLyQ
Ŷ
PRECAUCIÓN
:1RDOPDFHQH
HOHPHQWRVGHLQWHUpVSDUDQLxRVVREUHODSODFDGH
FRFFLyQORVQLxRVTXHVHWUHSHQDODFRFLQDSDUD
DOFDQ]DUHOHPHQWRVSXHGHQUHVXOWDUJUDYHPHQWH
KHULGRV
ADVERTENCIA
MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA PLACA DE COCCIÓN
Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios.
Ŷ 1RDOPDFHQHRXWLOLFHPDWHULDOHVLQIODPDEOHVFHUFD
GHODSODFDGHFRFFLyQWDOHVFRPRSDSHOSOiVWLFR
DJDUUDGHUDVWHODVUHFXEULPLHQWRVGHSDUHGFRUWLQDV
\JDVROLQDXRWURVYDSRUHV\OtTXLGRVLQIODPDEOHV
Ŷ 1XQFDXVHYHVWLPHQWDVKROJDGDVRDPSOLDVPLHQWUDV
XWLOLFHODSODFDGHFRFFLyQ(VWDVYHVWLPHQWDVSXHGHQ
SUHQGHUVHIXHJRVLHQWUDQHQFRQWDFWRFRQVXSHUILFLHV
FDOLHQWHVSURYRFDQGRTXHPDGXUDVJUDYHV
2
Ŷ 6yORXVHDJDUUDGHUDVVHFDVODVDJDUUDGHUDV
K~PHGDVRPRMDGDVFRORFDGDVHQVXSHUILFLHV
FDOLHQWHVSXHGHQSURYRFDUTXHPDGXUDVGHYDSRU1R
SHUPLWDTXHODVDJDUUDGHUDVHQWUHQHQFRQWDFWRFRQ
XQLGDGHVGHVXSHUILFLHRORVHOHPHQWRVFDOHQWDGRUHV
FDOLHQWHV1RXWLOLFHWRDOODVXRWUDVWHODVJUXHVDVHQ
OXJDUGHXQDDJDUUDGHUD
Ŷ 1XQFDXVHODSODFDGHFRFFLyQSDUDFDOHQWDUOD
KDELWDFLyQ
Ŷ 1RWRTXHORVHOHPHQWRVGHODVXSHUILFLH(VWDV
VXSHUILFLHVSXHGHQHVWDUWDQFDOLHQWHVFRPRSDUD
TXHPDUDXQTXHHVWpQGHFRORURVFXUR'XUDQWH\
GHVSXpVGHVXXVRQRODVWRTXHQLSHUPLWDTXHDOJ~Q
SDxRXRWURPDWHULDOLQIODPDEOHHQWUHHQFRQWDFWR
FRQORVHOHPHQWRVGHODVXSHUILFLHRFRQODViUHDV
FHUFDQDVDORVHOHPHQWRVGHODVXSHUILFLHGHMH
VXILFLHQWHWLHPSRSDUDTXHVHHQIUtHQSULPHUR
Ŷ /DV]RQDVSRWHQFLDOPHQWHFDOLHQWHVVRQODVXSHUILFLH
GHODHVWXID\ODViUHDVDOIUHQWH
Ŷ 1RFDOLHQWHUHFLSLHQWHVFHUUDGRVGHDOLPHQWRV3RGUtD
KDEHUXQDDFXPXODFLyQGHSUHVLyQHQHOUHFLSLHQWH\
pVWHSRGUtDH[SORWDUSURYRFDQGROHVLRQHV
Ŷ &RFLQHFDUQHVGHUHV\GHDYHSRUFRPSOHWR/DV
FDUQHVGHUHVKDVWDDOFDQ]DUXQDWHPSHUDWXUDLQWHUQD
GHSRUORPHQRVƒ) ƒ& \ODVFDUQHVGHDYHD
XQDWHPSHUDWXUDLQWHUQDGHSRUORPHQRVƒ) ƒ& /DFRFFLyQDHVWDVWHPSHUDWXUDVJHQHUDOPHQWHSURWHJH
GHHQIHUPHGDGHVWUDQVPLWLGDVSRUORVDOLPHQWRV
Ŷ 1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURV
PDWHULDOHVLQIODPDEOHVVHDFXPXOHQGHQWURGHOD
FRFLQDRHQVXFHUFDQtD/DJUDVDVREUHODSODFDGH
FRFFLyQSXHGHHQFHQGHUVH
LEA Y GUARDE ESTAS INSTRUCCIONES
49-80747
Ŷ (
QFDVRGHLQFHQGLRQRXWLOLFHDJXDHQLQFHQGLRVGH
JUDVD1XQFDOHYDQWHXQDVDUWpQHQOODPDV$SDJXH
ORVFRQWUROHV$SDJXHXQDVDUWpQHQOODPDVVREUHXQD
XQLGDGGHVXSHUILFLHFXEULHQGRODVDUWpQSRUFRPSOHWR
FRQXQDWDSDTXHDMXVWHELHQXQDSODQFKDSDUD
JDOOHWDVRXQDEDQGHMDSODQD8WLOLFHXQTXtPLFRVHFR
PXOWLXVRRXQH[WLQWRUGHLQFHQGLRVGHHVSXPD
Ŷ 1XQFDGHMHODVXQLGDGHVGHVXSHUILFLHVLQDWHQFLyQHQ
FRQILJXUDFLRQHVGHFDORUPHGLDRDOWD/RVDOLPHQWRV
TXHKLHUYHQ\VHGHUUDPDQSXHGHQSURYRFDUKXPR\
GHUUDPHVJUDVRVRVTXHSXHGHQSUHQGHUVHIXHJR
Ŷ 1XQFDGHMHDFHLWHVLQDWHQFLyQPLHQWUDVIUtH6LVH
GHMDFDOHQWDUPiVDOOiGHOSXQWRGHKXPHRHODFHLWH
SXHGHHQFHQGHUVHSURYRFDQGRXQLQFHQGLRTXH
SRGUtDSURSDJDUVHDORVJDELQHWHVFHUFDQRV8WLOLFH
XQWHUPyPHWURSDUDJUDVDFXDQGRVHDSRVLEOHSDUD
FRQWURODUODWHPSHUDWXUDGHODFHLWH
Ŷ 3DUDHYLWDUHOGHUUDPHGHDFHLWH\XQLQFHQGLRXWLOLFH
XQDFDQWLGDGPtQLPDGHDFHLWHFXDQGRIUtDHQVDUWHQHV
SRFRSURIXQGDV\HYLWHODFRFFLyQGHDOLPHQWRV
FRQJHODGRVFRQXQDFDQWLGDGH[FHVLYDGHKLHOR
Ŷ 8WLOLFHHOWDPDxRGHUHFLSLHQWHDGHFXDGR(OLMD
UHFLSLHQWHVFRQEDVHVSODQDVORVXILFLHQWHPHQWH
JUDQGHVSDUDFXEULUHOHOHPHQWRFDOHQWDGRUGH
VXSHUILFLH/DXWLOL]DFLyQGHUHFLSLHQWHVPiVSHTXHxRV
GHMDUiH[SXHVWDXQDSRUFLyQGHODXQLGDGGH
VXSHUILFLHDOFRQWDFWRGLUHFWRORTXHSXHGHSURYRFDU
HOHQFHQGLGRGHVXVYHVWLPHQWDV8QDUHODFLyQ
DGHFXDGDGHOUHFLSLHQWHFRQODXQLGDGGHVXSHUILFLH
WDPELpQPHMRUDUiODHILFLHQFLD
Ŷ 3DUDPLQLPL]DUODSRVLELOLGDGGHTXHPDGXUDVHO
HQFHQGLGRGHPDWHULDOHVLQIODPDEOHV\ORVGHUUDPHV
ODPDQLMDGHOUHFLSLHQWHGHEHJLUDUVHKDFLDHOFHQWUR
GHODHVWXIDVLQVREUHSDVDUVHDQLQJ~QHOHPHQWRGH
VXSHUILFLHFHUFDQR
INFORMACIÓN DE SEGURIDAD
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DE LA ESTUFA
ADVERTENCIA SEGURIDAD SOBRE LA ESTUFA RADIANTE
FDORUGHODSODFDGHFRFFLyQRGHODYHQWLODFLyQGHO
Ŷ 6
yORFLHUWRVWLSRVGHYLGULRYLGULRFHUiPLFRFHUiPLFR
KRUQROXHJRGHTXHIXHDSDJDGRWDPELpQSXHGHQ
REMHWRVGHEDUURXRWURVUHFLSLHQWHVGHYLGULRVRQ
KDFHUTXHGLFKRVDUWtFXORVVHLQFHQGLHQ
DSWRVSDUDVXXVRHQODHVWXIDRWURVVHSXHGHQ
URPSHUGHELGRDOFDPELREUXVFRGHWHPSHUDWXUD
Ŷ 8VHHO/LPSLDGRUSDUD3ODFDVGH&RFFLyQGH
FHUiPLFD&(5$0$%5<7(®\OD$OPRKDGLOOD
Ŷ 7HQJDFXLGDGRDOWRFDUODHVWXID/DVXSHUILFLHGH
YLGULRGHODHVWXIDUHWHQGUiFDORUGHVSXpVGHTXHORV
GH/LPSLH]D&(5$0$%5<7(®SDUDOLPSLDUOD
FRQWUROHVVHKD\DQDSDJDGR 2)) SODFDGHFRFFLyQ$QWHVGHUHDOL]DUODOLPSLH]D
HVSHUHKDVWDTXHODSODFDGHFRFFLyQVHHQIUtH\
Ŷ 1RFRFLQHHQXQDFRFLQDURWD6LODFRFLQDVXIUH
TXHODOX]LQGLFDGRUDVHDSDJXH8QDHVSRQMDR
URWXUDVORVSURGXFWRVGHOLPSLH]D\ORVGHUUDPHV
WHODPRMDGDVREUHXQDVXSHUILFLHFDOLHQWHSXHGH
SRGUiQSHQHWUDUVREUHGLFKDVURWXUDVFUHDQGRULHVJRV
FDXVDTXHPDGXUDVGHYDSRU$OJXQRVOLPSLDGRUHV
GHGHVFDUJDVHOpFWULFDV&RPXQtTXHVHFRQXQWpFQLFR
SXHGHQSURGXFLUKXPRVWy[LFRVVLVHORVDSOLFDD
FDOLILFDGRGHLQPHGLDWR
XQDVXSHUILFLHFDOLHQWH/HD\FXPSODFRQWRGDVODV
Ŷ (YLWHUD\DUODHVWXIDGHYLGULR/DHVWXIDSXHGH
LQVWUXFFLRQHV\DGYHUWHQFLDVGHODVHWLTXHWDVGH
VXIULUUD\RQHVFRQDUWtFXORVWDOHVFRPRFXFKLOORV
ODVFUHPDVGHOLPSLH]D127$/RVGHUUDPHVGH
LQVWUXPHQWRVSXQWLDJXGRVDQLOORVXRWUDVMR\DV\
SURGXFWRVD]XFDUDGRVVRQXQDH[FHSFLyQ6HGHEHQ
DEURMRVGHYHVWLPHQWDV
HOLPLQDUUDVSDQGRPLHQWUDVD~QHVWiQFDOLHQWHV
Ŷ 1RFRORTXHQLJXDUGHDUWtFXORVTXHVHSXHGDQGHUUHWLU
XWLOL]DQGRXQJXDQWHSDUDKRUQRRXQDHVSiWXOD
RLQFHQGLDUHQODSODFDGHFRFFLyQLQFOXVRFXDQGRQR
3DUDDFFHGHUDLQVWUXFFLRQHVGHWDOODGDVFRQVXOWHOD
HVWpVLHQGRXVDGD6LODFRFLQDHVHQFHQGLGDGHIRUPD
VHFFLyQGHOLPSLH]DGHODSODFDGHFRFFLyQGHYLGULR
LQYROXQWDULDGLFKRVDUWtFXORVVHSRGUiQLQFHQGLDU(O
LEA Y GUARDE ESTAS INSTRUCCIONES
49-80747
3
GARANTÍA
¡Gracias! ... por su compra de un electrodoméstico de la Marca GE
Registre su Electrodoméstico: £5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWUHJLVWHU
8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUiXQDPHMRUFRPXQLFDFLyQ\XQVHUYLFLRPiVSXQWXDOGHDFXHUGRFRQORVWpUPLQRVGHVX
JDUDQWtDHQFDVRGHVXUJLUODQHFHVLGDG7DPELpQSXHGHHQYLDUXQDFDUWDHQODWDUMHWDGHLQVFULSFLyQSUHLPSUHVDTXHVHLQFOX\HFRQ
HOPDWHULDOHPEDODGR
Garantía de la Placa de Cocción Eléctrica de GE
GEAppliances.com
7RGRHOVHUYLFLRGHJDUDQWtDHVSURYLVWRSRUQXHVWURV&HQWURVGH6HUYLFLRGH)DEULFDRXQWpFQLFRDXWRUL]DGRGH6HUYLFLRDO&OLHQWH
&XVWRPHU&DUHŠ 3DUDSURJUDPDUXQDYLVLWDGHOVHUYLFLRWpFQLFRDWUDYpVGH,QWHUQHWYLVtWHQRVHQZZZJHDSSOLDQFHVFRP
VHUYLFHBDQGBVXSSRUWROODPHDO*(&$5(6 &XDQGROODPHSDUDVROLFLWDUHOVHUYLFLRWHQJDORVQ~PHURVGH
VHULDO\GHPRGHORGLVSRQLEOHV
3DUDUHDOL]DUHOVHUYLFLRWpFQLFRGHVXHOHFWURGRPpVWLFRVHSRGUiUHTXHULUHOXVRGHGDWRVGHOSXHUWRGHDERUGDMHSDUDVX
GLDJQyVWLFR(VWRGDDOWpFQLFRGHOVHUYLFLRGHIiEULFDGH*(ODKDELOLGDGGHGLDJQRVWLFDUGHIRUPDUiSLGDFXDOTXLHUSUREOHPDFRQ
VXHOHFWURGRPpVWLFR\GHD\XGDUD*(DPHMRUDUVXVSURGXFWRVDOEULQGDUOHD*(ODLQIRUPDFLyQVREUHVXHOHFWURGRPpVWLFR6LQR
GHVHDTXHORVGDWRVGHVXHOHFWURGRPpVWLFRVHDQHQYLDGRVD*(VROLFLWDPRVTXHOHLQGLTXHDVXWpFQLFRQRHQWUHJDUORVGDWRVD
*(HQHOPRPHQWRGHOVHUYLFLR
'XUDQWHHOSHUtRGRGHXQDxRGHVGHODIHFKDRULJLQDOGHFRPSUD*(OHEULQGDUiFXDOTXLHUSDUWHGHODSODFDGHFRFFLyQTXHIDOOH
GHELGRDXQGHIHFWRHQORVPDWHULDOHVRODIDEULFDFLyQ'XUDQWHHVWDJDUDQWtDOLPLWDGDGHXQDxR*(WDPELpQSURYHHUiVLQFRVWR
WRGRHOWUDEDMR\HOVHUYLFLRHQHOKRJDUUHODFLRQDGRFRQHOUHHPSOD]RGHODSDUWHTXHSUHVHQWHGHIHFWRV
$EURFKHVXUHFLERDTXt3DUDDFFHGHUDOVHUYLFLRWpFQLFRGHDFXHUGRFRQ
ODJDUDQWtDGHEHUiFRQWDUFRQODSUXHEDGHODIHFKDRULJLQDOGHFRPSUD
Qué no cubrirá GE:
Ŷ 9LDMHVGHOWpFQLFRGHOVHUYLFLRDVXKRJDUSDUDHQVHxDUOH
VREUHFyPRXVDUHOSURGXFWR
Ŷ ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV
Ŷ )DOODVGHOSURGXFWRHQFDVRGHDEXVRPDOXVRPRGLILFDFLyQ
RXVRSDUDSURSyVLWRVGLIHUHQWHVDORULJLQDORXVRFRPHUFLDO
Ŷ 5HHPSOD]RGHIXVLEOHVGHODFDVDRUHLQLFLRGHGLV\XQWRUHV
Ŷ 'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH
LQFHQGLRLQXQGDFLRQHVRFDWiVWURIHVQDWXUDOHV
Ŷ 'DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV
GHIHFWRVVREUHHVWHSURGXFWR
Ŷ 'DxRFDXVDGRGHVSXpVGHODHQWUHJD
Ŷ 3URGXFWRQRDFFHVLEOHSDUDEULQGDUHOVHUYLFLRUHTXHULGR
Ŷ 6ROLFLWHHOVHUYLFLRWpFQLFRSDUDUHSDUDURUHHPSOD]DUODV
OiPSDUDVH[FHSWRODVOiPSDUDV/('
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS
6X~QLFD\H[FOXVLYDDOWHUQDWLYDHVODUHSDUDFLyQGHOSURGXFWRFRPRVHLQGLFDHQOD*DUDQWtD/LPLWDGD/DVJDUDQWtDVLPSOtFLWDV
LQFOX\HQGRJDUDQWtDVLPSOtFLWDVGHFRPHUFLDELOLGDGRFRQYHQLHQFLDVREUHXQSURSyVLWRSDUWLFXODUVHOLPLWDQDXQDxRRDOSHUtRGR
PiVFRUWRSHUPLWLGRSRUODOH\
(VWDJDUDQWtDVHH[WLHQGHDOFRPSUDGRURULJLQDO\DFXDOTXLHUGXHxRVXEVLJXLHQWHGHSURGXFWRVFRPSUDGRVSDUDXVRKRJDUHxR
GHQWURGH((886LHOSURGXFWRHVWiHQXQiUHDGRQGHQRVHHQFXHQWUDGLVSRQLEOHXQ3URYHHGRU$XWRUL]DGRGHO6HUYLFLR7pFQLFR
GH*(XVWHGVHUiUHVSRQVDEOHSRUHOFRVWRGHXQYLDMHRVHSRGUiUHTXHULUTXHWUDLJDHOSURGXFWRDXQDXELFDFLyQGHO6HUYLFLR
7pFQLFRGH*($XWRUL]DGRSDUDUHFLELUHOVHUYLFLR(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRDVX
KRJDU
$OJXQRVHVWDGRVQRSHUPLWHQODH[FOXVLyQROLPLWDFLyQGHGDxRVIRUWXLWRVRFRQVHFXHQWHV(VWDJDUDQWtDOHGDGHUHFKRVOHJDOHV
HVSHFtILFRV\HVSRVLEOHTXHWHQJDRWURVGHUHFKRVOHJDOHVTXHYDUtDQHQWUHXQHVWDGR\RWUR3DUDFRQRFHUFXiOHVVRQVXV
GHUHFKRVOHJDOHVFRQVXOWHDODRILFLQDGHDVXQWRVGHOFRQVXPLGRUORFDORHVWDWDORDO)LVFDOGHVXHVWDGR
Garante: General Electric Company. Louisville, KY 40225
Garantías Extendidas:$GTXLHUDXQDJDUDQWtDH[WHQGLGDGH*(\DSUHQGDVREUHGHVFXHQWRVHVSHFLDOHVTXHHVWiQGLVSRQLEOHV
PLHQWUDVVXJDUDQWtDD~QHVWiYLJHQWH/DSXHGHDGTXLULUHQFXDOTXLHUPRPHQWRDWUDYpVGH,QWHUQHWHQ
ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP
ROODPDQGRDOGXUDQWHHOKRUDULRFRPHUFLDOKDELWXDO/RV6HUYLFLRVSDUDHO&RQVXPLGRU+RJDUHxRGH*(D~QHVWDUiQ
DOOtFXDQGRVXJDUDQWtDFDGXTXH
4
49-80747
£&RQVXOWHHO6LWLR:HEGH(OHFWURGRPpVWLFRVGH*( www.geappliances.com/service_and_support/ GXUDQWHODVKRUDVFXDO
TXLHUGtDGHODxR3DUDPD\RUFRQYHQLHQFLD\XQVHUYLFLRPiVUiSLGRDKRUDSXHGHGHVFDUJDUHO0DQXDOGHO3URSLHWDULRRUGHQDU
SLH]DVRLQFOXVRSURJUDPDUHOVHUYLFLRWpFQLFRDWUDYpVGH,QWHUQHW
Servicio Programado: (OVHUYLFLRGHUHSDUDFLyQGHH[SHUWRVGH
*(HVWiDVyORXQSDVRGHVXSXHUWD(QWUHD,QWHUQHW\SURJUDPH
VXVHUYLFLRHQZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWR
OODPHDO*(&$5(6 GXUDQWHHOKRUDULRGH
DWHQFLyQFRPHUFLDO
Piezas y Accesorios: $TXHOODVSHUVRQDVFDOLILFDGDVSDUDUHDOL]DU
HOVHUYLFLRWpFQLFRVREUHVXVSURSLRVHOHFWURGRPpVWLFRVSRGUiQ
VROLFLWDUHOHQYtRGHSLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXV
KRJDUHV VHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU 2UGHQHDWUDYpVGH,QWHUQHWKR\GXUDQWHODVKRUDVRHQIRUPD
WHOHIyQLFDDOGXUDQWHHOKRUDULRGHDWHQFLyQFRPHUFLDO
/DVLQVWUXFFLRQHVTXHILJXUDQHQHVWHPDQXDOFXEUHQORV
SURFHGLPLHQWRVTXHVHUiQUHDOL]DGRVSRUFXDOTXLHUXVXDULR
2WURVVHUYLFLRVWpFQLFRVJHQHUDOPHQWHGHEHUtDQVHUGHULYDGRV
DSHUVRQDOFDOLILFDGRGHOVHUYLFLR6HGHEHUiWHQHUFXLGDGR\D
TXHXQDUHSDUDFLyQLQGHELGDSRGUiKDFHUTXHHOIXQFLRQDPLHQWR
QRVHDVHJXUR
Estudio de Diseño de la Vida Real: *(DSR\DHOFRQFHSWR
GH'LVHxR8QLYHUVDOHQSURGXFWRVVHUYLFLRV\DPELHQWHVTXH
SXHGHQVHUXVDGRVSRUSHUVRQDVGHWRGDVODVHGDGHVWDPDxRV
\FDSDFLGDGHV5HFRQRFHPRVODQHFHVLGDGGHUHDOL]DUGLVHxRV
SDUDXQDDPSOLDJDPDGHKDELOLGDGHVHLQFDSDFLGDGHVItVLFDV\
PHQWDOHV3DUDPiVGHWDOOHVVREUHODVDSOLFDFLRQHVGH'LVHxR
8QLYHUVDOGH*(LQFOX\HQGRLGHDVGHGLVHxRGHFRFLQDVSDUD
SHUVRQDVFRQLQFDSDFLGDGHVYLVLWHQXHVWURVLWLRZHEKR\6REUH
FDVRVGHLQFDSDFLGDGDXGLWLYDFRPXQtTXHVHDO7''*($&
Contáctenos: 6LQRVHHQFXHQWUDVDWLVIHFKRFRQHOVHUYLFLR
TXHUHFLELyGH*(FRPXQtTXHVHFRQQRVRWURVDWUDYpVGH
QXHVWURVLWLRZHEFRQWRGRVORVGHWDOOHVLQFOX\HQGRVXQ~PHUR
WHOHIyQLFRRHVFULEDD
General Manager, Customer Relations
GE Appliances, Appliance Park Louisville, KY 40225
Piezas y Accesorios
3DUDUHDOL]DUXQDRUGHQYLVtWHQRVDWUDYpVGH,QWHUQHWHQ
www.GEApplianceParts.com ((88 RHQwww.GEAppliances.ca &DQDGi ROODPHDO800.626.2002 ((88 800.661.1616 &DQDGi
ASISTENCIA / PIEZAS Y ACCESORIOS
¿Desea realizar una consulta o necesita ayuda con su electrodoméstico?
/DVVLJXLHQWHVSLH]DVHVWiQGLVSRQLEOHV
Piezas
3ODQFKD
-;*5,'/
/LPSLDGRU\3XOLGRUGH$FHUR,QR[LGDEOH
30;
Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje
&RQFXLGDGRWRPHXQH[WUHPRGHODSHOtFXODSURWHFWRUDGHHQYtR
FRQORVGHGRV\OHQWDPHQWHUHWLUHODPLVPDGHODVXSHUILFLHGHO
HOHFWURGRPpVWLFR1RXWLOLFHQLQJ~QSURGXFWRILORVRSDUDUHWLUDUOD
SHOtFXOD5HWLUHWRGDODSHOtFXODDQWHVGHXVDUHOHOHFWURGRPpVWLFR
SRUSULPHUDYH]
3DUDDVHJXUDUTXHQRKD\DGDxRVVREUHHODFDEDGRGHO
SURGXFWRODIRUPDPiVVHJXUDGHUHWLUDUHODGKHVLYRGHODFLQWD
GHHPEDODMHHQHOHFWURGRPpVWLFRVQXHYRVHVDSOLFDQGRXQ
GHWHUJHQWHOtTXLGRKRJDUHxRSDUDODYDUSODWRV$SOLTXHFRQXQD
WHODVXDYH\GHMHTXHVHVHTXH
NOTA: (ODGKHVLYRGHEHUiVHUHOLPLQDGRGHWRGDVODVSDUWHV
1RVHSXHGHUHWLUDUVLVHKRUQHDFRQpVWHGHQWUR
49-80747
5
USO DE LA PLACA DE COCCIÓN: Funciones de la Placa de Cocción
Funciones de la Placa de Cocción
Es posible que las funciones y apariencias varíen con relación a su modelo a lo largo del manual.
1
2
5
Placa de cocción de 30”
3
4
6
7
Controles de la Interfase del Usuario
1
2
5
Placa de cocción de 36”
3
4
6
7
Controles de la Interfase del Usuario
1. Cooking Element(s) (Elemento(s) de Cocción):&RQVXOWHODSiJLQD
2. Power Level Arc (Arco Eléctrico):&RQVXOWHODSiJLQD
3. Sync Burners (Quemadores Sincronizados):&RQVXOWHODSiJLQD
4. All Off (Todo Apagado):&RQVXOWHODSiJLQD
5. Lock (Bloqueo):&RQVXOWHODSiJLQD
6. Timer Select (Selección del Temporizador):&RQVXOWHODSiJLQD
7. Display (Pantalla):&RQVXOWHODSiJLQD
6
49-80747
/DHVWXIDUDGLDQWHFXHQWDFRQXQLGDGHVFDOHQWDGRUDVGHEDMR
GHXQDVXSHUILFLHOLVDGHYLGULR
NOTA:8QOLJHURRORUHVQRUPDOFXDQGRXQDHVWXIDQXHYDVH
XWLOL]DSRUSULPHUDYH](VSURYRFDGRSRUHOFDOHQWDPLHQWRGH
SLH]DVQXHYDV\PDWHULDOHVDLVODQWHV\GHVDSDUHFHUiHQSRFR
WLHPSR
NOTA:(VWDSODFDGHFRFFLyQFXHQWDFRQXQLGDGHVGH
VXSHUILFLHGH5DSLG5HVSRQVH 5HVSXHVWD5iSLGD /DHVWXID
VHFDOHQWDUiRHQIULDUiUiSLGDPHQWHKDVWDODFRQILJXUDFLyQGHO
QLYHOGHSRWHQFLDGHVHDGRHQHOWLHPSRPiVUiSLGRSRVLEOH
0LHQWUDVODVXQLGDGHVGHVXSHUILFLHHVWiQHQFHQGLGDVHV
SRVLEOHTXHQRYH]HQpVWDVVXEULOORURMRGXUDQWHFLHUWDV
FRQGLFLRQHVGHFDOHQWDPLHQWRRHQIULDPLHQWR
/DVWHPSHUDWXUDVGHODHVWXIDVHLQFUHPHQWDQFRQHOQ~PHUR
GHXQLGDGHVGHVXSHUILFLHTXHVHHQFXHQWUDQHQFHQGLGDV&RQ
RXQLGDGHVHQFHQGLGDVODVWHPSHUDWXUDVGHODVXSHUILFLH
VRQDOWDV6LHPSUHWHQJDFXLGDGRDOWRFDUODHVWXID
Nunca cocine directamente sobre el vidrio.
Siempre utilice recipientes de cocción.
Siempre coloque el recipiente en el centro
de la unidad de superficie sobre la que
está cocinando.
No deslice los recipientes de cocción a través
del control y la superficie de la estufa porque
puede rayar el vidrio. El vidrio es resistente a
los rayones, pero no a prueba de los mismos.
Consejos para Productos Enlatados en el Hogar
$VHJ~UHVHTXHHOSURGXFWRHQODWDGRVHHQFXHQWUHVREUHOD
XQLGDGVXSHUILFLDO
$VHJ~UHVHGHTXHHOSURGXFWRHQODWDGRVHDSODQRHQVXSDUWH
LQIHULRU
3DUDHYLWDUTXHPDGRUDVGHYDSRURFDORUWHQJDFXLGDGRDO
HQODWDUHOSURGXFWR
49-80747
8VHUHFHWDV\SURFHGLPLHQWRVGHIXHQWHVFRQILDEOHV(VWRV
VHHQFXHQWUDQGLVSRQLEOHVDWUDYpVGHIDEULFDQWHVFRPR%DOO®
\.HUU®\HO'HSDUWPHQWRI$JULFXOWXUH([WHQVLRQ6HUYLFH
6HUYLFLRGHO'HSDUWDPHQWRGH$JULFXOWXUD (OXVRGHHQODWDGRVFHUUDGRVDEDxRPDUtDFRQIRQGRV
RQGHDGRVSRGUiQH[WHQGHUHOWLHPSRUHTXHULGRSDUDWUDHUHO
DJXDDOSXQWRGHKHUYRU
USO DE LA PLACA DE COCCIÓN: Estufa de Vidrio Radiante / Consejos para Productos Enlatados en el Hogar
Estufa de Vidrio Radiante
7
USO DE LA PLACA DE COCCIÓN: Utensilio para Placa de Cocción para Vidrio Radiante / Para mejores resultados
8
Utensilio para Placa de Cocción para Vidrio Radiante
/DVLJXLHQWHLQIRUPDFLyQORD\XGDUiDHOHJLUORVUHFLSLHQWHVGHFRFFLyQTXHEULQGDQXQEXHQ
GHVHPSHxRHQHVWXIDVGHYLGULR
Acero inoxidable:
Esmalte de porcelana sobre acero:
5HFRPHQGDGR
1RVHUHFRPLHQGD
&DOHQWDUUHFLSLHQWHVYDFtRVSXHGHSURYRFDUGDxRV
SHUPDQHQWHVDOYLGULRGHODVHVWXIDV(OHVPDOWH
Verifique que los recipientes
SXHGHGHUUHWLUVH\DGKHULUVHDODHVWXIDFHUiPLFD tengan bases planas
Aluminio:
6HUHFRPLHQGDGHFDSDJUXHVD
%XHQDFRQGXFWLYLGDG/RVUHVLGXRVGHDOXPLQLR
DYHFHVSDUHFHQUD\RQHVVREUHODHVWXIDSHUR
SXHGHQTXLWDUVHVLVHORVOLPSLDGHLQPHGLDWR
'HELGRDVXEDMRSXQWRGHIXVLyQQRGHEH
XWLOL]DUVHDOXPLQLRGHFDSDILQD
Base de cobre:
5HFRPHQGDGR
(OFREUHSXHGHGHMDUUHVLGXRVTXHSXHGHQ
SDUHFHUUD\RQHV/RVUHVLGXRVSXHGHQHOLPLQDUVH
VLHPSUH\FXDQGRODHVWXIDVHOLPSLHGH
LQPHGLDWR6LQHPEDUJRQRSHUPLWDTXHHVWDV
ROODVKLHUYDQHQVHFR(OPHWDOVREUHFDOHQWDGR
SXHGHDGKHULUVHDODVHVWXIDVGHYLGULR6LQR
VHHOLPLQDGHLQPHGLDWRXQDROODFRQODEDVH
GHFREUHVREUHFDOHQWDGRGHMDUiXQUHVLGXRTXH
PDQFKDUiODHVWXIDHQIRUPDSHUPDQHQWH
utilizando una regla.
Vidrio-cerámico:
1RVHUHFRPLHQGD
'HVHPSHxRSREUH5D\DODVXSHUILFLH
Cerámica:
1RVHUHFRPLHQGD
'HVHPSHxRSREUH3XHGHUD\DUODVXSHUILFLH
Hierro fundido:
1RVHUHFRPLHQGDDPHQRVTXHVHHQFXHQWUH
HVSHFtILFDPHQWHGLVHxDGRSDUDHVWXIDVGHYLGULR
3REUHFRQGXFWLYLGDG\OHQWLWXGSDUDDEVRUEHUHO
FDORU5D\DODVXSHUILFLHGHODHVWXID
Esmalte de porcelana sobre hierro
fundido:
6HUHFRPLHQGDVLODEDVHGHODROODVHHQFXHQWUD
UHYHVWLGD
No se recomiendan
recipientes con bases
redondeadas, curvadas, con
rebordes o torceduras..
NOTA:6LJDWRGDVODVUHFRPHQGDFLRQHVGHOIDEULFDQWHGHUHFLSLHQWHVFXDQGRXWLOLFHFXDOTXLHUFODVHGHUHFLSLHQWHGHFRFFLyQ
VREUHODHVWXIDFHUiPLFD
Para Mejores Resultados
Ŷ &RORTXHVyORUHFLSLHQWHVVHFRVVREUHORVHOHPHQWRVGH
VXSHUILFLH1RFRORTXHWDSDVVREUHORVHOHPHQWRVGH
VXSHUILFLHHQHVSHFLDOWDSDVPRMDGDV/DVROODV\WDSDV
PRMDGDVSRGUiQTXHGDUDGKHULGDVDODVXSHUILFLHXQD
YH]IUtDV
Ŷ 1RXVHZRNVFRQDQLOORVGHVRSRUWH(VWDFODVHGHZRNQR
VHFDOLHQWDVREUHHOHPHQWRVGHVXSHUILFLHGHYLGULR
Ŷ 5HFRPHQGDPRVHOXVRGHZRNVGHEDVHSODQD
VRODPHQWH6HHQFXHQWUDQGLVSRQLEOHVHQVXQHJRFLR
PLQRULVWDORFDO/DEDVHGHOZRNGHEHWHQHUHOPLVPR
GLiPHWURTXHHOHOHPHQWRGHVXSHUILFLHSDUDDVHJXUDUXQ
FRQWDFWRDGHFXDGR
Ŷ $OJXQRVSURFHGLPLHQWRVGHFRFFLyQHVSHFLDOHVUHTXLHUHQ
UHFLSLHQWHVGHFRFFLyQHVSHFtILFRVFRPRROODVDSUHVLyQ
IUHLGRUDVHWF7RGRVORVUHFLSLHQWHVGHFRFFLyQGHEHQWHQHU
EDVHVSODQDV\VHUGHOWDPDxRFRUUHFWR
No coloque recipientes mojados sobre la
estufa de vidrio.
No use woks con anillos de soporte sobre la
estufa de vidrio.
Utilice woks de base plana sobre la estufa
de vidrio.
49-80747
/RVHOHPHQWRVGHODVXSHUILFLHUHDOL]DUiQFLFORVGHHQFHQGLGR\DSDJDGR
SDUDPDQWHQHUODWHPSHUDWXUDTXHVHOHFFLRQy7RGRVORVHOHPHQWRV
GHODVXSHUILFLHUDGLDQWHFXHQWDQFRQXQOLPLWDGRUGHWHPSHUDWXUDTXH
HYLWDTXHODSODFDGHFRFFLyQGHYLGULRVHFDOLHQWHGHPDVLDGRORFXDO
HVQRUPDO(VSRVLEOHTXHHOOLPLWDGRUGHWHPSHUDWXUDUHDOLFHFLFORVGH
DSDJDGRGHORVHOHPHQWRVFRQPiVIUHFXHQFLDVL
Ŷ
Ŷ
Ŷ
Ŷ
/DROODKLHUYHKDVWDVHFDUVH
(
OIRQGRGHODROODQRHVSODQR
/DROODHVWiIXHUDGHOFHQWUR
1RKD\ROODHQHOHOHPHQWR
Uso de los Elementos de Cocción
(QFLHQGDHO4XHPDGRU HV 0DQWHQJDSUHVLRQDGDODWHFODOn/
Off (Encendido/ Apagado)GXUDQWHDSUR[LPDGDPHQWHPHGLR
VHJXQGR6HSRGUiHVFXFKDUXQUHSLTXHFDGDYH]TXHVH
SUHVLRQHXQDWHFOD
(OQLYHOGHSRWHQFLDSXHGHVHUVHOHFFLRQDGRGHFXDOTXLHUDGH
ODVVLJXLHQWHVIRUPDV
Luces
LED
Deslice su dedo sobre el arco gris HQORVJUiILFRV KDVWDHO
QLYHOGHSRWHQFLDGHVHDGRNo hay sensor en las luces LEDR
Presione En Cualquier ParteGHODUFRJULVR
Área de Paso de Arcos Grises
Área de
Paso de
Arcos Grises
3UHVLRQHODVWHFODV+R–SDUDDMXVWDUHOQLYHOGHSRWHQFLD
R
$WDMRKDVWD+L $OWR LQPHGLDWDPHQWHOXHJRGHHQFHQGHUOD
XQLGDGSUHVLRQHODWHFOD+R
$WDMRKDVWD/RZ %DMR ,QPHGLDWDPHQWHOXHJRGHHQFHQGHU
ODXQLGDGSUHVLRQHODWHFOD-
Ajuste del Tamaño del Quemador
(OWDPDxRGHODQLOORGHOTXHPDGRUHVDMXVWDEOHDDOJXQRV
HOHPHQWRV(OWDPDxRGHODQLOORSXHGHVHUVHOHFFLRQDGR
SUHVLRQDQGRHOJUiILFRGHODQLOORGHOTXHPDGRU
49-80747
Elemento de la
Superficie Individual
Elemento de la
Superficie Dual
Elemento de la Superficie
con Tres Anillos
USO DE LA PLACA DE COCCIÓN: Ciclos de los Elementos / Uso de los Elementos de Cocción / Ajuste del Tamaño del Quemador
Ciclos de los Elementos
9
USO DE LA PLACA DE COCCIÓN: Apague el Quemador(es) / Selección de las Configuraciones de la Placa de Cocción/ Cómo Sincronizar los Elementos Izquierdos
10
Apague el Quemador(es)
3UHVLRQHODWHFODOn/Off (Encender/ Apagar)SDUDXVDU
XQTXHPDGRULQGLYLGXDORSUHVLRQHODWHFODAll Off (Todo
Apagado)
Selección de las Configuraciones de la Placa de Cocción
(OLMDHOHOHPHQWRTXHPDGRUTXHPHMRUVHDGHFXHDOWDPDxR
GHOXWHQVLOLR&DGDHOHPHQWRTXHPDGRUGHVXQXHYDSODFDGH
FRFFLyQFXHQWDFRQVXVSURSLRVQLYHOHVGHSRWHQFLDGHVGHEDMR
KDVWDDOWR/DVFRQILJXUDFLRQHVGHOQLYHOGHSRWHQFLDQHFHVDULD
SDUDODFRFFLyQYDUtDQGHSHQGLHQGRGHOXWHQVLOLRXVDGRHO
WLSR\FDQWLGDGGHFRPLGD\HOUHVXOWDGRGHVHDGR(QJHQHUDO
XVHODVFRQILJXUDFLRQHVEDMDVSDUDGHUUHWLUPDQWHQHURKHUYLU
DIXHJROHQWR\XVHODVFRQILJXUDFLRQHVDOWDVSDUDFDOHQWDU
UiSLGRVRDVDU\IUHtU$OPDQWHQHUODVFRPLGDVFDOLHQWHV
FRQILUPHTXHODFRQILJXUDFLyQVHOHFFLRQDGDHVVXILFLHQWHSDUD
PDQWHQHUODWHPSHUDWXUDGHODFRPLGDSRUHQFLPDGHORVž)
3DUDGHUUHWLUQRVHUHFRPLHQGDHOXVRGHORVHOHPHQWRVPiV
JUDQGHV\GHDTXHOORVFRQODPDUFD³0DQWHQHU&DOLHQWH´
+L $OWR HVHOQLYHOGHSRWHQFLDPiVDOWRGLVHxDGRSDUD
FRFLQDU\KHUYLUFDQWLGDGHVJUDQGHVGHIRUPDUiSLGD+L $OWR IXQFLRQDUiGXUDQWHXQWLHPSRPi[LPRGHPLQXWRV+L
$OWR SXHGHVHUUHSHWLGROXHJRGHOFLFORLQLFLDOGHPLQXWRV
SUHVLRQDQGRODWHFOD+
PRECAUCIÓN:
Hi (Alto)
hervir rápido
freir
1RFRORTXHQLQJ~QXWHQVLOLR
FXELHUWRQLGHMHGHUUDPHV
H[FHVLYRVGHDJXDHQODVWHFODV
GHOFRQWURO'HHVWDUSUHVHQWH
SRUYDULRVVHJXQGRVHVWRSRGUi
KDFHUTXHODVWHFODVWiFWLOHVQR
UHVSRQGDQ\TXHVHDSDJXHOD
VXSHUILFLHGHFRFFLyQ
soasar
reducir
hervir lento
mantener
Low (Bajo)
derretir
Cómo Sincronizar los Elementos Izquierdos
Para Encender
Para Apagar
0DQWHQJDODWHFODSync Burners (Quemadores Sincronizados)
SRUDSUR[LPDGDPHQWHPHGLRVHJXQGRSDUDFRQHFWDUORVGRV
TXHPDGRUHV8WLOLFHFXDOTXLHUDGHHVWRVHOHPHQWRVFRPRVH
GHVFULEHHQODSiJLQDSDUDDMXVWDUHOQLYHOGHSRWHQFLD
3UHVLRQHODWHFODOn/ Off (Encender/ Apagar)GHXQRGH
ORVTXHPDGRUHVSDUDDSDJDUODIXQFLyQSync Burners
(Quemadores Sincronizados)
R
3UHVLRQHSync Burners (Quemadores Sincronizados)
SDUDDSDJDUDPERVTXHPDGRUHV
49-80747
Bloquear
3UHVLRQHODWHFOD&RQWURO/RFN %ORTXHRGHO&RQWURO SRU
VHJXQGRV
Indicador/ Símbolo del
Bloqueo del Control
Desbloquear
3UHVLRQHODWHFODControl Lock (Bloqueo del Control)
QXHYDPHQWHSRUVHJXQGRV
&RQVXOWHODVHFFLyQ&XVWRP6HWWLQJV &RQILJXUDFLRQHV
(VSHFLDOHV SDUDDFWLYDUODIXQFLyQ$XWR/RFN %ORTXHR
$XWRPiWLFR Bloqueo de la Placa de Cocción: bloquea
el funcionamiento de los controles
Temporizador Único de la Cocina
Para Encender
Para Apagar
3UHVLRQHODWHFODTimer Select (Seleccionar Temporizador)
3UHVLRQHODVIOHFKDV೸RVSDUDHOHJLUHOQ~PHURGHVHDGR
GHPLQXWRV(OWHPSRUL]DGRUVHLQLFLDDXWRPiWLFDPHQWH
VHJXQGRVGHSXpVGHWRFDUODWHFOD/DOX]/('³21´
(QFHQGHU DSDUHFHUiGHIRUPDDXWRPiWLFDXQDYH]
FRQILJXUDGRHOWHPSRUL]DGRU
0DQWHQJDSUHVLRQDGDODWHFODTimer Select (Seleccionar
Temporizador)GXUDQWHVHJXQGRVSDUDFDQFHODUHO
WHPSRUL]DGRU/DDODUPDVRQDUiGHIRUPDFRQWLQXDXQD
YH]ILQDOL]DGRHOWLHPSRKDVWDTXHHOXVXDULRDSDJXHHO
WHPSRUL]DGRU
49-80747
NOTA: 8VHHOWHPSRUL]DGRUGHODFRFLQDSDUDPHGLUHOWLHPSR
GHFRFFLyQRFRPRUHFRUGDWRULR(OWHPSRUL]DGRUGHODFRFLQD
QRFRQWURODORVHOHPHQWRVGHFRFFLyQ(OWHPSRUL]DGRUVH
DSDJDVLQRKD\DFWLYLGDGSRUVHJXQGRV
USO DE LA PLACA DE COCCIÓN: Bloqueo de la Placa de Cocción/ Temporizador Único de la Cocina
Bloqueo de la Placa de Cocción
11
USO DE LA PLACA DE COCCIÓN: Temporizadores Múltiples/ Indicador Luminoso de Calor
12
Temporizadores Múltiples
Modo de Temporizador
3DUDPiVLQIRUPDFLyQFRQVXOWH&RQILJXUDFLRQHV(VSHFLDOHVHQ
ODVHFFLyQGHO0RGRGH7HPSRUL]DGRUSDUDDFFHGHUDODIXQFLyQ
GH7HPSRUL]DGRU0~OWLSOH&DGDTXHPDGRUSXHGHVHUFRQHFWDGR
FRQXQWHPSRUL]DGRU(OTXHPDGRUGHEHHVWDUHQFHQGLGRSDUD
FRQILJXUDUHOWHPSRUL]DGRU&XDQGRPiVGHXQTXHPDGRU
HVWpHQFHQGLGRHORUGHQGHOWHPSRUL]DGRUVHUiGHL]TXLHUGDD
GHUHFKD
Para Encender Múltiples Quemadores
3UHVLRQHODWHFODTimer Select (Seleccionar
Temporizador)(OQLYHOGHSRWHQFLDGHOTXHPDGRU
FRUUHVSRQGLHQWH\ODSDQWDOODWLWLODUiQ3UHVLRQHODVIOHFKDV
೸RVSDUDDMXVWDUHOWHPSRUL]DGRU6LQRKD\PiVDFFLRQHV
HOWHPSRUL]DGRUVHLQLFLDGHIRUPDDXWRPiWLFDOXHJRGH
VHJXQGRV/DOX]/('³21´ (QFHQGHU VHLOXPLQDUiFXDQGR
HOWHPSRUL]DGRUHVWpHQFHQGLGR
3DUDFRQILJXUDUHOWHPSRUL]DGRUGHOVLJXLHQWH
TXHPDGRUSUHVLRQHODWHFODTimer Select (Seleccionar
Temporizador)(OQLYHOGHSRWHQFLDGHOTXHPDGRU
FRUUHVSRQGLHQWH\ODSDQWDOODWLWLODUiQ3UHVLRQHODVIOHFKDV
೸RVSDUDDMXVWDUHOWHPSRUL]DGRU6LQRKD\PiVDFFLRQHV
HOWHPSRUL]DGRUVHLQLFLDGHIRUPDDXWRPiWLFDOXHJRGH
VHJXQGRV/DOX]/('³21´ (QFHQGHU VHLOXPLQDUiFXDQGR
HOWHPSRUL]DGRUHVWpHQFHQGLGR5HSLWDHVWRVSDVRVFRQORV
WHPSRUL]DGRUHVUHVWDQWHV
Para Apagar Múltiples Quemadores
0DQWHQJDSUHVLRQDGDODWHFODTimer Select (Seleccionar
Temporizador)GXUDQWHVHJXQGRVSDUDFDQFHODUHO
WHPSRUL]DGRU(OQLYHOGHSRWHQFLDGHOTXHPDGRUFRUUHVSRQGLHQWH
\ODSDQWDOODWLWLODUiQ&XDQGRORVWLHPSRVGHOTXHPDGRUILQDOL]DQ
VXWHPSRUL]DGRUFRUUHVSRQGLHQWHWDPELpQILQDOL]D
Nivel de Potencia del Quemador
Pantalla
Indicador Luminoso de Calor
8QDOX]LQGLFDGRUDGHVXSHUILFLHFDOLHQWH XQDSDUDFDGD
HOHPHQWRGHFRFFLyQ EULOODUiFXDQGRODVXSHUILFLHGHYLGULR
HVWpFDOLHQWH\SHUPDQHFHUiHQFHQGLGDKDVWDTXHOD
VXSHUILFLHKD\DEDMDGRVXWHPSHUDWXUDKDVWDXQDWHPSHUDWXUD
TXHVHDVHJXUDDOWDFWR
Luz Indicadora de Superficie Caliente
49-80747
0
DQWHQJDSUHVLRQDGDODWHFODAll Off (Apagar Todo)
GXUDQWHVHJXQGRV/XHJRGHIRUPDLQPHGLDWDPDQWHQJD
SUHVLRQDGDODWHFODTimer Select (Selección de Tiempo)
GXUDQWHVHJXQGRVSDUDLQJUHVDUODV&RQILJXUDFLRQHV
(VSHFLDOHV(VDVGRVWHFODVGHEHQVHUSUHVLRQDGDVGHQWUR
GHORVVHJXQGRV&XDOTXLHURWUDWHFODFDQFHODUiHOPRGR
³&´DSDUHFHHQODSDQWDOOD3DUDQDYHJDUDWUDYpVGHOD
IXQFLyQ&XVWRP6HWWLQJV &RQILJXUDFLRQHV(VSHFLDOHV XVH
ODVWHFODV೸ DUULED RV DEDMR 6L೸ DUULED HVVHOHFFLRQDGR
HOFLFORGHODSDQWDOODVHLQLFLDHQ³&´6LV DEDMR HV
VHOHFFLRQDGRHOFLFORGHODSDQWDOODVHLQLFLDHQ³&´
3DUDDFWLYDUXQDQXHYD&RQILJXUDFLyQ(VWiQGDUHOXVXDULR
GHEHUiPDQWHQHUSUHVLRQDGDODWHFODTimer Select
(Selección del Temporizador)GXUDQWHVHJXQGRV6yOR
81$GHODV2SFLRQHVGH&RQILJXUDFLRQHV(VSHFLDOHVSXHGH
VHUDFWLYDGDSDUDFDGD&RQILJXUDFLyQ(VWiQGDU(O/('URMR
³2Q´ (QFHQGLGR VHHQFHQGHUi\XQVRQLGRVHDSDJDUi
XQDYH]DFWLYDGDODQXHYDFRQILJXUDFLyQHVWiQGDU
/DSODFDGHFRFFLyQVDOGUiGHODV&RQILJXUDFLRQHV
(VSHFLDOHVVLTXHGDLQDFWLYDGXUDQWHPLQXWRV
3DUDVDOLUGHODV&RQILJXUDFLRQHV(VSHFLDOHV\JXDUGDU
FXDOTXLHUFDPELRPDQWHQJDSUHVLRQDGDODWHFODAll Off
(Todo Apagado)GXUDQWHVHJXQGRV
Cuadro de Configuraciones Especiales
Configuraciones Especiales
Elecciones de Configuración Estándar
C0 (Configuraciones de Fábrica)
C01 - 5HLQLFLRGH)iEULFD %RUUDODV&RQILJXUDFLRQHV(VSHFLDOHV\UHVWDXUDODVFRQILJXUDFLRQHVRULJLQDOHV C02 - &RQILJXUDFLRQHV(VSHFLDOHVDFWLYDGDV 1RYLVLEOHDPHQRVTXHRWUDFRQILJXUDFLyQHVWiQGDUVHD
VHOHFFLRQDGD<DXWRPiWLFDPHQWHVHHQFLHQGHFXDQGRFXDOTXLHURWUDFRQILJXUDFLyQHVWiQGDUHVVHOHFFLRQDGD1R
SXHGHVHUVHOHFFLRQDGDSRUHOXVXDULR C1 (Bloqueo del Control)
C11 - %ORTXHR(VWiQGDU HVGHFLU6yORFXDQGRHOERWyQGHEORTXHRHVSUHVLRQDGRGXUDQWHVHJXQGRV 6LVH
XVDUiXQWHPSRUL]DGRU&RQWURO/RFN %ORTXHRGHO&RQWURO QRHVWiGLVSRQLEOH
C12 - $XWR/RFN %ORTXHR$XWRPiWLFR HVGHFLUVHDSOLFDOXHJRGHTXHODSODFDGHFRFFLyQKD\DHVWDGRHQHO
PRGRGHHVSHUDGXUDQWHPLQXWRV /DXQLGDGGHEHUiHVWDUFRPSOHWDPHQWHDSDJDGDSDUDHVWDUHQ$XWR/RFN
%ORTXHR$XWRPiWLFR C2 (Nivel de la luz LED)
C21 - ,OXPLQDFLyQ&RPSOHWD
C22 - ,OXPLQDFLyQ0HGLD
C23 - ,OXPLQDFLyQ0iV%DMD
C3 (Volumen del Sonido del Botón)
C31 - 7RGRVORVVRQLGRVHVWiQDFWLYDGRVDO 3DUDORVVRQLGRVGHDODUPD FXDOTXLHUQLYHOTXHHVWp
FRQILJXUDGRHQF
C32 - (OQLYHOGHVRQLGRGHOERWyQHVUHGXFLGRHQXQORVVRQLGRVGHDODUPDVDO
C33 - 6RQLGRVGHORVERWRQHVGHVDFWLYDGRVORVVRQLGRVGHODVDODUPDVHVWiQDFWLYDGRVDO
C4 (Volumen de Sonido de la
Alarma del Temporizador)
C41 - $OWR
C5 (Duración de la Alarma
del Temporizador)
C51 - ,QGHILQLGR HVGHFLUODDODUPDFRQWLQ~DKDVWDTXHVHDGHVDFWLYDGDSRUHOXVXDULR UTILISATION DE LA TABLE DE CUISSON: Configuraciones Especiales
Configuraciones Especiales
C42 - %DMR
C52 - /DDODUPDVXHQDGXUDQWHVHJXQGRV
C53 - /DDODUPDVXHQDGXUDQWHVHJXQGRV
C54 - /DDODUPDVXHQDGXUDQWHVHJXQGRV
C6 (Modo del Temporizador)
C61 - 7HPSRUL]DGRUFRQXQD6ROD&RFLQD ,QGHSHQGLHQWHGHORVHOHPHQWRV C62 - 7HPSRUL]DGRU0~OWLSOH $MXVWDGRDFDGDHOHPHQWR
/DVRSFLRQHVHQJULDVVRQFRQILJXUDFLRQHVSRURPLVLyQ
49-80747
13
USO DE LA PLACA DE COCCIÓN: Plancha
14
Plancha (accesorio opcional)
Uso de la Plancha
PRECAUCIÓN
Peligro De Quemaduras
Ŷ Las superficies de la plancha pueden estar lo suficientemente calientes como para provocar quemaduras durante
y después del uso. Coloque y quite la plancha cuando esté fría y todas las unidades de superficie estén apagadas.
Utilice agarraderas si toca la plancha cuando está caliente. No hacerlo puede provocar quemaduras.
Ŷ Coloque y retire la plancha sólo cuando todas las parrillas y la plancha estén frías y todas las unidades superficiales
estén en OFF (Apagado).
$QWHVGHXWLOL]DUHVWHUHFLSLHQWHGHFRFFLyQSRUSULPHUDYH]OiYHORSDUDDVHJXUDUVHGHTXHHVWpOLPSLR/XHJRF~UHOROLJHUDPHQWH
IURWDQGRDFHLWHGHFRFFLyQVREUHODVXSHUILFLHGHFRFFLyQ
Cómo Colocar La Plancha
IMPORTANTE:6LHPSUHFRORTXH\XWLOLFHODSODQFKDHQOD
XELFDFLyQGHVLJQDGDVREUHODHVWXID
Tipo de Comida
&yPR&DOHQWDU7RUWLOODV
3DQTXHFDV
+DPEXUJXHVDV
+XHYRV)ULWRV
(PEXWLGRVSDUDHO'HVD\XQR
6iQGZLFKHV&DOLHQWHV 7DOHV
FRPRFRQ4XHVRDOD3ODQFKD
Configuración de Cocción
0HG%DMR 0HG/R
0HG%DMR 0HG/R
0HG
0HG%DMR 0HG/R
0HG
0HG%DMR 0HG/R
/DVFRQILJXUDFLRQHVGHODSODQFKDIXQFLRQDQFRPRXQDJXtD\
SXHGHVHUQHFHVDULRDMXVWDUODVHQEDVHDODVSUHIHUHQFLDVGH
FRFFLyQLQGLYLGXDO
Funcionamiento de la Plancha
NOTAS IMPORTANTES:
Ŷ /LPSLHODSODQFKDFRQXQDHVSRQMD\GHWHUJHQWHVXDYHHQ
DJXDWLELD12XWLOLFHHVSRQMLOODVGHIUHJDUD]XOHVRYHUGHV
RODQDGHDFHUR
Ŷ 1RFRFLQHDOLPHQWRVH[WUHPDGDPHQWHJUDVRVRV\WHQJD
FXLGDGRFRQORVGHUUDPHVGHJUDVDPLHQWUDVFRFLQD
Ŷ 1XQFDFRORTXHRDOPDFHQHHOHPHQWRVVREUHODSODQFKD
D~QFXDQGRQRHVWpHQXVR/DSODQFKDSXHGHFDOHQWDUVH
FXDQGRVHXWLOL]DQODVXQLGDGHVGHVXSHUILFLHFHUFDQDV
Ŷ 1RXVHXWHQVLOLRVPHWiOLFRVFRQSXQWDVDILODGDVRERUGHV
iVSHURVSRUTXHSXHGHQGDxDUODSODQFKD1RFRUWH
DOLPHQWRVVREUHODSODQFKD
Ŷ 1RXVHUHFLSLHQWHVGHFRFFLyQSDUDHODOPDFHQDPLHQWRGH
DOLPHQWRVRDFHLWH3XHGHQSURYRFDUVHPDQFKDV\RJULHWDV
SHUPDQHQWHV
Ŷ /DSODQFKDLUiSHUGLHQGRHOFRORUFRQHOWLHPSRGHELGRDOXVR
Ŷ 1ROLPSLHODSODQFKDHQHOKRUQRDXWROLPSLDQWH
Ŷ 6LHPSUHHVSHUHDTXHHOUHFLSLHQWHGHFRFFLyQVHHQIUtH
DQWHVGHVXPHUJLUORHQDJXD
Ŷ 1RVREUHFDOLHQWHODSODQFKD
3DUDHQFHQGHUODVXQLGDGHVGHODVXSHUILFLHGHWRGDOD
SODQFKDXVHODIXQFLyQGHOFRQWUROGH6\QF%XUQHU 4XHPDGRU
6LQFURQL]DGR 3UHVLRQHODWHFODSync Burner (Quemador
Sincronizado)\OXHJRDMXVWHHOQLYHOGHSRWHQFLDDOD
FRQILJXUDFLyQGHVHDGDFRPRVHGHVFULEHHQODSiJLQD
49-80747
Limpieza Normal De Uso Diario
8VHOLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$%5<7(®HQVX
HVWXIDGHYLGULR
3DUDPDQWHQHU\SURWHJHUODVXSHUILFLHGHVXHVWXIDGHYLGULR
VLJDHVWRVSDVRV
$QWHVGHXVDUODHVWXIDSRUSULPHUDYH]OtPSLHORFRQ
OLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$%5<7(®(VWR
D\XGDDSURWHJHUODHVWXID\KDFHODOLPSLH]DPiVVHQFLOOD
(OXVRGLDULRGHOOLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$
%5<7(®D\XGDUiDPDQWHQHUHODUWHIDFWRFRPRQXHYR
6DFXGDELHQODFUHPDGHOLPSLH]D$SOLTXHXQDVJRWDV
GHOLPSLDGRUGHHVWXIDVGHFHUiPLFD&(5$0$%5<7(®
GLUHFWDPHQWHVREUHODHVWXID
8WLOLFHXQDWRDOODGHSDSHORXQSDxR
GHOLPSLH]DSDUDHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®SDUDOLPSLDUWRGD
ODVXSHUILFLHGHODHVWXID
8VHXQSDxRVHFRRXQDWRDOODGH
SDSHOSDUDTXLWDUORVUHVWRVGHO
OLPSLDGRU1RKDFHIDOWDHQMXDJDU
NOTA:(VPX\LPSRUWDQWHTXH12
&$/,(17(ODHVWXIDKDVWDTXHORKD\D
OLPSLDGRSRUFRPSOHWR
Limpie la estufa después
de cada derrame. Utilice
el limpiador de estufas de
cerámica CERAMA BRYTE®.
Residuos Pegados
NOTA:8VWHGSXHGHGDxDUODVXSHUILFLHGHYLGULRVLXWLOL]D
HVSRQMLOODVTXHQRVHDQODVUHFRPHQGDGDV
'HMHHQIULDUODHVWXID
&RORTXHXQDVJRWDVGHOLPSLDGRUGHHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®VREUHWRGDHOiUHDGHUHVLGXRVSHJDGRV
8WLOL]DQGRHOSDxRGHOLPSLH]DSDUDHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®LQFOXLGDIURWHHOiUHDVXFLDDSOLFDQGR
SUHVLyQVHJ~QVHDQHFHVDULR
6LTXHGDQUHVWRVUHSLWDORVSDVRVLQGLFDGRVFRQ
DQWHULRULGDG
3DUDSURWHFFLyQDGLFLRQDOGHVSXpVGHKDEHUTXLWDGRWRGRV
ORVUHVWRVSXODWRGDODVXSHUILFLHFRQOLPSLDGRUGHHVWXIDV
GHFHUiPLFD&(5$0$%5<7(®\XQDWRDOODGHSDSHO
Utilice un paño de limpieza para estufas de cerámica
CERAMA BRYTE®.
Residuos Pegados Rebeldes
'HMHHQIULDUODHVWXID
8WLOLFHODUDVTXHWDGHILOR~QLFRDXQiQJXORDSUR[LPDGR
GHƒFRQWUDODVXSHUILFLHGHOYLGULR\UDVTXHODVXFLHGDG
3XHGHVHUQHFHVDULRDSOLFDUSUHVLyQDODUDVTXHWDSDUD
TXLWDUODVXFLHGDG
'HVSXpVGHUDVFDUFRQODUDVTXHWDGHILORFRORTXH
XQDVJRWDVGHOLPSLDGRUGHHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®VREUHHOiUHDGHVXFLHGDGTXHPDGD
8WLOLFHHOSDxRGHOLPSLH]DSDUDHVWXIDVGHFHUiPLFD
&(5$0$%5<7(®SDUDTXLWDUODVXFLHGDGUHVWDQWH
3DUDSURWHFFLyQDGLFLRQDOGHVSXpVGHKDEHUTXLWDGRWRGRV
ORVUHVWRVSXODWRGDODVXSHUILFLHFRQOLPSLDGRUGHHVWXIDV
GHFHUiPLFD&(5$0$%5<7(®\XQDWRDOODGHSDSHO
49-80747
CUIDADO Y LIMPIEZA: Cómo Limpiar la Estufa de Vidrio
Cómo Limpiar la Estufa de Vidrio
La rasqueta de estufas de cerámica CERAMA BRYTE® y todos los
insumos recomendados se encuentran disponibles en nuestro
Centro de Repuestos. Ver instrucciones bajo la sección “Para solicitar
repuestos” en la página siguiente.
NOTA: No utilice hojas desafiladas o dañadas.
15
CUIDADO Y LIMPIEZA: Cómo Limpiar la Estufa de Vidrio
16
Cómo Limpiar la Estufa de Vidrio
Marcas De Metal Y Rayones
7HQJDFXLGDGRGHQRGHVOL]DUROODV\VDUWHQHVDWUDYpVGHVX
HVWXID'HMDUiPDUFDVGHPHWDOVREUHODVXSHUILFLHGHODHVWXID
(VWDVPDUFDVSXHGHQTXLWDUVHXWLOL]DQGRHOOLPSLDGRUGH
HVWXIDVGHFHUiPLFD&(5$0$%5<7(®FRQHOSDxRGH
OLPSLH]DSDUDHVWXIDVGHFHUiPLFD&(5$0$%5<7(®
6
LVHSHUPLWHTXHROODVFRQXQDFDSDILQDGHDOXPLQLR
RFREUHKLHUYDQHQVHFRODFDSDSXHGHGHMDUXQD
GHFRORUDFLyQQHJUDHQODHVWXID
(VWRGHEHTXLWDUVHGHLQPHGLDWRDQWHVGHFDOHQWDUGH
QXHYRRODGHFRORUDFLyQSXHGHOOHJDUDVHUSHUPDQHQWH
NOTAS:9HULILTXHFRQFXLGDGRTXHODEDVHGHODVROODVQRVHD
iVSHUDSDUDQRUD\DUODHVWXID
Daños por derrames azucarados y plástico derretido
6HGHEHUiWHQHUHVSHFLDOFXLGDGRDOUHWLUDUVXVWDQFLDVFDOLHQWHVa fin de evitar daños permanentes sobre la superficie
de vidrio./RVGHUUDPHVGHSURGXFWRVD]XFDUDGRV WDOHVFRPRJHODWLQDVFDUDPHORFRQD]~FDUGXOFHV\MDUDEHV RSOiVWLFRV
PH]FODGRVSXHGHQKDFHUTXHVHSLTXHODVXSHUILFLHGHVXSODFDGHFRFFLyQ QRFXELHUWRSRUODJDUDQWtD DPHQRVTXHHOGHUUDPH
VHDHOLPLQDGRFXDQGRD~QHVWpFDOLHQWH6HGHEHWHQHUHVSHFLDOFXLGDGRDOUHWLUDUVXVWDQFLDVFDOLHQWHV
$VHJ~UHVHGHXVDUXQDHVSiWXODQXHYD\FRQILOR
1RXVHXQDKRMDGHVDILODGDRURWD
$
SDJXHWRGRVORVHOHPHQWRVGHVXSHUILFLH4XLWHODVROODV
FDOLHQWHV
8WLOL]DQGRXQJXDQWHGHFRFLQD
D8VHXQDUDVTXHWDGHILOR~QLFR UDVTXHWDSDUDHVWXIDV
GHFHUiPLFD&(5$0$%5<7(® SDUDGHVSOD]DUHO
GHUUDPHDXQiUHDIUtDVREUHODHVWXID
E4XLWHHOGHUUDPHFRQWRDOODVGHSDSHO
&
XDOTXLHUGHUUDPHUHVWDQWHGHEHGHMDUVHKDVWDTXHOD
VXSHUILFLHGHODHVWXIDVHKD\DHQIULDGR
1RXVHORVHOHPHQWRVGHVXSHUILFLHGHQXHYRKDVWDTXH
WRGRVORVUHVWRVVHKD\DTXLWDGRSRUFRPSOHWR
NOTA:6LODVXSHUILFLHGHYLGULR\DKDVXIULGRPDUFDVR
KHQGLGXUDVHOYLGULRGHODHVWXIDGHEHUiUHHPSOD]DUVH(QHVWH
FDVRVHUiQHFHVDULDODDWHQFLyQGHXQWpFQLFR
49-80747
Notas
49-80747
17
Notas
18
49-80747
Notas
49-80747
19
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
20
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite
solicitar reparaciones.6LVHSURGXFHXQHUURUHQHOIXQFLRQDPLHQWRGHOFRQWUROXQFyGLJRGHIDOODWLWLODUiHQODSDQWDOOD
5HJLVWUHHOFyGLJRGHHUURU\OODPHDOVHUYLFLRWpFQLFR
Problema
Causa Posible
Qué Hacer
Los elementos de
superficie no mantienen
un hervor constante o la
cocción es lenta
Se está utilizando recipientes de cocción
inadecuados.
8VHROODVDEVROXWDPHQWHSODQDV\TXH
FRLQFLGDQFRQHOGLiPHWURGHODXQLGDGGHOD
VXSHUILFLHVHOHFFLRQDGD
Los elementos de
superficie no funcionan
bien
Los controles de la estufa están mal configurados.
9HULILTXHSDUDHVWDUVHJXURGHTXHVHKD
FRQILJXUDGRHOFRQWUROFRUUHFWRSDUDHO
HOHPHQWRGHVXSHUILFLHTXHHVWiXWLOL]DQGR
Indicador de arco
de corriente en ON
(Encendido) titilando
Las teclas +, -, o bloque del control fueron
presionadas antes de haber encendido un
elemento.
&RQVXOWHODVHFFLyQGH8VRGHORV(OHPHQWRV
GH&RFFLyQ
Rayones en la superficie
de vidrio de la estufa
Se están usando métodos de limpieza incorrectos.
8WLOLFHSURFHGLPLHQWRVGHOLPSLH]D
UHFRPHQGDGRV9HUODVHFFLyQ&yPROLPSLDUOD
HVWXIDGHYLGULR
Se están usando recipientes con bases ásperas
o hay partículas gruesas (sal o arena) entre el
recipiente y la superficie de la estufa. Se ha
deslizado un recipiente a través de la superficie de
la estufa.
3DUDHYLWDUUD\RQHVXVHORVSURFHGLPLHQWRV
GHOLPSLH]DUHFRPHQGDGRV9HULILTXHTXHODV
EDVHVGHORVUHFLSLHQWHVHVWpQOLPSLDVDQWHV
GHOXVR\XWLOLFHUHFLSLHQWHVFRQEDVHVOLVDV
No se limpiaron los derrames de alimentos antes
del uso siguiente.
9HUODVHFFLyQ&yPROLPSLDUODHVWXIDGH
YLGULR
Superficie caliente en un modelo con un estufa de
vidrio de color claro.
(VWRHVQRUPDO/DVXSHUILFLHSXHGHSDUHFHU
GHFRORUDGDFXDQGRHVWiFDOLHQWH(VWRHV
WHPSRUDO\GHVDSDUHFHUiPLHQWUDVVHHQIUtDHO
YLGULR
Plástico derretido sobre
la superficie
La estufa caliente entró en contacto con plástico.
9HUODVHFFLyQ6XSHUILFLHGHYLGULR
SRVLELOLGDGHVGHGDxRSHUPDQHQWHHQOD
VHFFLyQ&yPROLPSLDUODHVWXIDGHYLGULR
Marcas (o hendiduras)
en la estufa
Se ha derramado una mezcla azucarada caliente
en la estufa.
/ODPHDXQWpFQLFRFDOLILFDGRSDUDHO
UHHPSOD]R
El teclado no responde
El teclado está sucio.
/LPSLHHOWHFODGR
El fusible puede haberse quemado o el disyuntor
puede haber saltado.
&DPELHHOIXVLEOHRYXHOYDDFRQILJXUDUHO
GLV\XQWRU
Áreas de decoloración
en la estufa
49-80747
Download PDF

advertising