Concevoir des services collaboratifs adaptés à des - MAP-CRAI

Concevoir des services collaboratifs adaptés à des - MAP-CRAI
 Centre de Recherche en Architecture et Ingénierie UMR n°3495 CNRS / Ministère de la Culture et de la Communication École EĂƚŝŽŶĂůĞ^ƵƉĠƌŝĞƵƌĞĚ͛ƌĐŚŝƚĞĐƚƵƌĞĚĞEĂŶĐLJ Université de Lorraine École Doctorale IAEM Lorraine Département de Formation Doctorale en Informatique Thèse
pour O¶REWHQWLRQ du titre de
Docteur GHO¶8QLYHUVLWpGH/RUUDLQH
en 6FLHQFHVGHO¶$UFKLWHFWXUH
par
Daniel Zignale
Concevoir des services collaboratifs adaptés à
des pratiques métiers :
une méthode centrée usages
Application au domaine de la construction
Soutenance publique le 17 juillet 2013
M embres du Jury :
Mme Sophie DUPUY-CHESSA
M. Stéphane HANROT
M. Eric DUBOIS
M. Pierre LECLERQ
M. Gilles HALIN
M. Sylvain KUBICKI
Rapporteur
Rapporteur
Examinateur
Examinateur
Directeur
Co-directeur
Maître de conférences en informatique, HDR, Grenoble
Architecte, Professeur en architecture, HDR, Marseille
Professeur en informatique, Namur
Ingénieur-Architecte, Professeur en sciences appliquées, Liège
Maître de conférences en informatique, HDR, Université de Lorraine
Architecte, 'RFWHXUHQVFLHQFHVGHO¶DUFKLWHFWXUH, Luxembourg
Avec le support du CRP Henri Tudor et du Fonds National de la Recherche Luxembourgeois
¬$QJHORHW7LQD«
Remerciements
Cette thèse est OHIUXLWGHO¶HQJDJHPHQWet la confiance de plusieurs personnes et instituts sans
lesquels XQMHXQHDUFKLWHFWHIUDvFKHPHQWGLSO{PpQ¶DXUDLWSX mener un tel projet. Je tiens à leur
adresser toute ma gratitude.
Je dois très probablement les fondations de ce projet à M. Sylvain Kubicki, qui a su piquer ma
FXULRVLWp HW pYHLOOHU PRQ LQWpUrW SRXU OD UHFKHUFKH DORUV PrPH TXH M¶HIIHFWXDLV PRQ VWDJH GH
Master 2 &¶HVW JUkFH j VD PRWLYDWLRQ TXH M¶DL HX OD YRORQWp HW OD SRVVLELOLWp G¶HQWUHSUHQGUH FH
parcRXUVTX¶LODégalement su encadrer avec sérieux, mais aussi sympathie.
Je dois également le bon déroulement de cette étude à M. Gilles Halin, directeur de ce travail
de thèse, et clé de voute de cette structure multidisciplinaire, entre architecture et informatique. Je
lui suis reconnaissant pour sa pédagogie, la pertinence de ses propos, son sérieux et sa bonne
humeur tout au long de la direction de mes travaux.
-HVXLVKHXUHX[G¶DYRLUSXEpQpILFLHUGXFRQWH[WHSURIHVVLRQQHORIIHUWSDUOH&53+HQUL7XGRU
et le CRAI. Je remercie Éric Dubois, directeur du département SSI, Séverine Mignon, coach de
O¶XQLWp6,6(HW)DEULFH$EVLOmanageur du programme construction pour leur confiance et leur
soutien. Je remercie également Jean-Claude Bignon, SURIHVVHXUjO¶pFROHG¶DUFKLWHFWXUHGH1DQF\
et directeur de recherche au CRAI, pour ses conseils avisés.
Je remercie tout particulièrement mon collègue et ami Conrad Boton, pour sa bonne humeur,
mais aussi son soutien et son aide précieuse. Les longues discussions qui ont régulièrement
ponctué nos travaux de thèse respectifs ont toujours été très enrichissantes.
1RPEUHX[ VRQW PHV FROOqJXHV DYHF TXL M¶DL SX SDUWDJHU GH WUqV ERQV PRPHQWV DX FRXUV GH
cette thèse et qui y ont contribué, même indirectement. Quelques noms parmi WDQWG¶DXWUHVTXLRQW
ma reconnaissance et ma sympathie : Jean-Sébastien, Thomas, Alain, Gerald, Cédric, Jocelyn,
Elio, Carine, Kévin, Anis«
8 |
Résumé
Dans le domaine du projet de conception-construction architecturale, la gestion de la
collaboration entre OHV GLIIpUHQWV DFWHXUV G¶XQ SURMHW HVW XQ HQMHX LPSRUWDQW '¶XQ SURMHW j XQ
autre, en fonction du projet, mais aussi des acteurs qui y interviennent, les pratiques de travail
varient. Parallèlement, de nombreux services sont proposés et utilisés pour assister la
collaboration, certains sur un modèle « grand public ª HW G¶DXWUHV SOXV RULHQWpV YHUV XQ XVDJH
SURIHVVLRQQHO /¶H[SpULHQFH CRTI-weB HVW XQ SURMHW GH GpYHORSSHPHQW G¶XQ FROOHFWLFLHO PHQp
avec et pour les professionnels du secteur au Luxembourg. Il propose actuellement deux services
dans sa version commerciale OHVHUYLFHG¶pFKDQJHVHWJHVWLRQGHGRFXPHQWVSODQVGRFXPHQWV
WHFKQLTXHV HW OH VHUYLFH GH UpGDFWLRQ HW JHVWLRQ GHV UDSSRUWV GH FKDQWLHU 0DOJUp O¶pWXGH GHV
besoins métiers menée en amont du GpYHORSSHPHQW O¶RXWLO SUpVHQWH FHSHQGDQW GHV PDQTXHV
G¶DGDSWDWLRQ&HFRQVWDWG¶LQDGDSWDWLRQQ¶HVWSDVXQFDVLVROpLOUHIOqWHXQHODFXQHJpQpUDOHGHFH
JHQUH G¶RXWLOV j VDWLVIDLUH SOHLQHPHQW OHV DWWHQWHV GHV SURIHVVLRQQHOV &¶HVW SRXUTXRL ce travail
doctoral propose XQ FDGUH G¶DQDO\VH VXSSRUWp SDU OD PRGpOLVDWLRQ GHV FRPSRUWHPHQWV GHV
utilisateurs. Nous adoptons alors plusieurs points de vue relatifs à différents champs de
recherches OH JpQLH ORJLFLHO OD FRQFHSWLRQ G¶LQWHUIDFHV KRPPH-PDFKLQH O¶HQWUHSrise orientée
VHUYLFHV HW OD FRQFHSWLRQ GH V\VWqPH G¶LQIRUPDWLRQ HW HQILQ OH WUDYDLO FROODERUDWLI DVVLVWp SDU
ordinateur (TCAO).
'¶XQSRLQWGHYXHRUJDQLVDWLRQQHOQRXVLGHQWLILRQVOHVSUDWLTXHVFROOHFWLYHVH[HUFpHVSDUOHV
JURXSHVG¶DFWHXUVLPSOLTXpVGDns le projet. Nous en déduisons ensuite les pratiques individuelles,
à savoir les responsabilités de chacun en fonction de son rôle dans le groupe.
'¶XQ SRLQW GH YXH RSpUDWLRQQHO QRXV QRXV LQWpUHVVRQV j OD PpGLDWLVDWLRQ GH FHV
UHVSRQVDELOLWpV SDU O¶XVDJH de différentes solutions technologiques. La caractérisation de ces
usages est liée à la notion de contexte OH FRQWH[WH WHFKQLTXH PDWpULHO ORJLFLHO« OH FRQWH[WH
VSDWLDO ORFDOLVDWLRQ HQYLURQQHPHQW« OH FRQWH[WH WHPSRUHO IUpTXHQFH UpJXODULWp
syncKURQLVDWLRQ«
Enfin, le point de vue fonctionnel vise à définir le service utilisé, c'est-à-dire le comportement
QRQSOXVGHO¶utilisateur, mais du système qui répond à son besoin.
| Résumé 9 Les concepts introduits et leur caractérisation permettent individuellement de cadrer et
formaliser (par des modèles graphiques) la description des différents comportements à des fins
analytiques. Dans un but productif, nous proposons la méthode PUSH (Practices and Usages
based Services enHancement) qui orchestre ces différents points de vue et permet de générer un
HQVHPEOH G¶H[LJHQFHV SRXU OH GpYHORSSHPHQW GH VHUYLFHV GLWV © adaptés ». Communication et
traçabilité sont les maitres mots de cette méthode de conception.
/H FRQWH[WH G¶pWXGH j OD IRLV RULHQWp UHFKHUFKH HW GpYHORSSHPent (créé au travers de la
collaboration entre le CRAI à Nancy et le CRP Henri Tudor à Luxembourg) nous a permis
G¶pYDOXHUHWG¶DPpOLRUHUODGpILQLWLRQGHVFRQFHSWVPLVHQDYDQWDLQVLTXHODPLVHHQSODFHGHOD
PpWKRGH386+/¶DPpOLRUDWLRQGHVVHUYLFHVGXcollecticiel CRTI-weB DIDLWO¶REMHWGHGHX[FDV
G¶pWXGH 8Q WURLVLqPH FDV FRQFHUQDLW OH GpYHORSSHPHQW G¶XQ WDEOHDX GH ERUG GH JHVWLRQ GH
chantier sur interface mobile.
M ots-clés : Construction, Collaboration, Services informatiques, Génie Logiciel, Interfaces
Homme-Machines, Conception centrée usages, Science de la conception.
10 Résumé |
Sommaire
Liste des abréviations et acronymes ..................................................................................................... 15 Introduction ......................................................................................................................................... 17 hŶĞƚŚğƐĞăůĂĐƌŽŝƐĠĞĚĞƐĐŚĞŵŝŶƐĞŶƚƌĞƐĐŝĞŶĐĞƐĚĞů͛ĂƌĐŚŝƚĞĐƚƵƌĞĞƚŐĠŶŝĞůŽŐŝĐŝĞů ............................. 18 Problématique générale ............................................................................................................................ 18 Plan de la thèse ......................................................................................................................................... 20 PARTIE 1 : ASSISTER LA COLLABORATION DANS LES PROJETS DE CONSTRUCTION. DEFINIǯIQUE ET RECUL THEORIQUE.
...................................................................................................................................................... 21 ....................... Chapitre 1 ʹ La coordination dans les projets de conception/ construction architecturale
............................................................................................................................................................ 23 1.1 La caractérisation du secteur dans les travaux précédents ......................................................... 23 1.2 Les projets de construction et les outils de TCAO ........................................................................ 29 1.3 Conclusion .................................................................................................................................... 35 ................................................... Chapitre 2 ʹ hŶĐĂƐĚĞĚĠǀĞůŽƉƉĞŵĞŶƚĚ͛ƵŶŽƵƚŝůĚĞdK : CRTI-­‐weB
............................................................................................................................................................ 37 2.1 ĞƐĐƌŝƉƚŝŽŶĚĞů͛ĞdžƉĠƌŝĞŶĐĞ .......................................................................................................... 37 2.2 Analyse critique ............................................................................................................................ 42 2.3 Conclusion .................................................................................................................................... 45 ................................................................................. Chapitre 3 -­‐ Problématique et méthode de travail
............................................................................................................................................................ 47 3.1 Construction de la problématique ............................................................................................... 47 3.2 Méthode de recherche ................................................................................................................ 50 PARTIE 2 : THEORIES ET METHODES. CONCEVOIR DES SERVICES COLLABORATIFS ADAPTES ................................................................................................. 53 ....................................................... Chapitre 4 -­‐ DĞů͛ƵƚŝůŝƐĂƚĞƵƌăůĂĐŽŶĐĞƉƚŝŽŶůŽŐŝĐŝĞůůĞĞƚĚ͛ŝŶƚĞƌĨĂĐĞƐ
............................................................................................................................................................ 55 4.1 Les méthodes et activités relatives à la conception logicielle ...................................................... 55 4.2 >ĂĐŽŶĐĞƉƚŝŽŶĚ͛/,D ͗ĚĞů͛ƵƚŝůŝƐĂƚĞƵƌăů͛ŝŶƚĞƌĨĂĐĞ ...................................................................... 69 4.3 >ĞƐĞŶũĞƵdžĚĞů͛/ŶŐĠŶŝĞƌŝĞĞƚĚĞů͛ƌĐŚŝƚĞĐƚƵƌĞŝƌŝŐĠĞƉĂƌůĞƐDŽĚğůĞƐ͘ ..................................... 82 4.4 Conclusion : vers « une méthode centrée usages » ..................................................................... 87 ........................ Chapitre 5 -­‐ Ğů͛ĞŶƚƌĞƉƌŝƐĞŽƌŝĞŶƚĠĞƐĞƌǀŝĐĞƐăůĂĐŽŶĐĞƉƚŝŽŶĚĞ^LJƐƚğŵĞƐĚ͛/ŶĨŽƌŵĂƚŝŽŶ
............................................................................................................................................................ 89 5.1 >͛ĞŶƚƌĞƉƌŝƐĞŽƌŝĞŶƚĠĞƐĞƌǀŝĐĞ ....................................................................................................... 89 5.2 ĞůĂŵŽĚĠůŝƐĂƚŝŽŶĚĞƐWƌŽĐĞƐƐƵƐDĠƚŝĞƌĂƵ^LJƐƚğŵĞĚ͛/ŶĨŽƌŵĂƚŝŽŶ .......................................... 96 5.3 Conclusion : vers « des services adaptés aux pratiques métiers »............................................. 103 .................................... Chapitre 6 ʹ Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs
.......................................................................................................................................................... 105 6.1 Description des outils de TCAO et des services collaboratifs ..................................................... 105 6.2 Vers une réponse à « ů͛ĠĐŚĞĐĚĞůĂƐŽůƵƚŝŽŶĐŽůůĞĐƚŝĐŝĞů » .......................................................... 109 12 Sommaire | 6.3 Conclusion : « concevoir des services collaboratifs » ................................................................ 111 ..................................................... Chapitre 7 ʹ Les méthodes de conception de services : études de cas
.......................................................................................................................................................... 115 7.1 CoCSys, une méthode de conception de collecticiels dirigée par des modèles ........................ 115 7.2 La méthode Symphony et les modèles pour la collaboration .................................................... 123 7.3 >͛/D;/ŶĨŽƌŵĂƚŝŽŶĞůŝǀĞƌLJDĂŶƵĂůͿƉŽƵƌůĂĐŽŶĐĞƉƚŝŽŶĚĞƐĞƌǀŝĐĞƐ/D ............................... 129 7.4 Conclusion et mise en place de la méthode .............................................................................. 134 PARTIE 3 : GUIDER LA CONCEPTION DE SERVICES COLLABORATIFS ADAPTES AU SECTEUR DE LA CONSTRUCTION. ETUDES, PROPOSITIONS ET PERSPECTIVES. ..................................................................................................................... 137 ............................................................................................ Chapitre 8 ʹ Introduction de la proposition
.......................................................................................................................................................... 139 8.1 Enjeux de la méthode ................................................................................................................ 139 8.2 Méthodologie ............................................................................................................................. 141 8.3 La méthode PUSH : « Practice and Usage-­‐based Service enHancement ................................... 147 8.4 Conclusion .................................................................................................................................. 151 ........................................... Chapitre 9 ʹ La modélisation des pratiques : le point de vue organisationnel
.......................................................................................................................................................... 153 9.1 Définitions et concepts .............................................................................................................. 153 9.2 Le Méta-­‐Modèle des Pratiques Métier ...................................................................................... 162 9.3 Le modèle de pratiques ............................................................................................................. 169 9.4 Conclusion .................................................................................................................................. 174 ................................................. Chapitre 10 ʹ La modélisation des usages : le point de vue opérationnel
.......................................................................................................................................................... 177 10.1 Définition et concepts ................................................................................................................ 177 10.2 Le méta-­‐modèle des Usages ...................................................................................................... 179 10.3 >ĞƐŵŽĚğůĞƐĚ͛ƵƐĂŐĞ .................................................................................................................. 187 10.4 Conclusion .................................................................................................................................. 194 ................................................. Chapitre 11 ʹ La modélisation des services : le point de vue fonctionnel
.......................................................................................................................................................... 199 11.1 Définitions et concepts .............................................................................................................. 199 11.2 Méta-­‐modèle de service ............................................................................................................ 200 11.3 Modélisation des services et implémentation ........................................................................... 207 11.4 Conclusion .................................................................................................................................. 211 ................................................................... Chapitre 12 ʹ La méthode PUSH : expérimentations et bilan
.......................................................................................................................................................... 213 12.1 Introduction aux expérimentations ........................................................................................... 213 12.2 Expérimentation n°1 ͗>͛ĂŵĠůŝŽƌĂƚŝŽŶĚƵƐĞƌǀŝĐĞĚ͛ƵƉůŽĂĚĚĞZd/-­‐weB .................................. 217 12.3 Expérimentation 2 ͗ů͛ĂƵƚŽŵĂƚŝƐĂƚŝŽŶĚƵƐĞƌǀŝĐĞĚ͛ƵƉůŽĂd de CRTI-­‐weB ................................... 227 12.4 Expérimentation 3 ͗ƐƉĠĐŝĨŝĐĂƚŝŽŶĚ͛ƵŶƚĂďůĞĂƵĚĞďŽƌĚ ............................................................ 235 12.5 Conclusion : apports des expérimentations ............................................................................... 241 Conclusion et perspectives ................................................................................................................. 247 Concevoir une méthode de conception : recul sur une approche orientée « design science » ............. 247 >ĞƐůŝŵŝƚĞƐĚĞů͛ĂƉƉƌŽĐŚĞ ......................................................................................................................... 248 Perspectives ............................................................................................................................................ 249 | Sommaire
13 Sommaire détaillé ....................................................................................... Error! Bookmark not defined. Bibliographie ..................................................................................................................................... 257 Glossaire ............................................................................................................................................ 273 Table des illustrations ........................................................................................................................ 277 Liste des figures ....................................................................................................................................... 277 Liste des tableaux .................................................................................................................................... 281 Annexes ............................................................................................................................................. 283 Analyse des « tickets » de conception de CRTI-­‐weB ............................................................................... 283 ĂŚŝĞƌĚ͛ĞdžŝŐĞŶĐĞƐ ͗ŵŽĚĞĚ͛ĞŵƉůŽŝ ....................................................................................................... 288 ĂŚŝĞƌĚ͛ĞdžŝŐĞŶĐĞƐ;ƉĂƌƚŝĞĠĚŝƚĂďůĞͿ ........................................................................................................ 294 Résumé .................................................................................................................................................... 299 14 Sommaire | Liste des abréviations et
acronymes
AIC :
Architecture Ingénierie et Construction
GL :
Génie Logiciel
GMF :
Graphical Modeling Framework
IDM :
Information Delivery Manual
IHM :
Interface Homme-Machine
MDA :
Model-Driven Architecture
MDE :
Model-Driven Engineering
MO :
0DLWUHG¶ouvrage
MOE :
MaiWUHG¶°XYUH
MMPM :
Méta-Modèle des Pratiques Métiers
MMPU :
Méta-Modèle des Usages
MMS :
Méta-Modèle des Services
MMSA :
Méta-Modèle des Services Adaptés
MVC :
Model-View-Controller
PUSH :
Practice and Usage-based Service enhancement
SOA :
Service-Oriented Architecture
TCAO :
Travail Collaboratif Assisté par Ordinateur
| Liste des abréviations et acronymes
15 16 Liste des abréviations et acronymes | I ntroduction
$X FRXUV G¶XQ SURMHW GH FRQFHSWLRQFRQVWUXFWLRQ DUFKLWHFWXUDOH OH FRQWH[WH GH WUDYDLO OHV
compétences et les missions de chacun des intervenants sont différents. Cela rend difficiles la
gestion HW O¶RSWLPLVDWLRQ du travail HW GHV pFKDQJHV G¶LQIRUPDWLRQ dans un contexte collectif.
3RXUWDQWjO¶pFKHOOHGXSURMHWO¶REMHFWLIHVWXQLTXH ODFUpDWLRQG¶XQRXYUDJHFRQVWUXLt, unique et
remarquable, qui sera parcouru, vécu, et adopté.
Les mauvais choix, les changements dans la conception, les retards, les malfaçons ont des
impacts financiers considérables dans un contexte économique déjà particulier, l¶HUUHXU
individuelle se répercutant sur le travail global. Il est donc de la responsabilité de chacun de
mener à bien son activité. Mais souvent la manière dont les acteurs collaborent est une source de
problèmes supplémentaires : mauvaise compréhension, mauvaise WUDQVPLVVLRQ G¶informations,
absence de suivi des demandes des collaborateurs, etc. ... La gestion de ces risques issus de la
collaboration est un enjeu important.
Pour assister O¶LPSOLFDWLRQ GHV DFWHXUV GDQV OHXU FROODERUDWLRQ DYHF OHV DXWUHV PHPEUHV GX
projet, il est pURILWDEOHG¶XWLOLVHUOHVRXWLOVWHFKQRORJLTXHVDXMRXUG¶KXLdisponibles. De plus en plus
SHUIRUPDQWVHWDFFHVVLEOHVFHVRXWLOVVRQWVRXYHQWODFOpG¶XQHERQQHJHVWLRQGXSURMHWGLPLQXDQW
OHV ULVTXHV G¶HUUHXU HW UpGXLVDQW OH WHPSV GH FHUWDLQHV DFWLYLWps de coordination. Les approches
« orientées services » ambitionnent de rendre ces outils modulaires et flexibles. /¶HQMHX, auquel
nous essayons de répondre au cours de ce travail, HVWDORUVG¶DVVXUHUXQHERQQHadéquation de ces
services afin que la réponse aux besoins soit réelle.
Bien des architectes préfèrent que leurs graphistes aient eux-mêmes une formation
G¶DUFKLWHFWHSRXUIDFLOLWHUOHGLDORJXH entre eux. De même, SURILWHUG¶XQHFRQQDLVVDQFHDFFUXHGX
métier pour spécifier des services peut être considéré comme un réel atoutELHQTX¶XQHpTXLSHGH
conception doive V¶HQWRXUHUpJDOHPHQWGHVPHLOOHXUHVFRPSpWHQFHVWHFKQLTXHVHWHUJRQRPLTXHV.
La caractéristique de ce travail de doctorat, fruit de la collaboration entre le Centre de Recherche
en Architecture et Ingénierie de Nancy et le Centre de Recherche Public Henri Tudor à
Luxembourg (et plus particulièrement son département « Service Science and Innovation »), est
| Introduction
17 justement de placer les préoccupations métiers au centre des projets de conception de services
SRXUO¶$UFKLWHFWXUHO¶,QJpQLHULHHWOD&RQVWUXFWLRQ$,&.
Une thèse à la croisée des chemins entre sciences GHO¶architecture et génie logiciel
/HVWUDYDX[XQLYHUVLWDLUHVPHQpVHQVFLHQFHVGHO¶DUFKLWHFWXUHFRXYUHQWSOXVLHXUVFKDPSVGH
recherche. Cette thèse en développera deux particuliers :
- la conception collaborative dans les projets d¶$UFKLWHFWXUH,QJpQLHULHHW&RQVWUXFWLRQ$,&
- la conception collaborative dans les projets de Génie Logiciel visant à assister les pratiques de
projet AIC.
La conception est une science de O¶DUWLILFLHO F¶HVW XQ SURFHVVXV itératif de création et
XWLOLVDWLRQ G¶artefacts dont la nature est liée au domaine considéré. Par exemple, le plan ou
O¶RXYUDJHVRQWGHVDUWHIDFWVGHODFRQFHSWLRQDUFKLWHFWXUDOHDORUVTXHOHVPRGqOHs UML et le code
implémenté comptent parmi ceux de la conception logicielle. Les processus quant à eux sont la
PLVHHQ°XYUHG¶DFWLYLWpVGHGLIIpUHQWs types associées à des acteurs UHVSRQVDEOHVGHO¶H[pFXWLRQ
de ces activités.
Les projets G¶DUFKLWHFWXUH HW ceux du génie logiciel peuvent être appréhendés comme deux
processus de conception similaires qui associent des points de vue différents. Ces points de vue
peuvent, comme identifié plus haut, être source de divergences. $QDO\VHU FHVSURMHWVF¶HVW alors
coQVLGpUHU SOXV TXH O¶DUWLILFLHO QRXV YHUURQV TX¶XQ FRQWH[WH GH SURMHW HVW DXVVL défini par des
facteurs humains.
C¶HVW j OD FURLVpH GHV FKHPLQV HQWUH FHV GHX[ GRPDLQHV TXH FHWWH WKqVH WURXYH VD VRXUFH
/¶REMHFWLI HVW HQ HIIHW GH WLUHU SDUWL G¶XQH DQDO\VH des pratiques de conception dans le domaine
$,& SRXU VSpFLILHU FHOOHV G¶XQ SURMHW GH */ pour la conception de services adaptés au secteur.
Cette problématique de double conceptualisation et de mise en FRUUHVSRQGDQFHVHUDDXF°XUGHFH
travail.
Problématique générale
1RWUH DQDO\VH GH OD FRQFHSWLRQ ORJLFLHOOH V¶HVW SDUWLFXOLqUHPHQW SRUWpH VXU son aspect
méthodique et VWUXFWXUp(QFHTXLFRQFHUQHO¶DQDO\VHGHVSUDWLTXHVarchitecturales, nous avons au
FRQWUDLUHYRXOXJDUGHUjO¶HVSULWOHFDUDFWqUHXQLTXHHWSHu prédictif de chaque projet.
Conceptualiser les méthodes de GL
Les méthodes de conception logicielle ont évolué avec le temps pour répondre à la complexité
croissante des applications informatiques, HQ V¶RULHQWDQW de la programmation proprement dite
vers O¶DQDO\VH HW OD modélisation. La première étape fut de pouvoir définir des parties de codes
VRXV IRUPH G¶éléments réutilisables, facilitant ainsi la reprise de solutions informatiques
prédéveloppées. Les étapes suivantes permirent de prendre de plus en plus de recul et de
capitaliser les développements, cherchant à spécifier un système à partir de concepts externes
relatifs aux utilisateurs, à leurs tâches, à leur métier, à leur organisation« Nous avons analysé et
cherché à tirer parti de ces approches de conception dites « dirigées par les modèles ».
18 Introduction |
Conceptualiser les pratiques architecturales
Malgré des bases fondamentales ancestrales, les pratiques de conception et de construction
architecturales QH FHVVHQW G¶pYROXHU (OOHV sont SRXVVpHV SDU O¶LQQRYDWLon dans les techniques
constructives et les matériaux, PDLVDXVVLSDUXQFRQWH[WHpFRQRPLTXHGpOLFDWTXLGHPDQGHG¶rWUH
VDQV FHVVH SOXV SURGXFWLI HW HIILFDFH /D YRORQWp HW VXUWRXW OD QpFHVVLWp G¶DWWHLQGUH GHV
performances environnementales élevées se montre également particulièrement génératrice de
changements. Une partie du présent travail de doctorat se tourne YHUVO¶DQDO\VHHWODGHVFULStion de
ces pratiques. Ce travail met en avant les objectifs génpULTXHVHWOHVVSpFLILFLWpVG¶XQcontexte de
projet et ses variations.
Proposer des services informatiques pour le secteur AI C
Comme le montre le schéma suivant (Figure 1), ce travail porte essentiellement sur
O¶H[SUHVVLRQGHVEHVRLQVRXH[LJHQFHVjO¶RULJLQHG¶XQSURMHWGHFRnception de services, à partir
GHODGHVFULSWLRQG¶XQSURMHWGHFRQFHSWLRQDUFKLWHFWXUDOH (QG¶DXWUHVWHUPHVQRXVSURSRVRQVXQH
DSSURFKH TXL LQWqJUH O¶DQDO\VH GHV SUDWLTXHV PpWLHUV dans le contexte AIC à une méthode de
conception de services adaptés. /HFRQFHSWG¶XVDJHPpGLDWLVDQWFHVSUDWLTXHVHWPDWpULDOLVpSDUOHV
services est au centre de cette approche.
Cette méthode suit donc un processus en plusieurs étapes analytiques et conceptuelles. Ces
étapes sont décrites par divers modèles qui formalisent O¶H[SUHVVLRQGH SRLQWV GHYXHGLIIpUHQWV,
UHODWLIV DX[ GLIIpUHQWV LQWHUYHQDQWV GDQV XQ SURMHW GH GpYHORSSHPHQW GH VHUYLFHV O¶XWLOLVDWHXU
O¶H[SHUW PpWLHU OH FRQFHSWHXU OH GpYHORSSHXU /H SDVVDJH G¶XQ PRGqOH j O¶DXWUH GpILQLW
O¶pYROXWLRQ G¶XQ SRLQW GH YXH YHUV XQ DXWUH MXVTX¶j OD GpILQLWLRQ GX VHUYLFH GHPDQGp Cette
évolution est définie par un méta-modèle qui conceptualise les points de vue et les
correspondances entre chaFXQG¶HQWUHHX[. Le plan de cette thèse découle des problématiques ici
mises en avant.
Figure 1.
&RQFHSWXDOLVDWLRQG¶XQSURMHWGHFRQFHSWLRQDUFKLWHFWXUDOH
SRXUODVSpFLILFDWLRQG¶XQSURMHWGHFRQFHSWLRQORJLFLHOOH
| Introduction
19 Plan de la thèse
Trois parties composent ce manuscrit et intègrent les éléments de la problématique que nous
venons de dégager. Elles décrivent une approche qui est elle-même une approche de conception :
OD FRQFHSWLRQ G¶XQH PpWKRGH SRXU O¶DGDSWDWLRQ GH VHUYLFHV DX FRQWH[WH FROODERUDWLI G¶XQ SURMHW
AIC.
Partie 1 : assister la collaboration dans les projets de construction
La première partie, composée de trois chapitres décrit OHV GHX[ FRQWH[WHV GH O¶pWXGH /H
premier est le contexte scientifique XQH OLJQpH G¶pWXGHV HW QRWDPPHQW GH WKqVHV VXU OD
coordination dans les projets de construction, son analyse, sa visualisation. Le deuxième est le
FRQWH[WH G¶DSSOLFDWLRQ OH GpYHORSSHPHQW GH VHUYLFHV G¶DVVLVWDQFH j OD FROODERUDWLRQ SRXU OH
secteur luxembourgeois de la construction. La problématique y est alors détaillée, suivie de la
méthodologie adoptée, dans le chapitre trois.
Partie 2 : théories et méthodes, concevoir des services collaboratifs adaptés
Quatre chapitres composenWFHWWHSDUWLHHWH[SORUHQWGHVFKDPSVG¶pWXGHVSDUDOOqOHVUHODWLIVj
la conception de services informatiques. Nous les présentons au travers de plusieurs paradigmes
de la conception logicielle. Le premier chapitre (chapitre 4) décrit O¶pYROXWLRQ GHV PpWKRGHV GX
*/ OHXU HQULFKLVVHPHQW SDU O¶pWXGH GH O¶XWLOLVDWHXU HW LQWURGXLW O¶LQJpQLHULH GLULJpH SDU OHV
modèles. Le deuxième (chapitre 5) explore le concept de service avec une étude sur la
modélisation des processus métier dans une entreprise et la conception des systèmes
G¶LQIRUPDWLRQ SRXU O¶HQWUHSULVH /e troisième et le quatrième (chapitres 6 et 7) introduisent de
manière théorique puis par GHVFDVG¶pWXGHVODFRQFHSWLRQGHVHUYLFHVFROODERUDWLIV
Partie 3 : guider la conception de services collaboratifs adaptés au secteur de la
construction
Les chapitres huit à douze forment la troisième et dernière partie de cette thèse. Le premier
(chapitre 8) introduit QRWUHDSSURFKHSRXUO¶DGDSWDWLRQGHVHUYLFHVFROODERUDWLIVDX[SUDWLTXHVGX
secteur AIC. Les suivants la décrivent selon le découpage suivant : modélisation des pratiques
(chapitre 9), modélisation des usages (chapitre 10), modélisation des services et capitalisation de
O¶pWXGH VRXV IRUPH G¶H[LJHQFHV FKDSLWUH Le dernier chapitre (chapitre 12) présente trois
expérimentations qui ont été menées pour construire, parfaire et valider partiellement cette
approche.
Une conclusion propose un bref récapitulatif du travail effectué. Nous essayons notamment
G¶HQIDLUHUHVVRUWLUOHVOLPLWHVHWG¶HQGpJDJHUGHVSHUVSHFWLYHVTXLSRXUURQWrWUHDERUGpHVGDQVGHV
travaux futurs.
20 Introduction |
PARTIE 1 : Assister la collaboration dans les projets de
construction. DéfLQLWLRQG¶XQHSUREOpPDWLTXHHWUHFXOWKpRULTXH
Dans cette première partie, notre étude sera resituée
dans son double contexte, entre enjeux métiers et
démarche scientifique. Le chapitre 1 introduira le
contexte métier, à savoir le domaine « Architecture,
Ingénierie et Construction » (AIC), ses caractéristiques
et les éléments qui le composent. Puis il approfondira
plus particulièrement la thématique du Travail
Collaboratif Assisté par Ordinateur (TCAO) dans ce
contexte particulier. Le chapitre 2 décrira une
expérience de conception de services G¶XQ RXWLO GH
TCAO particulier. Il nous permettra de tirer quelques
FRQFOXVLRQV TXDQW j OD QDWXUH HW DX[ HQMHX[ G¶XQ WHO
travail de conception de services. À partir de ces
analyses, nous définirons nos objectifs et notre
problématique au cours du chapitre 3. Un premier recul
théorique sur la science de la conception conclura ce
chapitre et servira de point de départ j O¶pWDW GH O¶DUW
proposé dans la deuxième partie de cette thèse.
Chapitre 1 ± La coordination dans
les projets de
conception/
construction architecturale
Ce premier chapitre fait le point sur les études menées autour de la coordination dans les
projets de conception/construction architecturale, aussi appelés projets AIC (pour Architecture,
Ingénierie et CRQVWUXFWLRQ ,ODERUGH XQSRLQWGH YXHG¶DERUG WKpRULTXH visant à caractériser ce
VHFWHXUVXUODEDVHGHVGLIIpUHQWVFRQFHSWVTXHVRQWO¶DFWHXUO¶DUWHIDFWHWO¶DFWLYLWp Ces concepts
sont issus de travaux précédents sur la modélisation GHO¶DFWLYLWpFROOective dans un projet AIC. Le
chapitre introduit dans un second temps les outils de Travail Collaboratif Assisté par Ordinateur
(TCAO) : leur buts, leur nature, leurs enjeux.
1.1 La caractérisation du secteur dans les travaux précédents
Les travaux de mes prédécesseurs, menés au sein du laboratoire MAP-CRAI, ont contribué à
faire évoluer de manière continue une modélisation du FRQWH[WH G¶XQ SURMHW $,& /¶objectif de
Damien Hanser (Hanser 2003) était de représenter des situations collaboratives particulières au
travers de trois concepts : O¶DFWHXU O¶DFWLYLWp HW OH GRFXPHQW Mouhamed Bouattour (Bouattour
2005) \ DMRXWD OH FRQFHSW G¶REMHW SRXU LQWURGXLUH la caractérisation des ouvrages (et éléments
d¶ouvrages) et des espaces bâtis. Sylvain Kubicki (Kubicki 2006) porta son attention sur le
FRQFHSW G¶RXWLO HW OD IDoRQ GRQW LO V¶LQWpJUDLW GDQV OH FRQWH[WH GX SURMHW /¶REMHFWLI pWDLW DORUV
G¶XWLOLVHU OD UHSUpVHQWDWLRQ GH OD FROODERUDWLRQ DILQ de PHQHU XQH pWXGH VXU O¶DVVLVWDQFH GH OD
collaboration grâce à des outils-logiciels dédiés. La thèse de Annie Guerriero (Guerriero 2009)
FRQVLGpUDODUHSUpVHQWDWLRQG¶XQDVSHFWSDUWLFXOLHUGHODFROODERUDWLRQjVDYRLUODFRQILDQFH
/¶HQVHPEOHGHFHVWUDYDX[IRUPHODEDVHWKpRULTXHVXUODTXHOOHV¶DSSXLHFHWUDYDLOGHWKqVH
Au cours des paragraphes suivants, nous présenterons les concepts importants qui en émergent et
qui caractérisent ce qui est défini comme « le contexte GHO¶DFWLYLWpFROOHFWLYH » G¶XQ projet AIC.
| Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
23 1.1.1 Les acteurs et leur caractérisation
/¶DFWHXU HVW LGHQWLILp FRPPH une personne ou un groupe de personnes impliqué dans un
projet. Les responsabilités, PDLVDXVVLODFRQILDQFHTX¶RQDFFRUGHjun acteur dans un projet, sont
portées par le rôle TX¶LO HQGRVVH. Selon (Hanser 2003), « les rôles sont le point fondamental de
toXWPRGqOHGHVWLQpjUHSUpVHQWHUO¶DFWLYLWpGHgroupe, FDUOHU{OHPDWpULDOLVHODSDUWLFLSDWLRQG¶XQ
acteur à une activité » (p. 130). Il en identifie deux types : les rôles organisationnels et les rôles
opérationnels.
Le rôle organisationnel est dépendant du projet et du cadre contractuel qui y est établi, il est
donc défini en début de projet. ,O SHXW rWUH DVVLPLOp DX U{OH GH O¶DFWHXU GDQV OH GRPDLQH
cinématographique j VDYRLU TX¶XQ DFWHXU SHXW MRXHU GHV U{OHV GLIIpUHQWV G¶XQ SURMHW j XQ DXWUH
(voire au sHLQG¶XQPrPHSURMHW Les rôles les plus communément reconnus sont :
- /HPDvWUHG¶RXYUDJHTXLHVWOHFRPPDQGLWDLUHGHO¶RXYUDJHjFRQFHYRLU
- /HV DUFKLWHFWHV HW LQJpQLHXUV TXH O¶RQ UHJURXSHUD VRXV OH U{OH FRPPXQ GH FRQFHSWHXUV
responsable de la production des plans et autres documents qui spécifient le bâtiment à la fois
formellement et techniquement
- /HVFRQVWUXFWHXUVTXLPHWWHQWHQ°XYUHOHEkWLPHQWjSDUWLUGHVGRFXPHQWVGHFRQFHSWLRQ
- Le coordinateur, responsable du bon déroulement du projet, notamment SDU O¶LGHQWLILFDWLRQ
GHVSUREOqPHVHWOHVXLYLGHO¶LQIRUPDWLRQ
- /¶H[SHUWTXLHVWUHODWLIjXQU{OHGHFRQVHLOOHUFRPPHO¶DVVLVWDQWjODmaîtrise G¶ouvrage, mais
DXVVLG¶DQDO\VWHFRPPHOHVEXUHDXx de contrôle
- Enfin, nous regroupons toutes les institutions externes aux projets, mais ayant un rôle
GpFLVLRQQHOVRXVOHU{OHG¶DGPLQLVWUDWLRQ
La notion de mission contractuelle définit les responsabilités attribuées à un acteur et ses
objectifs à atteindre. 3DU H[HPSOH OHV PLVVLRQV GH PDvWULVH G¶°XYUH VRQW FRQILpHV par le maître
G¶RXYUDJH j XQDUFKLWHFWHRXXQ entrepreneur. En France, la loi MOP1 (loi relative à la maîtrise
d'ouvrage publique HW j VHV UDSSRUWV DYHF OD PDvWULVH G
°XYUH SULYpH) régit la nature de ces
missions. Par définition, « lHPDvWUHG¶°XYUHHVWOD personne de droit privé ou le groupement de
personnes de droit privé qui doit permettre d'apporter une réponse architecturale, technique et
économique au programme »2. Les missions GHPDvWULVHG¶°XYUHVRQW :
- les études d'esquisse,
- les études d'avant-projets,
- les études de projet,
- l'assistance apportée au maître de l'ouvrage pour la passation du contrat de travaux,
- les études d'exécution ou l'examen de la conformité au projet et le visa de celles qui ont été
faites par l'entrepreneur,
- la direction de l'exécution du contrat de travaux,
- l'ordonnancement, le pilotage et la coordination du chantier,
- l'assistance apportée au maître de l'ouvrage lors des opérations de réception et pendant la
période de garantie de parfait achèvement.
Le rôle opérationnel permet une distinction plus fine des acteurs dans le sens où il ne relève
SOXVG¶XQHUHVSRQVDELOLWpvis-à-vis du projet, mais vis-à-YLVGHO¶LQIRUPDWLRQ/HU{OHRSpUDWLRQQHO
conditionne, FRPPH VRQ QRP O¶indique, les opérations des acteurs sur les documents et sur
l¶RXYUDJH. Par exemple, en ce qui concerne le document « rapport de chantier » le rôle
1
2
http://www.marche-­‐public.fr/Marches-­‐publics/Textes/Lois/loi-­‐85-­‐704-­‐MOP.htm http://www.marche-­‐public.fr/Marches-­‐publics/Definitions/Entrees/Maître-­‐oeuvre.htm 24 Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale |
RSpUDWLRQQHOGHUpGDFWLRQHVWDWWULEXpDXFRRUGLQDWHXUDORUVOHVDXWUHVDFWHXUVQ¶DXURQWTX¶XQU{OH
de consultation voire de commentaire.
'¶XQ SRLQW GH YXH DGPLQLVWUDWLI, les DFWHXUV HQ WDQW TX¶individus et organisations sont
LGHQWLILpV SDU XQ WLWUH (Q FH TXL FRQFHUQH O¶LQGLYLGX, ce titre dépend de sa formation, et
correspond à son métier (ex. architecte, XUEDQLVWHpOHFWULFLHQPHQXLVLHU«3RXUXQHRUJDQLVDWLRQ
on parleUD GH W\SH G¶RUJDQLVDWLRQ H[ XQH DJHQFH G¶DUFKLWHFWXUH XQ EXUHDX G¶pWXGHV XQH
HQWUHSULVHGHJURV°XYUH« (Hanser 2003).
Un acteur reconnu par son métier, peut endosser plusieurs rôles et donc missions &¶HVW
souvent le cas pour un architecte qui peut être à la fois concepteur et coordinateur.
Réciproquement, un rôle peut être joué par plusieurs personnes aux métiers différents. Par
exemple, le même rôle de coordinateur joué dans un cas par O¶DUFKLWHFWHGXSURMHWpeut aussi bien
être attribué à un coordinateur pilote dédié qui fait de la coordination son activité principale.
Grâce à une attribution des rôles ainsi plus étendue, les tâches sont plus finement réparties, ce qui
permet à chacun de PLHX[FRQFHQWUHUVRQWUDYDLO&HODV¶DYqUHSDUWLFXOLqUHPHQWQpcessaire dans un
projet de grande envergure, du fait de la complexité des missions.
De manière générale, le titre possède plus un caractère distinctif et témoigne de la formation
DQWpULHXUHG¶XQDFWHXU /HFRQFHSWGHU{OHHVWEHDXFRXSSOXVLPSRUWDQWWpPRLJQDQWGH O¶DFWLYLWp
UpHOOHG¶XQDFWHXUGDQVXQFRQWH[WHGHSURMHWSDUWLFXOLHUHWGXGpURXOHPHQWGHFHOXL-ci.
1.1.2 Les artefacts et les outils
Une interaction entre un acteur et ce TX¶LO SURGXLW HVW VXSSRUWpH LQVWUXPHQWpH SDU GHV
documents, des logiciels, des PDFKLQHVGHVPpWKRGHVGHVORLV« RQGLUDTX¶HOOHHVWPpGLDWLVpH
par des artefacts (Kuutti 1996; Engeström 1987; Hanser 2003). Comme le souligne (Hanser
2003), un artefact peut également être un SURGXLW(QHIIHWDXFRXUVG¶XQSURMHW$,&OHGRFXPHQW
« plan » est dans un premier lieu un produit de conception puis est utilisé comme support lors de
ODFRQVWUXFWLRQGHO¶RXYUDJH
Originellement donc O¶DUWHIDFW HVW assimilé à un outil (les outils-machines, les outilsdocuments, les outils-méthodes, les outils-logiciels). (Kubicki 2006) propose cependant de traiter
ces deux concepts distinctement :
- OHFRQFHSWG¶RXWLOKpULWHGXFDUDFWqUH© instrumental » et contient aussi bien les outils-matériel
que les outils-logiciel
- O¶DUWHIDFWHVWTXDQW à lui ramené à sa définition première à savoir « un produit artificiel réalisé
SDUO¶KRPPH ªHWUHJURXSHOHVGRFXPHQWVOHVSODQVOHVGHVFULSWLIVWH[WHVOHVSKRWRV«HWOHV
REMHWVOHVRXYUDJHVRXpOpPHQWVG¶RXYUDJHVDUFKLWHFWXUDX[
1.1.3 L¶DFWLYLWp
De manière générale, l¶DFWLYité est définie comme un ensemble « G¶RSpUDWLRQV KXPDLQHV
dirigées vers une finalité », « O¶H[HUFLFHG¶XQHIRQFWLRQG¶XQPpWLHUª3 ou « un ensemble de tâches
3
http://www.linternaute.com/dictionnaire/fr/definition/activite/ | Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
25 organisées au sein d'un processus »4. /¶DFWLYLWpSHXWpJDOHPHQWrWUHV\QRQ\PHG¶DFWLRQPourtant,
ces différents termes se rapportent à des concepts sensiblement différents.
Nous pouvons trouver des premiers éléments de définition plus distinctifs dans la théorie de
O¶DFWLYLWp. Elle tire ses origines des travaux du psychologue Lev Vygotsky sur la « dynamique de
O¶DFWLYLWp KXPDLQH » et fut reprise par (Leontiev 1978) qui distingue trois concepts O¶DFWLYLWp
O¶DFWLRQO¶RSpUDWLRQYRLU(Hanser 2003)).
- /¶activité est un processus de transformation visant atteindre un objectif général et découpé
en plusieurs étapes ou phases.
- Les actions VRQW OD GpFRPSRVLWLRQ G¶XQH RX SOXVLHXUV DFWLYLWpV HQ SURFHVVXV FRQVFLHQWV HW
UpIOpFKLV (Q G¶DXWUHV WHUPHV XQH DFWLRQ HVW OD PDWpULDOLVDWLRQ G¶XQH YRORQWp G¶DWWHLQGUH XQ
objectif (ou une paUWLHG¶REMHFWLIDXWUDYHUVG¶XQSURFHVVXVGDQVOHTXHORQpYDOXHO¶REMHFWLI
RQH[pFXWHO¶DFWLRQHWFRQWU{OHVLO¶REMHFWLIjpWpDWWHLQW
- Les opérations VRQW OHV PpFDQLVPHV TXL FRPSRVHQW O¶DFWLRQ HW TXL VRQW UpDOLVpV GH PDQLqUH
inconsciente.
Cependant, comme le soulève (Hanser 2003), il est difficile de cerner les limites entre ces
WURLVFRQFHSWV3DUH[HPSOHVHORQFHVGpILQLWLRQVOHSURMHWGHFRQVWUXFWLRQG¶XQEkWLPHQWHVWOXLmême identifié comme activité. Il est cependant découpé en sous-activités relatives à des sousobjectifs comme réduire les couts, ou atteindre une performance thermique. De même, il est
GLIILFLOH G¶LGHQWLILHU FH TXL HVW GH O¶RUGUH GH O¶DFWLRQ RX GH Oa sous-action au travers de tous les
SURFHVVXV PLV HQ °XYUH GDQV XQ WHO SURMHW (QILQ OH FDUDFWqUH LQFRQVFLHQW G¶XQH RSpUDWLRQ HVW
IRUWHPHQWGpSHQGDQWGHO¶DSSUHQWLVVDJHGHO¶DFWHXUTXLO¶H[pFXWH
6RXV OH PrPH FRQFHSW G¶DFWLYLWp OHV WUDYDX[ de nos prédécesseurs regroupent le projet, les
phases de projet, et les tâches.
Le projet et les phases de projet
,O HVW DGPLV GH FRQVLGpUHU XQ SURMHW $,& FRPPH XQ GRXEOH SURFHVVXV FRPSRVp G¶XQH pWDSH
préparatoire (liée à la conception) HW G¶XQH pWDSH RSpUDWRLUH (liée à la construction). Plus
ODUJHPHQW FHV GHX[ pWDSHV V¶LQVFULYHQW GDQV XQ HQVHPEOH de phases GX F\FOH GH YLH G¶XQ
bâtiment, dont la granularité varie selon les études (Bobroff et al. 1993; Armand 1997; Hanser
2003; Kubicki 2006). Nous retenons dans cette thèse les phases suivantes :
- le montage pendant lequel la maîWULVHG¶RXYUDJHDFTXLHrt le terrain, définit le programme du
bâtiment à construire, établit le budget et choisit les concepteurs (éventuellement par le
PR\HQG¶XQFRQFRXUV
- la conception (aussi appelée phase « études ») pendant laquelle la maîtrise G¶°XYUHIRUPXOH
« une réponse architecturale, technique et économique ª j OD GHPDQGH GX PDvWUH G¶RXYUDJH
Selon la loi MOP, elle comprend les (sous-)phases Esquisse, Avant Projet Sommaire (APS),
Avant Projet Détaillé (APD), Projet et Assistance aux contrats de travaux.
- La construction (qui contient la mise en chantier et le chantier) pendant laquelle les différents
corps de métiers réalisent les travaux et érigent le bâtiment conçu. Les constructeurs sont
HQJDJpVSDUOHPR\HQG¶DSSHOVG¶RIIUHVIl est de la responsabilité du coordinateur de répartir
les différentes interventions et de suivre le déroulement du chantier.
- /¶exploitation qui fait suite à la réception du bâtiment et comprend la vérification, la gestion
et la maintenance de celui-ci.
4
http://fr.wikipedia.org/wiki/Activité 26 Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale |
La fin de vie G¶XQ EkWLPHQW est souvent vue comme la dernière phase du projet. Nous
préférons la considérer comme un nouveau projet en soi, avec sa propre étape préparatoire
VXSSRUWpH SDU O¶pWXGH GH O¶H[LVWDQW HW GHV VROXWLRQV à adopter) suivie G¶XQH étape opératoire (la
PLVHHQ°XYUHGHVWUDYDX[de requalification ou sa démolition).
Le concept de tâche
/RUVTX¶RQ SDUOH GH OD répartition du travail dans un projet, aussi appelée coordination du
projet, on utilise plus communément le terme tâche. 8QHWkFKHHVWXQHIUDFWLRQG¶DFWLYLWpDWWULEXpH
à un membre du projet. Ce fractionnement diffère selon la nature de la répartition (Kvan 2000;
Henri & Lundgren-Cayrol 2001; Kubicki 2006; Piquet 2009). (Malone & Crowston 1994) la
définissent de manière générale comme « la gestion des dépendances entre les activités ».
- 'DQVOHFDVG¶XQHcoordination dite collaborativeOHOLYUDEOHG¶XQHWkFKHHVWune version du
SURGXLW ILQDO 'DQV FH FDV FKDTXH DFWHXU SDUWLFLSH SOHLQHPHQW j OD UpVROXWLRQ GH O¶REMHFWLI,
F¶HVWXQWUDYDLO© G¶pJDOjpJDO ». Lors de la mise en commuQO¶pFKDQJHHQWUHOHVGLIIpUHQWV
acteurs est fort et le travail individuel devient difficilement identifiable. « Le travail
FROODERUDWLI QH UHOqYH SDV G¶XQH UpSDUWLWLRQ j SULRUL GHV U{OHV » (Piquet 2009) LO V¶DJLW de la
« UpVROXWLRQFRPPXQHG¶XQSUREOqPH » (Sylvain Kubicki 2006).
- Si la coordination est coopérative, chaque tâche donne lieu à une partie du produit final, ces
parties étant ensuite assemblées. Cela nécessite une attribution précise de chaque tâche à un
acteur en fonction de son rôle (voir 1.1.1). /¶pFKDQJHHVW faible et chacun est responsable de
sa tâche, dans un groupe hiérarchiquement organisé. Les ressources sont également attribuées
indépendamment pour chaque tâche.
/HSDVVDJHG¶XQHVLWXDWLRQFROODERUDWLYHjXQe situation coopérative est G¶DLOOHXUVperceptible
DXFRXUVGHVSKDVHVG¶XQSURMHW$IC. La collaboration est relative aux activités conceptuelles, on
O¶REVHUYHSDUH[HPSOHHQSKDVHHVTXLVVHORUVTX¶XQHpTXLSHGHFRQFHSWHXUVFRQoRLWOHEkWLPHQWj
partir du programme. Chacun en fait sa propre interprétation et propose sa version du bâtiment
envisagé. /DFRRSpUDWLRQHVWREVHUYDEOHORUVG¶DFWLYLWpVGHIRUPDOLVDWLRQRXG¶H[pFXWLRQ comme
le PRQWDJH GH O¶$3' par exemple. Les tâches comme le dessin des plans, des façades, des
coupes, la réalisation des perspectives, HWF«sont alors réparties individuellement selon les rôles
de chacun. Le concepteur, alors supérieur hiérarchique supervise les tâches. Il en va de même sur
OHFKDQWLHUFKDFXQpWDQWUHVSRQVDEOHG¶XQpOpPHQWGHO¶RXYUDJHjFRQVWUXLUH
4X¶HOOHV V¶LQVFULYHQW GDQV XQH FROODERUDWLRQ RX XQH FRRUGLQDWLRQ Oes tâches peuvent être
W\SpHV HQ IRQFWLRQ GH OHXU QDWXUH HW GH FH TX¶HOOHV VHUYHQW j DFFRPSOLU (Hanser 2003) identifie
trois types :
- les tâches de productioQTXLFRQVLVWHQWjODPDQLSXODWLRQG¶REMHWVHQFRQFHSWLRQ,
- lHVWkFKHVGHV\QWKqVHTXLVRQWGHO¶RUGUHGXGpFLVLRQQHOFRPPHODYDOLGDWLRQRXOHYRWH,
- lHV WkFKHV GH FRRUGLQDWLRQ TXL VRQW GH O¶RUGUH GH O¶RUJDQLVDWLRQQHO DYHF OD JHVWLRQ GHV
ressources, des pKDVHVGHWUDYDLOGXSHUVRQQHO«
1.1.4 Conclusion
Le schéma suivant (Figure 2), issu de (Guerriero 2009)UHWUDFHO¶pYROXWLRQGHVFRQFHSWVque
nous venons de décrire, composant le contexte coopératif dans les travaux précédemment menés
au sein du laboratoire CRAI.
| Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
27 Figure 2.
Évolution des concepts du contexte GHO¶DFWLYLWpFROOHFWLYH de
2003 à 2006 (issu de (Guerriero 2009))
La dernière caractérisation du contexte coopératif est représentée par le diagramme relationnel
qui suit (Figure 3).
Les relations entre chacun des concepts principaux (classes primaires) caractérisent ce que
nous appellerons la dynamique du projet. Une relation entre deux éléments définit les actions ou
OHVVWDWXWVG¶XQpOpPHQWSDUUDSSRUWjXQDXWUH3DUH[HPSOH :
- la relation acteur-artefact est UHODWLYHjO¶pGLWLRQGHGRFXPHQWVRXHQFRUHjO¶pODERUDWLRQG¶XQ
ouvrage et peut en définir la nature (ex. un acteur « rédige » un document),
- la relation activité-activité détermine O¶RUGRQQDQFHPHQWGHVWkFKHVH[XQHWkFKH© succède »
à une autre tâche).
Figure 3.
Extrait du méta-modèle du contexte GHO¶DFWLYLWpFROlective
(issu de (Guerriero 2009)
28 Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale |
Cependant, ces relations ne sont pas clairement définies 'H SOXV OD GHVFULSWLRQ G¶XQH
situation collaborative de par ces relations reste ambiguës. Par exemple, si un document est créé
SDU XQ DFWHXU LO HVW DXVVL OH IUXLW G¶XQH DFWLYLWp HW pJDOHPHQW SURGXLW SDU XQ RXWLO Il faudrait
pouvoir définir clairement la nature de ces relations. Nous constatons donc un besoin de
restructurer ce modèle.
5DSSHORQV pJDOHPHQW TXH OD FDUDFWpULVDWLRQ GX FRQWH[WH GH O¶DFWLYLWp FROOHFWLYH a MXVTX¶j
présent été menée afin de visualiser et comprendre de celui-ci. 2Q SDUOH G¶DLOOeurs de multivisualisation, le but étant de lier entre elles des représentations différentes comme le font par
H[HPSOHOHVRXWLOV%DW¶L9LHZV(Kubicki 2006) HW%DW¶L7UXVW(Guerriero 2009).
Nous montrons dans ce travail que cette représentation peut aussi servir une approche plus
SURGXFWLYHHQGHYHQDQWODEDVHGHODFRQFHSWLRQG¶RXWLOV
On note à ce propos que dans sa thèse, $QQLH*XHUULHURQH FRQVLGqUH SDVO¶RXWLO ORUVTX¶HOOH
traite de la confiance vis-à-YLVGXFRQWH[WHG¶XQSURMHW&HFRQFHSWVXVFLWHHQHIIHWO¶LQWHUURJDWLRQ :
O¶RXWLOIDLW-LOSDUWLHGXFRQWH[WHG¶XQSURMHWRXHVW-FHTX¶LOO¶LQVWUXPHQWH ? Doit-il être considéré en
même de temps ou a posteriori des caractérisations du projet ?
Nous choisissRQV GH FRQVLGpUHU O¶RXWLO FRPPH XQ PR\HQ GH PpGLDWLVer le contexte de
O¶DFWLYLWp FROOHFWLYH G¶XQ projet et non pas comme un élément de celui-ci. Cela nous permet en
effet de traiter leur description de manière séparée G¶DERUGOHPpWLHUSXLVO¶RXWLOODJH, cherchant
ensuite j FDUDFWpULVHU OH OLHQ TXL V¶RSqUe entre activité collective et outils à travers cette
médiatisation.
Le sous-FKDSLWUH VXLYDQW MXVWLILH OH EHVRLQ G¶XQH telle médiatisation et présente ensuite des
H[HPSOHVG¶RXWLOV.
1.2 Les projets de construction et les outils de TCAO
1.2.1 Pourquoi PpGLDWLVHUO¶Dctivité collective ?
(Kubicki et al. 2006) UHOqYH O¶LPSRUWDQFH GH OD maîtrise des processus de coordination pour
DVVXUHU OH VXFFqV G¶XQ SURMHW $IC et par extension, la qualité du bâtiment construit. Certains
facteurs liés à la nature du projet AIC et porteurs de risques (c.à.d. VXVFHSWLEOHVGHV¶RSSRVHUj
son bon déroulement) font émerger O¶LPSRUWDQFHGe cette maîtrise :
- de nombreuses contraintes fonctionnelles, techniques, économiques et esthétiques qui varient
G¶XQSURMHWjXQDXWUH,
- de nombreux acteurs avec leurs propres connaissances et méthodes de travail, certains parfois
réfractaires à adapter celles-ci à un projet particulier,
- des équipes éphémères qui se recomposent tout au long du projet,
- des relations contractuelles non hiérarchiques et des décisions non centralisées
(particulièrement en phase chantier),
- un séquençage du projet basé sur des prises de décision « sur le tas », mais pourtant
déterminantes et parfois irréversibles,
- des interactions entre acteurs informelles, peu tracées et peu prédictives.
| Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
29 Nous avons précédemment distingué coordination collaborative et coordination coopérative.
Pour rappel, on peut dire que ORUV G¶XQH FRRSpUDWLRQ « on VDLW SUpFLVpPHQW FH TX¶RQ YD IDLUH »
alors que dans la collaboration, « RQDO¶LGpHGHFHYHUVTXRLRQva » sachant que cela peut évoluer
(Rameau & Samyn 2006). Afin de mieux comprendre la nature des processus de coordination,
(Kubicki 2006) opère trois autres distinctions :
- entre coordination explicite (basée sur les artefacts) et implicite (orale),
- entre coordination hiérarchique (multi-acteurs), adhocratique (inter-acteurs) et transversale
(extra-acteurs),
- entre ajustement mutuel, supervision et standardisation
La coordination explicite se base sur une ligne de progression bien établie et la résolution des
problèmes par anticipation. Cependant, O¶DQWLFLSDWLRQGHVSUREOqPHVQ¶HVWSDVWRXMRXUVSRVVLEOHHW
LOHVWQpFHVVDLUHG¶DGDSWHUOHSURFHVVXVDX[FKDQJHPHQWV : on parle alors de coordination implicite
(Andersen et al. 2000; C Godart et al. 2001).
La coordination hiérarchique ou multi-DFWHXUVUHSRVHVXUOHSDUWDJHGHO¶LQIRUPDWLRQ pour le
groupe et la conscience de celui-ci en ce qui concerne le déroulement du projet. La coordination
adhocratique ou inter-DFWHXUVFDUDFWpULVHXQWUDYDLOG¶DFWHXUjDFWHXUDXVein du projet alors que la
coordination transversale ou extra-acteurs met en relation un acteur du projet avec un acteur dit
« externe » (comme un expert ou un sous-traitant spécialisé). Dans les deux cas (inter/extra) on
observe plutôt un phénomène de misHHQFRPPXQGHO¶LQIRUPDWLRQEDVpHVXUO¶pFKDQJH, différent
de la diffusion à sens unique dont les droits reviennent à une entité hiérarchique (Figure 4).
Figure 4.
Distinction entre coordination hiérarchique, adhocratique et
transversale (tiré de (Kubicki 2006))
Enfin à partir des travaux de Mintzberg (Mintzberg 1989), on distingue les mécanismes de
FRRUGLQDWLRQ G¶DMXVWHPHQW PXWXHO EDVpV VXU OD FRPPXQLFDWLRQ LQIRUPHOOH GH OD VXSHUYLVLRQ
(basée sur des ordres et des instructions) et de la standardisation (c.à.d. de la spécification des
procédés, des résultats à obtenir ou encore des qualifications à avoir).
Le schéma suivant (Figure 5) illustre la corrélation entre les caractères de la coordination dans
un projet AIC. LHV DFWLYLWpV LPSOLTXDQW XQ JUDQG QRPEUH G¶DFWHXUV W\SLTXHPHQW les activités
opératoires comme celles de construction en phase chantier, sont en général de nature coopérative
HW QpFHVVLWH G¶rWUH RUJDQLVpHV GH PDQLqUH H[SOLFLWH Les activités préparatoires, relatives à la
conception en collaboration, reposent quant à elles sur la prise récurrente de décisions HWO¶DXWRorganisation du travail pondérée par des ajustements mutuels. Nous constatons également à
travers ce schéma que les artefacts manipulés (les plans en sont le meilleur exemple) sont en
constante évolution lors des activités préparatoires (artefacts dynamiques) DORUV TX¶LOV VRQW
finalisés lors des activités opératoires (artefacts statiques).
30 Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale |
Figure 5.
Caractérisation des activités de coordination dans un projet
AIC (adapté de (Kubicki 2006))
La volonté de maîtriser la coordination HWGHIDFLOLWHUO¶DXWR-coordination DPRWLYpO¶XWLOLVDWLRQ
G¶RXWLOVmédiatisant celle-ci. Pour cela il a fallu améliorer notre compréhension de cette activité
collective et définir celle-ci sous toutes ses formes. Parallèlement O¶LQQRYDWLRQ FRQVWDQWH HQ
matière de technologies ouvre le panel des possibles, et favorise la création de nouveaux outils.
Nous en présentons quelques types dans la section suivante, certains fréquemment utilisés et
LQWpJUpVDX[SURMHWVG¶DXWUHVSOXVLQQRYDQWVHWSURVSHFWLIV
1.2.2 /HVW\SHVG¶RXWLOV
'H PDQLqUH JpQpUDOH OHV RXWLOV VXSSRUWDQW OD FRRUGLQDWLRQ SHUPHWWHQW G¶pWHQGUH OHV
fonctionnalités de nos outils classiquement utilisés pour gérer nos activités, dans un cadre pluriXWLOLVDWHXU /¶H[HPSOH OH SOXV FRXUDQW HVW OH FDOHQGULHU TXH QRXV SRXYRQV XWLOLVHU VHXO RX D
plusieurs. Les outils dont nous parlerons sont des outils numériques et non pas des outils dits
« physiques ªFRPPHO¶HQJin de chantier).
Médiatiser la coordination dans les activités opératoires
Les activités considérées ici sont relatives à la construction du bâtiment et plus
particulièrement à sa gestion, son organisation, son contrôle. 3OXVLHXUV W\SHV G¶RXWLOV VRQW
généralement adoptés pour médiatiser ces activités opératoires (Guerriero 2009).
- Les outils de planification permettant de coordonner les différentes tâches dans le temps. Il
existe plusieurs méthodes de planification comme les diagrammes de Gantt (exemple Figure
6), PERT ou « Line Of Balance » (Yamin & Harmelink 2001).
| Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
31 Figure 6.
-
-
-
-
Exemple de diagramme de GANTT 5
Les outils de compte-rendu permettent de rédiger les comptes-rendus de réunion et autres
rapports relatifs au chantier. Les outils de traitement de texte sont les plus couramment
utilisés, PDLV OH GpYHORSSHPHQW G¶RXWLOV QXPpULTXHV GpGLpV « afin de structurer le contenu
G¶XQ GRFXPHQW HVW DSSDUX FRPPH XQH SHUVSHFWLYH LQWpUHVVDQWH SRXU IDFLOLWHU WDQW O¶pGLWLRQ
que la diffusion et la consultation du compte-rendu » (Guerriero 2009).
Les outils de gestion des coûts et des ressources souvent sous la forme de tableurs ont pour
EXWG¶DQWLFLSHUOHEXGJHWORUVGHVSULVHVGHdécisions, mais aussi de gérer les paiements durant
ODFRQVWUXFWLRQGHO¶ouvrage.
/HV SODWHIRUPHV G¶pFKDQJH GH GRFXPHQWV permettent de centraliser les documents dans un
HVSDFH SDUWDJp HW GH JpUHU O¶DFFqV GHV GLIIpUHQWV DFWHXUV ,OV SRVVqGHQW GHV IRQFWLRQQDOLWpV
FRPSOpPHQWDLUHVWHOOHVTXHO¶DMRXWGHFRPPHQWDLUHVVXUXQGRFXPHQWpartagé, la notification
SDUPDLOORUVG¶XQSDUWDJH«
Les outils de mesure SHUPHWWHQWG¶pYDOXHU les performances du bâtiment (ex. les performances
énergétiques) sur la base du recueil de données, de OD VLPXODWLRQ HW OD JpQpUDWLRQ G¶XQH
évaluation (relative ou absolue).
Les outils de maquettage numérique sont une évolution des outils de Conception Assistée par
Ordinateur (CAO) classiques. Ils SHUPHWWDQW G¶DMRXWHU j XQ PRGqOH ' GHV LQIRUPDWLRQV
relatives aux éléments de O¶RXYUDJH WHO que la composition, les propriétés, la technique de
PRQWDJHjHPSOR\HU«
/HV GLYHUV RXWLOV FRPPH OH WpOpSKRQH OH PDLO OD PHVVDJHULH LQVWDQWDQpH« supportent la
communication.
2QSDUOH G¶RXWLO' SXLVQ'ORUVTX¶LOV¶DJLWGHUHSUpVHQWHUXQPRGqOH'RXXQHPDTXHWte
numérique) et de lier les ouvrages à des tâches dans une vue planning qui apparait alors comme
XQHTXDWULqPHGLPHQVLRQSXLVjG¶DXWUHV LQIRUPDWLRQVFRPPHODUHSUpVHQWDWLRQGHVFR€WVHWF«
Le tableau de bord HVW XQ RXWLO SDUWLFXOLHU TXH O¶RQ SHXW TXDOLIier d¶RXWLO G¶DJUpJDWLRQ HW de
synthèse vis-à-vis des autres outils que nous venons de présenter. Il apparait comme un
« instrument de mesure » (Fernandez 2010) en fournissant des valeurs synthétiques relatives à
O¶LQIRUPDWLRQWUDLWpHH[OHVWDWXWG¶XQH tâche, le nombre de remarques dans un rapport). Dans un
5
Image tirée de http://www.gestiondeprojet.net/articles/gantt.html 32 Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale |
VHFRQGWHPSVLOSHXWVXJJpUHUGHVFRPSRVLWLRQVGHYXHVFRQWHQDQWO¶LQIRUPDWLRQJpQpUpHSDUOHV
autres outils et faisant état du déroulement du projet.
La médiatisation de la coordination dans les activités préparatoires
&RPPHQRXV O¶DYRQV GpILQL, les activités préparatoires sont relatives à la conception et sont
essentiellement basées sur la « mise en commun ª G¶LQIRUPDWLRQ /H VFKpPD VXLYDQW Figure 7)
issu de (Hanser 2003) illustre cela par les phénomènes de conception distribuée et de coconception.
Figure 7.
Processus de conception alternant conception distribuée et
points de synthèse (tiré de (Hanser 2003))
Malgré l¶DMXVWHPHQW PXWXHO qui caractérise la conception, la traçabilité des choix et des
activités reste un atout et un besoin, notamment lors de la mise en commun et la synthèse des
propositions. Les outils qui assistent la coordination en phase chantier répondent également aux
besoins de la conception.
- Les outils de calendrier partagé permettent de fixer des dates limites, des rendez-vous,
G¶RUJDQLVHUGHVpYqQHPHQWV et notamment planifier les points de synthèse«
- Les outils de partage permettent de diffuser des documents /¶LQWpJUDWLRQ GDQV OHV RXWLOV GH
production permet O¶pGLWLRQSDUSOXVLHXUVDFWHXUV2QWURXYHFHJHQUHGHIRQFWLRQQDOLWpVSRXU
O¶pGLWLRQGHWH[WHVH[DYHF*RRJOH'RFXPHQWVPDLVDXVVLSOXVUpFHPPHQWSRXUODFUpDWLRQ
de plans (ex. Autocad, voir Figure 8).
- La maquette numérique SHXWDXVVLrWUHXWLOLVpHHQVLWXDWLRQGHFRQFHSWLRQO¶ingénieur pouvant
par exemple « récupérer le modèle établi par O¶architecte en vue de dimensionner les
structures ou encore de réaliser des simulations » (Guerriero 2009).
| Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
33 Figure 8.
FonctionnaOLWpVFROODERUDWLYHVGDQVO¶RXWLOGH&$2$XWRFDG
L¶DVVRFLDWLRQGHGHX[RXWLOVTXHVRQWOHEXUHDXYLUWXHOXQHWDEOHjGHVVLQQXPpULTXHFRXSOpH
à un système de visioconférence) et le logiciel Sketsha (un logiciel de croquis distribués) (Figure
9) est un exemple de dispositif GHPpGLDWLVDWLRQGHODFRQFHSWLRQFROODERUDWLYHSDUO¶HVTXLVVH. Il
permet à « deux équipes distantes de collaborer dans des conditions reproduisant la coprésence
>«@ de collaborateurs géographiquement dispersés ». Il est notamment utilisé dans un projet de
co-conception en milieu universitaire nommé le Studio Digital Coopératif (SDC) (Safin et al.
2012).
Figure 9. Utilisation du dispositif « Bureau Virtuel + Sketsha » au
cours du projet SDC (photos tirées de (Saffin & Leclercq 2010))
1.2.3 /¶DGDSWDWLRQDXFRQWH[WH
/HVRXWLOVSURSRVpVSRXUDVVLVWHUOHVDFWLYLWpVGHVDFWHXUVG¶XQSURMHW$,&VRQWGpYHORSSpVGH
manière à être « adaptés ªDXVHFWHXU/¶DGDSWDWLRQG¶XQRXWLOHVWODPDQLqUHGRQWFHOXL-ci répond
aux besoins de ses utilisateurs. Nous verrons que ces besoins sont étroitement liés à la notion de
contexte.
(Kubicki 2006) présente le concept de contexte « tri-facettes » composé des trois contextes
GpILQLVVDQW OH UDSSRUW G¶XQ DFWHXU j VRQ DFWLYLWp DX WUDYHUV GHV RXWLOV TX¶il manipule. Ces trois
contextes sont (Figure 10) :
34 Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale |
-
le contexte acteurTXLFDUDFWpULVHOHVLQWHQWLRQVHWOHVSUpIpUHQFHVGHO¶DFWHXUTXLDSSUpKHQGH
O¶RXWLO,
le contexte utilisateurTXLFDUDFWpULVHO¶LQWHUDFWLRQDYHFO¶RXWLOO¶RXWLOOXL-même mais aussi
son environnement,
le FRQWH[WHGHO¶DFWLYLWpFROOHFWLYH, caractérisant le projet.
Figure 10. Le contexte « tri-facettes » selon (Kubicki 2006)
$ILQG¶rWUHPpGLDWLVpSDUO¶RXWLOOHFRQWH[WHGHO¶DFWLYLWpGRLWrWUHFRQQXHWFDUDFWpULVp&HOD
IDLWO¶REMHWGHVpWXGHVFLWpHVSUpFpGHPPHQW (cf. § 1.1).
Les rôles et expériences dites « métier » GH O¶DFWHXU VRQW OHV IDFWHXUV GpWHUPLQDQWs de son
contexte. Ils vont grandement influencer son EHVRLQ G¶LQIRUPDWLRQ HW GRQF OD PDQLqUH GRQW LO
voudra et devra percevoir les éléments médiatisés. Par exemple, un ingénieur voudra avoir un
accès aux documents plans afin de les consulter, les analyser, voire les modifier alors qX¶XQ
coordinateur cKHUFKHUD DYDQW WRXW j VDYRLU V¶ils ont bien été diffusés, dans les délais convenus,
HWF«
Enfin le contexte utilisateur F¶HVW ODFRPELQDLVRQ GHVIRQFWLRQQDOLWpV WHFKQLTXHVRIIHUWHVSDU
XQRXWLOHWGHO¶HQYLURQQHPHQWGDQVOHTXHOVHWURXYHQWO¶XWLOLVDWHXUHWFHWRXWLO. Le projet AIC est
XQ FDV W\SLTXH G¶DFWLYLWp j HQYLURQQHPHQWV PXOWLSOH O¶DJHQFH OH FKDQWLHU OHV SDUWHQDLUHV OHV
OLHX[GHUpXQLRQVGLYHUVHV«/HVWHFKQRORJLHVjGLVSRVLWLRQVRQWGHSOXVHQSOXVSerformantes et
DFFHVVLEOHVHWOHVSRVVLELOLWpVG¶LQQRYDWLRQVRQWFURLVVDQWHVFRPPHOHGpPRQWUHO¶H[SpULHQFH SDC
TXHQRXVYHQRQVG¶LOOXVWUHU&HODV¶DSSOLTXHpJDOHPHQWHWWRXWSDUWLFXOLqUHPHQWDX[WHFKQRORJLHV
mobiles. Les performances des ordinateurs portables, des tablettes tactiles et Smartphones ont
augmenté, tout comme leur autonomie et leur connectivité réduisant ainsi le nombre de
FRQWUDLQWHVTXHO¶RQ pouvait assigner à la mobilité il y a quelques années (Satyanarayanan 1996).
1.3 Conclusion
Nous avons dans ce chapitre caractérisé OD FRRUGLQDWLRQ G¶un projet AIC et les outils qui la
supportent. (Q FRQFOXVLRQ GH OD SUHPLqUH SDUWLH VXU OD FDUDFWpULVDWLRQ GX FRQWH[WH GH O¶DFWLYLWp
collective (cf. 1.1.4), nous avons introduit le fait que celle-ci puisse servir la conception des outils
qui le médiatise. Pour cela, nous avons choisi d¶LVROHUO¶DQDO\VHHWODFDUDFWpULVDWLRQGHFHVRXWLOV
pour ensuite identifier ce qui définit la manière dont ils V¶DGDSWHQWau contexte.
| Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
35 DHV pWXGHV RQW PRQWUp TX¶j FH FRQWH[WH GH O¶DFWLYLWp FROOHFWLYH VH JUHIIHQW GHX[ DXWUHV
FRQWH[WHVUHODWLIVDX[DFWLRQVLQGLYLGXHOOHVGHO¶DFWHXU: le contexte acteur et le contexte utilisateur.
Nous parlons alors d¶XQ contexte « tri-facettes ».
&¶HVW SDU UDSSRUW à O¶HQVHPEOH Gu contexte tri-facettes que nous devons considérer la
FRQFHSWLRQG¶XQRXWLOFDUF¶HVWFHWWHFRPELQDLVRQTXLGpILQLt le mieux les besoins des acteurs dans
leur globalité. Or, la qualité perçue des outils est étroitement liée à leur capacité à répondre à ces
besoins.
-
Dès lors, deux approches de conception se distinguent :
une approche « top-down », selon laquelle on crée les outils en fonction des besoiQVF¶HVWXQ
SURFHVVXVG¶LQJpQLHULHFODVVLTXH,
une approche « bottom-up » SRXUODTXHOOHOHVRXWLOVVRQWFUppVGDQVXQSURFHVVXVG¶LQQRYDWLRQ
WHFKQRORJLTXHSXLVWUDQVIpUpV YHUVXQ RX SOXVLHXUVVHFWHXUVG¶XWLOLVDWLRQ avec une éventuelle
adaptation (on parle de rétro-ingénierie).
Au cours du chapitre suivant, nous nous penchons sur O¶DQDO\VH du GpYHORSSHPHQW G¶XQH
SODWHIRUPHG¶pFKange de documents particulière. /¶REMHFWLIHVWGHSRXYRLUen évaluer la méthode
de conception afin de comprendre les points forts à capitaliser, mais aussi les limites à surmonter.
36 Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale |
Chapitre 2 ± Un cas de
dévHORSSHPHQW G¶XQ RXWLO GH
TCAO : CRTI -weB
Le projet de recherche Build-IT fut mené par le Centre de Recherche Public Henri Tudor
(CRP HT) et le Centre de Ressources des Technologies HW GH O¶,QQRYDWLRQ SRXU OH EkWLPHQW
(CRTI-B) pour « JXLGHU OH VHFWHXU OX[HPERXUJHRLV GH OD FRQVWUXFWLRQ YHUV O¶XWLOLVDWLRQ G¶RXWLOV
QXPpULTXHV G¶DVVLVWDQFH j OD FRRSpUDWLRQ » (Guerriero 2009) %DVp VXU O¶DQDO\VH GHV © bonnes
pratiques » du secteur, ce projet aboutit DX SURWRW\SDJH G¶XQ RXWLO : CRTI-weB. Cet outil est
composé de deux « services métier » XQVHUYLFHG¶pFKDQJHGHGRFXPHQWVHWXQVHUYLFHGe gestion
(édition et partage) de compte-rendu de chantier6. Ce que nous appelons « expérience CRTIweB » comprend ce projet de recherche, mais aussi les développements, le transfert et les
pYDOXDWLRQV GH O¶RXWLO TXL RQW VXLYL (OOH FRPSUHQG pJDOHPHQW OHV WUDYDX[ DFWXHOV pour
O¶DPpOLRUDWLRQGHO¶RXWLO par la proposition de nouvelles fonctionnalités.
Le contexte de travail au sein du CRP Henri Tudor offre XQVWDWXWG¶REVHUYDWHXUSULYLOpJLpVXU
le déroulement actuel de cette expérience. Cela nous D SHUPLV G¶DQDO\VHU O¶XWLOLVDWLRQ GH O¶RXWLO
DLQVLTXHOHWUDYDLOGHGpYHORSSHPHQWPHQpSRXUO¶DPpOLRUHU
1.4 Description GHO¶H[SpULHQFH
/¶DSSURFKH PHQpH D VXLYL XQH WUDPH GH GpYHORSSHPHQW EDVpH VXU OD QRWLRQ GH © bonnes
pratiques à outiller ª TXH O¶RQ SHXW GpFRXSHU DLQVL : identification des besoins métiers et bonnes
SUDWLTXHV FDUDFWpULVDWLRQ GH O¶LQIRUPDWLRQ j PDQLSXOHU proposition et définition des services
SURSRVpVSDUO¶RXWLOSRXUFKDTXHERQQHSUDWLTXH et développement.
Devant la difficulté de déterminer précisément les fonctionnalités utiles à la collaboration
considérant les facteurs à risques du projet (cités plus tôt en 1.2.1), la définition finale des bonnes
SUDWLTXHV j PHWWUH HQ SODFH D IDLW O¶REMHW G¶XQ FRQVHQVXV HQWUH OH &53 +7 HW OH &57,-B. En ce
6
Plaquette descriptive de la plateforme disponible sur ce lien : http://uat.crti-­‐
web.com/public/Description_de_la_plateforme_CRTIweB.pdf | Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB
37 sens, ces pratiques consensuelles sont relatives à des comportements généralement observés dont
OHVGHX[RUJDQLVDWLRQVRQWMXJpO¶RXWLOODJHQpFHVVDLUH
Nous introduisons ici le concept de service, jusque-là non évoqué. Cette notion que nous
GpWDLOOHURQVSOXVWDUGSHUPHWGHGpILQLUOHVIRQFWLRQQDOLWpVG¶XQRXWLODXVVLELHQG¶XQSRLQWGHYXe
JpQpUDOTXHG¶XQSRLQWGHYXHWHFKQLTXH
1.4.1 I dentification des besoins métiers et bonnes pratiques
/HVSUHPLqUHVSKDVHVG¶DQDO\VHVRXVODIRUPHGHEUDLQVWRUPLQJRQWFRQGXLWjO¶LGHQWLILFDWLRQ
GHGHX[HQMHX[RXEHVRLQVUHODWLIVjO¶RXWLOODJHQXPpULTXHGHODFRQGXLWHG¶XQSURMHW$,& :
- la rédaction et la diffusion de comptes-rendus de chantier en prenant en compte les
spécificités et la structure de ce document,
- la diffusion de documents diverses durant le projet, que ce soit des plans, des textes, des
tableaux«
Relativement à ces besoins, les professionnels ont pu identifier certaines « bonnes pratiques »
généralement adoptées dans le cadre de leur travail (Tableau 1). Une bonne pratique est
caractérisée par une action (ex. rédiger, FRQVXOWHU«TXL© cible » une information (ex. le compteUHQGXOHVUHTXrWHVVXUXQSODQ«
Tableau 1. Besoins métiers à outiller et bonnes pratiques liées
Besoins
Rédaction et
diffusion de CR
Diffusion de
documents
Bonnes Pratiques
(CR1) Rédiger un compte-rendu selon un modèle prédéfini
(CR2) Animer la réunion de chantier et prise de notes
(CR3) Consulter le compte-rendu
(CR4) Lire les remarques qui nous concernent
(CR5) Réactions sur les points particuliers du CR
(CR6) Se tenir au courant de l'avancement des tâches de
construction
(CR7) Archiver un compte-rendu à valeur contractuelle (nonmodifiable)
(CR8) Rechercher les remarques en cas de litige
(Doc1) Standardiser le nommage des documents
(Doc2) Décrire et localiser les modifications effectuées sur un
document
(Doc3) Informer les personnes concernées d'un dépôt ou de la de
la modification d'un document
(Doc4) Transmettre et enregistrer les requêtes relatives à chaque
document
(Doc5) Réagir concernant un document et tracer les réactions
(Doc6) Maîtriser la visibilité des documents
(Doc7) Superviser et gérer l'échange des documents
Ces bonnes pratiques sont exercées par un ou plusieurs acteurs en fonction de leur rôle à la
fois organisationnel et opérationnel. Par exemple, la rédaction d¶XQcompte-rendu est attribuée au
coordinateur (rôle organisationnel) qui est alors considéré comme seul éditeur (rôle opérationnel)
38 Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB |
de ce type de documents, alors que le partage de plans se fait par tous les concepteurs impliqués
dans la production plans.
1.4.2 Caractérisation des comptes-rendus et autres documents
/DPRGpOLVDWLRQGXFRQWH[WHGHO¶DFWLYité collective dans un projet AIC a permis de définir un
FHUWDLQ QRPEUH GH FRQFHSWV GRQW FHOXL GH GRFXPHQWV /¶pWXGH GHV EHVRLQV a montré que le
compte-rendu faiVDLW O¶REMHW G¶XQH FDUDFWpULVDWLRQ SDUWLFXOLqUH SRVVpGDQW XQH VWUXFWXUH SURSUH j
considérer dans la définition G¶XQVHUYLFHGpGLpjVDJHVWLRQ. Comme nous pouvons le lire dans
(Guerriero 2009), un modèle spécifique a été défini « prenant en compte les concepts particuliers
de gestion de chantier autour du compte-rendu, et de la gestion documentaire ».
Un compte-rendu est lié à une réunion de chantier, résumant les informations relatives à celleFL HW SHUPHWWDQW GH JDUGHU WUDFH GH FH TXL V¶\ HVW GLW Une réunion de chantier est en général
SUpFpGpHG¶XQHYLVLWHGHFHOXL-ci, permettant de relever les éléments dont il faudra discuter. Ainsi,
le compte-rendu de chantier FRQWLHQW XQ HQVHPEOH G¶LQIRUPDWLRQV VWUXFWXUpHV VRXV OD IRUPH de
rubriques.
- Les références serYHQWjO¶LGHQWLILFDWLRQG¶XQFRPSWH-rendu, comme un numéro, une date de
FUpDWLRQOHQRPGHO¶DXWHXU«&HVUpIpUHQFHVVRQWQRWDPPHQWWUqVXWLOHVORUVG¶XQHUHFKHUFKH
par filtrage de métadonnées.
- La liste de présence et de diffusion contient les personnes présentes à la réunion de chantier et
à qui il faudra diffuser ce rapport.
- Les généralités font état de la situation du chantier et des ressources sur le site. Elles
identifient notamment les interruptions dues aux conditions météorologiques.
- Les notes sont des règles à suivre et des clauses qui s¶DSSOLTXent à chacun (elles sont définies
en début de projet et ne changent en général pas en cours de projet).
- La liste des remarques soulève les points particuliers dont on aura parlé pendant la réunion.
Les remarques possèdent leurs attributs propres, tels TX¶un numéro, un intitulé, une
description littérale, une priorité, une GDWHGHFRQVWDW«« &HVUHPDUTXHVSHXYHQWIDLUHO¶REMHW
de rappels au fil des semaines, ou encore être illustrées par des croquis ou des photos de
chantier ».
- /¶DYDQFHPHQW GpFULW OD SURJUHVVLRQ GX FKDQWLHU il est notamment comparé au planning de
chantier qui aura été fixé.
- /¶DJHQGDSUpFLVHODGDWHHWO¶KHXUHGRQWRQDXUDFRQYHQXSRXUODSURFKDLQHUpXQLRQ.
Les autres documents sont les plans de tout type, les fiches techniques, les tableurs, les
PRGqOHVHWF«F
HVW-à-GLUHWRXWGRFXPHQWVXSSRUWDQWO¶pFKDQJHG¶LQIRUPDWLRQHQWUHOHVDFWHXUVGX
SURMHW8QFHUWDLQQRPEUH G¶DWWULEXWVOHVGpILQLVVHQWHWSHUPHWWHQWOHXUJHVWLRQGDQVXQHEDVHGH
données coPPHjWUDYHUVO¶RXWLO&57,-weB :
- un nom, TXLORUVGHO¶H[SpULHQFHFUWL-ZHEDIDLWO¶REMHWG¶XQWUDYDLOSDUWLFXOLHUGRQQDQWOLHXj
une convention de nommage bien définie. Ainsi le nom de chaque document est la
composition de plusieurs acronymes permettant G¶LGHQWLILHU OD SKDVH GH SURMHW OH W\SH GH
GRFXPHQWVDYHUVLRQHWF«
- un auteur, qui est identifié lors du partage du document après avoir été identifié,
- une zone de visibilité TXLSHUPHWGHUHVWUHLQGUHO¶DFFqVjFHUWDLQVW\SHVG¶DFWHXUV,
- des actions eWGHVUpDFWLRQVTXLSHUPHWWHQWG¶DYHUWLUXQRXSOXVLHXUVDFWHXUVGHODGLVSRQLELOLWp
G¶XQGRFXPHQWRXG¶XQHWkFKHTXHFHOXL-ci doit accomplir vis-à-vis de ce document.
&HVDWWULEXWVVHUYHQWjRUJDQLVHUO¶LQIRUPDWLRQGDQVO¶HVSDFHSDUWDJé et, au même titre que les
références du compte-rendu, à les rechercher.
| Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB
39 1.4.3 Services proposés
/HV IRQFWLRQQDOLWpV GH O¶RXWLO SURSRVp VRQW UHJURXSpes en deux services dits « services
métier ªTXHVRQWOHVHUYLFHG¶pGLWLRQHWGLIIXVLRQGHFRPSWHV-rendus et le service de partage de
document, conformément aux deux besoins identifiés. Le concept de service métier est ici utilisé
SRXU GpFRPSRVHU O¶RXWLO DYHF XQ KDXW QLYHDX G¶DEVWUDFWLRQ &KDTXH ERQQH SUDWLTXH est ensuite
outillée par un « service informatique », une solution fonctionnelle pour effectuer cette pratique.
Le tableau suivant décrit les services informatiques proposés pour chaque bonne pratique, dans les
services métier « compte-rendu » (CR1 à 8) et « documents » (Doc1 à 7).
Tableau 2. Les 15 services informatiTXHVFRPSRVDQWO¶RXWLOCRTI-weB
BP
Services informatiques
(CR1)
Rédaction
(CR2)
Génération d'un brouillon pdf
(CR3)
Consultation
(CR4)
Tri des remarques par organisme
(CR5)
Réactions
(CR6)
Notifications
(CR7)
*pQpUDWLRQG¶XQPdf sécurisé
(CR8)
Recherche
(Doc1)
Nommage de documents et convention de nommage
(Doc2)
Mise à jour
(Doc3)
Notifications
(Doc4)
Actions
(Doc5)
Réactions
(Doc6)
Zones de visibilité
(Doc7)
Tableau de bord des échanges
/¶HQVHPEOH GH FHV VHUYLFHV informatiques fut implémenté sur base des technologies
PHP/MySQL dans une architecture client/serveur et sont accessibles à travers une interface web.
Ces services dits « services-web » sont décrits dans le protocole REST (Fielding 2000). Le
chapitre 5 de ce manuscrit apporte plus de précisions sur le concept de service. Nous le
réinterprétons également dans le cadre de notre proposition (chapitre 11).
/HV GHX[ ILJXUHV VXLYDQWHV LOOXVWUHQW O¶LQWHUIDFH GHV VHUYLFHV PpWLHUV © documents » (Figure
11) et « comptes-rendus » (Figure 12).
40 Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶un outil de TCAO : CRTI-weB |
Figure 11. Interface de CRTI-weB service « Documents »
Figure 12. Interface de CRT-weB service « Comptes-Rendus »
| Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB
41 1.5 Analyse critique
1.5.1 &RQWH[WHHWSURWRFROHG¶DQDO\VH
&RPPH QRXV O¶DYRQV LQWURGXLW SOXV W{W FH WUDYDLO GH WKqVH V¶HVW LQVFULW GDQV XQ FRQWH[WH
G¶DQDO\VHHWGHGpYHORSSHPHQWDXWRXUGHO¶RXWLO&57,-weB.
En ce qui concerne O¶DQDO\VH des utilisations, lHV UHWRXUV G¶H[SpULHQFH UDVVHPEOpV SDU mes
prédécesseurs ont composé un prePLHUFRUSXVG¶pOpPHQWVG¶DQDO\VH1ous les avons complétés en
DFFpGDQW HQ WDQW TX¶REVHUYDWHXUs aux différents projets sur la plateforme afin G¶analyser
précisément les partages. Nous avons notamment porté notre attention sur O¶REMHFWLI GH FHV
partages, les auteurs en fonction des types de GRFXPHQWVO¶XWLOLVDWLRQGHVDFWLRQVHW O¶XWLOLVDWLRQ
des réactions ainsi que leur contenu.
3RXUFHTXLHVWGHO¶DQDO\VHGXGpYHORSSHPHQWQRXVDYRQVSXSRUWHUXQUHJDUGVXUO¶HQVHPEOH
des tâches de développement prévues et menées (sous forme de « tickets » gérés par un outil en
ligne) et identifier la nature de ceux-ci. En plus de cela, nous avons été impliqués dans une tâche
de développement précise HQ WDQW TX¶H[pert métier. &H U{OH G¶H[SHUW D SRXU EXW G¶DQDO\VHU HW
comprendre les besoins des professionnHOV G¶XQ GRPDLQH DILQ GH OHV FDSLWDOLVHU HW OHV WUDQVIpUHU
pour la conception de solutions adaptées.
1.5.2 $QDO\VHGHO¶XWLOLVDWLRQ
/¶RXWLO&57,-weB a fait O¶REMHWGHSOXVLHXUVWHVWVGXFDGUHG¶pYDOXDWLRQGHSURWRW\SHjFHOXL
de feedbacks utilisateurs en utilisation « réelle » dans des projets AIC ou lors d¶DWHOLHUV GH
formation. Le public évaluateur est composé à la fois de professionnels du secteur (architectes,
entreprises de construction et MaîtreVG¶RXYUDJHHWGHVpWXdiants en architecture des universités
de Nancy et Liège (les étudiants ont évalué uniquement le service « documents »). Les premiers
résultats sont publiés dans (Guerriero 2009; Kubicki et al. 2009) PDLVG¶DXWUHVHQTXrWHVRQWGRQQp
OLHXjGHSOXVUpFHQWVFRQVWDWVVDFKDQWTXHO¶RXWLOIDLWO¶REMHWG¶DPpOLRUDWLRQVFRQVWDQWHV
/¶pYDOXDWLRQGXVHUYLFH© Comptes-rendus » en situation G¶DWHOLHUPRQWUHTXHO¶outil apparaît
fiable, facile à utiliser, compatible avec la pratique professionnelle HW TXH O¶DSSUHQWLVVDJH QH
QpFHVVLWHSDVG¶LQYHVtissement personnel important. Pourtant en situation réelle il ne trouve pas sa
place. Une des réponses formulées est largement liée à la difficulté de modifier les usages
internes. En effet, il semble que les personnes aiHQWDGRSWpO¶XWLOLVDWLRQV\Vtématique des modèles
(« templates ») Word ou Excel et que, bien TX¶elles soient conscientes du potentiel de O¶outil
CRTI-weB « Compte-rendu », elles se satisfont de leur outil actuel.
Le service « Documents ªDIDLWO¶REMHWG¶XQHDQDO\VHSOus détaillée avec un retour sur chacun
des services infRUPDWLTXHV TXL OH FRPSRVHQW 'HV H[SpULPHQWDWLRQV RQW SHUPLV G¶observer les
GLIIpUHQFHVG¶DSSUpKHQVLRQG¶XQSXEOLFjXQDXWUHjVDYRLUHQWUHSURIHVVLRQQHOVHWpWXGLDQWV Le
premier contexte est basé sur des relations contractuelles et une rigueur appliquée à un grand
QRPEUHG¶DFWHXUs et de documents, tandis que le deuxième HVWLQIRUPHOHWEDVpVXUO¶DMXVWHPHQW
PXWXHOG¶XQSHWLWJURXSHSURGXLVDQWSHXG¶LQIRUPDWLRQ
- De manière générale, le partage de documents doit être amélioré afin de prendre en compte la
SOXUDOLWp GHV IRUPDWV G¶XQ GRFXPHQW H[ XQ SODQ aux format dwg et pdf) et les liens qui
42 Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB |
-
-
-
peuvent exister entre plusieurs documents. Le partage de documents « un par un » trouve vite
ses limites dans des situations comme les rendus de projet dans lesquelles on partage
EHDXFRXSG¶LQIRUPDWLRQTXHFHVRLWGDQVOHGRPDLQHSURIHVVLRQQHORXpWXGLDQW
Le service de nommage est pertinent par rapport aux habitudes générales des professionnels.
Il doit être cependant flexible, car la convention de O¶Ordre de Architectes et Ingénieurs (OAI)
peut ne pas être adoptée par tout le monde /HV pWXGLDQWV VRQW j O¶LQYHUVH UpIUDFWDLUHV j FH
système : vis-à-vis du temps supplémentaire passé à nommer chaque document, ils ne
perçoivent pas de plus value, car le petit nombre de documents partagés ne requiert pas une
telle structuration. Il en va de même pour le service « zones ».
Les notifications par mail SHUPHWWHQW G¶pYLWHU OD FRQVXOWDWLRQ V\VWpPDWLTXH GH OD SODWHIRUPH
pour surveiller les partages, mais peuvent vite devenir problématiques en cas de nombreux
partages (surcharge de la boîte mail), particulièrement donc en milieu professionnel. Cela
soulève la question de les regrouper dans des mails « résumé » à intervalles réguliers.
Les réactions sur documents sont parfois détournées pour simplement stipuler que le
document a été consulté ou pour faire référence à un autre document (cf. besoin de lier les
documents entre eux). Les validations sont parfois faites informellement (en réunion, au
téléphone) et non tracées sur la plateforme. Chez les étudiants, le caractère non hiérarchique
du projet ne pousse pas à la demande de validations au profit de la recherche de conseils, et
G¶DYLV SDUWDJpV Se pose aussi la question de la visibilité des réactions vis-à-vis de tous les
utilisateurs.
Ces éléments peuvent être interprétés comme des « contre-exemples », témoignant des
ODFXQHVGHO¶RXWLOGDQVO¶DGDSWDWLRQGHO¶RXWLO
1.5.3 Analyse du développement et conclusion
Les études sur CRTI-weB nous permettent de relever plusieurs éléments importants relatifs
TXDQW DX GpYHORSSHPHQW G¶RXWLOV logiciels et plus particulièrement G¶DVVLVWDQFH DX WUDYDLO
collaboratif/coopératif.
Les exigences
Comme nous avons pu le vérifier en analysant les tâches de développement initiées sur la
plateforme après son transfert (120 tâches analysées, voir en annexes Figure 143, Figure 144,
Figure 145, Figure 146), la moitié G¶HQWUH HOOHV RQW SRXU SRLQW GH GpSDUW un « besoin métier »,
comme « partager des comptes-rendus de chantier avec photo », « FRQQDLWUH O¶DFWLYLWp G¶XQ
collaborateur » ou « récupérer toutes les données en fin de projet ª /¶DXWUH PRLWLp GHV
développements relève de O¶LPSOpPHQWDWLRQ GH IRQFWLRQQDOLWpV RX GH O¶DPpOLRUDWLRQ GHV
fonctionnalités existantes pour une utilisation plus rapide ou « confortable ».
&RQVLGpUDQW DXMRXUG¶KXL O¶DGRSWLRQ JUDQGLVVDQWH GH &57,-weB dans les projets de
constructLRQ OX[HPERXUJHRLV OD GpILQLWLRQ HW O¶RXWLOODJH GHV © bonnes pratiques » étaient un
premier pas cohérent et nécessaire. Mais nous comprenons que malgré la rigueur du travail de
FRQFHSWLRQ EDVp VXU O¶pWXGH Ge ces bonnes pratiques, et du fait du consensus autour des
spécifications fonctionnelles à mettre en place, WRXV OHV EHVRLQV Q¶Rnt pu être pris en compte et
devroQW O¶rWUH DX IXU HW j PHVXUH SRXU DVVXUHU O¶DGRSWLRQ et la pérennisation GH O¶RXWLO 1RXV
constatons également que au-delà de répondre à des besoLQVPpWLHUVO¶RXWLOGRLWrWUHDJUpDEOHHW
simple à utiliser. (Guerriero 2009) cite (Davis 1989) en disant que « O¶DSSURSULDWLRQ G¶XQH
nouvelle technologie repose sur deux dimensions » O¶XWLOLWp SHUoXH HW OD IDFLOLWp G¶XVDJH Notre
DQDO\VHFRQILUPHO¶DGpquation entre ces deux dimensions.
| Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB
43 /¶pWXGHGHs usages GHODSODWHIRUPHQRXVPRQWUHTXHO¶XWLOLWpSHUoXHQ¶HVWSDVDEVROXH(OOH
fait ressortir la relativité de cette utilité par rapport aux contextes identifiés plus tôt, dans la
mesure où :
- les utilisateurs ont reconnu pour la plupart la pertinence des services proposés, montrant que
O¶DQDO\VHGX FRQWH[WHGHO¶DFWLYLWpDSHUPLV de répondre à des besoins existants,
- la non-adoption dans certains cas des services est due à un contexte utilisateur déjà trop fourni
en outils et solutions largement adoptées,
- OHVYDULDWLRQVHQWUHSURIHVVLRQQHOVHWpWXGLDQWVPRQWUHQWO¶LQIOXHQFHGXFRQWH[WHGHO¶DFWHXUVXU
O¶DSSUpKHQVLRQG¶XQRXWLO
Au regard de cette analyse, nous nous questionnons alors sur la manière dont on pourrait à
présent :
- DPpOLRUHUO¶DQDO\VHGHVEHVRLQVDILQGHSUpGLUHOHVIXWXUHVGHPDQGHVGHGpYHORSSHPHQW
- et prendre en compte les contextes utilisateur et acteur pour spécifier des services réellement
adaptés à (et adoptés par) chacun.
Figure 13. Vers des outils de TCAO adaptés au contexte « tri-facettes »
La méthode de développement
/HVSUHPLqUHVYHUVLRQVGHO¶RXWLORQWpWpGpYHORSSpHV« en interne » au CRP Henri Tudor qui a
pJDOHPHQWDVVXUpXQU{OHG¶H[SHUWPpWLHUen étroite collaboration avec les praticiens du domaine.
Dès le transfert vers le secteur professionnel, les développements furent confiés à une société de
services externe (Kitry Consulting7). Dès lors, le processus est passé dans un schéma collaboratif
avec une réelle répartition des tâches de FRQFHSWLRQGpYHORSSHPHQWHWG¶pYDOXDWLRQ entre acteurs
différents.
Dans cette activité de développement, qui Q¶HVW SDV VDQV UDSSHOHU O¶DFWLYLWp FROOHFWLYH G¶XQ
projet AIC, la coordination est également un enjeu. Depuis 2009, la société externe commercialise
la solution et se charge également de la formation et du support des utilisateurs. Lorsque des
modifications purement fonctionnelles doivent être réalisées, ils développent directement une
solution, PDLV ORUVTXH FHOD UHOqYH G¶XQ SURElème métier, un processus de conception est de
QRXYHDX PLV HQ °XYUH EDVp VXU O¶DQDO\VH GHV EHVRLQV HW VXSSRUWp SDU OHV H[SHUWV PpWLHU &¶HVW
7
http://www.kitrygroup.com/ 44 Chapitre 2 ± Un cas de GpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB |
G¶DLOOHXUVFHU{OHTXHQRXVDYRQVWHQXDXFRXUVGHQRWUHLPSOLFDWLRQGDQVOHSURMHWFHTXLQRXVD
fourni un contH[WHG¶REVHUYDWLRQSULYLOpJLp
Figure 14. Schéma du processus de conception développement et
transfert des services de CRTI-weB
Nous nous questionnons dès lors sur la dépendance entre la qualité des solutions développées
et la qualité de la coordination au sein de ce processus de conception. De manière générale :
- ODTXDOLWpG¶XQHVROXWLRQHQWHUPHVGHVHUYLFHVLQIRUPDWLTXHVVHUDpYDOXpHSDUOHVXWLOLVDWHXUV
qui jugeront de la réponse de la capacité de ce service à répondre à leur besoin,
- la qualité de la coordination sera déterminée par la capacité des différents acteurs du projet à
exprimer leur point de vue (Hanrot 2005) et à répondre aux attentes de chacun.
1.6 Conclusion
Les observations que nous venons de faire et les remarques soulevées nous permettent à
présent dHFDGUHUOHVREMHFWLIVUHODWLIVjO¶DPpOLRUDWLRQGH&57,-weB et, de manière générale au
GpYHORSSHPHQWG¶XQRXWLOGH7&$2
Ce type de développement doit être guidé par des exigences clairement identifiées et
MXVWLILpHV (Q HIIHW LO QH V¶DJLW SDV GH GpYHORSSHU GHV VHUYLFHV TXH O¶RQ GHYUD PRGLILHU YRLU
supprimer dans un second temps, FDU LOV VHURQW LQXWLOLVpV &H JHQUH GH PpWKRGH V¶DYqUH WURS
longue et couteuse. La gestion du projet de développement est également un enjeu important. Il
V¶DJLW GH ELHQ WUDQVPHWWUH O¶LQIRUPDWLRQ QpFHVVDLUH j OD UpSRQVH GX EHVRLQ HW G¶DGRSWHU XQH
approche méthodique pour le développement de la solution.
Le chapitre suivant approfondit ces deux enjeux pris comme point de départ pour la définition
de notre problématique de recherche ainsi que O¶LGHQWLILFDWLRQGHVD[HVG¶pWXGHjDQDO\VHU
| Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRXWLOGH7&$2&57,-weB
45 Chapitre 3 - Problématique et
méthode de travail
Nous définissons GDQV FH FKDSLWUH OD SUREOpPDWLTXH TXL pPHUJH GHV FRQWH[WHV G¶pWXGH HW
objectifs relatifs identifiés précédemment : la proposition d¶XQH PpWKRGH GH FRQFHSWLRQ GH
services adaptés au secteur de la construction. La méthode de travail suivie pour répondre à cette
problématique est SUpVHQWpHVXUODEDVHG¶XQUHFXOWKpRULTXHVXUODVFLHQFHGHODFRQFHSWLRQ
1.7 Construction de la problématique
1.7.1 Objectifs et concepts vis-à-vis du contexte tri-facettes
Notre problématique se construit dans un premier temps DXWRXUGHO¶DQDO\VHHWODFULWLTXHGX
contexte tri-facettes introduit par (Kubicki 2006). L¶REMHFWLI GH FH WUDYDLO était la multiYLVXDOLVDWLRQGXFRQWH[WHGHO¶DFWLYLWpGDQVOHEXWGHIDYRULVHUOHVFRQGLWLRQVG¶XQHFRRUGLQDWLRQ
EDVpHVXUO¶DMXVWHPHQWPXWXHO
Suivant nos premières remarques, ce contexte sert de base à la caractérisation des besoins
métiers des acteurs. Les artefacts, regroupant documents du projet et ouvrages y sont bien définis,
mais nous constatons que la définition des activités reste générique. Les relations acteurs-artefacts
et acteurs-activités FDUDFWpULVHQWOHVDFWLRQVGHFKDFXQTXHFHVRLWG¶Xn point opérationnel (acteurartefact) ou organisationnel (acteur-activité), cependant ces concepts ne sont pas mis en avant. Il
Q¶\DG¶DLOOHXUVSDVde liste exhaustive des types de ces relations ou d¶DWWULEXWVGpWHUPLQDQWVOHV
caractérisant. Nous avons donc cherché jDPpOLRUHUQRWUHSHUFHSWLRQGXFRQWH[WHGHO¶DFWLYLWpHQ
améliorant la définition de ces relations.
Vis-à-vis des analyses VXU OD FRRUGLQDWLRQ QRXV SDUWRQV GX SRVWXODW TXH O¶DFWLYLWp GH SURMHW
GRLW DXVVL ELHQ rWUH GpILQLH G¶XQ SRLQW GH YXH coOOHFWLI TX¶LQGLYLGXHO Pour cela il nous semble
LPSRUWDQWGHSUHQGUHpJDOHPHQWHQFRPSWHOHSURILOPpWLHUHWOHVSUpIpUHQFHVG¶XQDFWHXURXHQ
G¶DXWUHV WHUPHV OH © contexte acteur ª TXL HVW GpWHUPLQDQW GDQV OD UpDOLVDWLRQ G¶XQH Dctivité
individuelle.
| Chapitre 3 - Problématique et méthode de travail
47 Le troisième contexte à prendre en compte est le « contexte utilisateur ». Nous devons donc
DERUGHU XQ SRLQW GH YXH WHFKQLTXH ,FL QRXV UHPHWWRQV GLUHFWHPHQW HQ FDXVH OD SODFH GH O¶RXWLO
dans le contexte dH O¶DFWLYLWp FROOHFWLYH (Q HIIHW QRXV VXSSRVRQV TXH O¶RXWLO © supporte » le
FRQWH[WHGHO¶DFWLYLWp collective en le médiatisant : il aide les acteurs à réaliser leurs activités et à
gérer les artefacts du projet. Il est vu comme un « moyen » et non comme un devoir. Prendre en
compte le contexte utilisateur consistera donc à comprendre les possibilités techniques dues à
O¶RXWLOHWVRQHQYLURQQHPHQWHWjSHUFHYRLUHQTXRLLOVXSSRUWHXQHDFWLYLWpHWGDQVTXHOOHPHsure
il est perfectible (ou remplaçable).
Dès lors, plusieurs concepts apparaissent comme importants. En voici une brève introduction,
nous les approfondLVVRQV GDQV OHV GLIIpUHQWV FKDSLWUHV GH O¶état de O¶DUW FKDSLWUHV j SRXU
ensuite les intégrer dans notre approche (chapitres 8 à 11).
Le concept de pratique
/HVDFWLYLWpVGHSURMHWVRQWGHVDFWLYLWpVFUpDWULFHV(QG¶DXWUHVWHUPHVHOOHVQHUHOqYHQWSDVGH
la théorie mais de la pratique. 1RXV YHQRQV G¶LQWURGXLUH ORUV GH OD GHVFULSWLRQ GH O¶H[SpULHQFH
CRTI-weB, le concept de « bonnes pratiques ». Elles font référence ici à des « astuces » (Chen
2009), à des pratiques « qui ont fait leurs preuves » comme par exemple la réunion hebdomadaire
GHFKDQWLHUVXLYLHGH ODUpGDFWLRQG¶XQUDSSRUW GH FKDQWLHU6HORn (Clot 2007) la bonne pratique
serait « la transformation collective ± institutionnellement secondée ± GHO¶DFWLYLWpHQLQVWUXPHQW
G¶XQHDXWUHDFWLYLWp ». Dans CRTI-weB, ces bonnes pratiques devaient en plus être consensuelles.
Nous retenons ce point de vue par lequel O¶DFWLYLWp GH SURjet est « instrumentée » par
G¶autres activités que sont les pratiques. Cependant, le concept de « bonne pratique ªQ¶HVWSDV
universel, car il peut être dépendant du contexte du projet (c.à.d. RQDGPHWTX¶XQHSUDWLTXHGLWH
bonne dans un projet pourra ne pas être adaptée dans un autre). Ce contexte est relatif à la nature
du projet et à un « ensemble de contextes » que sont le contexte géographique, culturel,
pFRQRPLTXH VRFLDO WHFKQRORJLTXH« DXWDQW GH IDFWHXUV TXL LQIOXHQFHUont la manière
G¶DSSUpKHQGHUOHSURMHWHWGRQFVHVSUDWLTXHV
&HOD QRXV DPqQH j RSpUHU XQH GLVWLQFWLRQ HQWUH OHV SUDWLTXHV JpQpULTXHV TXH O¶RQ UHWURXYH
dans tous les projets AIC) et les pratiques spécifiques (qui sont propre à un contexte de projet
particulier). Nous distinguons également les pratiques collectives (effectuées à plusieurs) des
pratiques individuelles. Les chapitres 5 et 9 illustrent notre acception et le positionnement de notre
approche par rapport au concept de pratique.
Les processus de O¶LQIRUPDWLRQHWGXPDWpULHO
(Björk 1999) divisent OH SURFHVVXV GH FRQVWUXFWLRQ G¶XQ EkWLPHQW HQ GHX[ VRXV-processus
UHODWLIVDXFKHPLQHPHQWGHO¶LQIRUPDWLRQHWGXPDWpULHOGDQVXQSURMHW8QVRXV-processus (aussi
appelé activité) est caractérisé par des Inputs, des Outputs, des Ressources. On retrouve en tant
TX¶LQSXWVHWRXWSXWVOHVDUWHIDFWVGpILQLVSUpFpGHPPHQWjVDYRLUOHVGRFXPHQWVHWOHVREMHWV/HV
ressources sont les acteurs responsables de ces activités, les outils ainsi que la connaissance
utilisés.
48 Chapitre 3 - Problématique et méthode de travail |
En ce qui concerne les sous-SURFHVVXV G¶LQIRUPDWLRQ %M|UN FRQVLGqUH FHV DFWLYLWpV GLWHV
« primaires » comme des règles supportées par des activités secondaires dont il en distingue
quatre types :
- la production G¶XQHQRXYHOOHLQIRUPDWLRQ,
- la communication de personne à personne,
- la diffusion G¶LQIRUPDWLRQ,
- lDUHFKHUFKHHWODUpFXSpUDWLRQG¶LQIRUPDWLRQ.
Le chapitre 10 présente comment nRXV LQWpJURQV FHV FRQFHSWV DILQ G¶DSSURIRQGLU QRWUH
description du métier.
/HFRQFHSWG¶XVDJH
Nous préfèrerons utiliseU OH FRQFHSW G¶XVDJH SOXW{W TXH FHOXL G¶XWLOLVDWLRQ ORUVTXH QRXV
YRXGURQV FRQVLGpUHUOHUDSSRUWG¶XQDFWHXUYLV-à-YLVGHO¶RXWLO. Cette distinction va au-GHOj G¶XQ
choix sémantique et trouve notamment sa justification dans le domaine du génie logiciel
(Constantine & Lockwood 2003). Le chapitre 4 introduit les différentes approches de conception
logicielles dont la conception centrée-usages. Le chapitre 10 (et particulièrement le § 1.31.1)
approfondit la distinction entre usage et utilisation et positionne notre approche par rapport à ce
concept.
/¶REMHFWLI DX WUDYHUV GX FRQFHSW G¶XVDJH HW GH décrire O¶DFWHXU HQ WDQW TX¶XWLOLVDWHXU OH
FRQWH[WHG¶XWLOLVDWLRQGpULYpGXFRQWH[WHPpWLHUHWILQDOHPHQWO¶RXWLOOXL-même comme médiateur
GHO¶DFWLYLWp
Les services
Comme O¶LOOXVWUH O¶H[SpULHQFH&57,-weB, un outil peut être décomposé en plusieurs niveaux
de services. La qualité de ces services au regard des professionnHOV G¶XQ VHFWHXU FRQGLWLRQQH
O¶DGRSWLRQG¶XQRXWLOSDUFHVGHUQLHUV
Le modèle de qualité de services proposé dans (Bjekovic & Kubicki 2011) repose sur six
critères :
- la correspondance au métier qui implique la réponse à une problématique métier, avec une
amélioration des pratiques et par extension la bonne réputation du service dans le milieu,
- ODVWDELOLWpTXLHVWUHODWLYHjODMXVWHVVHGXVHUYLFHODSHUWLQHQFHGHO¶LQIRUPDWLRQSURGXLWHVD
précision et sa disponibilité,
- lDSHUIRUPDQFHHQWHUPHVGHWHPSVGHUpSRQVHHWG¶XWLOLVDWLRQGHVUHVVRXUFHV,
- la sécurité assurée par le UHVSHFWGHODFRQILGHQWLDOLWpO¶LQWpJULWpc.à.d. la prévention des accès
HWPRGLILFDWLRQVODWUDoDELOLWpHWO¶DXWKHQWLFLWp
- O¶XtilisDELOLWp V\QRQ\PH GH FRPSUpKHQVLRQ G¶LQWXLWLYLWp GH IDFLOLWp G¶XWLOLVDWLRQ HW GH
prévention des erreurs vis-à-vis de l¶XWLOLVDWHXU
- OHUHVSHFWGHO¶H[LVWDQWGHSDUOHVXSSRUWGHVVWDQGDUGVHWO¶LQWHURSpUDELOLWpDYHFOHVVHUYLFHV
existants.
$ILQ G¶DWWHLQGUH FHV FULWqUHV LO HVW QpFHVVDLUH GH VWUXFWXUHU OH SURFHVVXV GH FRQFHSWLRQ GHV
VHUYLFHV ,O V¶DJLt typiquement de fournir une information pertinente aux équipes et d¶DVVXUHU
| Chapitre 3 - Problématique et méthode de travail
49 O¶HIILFDFLWp HW OD WUDoDELOLWp Ges échanges. Nous introduisons les services collaboratifs dans le
chapitre 6 et les intégrons dans notre approche dans le chapitre 11.
1.7.2 Formulation de la problématique
À partir des éléments introduits dans les chapitres précédents, nous sommes en mesure de
déterminer les axes de recherche à investiguer dans la suite de ce travail O¶DQDO\VHGHVEHVRLQVHW
la conception logicielle.
La question que nous nous posons est la suivante :
Pouvons-QRXVSURSRVHUXQHPpWKRGHVWUXFWXUpHHWEDVpHVXUO¶DQDO\VHGXFRQWH[WHWUL-facettes
pour le développement (ou la mise à jour) de services informatiques supportant les besoins de
collaboration (ou « services collaboratifs ») propres au projet AIC ?
$YDQWGHQRXVSHQFKHUYHUVO¶pWDWGHO¶DUWVXUOHVPpWKRGHVet les cas pratiques de conception
logicielle et plus particulièrement de services collaboratifs, nous présentons dans le sous-chapitre
suivant notre méthode de recherche introduite par une approche théorique sur la conception. Nous
souhaitons en effet nous inscrire dans une démarche scientifique qui nous permette de généraliser
notre approche, notamment vis-à-vis des éventuels EHVRLQVG¶DXWUHVGRPDLQHVTXe le projet AIC.
1.8 M éthode de recherche
Au regard de la problématique formulée, nous avons mené une étude sur les processus de
conception. 1RWUHUHFKHUFKHV¶HVWEDVpHVXUdes allers-retours entre théorie et cas concrets qui sont
justifiés SDUOHVFRQWH[WHVG¶études présentés au cours des deux premiers chapitres. En effet :
- ce travail possède un caractère appliqué, grâce au contexte de développement de CRTI-weB
et son transfert,
- il appartient à un contexte scientifique particulier, entre le monde académique (à savoir les
WKpPDWLTXHVGX&5$,HWOHVSURMHWVG¶LQQRYDWLRQHQMHX[GX&53+HQUL7XGRU.
À partir G¶XQH pWXGH VXU OHV GLIIpUHQWHV DSSURFKHV GH PRGpOLVDWLRQ G¶XQ SURFHVVXV GH
conception, (Laaroussi 2007) décrit un processus générique qui « en tant que processus cognitif de
UpVROXWLRQGHSUREOqPHVV¶DUWLFXOHDXWRXUGHWURLVDFWLYLWpVSULPLWLYHV O¶DQDO\VHGXSUREOqPHOD
SURSRVLWLRQG¶XQHVROXWLRQHWO¶pYDOXDWLRQGHFHWWHVROXWLRQ ». Nous nous sommes tournés vers les
théories de la science de la conception pour comprendre la nature de ce processus.
1.8.1 La science de la conception
On définit la science de la conception comme « VFLHQFH GH O¶DUWLILFLHO » (Simon 2004) ou
« science de la pratique » (Gregor 2009) (OOH WUDLWH GH OD FUpDWLRQ G¶REMHWV HW GH VDYRLUV SDr
O¶+RPPH SRXU DWWHLQGUH FHUWDLQV EXWV ex O¶LQJpQLHULH O¶DUFKLWHFWXUH« FRQWUDLUHPHQW DX[
« sciences comportementales » (Hevner et al. 2004) à savoir les sciences naturelles (ex. la
physiqXH OD FKLPLH« HW KXPDLQHV H[ O¶KLVWRLUH OD OLQJXLVWLTXH« Tui visent à expliquer des
éléments existants de la nature ou de la société.
La science de la conception consiste en ODFRQVWUXFWLRQHWO¶pYDOXDWLRQGHSURGXLWVGHTXDWUH
types : des concepts, des modèles, des méthodes et des instanciations (March 1995) :
50 Chapitre 3 - Problématique et méthode de travail |
-
les concepts « formenWOHYRFDEXODLUHG¶XQGRPDLQH »,
un modèle décrit une situation en exprimant les relations entre les concepts,
uQHPpWKRGHHVWXQHVXLWHG¶pWDSHVVXLYLHVSRXUDFFRPSOLUXQHWkFKH,
uQHLQVWDQFLDWLRQHVWODUpDOLVDWLRQG¶XQDUWHIDFWGDQVson environnement.
$WWHLQGUH XQ EXW XQ REMHFWLI QH VH IDLW SDV VDQV FRQWUDLQWHV TX¶HOOHV VRLHQW SK\VLTXHV
FRQWUDLQWHVWHFKQLTXHVJpRJUDSKLTXHVPpWpRURORJLTXHV«RXPRUDOHVHQWHUPHVGHTXDOLWpGH
GpODL GH SUL[« &RQFHYRLU F¶HVW GRQF REWHQLU XQH VRlution qui satisfasse un maximum de ces
contraintes, ce qui implique de les connaitre, de les évaluer voire de les prioriser.
Comme on peut le voir dans (Peffers et al. 2007), OHVPRGpOLVDWLRQVGHO¶DFWLYLWpGHFRQFHSWLRQ
sont variées, mais suivent une trame commune. Nous retenons O¶DSSURFKH GH (Vaishnavi &
Kuechler 2007) qui nous apprend que la conception est non seulement basée sur un processus,
mais aussi sur ODSURGXFWLRQG¶LQIRUPDWLRQHWG¶DUWHIDFWVHWla génération de flux de connaissances
(Figure 15). Le processus défini par (Vaishnavi & Kuechler 2007) contient cinq phases.
- Connaissance du problème : cette phase fait ressortir un besoin et fixe les objectifs et les
contraintes.
- Suggestion F¶HVWODSKDVHFUpDWLYHTXLVXLWGLUHFWHPHQWO¶H[SUHVVLRQGHO¶LGpH(Qressortent
« un premier essai », une « esquisse » de solution.
- Développement : la suggestion est approfondie et implémentée. Les techniques utilisées et les
artefacts créés sont dépendants du domaine.
- Évaluation O¶DUtefact créé à la phase précédente est évalué en fonction des objectifs fixés en
première phase.
- Conclusion : LOV¶DJLWGHGUHVVHUOHbilan et de capitaliser les résultats
Figure 15. Processus de conception, flux de connaissances et résultats
(tiré de (Vaishnavi & Kuechler 2007))
1RXV UHPDUTXRQV TXH FKDTXH pWDSH G¶XQ SURFHVVXV GH FRQFHSWLRQ JpQqUH XQ IOX[ GH
connaissance qui alimente la connaissance globale du problème, encourageant le raffinement des
choix au fur et à mesure des itérations de ce processus.
| Chapitre 3 - Problématique et méthode de travail
51 1.8.2
« Concevoir une méthode de conception »
À partir des éléments qui composent notre problématique (voir 1.7.2) nous constatons que
celle-ci relève de la science de la conception sous tous ses aspects :
- nous voulons concevoir des services informatiques pour le Travail Collaboratif Assisté par
Ordinateur (le produit souhaité est une instanciation).
- Nous YRXORQVTXHFHVVHUYLFHVVRLHQWDGDSWpVjXQGRPDLQHFHTXLQpFHVVLWHG¶HQFRQVWUXLUH
les concepts.
- Nous voulons concevoir une méthode qui supporte les objectifs précédents.
- Nous voulons construire des modèles VXUOHVTXHOVV¶DSSXLHODPpWKRGH
La figure suivante (Figure 16) illustre notre approche et la structure des prochains chapitres de
cet ouvrage. La partie 2 (chapitres 4, 5, 6 et 7) propose une analyse des méthodes de conception
dans divers domaines du développement logiciel et ce que nous en retenons pour « concevoir
notre propre méthode de conception ». La description de cette méthode et son application dans
divers cas G¶pWXGHfont O¶REMHWGHODSDUWLH (chapitres 8, 9, 10, 11 et 12).
Figure 16. Démarche suivie dans notre recherche basée sur la
conception
52 Chapitre 3 - Problématique et méthode de travail |
PARTIE 2 : Théories et méthodes. Concevoir des services
collaboratifs adaptés
La précédente partie fait émerger la nécessité de
concevoir et proposer des solutions informatiques
adaptées aux pratiques G¶XQ PpWLHU en nous intéressant
plus particulièrement aux pratiques de collaboration
dans un projet AIC. /¶HQMHXGHFHWWHpWXGHHVWGHGpILQLU
une méthode qui puisse guider cette conception. La
partie 2 de ce manuscrit présente les théories et
méthodes que nous avons explorées pour constituer
notre base de connaissance sur le sujet. Nous avons
notamment porté QRWUH DWWHQWLRQ VXU O¶LPSRUWDQFH GH OD
modélisation les différentes approches relatives. Nous
nous sommes WRXW G¶DERUG intéressés aux méthodes de
conception logicielle HWG¶IHM (chapitre 4). Nous avons
ensuite exploré le concept de services et la conception
des services informatiques dits « de technologies de
O¶LQIRUPDWLRQ et de la communication» (ICT) dans
O¶HQWUHSULVH (chapitre 5). Nous avons enfin étudié des
principes de conception de collecticiels et services
collaboratifs (chapitre 6). Le dernier chapitre de cette
partie (chapitre 8) illustre O¶DQDO\VHHWODFULWLTXHGHtrois
FDVG¶pWXGHGHFRQFHSWLRQparticuliers. Il se conclut par
O¶pYRFDWLRQ Ges éléments majeurs retenus comme base
de notre propre méthode.
54 |
Chapitre 4 - 'H O¶XWLOLVDWHXU j OD
conception logicielle HWG¶LQWHUIDFHV
Ce prePLHU FKDSLWUH UHWUDFH O¶pYROXWLRQ GH OD FRQFHSWLRQ ORJLFLHOOH HW HQ GpFULW OHV DFWLYLWpV
relatives. Il a notamment pour but de souligner O¶LPSRUWDQFH GH O¶DQDO\VH GHV EHVRLQV GHV
XWLOLVDWHXUVSRXUODVSpFLILFDWLRQGHORJLFLHOVHWG¶LQWHUIDFHVKRPPH-machine (IHM) et G¶LOOXVWUHU
la place des modèles dans une telle approche.
1.9 Les méthodes et activités relatives à la conception logicielle
La conception logicielle V¶LQVFULWGDQVXQHDSSURFKHFODVVLTXHGHFRQFHSWLRQWHOOHTXHGpFULWH
précédemment. Chaque phase apporte un élément important dans le processus de la conception et
VHUDGpWHUPLQDQWHGDQVODTXDOLWpGXUpVXOWDWHWO¶DWWHLQWHGHVREMHFWLIV&RPPHOHGLW(Sommerville
1996) cité dans (Dibbern et al. 2009) (p.13), « O¶HQMHXGHO¶LQJpQLHULHORJLFLHOOHHVWGHpermettre la
conception de logiciels de qualité par O¶XWLOLVDWLRQ GH WHFKQLTXHV (ou processus) HW G¶RXWLOV
appropriés ». 'DQV OH FDGUH G¶XQH RUJDQLVDWLRQ la conception logicielle consiste aussi à
comprendre comment les systèmes « homme-machine » produisenW HW GLIIXVHQW GH O¶LQIRUPDWLRQ
et influencent les organisations dans lesquelles ils sont intégrés (Vaishnavi & Kuechler 2007). Le
cycle de vie GXGpYHORSSHPHQWG¶XQORJLFLHOcomprend non seulement sa conception, mais aussi
son évaluation, sa distribution et sa maintenance.
Tel que (Booch et al. 2007) le définit, une méthode de conception logicielle F¶HVW XQ
processus qui vise à produire une suite de modèles8 décrivant, avec une notation (ou
formalisme) SURSUHGLIIpUHQWVDVSHFWVG¶XQORJLFLHOHQFRXUVGHGpYeloppement. ,OQHV¶DJLWSDV
dans cette étude de décrire toutes les méthodes de conception logicielle, PDLV SOXW{W G¶HQ
FRPSUHQGUH OHV FRQFHSWV LPSRUWDQWV (Q G¶DXWUHV WHUPHV QRXV FKHUFKons davantage ici à
comprendre la méthodologie de la conception logiciHOOH DILQ G¶\ SRsitionner notre propre
méthode, en nous demandant notamment :
8
hŶŵŽĚğůĞĞƐƚůĂƌĞƉƌĠƐĞŶƚĂƚŝŽŶĚĞƋƵĞůƋƵĞĐŚŽƐĞ͕ƐŽƵƐĨŽƌŵĞĚ͛ŽďũĞƚƉŚLJƐŝƋƵĞ;Ğdž͘ƵŶĞŵĂƋƵĞƚƚĞͿŽƵ
de description (un texte, un dessiŶ͙Ϳ͘hŶŵŽĚğůĞƉĞƵƚƐĞƌǀŝƌăůĂĚĞƐĐƌŝƉƚŝŽŶ;Ğdž͘ůĞƉůĂŶĚ͛ƵŶĞǀŝůůĞͿ
ĐŽŵŵĞăůĂĐŽŶĐĞƉƚŝŽŶ;Ğdž͘ůĞƉůĂŶĚ͛ƵŶĞŵĂŝƐŽŶăĐŽŶƐƚƌƵŝƌĞͿ͘ | Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
55 -
comment se déroulent les processus ?
Quels sont les modèles créés et utilisés ?
1.9.1 L¶pYROXWLRQGes processus de conception
Les méthodes traditionnelles de conception logicielle ont connu leur essor dans les années 6070, période de démocratisation (grâce à la baisse des prix) mais aussi de croissance en termes de
performances des outils informatiques. Les premières étaient des méthodes « en cascade » et
suivaient un processus linéaire (Figure 17, partie gauche). Puis elles adoptèrent une structure en 2
étapes (dite en V) : le processus de développement dans une approche « top-down », se déroulant
GHO¶DQDO\VHGHVEHVRLQVYHUVOHFRGHLPSOpPHQWp et le processus de test qui « remontait » du code
vers les besoins (Figure 17, partie droite). On les a aussi qualifiées de méthodes orientées
composants, car elles introduisaient le développement par assemblage de composants logiciels
« préfabriqués ª V¶LQVSLUDQW GHV GRPDLQHV GH O¶pOHFWURQLTXH RX GH OD PpFDQLTXH (Crnkovic et al.
2005; Bose 2002).
Figure 17. Structure des méthodes traditionnelles de conception
logicielle
Le modèle en spirale (Boehm 1988) introduit une variante dans les méthodes de
développement précédemment présentées (Figure 18). En effet après une phase de détermination
des objectifs, contraintes et alternatives (quart supérieur gauche), on identifie et cherche à
résoudre les risques relatifs aux objectifs. Cela se traduit par un premier prototypage et une
évaluation de celui-ci (quart supérieur droit). Si ce premier prototypage ne permet pas de lever les
risques, alors on planifie une seconde phase (quart inférieur gauche) et réitère le prototypage
juVTX¶j REWHQLU XQ SURWRW\SH RSpUDWLRQQHO GpSODFHPHQW YHUV OD GURLWH GDQV OH TXDUW VXSpULHXU
gauche) : on parle alors de conception dirigée par les risques. Cependant si une des phases
précédentes de prototypages permet de lever les risques majeurs, les prochaines étapes suivent le
cheminement classique du développement en cascade (quart inférieur gauche).
56 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Figure 18.
Schéma de la méthode en spirale
1.9.2 Vers un processus itératif
/RUV G¶XQH YDOLGDWLRQ D\DQW OLHX HQ ILQ GH SURMHW WRXWH pYDOXDWLRQ QpJDWLYH aura un coût
conséquent, car impliquant un « retour à la case départ » dans le processus de conception. &¶HVW
pourquoi les méthodes plus récentes de développement logiciel dites « livré clé en main » tel que
le « Processus Unifié de Développement Logiciel » (USDP pour Unified Software Development
Process) puis le RUP pour (Rational Unified Process) se sont basées sur un processus déployant
plusieurs cycles de développement dans le temps du projet de conception : un processus itératif et
incrémental (dont le QRPEUH G¶itérations pourra varier VHORQ OH W\SH HW O¶DPSOHXU GX SURMHW).
Chaque cycle de ce processus comprend quatre phases de développement (Kruchten 2001; Kroll
& Kruchten 2003) et se termine par un jalon, à savoir sa propre évaluation. Les tests qui
supportent ces évaluations peuvent être déterminés en début de cycle comme le préconise le
processus de développement « dirigé par les tests » (K Beck 2003).
- L¶pWXGHSUpOLPLQDLUH (ou « inception »DSRXUEXWG¶DYRLUXQHYXHG¶HQVHPEOHGHVREMHFWLIV
des couts, des risques.
- L¶pODERUDWLRQYLVHjGpFULUHSOXVSUpFLVpPHQWOHVEHVRLQVGpFULUHOHV\VWqPHOHYHUOHVULVTXHV
et planifier le projet.
- /DFRQVWUXFWLRQQ¶HVWDXWUHTXHODSURSRVLWLRQGHODVROXWLRQVRXVIRUPHIRQFWLRQQHOOHRXVRXV
forme de documentation, selon le moment dans le projet.
- La transition vise à déployer et tester la proposition voire à la livrer si le cycle se situe en fin
de projet, auquel cas cela comprend aussi la formation des utilisateurs et la maintenance.
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
57 Chaque phase fait appel à une ou plusieurs activités dont les principales sont les suivantes
(voir Figure 19) : la modélisation du métier, la définition et la gestion GHVH[LJHQFHVO¶DQDO\VH et
la conception O¶LPSOpPHQWDWLRQ OHV WHVWV HW OH GpSORLHPHQW (Kruchten 2001). Ces activités sont
relatives à des disciplines différentes qui impliquent des acteurs différents.
Figure 19. Processus, cycles, phases HWDFWLYLWpVG¶XQSURMHWGH
développement logiciel
&HVDFWLYLWpVV¶DSSXLHQW HQSDUWLHVXUODUpDOLVDWLRQHWO¶XWLOisation de différents modèles dont
les modèles UML (pour Unified Modeling Language). Ces modèles décrivent le système selon
différents points de vue.
1.9.3 Les activités de développement et leurs modèles
La modélisation métier
Comme on peut le lire dans (Gabay & Gabay 2008), la modélisation du domaine (ou
modélisation métier) « permet de mieux comprendre la structure et la dynamique de O¶RUJDQLVDWLRQ
étudiée. Elle assure au client que les utilisateurs finaux et les développeurs partagent une vision
FRPPXQHGHO¶Rrganisation ». Un modèle du domaine, sous forme de diagramme de classes UML
ou de diagramme Entité-Relations (E-R), représente graphiquement tout les objets (ou entités) du
domaine et leurs relations. (Q G¶DXWUHV WHUPHV LO GpILQLW OH FRQWH[WH HQ GpFULYDQW les objets du
« monde réel ª 2Q SDUOH DORUV G¶DQDO\VH RULHQWpH-objet, point de départ de la construction (ou
programmation) orientée objets (Booch et al. 2007). Selon (Gordijn et al. 2000), le modèle du
domaine (Business Model) définit « ce qui est offert, par qui, à qui, et ce qui est attendu en
retour »9.
9
Il est important de distinguer le Business Model du (Business) Process Model (c.à.d. le modèle de processus métier), ce dernier définissant la dynamique du Business Model (le « comment ») pour comprendre comment sont orchestrés les services dans une entreprise (voir § 1.14.2). 58 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Figure 20. Exemple de modèle métier sous forme de diagramme E-R
N.B : Dans les projets de développement dédiés à GHVXWLOLVDWHXUVKRUVG¶XQFRQWH[WHPpWLHU
précis H[XQJXLFKHWGHUHWUDLWG¶DUJHQWLOQ¶HVW pas nécessaire de mener cette activité.
L¶LQJpQLHULHGHVH[LJHQFHV (requirements engineering).
/¶LQJpQLHULH GHV H[LJHQFHV a pour but de guider la conception du logiciel. (Nuseibeh &
Easterbrook 2000), cités dans (Sutcliffe 2007), la définissent pour les systèmes informatiques
comme « OHSURFHVVXVGHGpFRXYHUWHG¶XQREMHFWLIHQLGHQWLILDQWOHVFOLHQWVHWOHXUVEHVRLQVHWHQ
GRFXPHQWDQWFHVLQIRUPDWLRQVGDQVXQIRUPXODLUHSURSLFHjO¶DQDO\VHODFRPPXQLFDWLRQHWjXQH
ultérieure implémentation ». (Yeh & Zave 1980) identifiaient déjà il y a 30 ans que « la plupart
des problèmes de développement de systèmes informatiques pourraient être assignés à une
mauvaise compréhension ou spécification de ce que le système est supposé faire ». Ils soulevaient
DLQVL O¶LPSRrtance de traiter avec attention la phase de connaissance du besoin (ou phase
G¶H[SUHVVLRQGHVH[LJHQFHV composée de :
- l¶LGHQWLILFDWLRQ GX besoin : LO V¶DJLW G¶LGHQWLILHU HW GpFULUH OHV REMHFWLIV TXL UHTXLqUHQW
O¶XWLOLVDWLRQG¶XQV\VWqPH sous différentes formes (LQWHUYLHZVJURXSHVGHWUDYDLO«,
- la compréhension du besoin LOV¶DJLWGHFROOHFWHUHWG¶DQDO\VHUGHO¶LQIRUPDWLRQjSURSRVGX
système, de son environnement et des interactions entre les deux,
- la spécification du besoin : il faut alors décrire le comportement désiré du système10.
On pourra rencontrer le terme « requirements elicitation ªSRXUFHTXLHVWGHO¶identification et
ODFRPSUpKHQVLRQGHO¶H[LVWDQW(Loucopoulos & Karakostas 1995).
La formalisation des exigences (spécifications y comprises) se fait à travers un « Document
G¶([LJHQFHV /RJLFLHOOHV » (SRD pour Software Requirements Document). Le SRD exprime ce
que le système doit faire mais pas comment, cette question étant relative à la conception. Il est le
moyen de communication entre utilisateurs, experts, analystes et développeurs. De plus, les
10
Selon (Jackson & Pamela Zave 1995)O¶H[LJHQFH© décrit une relation souhaitée parmi les
SKpQRPqQHV GH O¶HQYLURQQHPHQW », puis la spécification décrit quant à elle « le comportement
souhaité du système dans cet environnement ». Il nous précise que O¶H[LJHQFH GHYLHQW
spécification lorsque la relation souhaitée est partagée avec le système et contrôlée par ce dernier.
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
59 exigences ne doivent pas limiter la liberté de décision des concepteurs qui ont une connaissance
SOXVDSSURIRQGLHGHVWHFKQRORJLHVHWWHFKQLTXHVG¶LPSOpPHQWDWLRQ(W. Davis 1999). Permettant la
traçabilité des choix effectués HQWHUPHVG¶H[LJHQFHVOH65'VXSSRUWHpJDOHPHQWODYDOLGDWLRQpar
les utilisateurs (en phase exigences mais aussi en phase transition, c.à.d. après la conception).
Parmi les approches d¶LQJpQLHULHGHVH[LJHQFHVon pourra relever celles « orientées buts » («
Goal-Oriented Requirement Engineering ») (Cooper 1996; Kavakli 2002; Lamsweerde 2001;
Lamsweerde 2003) et celles « basées sur les scénarios » (« scenario-based RE ») (Salinesi 2004;
Sutcliffe 2003).
Les buts (goals) selon (Lamsweerde 2001), sont spécifiés afin de VXSSRUWHUO¶expression et la
validation des exigences DLQVL TXH OD JHVWLRQ GHV FRQIOLWV OD QpJRFLDWLRQ O¶H[SOLFDWLRQ HW
O¶pYROXWLRQGHVH[LJHQFHV(QG¶DXWUHVWHUPHVLGHQWLILHUXQEXWSHUPHWWUDGHGpWHrminer le besoin,
O¶H[LJHQFHSRXUDWWHLQGUHFHEXWLe tableau suivant (Tableau 3), tiré de (Kavakli 2002), montre
OHVGLIIpUHQWVDSSRUWVGHO¶DQDO\VHGHVEXWVGDQVOHVDFWLYLWps G¶LQJpQLHUie des exigences identifiées
précédemment.
Tableau 3. Activités de RE et type de buts les supportant
Activité de RE
Elicitation
Type de but
Buts courants
Apport
Compréhension de la situation
organisationnelle existante
Buts changeants
Compréhension du besoin de
changement
Spécification
Buts futurs
Laison des buts métiers avec des
composants système fonctionnels et
non-fonctionnels
Validation
%XWVG¶pYDOXDWLRQ
Validation de la conformité des
spécifications du système avec les
buts du client
(Kavakli 2002) ajoute que « OHSURFHVVXVG¶LQJpQLHULHGHVexigences peut être vu comme une
progression à travers quatre états de modélisation de la connaissance » décrits par ces quatre types
de buts O¶pWDW© tel quel ªO¶pWDW© de changement ªO¶pWDW© G¶pYDOXDWLRQ ªHWO¶pWDW© à être ». Il
précise que le cKHPLQHPHQW j WUDYHUV FHV TXDWUH pWDWV Q¶HVW SDV ILJp HW TX¶LO SRXUUD YDULHU HQ
fonction du projet.
Il existe plusieurs méthodes G¶LQJpQLHULHGHVH[LJHQFHVRULHQWpHEXWV(ex. KAOS, i*,NFR«)
(Lapouchnian 2005) et les formalismes varient également11. De manière générale, lorsTX¶RQ
modélise des buts il faut pouvoir distinguer :
- les buts stratégiques KDXW QLYHDX G¶DEVWUDFWLRQ relatifs aux objectifs du domaine (ex.
« assurer la prise en charge des patients), et les buts opérationnels EDVQLYHDXG¶DEVWUDFWLRQ
plus spécifiques (ex. « signaler la prise en charge du patient sur le tableau). Il peut exister
plusieurs niveaux de buts stratégiques et opérationnels. 2Q GLUD TX¶XQ EXW FRQWULEXH j
O¶DWWHLQWHGXEXWTXLOXLHVWVXSpULHXU (voir figure 6).
11
http://www.utdallas.edu/~supakkul/tools/RE-­‐Tools/ 60 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
-
les buts fonctionnels (ce TX¶LO IDXW faire) et les buts non fonctionnels qui sont des qualités
supplémentaires souhaitées VpFXULWpFR€WVXVDELOLWp«,
les buts « génératifs » (atteindre/cesser), « restrictifs » (maintenir/éviter) et les « softgoals »
qui sont relatifs à des préférences et évalués de manière qualitative et subjective
contrairement aux deux autres types,
les relations entre les buts (7SOXVLHXUVEXWVFRQWULEXHQWjO¶DWWHLQWHGXEXWVXSpULHXU(7
FRPSOHW SOXVLHXUV EXWV FRQWULEXHQW HW VXIILVHQW j O¶DWWeinte du but supérieur), OU (le but
inférieur est une alternative au but supérieur).
La figure suivante (Figure 21) est un exemple de diagramme de buts fonctionnels dans le
domaine du projet AIC. Elle illustre un besoin courant PDLV FUXFLDO TXL HVW G¶DVVXUHU OD ERQQH
exécution du chantier en faisant en sorte que les entreprises de construction accèdent aux
GRFXPHQWV j H[pFXWHU WRXW HQ pYLWDQW TX¶LOV Q¶XWLOLVHQW GHV GRFXPHQWV UHQGXV REVROqWHV SDU GHV
mises à jour.
Figure 21. Exemple de diagramme de buts
Les scénarios sont la représentation du monde réel. Les méthodes basées sur les scénarios
complètent les buts en rendant les intentions plus claires à travers des descriptions de
fonctionnement qui satisfassent ces buts. ScenIC et SCRAM en sont deux exemples (Misra &
Kumar 2005). On retrouve dans les typologies de scénarios un découpage similaire à celui
observé précédemment pour les buts (voir tableau 1), à savoir :
- les scénarios de déclaration du problème qui expliquent en quoi le système DFWXHO Q¶HVW SDV
satisfaisant,
- les scénarios de vision décrivent comment le système devrait opérer,
- lHV VFpQDULRV G¶XVDJH RX FRPSRUWHPHQWDX[ GpFULYHQW OHV FRPSRUWHPHQWV GHV XWLOLVDWHXUV HW
du système actuel, ainsi que leur contexte physique et social. Ils sont aussi utilisés comme
donnée de test pour la validation des exigences.
Les buts et les scénarios servent de base à la modélisation du système, tantôt transformés en
modèles conceptuels, tantôt utilisés FRPPH VRXUFH G¶LQVSLUDWLRQ SRXU OH GpYHORSSHPHQt via
prototypage (voir section suivante). Étant issus des témoignages des utilisateurs, ils présentent des
limites relatives à la subjectivité (RXEOLG¶LQIRUPDWLRn ou au contraire exagération des problèmes,
GLIIpUHQFHVG¶opinions«
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
61 Alors que les buts traduisent des intentions peut être trop vagues et que les scénarios
paraissent au contraire trop spécifiques, il semblerait pertinent selon (Misra & Kumar 2005) de
FRPELQHUFHVGHX[DSSURFKHVTXLV¶DYqUHQWFRPSOpPHQWDLUHV
Les activités de l¶DQDO\VH et de la conception (analysis and design).
/¶DQDO\VH est définie comme le fait de poser et comprendre le problème et son domaine en
faisant DEVWUDFWLRQGHO¶LPSOpPHQWDWLRQ/HVLQSXWVGHVDFWLYLWpVG¶DQDO\VHVRQWGRQFOHPRGqOHGX
domaine et les H[LJHQFHVTXHO¶on aura définies précédemment. Elles définissent elles-mêmes les
inputs nécessaires à la conception au travers GHSOXVLHXUVPRGqOHVFUppVjO¶DLGHG¶RXWLOVGpGLpV:
- un diagramme UML de FDV G¶XWLOLVDWLRQ XVH FDVH diagram) (Alistair Cockburn 2000)
décrivant de manière graphique un ensemble G¶pYqQHPHQWV ayant lieu entre un ou plusieurs
acteurs et le système pour accomplir un but précis. Notez que le diagramme de cas
G¶XWLOLVDWLRQ peut aussi être utilisé pour modéliser des buts (on parle alors de « business use
case »).
Figure 22. ([HPSOHGHGLDJUDPPH80/GHFDVG¶XWLOLVDWLRQ
-
Un diagramme UML de séquences12 décomposant chaque use case, en montrant les échanges
de messages entre un DFWHXU HW OH V\VWqPH DLQVL TXH GHV LQGLFDWLRQV HQ FDV G¶itération. Le
système est alors vu comme une « boite noire », sans détail de ce qui le compose.
12
http://www.agilemodeling.com/artifacts/sequenceDiagram.htm 62 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Figure 23. Exemple de diagramme de séquence système
$ORUVTXHO¶DQDO\VHGpFULWOHµquoi faire¶ (après avoir défini le µpourquoi ¶ avec les exigences),
la conception définit le µcomment faire¶. &HWWH DFWLYLWp LPSOLTXH O¶LQWHUSUpWDWLRQ GX FRQFHSWHXU
F¶HVWO¶DFWLYLWpFUpDWLYHGXSURFHVVXVHWODSOXVVXEMHFWLYH Elle FRQVLVWHjLQWHUSUpWHUO¶DQDO\VHSRXU
proposer une solution dans une architecture logicielle et matérielle à travers des classes et des
DEVWUDFWLRQV G¶REMHW F¶HVW FH TX¶RQ DSSHOOH O¶DUFKLWHFWXUH FRQFHSWXHOOH (Bass et al. 2003). Elle
UHSUpVHQWHjODIRLVO¶HQVHPEOHGHVpYqQHPHQWVHWO¶HQVHPEOHGHVGRQQpHV (Guibert 2007).
- Le concepteur étend le diagramme de séquences système en un diagramme de séquences
technique dans lequel il y ajoute les évènements internes au système qui est alors décrit plus
précisément (sous forme G¶HQWLWpV ORJLFLHOOHV RX GH FRPSRVDQWV, il est qualifié de « boîte
blanche »). On parle ici de « décomposition fonctionnelle ».
Figure 24. Représentation des évènements internes au système par un
diagramme de séquence technique
-
Il transforme le modèle conceptuel du domaine en un (autre) modèle relationnel (E-R ou de
classes UML) qui modélise quant à lui toutes les informations (et leurs structures) devant être
| Chapitre 4 - De O¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
63 manipulées (et donc stockées) afin de connaitre leur nature et donc le moyen de les traiter.
Les structures de données sont typées : texte, lien hypertexte, donnée numérique, date/heure,
objet multimédia, valeur booléenne. &¶HVW FH TX¶RQ DSSHOOH « l¶RUJDQLVDWLRQ VWUXFWXUHOOH ».
Cette structure sera utilisée par le développeur pour implémenter la solution dans son
HQYLURQQHPHQW GH GpYHORSSHPHQW VSpFLILTXH 3OXV FHWWH VWUXFWXUH FRQWLHQW G¶pOpPHQWV déjà
définis et codés, plus le développeur pourra gagner de temps en réutilisant ce code.
Figure 25. ([HPSOHGHUHSUpVHQWDWLRQG¶XQ concept métier en élément
de modèle structurel
Les activités GHO¶Lmplémentation.
/¶LPSOpPHQWDWLRQG¶XQlogiciel HVWO¶pFULWXUHGXFRGHLQWHUSUpWpSDUOHGLVSRVLWLITXLO¶H[pFXWH
&¶HVW GRQF RULJLQHOOHPHQW XQH VDLVLH GH WH[WH GDQV XQ ODQJDJH SDUWLFXOLHU HW YLD XQ pGLWHXU Au
travers des générations, les langages de programmation 2¶5HJDQ se sont éloignés du
« langage machine » (fait de 1 et de 0) pour devenir plus conceptuels et ainsi être plus facilement
manipulables et compréhensibles par les humains. On parle de langages « haut-niveau » qui
peuvent être créés indépendamment de la machine à partir de librairies puis compilés pour
différentes plateformes. Les langages orientés objet en font partie et ont la particularité de diviser
les tâches de programmation en objet (ex. -DYD&«UML propose de modéliser le système
sous forme de diagrammes de composants (qui permet de montrer les composants du système d'un
point de vue physique, tel TX
LOVVRQWPLVHQ°XYUH.
Il existe plusieurs modèles qui décrivent une architecture logicielle, introduisant différents
concepts (Bass et al. 2003). Le modèle MVC (Modèle-Vue-Contrôleur) offre un point de vue
simple au travers de trois classes (Figure 26).
- Le Modèle contient les données mais aussi les méthodes pour manipuler ces données (c.à.d.
ajouter, supprLPHUUpFXSpUHU«&¶HVW en quelque sorte le « F°XU » GHO¶DSSOLFDWLRQ
- /D 9XH HVW FH DYHF TXRL O¶XWLOLVDWHXU LQWHUDJLW 6\PEROLTXHPHQW SDUODQW XQH YXH HVW XQH
fenêtre sur le modèle : elle présente une partie du contenu de celui-ci. La vue a aussi pour rôle
GHFDSWHUOHVLQWHUDFWLRQVGHO¶XWLOLVDWHXU(par exemple les clicks).
- Le Contrôleur synchronise la vue et le modèle en les mettant à jour. Typiquement, il analyse
OHV UHTXrWHV HQYR\pHV SDU O¶XWLOLVDWHXU GHSXLV OD YXH ex. afficher des données particulières
FRPPHO¶HPSORLGXWHPSVG¶XQMRXUSDUWLFXOLHULOGHPDQGHDXPRGqOHDSSURSULpG¶H[pFXWHU
la requête (ex. DXPRGqOHG¶HPSORLVGHWHPSVGHUpFXSpUHUFHOXLGXMRXUGHPDQGpSXLVjOD
YXHGHV¶DFWXDOLVHUDYHFOHVLQIRUPDWLRQVHQYR\pHVSDUOHPRGqOH
64 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Figure 26. Schéma d¶XQHDUFKLWHFWXUHORJLFLHOOHreprésentée par le
modèle MVC
Le kit de développement logiciel (SDK pour « software development kit ») est O¶HQVHPEOHGHV
outils de développement qui seront fournis au développeur et permettront la création du logiciel
(codage et compilation) dans un environnement matériel et logiciel spécifique. Les SDKs
contiennent également des notes techniques et autres documentations pour assister le développeur.
Les activités de test et le déploiement.
Un cycle GHGpYHORSSHPHQWTX¶LOVRLWJOREDORXTX¶LOIDVVHSDUWLH G¶XQSURFHVVXVLWpUDWLIHVt
pYDOXpjWUDYHUVO¶pYDOXDWLRQGHses différentes phases (Kaner & Falk 1999).
Durant les phases de planification (c.à.d. G¶pWXGHV SUpOLPLQDLUHV HW G¶pODERUDWLRQ, il est
QpFHVVDLUH G¶pYDOXHU OHV H[LJHQFHV GH SDU O¶DQDO\VH GX SRD) et les définitions fonctionnelles
apportées par les activités de conception.
- Les exigences doivent être estimées cohérentes, vis-à-vis des besoins identifiés (le produit
« exigé » est-il utile ? Pendant combien de temps le sera-t-il ?) mais aussi des possibilités de
développement (quels sont les moyens personnels, techniques, financiers à disposition ? EstFHUDLVRQQDEOHG¶HQWDPHUOHGpYHORSSHPHQW".
- Le produit conçu (et proposé) doit répondre aux exigences, à savoir aux besoins mais cela
signifie aussi TX¶LO GRLW être réalisable techniquement (en fonction des performances du
GLVSRVLWLITXLO¶H[pFXWHUD.
/¶pYDOXDWLRQ GH OD VROXWLRQ LPSOpPHQWpH VH IDLW DX WUDYHUV GH WHVWV G¶XWLOLVDWLRQ exécutés en
LQWHUQHGDQVO¶pTXLSHGHGpYHORSSHPHQW(identification des bugs majeurs) puis auprès des clients
qui évalueront son utilité WHVW GH O¶DFFHSWDWLRQ. Le produit ne peut rWUH WHVWp TX¶j SDUWLU GX
moment où il est (en partie) fonctionnel.
Lors du déploiement, c'est-à-dire lors de la livraison du produit, il peuWrWUHQpFHVVDLUH G¶HQ
DVVLVWHUO¶LQVWDOODWLRQ/HSURGXLWGRLWHQVXLWHrWUH© maintenu » jWUDYHUVO¶DVVLVWDQFHWHFKQLTXHOD
correction de bugs persistants pYHQWXHOV YRLUH O¶pYROXWLRQ GH OD VROXWLRQ nouvelles
fonctionnalités, changement GHO¶LQWHUIDFH«).
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
65 1.9.4 Les méthodes agiles
Au-GHOj GHV DFWLYLWpV LGHQWLILpHV O¶DFWLYLWp GH JHVWLRQ GX SURMHW RFFXSH XQH SODFH WUqV
importante. Comme dans tout travail collaboratif, il est crucial de (1) pouvoir coordonner et
superviser les tâches de chacun et (2) assurer ODFRPPXQLFDWLRQHWOHWUDQVIHUWG¶LQIRUPDWLRQVHQWUH
OHV GLIIpUHQWV DFWHXUV GH O¶pTXLSH HW j tous les stades du développement. À la fin du 20e siècle,
nombre de chercheurs estimèrent que les cycles de développement traditionnel ne répondaient pas
à ces besoins et proposèrent leurs propres méthodes visant à améliorer le développement logiciel.
Afin de les unifier, ils LQVWDXUqUHQW OHV SULQFLSHV IRQGDPHQWDX[ G¶XQ GpYHORSSHPHQW DGDSWp GHV
logiciels : le développement agile.
Les principes
Le manifeste pour le développement agile de logiciels13 (Greer & Hamon 2011; Martin 2003)
rédigé en 2001 définit 12 principes déclinés des quatre valeurs fondamentales suivantes (voir
aussi Figure 27) :
- la priorité des individus et des interactions sur les procédures et les outils, en encourageant
O¶DXWo-organisation et la motivation,
- la priorité aux logiciels opérationnels qui seront plus utiles aux clients pour évaluer le travail
en cours (et donc mieux accueillis) que des documentations exhaustives,
- la pULRULWpjODFROODERUDWLRQDYHFOHVFOLHQWVSOXVTX¶jODQpJRFLDWLRQFRQWUDFWXHOOH avec eux,
impliquant ceux-FLWRXWOHORQJGXF\FOHGHGpYHORSSHPHQWDILQG¶DVVXUHUODSULVHHQFRPSWH
continue de leurs exigences (et plus uniquement au début du projet pour la définition du
contrat),
- la pULRULWpjO¶DGDSWDWLRQDXFKDQJHPHQWSOXVTX¶DXVXLYLG¶XQSODQDXWRULVDQWO¶pYROXWLRQGX
processus.
Figure 27. Valeurs des méthodes agiles face aux concepts des méthodes
classiques
13
http://www.agilemanifesto.org/iso/fr/ 66 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Plusieurs méthodes intègrent ces notions à OHXUPDQLqUHGHX[G¶HQWUHHOOHVVRQWGpFULWHVGDQV
la section qui suit : XP et SCRUM.
La méthode extreme programming (XP)
3DUPL OHV PpWKRGHV GH GpYHORSSHPHQW DJLOH O¶;3 (Beck 2006) « SRXVVH j O¶H[WUrPH » les
bonnes pratiques de développement classique. Cette méthode préconise des cycles de
développement très courts (de 2 à 3 semaines) basés sur des « user stories » fournis par le client.
Alors que le use case GpFULW O¶XWLOLVDWLRQ GX V\VWqPH GH PDQLqUH JpQpUDOH HW formalise de façon
permanHQWH O¶DFFRUG HQWUH OH FOLHQW HW OH GpYHORSSHXU Oes « user stories » (« histoires
G¶XWLOLVDWHXUV ») supportent une collaboration continue entre ces deux acteurs en décrivant des
scénarios G¶XWLOLVDWLRQ SUpFLV. Chaque « user story » est éphémère et faite pour être oubliée dès
lors que la solution a été implémentée et validée (Cohn 2003). /¶XWLOLVDWHXU HVW DLQVL IRUWHPHQW
impliqué dans le processus.
En fonction des « user stories » HWLWpUDWLYHPHQWMXVTX¶jFHTXH tous les cas de figure soient
traités et validés, les développeurs suivent le processus suivant :
- ils déterminent et attribuent les tâches de développement ainsi que les tests à mener,
- ils réalisent leurs tâches de développement en binôme,
- iOVWHVWHQWOHFRGHGpYHORSSpHWO¶LQWqJUHQWFRQWLQXHOOHPHQWdans le système final.
Figure 28. Cycle de développement dans la méthode XP
&HWWHPpWKRGHQHV¶LQVFULWSDVGXWRXWGDQVODPpWKRGRORJLHSUpVHQWpHSUpFpGHPPHQWFDUHOOH
HVWFODLUHPHQWRULHQWpHSURJUDPPDWLRQSDVGHSKDVHGHFRQFHSWLRQHWQ¶HVWSDVVXSSRUWpHSDUGHV
PRGqOHV(OOHSUpVHQWHFHSHQGDQWO¶DYDQWDJHGHJpUHU continuellement l¶pYROXWLRQ des besoins et
GHVULVTXHV /HIRQFWLRQQHPHQWSDU SHWLWHVpTXLSHVHW O¶DXWRQRPLHGHVELQ{PHVGHGpYHORSSHXUV
SHUPHWDXVVLGHVLPSOLILHUO¶DFWLYLWpGHJHVWLRQGXSURMHW
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
67 La méthode SCRUM
Le nom « scrum » se rapporte au domaine du rugby : F¶HVWcette manière de recommencer le
jeu UpSpWLWLYHPHQW WRXW DX ORQJ G¶XQH SDUWLH. La méthode de développement agile SCRUM
(Schwaber & Sutherland 2011; Schwaber & Beedle 2001) est également basée sur le
fractionnement du développement en cycles courts (1 à 4 semaines) qui sont ici nommés les
« sprints ». Les phases de « backlog » servent à déterminer les exigences (sous forme de « user
stories ») pour le produit en général puis plus précisément pour le sprint qui suit. La particularité
de la méthode SCRUM est qu¶XQHIRLVOHVSULQWFRPPHQFpLOQ¶HVWSDVLQWHUUXSWLEOH/¶pTXLSHGH
GpYHORSSHPHQWWUDYDLOOHDORUVVDQVFRQWDFWDYHFOHFOLHQWHWV¶RUJDQLVHHOOH-même. Les exigences
restent donc inchanJpHV GXUDQW FKDTXH F\FOH HW F¶HVW OH © ScrumMaster ª TXL V¶DVVXUH GX Eon
GpURXOHPHQW GX GpYHORSSHPHQW HW TXH O¶pTXLSH Q¶HVW SDV LQWHUURPSXH Au cours du sprint, des
UpXQLRQV MRXUQDOLqUHV OHV PrOpHV VHUYHQW j IDLUH OH SRLQW VXU O¶DYDQFHPHQW A la fin de chaque
sprint, une « démo ªGHFHTXLDpWpSURGXLWHVWSUpVHQWpHHWO¶pTXLSHHIIHFWXHXQHUpWURVSHFWLYHGH
ce qui a été fait (et pas fait).
Ici encore, la gestion du projet est une considération importante. Celui-ci est géré par des
cycles courts conclus par la mise en commun du travil et des discussions entre développeurs et
utilisateurs.
Figure 29. Processus de la méthode SCRUM
1.9.5 Constat et conclusion
Le projet de développement logiciel suit un cycle de vie structuré et formalisé.. Les méthodes
PRGHUQHVV¶DSSXLHQWVur des modèles qui rendent compte des activités menées et servent de point
de départ aux activités qui suivent, ce qui assure la cohérence des résultats tout au long du
processus mais aussi la traçabilité des choix. Les formalismes utilisés sont admis par la
communauté et sont compris par chacun.
/¶DJLOLWpDSSRUWHDX[PpWKRGHVGHGpYHORSSHPHQWXQHRUJDQLVDWLRQULJRXUHXVHGHVF\FOHVGH
GpYHORSSHPHQW /¶DOWHUQDQFH GH F\FOHV FRXUWV © exigences-développement-bilan » permet de
construire une solution logicielle petit à petit et toujours dans le respect des attentes du client. Ce
dernier peut exprimer ses besoins de manière simple à travers des modèles adaptés
(principalement les user stories) HWOHVGpYHORSSHXUVSHXYHQWDORUVV¶DXWR-organiser pour produire
une solution fonctionnelle qui sera rapidement évaluée. &HV PpWKRGHV DVVXUHQW DORUV O¶XWLOLWp GX
produit final proposé.
68 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
&H TXH O¶DJLOLWp Q¶DSSRUWH SDVHW TXLUHVWHOD ODFXQH GHVPpWKRGHVGH JpQLH ORJLFLHO F¶HVW OD
prise en compte des utilisateurs et de leurs interactions avec le système (Constantine 2002). En
HIIHWSRXUXQHERQQHDSSURSULDWLRQG¶XQRXWLOSDUXQXWLOLVDWHXULOHVWQpFHVVDLUHG¶HQGpILQLU non
seulement le fond (c.à.d. les fonctionnalités) mais au aussi la forme O¶LQWHUIDFH : on parle alors
G¶interface homme-machine (IHM) (Booth 1989). /HVPpWKRGHVDJLOHVQ¶RIIUHQWFHSHQGDQWSDVGH
réels guides pour les concepteurs et les développeurs en ce qui concerne les IHM. Les méthodes
dites « enrichies » apportent cette composante interface en orientant le développement sur
« O¶XWLOLVDELOLWp ».
1.10
/DFRQFHSWLRQG¶,+0 GHO¶XWLOLVDWHXUjO¶LQWHUIDFH
Si les méthodes classiques GH*pQLH /RJLFLHOVRQW EDVpHV VXU O¶pWXGH GH © ce que le logiciel
fait ª OHV PpWKRGHV HQULFKLHV GH FRQFHSWLRQ G¶,+0 V¶LQWpUHVVHQW en plus à « comment il doit le
faire ». Cette question jusque-là laissée au libre choix du développeur pendant le développement
est désormais WUDLWpHGqVO¶analyse et la conception à travers plusieurs approches : la conception
centrée utilisateur (CCU), la conception centrée activité (CCA), la conception dirigée par les buts
(CDB) et la conception centrée usage (CCUs). Cette section illustre comment ces approches
combinent études de terrain et implications diverses GH O¶XWLOLVDWHur dans le processus de
conception. Nous y présentons plusieurs types de modèles (caractérisant les tâches utilisateurs et
les concepts qui gravitent autour) qui sont utilisés pour la conception.
1.10.1 Vers une méthodologie de la conception enrichie
Les méthodes de GL et notamment les méthodes agiles visent la satisfaction du client,
considéré comme celui qui « a besoin » du logiciel. Le client est alors impliqué dans la
IRUPXODWLRQGHVH[LJHQFHVSXLVGDQVO¶pYDOXDWLRQGHODUpSRQVHjFHVH[LJHQFHV1RXVFRQVLGprons
à présent le client FRPPHOHIXWXUXWLOLVDWHXU(QG¶DXWUHVWHUPHVLOQHV¶LQWpUHVVHSOXVVHXOHPHQWj
ce que va lui apporter le logiciel (c.à.d. à la manière dont il répondra à ses besoins), mais il attend
en plus une utilisation simple et efficace à travers une interface adaptée RQSDUOHG¶XWLOLVDELOLWp
/DFDSDFLWpG¶XQH,+0jV¶DGDSWHUDX[FRQWUDLQWHVjODIRLVPDWpULHOOHVHWHQYLURQQHPHQWDOHVGDQV
le respect de son utilisabilité est définie comme sa plasticité (Thevenin 2001).
(Laurillau 2002) iOOXVWUH O¶HQULFKLVVHPHQW des méthodes de conception logicielle à travers
O¶H[HPSOHGHODPpWKRGH « en V » (Figure 30). Il réorganise les étapes de ce cycle « selon deux
catégories : OHV pWDSHV UHOHYDQW GH O¶HVSDFH ,+0 F¶HVW-à-dire les étapes de conception
HUJRQRPLTXH GX V\VWqPH HW G¶pODERUDWLRQ G¶XQ PRGqOH G¶LQWHUDFWLRQ UpSRQGDQW j GHV UHTXLV
LGHQWLILpV j O¶LVVXH GH O¶pWDSH G¶DQDO\VH GHV EHVRLQV HW OHV pWDSHV UHOHYDQW GH O¶HVSDFH ORJLFLHO
F¶HVW-à-dire les étapes de conception et de développement logiciels ».
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
69 Figure 30. Le processus de conception « en V », repris par (Laurillau
2002)
-
Plusieurs approches visent à SUpFRQLVHUO¶XWLOLVDELOLWp:
La conception centrée utilisateur (Norman 1986)
La conception centrée activité (Gifford & Enyedy 1999)
La conception dirigée par les buts (Cooper 1996)
La conception centrée usage (Constantine & Windl 2003)
Littéralement parlant, la CCU VHFRQFHQWUHVXUO¶XWLOLVDWHXUTXLPDQLSXOHOHV\VWqPHla CCA
VXU O¶DFWLYLWp c.à.d. les tâches qui doivent être proposées par le système) et la CDB sur les
buts (liés à O¶XWLOLVDWLRQGHV\VWqPH. Elles semblent donc être des approches différentes. Pourtant,
ODGpILQLWLRQGHO¶XWLOLVDWHXUGDQVOHVPpWKRGHVGH&&8V¶HVWpWHQGXHde sorte TX¶HOOHFRXYUHDXVVL
O¶LGHQWLILFDWLRQ GHV VHV PRWLYDWLRQV HW GH VHV WkFKHV 5pFLSURTXHPHQW O¶DQDO\VH GHV WkFKHV G¶XQ
système (dans la CCA) HVWOLpHDX[WkFKHVGHO¶XWLOLVDWHXUHWGRQFjODFRQQDLVVDQFHGHFHOXL-ci. Il
HQHVWGHPrPHSRXUO¶DQDO\VHGHVEXWs dans la CDB. Ces conclusions sont notamment celles de
O¶pWXGHPHQpHGDQV(Williams 2009), qui souligne que la limite qui sépare ces approches est floue
et difficile à déterminer.
Constantine, j O¶RULJLQH de la conception centrée usage, VH EDVH DXVVL VXU O¶DQDO\VH GH
O¶XWLOLVDWHXUGHVHVWkFKHVHWREMHFWLIV,OFKHUFKHFHSHQGDQWjOLPLWHUO¶LQWHUYHQWLRQGHO¶XWLOLVDWHXU
en donnant la priorité j O¶DEVWUDFWLRQ SDU OHV modèles sur (1) les données brutes à propos des
utilisateurs et (2) les prototypages réalistes et itératifs (Constantine & Windl 2003).
70 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Tableau 4. Différences majeures entre CC-Utilisateur et CC-Usage (Constantine, 2003)
Conception centrée utilisateur
&RQFHQWUDWLRQVXUO¶XWLOLVDWHXUVRQ
expérience, sa satisfaction
Conception centrée usage
Concentration VXUO¶XVDJHHWVXU
l¶outillage des tâches
'LULJpHSDUOHVGRQQpHVVXUO¶XWLOLVDWHXU
Dirigée par les modèles
,PSOLFDWLRQLPSRUWDQWHGHO¶XWLOLVDWHXU
,PSOLFDWLRQVpOHFWLYHGHO¶XWLOLVDWHXU
Description des utilisateurs, de leurs
caractéristiques
0RGqOHVGHUHODWLRQVHQWUHO¶XWLOLVDWHXUHW
le système
Maquettages réalistes
Maquettages abstraits
Conception par prototypage itératif
Conception par modélisation
Processus variés et souvent informels
Processus systématiques et entièrement
spécifiés
Évolution à travers la résolution
G¶HUUHXUV
Évolution jWUDYHUVO¶LQJpQLHULH
,FLHQFRUHQRWUHREMHFWLIQ¶HVWSDVGHGpFULUHOHVPpWKRGHVSRXUFHTX¶HOOHVVRQWPDLVSOXW{W
de comprendre les concepts qui caractérisent la conception. Nous préfèrerons parler plus
généralement de la méthodologie de la conception enrichie en la définissant au travers de ses
méthodes. Nous adoptons la définition de (Abras & Maloney-Krichmar 2004) (TX¶LO SURSRVH
originellement pour la conception centrée utilisateur) : « un ensemble de processus dans
lesquels les utilisateurs finaux influencent - G¶XQHIDoRQRXG¶XQHDXWUH- la mise en forme de
la conception ».
-
-
Ainsi, selon (Norman 1986)O¶XWLOLVDWHXUG¶XQHLQWHUIDFHDGDSWpHGHYUD
sDYRLUFHTX¶LOGRLWIDLUHHQIRQFWLRQGHFHTX¶LOYHXWIDLUHH[VLLOYHXWUHWRXUQHUjO¶DFFXHLO
G¶XQ VLWH VL LO YHXW YDOLGHU HW SD\HU VD FRPPDQGH« &HOD LPSOLTXH TXH OHV IRQFWLRQQDOLWpV
soient visibles et compréhensibles RQ SDUOHUD DORUV G¶DIIRUGDQFH14 (Maier, 2009). Le
concepWHXUSRXUUDpJDOHPHQWXWLOLVHUOHVFRQWUDLQWHVSRXUOLPLWHUOHVFKRL[GHO¶XWLOLVDWHXUHWOH
guider vers la solution.
6DYRLU FH TX¶LO VH SDVVH HW FH TX¶LO YD VH SDVVHU H[ © le fichier est en cours de
téléchargement », ou « si je clique sur annuler la traQVDFWLRQV¶DUUrWHUD »).
,OHVWSUpFRQLVpG¶XWLOLVHUGHVUHSUpVHQWDWLRQVJUDSKLTXHVVLPSOHVSOXW{WTXHGHVPRWVDLQVLTXH
GHVLPSOLILHUODVWUXFWXUHGHVWkFKHVDILQGHOLPLWHUOHUHFRXUVGHO¶XWLOLVDWHXUjVDPpPRLUH7RXWH
erreur dans un processus de tâches doit pouvoir être corrigée. Un système dit « centré utilisateur »
QHQpFHVVLWHSDVGHPDQXHOG¶XWLOLVDWLRQWUqVpWRIIp : il se veut intuitif.
Le tableau suivant (Tableau 5) présente quelques techniques et objectifs relatifs à
O¶LPSOLFDWLRQ du client au travers des SKDVHVG¶XQF\FOHGHSURMHWde développement logiciel. Sont
signalés en rouge les apports des méthodes enrichies par rapport aux méthodes traditionnelles de
Génie Logiciel (GL).
14
Le terme affordance vient du verbe « to afford » (offrir͕ĨŽƵƌŶŝƌ͕ƉƌŽĐƵƌĞƌͿĞƐƚĚĠƐŝŐŶĞůĂĐĂƉĂĐŝƚĠĚ͛ƵŶ
objet à suggérer sa propre utilisation. | Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
71 Tableau 5. Implication dHO¶acteur en tant que client et utilisateur
Technique
Groupe de travail
But
Connaitre les exigences du
client
Phase
Études préliminaires
Groupe de travail /
observations
Connaitre le domaine
G¶XWLOLVDWLRQ
Études préliminaires
Groupe de travail /
observations
Connaitre les tâches métier
TX¶LOIDXWDFFRPSOLU
Études préliminaires
I nterviews et
questionnaires
&RQQDLWUHO¶XWLOLVDWHXUHWVHV
préférences
Études préliminaires
Observations sur site
Connaitre le contexte
SK\VLTXHG¶XWLOLVDWLRQ
Études préliminaires
Tests, simulations
Évaluer les alternatives
d¶LQWHUDFWLRQ obtenir des
informations supplémentaires
sur les préférences
Élaboration/ Construction
Tests et
questionnaires
Évaluer O¶XWLOLWp
Transition
Tests et
questionnaires
Évaluer O¶XWLOLVDELOLWp
Transition
1.10.2 La modélisaWLRQGHO¶XWLOLVDWHXU et de son contexte
Selon (Dey 2001), « le contexte regroupe toutes les informations qui peuvent être utilisées
SRXUFDUDFWpULVHUODVLWXDWLRQG¶XQHHQWLWp8QHHQWLWpHVWXQHSHUVRQQHXQHQGURLWRXXQREMHWTXL
UHOqYHGHO¶LQWHUDFWLRn entre un utilisateur et une application, eux-mêmes inclus ».
Le modèle contextuel de (Tazari 2003) contient par exemple : le profil de ressources
matérielles et logicielles, le profil de localisation (c'est-à-GLUHODSRVLWLRQGHO¶XWLOLVDWHXUO¶LQVWDQW
SUpVHQWKHXUHGDWHFRXUDQWHOHSURILOGHO¶XWLOLVDWHXUH[SHUWFRQILUPpQRYLFHGDQVO¶DFWLYLWp
OHV SUpIpUHQFHV VXU OHV DSSOLFDWLRQV SDUDPpWUDJH GH OD SRVLWLRQ GHV PHQXV« GRQQpHV
spécifiques aux applications, les EXWV GH O¶XWLOLVDWHXU« (Calvary et al. 2003) regroupe ces
informations à travers trois concepts majeurs O¶XWLOLVDWHXUODSODWHIRUPHORJLFLHOOHHWPDWpULHOOH
HWO¶HQYLURQQHPHQW
Dans le processus de conception des IHM, la prise en compte G¶XQou plusieurs élément(s) du
contexte peut être déterminante tout comme elle peut être inutile. Il est donc important de savoir
déterminer quel rôle joue le contexte et comment le prendre en compte.
En 1999, Cooper introduisait la CDB et XQH PRGpOLVDWLRQ LQQRYDQWH GH O¶XWLOLVDWHXU et son
contexte dans le domaine des IHM : le persona (Cooper 1999). « Le persona est une description
SUpFLVHGHVFDUDFWpULVWLTXHVG¶XQXWLOLVDWHXUHWGHFHTX¶LOYHXWDFFRPSOLU ». Il peut représenter un
XWLOLVDWHXU SDUWLFXOLHU RX XQ HQVHPEOH G¶XWLOLVDWHXUV XQ SURILO (Chang et al. 2008). On apprend
également de (Chang et al. 2008) que le persona est créé HQSKDVHG¶pWXGHVSXLVFRPSOpWpVLGH
nouvelles informations sont acquises lors des tests,OSHXWpYHQWXHOOHPHQWrWUHLPDJLQpjO¶LVVXH
72 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
G¶XQH LGpH GH FRQFHSWLRQ SDUWLFXOièrement innovante, auquel FDV O¶XWLOLVDWHXU W\SH Q¶H[LVWH pas
encore.
Le persona a aussi été adopté GDQV OHV PpWKRGHV GH &&8 (Q IRQFWLRQ GHV FDV G¶pWXGHV, il
arbore différentes formes et différents contenus (Pruitt & Grudin 2003; Olsen 2004; Seffah et al.
2009). 'H PDQLqUH JpQpUDOH OD GHVFULSWLRQ GH O¶XWLOLVDWHXU au travers d¶XQ persona doit apporter
WRXWHLQIRUPDWLRQTXLSRXUUDV¶DYpUHUXWLOHGDQVODFRQFHSWLRQ GXORJLFLHOTX¶LOGHYUDDSSUpKHQGHU
(ex. les SULQFLSDOHV WkFKHV GH PDLQWHQDQFH G¶XQ PpWKRGLVWe qui sont utilisées pour concevoir un
système de e-PDLQWHQDQFH LQGXVWULHOOH DX QLYHDX G¶XQ JURXSH DJUR-alimentaire (Seffah et al.
2009)). Certains feront le choix de « tout dire » puis de piocher O¶LQIRUPDWLRQQpFHVVDLUHdans ces
GRQQpHV G¶DXWUHV OLPLWHUont la description à ce qui sera utile en omettant les informations
superflues. &HWWH LQIRUPDWLRQ SRXUUD rWUH G¶RUGUH SHUVRQQHO FRPPH SURIHVVLRQQHO HW GpILQLU via
différents attributs une identité, une activité, une expérience, une motivation, un contexte
physique, un contexte social, etc«
Constantine dans son approche de conception centrée usage utilise des « rôles utilisateur »
(user role) pour « informer le processus de conception ª j SURSRV GH O¶XWLOLVDWHXU (Constantine
2006). Le rôle utilisateur est défini comme « XQHQVHPEOHGHEHVRLQVFDUDFWpULVWLTXHVG¶LQWpUrWV
G¶DWWHQWHVHWGHFRPSRUWHPHQWVHQUHODWLRQDYHFXQV\VWqPHSDUWLFXOLHU ». Sa modélisation se fait
par une « checklist » au travers de trois concepts principaux : le contexte, les caractéristiques, les
critères (Figure 31).
(Q IRQFWLRQ GHV DSSURFKHV O¶XWLOLVDWHXU DUERUH GRQF GLIIpUHQWHV FDUDFWpULVDWLRQV La section
suivante montre TX¶Ll en va de même pour O¶HQVHPEOHGHVWkFKHVTX¶LOHIIHFWXHHQLQWHUDFWLRQDYHF
le système.
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
73 Figure 31. 0RGpOLVDWLRQG¶XQUôle utilisateur dans la conception centrée
usage (tiré de (L. L. Constantine 2006))
74 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
1.10.3 La modélisation des tâches et du contenu
Nous adoptons le point de vue de (Kaindl & Jezek 2002), qui définit la tâche « comme un
fragment G¶DFWLYLWp TX¶XQH SHUVRQQH GRLW HIIHFWXHU », où O¶DFWLYLWp HVW LFL O¶interaction avec un
système.
Il existe plusieurs niveaux d¶DEVWUDFWLRQ de tâches : GHO¶LQWHQWLRQ guidée par une réflexion (on
pourra parler de tâche cognitive) jO¶LQWHUDFWLRQphysique proprement dite. (Winckler et al. 2004)
en donne par exemple 4 niveaux (voir Tableau 6).
Tableau 6. Niveau et portée des tâches selon [Winckler2004]
Niveau
But
Portée
ButVHWLQWHQWLRQVGHO¶XWLOLVDWHXU
Abstrait
Décomposition des buts en tâches
génériques
I nteraction
$FWLRQVGHO¶XWLOLVDWHXUHWGXV\VWqPH
Présentation visuelle
Rendu des fonctions exécutées par
O¶DSSOLFDWLRQ
(Samaan 2006) prend en compte deux niveaux pour le modèle de tâches. « Le modèle abstrait
de tâches représente une vue générique du système modélisé, et cela indépendamment du contexte
G¶XWLOLVDWLRQ HQ JpQpUDO HW SOXV VSpFLILTXHPHQW LQGépendamment de la plate-forme ». Une tâche
dite « abstraite » peut alors suivre plusieurs « SDWWHUQVG¶LQWHUDFWLRQ », c'est-à-GLUHTX¶HOOHSHXWrWUH
réalisée de plusieurs façons à travers des ensembles de tâches « du modèle concret », comme par
exemple, sélectionner un élément avec la souris ou avec le clavier... Ainsi, dans le modèle
concret, « les tâches représentent des interactions concrètes avec des objets de la présentation
manipulée ».
/H FRQWHQX G¶XQH LQWHUIDFH HVW FRPSRVp G¶REMHWV G¶LQWHUDFWLRQ TXL SHXYHQW pJDOHPHQW rWUH
spécifiés de manière concrète (CIO pour Concrete Interaction Object) ou abstraite (AIO pour
Abstract Interaction Object). Selon (Bodart & Vanderdonckt 1996), le CIO « représente tout objet
G¶LQWHUIDFHYLVLEOHHWPDQLSXODEOHTXLSHXWrWUHXWLOLVpHQHQWUpHRXHQVRUWLHG¶information relative
jXQHWkFKHG¶LQWHUDFWLRQ ª/HPDQTXHG¶XQLIRUPLVDWLRQHWGHVWDQGDUGLVDWLRQGDQVOHV&,2OLPLWH
la compatibilité avec la programmation orientée objets qui manipule des concepts abstraits. Cela
les rend difficiles à réutiliser et à maintenir.
Figure 32. CIO similaires dans différents environnements
Un AIO « FRQVLVWH HQ XQ HQVHPEOH GH &,2V G¶XQH PrPH FDWpJRULH mais définis
LQGpSHQGDPPHQW GH OHXU HQYLURQQHPHQW G¶LPSOpPHQWDWLRQ ª /D PDQLSXODWLRQ G¶REMHWV DEVWUDLWV
permet de définir une interface qui sera réutilisable. Elle permet aussi de laisser libres les
GpYHORSSHXUVTXDQWjO¶LPSOpPHQWDWLRQGHODVROXWLRQHQIRQFWLRQGHO¶HQYLURQQHPHQW(QILQOHV
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
75 $,2VRQWODFOpGHODJpQpUDWLRQDXWRPDWLTXHG¶LQWHUIDFHVGLULJpHSDUOHVPRGqOHVYRLUODVHFWLon
suivante (1.11)). (Bodart & Vanderdonckt 1996) répartissent les AIO en six familles : les objets
G¶DFWLRQGHGpILOHPHQWVWDtiques, de contrôle, de dialogue et de réaction (feedback).
Tableau 7. /¶HQVHPEOHGHV$,2UpSDUWLVHQIDPLOOHs (extrait de (Bodart & Vanderdonckt
1996))
On distingue FHV QLYHDX[ G¶DEVWUDFWLRQ GDQV OHV différentes méthodes de modélisation. Les
paragraphes suivants illustrent comment le scénario et le use case utilisés dans les activités de
développement logiciel peuvent supporter la caractérisation des interactions avec plusieurs
QLYHDX[ G¶DEVWUDFWLRQ. Nous y présentons ensuite un type de modélisation spécifique et plus
adapté : les arbres de tâches. Enfin, nous montrons comment illustrer une interface à travers des
maquettages, ici aussi de façon concrète ou abstraite.
Les modélisations du GL
La modélisation par scénario, que nous avons introduite DYHF O¶DFWLYLWp G¶LQJpQLHULH GHV
exigences (voir § 4.1.2) est utilisé dans les approches CCU, CCA et CDB pour décrire le
FRPSRUWHPHQW G¶XQ SHUVRQD. '¶DSUqV (Cohn 2003) il VH YHXW SOXV SUpFLV TX¶XQH © user story ».
&RPPH RQ SHXW OH YRLU GDQV O¶H[HPSOH ci-dessous LQVSLUp GH O¶H[HPSOH GH (Cohn 2003)), un
scénario peut décrire littéralement des intentions (« veut y planifier un voyage ») des tâches
abstraites (« accède à notre site »), des WkFKHV G¶LQWHUDFWLRQ (« click », « saisit ») et des
représentations visuelles (« un formulaire de saisie »).
« Amy est intéressée par la culture japonaise et veut y planifier
un voyage. Elle accède à notre site internet et click sur le lien
Hôtels. Un formulaire de saisie apparaît. Elle saisit Nagoya
comme ville de séjour et les dates du 14 au 19 novembre. Elle
sélectionne parmi une liste d¶K{WHOV le Royal Park Inn ».
76 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIaces |
Ce type de modélisation littérale semble cependant plus adaptée pour décrire des buts, des
intentions et des tâches relativement abstraites que GHVWkFKHVG¶LQWHUDFWLRQ, ce qui parait long et
fastidieux. 'H SOXV DORUV TX¶XQ VFpQDULR V¶LQWpUHVVH j XQ XWLOLVDWHXU HQ SDUWLFXOLHU LO VHUDLW SOXV
LQWpUHVVDQW G¶DEVWUDLUH © un scénario type », relatif à un « type G¶XWLOLVDWHXU » TXH O¶RQ DXUD
identifié
A cet effet, &RQVWDQWLQHXWLOLVHOHFDVG¶XWLOLVation (use case). Dans (Constantine 2001), il en
distingue deux types OH FDV G¶XWLOLVDWLRQ FRQFUHW © concrete use case ª HW OH FDV G¶XWLOLVDWLRQ
essentiel (« essential use case », aussi appelé « task case »).
Le « concrete use case » introduit un premier QLYHDX G¶DEVWUDFWLRQ : ainsi, on ne dira plus
« Paul écrit son pseudo et son mot de passe dans les champs du formulaire et clique sur
soumettre » mais « O¶XWLOLVDWHXUUHQVHLJQHVHVidentifiants jO¶DLGHG¶XQIRUPXODLUHHWOHVVRXPHW ».
« /¶HVVHQWLDOXVHFDse » est encore plus abstrait : il est composé de tâches du type « donne son
identification ». Comme on peut le voir dans (Constantine 2001) un « essential use case » est
défini comme « représentant des petits morceaux d¶H[pFXWLRQ G¶XQ U{Oe utilisateur ». Il se veut
essentiel, à savoir simple et abstrait (en contraste avec le scénario qui est complet et réaliste) ainsi
TX¶LQGpSHQGDQW GH OD WHFKQRORJLH (Constantine 2006). On parle alors des intentions de
O¶XWLOLVDWHXU HW Ges responsabilités du système. Il est représenté par Constantine sous forme
« littérale structurée », à savoir G¶un tableau en 2 colonnes (voir Figure 33).
7RXWFRPPHQRXVO¶DYRQVYXDXWUDYHUVGHO¶DQDO\VHGHVDFWLYLWpVGHFRQception logicielle, le
« use case » peut être représenté graphiquement. Le GLDJUDPPH GH FDV G¶XWLOLVDWLRQ permet
G¶LOOXVWUHU XQ HQVHPEOH GH « use cases » pour un système donné, le diagramme de séquences
permettra de décomposer le use case, au même titre que le tableau (figure 17).
Figure 33. Différentes représentations graphiques pour la
GpFRPSRVLWLRQG¶XQXVHFDVH
&RQVWDQWLQH QRXV PHW FHSHQGDQW HQ JDUGH FRQFHUQDQW O¶XWLOLVDWLRQ GHs diagrammes de
séquences car elle introduit la considération prématurée de la conception interne du système plutôt
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
77 TXH G¶HQFRXUDJHU j VH FRQFHQWUHU VXU OD QDWXUH HVVHQWLHOOH GHV WkFKHV Nous retiendrons
O¶LPSRUWDQFH GH FRQVLGpUHU OHV pWDSHV GH OD FRQFHSWLRQ XQH j XQH HQ XWLOLsant des formalismes
adaptés. &¶HVW FH TXH IDLW SDU H[HPSOH (Göransson et al. 2003) en intégrant la « conception de
O¶XWLOLVDELOLWp ª GH O¶DQJODLV © Usability Design ») dans les activités du RUP, avant les activités
G¶DQDO\VHHWFRQFHSWLRQ,O relève également les limites du langage UML et plus particulièrement
des « use cases ª GDQV FHWWH DFWLYLWp FDU LOV SRUWHQW O¶DWWHQWLRQ VXU OH V\VWqPH HW VRQW GH SOXV
« difficiles à comprendre par les utilisateurs ».
'¶DXWUHVPRGpOLVDWLRQVRQWYXOHMRXU indépendamment des méthodes de conception logicielle
mais visant plutôt à outiller celles-ci a posteriori, en caractérisant les tâches IHM : les arbres de
tâches.
Les arbres de tâches
La représentation à travers des arbres hiérarchiques permet de décrire tous les niveaux
G¶DEVWUDFWLRQGHVWkFKHVGHODSOXVDEVWUDLWHjODSOXVSUpFLVHNous présentons ici deux modèles de
tâches utilisateurs basés sur des arbres hiérarchiques : CTT et K-MAD.
'¶DSUqV (Mori et al. 2002), « XQH WkFKH GpILQLW FRPPHQW O¶XWLOLVDWHur peut atteindre un but
GDQVXQGRPDLQHVSpFLILTXHG¶DSSOLFDWLRQ », le but étant « XQHPRGLILFDWLRQGpVLUpHGHO¶pWDWG¶XQ
système ou une requête à ce système ». Les auteurs distinguent quatre types de tâches auxquelles
ils attribuent un élément graphique particulier pour créer leur propre forPDOLVPHG¶DUEUHGHWkFKHV
nommé CTT (ConcurTaskTree) et supporté par un éditeur dédié (CTTE)15 :
- les tâches utilisateur, cognitives ou physiques, entièrement H[pFXWpHV SDU O¶XWLOLVDWHXU VDQV
interaction avec le système,
- les tâches application, entièrement exécutées par le système (ex. la notification),
- lHVWkFKHVG¶LQWHUDFWLRQH[pFXWpHVSDUO¶XWLOLVDWHXUHQLQWHUDFWLRQDYHFOHV\VWqPH,
- les tâches abstraites, qui ne sont aucune des autres tâches mais sont décomposables en
SOXVLHXUVG¶HQWUHHOOHV.
Les différentes tâches sont liées entre elles de manière à représenter leur chronologie. Ainsi,
deux tâches peuvent être indépendantes ou synchronisées, une tâche peut autoriser la suivante ou
désactiver la précédente, elle peut être itérative, récursive, voire optionnelle.
(Pribeanu 2005) y ajoute également la notion de couche fonctionnelle (indépendante de la
plateforme) et de couche opérationnelle (dépendante de la plateforme). 8QH[HPSOHG¶XWLOLVDWLRQ
GH&77(SRXUODFRQFHSWLRQG¶LQterface est illustré Figure 34.
15
>͛ŽƵƚŝůddĞƚůĞƐŝŶĨŽƌŵĂƚŝŽŶƐƌĞůĂƚŝǀĞƐĂƵĨŽƌŵĂůŝƐŵĞddƐŽŶƚĚŝƐƉŽŶŝďůĞƐăĐĞƚƚĞĂĚƌĞƐƐĞ͗
http://giove.isti.cnr.it/tools/CTTE/home 78 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Couche fonctionnelle Couche opérationnelle Figure 34. ([HPSOHG¶DUEUHGHWkFKHV&77( (extrait de dans (Pribeanu
2005))
5HODWLYHPHQW SURFKH GH O¶pGLWHXU &77( O¶RXWLO .-MADe16 (Kernel of Model for Activity
Description environnement) (Baron et al. 2006) permet de « UHSUpVHQWHUO¶DFWLYLWpGHO¶XWLOLVDWHXU
VRXVIRUPHG¶DUEUHVGHWkFKHV » VXUODEDVHG¶XQHVWUXFWXUHnommée N-MDA (Noyau du Modèle
GH'HVFULSWLRQGHO¶$FWLYLWp(Lucquiaud 2005). Il est composé de trois éditeurs :
- l¶pGLWHXUJUDSKLTXHSRXU construire des arbres de tâches,
- l¶pGLWHXUGHFDUDFWpULVWLTXHVSRXUFDUDFWpULVHUFHVWkFKHVjWUDYHUVGLIIpUHQWVDWWULEXWV,
- l¶pGLWHXUGHVREMHWVPDQLSXOpVSDUO¶XWLOLVDWHXU
L¶DUEUHde tâches K-MAD permet de décomposer O¶DFWLYLWpen : une tâche générale, des tâches
intermédiaires, puis des tâches dites élémentaires (le plus fin degré de granularité). On retrouve le
GpFRXSDJHHQW\SHVGHWkFKHVFRPPHGDQV&77HQIRQFWLRQGHOµH[pFXWDQW de la tâche :
- la tâche utilisateur, exécutée par un individu ou une organisation,
- la tâche système, exécutée complètement par un équipement,
- la tâche interactive, déclenchée SDUO¶XWLOLVDWHXUHWUpDOLVpHVXUO¶pTXLSHPHQW,
- la tâche abstraite contient des sous-WkFKHVG¶H[pFXWDQWGLIIpUHQW,
- lDWkFKHGRQWO¶H[pFXWDQWHVWLQFRQQX esWFRPPHVRQQRPO¶LQGLTXHLQGpWHUPLQpH.
Figure 35. Les cinq types de tâches qui composent un arbre K-MAD
/HV WkFKHV ILOOHV G¶XQH PrPH WkFKH PqUH SHXYHQW rWUH RUGRQQDQFpHV GH IDoRQ VpTXHQWLHOOH
XQHDSUqVO¶DXWUHSDUDOOqOHHQPrPHWHPSVDOWHUQDWLYHXQHRXO¶DXWUHRXVDQVRUGUH&¶HVWFH
TX¶RQ DSSHOOH OD GpFRPSRVLWLRQ G¶XQH WkFKH (une tâche sans décomposition sera qualifiée
16
>͛ŽƵƚŝů<-­‐MADe et le manuel utilisateur sont disponibles à cette adresse : http://kmade.sourceforge.net/download.php | Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
79 G¶pOpPHQWDLUH 8QH WkFKH TXHOOH TX¶HOOH VRLW SHXW rWUH : obligatoire ou facultative, interruptible
ou pas, contrainte ou pas (c.à.d.. par un évènement, une condition), itérative ou unique.
Le maquettage
/RUV G¶XQ PDTXHWWDJH, iO V¶DJLW GH UHSUpVHQWHU JUDSKLTXHPHQW OHV IRQFWLRQV SRXUYXHV SDU OH
système. /HPDTXHWWDJHUHSUpVHQWHO¶LQWHUIDFHjXQLQVWDQWXnique.
Un maquettage peut être très précis, avec des éléments graphiques particuliers, un agencement
GpMjSHQVpXQHJHVWLRQGHODQDYLJDWLRQHWF«Il est un élément important dans les méthodes de
FRQFHSWLRQG¶,+0&&8&&$&'%FDULO supporte le dialogue entre utilisateurs et concepteurs
en leur permettant de représenter la future interface de manière concrète par la composition
G¶pOpPHQWVJUDSKLTXHV : les CIO (Concrete Interaction Objects) (ex. Figure 36).
Figure 36. Exemple de maquettage (outil « Balsamiq Mockup »)
,FL HQFRUH &RQVWDQWLQH VH GpPDUTXH SDU VD YRORQWp G¶DEVWUDFWLRQ HQ SURSRVDQW XQH PpWKRGH
pour décrire de manière graphique une maquette FRPSRVpH G¶REMHWV DEVWUDLWV OHV Abstract
Interaction Objects, AIO). Dans (Constantine 2003), il détermine 12 familles de tâches
LQWHUDFWLYHV UHODWLYHV j O¶XWLOLVDWHXU DLQVL TXH pOpPHQWV G¶LQWHUfaces (des conteneurs et des
interacteurs) (Figure 37). En composant ces tâchHV HW GHV pOpPHQWV G¶LQWHUDFWLRQ VRXV IRUPH
G¶pOpPHQWV JUDSKLTXHV GHV © composants abstraits canoniques »), il cherche à modéliser les
interfaces à travers des « prototypes abstraits » (Constantine 1998) décrits en termes de forme et
de fonction, mais indépendamment de toute apparence (Figure 38). Notons que, dans la
FRPSRVLWLRQGHSOXVLHXUVYXHVO¶DXWHXUQ¶LOOXVWUHSDVOHOLHQG¶HQWUHOHVYXHV,OV¶DJLWG¶LOOXVWrer
une interface à un instant précis.
80 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Figure 37. 7kFKHVHWpOpPHQWVG¶LQWeraction abstraits
Figure 38. Exemple de prototype abstrait
1.10.4 Constat et conclusion
Les méthodes de conception IHM enrichissent la conception logicielle en interrogeant
O¶XWLOLVDWHXUVXUVHVSUpIpUHQFHVHWVXUVHVWkFKHVDILQG¶KDELOOHUOHVV\VWqPHVJUkFHjGHVLQWHUfaces
adaptées. (OOHVSUpFRQLVHQWDLQVLO¶XWLOLVDELOLWpOjoù les méthodes de GL traditionnelles se limitent
j O¶XWLOLWp 'H PDQLqUH JpQpUDOH OD PpWKRGRORJLH GH OD FRQFHSWLRQ ORJLFLHOOH V¶DSSXLH VXU GHV
modèles qui sont tantôt produits tantôt utilisés par des acteurs différents tout au long des
processus. Ces modèles peuvent être concrets (c.à.d. très représentatifs de la future utilisation du
logiciel) ou abstraits. 1RXVFRQVWDWRQVG¶DLOOHXUVTXHVLOHVIRUPDOLVPHVSURSRVHQWGLYHUVHVIDoRQV
de représenter graphiquement les tâches abstraites comme concrètes, il est rare de trouver une
UHSUpVHQWDWLRQGHVREMHWVG¶LQWHUDFWLRQGHPDQLqUHDEVWUDLWH
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
81 LHVSURIHVVLRQQHOVGXGRPDLQHV¶DFFRUGHQWjGLUHTXH OHSDVVDJHG¶XQPRGqOHjO¶DXWUHUHVWH
peu structuré du fait du caractère « manuel » de cette opération. Nous traitons dans la section
suivante G¶XQH DSSURFKH TXL SRXU SDOOLHU j FHOD YLVH la génération, la transformation et
O¶XWLlisation de modèles de façon automatisée.
1.11
/HVHQMHX[GHO¶,QJpQLHULHHWGHO¶$UFKLWHcture Dirigée par les M odèles.
1.11.1 I ntroduction jO¶,ngénierie Dirigée par les Modèles (I DM)
'¶XQSRLQWGHYXHRSpUDWLRQQHOODFRQFHSWLRQFODVVLTXHG¶XQORJLFLHOFRQVLVWHjFRPSUHQGUHHW
DEVWUDLUH VRQ FRQWH[WH G¶XWLOLVDWLRQ j OD IRLV SURIHVVLRQQHO HW WHFKQLque) puis à transférer cette
DQDO\VH DX GpYHORSSHXU TXL VH FKDUJHUD GH OD SURJUDPPDWLRQ VHORQ VRQ LQWHUSUpWDWLRQ &¶HVW OD
base des méthodes de conception orientées logiciel et utilisateur présentées dans les sections
précédentes, différentes formes de modèles ont été introduites. Cependant, il est possible que la
SHUWH G¶LQIRUPDWLRQ RX XQH PpVLQWHUSUpWDWLRQ puisse HQJHQGUHU XQ PDQTXH G¶DGDSWDWLRQ GH OD
solution par rapport au besoin voire un échec du projet de développement/HEXWGHOµ,'0HVWGH
pouvoir DXWRPDWLVHU O¶LPSOpPHQWDWLRQ c.à.d. la génération du code) en réduisant au maximum
O¶LQWHUYHQWLRQKXPDLQHGDQVO¶LQWHUSUpWDWLRQGHO¶DQDO\VHHWODFRQFHSWLRQ.
« /¶,'0 VH GLVWLQJXH GHV PpWKRGHV GH PRGpOLVDWLRQ WUDGLWLRQQHOOHV SDU OD SUpRFFXSDWLRQ
constante de rendre les modèles productifs plutôt que contemplatifs » (Favre 2004). Les modèles
qualifiés de contemplatifs sont utiles pour la communication et la compréhension mais ne sont pas
XWLOLVpV SRXU SURGXLUH GX FRGH FH TXL UHVWH O¶DFWLYLWp GH O¶LQIRUPDWicien. Un modèle devient
SURGXFWLIORUVTX¶LOHVWUHQGXLQWHUSUpWDEOHHWPDQLSXODEOHSDUXQHPDFKLQH
Ainsi, l¶,'0simplifie le travail des ingénieurs du développement logiciel en leur permettant
de ne plus manipuler du code à implémenter mais des modèles de code, à savoir des descriptions
écrites dans un langage adapté. On dira que le niveau de modélisation du code est le niveau 0 (ou
M0). Il peut être conforme à plusieurs modèles (de niveau M1) eux-mêmes définis par des métaPRGqOHV OH QLYHDX 0 TXL V¶DSpuient enfin sur un méta-méta-modèle (le niveau M3). /¶,'0
englobe plusieurs contextes de travail avec leurs propres concepts et langages, ainsi que les outils
et compétences relatives F¶HVW FH TX¶RQ DSSHOOH GHV © espaces techniques » (ET) (Kurtev et al.
2002; Favre 2004; Pérochon 2008; Bézivin & Kurtev 2005). On distingue par exemple (voir aussi
Figure 39) :
- O¶(7 GH OD 6\QWD[H $EVWUDLWH PRGpOLVDWLRQ GH SURJUDPPHV H[pFutables par un langage de
programmation (M1) dont la syntaxe est définie dans une grammaire (M2) elle-même
conforme à une famille de métalangages (M3) (ex. le langage JAVA, la grammaire JAVA et
EBNF (Extended Backus-Naur Form)),
- l¶(7;0/eXtendable Markup Langage) : modélisation de la structure et du type de contenu
G¶XQGRFXPHQW;0/M1) grâce une syntaxe contrainte par des règles grammaticales et des
schémas (M2) conformes à un méta-schéma XML (M3),
- l¶(7 GH O¶DUFKLWHFWXUH GLULJpH SDU OHV PRGqOHV (MDA pour « Model-Driven Architecture ») :
PRGpOLVDWLRQ G¶XQ V\VWqPH G¶LQIRUPDWLRQ HW GX FRQWH[WH PpWLHU SDU GHV PRGqOHV HW PpWDmodèles UML conformes au MOF (Meta Object Facility) /¶(7 (0) (FOLSVH 0RGHOOLQJ
Framework) est similaire à MDA, selon (Jean Bézivin & Kurtev 2005) ils pourraient être
considérés comme un seul ET.
82 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Figure 39. (VSDFHVWHFKQLTXHVGHO¶,'0HWQLYHDX[GHPRGpOLVDWLRQ
3DUPLOHV(VSDFH7HFKQLTXHVGHO¶,'0QRXVQRXVLQWpUHVVHURQVSDUWLFXOLqUHPHQWjOD0'$
TXLV¶DSSOLTXHDXGpYHORSSHPHQWGHV\VWqPHVLQIRUPDWLTXHV
1.11.2 /¶DUFKLWHFWXUHGLULJpHSDUOHVPRGqOHV
/¶DUFKLWHFWXUH GLULJpH SDU OHV PRGqOHV17 (MDA pour « Model-Driven Architecture ») est un
« standard industriel » qui consiste à structurer la conception en modélisant le besoin métier
indépendamment de toute plateforme technique puis de « transformer » ce modèle en une
architecture technique qui pourra évoluer. Cette approche est issue du constat que le métier évolue
moins vite quH OD WHFKQLTXH HW TXH O¶RQ GRLW SRXYRLU FKDQJHU GH SODWHIRUPH WHFKQLTXH RX HQ
utiliser plusieurs) pour un contexte métier qui lui ne change pas (ou peu). Le processus de
développement se fait à travers quatre modèles UML, chacun étant proposé par un acteur
différent (Brown et al. 2005; Favre & Pereira 2007):
- lH &,0 &RPSXWDWLRQ ,QGHSHQGDQW 0RGHO F¶HVW OH modèle du domaine qui décrit
O¶HQYLURQQHPHQW G¶utilisation du système et fait notamment ressortir les contraintes et les
exigences,
- le PIM (Plateform IndeSHQGDQW 0RGHO GpFULW O¶DUFKLWHFWXUH GX V\VWqPH HQ UHSUpVHQWDQW OH
SURFHVVXVG¶XWLOLVDWLRQ et les données manipulées,
- le PSM (Plateform Specific Model) est créé pour LPSOpPHQWHU OD VROXWLRQ &¶HVW HQ IDLW XQ
ensemble de modèles, le premier étant issu du PIM mais prenant en compte les spécificités de
la plateforme, les autres étant le fruit de transformations successLYHV MXVTX¶j O¶REWHQWLRQ GH
O¶,60,
- /¶,60,PSOHPHQWDWLRQ6SHFLILF0RGHO est la spécification du système dans son code source.
Le cadre de référence Caméléon (Calvary et al. 2003) décrit un processus de conception
G¶LQWHUIDFHV DGDSWDEOHV DX FRQWH[WH G¶XVDJH EDVp VXU OD 0'$ ,O DVVRFLH j FKDTXH PRGqOH XQ
QLYHDX G¶DEVWUDFWLRQ GH O¶LQWHUIDFH WHO TXH QRXV O¶DYRQV QRWDPPHnt introduit au § 1.10.3. Ces
niveaux sont les suivants :
17
Voir http://www.omg.org/mda | Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQterfaces
83 -
le niveau tâche-concepts définit les tâches utilisateurs et les concepts manipulés (niveau
CIM),
l¶LQWHUIDFHDEVWUDLWH$8,GpILQLWO¶LQWHUIDFHHQHVSDFHVGHWUDYDLOOLpVHQWUHHX[QLYHDX3,0,
l¶LQWHUIDFH FRQFUqWH &8, SUpFLVH FKDTXH HVSDFH HQ termes GH IHQrWUHV HW G¶REMHWV
G¶LQWHUDFWLRQQLYHDX360,
l¶,+0ILQDOH)8,H[pFXWDEOHQLYHDX,60.
(Sottet et al. 2005) LOOXVWUHXQH[HPSOHGHSURSRVLWLRQG¶LQWHUIDFHEDVpHVXUODWUDQVIRUPDWLRQ
de modèles. Dans son exemple il cherche à configurer une interface de gestion de température
GDQVSOXVLHXUVSLqFHVG¶XQHPDLVRQ. En suivant les étapes définies plus haut il décrit :
- le CIM par les concepts manipulés comme la température (avec ses valeurs min, max et son
unité), les pièces (cellier ou salon) et les tâches à exécuter (choisir, gérer),
- le PIM par le processus G¶XWLOLVDWLRQ à suivre (dérivé des concepts), « choisir pièce » puis
« régler température »,
- le PSM par l¶LQWHUIDFH VRXV IRUPH GH FRQWHQHXUV HW G¶LQWpUDFWHXUV liés aux actions du
SURFHVVXV,OV¶DJLWLFLG¶XQH fenêtre contenant une liste de sélection de pièces pour « choisir
pièce », une liste de sélection de valeurs numériques pour « régler température » et un
conteneur DIILFKDQWO¶XQLWpGHWempérature utilisée.
- /¶,60jVDYRLUOHFRGHQ¶HVWSDVpGLWp : il est généré automatiquement.
Figure 40. Illustration des transformations entre modèles dans le cas
G¶pWXGHGH(Sottet et al. 2005)
84 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
/¶DXWRPDWLVDWLRQ GHV WUDQVIRUPDWLRQV HQWUH OHV FRQFHSWV GH FKDTXH pWape permet de générer
rapidement une solution opérationnelle. De plus, tout changement des concepts du CIM induit une
SRWHQWLHOOH DGDSWDWLRQ GH OD VROXWLRQ JpQpUpH 'DQV O¶H[HPSOH de (Sottet et al. 2005) que nous
venons de décrire, cela pourrait se traduirH SDU O¶aMRXW G¶XQ W\SH GH SLqFH RX HQFRUH OD
modification des valeurs min et max de la température.
Les approches de MDA peuvent prendre différentes formes. Par exemple, (Kalnins et al.
2010) utilise RSL (Requirements Specification Language), un scénario dans « un langage semiformel pour la spécification des exigences pour un système informatique » dont il déduit le
PRGqOHG¶DQDO\VHVRXVIRUPHGHGLDJUDPPHVGHFODVVHV80/ et ce, par analyse des mots-clés du
scénario. Il constitue ainsi le CIM. Le PIM est cUpp SDU O¶DQDO\VH UpFXUVLYH GH WRXW OHV FDV
G¶XWLOLVDWLRQGXVFpQDULRHWjSDUWLUGHVGRQQpHVGXPRGqOHG¶DQDO\VH/DFigure 41 illustre cette
transformation.
/HVDSSURFKHVUpFHQWHVGH0'$SUHQQHQWHQFRPSWHQRPEUHG¶pOpPHQWVGu contexte, relatifs
j O¶XWLOLVDWHXU j VD ORFDOLVDWLRQ j VRQ PDWpULHO HWF« SRXU JpQpUHU GHV LQWHUIDFHV DGDSWpHV DX
FRQWH[WHG¶XWLOLVDWLRQ(QFHVHQVOHVSUHPLHUVPRGqOHVQHVRQWSDVUpHOOHPHQWLQGpSHQGDQWVGHOD
technologie. Les contraintes et exigencHVPRGpOLVpHVSDUOH&,0VRQWHQHIIHWOLpHVjO¶XVDJHGH
technologies, ce qui implique que la génération du PIM soit dépendante de cet usage.
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
85 Figure 41. /HVPRGqOHVHWOHXUWUDQVIRUPDWLRQGDQVO¶DSSURFKH0'$GH
(Kalnins et al. 2010)
86 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
1.12
Conclusion : vers « une méthode centrée usages »
Les théories et méthodes de la conception appliquées au développement logiciel se sont
formalisées au cours de la deuxième moitié du siècle dernier.
Aux vues des analyses menées dans ce premier chapitre de la partie 2, le mot clé qui ressort
GH O¶pYROXWLRQ GH OD FRQFHSWLRQ ORJLFLHOOH HVW © conceptualisation ». &RPPH O¶illustre le schéma
suivant (Figure 42), la première étape fut de conceptualiser le code lui-même à travers des
composants réutilisables. Puis lH SRLQW G¶HQWUpH GH OD FRQFHSWLRQ ORJLFLHOOH V¶HVW GpSODFp « à des
niveaux de plus en plus élevés ». Les concepteurs ont ainsi cherché à G¶DERUGdéfinir les besoins
et exigences GH O¶XWLOLVDWHXU, SXLV O¶XWLOLVDWHXU lui-même au travers de différents modèles. Nous
UHWHQRQV GH FHWWH pWXGH O¶LPSRUWDQFH Ge la modélisation. Un concept fort émerge également : il
V¶DJLWGXFRQFHSWG¶usage et de la conception centrée-usages.
Figure 42. 3RLQWVG¶HQWUpHGHla conception logicielle au cours de
O¶pYROXWLRQGHs méthodes
Le chapitre suivant montre comment les approches plus récentes « PRQWHQWG¶XQQLYHDX » par
UDSSRUW j O¶XWLOLVDWHXU HW V¶LQWpUHVVHQW j VRQ FRQWH[WH PpWLHU. (Dupuy-Chessa 2011) évoque
différents paradigmes dont elle résume les apports respectifs en ces termes :
- le GL fournit des techniques et outils (c.à.d. des méthodes) pour mener à bien un projet de
conception logicielle,
- le domaine des IHM « QRXVDSSUHQGjFRQVLGpUHUO¶XWLOLVDWHXUILQDOGqVOHVSUHPLqUHVSKDVHV
G¶XQSURMHWORJLFLHO »,
- le domaine des SI « prend en compte le contexte organisationnel ».
En effet, les approches de développement dites orientées services ne V¶LQWpUHVVHQW plus à
O¶utilisateur « en tant que tel » mais à O¶RUJDQLVDWLRQ dans laquelle il évolue. Elles permettent alors
de réSRQGUH DX[ EHVRLQV GH O¶HQWUHSULVH HQ SURSRVDQW GHV VROXWLRQV ORJLFLHOOHV GpFRPSosées en
« services élémentaires pouvant être combinés et réutilisés » (Boucher 2009). Nous nous
intéressons notamment à la notion de « processus métier ªTXLGpFULWO¶RUFKHVWUation des services
daQVXQHHQWUHSULVHDILQG¶RULHQWHU la conception des systèmes informatiques.
| Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
87 88 Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV |
Chapitre 5 - De l¶HQWUHSULVH
orientée services à la conception de
6\VWqPHVG¶,QIRUPDWLRQ
Ce chapitre présente OHFRQFHSW GHVHUYLFHGDQV OH PRQGH GH O¶HQWUHSULVH SXLV G¶XQ SRLQW GH
YXH LQIRUPDWLTXH /HV VHUYLFHV LQIRUPDWLTXHV GHV WHFKQRORJLHV GH O¶LQIRUPDWLRQ HW GH OD
communication (ICT) supportent les processus métiers dans les organisations. Nous nous
LQWpUHVVRQVjOHXUFRQFHSWLRQGHO¶DQDO\VHGHFHVSURFHssus à la spécification des services.
1.13
/¶HQWUHSULVHRULHQWpHVHUYLFHs
1.13.1 Le concept de service
Un service est une prestation qui met à disposition G¶un client « une capacité technique ou
intellectuelle » (selon la définition INSEE18) pour supporter un besoin. (Maglio & Spohrer 2007)
le définit comme « O¶DSSOLFDWLRQGHFRPSpWHQFHVSRXUOHEpQpILFHGHVDXWUHV », (Rosemann et al.
2009) précise cette définition en parlant de « capacité autonome et transformationnelle qui est
offerte à et consommée par des clients internes ou externes (c.à.d. j O¶HQWUHSULVH pour leur
bénéfice » (voir aussi (Lovelock & Wirtz 1981)). /DSURGXFWLRQG¶XQVHUYLFHQHIRXUQLWGRQFSDV
un bien tangible, stockable et consommable a posteriori : elle est immatérielle. Cette production
fournit une aide à une ou plusieurs personnes, avec ou sans profit visé (on parlera de services
marchands et non marchands), et en fonction G¶XQ FRQWH[WH PpWLHU ex. les soins médicaux, les
transports, la restauration, la vente«). 2QSRXUUDUpVXPHUODGpILQLWLRQG¶XQVHUYLFHFRPPHOHIDLW
2¶6XOOLYDQ par trois caractéristiques F¶HVW une action, qui a une valeur et qui peut
FRPSRVHU G¶DXWUHV VHUYLFHV (dits services composites ou méta-services (Crawford et al. 2005)).
Au-deljGHO¶LGHQWLILFDWLRQGHVEHVRLQVHWGHODSURSRVLWLRQOHF\FOHGHYLHGHGpYHORSSHPHQWG¶XQ
VHUYLFHFRPSUHQGVDYHQWHHWVDGLVWULEXWLRQDLQVLTX¶XQVXSSRUWpYHQWXHO (Figure 43).
18
http://www.insee.fr/fr/methodes/default.asp?page=definitions/services.htm | Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
89 Figure 43. /HF\FOHGHYLHGHGpYHORSSHPHQWG¶XQVHUYLce (tiré de
[ Birnbaum, 2004] )
Selon 2¶)DUUHOO , un service est évalué par : (1) sa qualité, définie par la proportion
dans laquelle il répond aux attentes du client, et (2) son utilité TXLHVWMXVWLILpHSDUO¶LPSDFWpositif
TX¶DXUD FH VHUYLFH VXU O¶Dctivité du client. Notons que ces deux caractéristiques sont
indépendantes. En effet, dHPrPHTXHO¶H[pFXWLRQSDUIDLWHG¶XQELHQQ¶LPSOLTXHSDV de manière
évidente TX¶RQ HQ DLW EHVRLQ OD TXDOLWp G¶XQ VHUYLFH (on parlera de QoS pour « Quality of
Service ») n¶HVW SDV QRQ SOXV V\QRQ\PH G¶XWLOLWp (ex. un soin prodigué sur une personne saine
reste inutile, même si réalisé à la perfection).
Dans la pratique on retrouve la notion service dans plusieurs sciences comme la « business
science », « O¶LQIRUPDWLRQVFLHnce » ou la « computer science » (Baida et al. 2004).
- Dans la « business science », on parle de service comme nous venons de le définir, à savoir
comme G¶XQH © activité métier qui donne lieu à des résultats intangibles et/ou à des
bénéfices ». Le terme « e-service » représente un service fourni SDUOHELDLVG¶LQWHUQHW
- Dans la « computer science » OH WHUPH VHUYLFH GpFULW XQH IRQFWLRQQDOLWp G¶XQH
DSSOLFDWLRQG¶XQORJLFLHOOHZHE-service est une fonctionnalité accessible via internet.
- Dans « O¶LQIRUPDWLRn science », on retrouve les termes relatifs aux deux autres sciences : le
service dit « informatique » (la fonctionnalité) outille le service dit « métier » (la prestation).
1.13.2 /¶DUFKLWHFWXUHRULHQWpHVHUYLFHs
(Cherbakov et al. 2005) décompose les entreprises en partie opérantes (nommés « business
components », c'est-à-dire des « composants métier ») qui regroupent des personnes, des
ressources, du savoir-faire et de la technologie et caractérisées par un objectif à atteindre, de par
des activités menées, misent en place sous une gouvernance. On parlera de « services métier »
pour décrire les services échangés entre ces parties opérantes, à savoir tantôt offerts tantôt
consommés (en interne et/ou par des clients externes). Une fois orchestrés en processus, les
services métier sont supportés par un ensemble de « services I CT » (Services informatiques de
7HFKQRORJLHVGH O¶,QIRUPDWLRQ et de la Communication) qui composent le système informatique
GH O¶HQWUHSULVH F¶HVW FH TX¶RQ DSSHOOH O¶Architecture Orientée Service (SOA pour ServiceOriented Architecture) (voir Figure 44).
La SOA supporte la proposition de solutions métier et techniques qui pourront évoluer avec le
FRQWH[WH GH O¶HQWUHSULVH HQ IRQFWLRQ GHV RSSRUWXQLWpV GH GpYHORSSHment ou au contraire des
menaces (Zimmermann 2004). (MacKenzie et al. 2006) dira que « dans la SOA, les services sont
les moyens par lesquels les besoins et les capacités sont rapprochés ». Autrement dit, elle permet
90 Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ |
de mettre les capacités « au service » des besoins. /¶pYDOXDWLRQGHOD4R6FRQWULEXHjO¶pYDOXDWLRQ
JOREDOH GH O¶HQWUHSULVH HOOH IDLW SDUWLH LQWpJUDQWH de la gestion des entreprises (Cardoso et al.
2004).
Figure 44. Services métier et ICT dans la SOA 19
'pILQLWLRQG¶XQVHUYLFHPpWLHU
(Lê et al. 2010) propose un langage de description des services métiers (nommé BSDL pour
%XVLQHVV 6HUYLFH 'HVFULSWLRQ /DQJXDJH LQVSLUp GHV WUDYDX[ GH -XVWLQ 2¶6XOOLYDQ HW VRQ pTXLSH
VXUODGHVFULSWLRQGHVFDSDFLWpVHWSURSULpWpVG¶XQVHUYLFH2¶6XOOLYan 2006; Oaks et al. 2003)20. Il
illustre ce BSDL par un méta-modèle UML (Figure 45) dont les concepts principaux sont les
suivants :
- le fournisseur (ou prestataire) : entité métier (entreprise, organisation, individu) produisant et
fournissant le service,
- le demandeur (ou client, ou consommateur) : entité métier (entreprise, organisation, individu)
demandant le service,
- la capacité : F¶HVW© ce que le service fait »/HVFDSDFLWpVG¶XQVHUYLFHRQWGHVrègles, à savoir
des effets et des pré-conditions. (OOHVSRVVqGHQWXQHGXUpHHWXQHGDWHG¶H[pFXWLRQElles sont
décrites lexicalement par des verbes.
- La signature F¶HVW XQ HQVHPEOH GH paramètres représentant les inputs et outputs G¶XQH
FDSDFLWpHWGRQFG¶XQVHUYLFH&HVSDUDPqtres sont décrits lexicalement par des noms.
- Les propriétés non fonctionnelles : ce sont les obligations (telles que le paiement ou le
programme) devant être assumées par le fournisseur et le demandeur, engendrant dans le cas
contraire une pénalité. Le prix et la qualité sont également des propriétés non fonctionnelles.
19
20
http://www.ibm.com/developerworks/webservices/library/ws-­‐WSBFoverviewpart1/index.html Voir aussi leur site internet : http://www.service-­‐description.com/index.htm | Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
91 Figure 45. Méta-modèle du BSDL [ Lê, 2010]
1.13.3 Le service informatique I CT
« En informatique, un service est une fonctionnalité >«@mise à disposition par un composant
logiciel pour assurer une tâche particulière », il peut être réutilisé ou recomposé en fonction des
besoins métiers. DDQVXQHDUFKLWHFWXUHG¶HQWUHSULVH :
- un service ICT « VXSSRUWHO¶H[pFXWLRQG¶XQVHrvice métier » (Kohlborn et al. 2009),
- un service ICT est délivré par un système21 informatique pouvant être utilisé séparément par
plusieurs entités.
21
(Wieringa 1998) ĚĠĨŝŶŝƚƵŶƐLJƐƚğŵĞĐŽŵŵĞƵŶĞŶƐĞŵďůĞĚ͛ĠůĠŵĞŶƚƐŝŶƚĞƌĂĐƚŝĨƐ͕ŝŶĐůƵĂŶƚle matériel (hardware) et le logiciel ;ƐŽĨƚǁĂƌĞͿ͘>ĞƐLJƐƚğŵĞŝŶĨŽƌŵĂƚŝƋƵĞŶ͛ĞƐƚĂƵƚƌĞƋƵĞůĞƐƵƉƉŽƌƚƚĞĐŚŶŽůŽŐŝƋƵĞĚƵ
ƐLJƐƚğŵĞĚ͛ŝŶĨŽƌŵĂƚŝŽŶĚ͛ƵŶĞĞŶƚƌĞƉƌŝƐĞ. 92 Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ |
Un service informatique, au même titre TX¶un service métier est défini par : un client, un
fournisseur et une description (comprenant Capacités, Paramètres, et Propriétés non
fonctionnelles). /D GHVFULSWLRQ Q¶HVW SOXV OH[LFDOH PDLV DGRSWH XQ ODQJDJH LQIRUPDWLTXH FRPSULV
par les systèmes. La distribution G¶XQVHUYLFHLQIRUPDWLTXHVHIDLWWHOOHTX¶LOOXVWUpHGDQVODfigure
46, suivant le paradigme « trouver, joindre, invoquer » (Endrei et al. 2004; Papazoglou &
Georgakopoulos 2003) : le fournisseur publie le service dans un registre qui permet au client de le
trouver et ainsi d'y accéder. Le client y accède grâce à un programme, installé sur un dispositif et
proposant une interface logicielle adaptée (Figure 46).
Figure 46. Rôles et interactions dans une SOA (tiré de (Endrei2004))
/¶approche de développement basée sur les services a été guidée par la volonté de structurer,
développer et déployer les logiciels, de manière plus flexible tout en réduisant les coûts et la
durée. En 2000, (Bennett & Layzell 2000) faisait émerger plusieurs enjeux relatifs à un
développement logiciel « souple » : la répRQVHDX[H[LJHQFHVGHO¶XWLOLVDWHXUODSHUVRQQDOLVDWLRQ
O¶DGDSWDWLRQune structure simple, la transparence ou encore la confiance. Ils introduisaient alors
une approche permettant aux consommateurs de « choisir la combinaison de services la plus
appropriée à tout moment » (on parlera du concept de « late binding »).
Dans cette idée, (Sommerville 2005) UHGpILQLWOHFRQFHSWG¶LQJpQLHULHGHVH[LJHQFHVLQWURGXLW
en 4.1.2) comme la définition du système en termes de services fournis et utilisés. Il encourage
DLQVLODFRQVWUXFWLRQSDUODFRQILJXUDWLRQGHVHUYLFHVH[LVWDQWVSHUPHWWDQWG¶DXJPHQWHUODUDSLGLWp
de la formulation des exigences mais aussi de leur interprétation et du développement.
Tout comme G¶XQ SRLQW GH YXH organisationnel la SOA encourage le développement de
O¶HQWUHSULVH par sa réorganisation, elle permet G¶XQ SRLQW GH YXH ,QJpQLHULH /RJLFLHOOH de
réorganiser et redéployer des processus métiers, des composants fonctionnels et des informations
sous forme de services autonomes (Van Den Heuvel 2009; He 2003). En effet, la réduction de
O¶LQWHUGpSHQGDQFH HQWUH OHVVHUYLFHV (le « loose-coupling ») permet de réduire les risques induits
SDUOHFKDQJHPHQWG¶XQpOpPHQWVXUOHUHVWHGXV\VWqPH Ainsi, O¶pYROXWLRQSDUWLHOOH du contexte
organisationnel d¶XQH HQWUHSULVH Q¶DXUD G¶LPSDFW que sur les services concernés et non sur
O¶LQWpJUDOLWpGXV\VWqPH
| Chapitre 5 - 'HO¶HQWUHSULVH RULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
93 Le cas particulier des services-web.
$YHFODJpQpUDOLVDWLRQGHO¶XWLOLVDWLRQdes réseaux et plus largement G¶LQWHUQHW, autant dans le
milieu professionnel que GDQVOHVIR\HUVO¶DFFqVDX[VHUYLFHVPpWLHUVSDUOHELDLVGHVservices ICT
est désormais commun. Le client G¶XQ service peut DXMRXUG¶huiRTX¶LOVRLW être « intégré » dans
O¶DUFKLWHFWXUH G¶HQWUHSULVH et « trouver » son service, en tant qu¶XWLOLVDWHXU Ge services
informatiques connectés via le web : on parle alors de « services-web ». Le service-web peut être
défini littéralement comme « XQH LQWHUIDFH TXL GpFULW XQH FROOHFWLRQ G¶RSpUDWLRQV TXL VRQW
accessibles par un réseau » (Gottschalk et al. 2002). Il est décrit grâce à un langage nommé
WSDL (Web Service Description Language) et stocké dans les serveurs du fournisseur puis
publié dans un registre UDDI (Figure 47) qui pointera le bon service en fonction de la demande
du client. Le client accède alors au service via un protocole SOAP/http. On distingue 3 catégories
de services-web22 :
- les services-ZHE G¶intégration donnent accès aux services de transactions : le client accède
directement aux services de vente (ex. amazon, ituneV«, de gestion de ses comptes
EDQFDLUHVG¶RUJDQLVDWLRQGHVHVYR\DJHV (ex. booking, lastminute«),
- les services-ZHEG¶LQIRUPDWLRQpWHQGHQWODSRUWpHGHVVWUXFWXUHVIRXUQLVVDQWGHO¶LQIRUPDWLRQ
DFWXDOLWpVPpWpRILQDQFHV«,
- les services-ZHEG¶H[WHUQDOLVDWLRQSHUPHWWHQWjSOXVLHXUVVWUXFWXUHVG¶DVVRFLHUOHXUVSURFHVVXV
en les « faisant sortir » de leur propre architecture (pour par exemple combiner la
PDQXIDFWXUHO¶DVVHPEOageODGLVWULEXWLRQ«.
Figure 47. Rôles et interactions dans une architecture de services web22
22
http://publib.boulder.ibm.com/infocenter/rtnlhelp/v6r0m0/index.jsp?topic=%2Fcom.ibm.etools.webservi
ce.doc%2Fconcepts%2Fcws.html 94 Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ |
1.13.4 La place des services I CT dans un business model compétitif
5DSSHORQV TX¶XQH HQWUHSULVH HVW GpILQLH FRPPH XQH VWUXFWXUH TXL FRPELQH HQ LQWHUQH GHV
moyens humains, matériels, immatériels (services) et financiers 23, afin de créer et fournir en
externe GHV ELHQV RX G¶DXWUHV VHUYLFHV 2Q GLVWLQJXHUD DORUV HQWUHSULVHV GH PDQXIDFWXUH HW
entreprises administratives WRXW FRPPH RQ SRXUUD SDUOHU G¶LQGXVWULH WUDGLWLRQQHOOH HW G¶LQGXVWULH
de services. Mais quelle que soit leur nature, elles adoptent toutes un « Business Model »
particulier.
Afin de rester compétitives, les entreprises doivent maintenir voire augmenter leur
productivité (c.à.d O¶HIILFDFLWp OH UHQGHPHQW GH OHXU SURFHVVXV GH FUpDWLRQ GH ELHQV RX GH
services) et leur production (c.à.d O¶DSSRUW GH YDleur ajoutée à cette création). Pour cela, la
restructuration de leur modèle (le « %XVLQHVV 0RGHO HVW SDUIRLV QpFHVVDLUH '¶XQ SRLQW GH YXH
RUJDQLVDWLRQQHOFHODLPSOLTXHO¶DGRSWLRQGHQRXYHDX[SURGXLWVHWSURFHVVXV(Hodgson 2003). Les
impacts respectifs du Taylorisme (fin du 19e siècle) et du Fordisme (début du 20e) sur la
FURLVVDQFHGXVHFWHXUGHODVLGpUXUJLHHWGHO¶DXWRPRELOHHQVRQWXQH[HPSOHFRQQX/HVPRGqOHV
furent en effet bouleversés de par O¶pYROXWLRQ GHV SURFHVVXV GH WUDYDLO HW GHV SURGXits avec
O¶DSSOLFDWLRQGHSOXVLHXUVSULQFLSHVWHOVTXH24 :
- la division du travail à la fois verticale (c.à.d. la séparation de la conception et de la
réalisation) et horizontale (c.à.d. OD UpSDUWLWLRQ GHV WkFKHV DYHF O¶DSSDULWLRQ GX WUDYDLO j OD
chaîne),
- ou la standardisation des pièces favorisant la production en série.
0DLV DFWXHOOHPHQW O¶RSWLPLVDWLRQ GHV SURFHVVXV QH VXIILW SOXV j OD FURLVVDQFH GDQV XQ
HQYLURQQHPHQW WRXMRXUV SOXV GHPDQGHXU GRXEOp G¶XQ FRQWH[WH pFRQRPLTXH FRQFXUUHQWLHO HW
changeant : il IDXWYHQGUHSOXVPRLQVFKHUHQGpSHQVDQWPRLQV«'DQVVRQpWXGHVXU© la place
du business model dans la compagnie », (Osterwalder 2004) PRQWUHTXHO¶pYROXWLRQGHFHGHUQLHU
HVWGpSHQGDQWHQRQVHXOHPHQWGHO¶RUJDQLVDWLRQc.à.d. des processus métier, comme décrit plus
KDXWPDLVDXVVLGHODVWUDWpJLHDGRSWpHGpILQLHSDUXQHSRVLWLRQGHVREMHFWLIV«HWGHV6\VWqPHV
G¶,QIRUPDWLRQ XWLOLVpV /D Figure 48 LOOXVWUH FHWWH FRUUpODWLRQ DLQVL TXH O¶LQIOXHQFH GH FH TXH
O¶DXWHXU DSSHOOe « forces extérieures ª UHODWLYHV j O¶HQYLURQQHPHQW FRPSpWLWLRQ FKDQJHPHQWs
VRFLDX[OpJDX[WHFKQRORJLTXHVRXGDQVODGHPDQGHGHVFOLHQWV'¶XQSRLQWGHYXHVWUDWpJLTXHOD
FRPSpWLWLYLWp HVW DVVXUpH SDU OD FRQTXrWH GH QRXYHDX[ PDUFKpV HW SDU O¶DGRSWLRn de nouvelles
FRPSpWHQFHV'¶XQSRLQWGHYXHWHFKQRORJLTXHF¶HVWO¶DGRSWLRQGHQRXYHOOHVVROXWLRQVHQWHUPHV
de services ICT qui aura un impact positif. (Osterwalder 2004) le justifie à travers les quatre
apports suivants :
- la réduction des coûts de transaction et de coordination,
- O¶offre de nouveaux produits et services plus complexes de par la collaboration de plusieurs
compagnies,
- O¶amélioration et O¶H[SDQVLRQGHVPR\HQVG¶DWWHLQGUHOHFOLHQW,
- la proposition de nouveaux ordres de prix et de mécanismes de revenus.
23
24
http://fr.wikipedia.org/wiki/Entreprise http://fr.wikipedia.org/wiki/Fordisme | Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
95 Figure 48. Corrélation entre Business model, Environnement, Stratégie,
3URFHVVXVHW6\VWqPHVG¶,QIRUPDWLRQ>2VWZDOGHU- p.16]
/D YDOHXU GHV VHUYLFHV ,&7 Q¶HVW GRQF SOXV j SURXYHU GDQV XQ EXVLQHVV PRGHO TXL VH YHXW
compétitif. Dans la section suivante, nous nous intéressons particulièrement à leur conception à
partir de la modélisation des processus métiers.
1.14
De la modélisation des Processus M étier au SystèPHG¶I nformation
1.14.1 I ntroduction à la conception de 6\VWqPHVG¶,QIRUPDWions (SI )
8Q V\VWqPH G¶LQIRUPDWLRQ HVW OD FRPELQDLVRQ GHV DFWLYLWpV GHV PHPEUHV G¶XQH HQWUHSULVH
(c.à.d. qui supportent les opérations métiers, la gestion et la prise de décision) et des technologies
GHO¶LQIRUPDWLRQTX¶LOVXWLOLVHQWc.à.d. pour stocker, UpFXSpUHUHWWUDQVPHWWUHGHO¶LQIRUPDWLRQ
(Zachman 1987) V¶HVWLQVSLUpGXGRPDLQHGHODFRQVWUXFWLRQSRXUFRQFHSWXDOLVHUO¶DUFKLWHFWXUH
GHVV\VWqPHVG¶LQIRUPDWLRQ6RQIUDPHZRUNSHUPHWGHGpFULUHXQ6,HQDGRSWDQWSOXVLHXUVSRLQWV
de vue :
- le point de vue du planificateur dans laquelle sont définis les objectifs,
- le point de vue du maître G¶RXYUDJHTXLGpFULWOHFRQWH[WHPpWLHUGHIDoRQFRQFHSWXHOOH,
- le point de YXHGXFRQFHSWHXUTXLGpFULWOHV\VWqPHG¶LQIRUPDWLRQGHIDoRQSUpFLVH,
- le point de YXHGHO¶ingénieur qui décrit les contraintes techniques,
- le point de vue du constructeur qui décrit les consignes de développement,
- le point de vue machine, à savoir le code implémenté.
Zachman introduit également une série de questions à se poser pour décrire SI. Ce
questionnement est mené pour chaque point de vue et donne lieu à un ensemble de modèles
GHVFULSWLIVSRXUFKDFXQG¶HX[,OREWLHQWDLQVLXQVFKpPDGHFODVVLILFDWLRQHQGLPHQVLRQVSRXUOD
UHSUpVHQWDWLRQGHVFULSWLYHG¶XQHHQWUHSULVHILJXUH/HVpOpPHQWVTX¶LOFKHUFKHjGpWHUPLQHUHW
leurs questions relatives sont :
- le « Quoi ? » qui définit les données,
- le « Comment ? » qui interroge les processus fonctionnels,
- le « Où ? » et le « Quand ? » qui déterminent le contexte de localisation et temporel,
- le « Qui ? » qui définit les acteurs et leurs responsabilités GDQVO¶RUJDQLVDWLRQ,
- et le « Pourquoi ? ªTXLDSRXUEXWG¶LGHQWLILHUOHEXWOHVPRWLYDWLRQV
96 Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ |
&RPPH O¶LOOXVWUH (Frankel et al. 2003) (voir Figure 49), les méthodes de génie logiciel et
QRWDPPHQWO¶DUFKLWHFWXUHGLULJpe par les modèles (MDA) peuvent être intégrées à cette approche,
OH SDVVDJH G¶XQ SRLQW GH YXH j O¶DXWUH SHUPHWWDQW GH JXLGHU OH SURFHVVXV GH FRQFHSWLRQ GHV
WHFKQRORJLHVGHO¶LQIRUPDWLRQ(CM Pereira 2004).
- Le CIM (Computation Independant Model) est le point de vue de O¶$QDO\VWH Métier qui
modélise le métier
- Le PIM est le point de vue du Concepteur qui modélise le système
- Le PSM HW O¶,60 OH FRGH VRQW OH SRLQW GH YXH GX 'éveloppeur qui modélise la solution
technologique et la développe.
Figure 49. Le Framework Zachman et les modèles de la MDA (extrait
de (Frankel 2003)
Un nouveau paradigme
Comme on peut le lire dans (Ramollari & Dranidis 2007), le développement orienté service
HVW XQ FKDQJHPHQW GH SDUDGLJPH GDQV O¶LQJpQierie logicielle dans lequel « le service est une
DEVWUDFWLRQ XWLOLVpH SRXU VXSSRUWHU OH GpYHORSSHPHQW UDSLGH HW SHX RQpUHX[ G¶DSSOLFDWLRQV j
travers la composition de services ». Nous comprenons ici que la FRQFHSWLRQ G¶XQ 6, est une
activité de conception logicielle, qui suit les principes de développement utilisant des techniques
G¶DEVtraction par les modèles (Loniewski et al. 2011), PDLVTX¶elle adopte un autre point de vue.
Selon (Papazoglou & Van Den Heuvel 2006), la méthodologie de la conception et du
développement orientée services (SODD) se base sur les modèles de développement logiciel tels
que le développement orienté composant et le RUP (voir 2.1.1) tout en se concentrant sur la
modélisation des processus métiers dans le domaine de l¶HQWUHSULVH. 'DQVOHPrPHRUGUHG¶LGpH
(Hussain et al. 2010) effectue également un mapping entre le framework de développement de
service SOMA (Service-Oriented Modeling and Architecture) (Arsanjani 2004) et le RUP (cf. §
1.9) en mettant en parallèle les phases de conception de service du framework (Identification,
| Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
97 Spécification, Réalisation, Déploiement) et les phases de conception logicielle du RUP (Inception,
Elaboration, Construction, Transition).
-
Trois QLYHDX[G¶DEVWUDFtion de la conception de SI sont présentés dans (Front et al. 2009) :
le niveau intentionnel qui décrit les besoins et les buts pour en déduire les exigences du
système,
le niveau organisationnel qui décrit « O¶RUJDQLVDWLRQ à mettre en place pour répondre aux
objectifs »,
le niveau opérationnel qui décrit les solutions informatiques.
On retrouve au travers de ces trois niveaux non pas les phases du RUP mais plutôt la
caractérisation des différentes activités. Aux niveaux intentionnel et opérationnel, se déroulent les
activités de modélisation du domaineG¶LQJpQLHULHGHVH[LJHQFHVHWGHGpYHORSSHPHQWau travers
des différents modèles présentés précédemment.
Le changement de paradigme apparait au niveau organisationnel, au cours des activités
G¶analyse et de conception : là où les domaines du GL et des IHM définissent des « cas
G¶XWLOLVDWLRQ » et des « tâches ªUHODWLYHVjXQDFWHXUO¶LQJpQLHULHGHV6,UHTXLHUWODPRGpOLVDWLRQ
des activités de chacun des acteurs impliqués dans des « processus » relatifs à une organisation.
La section suivante présente les formalismes utilisés pour la modélisation G¶XQHRUJDQLVDWLRQ
et des processus. Nous nous intéressons ensuite au GpURXOHPHQW GH FHWWH SKDVH G¶DQDO\VH HW
conception.
1.14.2 La modélisation du métier et des processus
1RXV DYRQV GpMj SDUFRXUX XQ HQVHPEOH GH PRGqOHV XWLOLVpV SRXU UHSUpVHQWHU O¶DUFKLWHFWXUH
G¶XQV\VWqPHGDQVOHVPpWKRGHVGH*/HW,+01RXVQRXVLQWpUHVVHURQVLFLSOXVSDUWLFXOLqUHPHQW
à la modélisation des processus métiers qui est la clé des méthodes orientées services.
« Les processus métiers sont considérés comme des blocks réutilisables indépendants de
O¶DSSOLFDWLRQ HW GH OD SODWHIRUPH TXL OD VXSSRUWH » (Papazoglou & Van Den Heuvel 2006). Un
processus peut être décrit à travers quatre perspectives (Curtis 1992) :
- la perspective fonctionnelle qui décrit les règles métier,
- la perspective comportementale qui décrit le séquençage des activités,
- la perspective organisationnelle qui décrit les acteurs,
- la perspective informationnelle qui décrit leVpOpPHQWVG¶LQIRUPDWLRQ.
(List 2006) ou encore (Aguilar-Savén 2004) décrivent et évaluent plusieurs langages de
modélisation des processus métiers (BPMLs). Les plus largement répandus sont : les diagrammes
G¶DFWLYLWps UML, BPMN et IDEF3.
Les diagraPPHV G¶DFWLYLWp 80/ $' UML) et les diagrammes BPMN (Business Process
Modelling notation) sont souvent comparés et confrontés dans la littérature (White 2004; Eloranta
& Kallio 2006; Peixoto et al. 2008). BPMN et AD sont deux vues (ou instances) du même métamodel, le BPDM (Business Process Definition Metamodel). Ces diagrammes représentent dans
des « swimlanes » les activités de différents acteurs sous forme G¶pYqQHPHQWV G¶pWDWV HW GH
données manipulées. Ces deux formalismes sont très similaires, malgré que le diagramme
98 Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ |
G¶DFWLYLWps UML reste plus technique et donc moins accessible aux business analystes. En effet, si
BPMN est un langage qui fut développé exclusivement pour la représentation des processus
PpWLHU OHV GLDJUDPPHV G¶DFWLYLWp 80/ GpFULYHQW RULJLQHOOHPHQW OHV DFWLYLWpV HW DFWLRQV G¶XQ
V\VWqPH &¶HVW SRXUTXRL LO DXUD IDOOX pWHQGUH FH IRUPDOLVPH HQ VWpUpRW\SDQW OHV DFWLYLWpV HQ
processus LOV¶DJLWGHFUpHUXQpOpPHQWQRXYHDX dérivé de celui qui existe déjà, mais qui a des
propriétés spécifiques adaptées à un usage spécialisé, ici la représentation des processus métier).
BPMN et AD suivent tout deux les patterns des workflow de (Huang & Mynatt 2006), TXHO¶RQ
peut regrouper en quatre familles : les contrôles de flux, les données, les ressources, les
exceptions.
Figure 50. Représentations d¶XQ même processus avec BPMN (en haut)
et AD UML (en bas)
Comme cité précédemment, le langage UML doit être étendu pour correspondre aux besoins
de représentations du métier. De manière générale, sept diagrammes UML peuvent être étendus et
XWLOLVpVSRXUUHSUpVHQWHUGHVpOpPHQWVG¶XQEXVLQHVVPRGHO(Cesare & Lycett 2003) (Tableau 8).
| Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
99 Tableau 8. Les diagrammes UML et leur potentiel de modélisation du métier (Cesare &
Lycett 2003)
(Noran 2000) confronte UML et IDEF (ICAM25 DEFinition) qui est aussi une suite de
méthodes de modélisation et supporte ODFRQFHSWLRQGHV\VWqPHVHWO¶DQDO\VHPpWLHUHQpWDSHV :
- IDEF3 (pour la description de processus et des objets) et IDEF5 (pour la description
G¶RQWRORJLHs) modélisent « le monde réel » et les relations entre les acteurs, les éYqQHPHQWV«
- ,'()PRGpOLVDWLRQGHVIRQFWLRQVHW,'()PRGpOLVDWLRQGHO¶LQIRUPDWLRQPRGpOLVHQWOHV
H[LJHQFHVUHODWLYHVjODJHVWLRQGHO¶LQIRUPDWLRQ
- IDEF1x (modélisation des données), IDEF2 (modélisation de la dynamique des systèmes) et
IDEF4 (Conception Orientée Objet) supportent la conception du système répondant aux
besoins identifiés précédemment.
Figure 51. Un exemple de diagramme IDEF3 pour la description des
processus (Noran 2000)
25
Pour Integrated Computer Aided Manufacturing, ƵŶƉƌŽŐƌĂŵŵĞĚĞů͛h^ŝƌ&ŽƌĐĞ 100 Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ |
1.14.3 Du service métier au service informatique
&RPPHQRXVO¶DYRQVGLWOHVDFWLYLWpVGXQLYHDXRUJDQLVDWLRQQHOVXSSRUWpHVSDUOHVSURFHVVXV
GDQVOHGpYHORSSHPHQWG¶XQH62$FRUUHVSRQGHQWDX[DFWLYLWpVG¶DQDO\VHHWFRQFHSWLRQDXFRXUV
G¶XQ développement logiciel. Rappelons que dans le RUPO¶DQDO\VHFRQVLVWHjPRGpOLVHUOH© quoi
faire » puis lors de la conception on modélise le « comment faire ». Dans OHGpYHORSSHPHQWG¶XQH
SOA , on retrouve cette distinction à travers deux aspects (Kohlmann & Alt 2007):
- l¶DVSHFW PpWLHU DYHF la modélisation des « services métiers », orchestrés en processus
(Arsanjani 2004),
- l¶DVSHFW technique, avec la modélisation du système décomposé en « services
informatiques » qui sont liés à des fonctionnalités logicielles à définir ou à réutiliser (Zhang
et al. 2005).
Certaines méthodes de conception (ou re-conception) de services cherchent à couvrir ces deux
aspects (Quartel et al. 2004), PDLVQRPEUHG¶HQWUHVHOOHVne se focalisent que VXUO¶XQRXO¶DXWUH de
FHVDVSHFWV&¶HVWnotamment le constat que fait (Kohlborn et al. 2009) après une analyse détaillée
G¶XQHWUHQWDLQHGHFHV méthodes. Au-delà de cette analyse, il propose de définir une « approche
consolidée ªSRXUO¶LGHQWLILFDWLRQGHQRXYHDX[VHUYLFHV« qui pourront être fournis aussi bien à un
QLYHDX PpWLHU TX¶j XQ QLYHDX WHFKQLTXH ». Dans les paragraphes qui suivent, nous synthétisons
VRQDSSURFKHHQO¶LOOXVWUDQWSDUO¶H[HPSOHG¶XQVHUYLFHGHGHYLV
-
-
A partir du modèle du domaine et des exigences, les services métiers sont définis par :
les ressources, à savoir le prestataire du service (ex. le responsable des devis), le contrat relatif
DXVHUYLFHHWOHVLQIRUPDWLRQVQpFHVVDLUHVjO¶H[pFXWLRQGXVHUYLFHH[ODGHPDQGHGXFOLHQW
la faisabilité, le devis...),
le modèle interactionnel qui FDUDFWpULVH O¶LQWHUDFWLRQ DYHF OH FOLHQW j VDYRLU Oes tâches de
celui-ci TXLPqQHQWjO¶H[pFXWLRQGXVHUYLFHHWTXLOXLVXFFqGHQWH[XQVHUYLFHGHGHYLVHVW
DSSHOp SDU XQH UHTXrWH GX FOLHQW LO HVW VXLYL SDU O¶DFFHStation ou le refus du devis par le
client),
le modèle opérationnel qui décompose le service en un processus de sous-services (ex.
recevoir la requête du client, clarifier la faisabilité, créer le devis).
Chaque sous-service est de nouveau décomposé en services atomiques (c.à.d. ayant le plus
bas niveau de granularité), un service informatique étant alors assigné à chacun de ces services
DWRPLTXHV/¶DQDO\VHGXV\VWqPHH[LVWDQWSHUPHWWUDG¶LGHQWLILHU si un service informatique adapté
existe déjà (c.à.d. est déjà implémenté et peut être réutilisé). Sinon il est nécessaire de le définir
par :
- les fonctionnalités TX¶LO VXSSRUWH, du type « créer », « modifier », « supprimer ª« (le
développement par composants permettra de grouper ces fonctionnalités en composants et
G¶DLQVLUHFRPSRVHUOHVVHUYLFHVLQIRUPDWLTXHV,
- les inputs et les outputs de chaque fonctionnalité.
&RPPHQRXVO¶DYRQVYXGDQVOHVDSSURFKHV,+0LOH[LVWHGHVDSSURFKHVYLVDQWjDXWRPDWLVHU
cette dérivation des services métiers en services informatiques. Par exemple, (Touzi et al. 2009)
automatise la proposition de services collaboratifs dans une approche MDA à partir de modèles de
processus collaboratifs. Il développe pour cela des règles de transformation pour traduire les
modèles métier en modèle technique. La PpWKRGHHVWVXSSRUWpHSDUXQHVXLWHG¶RXWLOV On retrouve
OHPrPHJHQUHG¶DSSURFKHGDQV(Bispo et al. 2010) ou encore (Delgado 2010).
| Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
101 Le développement de SI est donc supporté par la modélisation de processus qui définissent
O¶DFWLYLWp PpWLHU j un niveau organisationnel. Cependant, la modélisation des processus métier
comporte certaines limites.
1.14.4 Les limites des approches basées sur le Business Process Modeling (BPM)
Même si les modèles de processus peuvent servir de support au développement automatisé
SDU GHV DSSURFKHV GH 0'$ LO VHPEOH TXH GDQV XQ FHUWDLQ QLYHDX GH GpWDLO O¶LQWHUYHQWLRQ G¶XQ
DQDO\VWH HW G¶XQ GpYHORSSHXU VRLW QpFHVVDLUH (Noran 2000) affirme que « OD WUDGXFWLRQ G¶XQ
PRGqOHPpWLHUHQXQPRGqOHORJLFLHOQ¶HVWSDVXQSURFHVVXVVLPSOe ». Pour (Soulier et al. 2007)
« il parait illusoire de croire pouvoir sHSDVVHUG¶XQHSKDVHG¶LPSOpPHQWDWLRQ ».
De plus, le BPM suscite des questions quant à sa capacité à représenter des situations
collaboratives particulières. (Van der Aalst 1998) nous dira que « les processus collaboratifs sont
KRUVGHODSRUWpHGHODGpILQLWLRQGHVZRUNIORZV'DQVXQSURFHVVXVFROODERUDWLIO¶DFFHQWHVWPLV
VXUODFRPPXQLFDWLRQHWOHSDUWDJHGHO¶LQIRUPDWLRQSOXVTXHVXUODGpILQLWLRQG¶XQSURFHVVXVTX¶LO
Q¶HVWDOorVSDVQpFHVVDLUHG¶H[SOLFLWHU ». (Berard & Karlshoej 2012), citant (Curtis 1992) et (List
2006) fait ressortir le fait que les langages de modélisation de processus implémentent bien les
aspects fonctionnels et comportementaux, c'est-à-dire les règles métiers et leur séquençage. Par
contre, ils sont limités en termes de perspective organisationnelle (la modélisation des acteurs) et
LQIRUPDWLRQQHOOHODPRGpOLVDWLRQGHVpOpPHQWVG¶LQIRUPDWLRQWUDLWpV
&HOD V¶DYqUH G¶DXWDQW SOXV YUDL HQ qui concerne notre domaine G¶DSSOLFDWLRQ, le projet AIC,
pour lequel la représentation sous la forme de processus métiers rigoureux tels que ceux utilisés
dans la modélisation G¶HQWUHSULVH VHPEOH trop « rigide ». En effet, les équipes de projet de
conception architecturale ne sont pas dirigées par une « couche stratégique » qui cherche à
maximiser le rendement de l¶entreprise par un processus optimisé. L¶LQFHUWLWXGH GX SURFHVVXV
décisionnel dans un projet AIC conduit les acteurs à devoir V¶DGDSWHU à tout instant, tout en étant
peu dans une logique de planification F¶HVWXQSURFHVVXVdit « ad hoc » (Kubicki 2006)/¶DFWLRQ
est en effet étroitement liée à son contexte social et physiqueSOXVTX¶DXQHGLUHFWLYHVWUDWpJLTXH
générale. (Suchman 1987) introduit le concept « G¶DFWLRQ Vituée ». On peut également lire dans
(Hanser 2003) TX¶³XQ SURMHW DUFKLWHFWXUDO Q¶HVW MDPDLV PRQRWRQH FDU FKDTXH QRXYHDX SURMHW
correspond à un contexte particulier, il serait donc illusoire de tenter de dégager un processus
SUpFLVHWUHSURGXFWLEOHG¶XQSrojet à un autre ».
Tout comme le font (Sierhuis & Clancey 2002) ou (Soulier & Lewkowicz 2006) nous
préférons parler de « pratiques ». En effet, le terme pratique est synonyme de méthode, de
PDQLqUH GH IDLUH PDLV DXVVL G¶DFFRPSOLVVHPHQW : on parle de « pratique ingénieuse », ou de
« bonne pratique ». La pratique se réfère également à une expérience, une habitude et à une
amélioration continue (cf. « acquérir de la pratique »). On confère alors au concept de pratique
XQH FHUWDLQH VRXSOHVVH TXL IDYRULVH O¶DPplioration. Dans la caractérisation des besoins métiers
relatifs au projet AIC, nous adoptons donc le concept de « pratique métier » plutôt que celui de
SURFHVVXVSRXUFDUDFWpULVHUO¶DFWLYLWpFROOHFWLYHHWLQGLYLGXHOOH
102 Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ |
1.15
Conclusion : vers « des services adaptés aux pratiques métiers »
Comme on peut le lire dans (Emig & Weisser 2006), la conception orientée processus métier
« HVWODSURFKDLQHpWDSHGDQVO¶pYROXWLRQGHODFRQFHSWLRQORJLFLHOOH », « elle ne remplace pas mais
complète les approches existantes ». Elle permet en effet de relier les aspects techniques aux
besoins métiers GHO¶HQWUHSULVHafin que ces derniers conditionnent le développement logiciel. En
G¶DXWUHV WHUmes, elle apporte aux approches de GL la dimension « organisationnelle » de
O¶HQWUHSULse aux besoins métiers analysés, tout comme la conception IHM apportait la dimension
« interactionnelle ». 'DQV OHV DSSURFKHV GH FRQFHSWLRQ RULHQWpHV VHUYLFHV O¶RUJDQLVDWLRQ HVW
décomposée en services métiers qui sont supportés par des services informatiques I CT.
&¶HVWFHTXHUpVXPHODILJXUHVXLYDQWHFigure 52) en resituant ces différentes approches par
rapport aux différentes « couches ªG¶XQHDUFKLWHFWXUHG¶HQWUHSULVH2Q\GLVWLQJXHpJDOHPHQWOHV
différents modèles qui les supportent (bulles vertes).
Figure 52. Représentation des approches de conception de services ICT
GDQVO¶DUFKLWHFWXUHGHO¶HQWUHSULVH
La modélisation des processus métiers est largement adoptée par les concepteurs de systèmes
G¶LQIRUPDWLRQGDQVOHGRPDLQHGHO¶HQWreprise et ce à travers différents formalismes. Pourtant, elle
semble comporter quelques limites quant à la modélisation de du contexte organisationnel G¶XQ
projet AIC. En effet, le travail de chacun est composé dans un cadre alternant supervision directe
et ajustement mutuel : (Kubicki 2006) parle de « coordination flexible ». Or nous pensons, à la
manière de (Marjanovic et al. 2007), que la communauté « BPM » est restée concentrée sur une
coordination inflexible. Devant ces préoccupations, nous avons mené une première réflexion sur
le concept de pratique métier.
Le chapitre suivant oriente notre étude vers le domaine du TCAO. Nous décrivons ces outils
en introduisant le concept de « service collaboratif ». Nous considérons ensuite les grands
principes de conception de collecticiels (et donc de services collaboratifs) dits adaptés puis nous
adoptons un point de vue plus technique par la description de leur architecture logicielle.
| Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
103 Chapitre 6 ± Travail Collaboratif
Assisté par Ordinateur et Services
Collaboratifs
Ce chapitre introduit dans un premier temps les notions propres à la description des outils de
Travail Collaboratif Assisté par Ordinateur (TCAO) et étend cette description DX[VHUYLFHVTX¶LOV
proposent : les services collaboratifs. Pour (Vissers et al. 2004) les services collaboratifs sont
« conçus pour supporter les groupes de personnes qui interagissent entre elles dans leurs tâches
collaboratives ». Nous mettons HQVXLWHHQDYDQWOHVUDLVRQVG¶pFKHFGHFHJHQUHGHVHUYLFHV et les
principes pour y remédier. '¶DSUqV (Veer 1996), la conception des collecticiels forme « une
nouvelle branche dans les méthodes de conception ». Dans la continuité des propos tenus dans les
chapitres précédents, nous considérons cette branche comme un « nouveau paradigme ».
1.16
Description des outils de TCAO et des services collaboratifs
1.16.1 Les dimensions fonctionnelles et spatio-temporelles
Les outils de TCAO aussi appelés collecticiels, supportent les pratiques collectives de leurs
utilisateurs de plusieurs manières RQ GLUD TX¶ils couvrent un ou plusieurs « espaces
fonctionnels » (Ellis & Wainer 1994). Les trois espaces fonctionnels principaux qui composent ce
TX¶RQDSSHOOHle « trèfle fonctionnel » (Salber et al. 1995; Piquet 2009) sont:
- l¶HVSDFHGHSURGXFWLRQVXSSRUWDQWO¶DFWLRQGHVDFWHXUVVXUO¶LQIRUPDWLRQ,
- l¶HVSDFHGHFRRUGLQDWLRQVXSSRUWDQWODSODQLILFDWLRQGHVDFWLYLWpV,
- l¶HVSDFHGHFRPPXQLFDWLRQVXSSRUWDQWO¶pFKDQJHG¶LQIRUPDWLRQ.
On parle aussi du modèle 3C (Gerosa & Pimentel 2006) pour Communication, Coordination
et Coopération, où le terme Coopération est utilisé pour parler de la « production conjointe des
PHPEUHVG¶XQJURXSHDXVHLQG¶XQHVSDFHSDUWDJp ». (David 2001) propose une évolution du trèfle
fonctionnel, intégrant un nouvel espace de « conversation ». Cet espace comprend les outils
SHUPHWWDQWODFRPPXQLFDWLRQHQWUHOHVDFWHXUVPDLVQHSURGXLVDQWSDVG¶LQIRUPDWLRQSHUVLVWDQWH
DXFRQWUDLUHGHO¶HVSDFHGHFRPPXQLFDWLRQFigure 53).
| Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs
105 Figure 53. Le modèle évolué du « trèfle fonctionnel »
/RUV GH O¶XVDJH G¶XQ collecticiel, les interventions des différents utilisateurs peuvent être
conceptuellement réparties dans deux contextes différents : le contexte temporel et le contexte de
localisation (Piquet 2009):
- RQ SDUOH G¶Xsages synchrones lorsque plusieurs utilisateurs agissent en même temps, et
G¶XVDJHs asynchrones ORUVTX¶LOVLQWHUYLHQQHQWjGHVPRPHQWVGLIIpUHQWV,
- on distingue également les usages « dans un même lieu » des usages « à distance »
Figure 54. 5pSDUWLWLRQGHVW\SHVG¶usages dans le modèle spatiotemporel
1.16.2 Les types de services collaboratifs
Répartis dans les trois espaces fonctionnels et les quatre espaces spatio-temporels, les
collecticiels offrent un certain nombre de ces « services collaboratifs » utilisés à différents
moments de la collaboration (Laurillau 2002; Dewan 2001; Gerosa & Pimentel 2006), tels que :
- lHVVHUYLFHVGHJHVWLRQGHO¶HPSORLGXWHPSV,
- lHV VHUYLFHV GH SDUWDJH HW FRQWU{OH GH O¶LQIRUPDWLRQ TXL SHUPHWWHQW GH JpUHU O¶DFFqV GHV
XWLOLVDWHXUVjO¶LQIRUPDtion partagée (cela implique la consultation mais aussi la modification
par un groupe comme ODFRPSDUDLVRQHWODIXVLRQGHVpGLWLRQVO¶DQQXODWLRQ«,
- lHVVHUYLFHVGH JHVWLRQ G¶LQWHUIDFH TXL SHUPHWWHQW GH SURSDJHUOHVpOpPHQWV JUDSKLTXHVHQWUH
les utilisateurs, de manière synchrone (tout le monde voit la même chose) ou de manière
répartie (chacun a sa propre visualisation),
106 Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs |
-
lHVVHUYLFHVGHQRWLILFDWLRQTXLLQIRUPHQWOHVGLIIpUHQWVXWLOLVDWHXUVGHVFKDQJHPHQWVG¶état du
système,
les services de courrier élecWURQLTXHGHWFKDWGHIRUXPHWF«
Le schéma suivant recomposé à partir de (Laaroussi 2007) et (Guerriero 2009) illustre une
répartition de ces services supportant la conception architecturale en fonction des dimensions
fonctionnelles présentées précédemment (Figure 55). L¶DVSHFW UpDFWLI HVW UHODWLI j XQH DFWLYLWp
« TXL pYROXH HW V¶DGDSWH », « GRQW OH FRQWHQX FKDQJH DYHF O¶HQYLURQQHPHQW DYHF OD SHUVRQQDOLWp
des acteurs ». Une activité prédictive doit quant à elle « être planifipH HW LQVWUXPHQWpH R O¶RQ
définit au préalable les actions qui seront menées ».
Figure 55. Positionnement des services par rapport aux caractéristiques
G¶XQHDFWLYLWpFROOHFWLYH ((Laaroussi 2007) et (Guerriero 2009))
1.16.3 Description fonctionnelle
1RXV SURSRVRQV O¶pWXGH GH SOXVLHXUV PRGqOHV G¶DUFKLWHFWXUH ORJLFLHOOH spécifiques à la
description de services collaboratifs. Ces modèles font évoluer le modèle MVC qui a retenu notre
attention au § 1.9.3 (cf. Figure 26).
Le modèle Arch (L Bass et al. 1992) est une évolution directe du modèle MVC. Dans ce
modèle un « adaptateur ªDEVWUDLWOHVREMHWVGXGRPDLQHHQREMHWVFRQFHSWXHOVORUVGHO¶LQWHUDFWLRQ
entre le Modèle (appelé Noyau fonctionnel) et le Contrôleur (appelé Contrôleur de dialogue). De
même, les « REMHWVG¶LQWHUDFWLRQ ªGHOD9XHOH&RPSRVDQW3K\VLTXHG¶,QWHUDFWLRQVRQWDEVWUDLWV
en « objets de présentation » par un « &RPSRVDQW/RJLTXHG¶,QWHUDFWLRQ ».
| Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs
107 Le modèle Daewan introduit la prise en compte de plusieurs utilisateurs en faisant évoluer le
modèle Arch. Chaque branche est dupliquée pour chaque utilisateur et une partie partagée assure
la mise en correspondance de ces branches. Les utilisateurs et les services communiquent entre
eux jO¶DLGHGHGHX[W\SHVG¶pYpQHPHQWVOHVpYpQHPHQWVG¶LQWHUDFWLRQUHIOpWDQWO¶LQWHUDFWLRQGH
O¶XWLOLVDWHXU DYHF OH service HW OHV pYpQHPHQWV GH OD FROODERUDWLRQ UHIOpWDQW O¶LQWHUDFWLRQ HQWUH les
services (Laurillau 2002).
Les modèles PAC-Amodeus et Clover (Laurillau & Nigay 2002) développent encore ces
DUFKLWHFWXUHVQRWDPPHQWHQGpFRPSRVDQWOHF°XUIRQFWLRQQHOHQDJHQWVjVDYRLUGHVSURJUDPPHV
qui exécutent les requêtes). Nous ne souhaitons pas dans notre étude atteindre un niveau de
description technique aussi avancé. Nous proposons au contraire de synthétiser ces informations
SRXUGpFULUHXQPRGqOHG¶DUFKLWHFWXUHVLPSOHTXHQRXVSRXUURQVUpXWLOLVHU pour décrire un service
collaboratif.
Du modèle MVC au modèle Co-MVC
Nous proposons de repartir de O¶DUFKLWHFWXUH09& que nous avons présentée précédemment
(cf. § 1.9.3, Figure 26 HW G¶\ DMRXWHU OD GLPHQVLRQ FROOHFWLYH LQWURGXLWH GDQV FH FKDSLWUH 1RXV
appelons ce modèle Co-MVC (Figure 56).
&RPPH O¶LOOXVWUH OD Figure 56, le Modèle (ou Noyau Fonctionnel) est divisé en un modèle
« partagé » (ou public) et un modèle « privé » répliqué pour chaque utilisateur. On comprend ici
que lorsque le modèle du groupe effectue une requête ou se met à jour, cela se réplique chez les
utilisateurs qui sont concernés. On parle alors de synchronisation.
Nous réintroduisons également les deux dimensions analysées au début de ce chapitre (en
rouge sur la figure) :
- la dimension fonctionnelle, qui nous permet de distinguer les services de Communication, de
Coordination et de Coopération
- la dimension spatio-temporelle qui permet de définir si des services agissent de manière
synchrone ou asynchrone, colocalisée ou à distance.
Figure 56. /HPRGqOHG¶DUFKLWHFWXUHCo-MVC pour décrire un service
collaboratif
108 Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs |
1.17
Vers une réponse à « O¶pFKHFGHODVROXWLRQFROOHFWLFLHO »
1.17.1 /HVFRQVWDWVG¶pFKHF
Nous avons présenté, dans la première partie de ce manuscrit O¶H[SpULHQFH PHQpH GDQV OD
FRQFHSWLRQ G¶XQ FROOHFWLciel particulier : CRTI-weB. Cet outil offre un certain nombre de
« services collaboratifs » qui ont été définis pour le domaine particulier du projet AIC. Pourtant,
nous avons pu identifier des manques G¶DGDSWDWLRQ GH O¶RXWLO HQWUDLQDQW FHUWDLQV IUHLQV j VRQ
utilisation par les professionnels du domaine. CRTI-ZH%Q¶HVWSDVXQFDVLVROp : la littérature nous
PRQWUH TXH FHV PDQTXHV JpQpUDX[ G¶DGDSWDWLRQ WURXYHQW OHXU VRXUFH GDQV OH SURFHVVXV GH
conception lui-même.
-
Jonathan Grudin (Grudin 1988; Grudin 1994) LGHQWLILHWURLVFDVG¶pFKHFVPDMHXUV
O¶RXWLOOXL-PrPHpFKRXHFDULOGHPDQGHXQWUDYDLOVXSSOpPHQWDLUHjGHVXWLOLVDWHXUVTXLQ¶HQ
perçoivent pas directement le bénéfice,
ODFRQFHSWLRQGHO¶RXWLOpFKRue car elle est basée sur des intuitions de bénéfices sans prévoir
O¶LPSDFWUpHOTX¶DXUDO¶RXWLO
OHVFRQFHSWHXUVpFKRXHQWFDULOVQHFDSLWDOLVHQWSDVG¶H[SpULHQFHGDQVODFRQFHSWLRQOHVRXWLOV
étant trop complexes et ne permettant pas une analyse et une évaluation généralisable.
Selon (Greenberg 1991) O¶pFKHF YLHQW GX IDLW TXH OHV PpWKRGHV GH FRQFHSWLRQ ORJLFLHOOH
FLEOHQW OHV XWLOLVDWHXUV LQGLYLGXHOOHPHQW VDQV OHV FRQVLGpUHU FRPPH PHPEUHV G¶XQ JURXSH
/¶LQVDWLVIDFWLRQ GH FHUWDLQV XWLOLVDWHXUV IDLW SDUWLH des limites « acceptables » dans le
GpYHORSSHPHQWG¶XQRXWLO ORJLFLHOFODVVLTXH2UGDQVOHFDVG¶XQFROOHFWLFLHO, cette insatisfaction
V¶DYqUH SOXV SUpMXGLFLDEOH HOOH D XQ LPSDFW QpJDWLI VXU OH WUDYDLO GH WRXWH O¶pTXLSH HQWUDLQDQW
O¶DEDQGRQ JpQpUDO GH O¶RXWLO (Cockburn & Jones 1995) ajoute que les stratégies de conception
« ne réussissent pas à prendre en compte les facteurs sociaux dans le travail de groupe ». Il relève
également le manque de traçabilité des approches, les erreurs de conception étant sans cesse
répétées.
Greenberg reste très critique quinze ans après dans (Greenberg 2006) : selon lui, les besoins
et les possibilités sont grands concernant la suppression des barrières dues à la distance et
O¶DXJPHQWDWLRQ GX WUDYDLO GH JURXSH PDLV O¶DGRSWLRQ GHV FROOHFWLFLHOV UHVWH OLPLWpH mis à part
pour les services de messagerie instantanée qui sont maintenant largement implémentés). Il relève
QRWDPPHQWODGLIILFXOWpWHFKQLTXHGHGpYHORSSHPHQWGHVVROXWLRQVOLpHDXPDQTXHG¶RXtils pour
la conception.
En ce qui concerne les projets AIC, (Nitithamyong & Skibniewski 2007) relève (au travers
G¶XQH pWXGH VXU SURMHWV HW V\VWqPHV TXH O¶XVDJH GHV FROOHFWLFLHOV UpGXLW OHV WHPSV HW OHV
coûts induits par la collaboration mais « Q¶D SDV G¶LPSDFW VLJQLILFDWLI VXU O¶DPpOLRUDWLRQ GH OD
qualité du projet, la sécurité et la satisfaction du client ». (Kubicki et al. 2009) constate que les
collecticiels :
- sont trop orientés « métier unique ª j VDYRLU TX¶LOV VXSSRUWHQW O¶DFWLYLWp G¶XQ PpWLHr en
SDUWLFXOLHUPDLVSDVOHVDFWLYLWpVG¶XQSURMHW$,&GDQVVHVGLPHQVLRQVFRRSpUDWLYHV
- SUpVHQWHQW XQ PDQTXH G¶LQWHURSpUDELOLWp GH SDU OD GLIIpUHQFH GH IRUPDW GDQV OHV GRQQpHV j
traiter (particulièrement en ce qui concerne les représentations graphiques et la multitude
G¶RXWLOVXWLOLVpVjFHWHIIHW
| Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs
109 -
QHUHSUpVHQWHQWTX¶XQHSDUWLHGXFRQWH[WHFRRSpUDWLIFjGGHO¶DFWLYLWpJOREDOHGHSURMHWDX
WUDYHUV G¶LQIRUPDWLRQV © classiques » (comme le planning, les rapports, les listes de
documents...)
1.17.2 /HVSULQFLSHVG¶XQFROOHFWLFLHO adapté
'HYDQW OHV GLYHUV FRQVWDWV G¶pFKHF GH OD VROXWLRQ GHV FROOHFWLFLHOV, (Greenberg 2006) relève
O¶LQWpUrWGHGpYHORSSHUGHVVROXWLRQV© personnalisables ªTXLV¶DGDSWHUDLHQWDX[U{Oes de chacun.
Il définit un « collecticiel personnalisable » comme un collecticiel dont le comportement peut être
SDUDPpWUpSRXUUpSRQGUHDX[EHVRLQVSDUWLFXOLHUVGHVSDUWLFLSDQWVG¶XQJURXSH ou du groupe luimême. Le collecticiel persRQQDOLVDEOHV¶DGDSWHG¶XQSRLQWGHYXHVRFLDOHQSUHQDQWHQFRPSWHOHV
GLIIpUHQFHVGHVXWLOLVDWHXUVDXVHLQGHOHXUJURXSHHWG¶XQSRLQWGHYXHWHFKQLTXHHQSHUPHWWDQWj
O¶XWLOLVDWHXU GH FKRLVLU OD VROXWLRQ TXL UpSRQG OH SOXV j VHV EHVRLQV Selon (Katsumata 2007), il
déploie un mécanisme orienté par les tâches qui prédit les intentions et les demandes de
O¶XWLOLVDWHXUHQIRQFWLRQGHVDVLWXDWLRQGDQVOHJURXSe et de son contexte G¶XWLOLVDWLRQ.
(Cockburn & Jones 1995) présente un guide pour le développemHQWG¶RXWLOVVXSSRUWDXWUDYDLO
FROODERUDWLI,FLHQFRUHO¶XWLOLVDWHXUHWVRQFRQWH[WHPpWLHUHWWHFKQRORJLTXHVRQWPLVDXFHQWUH
des préoccupations. Ce guide est composé de 4 principes :
- mD[LPLVHUO¶DFFHSWDWLRQSHUVRQQHOOH c.à.d. encourager les individus à adopter le système en
H[SOLFLWDQWFHTX¶LO© leur apporterait »,
- mLQLPLVHUOHUHFRXUVDX[H[LJHQFHVGHO¶XWLOLVDWHXUHWDLQVLUpGXLUHODGLVSDULWpHQWUHOHVFRûts
et les bénéfices,
- minimiser les contraintes, c.à.d. laisser O¶XWLOLVDWHXUOLEUHGHJpUHr son travail de la manière qui
lui parait la plus adaptée et non pas comme le système lui impose,
- mD[LPLVHU O¶LQWpJUDWLRQ H[WHUQH c.à.d. O¶LQWpJUDWLRQ GDQV O¶HQYLURQQHPHQW WHFKQRORJLTXH
DFWXHOGHO¶XWLOLVDWHXU.
1.17.3 « Loose coupling » et conception de services collaboratifs
Le terme « loose coupling » (littéralement « couplage lâche ou faible ») est utilisé pour
décrire la relation entre des personnes ou groupes de personnes dans laquelle les évènements de
chacun sont couplés et réactifs (c.à.d. aux actions des autres) mais préservent leur propre identité
et leur propre contexte (Pinelle & Gutwin 2005). On distingue le « loose coupling » dans lequel
les besoins de communication sont réduits et les personnes ont seulement « EHVRLQ G¶rWUH DX
FRXUDQW GH O¶DFWLYLWp G¶DXWUXL GX © tight coupling » (couplage rigide ou fort) caractérisé par une
communication, une dépendance et une interaction fortes entre personnes (et/ou groupes) (Olson
1996; Grinter et al. 1999).
Le concept de « loose coupling ª V¶DSSOLTXH SDUWLFXOLèrement aux organisations composées
G¶pTXLSHV PXOWLGLVFLSOLQDLUHV GDQV OHVTXHOOHV FKDTXH DFWHXU SRVVqGH une certaine autonomie, sa
SURSUHH[SHUWLVHHWOHVSUDWLTXHVTXLOXLVRQWOLpHVFRPPHF¶HVWOHFDVSRXUOHVpTXLSHVGHSURMHW
AIC.
(Pinelle & Gutwin 2005) SUpVHQWH XQH VXLWH G¶DSSURFKHV GH FRQFHSWLRQ GH FROOHFWLFLHO
supportant un travail collaboratif basé sur ce concept de « loose coopling » (Tableau 9). Ces
DSSURFKHV VRQW JpQpUDOHV V¶DSSOLTXDQW DX GpYHloppement de tous types de services. On pourra
trouver dans (Sohlenkamp et al. 2000) ou (Sutcliffe 2005) GHVVpULHVG¶H[LJHQFHVSOXVVSpFLILTXHV
UHODWLYHVjODFRQFHSWLRQG¶XQVHUYLFHGHQRWLILFDWLRQ
110 Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs |
Tableau 9. Résumé des approches de conception basée sur le concept de « loose coupling »
1.18
Approches de conception
Descriptions
6XSSRUWGHO¶DXWRQRPLH
et de la flexibilité
Support des pratiques actuelles de travail, sans forcer
O¶LQWHUGpSHQGDQFHGHVDFWHXUVDXULVTXHGHUpGXLUHOHXU
autonomie et leur flexibilité.
Agrégation de
O¶LQIRUPDWLRQ
'pSODFHPHQWGHSDUWLHVG¶LQIRUPDWLRQGHSXLVGHVHVSDFHV
tampons vers un unique repository pour améliorer la
coordination et la conscience des activités du monde réel
Support des espaces de
travail individuels et du
partage discret
LHSDUWDJHG¶LQIRUPDWLRQDYHFXQou plusieurs membres
GHO¶pTXLSHGRLWSRXYRLUVHIDLUHjODdiscrétion des autres
acteurs
Intégration de la
collaboration avec des
équipements du travail
individuel
Les équipements collaboratifs ne doivent pas interférer
avHFO¶XWLOLVDWLRQG¶DXWUHVéquipements plus généralement
utilisés
Facilité de la conscience
asynchrone
Support de la conscience des activités des autres et
persistance GHO¶LQIRUPDWLRQDYHFOHWHPSV
Support de la
coordination « lâche »
Minimiser les efforts de coordination et la négociation
directe des utilisateurs
Support de la
communication « lâche »
Minimiser les efforts requis pour initier une
communication
Support du changement
vers un couplage plus
« rigide »
Supporter des interactions et communications directes ou
GXPRLQVHQVXSSRUWHUO¶RUJDQLVDWLRQ
3UpVHUYDWLRQG¶XQH
organisation flexible
/DLVVHUOHVDFWHXUVGpWHUPLQHUOHXUQLYHDXG¶LPSOLFDWLRQ
dans les situations collaboratives
Conclusion : « concevoir des services collaboratifs »
Les études sur le TCAO (couplées à notre expérience GDQV OH GRPDLQH DYHF O¶RXWLO &57,weB) nous ont SHUPLVG¶LGHQWLILHU un certain nombre de « services collaboratifs » qui composent
un collecticiel. Ces services supportent la communication, la coopération et la coordination et ceci
dans des contextes de localisation et temporel différents. Nous avons défini un modèle
G¶DUFKLWHFWXUHORJLFLHOOHTXLGpFULt XQVHUYLFHFROODERUDWLIG¶XQpoint de vue fonctionnel.
3RXUSDOOLHUDX[PDQTXHVG¶DGDSWDWLRQGHV collecticiels, les approches de conception se sont
WRXUQpHVYHUVO¶DQDO\VHGHJUDQGSULQFLSHVRXFDUDFWpULVWLTXHVSURSUHVDXWUDYDLOFROODERUDWLI1RXV
pouvons assumer à partir des quelques exemples donnés que la clé de cette adaptation réside dans
le resSHFWGHO¶XWLOLVDWHXUFjGODFDSDFLWpGXFROOHFWLFLHO à respecter les pratiques de travail (et la
GLVFUpWLRQ GHV XWLOLVDWHXUV VDQV OHV DOWpUHU DLQVL TXH O¶HIILFDFLWp c.à.d. la capacité à réduire les
efforts induits par certaines tâches. Ces principes ou approches ne restent pourtant que des lignes
directrices sans être vraiment des spécifications pour la conception de services collaboratifs
adaptés.
| Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs
111 Un nouveau paradigme
Figure 57. Vers un nouveau changement de paradigme dans la
conception logicielle
Au terme des analyses menées dans les chapitres 4 et 5, nous avons pu observer comment le
domaine des IHM et des SI « alimentaient » le Génie Logiciel pour concevoir respectivement des
Interfaces adaptées aux utilisateurs et des Services InfoUPDWLTXHV UpSRQGDQW DX[ EHVRLQV G¶XQH
organisation. La conception de services collaboratifs étudiée dans ce chapitre 6 peut être vue
comme une « nouvelle branche », un troisième paradigme de la conception logicielle (Figure 57).
Le tableau ci-dessous résume les avantages et les limites des différentes approches (Tableau 10).
Tableau 10. Avantages et limites des champs étudiés
Domaines
GL
Avantages
Méthodes structurées basées sur des
modèles
Séparation dHO¶DQDO\VHPpWLHUHWGH
la spécification du système
Limites
Pas de prise en compte du contexte de
O¶XWLOLVDWHXU
Méthodes orientées exigences et non
utilisabilité
I HM
Prise en compte approfondie de
O¶XWLOLVDWHXUGHVHVSUpIpUHQFHVHW
de son contexte
Tâches interactives clairement
définies
Point de vue mono-utilisateur
SI
Point de vue organisationnel
Prise en compte des besoins de
O¶HQWUHSULVHDFFHQWVXUO¶HIILFDFLWp
et la productivité
Réutilisation de services existants
Processus rigides guidés par une
stratégie, peu adaptés à des situations
collaboratives particulières
/¶LQGLYLGXHVWPLVGHcôté
Collecticiels
Basés sur des grands principes de la
collaboration
Points de vue aussi bien individuels
que collectifs
Les principes de collaboration ne sont
pas spécifiques à un domaine
Les approches sont trop théoriques et
manquent de méthode
112 Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs |
-
Au travers des différentes analyses nous pouvons conclure que :
un collecticiel GRLWIRXUQLUGHVVHUYLFHVDGDSWpVjFKDFXQGHVXWLOLVDWHXUVHQWDQWTX¶LQGLYidus
PDLV DXVVL HQ WDQW TXH PHPEUHV G¶XQ JURXSH GH WUDYDLO HW pOpPHQWV GX FRQWH[WH FRRSpUDWLI
dans lequel ils sont impliqués,
la conception des services collaboratifs VH GRLW G¶rWUH PpWKRGLTXH HW RXWLOOpH DX UHJDUG GHV
méthodes classiques de conception logicielle, tout en prenant en compte les grands principes
de la conception de services collaboratifs mais aussi les spécificités fonctionnelles de ce type
de services.
Le chapitre suivant propose une description de trois méthodes particulières de conception de
services collaboratifs pour assister des besoins métiers. Ces études nous ont permis de dégager les
SRLQWVG¶LQWpUrWHWOHVOLPLWHV de telles approches afin de construire notre propre méthode.
| Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs
113 114 |
Chapitre 7 ± Les méthodes de
conception de services : études de
cas
Ce chapitre développe trois méthodes de conception de services particulières. /¶REMHFWLI HVW
de montrer O¶LQWpUrWHWODPDQLqUHG¶XWLOLVHUGes modèles pour mener un projet de développement
de services adaptés. Les bases de notre proposition sont définies en fin de chapitre, en mettant en
pYLGHQFH OHV SRLQWV G¶LQWpUrW HW OHV OLPLWHV GH FHV WURLV PpWKRGHV La première illustre
SDUWLFXOLqUHPHQW ELHQ O¶XWLOLVDWLRQ G¶RXWLOV GH PRGpOLVDWLRQ GpGLpV SRXU pGLWHU OHV GLIIpUHQWV
PRGqOHVHWOHSDVVDJHG¶XQPRGqOHjO¶DXWUH/DGHX[LqPHPHWHQDYDQWODFRUUHVSRQGDQFHHQWUH
PRGqOHVHWOHXUVWUDQVIRUPDWLRQVGDQVXQFDGUHGHUpIpUHQFHG¶LQJpQLHULHGLULJpHSDUOHVPRGqOHV
Enfin, la troisième est une méthode dédiée au projet AIC, notammHQWSDUODVSpFLILFDWLRQG¶REMHWs
de modélisation du bâtiment.
1.19
CoCSys, une méthode de conception de collecticiels dirigée par des modèles
Dans sa thèse, Olivier Delotte (Delotte 2006) présente CoCSys, XQ SURFHVVXV G¶DVVLVWDQFe à
la construction HW O¶pYROXWLRQ G¶DSSOLFDWLRQV mobiles « HQ V¶DSSX\DQW VXU XQH DUFKLWHFWXUH HW GHV
mécanismes à base de modèles ». ,O V¶DJLW G¶un processus itératif basé sur la transformation de
modèles (voir la Figure 58) :
- ODSKDVHHVWODSKDVHG¶LGHQWLILFDWLRQGHVVFpQDULRVG¶XWLOLVDWLRQdonnant lieu à FUpDWLRQG¶Xn
modèle de scénarios,
- la phase 1 consiste à créer un modèle comportemental sur la base des scénarios,
- la phase 2 transforme le modèle comportemental en modèle G¶Drchitecture logicielle,
- OD SKDVH VXSSRUWH O¶LWpUDWLRQ SDU OD SULVH HQ FRPSWH GHV QRXYHDX[ VFpQDULRV G¶XWLOLVDWLRQ
dans le modèle comportemental.
Cette section en présente dans un premier temps le principe de fonctionnement théorique puis
une analyse critique qui questionne QRWDPPHQWO¶DSSOLFDELOLWpGHFHWWHPpWKRGH
| Chapitre 7 ± Les méthodes de conception de services : études de cas
115 Figure 58. Schéma du processus CoCSys (tiré de (Delotte2006))
1.19.1 Déroulement de la méthode
La formalisation des scénarios
Figure 59. Un exemple de scénario contextualisé dans son éditeur
Le scénario est dans cette approche une vision partielle des besoins des utilisateurs dans un
certain contexte. Afin de formaliser ces « scénarios contextualisés », les auteurs ont créé un
formalisme de modélisation hybride supportant une description textuelle (sRXVIRUPHG¶KLVWRLUHV
courtes) et une description graphique proche du FDVG¶XWLOLVation (voir Figure 59). Ce modèle est
O¶LQVWDQFLDWLRQG¶XQPpWD-modèle, le MMSC (méta-modèle du scénario contextualisé) il est édité
SDU O¶RXWLO CBME (Contextual Behaviour Model Environment, Figure 65). Voici les concepts
définis par le MMSC et leurs représentations respectives avec le formalisme de CBME (Figure
60, Figure 61, Figure 62, Figure 63, Figure 64) :
116 Chapitre 7 ± Les méthodes de conception de services : études de cas |
-
8QDFWHXUHVWGpILQLSDUVRQU{OHGDQVO¶DFWLYLWpHWSDUXQLGHQWLILDQWTXLSHUPHW de le définir
FRPPHO¶DFWHXUSUincipal qui réalise les tâches décrites, (2) un acteur secondaire impliqué
mais non responsable ou (-XQDFWHXUSDVVLITXLHVWSUpVHQWPDLVQRQFRQFHUQpSDUO¶DFWLRQ
Chaque acteur et le système possèdent leur propre zone de définition sur le graphique
(appelée « espace de vie ») dont les limites sont représentées par des lignes en pointillés.
Figure 60. 5HSUpVHQWDWLRQG¶XQDFWHXUHWG¶XQHOLPLWHHQWUHGHX[
« espaces de vie » dans CBME
-
/HFRQWH[WHJpRJUDSKLTXHHWOHFRQWH[WHWHPSRUHOORFDOLVHQWO¶DFWHXUGDQVO¶HVSDce et dans le
temps.
Figure 61. Représentation des contextes géographique et temporel dans
CBME
-
/¶DUWHIDFW HVW XQ REMHW créé, manipulé ou détruit par une tâche, tandis que le dispositif et le
système sont respectivement le support interactif et le logiciel utilisés
Figure 62. 5HSUpVHQWDWLRQGHO¶artefact, du dispositif et du système dans
CBME
-
Les relations sont de type Possède, Accède, Contacte, Synchronisation de données, Exécute
(une tâche), Ordonnancement de tâche
Figure 63. Représentations des relations du scénario contextualisé dans
CBME
| Chapitre 7 ± Les méthodes de conception de services : études de cas
117 -
Il existe enfin deux types de pré-conditions : optionnelles ou obligatoires
Figure 64. Représentation des deux types de pré-condition du scénario
contextualisé dans CBME
Les scénarios contextualisés sont exprimés de façon textuelle par les utilisateurs puis
interprétés et formalisés graphiquement par les concepteurs qui en dégagent un objectif et peuvent
également proposer des scénarios alternatifs. /¶pWXGHQHGRQQHSDVGHUHWRXUVTXDQWjO¶pFULWXUHGH
FHVPRGqOHVTXHFHVRLWSDUUDSSRUWjO¶XWLOLVDELOLWp GHO¶RXWLORXODFRPSUpKHQVLRQGHVFRQFHSWV
'¶XQ SRLQW GH YXH H[WHUQH HW VXU la base des éléments illustrés, les éléments utilisés semblent
FODLUVPrPHV¶LOVJDJQHUDLHQWSHXW-être à être davantage distingués graphiquement. Ils ne reflètent
par contre pas EHDXFRXS OH GRPDLQH G¶DSSOLFDWLRQ GX IDLW GX SHX G¶LQIRUPDWLRQ GRQQpH SRXU
FKDFXQG¶HX[TXHOW\SHGHWHFKQLFLHQHVW-ce ? Quels sont les attributs de la facture "HWF«
Figure 65. Utilisation de CBME pour écrire les scénarios contextualisés
(tiré de [ Delotte2006] )
118 Chapitre 7 ± Les méthodes de conception de services : études de cas |
Le modèle comportemental CAB (Contextual Application Behavior)
Le modèle comportemental CAB a pour but de synthétiser les besoins des utilisateurs. Il est
créé à partir des modèles de scénarios. Ce modèle doit être XWLOLVDEOH SRXU O¶LQWpJUDWLRQ GHV
services et outils nécessaires à la réalisation des tâches. Le CAB est en réalité un ensemble de
modèles ayant chacun leur propre formalisme :
- Le workflow basé sur le framework « 2flow » (Saïkali 2001) TXLV¶DSSXLHVXUXQPpWD-modèle
du workflow flexible (MMWf).
Figure 66. Exemple de représentation de trois processus alternatifs
(encadrés colorés) avec le formalisme « 2flow »
-
-
Le modèle de tâches LQVWDQFLDWLRQG¶XQPpWD-modèle de tâches (MMT) est exprimé avec le
formalisme CTT (Mori et al. 2002) (cf. § 1.10.3) DXJPHQWp G¶XQH FDWpJRULVDWLRQ GHV WkFKHV
UHODWLYHDXWUqIOHIRQFWLRQQHOOHVWkFKHVGH3URGXFWLRQGH&RPPXQLFDWLRQHWG¶2UJDQLVDWLRQ
(Piquet 2009). Les arbres de tâches du CAB sont composés de tâches abstraites qui seront
spécifiées ensuite en fonction GHODFRQILJXUDWLRQPDWpULHOOHHWGXGLVSRVLWLIG¶LQWHUDFWLRQ
/H PRGqOH GX FRQWH[WH LQVWDQFLDWLRQ G¶XQ PpWD-modèle du contexte (MMC), qui décrit
O¶HQYLURQQHPHQW GH O¶XWLOLVDWHXU FRPSRVp GH © O¶HQVHPEOH GHV LQIRUPDWLRQV TXL RQW XQH
LQIOXHQFHVXUOHVEHVRLQVHWOHVFDSDFLWpVGHO¶XWLOLVDWHXUjFRPPXQLTXHU » et des dispositifs
TX¶LOutilise.
Le méta-modèle comportemental est une agrégation de ces 3 méta-modèles (MMWf, MMT,
00&HWGpFULWDXVVLOHVPRGqOHVGHU{OHHWG¶DUWHIDFW
La créDWLRQGHO¶DSSOLFDWLRQ
3RXUO¶DSSOLFDWLRQGHFHWWHPpWKRGH(Delotte 2006) GpFRPSRVHO¶DUFKLWHFWXUHORJLFLHOOHG¶XQ
système coopératif en trois niveaux :
- Le CUO-M (Collaborative User-Oriented Model) supervise les interactions et propose les
interfaces de présentation. Il est décrit dans le formalisme AMF-C, une évolution du modèle
| Chapitre 7 ± Les méthodes de conception de services : études de cas
119 -
G¶DUFKLWHFWXUH logicielle multi-agents AMF (Agent Multi-Facettes) (Masserey & Samaan
2006)
Le CSA-M (Collaborative System Architecture Model) contrôle les sessions, les utilisateurs et
les groupes.
Le DSI-M (Distributed System Infrastructure Model) distribue les messages et contrôle le
contenu.
La deuxième phase de transformation assure le passage de modèle comportemental CAB au
PRGqOH G¶DUFKLWHFWXUH ORJLFLHOOH. Les patrons de tâches, les composants logiciels et les patrons
G¶LQWHUDFWLRQ IRUPHQW GHV FDWDORJXHV GDQV OHVTXHOV YRQW V¶DOLPHQWHU chacune des trois étapes de
cette phase 2.
- Étape 1 : les patrons de tâches permettent de choisir dans une bibliothèque, le déroulement
souhaité de certaines tâches utilisateurs en une suite prédéterminée de tâches concrètes
G¶LQWHUDFWLRQHWV\VWqPHGpSHQGDQWHGXFRQWH[WH
- Étape 2 : « les composants sont les éléments logiciels disponibles pour être intégrés lors de
O¶DGDSWDWLRQ ». Si un composaQW Q¶H[LVWH SDV une demande de développement est formulée.
Ces composants peuvent être des applications spécifiques « dont la portabilité doit être gérée
en amont ». Le processus KMDE (Knowledge-Model Driven Engineering) réalise le passage
entre le workflow du modèle CAB et son implémentation, par l'identification et l'intégration
des composants fonctionnels souhaités. /¶RXWLO.0'(JVXSSRUWHFHSDVVDJH,Oprésélectionne
les services susceptibles de répondre aux besoins identifiés et permet au concepteur de valider
ou modifier le choix.
- Étape 3 : la figure suivante (Figure 67LOOXVWUHODJpQpUDWLRQGHO¶DSSOLFDWLRQSDUODPLJUDWLRQ
des services formalisés en AMF vers le dispositif.
120 Chapitre 7 ± Les méthodes de conception de services : études de cas |
Figure 67. Migration des services vers le dispositif
1.19.2 Analyse critique
La méthode de conception CoCSys est basée sur les approches MDA de transformation de
modèles et se déroule en SOXVLHXUVSKDVHVO¶LGHQWLILFDWLRQG¶XQVFpQDULRFRQWH[WXHOGpFULYDQWGHV
FDV G¶XWLOLVDWLRQ OD VSpFLILFDWLRQ G¶XQ PRGqOH FRPSRUWHPHQWDO SXLV OH GpYHORSSHPHQW G¶XQH
DUFKLWHFWXUHORJLFLHOOH(OOHVXSSRUWHODSULVHHQFRPSWHGHVEHVRLQVUHODWLIVDXU{OHG¶XQHSHUVRQQH
dans son organisation pour lui proposer des services informatiques adaptés. La méthode permet en
plus de considérer le contexte utilisateur GH FHWWH SHUVRQQH /¶DXWHXU SURSRVH XQe méthode de
FRQFHSWLRQG¶DSSOLFDWLRQVjVDYRLUXQSURFHVVXVGHFRQFHSWLRQjVXLYUHDLQVLTXHOHVIRUPDOLVPHV
et les outils de modélisation supportant ce processus (notamment CBME et KMDEg). Le but de
cette méthode est de générer une interface qui permet G¶DFFpGHUà des services qui ont été
identifiés comme nécessaires jO¶H[pFXWLRQG¶XQSURFHVVXVPpWLHU.
| Chapitre 7 ± Les méthodes de conception de services : études de cas
121 Le « méta-modèle des scénarios contextualisés » (MMSC) décrit les scénarios métier avec des
concepts particuliers. Nous constatons que ce méta-modèle est très général et TX¶LO Q¶HQWUH SDV
dans le détail des éléments décrits (quel type de technicien est-ce ? Quels sont les attributs de la
facture ? etc«6LFHODSHXWVXIILUHGDQVXQFRQWH[WHSURIHVVLRQQHOVLPSOHQRXVSHQVRQVTX¶XQ
tel méta-modèle GHYUD DSSRUWHU SOXV G¶pOpPHQWV GH GHVFULSWLRQ SRXU XQ FRQWH[WH SOXV FRPSOH[H
comme celui du projet AIC. Le formalisme de modélisation des scénarios est à la fois graphique
et textuel. /¶DSSURFKHSDUFUpDWLRQG¶XQPpWD-PRGqOHHWG¶XQIRUPDOLVPHGpGLpQRXVVHPEOH
par ailleurs intéressante(QFHTXLFRQFHUQHO¶XWLOLVDWLRQGHFHIRUPDOLVPHQRXVQRWRQVTXH les
utilisateurs eux-PrPHV Q¶XWLOLVHQW SDV O¶pGLWHXU GH VFpQDULRV DILQ G¶H[SULPHU OHXU EHVRLQ /D
description de leurs pratiques habituelles est retranscrite a posteriori par les concepteurs.
/DPpWKRGHHVWXQHPpWKRGHGHFRQFHSWLRQG¶RXWLOVFROODERUDWLIVSRXUWDQWODGHVFULSWLRQGHV
scénarios est toujours indiYLGXHOOH (OOH Q¶HVW SDV UDWWDFKpH j XQ FRPSRUWHPHQW XQ EHVRLQ
collaboratif plus général qui implique la mise en place de ces scénarios individuels. Dans le cas
G¶pWXGHSUpVHQWpXQHVRFLpWpGHGpSDQQDJHOHVSURFHVVXVGHWUDYDLOVRQWpWDEOLVHWILJpV,OQ¶HVW
pas nécessaire de retracer les objectifs généraux. Mais dans un contexte plus complexe, on peut
SUHVVHQWLU TX¶il faudra chercher davantage à comprendre comment se déroule la
FROODERUDWLRQ DILQ G¶LGHQWLILHU OHV SUDWLTXHV GH FKDFXQ, les unes vis-à-vis des autres. Cela
permettrait de mieux décrire ces pratiques mais aussi de pouvoir les optimiser dans une
SUREOpPDWLTXHG¶DPpOLRUDWLRQGHODFROODERUDWLRQ
Nous pouvons nous poser la question de la séparation entre ce qui relève de la pratique métier
(autrement dit ce qui doit être fait par des professionnels, quel TX¶HQ VRLW OH PR\HQ HW FH TXL
UHOqYH GH O¶XVDJH GX GLVSRVLWLI SRXU DVVLVWHU FHWWH SUDWLTXH PpWLHU 'DQV O¶H[HPSOH proposé, la
différence apparait clairement : la phrase « le technicien édite le compte rendu et prépare la
facture » décrit une pratique liée au rôle et à la mission du technicien, alors que des informations
telles que « tous les matins », « chez le client » ou « avec un PDA » sont des informations
contextuelles relatives à un usage particulier. Dans ce contexte métier, les scénarios de travail et
les usages qui les assistent sont répétitifs et prédéfinis. Aussi, LOQ¶HVWSDVUpHllement nécessaire de
séparer leur modélisation. Ici encore, dans un contexte plus complexe comme celui du projet AIC,
QRXVSUHVVHQWRQVODQpFHVVLWpG¶DOOHUSOXVORLQGDQVODPRGpOLVDWLRQHQLGHQWLILDQWGes variations
G¶XVDJH pour une même pratique (sur le chantier avec un smartphone et au bureau avec un
ordinateur par exemple). Comme nous pouvons le lire (p.149): « il est nécessaire de reformuler
certains éléments du récit pour avoir une homogénéisation lexicale (processus de
transformation) ». Par exemple, le verbe « recevoir » dans le premier scénario devient «
télécharger ». Nous retrouvons ici au travers dHV SURSRV GH O¶DXWHXU OD QpFHVVLWp G¶RSpUHU XQH
transformation entre une description « métier » (recevoir) et relative à un outil
(télécharger). 1RXV SHQVRQV TX¶LO est nécessaire de traiter deux modèles différents plutôt que
G¶DGDSWHUOHPrPHPRGqOH
La méthode CoCsys propose des phases de transformation structurées qui, GH O¶DQDO\VH GHV
besoins j OD VSpFLILFDWLRQ GH O¶DUFKLWHFWXUH GH O¶RXWLO SHUPHWWHQW GH MXVWLILHU FKDTXH pWDSH HQ
retraçant le processus de développement. Pourtant, le passage des scénarios au modèle
FRPSRUWHPHQWDOQ¶HVWSDVV\VWpPDWLTXH/Hs modèles de scénario contextualisé et comportemental
sont instanciés à partir de méta-modèles (le MMSC et le MMC). Cependant, on ne distingue pas
le lien entre ces deux méta-modèles. Il aurait été intéressant de pouvoir mettre en correspondance
le MMSC DX00&SRXUIRUPDOLVHUOHSDVVDJHG¶XQPRGqOHXQDXWUH
122 Chapitre 7 ± Les méthodes de conception de services : études de cas |
En ce qui concerne la deuxième phase de transformation, son applicabilité dans divers cas
Q¶HVWSDVYpULILpH dans la thèse analysée. Des travaux scientifiques ultérieurs à la thèse analysée
comme (Yin 2010) ou (Bain et al. 2009) réutilisent la méthode CoCsys comme base de leurs
travaux scientifiques. Cependant, la réelle applicabilité de la méthode dans un contexte
SURIHVVLRQQHOQ¶HVWSDVpYDOXpHHWPRQWrerait peut-être ses limites. Nos expériences dans le secteur
$,&HWQRWDPPHQWO¶H[SpULHQFH&57,-weB (cf. Chapitre 2) soulignent le risque de proposer des
services inadaptés malgré un processus de conception JXLGpSDUO¶DQDO\VHPpWLHU
Du fait que cette méthode a été pensée pour la conception de systèmes mobiles et pour des
processus métiers figés, elle trouvera certainement VHV OLPLWHV GDQV G¶DXWUHV FRQWH[WHV
SURIHVVLRQQHOVSOXVFRPSOH[HVFRPPHOH&RQWH[WH&RRSpUDWLIG¶XQ3URMHWGH&RQVWUXFWLRQ (voir §
1.1). Cependant, en nous inspirant de CoCsys, nous pouvons déjà identifier des objectifs relatifs à
la conception de notre propre méthode qui puisse être fonctionnelle dans ce contexte. Nous
souhaitons :
- analyser les pratiques existantes en utilisant des concepts et formalismes adaptés au domaine,
- DVVXUHU OH SDVVDJH GH O¶DQDO\VH PpWLHU j OD SURSRVLWLRQ GH VHUYLFHV SDU OD PLVH HQ
correspondance de méta-modèles les définissant,
- supporter le développement de nouveaux services (ou leur amélioration) dans des contextes
G¶XVDJH différents mais répondant aux pratiques analysées.
1.20
La méthode Symphony et les modèles pour la collaboration
Nous avons évoqué, plus tôt dans ce manuscrit (cf. § 1.12), le point de vue de Sophie DupuyChessa (Dupuy-Chessa 2011) quant à la croisée des chemins entre la modélisation des Interfaces
Homme-0DFKLQH,+0HWGHV6\VWqPHVG¶LQIRUPDWLRQV6,Sour la conception logicielle. Nous
présentons ici la méthode de développement proposée par son équipe et basée sur la spécification
G¶H[LJHQFHV j OD IRLV RUJDQLVDWLRQQHOOHV HW LQWHUDFWLRQQHOOHV Nous nous intéressons tout
particulièrement aux activités collaboratives mises en place au cours de ce processus.
1.20.1 Symphony et symphony étendue
Symphony est une méthode de développement de système interactif itérative et incrémentale.
Un système interactif est composé de deux parties : l'interface utilisateur et le noyau fonctionnel.
L'interface utilisateur contient les éléments logiciels et matériels dédiés à la capture des entrées de
l'utilisateur et à la restitution des sorties du système. Le noyau fonctionnel contient le reste du
système, c'est-à-dire ses composants de calcul et de stockage de l'information. La méthode
Symphony est une méthode EDVpHVXUO¶XWLOLVDWLRQGHFRPSRVDQWV (cf. § 1.9.1) appelés objets. Les
« objets interactionnels » décrivent O¶LQWHUIDFHet sont spécifiés à partir des « objets métiers » qui
eux décrivent le noyau fonctionnel.
/H EXW HVW GH IDFLOLWHU OD FROODERUDWLRQ HQWUH OHV DFWHXUV G¶XQ SURMHW GH FRQFHSWLRQ ORJLFLHOOH
SDUWLFXOLqUHPHQWHQWUHFHX[GHO¶,+0HWGX*/HWGHSHUPHWWUHDX[FRQFHSWHXUVGHSURGXLUHGHV
modèles cohérents, assurant ainsi une certaine qualité du produit. Quatre principes sont à respecter
:
- « ne pas bouleverser les pratiques des acteurs ª G¶XQ SURMHW GH GpYHORSSHPHQW FH TXL
implique leur laisser leurs outils et leurs modèles,
- permettre la synchronisation de ces acteurs sur des objectifs ou des modèles communs
- assurer « la traçabilité et la cohérence entre les modèles »,
| Chapitre 7 ± Les méthodes de conception de services : études de cas
123 -
« fournir des outils de support à la méthode ».
Chaque itération GDQVO¶DSSOLFDWLRQGHODPpWKRGH donne la priorité à un processus métier et
suit un cycle en Y (Figure 68). « La branche fonctionnelle de gauche correspond à la
traditionnelle modélisation des besoins » du domaine (à travers des diagrammes de cas
G¶XWLOLVDWLRQHWGHVVFpQDULRVHWGHVXWLOLVDWHXUV (diagrammes de WkFKHVPRGDOLWpVG¶LQWHUDFWLRQVHW
maquettes). « La branche technique de droite permet aux concepteurs de concevoir les
architectures techniques et logicielles » (Dupuy-Chessa et al. 2010).
Figure 68. Cycle de Symphony étendue
/¶H[WHQVLRQ « Symphonie étendue » complète cette approche « pour y inclure les pratiques de
conception des systèmes de réalité mixte » (comprenant les systèmes de réalité augmentée et les
interfaces tangibles). Elle propose ainsi une méthode de développement complète et appliquée à
un contexte technique particulier.
Nous nous sommes particulièrement concentrés sur la branche fonctionnelle (branche gauche)
en cherchant à identifier comment elle allie des préoccupations à la fois logicielles et
interactionnelles pour répondre à des besoins métiers. La branche technique nous apporte en outre
des éléments de description du contexte utilisateur.
124 Chapitre 7 ± Les méthodes de conception de services : études de cas |
8QH SKDVH SUpOLPLQDLUH D SRXU EXW G¶DQDO\VHU OH PpWLHU WHO TX¶LO HVW SUDWLTXp SDU OH FOLHQW
GHPDQGHXU G¶XQH VROXWLRQ ORJLFLHOOH DILQ G¶LGHQWLILHU OHV SURFHVVXV PpWLHU HW OHXUV SDUWLFLSDQWV
&HVSURFHVVXVVRQWFRPSRVpVG¶DFWLYLWpVGpFOHQFKpes par un input ou un évènement. La méthode
Symphony propose une description de ces processus sous forme de scénarios en langage naturel.
Cette phase est la responsabilité des experts métier et des experts en utilisabilité qui collaborent
pour « FDSWXUHUOHVSUHVFULSWLRQVEDVpHVVXUO¶LPSOpPHQWDWLRQDFWXHOOHGXSURFHVVXVPpWLHUHWSRXU
ODGpILQLWLRQG¶XQFDGUHGHUpIpUHQFHGHO¶XWLOLVDWHXUGHO¶DSSOLFDWLRQ ».
'DQV OH FDV G¶DSSOLFDWLRQ LOOXVWUp GDQV (Dupuy-Chessa et al. 2010) O¶REMHFWLI HVW GH
développer un VHUYLFHG¶LGHQWLILFDWLRQGHGpJkWVjWUDYHUVXQV\VWqPHGHUpDOLWpPL[WHLOOXVWUDWLRQ
Figure 69).
Figure 69. 3URWRW\SDJHGHO¶LGHQWLILFDWLRQG¶XQGpJkWjWUDYHUVXQ
système de réalité mixte
1.20.2 La branche fonctionnelle
La spécification conceptuelle des besoins
Les processus métier et les acteurs qui y interviennent sont ici détaillés, sous forme de
diagrammes de séquences et d¶DXWUHVVFpQDULRV/¶LQWHUYHQWLRQGHVSpFLDOLVWHVHQ,+0SHUPHWGH
W\SHUOHVLQWHUDFWLRQVjHQYLVDJHUSRXUO¶DSSOLFDWLRQjSDUWLUGHVSUHVFULSWLRQVJpQpUpHVORUVGHOD
phase précédente.
La spécification organisationnelle et interactionnelle des besoins
Cette phase détermine « qui fera quoi et quand » avec le système à concevoir. Le spécialiste
« Génie Logicel » (GL) identifie pour chaque utilisateur « GHV FDV G¶XWLOLVDWLRQ j SDUWLU GHV
descriptions précédentes des processus métiers, puis raffine les concepts métiers en composants
fonctionnels appelés « objets métiers » ». /DFROODERUDWLRQHQWUHVSpFLDOLVWHVGX*/HWGHO¶,+0VH
formalise ensuite par la transposition de ces objets métiers HQREMHWLQWHUDFWLRQQHOV,OV¶Dgit ici de
définir ce qui va représenter un FRQFHSWPpWLHUGDQVO¶LQWHUIDFHCette étape inclut (Dupuy-Chessa
2011) :
- des scénarios G¶LQWHUDFWLRQDEVWUDLWVSXLVFRQFUHWVHQODQJDJHQDWXUHO,
- des modèles de tâches sous forme de diagrammes dits « dynamiques » (tel que CTT, cf. §
1.10.3)
- des diagrammes dits « statiques » comme le modèle ASUR (Dubois et al. 2002) qui décrit le
contexte matériel (de manière générale) et les données à traiter (illustré Figure 70),
- et des maquettes.
| Chapitre 7 ± Les méthodes de conception de services : études de cas
125 .
Figure 70. Description générale du contexte matériel et des données à
traiter avec le formalisme ASUR
6LO¶RQUHSUHQGO¶H[HPSOHLOOXVWUpFigure 69O¶REMHWPpWLHUGpJkWGDPDJHHVWUHSUpVHQWpSDU
une « cible rouge ªTXLHVWO¶REMHWLQWHUDFWLRQQHOFRUUHVSRQGDQW
/¶DQDO\VHGHVVSpFLILFDWLRQV
,O V¶DJLW LFL G¶DVVXUHU OD FRUUHVSRQGDQFH HQWUH OHV REMHWV PpWLHUV HW OHV REMHWV LQWHUDFWLRQQHOV
(Figure 71). Pour cela ces objets sont structurés de manière identique en objets processus
(« business process » et « interactionnal process ») et objets entités (« business entity » et
« interactionnal entity »)26. Ensuite, on définit la correspondance (« translation ») entre les deux
W\SHVG¶REMHWV. 2QSDUOHUDG¶DQDO\VHG\QDPLTXHSRXUFHTXLHVWde la description des processus et
G¶DQDO\VHVWDWLTXHSRXUFHTXLHVWGHs entités.
(QFHTXLFRQFHUQHO¶HVSDFHPpWLHUOHVFDVG¶XWLOLVDWLRQLGHQWLILpVSDUOHVSpFLDOLVWH*/VRQW
raffinés en diagrammes de séquences pour identifier les processus (analyse dynamique). Les
entités sont ensuite décrites en termes de méthodes et attributs (analyse statique).
Pour ce qui est de O¶DQDO\VH G\QDPLTXH GH O¶HVSDFH LQWHUDFWLRQQHO OD VSpFLILFDWLRQ HVW
complétée par des « GLDJUDPPHVG¶pWDWVTXLGpFULYHQWOHF\FOHGHYLHGHVREMHWV ». Un exemple de
passage G¶pWDW SRXU O¶REMHW GpJkW HVW OH passage de déverrouillé (éditable) à verrouillé (non
éditable). /¶DQDO\VHVWDWLTXHVHIDLWGHODPrPHIDoRQTXHSRXUO¶HVSDFHPpWLHU
Enfin, les objets « translation » servent, FRPPHOHXUQRPO¶LQGLTXH, à gérer la correspondance
entre les objets métiers et les objets interactionnels (ils transforment par exemple les coordonnées
HQ SL[HOV G¶XQ UHSqUH REMHW LQWHUDFWLRQQHO HQ OD SRVLWLRQ G¶Xn dégât (objet métier) dans un
modèle 3D). Un diagramme de séquence illustre ce processus de transformation.
26
Un troisième élément compose les objets dits « tripartites », ŝůƐ͛ĂŐŝƚĚĞůĂĚŽŶŶĠĞĚĞƌĠĨĠƌĞŶĐĞƐĞƌǀĂŶƚ
ăůĂŶŽŵĞŶĐůĂƚƵƌĞƉŽƵƌĐĞƋƵŝĞƐƚĚĞů͛ŽďũĞƚŵĠƚŝĞƌĞƚƌĞƉƌĠƐĞŶƚĂŶƚůĞƐĚŽŶŶĠĞƐĚĞďĂƐĞ;ĐŽŵŵĞůĞƐĐŽĚĞƐ
couleurs) pour les objets interactionnels. 126 Chapitre 7 ± Les méthodes de conception de services : études de cas |
Figure 71. /¶DUFKLWHFWXUH6\PSKRQ\ (tiré de (S Dupuy-Chessa 2011))
1.20.3 La branche technique et la conception
La branche technique consiste à déFULUH j OD IRLV O¶DUFKLWHFWXUH logicielle HW O¶DUFKLWHFWXUH
technique.
/¶DUFKLWHFWXUHORJLFLHOOHSUpFRQLVpHHVWOHPRGqOH09& (cf. § 1.9.3, Figure 26). Il permet la
correspondance avec les objets Symphony décrits précédemment :
- les objets interactionnels correspondent à la Vue
- les objets métiers correspondent au Modèle
- les objets translation correspondent au Contrôleur
/¶DQDO\VHWHFKQLTXHHVWTXDQWjHOOHFRPSRVpHde la spécification des dispositifs choisis plus
tôt (cf. modèle ASUR, (Dubois et al. 2002)), et de la description de ces dispositifs (ex. le modèle
du dispositif, la résolution GHO¶pFUDQODTXDOLWpG¶LPDJH.
À SDUWLU GH Oj OD FRPELQDLVRQ GH O¶DQDO\VH IRQctionnelle avec les choix techniques et le
GpSORLHPHQW GDQV O¶LQIUDVWUXFWXUH WHFKQLTXH peut être effectuée. Ici un nouvel élément sert de
charnière, à savoir le rôle. 7RXMRXUV G¶DSUqV (Sophie Dupuy-Chessa et al. 2010), ce rôle
commande jO¶REMHWWUDQVODWLRn (contrôleur) ODFUpDWLRQG¶XQQRXYHOREMHWPpWLHU(modèle) et son
instanciation HQ WDQW TX¶REMHW LQWHUDFWLRQQHO (vue &¶HVW FH TXL VH SDVVH WHFKQLTXHPHQW ORUV GH
O¶LGHQWLILFDWLRQ G¶XQ QRXYHDX GpJkWTXL HVWDORUV FUppGDQV OH PRGqOHHWUHSUpVHQWp SDU OH repère
correspondant dans la vue.
1.20.4 Analyse critique et conclusion
/¶DSSURFKH GH O¶pTXLSH de Sophie Dupuy-Chessa (Dupuy-Chessa 2011) et les travaux
associés aboutissent à la proposition G¶une méthode de conception basée sur la mise en commun
des préoccupatioQVGHO¶,+0HWGHV6, pour la conception logicielle. Plusieurs points attirent notre
attention au regard de nos préoccupations.
Dès la SKDVH G¶DQDO\VH SUpOLPLQDLUH le métier est décrit « WHO TX¶LO HVW SUDWLTXp ». Nous
SHQVRQVTX¶LO\DXQUpHOHQMHXGDQVFette phase, notamment concernaQWODGHVFULSWLRQG¶XQSURMHW
AIC. Nous cherchRQV HQ HIIHW j WHQLU FRPSWH GHV YDULDWLRQV G¶XQ FRQWH[WH GH SURMHW j XQ DXWUH,
variations qui pourront se retranscrire dans la façon de « pratiquer un métier ». Le formalisme
| Chapitre 7 ± Les méthodes de conception de services : études de cas
127 utilisé est le scénario, en langage naturel/¶pGLWLRQHVWOLEUHVDQVVWUXFWXUHTXLVRLWGpWHUPLQpHSDU
le contexte métier analysé. 1RXVSHQVRQVTX¶DVVLVWHUFHWWHDQDO\VHSDUO¶XWLOLVDWLRQGH concepts
métiers clairement définis (tels que nous les avons introduits dans le premier chapitre) et un
formalisme adéquat puissent FRQWULEXHUjO¶DPpOLRUHU.
'DQV XQ GHX[LqPH WHPSV QRXV SURSRVRQV G¶H[SORLWHU OD FRUUHVSRQGDQFH HQWUH OHV PRGqOHV
pour guider la modélisation, notamment au cours des deux phases de spécification des besoins de
la branche fonctionnelle (spécification conceptuelle des besoins, spécification organisationnelle et
interactionnelle des besoins &H OLHQ Q¶HVW HQ HIIHW SDV H[SOLFLWH GDQV OD PpWKRGH 6\PSKRQ\
7\SLTXHPHQW VL O¶RQ UHSUHQG OD GHVFULSWLRQ Iaite précédemment de la spécification
organisationnelle et interactionnelle, il est question par exemple de définir comment « le
spécialiste GL LGHQWLILH GHV FDV G¶XWLOLVDWLRQ j SDUWLU GHV GHVFULSWLRQV SUpFpGHQWHV GHV SURFHVVXV
métiers, puis raffine les concepts métiers en composants fonctionnels ». Cette correspondance est
pYRTXpHPDLVQ¶HVWSDVGpWDLOOpH /¶HQMHXHVWG¶XWLOLVHUOHVPRGqOHVDGpTXDWVDGDSWpVDX[EHVRLQV
de représentation correspondants au point de vue de chaque spécialiste.
Nous pensons que la collaboration des différents spécialistes mise en avant dans la
méthode Symphony est un point important à considérer. La Figure 72 illustre cette
collaboration au cours de la phase « spécification organisationnelle et interactionnelle. Elle débute
par une activité commune de décomposition des processus métiers pendant laquelle les acteurs
décrivent O¶pWDW GH OD VLWXDWLRQ DXVVL ELHQ G¶XQ SRLQW GH YXH PpWLHU TXH WHFKQLTXH. Puis les
spécialistes de chaque domaine modélisent leurs préoccupations ensemble ou séparément (les
besoins fonctionnels par le spécialiste GL HWOHVEHVRLQVHQWHUPHVG¶LQWHUDFWLRQpar le spécialiste
,+0HWO¶Hrgonome). /¶HQMHXHVWGHSHUPHWWUHjFKDFXQGHIRUPDOLVHUVRQDQDO\VHSXLVGHOHVOLHU
dans un processus de conception cohérent. Cela pourra pallier au risque précédemment analysé
dans (Delotte 2006)GHQHSDVIDLUHODSDUWGHVFKRVHVHQWUHOHWUDYDLOGHVDFWHXUVG¶XQGRPDLQHHW
le futur dispositif technologique qui va médiatiser ce travail. Ici la spécification organisationnelle
et interactionnelle est menée parallèlement à une spécification technique pour ensuite, lors de la
conception, aboutir à une ou plusieurs solutions adaptées.
128 Chapitre 7 ± Les méthodes de conception de services : études de cas |
Figure 72. Intervention des différents acteurs de la méthode Symphony
au cours de la spécification des besoins (issu de (S Dupuy-Chessa
2011))
(Dupuy-Chessa 2011) pYRTXHO¶pYROXWLRQGHO¶HVSDFHPpWLHUGpFOHQFKpHSDUO¶LQWpJUDWLRQGHV
FKRL[G¶LQWHUDFWLRQDGRSWpVSDUO¶HUJRQRPHHWOHVSpFLDOLVWH,+0Nos contributions à des projets
appliqués de développement de services pour le secteur AI&QRXVSHUPHWWHQWG¶DUJXPHQWHUGDQV
FH VHQV (Q HIIHW O¶LPSOLFDWLRQ GHV DFWHXUV PpWLHUV GDQV XQ SURFHVVXV GH GpYHORSSHPHQW G¶XQ
nouvel outil passe fortement par la confrontation à des prototypages G¶LQWHUIDFHV&HWWHGpPDUFKH
IDYRULVH SUREDEOHPHQW WUqV W{W O¶DSSURSULDWLRQ GH OD WHFKQRORJLH SDU VHVIXWXUV XWLOLVDWHXUV Nous
SHQVRQVTXHO¶LQWHUDFWLRQSHXWDYRLUXQU{OHmajeur dans la conception de services.
La troisième et dernière approche considérée dans ce chapitre sur les méthodes de
conceptions concerne la conception de services spécifiques au secteur AIC, basée sur O¶pFKDQJH
G¶LQIRUPDWLRQ et O¶XWLOLVDWLRQGHPDTXHWWHVQXPpULTXHV BIM..
1.21
L¶,'0,QIRUPDWLRQ'HOLYHU\0DQXDO) pour la conception de services BI M
1.21.1 BI M, I FC, I DM : une brève introduction
La modélisation des informations du bâtiment, plus communément « maquette numérique »
ou %,0%XLOGLQJ,QIRUPDWLRQ0RGHOLQJDSRXUEXWG¶DJUpJHUOHVGRQQpHVUHODWLYHVjXn bâtiment
en un modèle unique orienté objets (les ouvrages du bâtiment (Ibrahim & Krawczyk 2003)). Le
%,0 SHUPHW DLQVL G¶DPpOLRUHU OD FRPSUpKHQVLRQ GX EkWLPHQW QDWXUH des ouvrages, quantité de
PDWpULDX[« et des SURFHVVXV PLV HQ °XYUH /HV RXWLOV DVVRFLps supportent les échanges
G¶LQIRUPDWLRQ dans les activités de conception et construction architecturale. Le modèle IFC
| Chapitre 7 ± Les méthodes de conception de services : études de cas
129 (Industry Foundation Classes, récemment renommé Information For Construction) est un format
de données standardisé et ouvert, développé SRXU IDYRULVHU O¶LQWHURSpUDELOLWp GDQV OHV DSSURFKHV
BIM. &KDTXH REMHW ,)& SURSRVH XQH VSpFLILFDWLRQ GH O¶LQIRUPDWLRQ UHODWLYH DX SURMHW FRQVLGpUp,
« tout au long du cycle de vie du projet, à travers les disciplines et les applications logicielles »
(Eastman & Sacks 2010). /HVSUREOpPDWLTXHVDFWXHOOHVGDQVO¶LPSOpPHQWDWLRQGXIRUPDW,)&VRQW
proches de celles qui se posent pour la conception de services et SI, à savoir la maîtrise de la
VpFXULWpGHVpFKDQJHVODILDELOLWpGHO¶XWLOLVDWLRQ
Le format IFC eVWVXUWRXWXWLOLVpDXMRXUG¶KXLSRXUUHQGUHLQWHURSpUDEOHVGHVORJLFLHOVGH&$2
(Conception Assistée par Ordinateur), c'est-à-dire SHUPHWWUH O¶pFKDQJH GH PDTXHWWHVQXPpULTXHV
G¶XQORJLFLHOjO¶DXWUH Cependant, FHV pFKDQJHV EDVpVVXUO¶LQWHURSpUDELOLWpGHV données ne sont
pas structurés. Comme on peut également le lire dans (Eastman & Sacks 2010), « le schéma IFC
ne capture pas ODPDQLqUHGRQWO¶LQIRUPDWLRQHVWFUppHHWSDUWDJpHSDUOHVSURIHVVLRQQHOV ». Il ne
définit pas non plus les exigences relatives à ces échanges, ce qui rend difficile la conception de
véritables logiciels de collaboration basée VXUO¶,)&
3RXU UpSRQGUH j FHOD O¶DSSURFKH ,'0 VRXWHQXH SDU O¶DVVRFLDWLRQ %XLOGLQJ60$57 D SRXU
REMHFWLIGHGpILQLUGHVPRGqOHVG¶pFKDQJHVLa réalisation de manuels IDM (Information Delivery
Manual) « définit OHV VSpFLILFDWLRQV SRXU IDLUH FRUUHVSRQGUH OHV pFKDQJHV G¶LQIRUPDWLRQ DYHF OHV
REMHWV GX PRGqOH ,)& SRXU O¶LPSOpPHQWDWLRQ G¶LQWHUIDFHV ORJLFLHOOHV » réellement collaborative,
dans le sens où elles supporteraient des processus métiers valides &H WUDYDLO G¶LPSOpPHQWDWLRQ
implique deux exigences primordiales :
- cLEOHUGHVFDVG¶XWLOLVDWLRQVFRQFUHWVHWLQWpUHVVDQWVSRXUOHVXWLOLVDWHXUV,
- mDLQWHQLUODFRPSDWLELOLWpDYHFO¶LPSOpPHQWDWLRQG¶DXWUHVORJLFLHOV.
$ O¶KHXUH DFWXHOOH OHV YpULWDEOHV XWLOLVDWHXUV HW FRQFHSWHXUV GH FHV PDQXHOV VRQW GHV
chercheurs. Une volonté de standardisation des processus de conception/construction existe, mais
OD SRUWpH GH O¶DSSURFKH SHUPHW DXVVL G¶HQYisager ce formalisme pour décrire le processus
FROODERUDWLIG¶XQSURMHWGRQQp
1.21.2 Définition dHVREMHWVG¶pFKDQJH sur la base de processus
/¶,'0HVWFRPPHVRQQRPO¶LQGLTXHXQPDQXHOF
HVW-à-dire un document qui regroupe des
informations nécessaires à O¶LPSlémentation de modèles IFC. 0DLV F¶HVW pJDOHPHQW Velon la
définition de (Berard & Karlshoej 2012), un langage de modélisation des processus métier qui
étend BPMN, une manière de modéliser et reconcevoir le processus lui-même.
« Les MVD (Model View Definition) WUDGXLVHQW O¶,'0 HQ XQ GRFXPHQW SRXU OH
développement logiciel » (Hietanen 2006). ,OV¶DJLWGe sous-ensembles du modèle IFC global, et
contenant la structure des données SRXUO¶pFKDQJH.
Le processus et les exigences G¶pFKDQJH
Le processus illustré dans la figure suivante (Figure 73) représente la collaboration entre
plusieurs rôles organisationnels que portent les concepteurs (design team), le coordinateur
(project management) et le fournisseur (supply chain). On peut y lire que O¶pTXLSHGHFRQFHSWLRQ
130 Chapitre 7 ± Les méthodes de conception de services : études de cas |
conçoit son bâtiment en utilisant des produits qui sont développés par les fabricants qui valident et
estiment le prix de ces derniers. Le coordinateur doit assister ce processus.
Figure 73. 9XHG¶HQVHPEOHG¶XQ processus (Berard & Karlshoej 2012)
DDQVOHFDGUHGHO¶XWLOLVDWLRQG¶XQVHUYLFH « G¶RXYUDJHV virtuels » (Virtual Building Product,
VBP) à travers le BIM, les actions métiers identifiées dans le processus sont décomposées pour
former un nouveau processus qui décrit le service utilisé ((Charles Eastman & Sacks 2010) utilise
le terme « FDV G¶XWLOLVDWLRQ »). 'DQV O¶H[HPSOH GpFULW ci-dessous (Figure 73), O¶DFWLRQ « Design
Building » est décomposée en cinq actions : « load VBP », « Choose size and type », « Validate
ease of manufacturing », « Insert into model » et « Update design model » (Figure 74). Notons
TXHO¶DFWLRQ« validate ease of manufacturing » VHIDLWDXWRPDWLTXHPHQWO¶DFWHXUUHVSRQVDEOHHVW
le service « virtual building product» lui-même) en fonction de règles prédéfinies.
Figure 74. « &DVG¶XWLOLVDWLRQ » du produit virtuel (Berard & Karlshoej
2012)
| Chapitre 7 ± Les méthodes de conception de services : études de cas
131 /¶HQMHX HVW DORUV GH SRXYRLU GpILQLU OHV H[LJHQFHV G¶pFKDQJH HQ identifiant les « objets
G¶pFKDQJH » (E.O) et les ©PRGqOHV G¶pFKDQJH ª (0 TX¶LOV FRQVWLWXHQW Les E.O évoluent en
fonction du modèle auquel ils appartiennent. Par exemple, un poteau pourra être un simple
volume géométrique dans un modèle conceptuel ou être plus finement décrit lors des phases
ultérieures (Eastman & Jeong 2010). Ces objets sont soumis à des règles métiers comme par
exemple des dimensions réglementaires.
/¶LPSOpPHQWDWLRQ
LDFUpDWLRQGHO¶,'0DXWRXUGHODmodélisation des processus et GHVREMHWVG¶pFKDQJHSHUPHW
de formaliser les besoins des professionnels tHOVTX¶LOVOHVFRPPXQLTXHQW&¶HVWXQHPRGpOLVDWLRQ
indépendante du format utilisé, car les professionnels Q¶RQW généralement pas les compétences
nécessaires pour définir cela. En revanche, « OD FRUUHVSRQGDQFH GH O¶HQVHPEOH G¶LQIRUPDWLRQV
avec une structure de données est la responsabilité du développeur du système » (Berard &
Karlshoej 2012). Comme le montre le schéma suivant (Figure 75), LOV¶DJLWG¶DSSOLTXHUOHVFKpPD
IFC et sa documentation (« IFC model specification »27) au[ H[LJHQFHV G¶pFKDQJH pour
implémenter une solution. Les « Model View Definitions » (MVD), qui sont des sous-ensembles
de modèle IFC, documentent la manière dont ces spécifications sont appliquées pour
O¶LPSOpPHQWDWLRQG¶XQHVROXWLRQIFC (Hietanen 2006). Enfin, celle-ci est implémentée.
Figure 75. 9XHG¶HQVHPEOHGHVpWDSHVSRXUOHGpSORLHPHQWde solutions
basées sur l¶,)& (adapté de (Hietanen 2006))
/H PRGqOH ,)& HVW DXMRXUG¶KXL HQWLqUHPHQW FHUWLILp ,62 FH TXL YD HQFRXUDJHU VD
standardisation et son adoption par le secteur. La portée de cette approche est de pouvoir écrire
GHV SURFHVVXV PpWLHUV DXWRXU GX %,0 GH PDQLqUH VWDQGDUGLVpH pJDOHPHQW DILQ G¶HQ FUpHU GHV
FDWDORJXHV $ WHUPHV FHOD SHUPHWWUD G¶LPSOpPHQWHU GHV services BIM par la composition de
processus standards, liés aux besoins des utilisateurs.
1.21.3 Analyse critique et conclusion
Le BIM et lD FHQWUDOLVDWLRQ GHV GRQQpHV GX EkWLPHQW DXWRXU G¶XQ PRGqOH XQLTXH est un
FRQWH[WH WHFKQRORJLTXH LQQRYDQW HW SOHLQ G¶LQWpUrW SRXU OH VHFWHXU $IC. Il est supporté par la
créatLRQGHGRQQpHVGDQVXQIRUPDWG¶pFKDQJHVWDQGDUG O¶,)&
27
ŽŶƉŽƵƌƌĂŝƚĚ͛ĂŝůůĞƵƌƐƉĂƌůĞƌĚĞŵĠƚĂ-­‐modèle IFC 132 Chapitre 7 ± Les méthodes de conception de services : études de cas |
Cependant, FRPPH O¶pYRTXH (Eastman & Sacks 2010), « le schéma IFC ne capture pas la
PDQLqUH GRQW O¶LQIRUPDWLRQ HVW FUppH HW SDUWDJpH SDU OHV SURIHVVLRQQHOV ». Pour cela il est
QpFHVVDLUHG¶LQWHUURJHUOHVSURIHVVLRQQHOVHWGHFDSWHUOHVSURFHVVXVTX¶LOVPHWWHQWHQ°XYUHGDQV
OHXUFRQWH[WHGHWUDYDLOVSpFLILTXH/¶,'0HVWFRQoXjFHWHIIHW : il rassemble les processus et les
exiJHQFHVHQWHUPHVG¶pFKDQJHVHQGHKRUVGHWRXWHSUpRFFXSDWLRQVXUO¶LPSOpPHQtation.
Les processus GHO¶IDM sont créés en plusieurs temps. Dans un premier temps, F¶HVWle point
de vue métier qui est modélisé (Figure 73)DYHFO¶DQDO\VHGHVSURFHVVXVFROODERUDWLIVPLVHQSODFH
au cours de phase spécifique du projet. Basé sur le BPMN, ces processus décrivent les tâches de
chacun sous forme de « swimlanes ». Le deuxième point de vue porte sur des « FDVG¶XWLOLVDWLRQ »
au cours desquels les « tâches métiers » sont décomposées en « tâches utilisateur » sur le système
(Figure 74). Le formalisme utilisé est le même et la décomposition des tâches est identifiable par
le nommage de celles-ci (ex. les tâches 1.2.1 et 1.2.2 sont les tâches utilisateurs qui composent la
tâche métier 1.2). /¶pWXGHQHQRXVGLWFHSHQGDQWSDVTXLH[SULPHFHVSRLQWVGHYXHHWFRPPHQW,O
VHUDLW LQWpUHVVDQW G¶LGHQWLILHU OD SODFH GHV XWLOLVDWHXUV GHV DQDO\VWHV PpWLHUV RX HQFRUH GHV
développeurs dans un tel processus ainsi que la manière dont ils collaborent autour des langages
utilisés.
Concernant le formalisme, on ne retrouve par contre pas de formalismes propres au génie
logiciel (GL). Par exemple, les auteurs utilisent le terme « FDVG¶XWLOLVDWLRQ » qui est emprunté au
*/ PDLV TXL Q¶HVW SDV IRUPDOLVp SDU OH diagramme UML correspondant (le diagramme de cas
G¶XWLOLVDWLRQ
Vis-à-YLVGHO¶DQDO\VHPpWLHUQRXVSHQVRQVTXH les modèles de processus sont inadaptés pour
la description du contexte particulier d¶XQ projet AIC (cf. § 1.14.4). (Berard & Karlshoej 2012)
partage notre avis, argumentant en ces termes : « les processus de projet de construction sont très
flexibles et, aYHFOHVSUDWLTXHVG¶DXMRXUG¶KXLLOHVWGLIILFLOHGHPRGpOLVHUXQSURFHVVXVtrès détaillé
afin de le standardiser ». Il ajoute : « QRQVHXOHPHQWO¶RUGUHGHO¶H[pFXWLRQGHVWkFKHVHVWGLIIpUHQW
G¶XQSURMHWjXQDXWUHPDLVO¶LQWHUDFWLRQHQWUHRUJDQLVDWLRQVSHXWDXVVLGLIIpUHUjO¶LQWpULHXUPrPH
G¶XQ SURMHW ». /¶REMHFWLI HVW GRQF G¶pYLWHU G¶LQYHVWLU GX WHPSV HQ VH SHUGDnt dans de la
« surmodélisation ª HW GH WURXYHU O¶pTXLOLEUH HQWUH modélisations générique et spécifique afin de
couvrir différents besoins tout en restant pertinent. Nous SHQVRQVTX¶LOHVWLPSRUWDQWGHSULYLOpJLHU
des modèles simples autour de concepts clairement définis.
'DQVOHFDGUHGXGpYHORSSHPHQWG¶XQensemble FRPSOHWGHVHUYLFHVEDVpVVXUOH%,0O¶,'0
décrit non pas un seul, PDLVGHPXOWLSOHVSURFHVVXVTXLFRPSRVHQWO¶DFWLYLWpJOREDOHGHSURMHWAu
final, un IDM se présente comme une « checklist de plus de 50 pages ». 1RXVSHQVRQVTX¶LOVHUDLW
utile de décomposer cette approche en créant des IDM plus « ciblés ª ,O V¶DJLW GH mener des
processus de développement plus courtsDILQG¶HQIDFLOLWHUOHGpURXOHPHQW et la traçabilité.
Nous remarquons dans (Eastman & Sacks 2010) TXH OHV SURFHVVXV GH O¶,'0 PRGpOLVHQW
pJDOHPHQWO¶LQIRUPDWLRQTXLQ¶HVWSDVpFKDQJpHjWUDYHUVGHVPRGqOHV&HODSHUPHWtrait G¶étendre
OH FKDPS G¶DSSOLFDWLRQ en dehors du BIM et nous y voyons un intérêt pour la spécification de
services ,7 SOXV YDULpV UHODWLIV j GµDXWUHV WHFKQRORJLHV FROOHFWLFLHOV DSSOLFDWLRQV PRELOHV«
/¶DSSURFKH ,'0 QH V¶pWHQG SDV VXU la proposition de services autres que le BIM, pourtant elle
pourrait y contribuer. En effet, elle fournit une analyse métier cohérente et complète qui pourrait
être intégrée aux méthodes plus générales de Génie Logiciel et de conception de services. Cela
| Chapitre 7 ± Les méthodes de conception de services : études de cas
133 serait notamment profitable aux professionnels du secteur à court terme, en attendant la
démocratisation du BIM et des IFC qui se fait lentement.
1.22
Conclusion et mise en place de la méthode
Le but de cette partie pWDLW G¶LQWURGXLUH OD FRQFHSWLRQ GH VHUYLFHV collaboratifs pour
comprendre la démarche à suivre dans le développement de notre propre méthode de conception.
Notre objectif est de répondre aux problématiques sectorielles détaillées au chapitre 3 (notamment
au § 1.7.2). Ce chapitre détaille trois méthodes de conception dont nous avons pu faire ressortir
les avantages et limites. Il complète notre analyse menée au travers des chapitres 4, 5 et 6 sur le
GL, les IHM, les SI et le TCAO.
De manière générale, ces méthodes QRXV SHUPHWWHQW GH FRPSUHQGUH OH GpURXOHPHQW G¶XQ
SURFHVVXVGHFRQFHSWLRQGDQVXQFDVFRQFUHWG¶DSSOLFDWLRQ(OOHV ne semblent cependant pas faire
leurs preuves dans des cas réels de projet de conception et transfert des services, à savoir dans le
but de répondre aux besoins spécifiques G¶XQGRPDLQHSURIHVVLRQQHO et dans des conditions réelles
de développement. De plus, chacune couvre un contexte technologique très précis, ce qui limite
leur extension dans des domaines variés.
Pour approfondir certains des SRLQWV G¶LQWpUrWV évoqués ou pallier à certaines des limites
perçues, nous proposons de définir le cadre de notre approche sur la base des hypothèses
suivantes :
- Une analyse métier doit être basée sur la modélisation de situations collaboratives précises et
non sur la « surmodélisation » de processus complexes.
- Les modèles graphiques favorisent la synthèse et la compréhension, ils sont particulièrement
adaptés à la mise en correspondance de concepts entre plusieurs modèles. Les modélisations
OLWWpUDOHV IRXUQLVVHQW TXDQW j HOOHV GH O¶LQIRUPDWLRQ SUpFLVH HW en grande quantité. Il sera
MXGLFLHX[GHFRPELQHUOHVGHX[HQIRQFWLRQGHO¶LQIRUPDWLRQjPodéliser.
- /H FRXSODJH WDUGLI HQWUH H[LJHQFHV HW DVSHFWV WHFKQLTXHV DVVXUH OD SRVVLELOLWp G¶pWHQGUH
O¶DSSURFKHjGLIIpUHQWVGRPDLQHVPpWLHUVFRPPHjGLIIpUHQWVFRQWH[WHVWHFKQRORJLTXHV.
- 6HFRQFHQWUHUVXUODQRWLRQG¶LQIRUPDWLRQPDQLSXOpHjWUDYHUVOHFRQFHSWG¶REMHWSHUPHWGH
traduire O¶HVSDFH RUJDQLVDWLRQQHO HQ HVSDFH LQWHUDFWLRQQHO DYDQW GH GpILQLU OHV VHUYLFHV G¶XQ
point de vue fonctionnel.
- Plusieurs espaces interactionnels et fonctionnels peuvent correspondre à plusieurs espaces
organisationnels, en fonction GHV YDULDWLRQV GH FRQWH[WH TXH FH VRLW FHOXL GH O¶DFWLYLWp GH
O¶DFWHXURXGHO¶XWLOLVDWHXU.
134 Chapitre 7 ± Les méthodes de conception de services : études de cas |
A partir des différents concepts qui émergent de nos analyses, nous proposons une approche
structurée baVpHVXUXQFKHPLQHPHQWG¶pWDSHVrelatives à trois points de vue (Figure 76) :
- Le point de vue organisationnel. Nous souhaitons rWUH SOXV SUpFLV TXH ORUV GH O¶pQRQFp GH
besoins ou de principes généraux relatifs à la collaboration mais sans atteindre la rigidité des
processus. Nous nous concentrRQVVXUO¶analyse des rôles et activités métiers des utilisateurs
dans une équipe de projet AIC. Nous adoptons le concept de Pratiques métiers (Collectives
et I ndividuelles).
- Le point de vue opérationnel. Nous considérons ici les personnes HQWDQWTX¶utilisateurs de
diverses technologies et dans des contextes G¶XWLOLVDWLRQ relatifs au projet AIC pour concevoir
XQVFpQDULRG¶XWLOLVDWLRQDGDSWp ,OQRXVVHPEOHLPSRUWDQWGHQ¶DYRLUTXHUDUHPHQWUHFRXUVj
O¶XWLOLVDWHXUNous adoptons le conceSWG¶Usage.
- Le point de vue fonctionnel. Notre objectif est de spécifier des nouveaux services ou
G¶DGDSWHUGHVVHUYLFHVH[LVWDQWVSRXUDPpOLRUHUO¶XWLOLWpHWO¶XWLOLVDELOLWpGHVRXWLOVGH7&$2.
Nous adoptons le concept de Services Collaboratifs.
Figure 76. Construction de notre méthode en fonctions des approches
analysées et leurs apports respectifs
| Chapitre 7 ± Les méthodes de conception de services : études de cas
135 PARTIE 3 : Guider la conception de services collaboratifs adaptés
au secteur de la construction. Études, propositions et perspectives.
Nous montrons dans cette dernière partie la construction
de QRWUH PpWKRGH G¶DQDO\VH HW FRQFHSWLRQ SRXU OD
proposition de services collaboratifs adaptés sur la base
GHVK\SRWKqVHVGpJDJpHVHWGHO¶DSSURFKHLQWURGuite. Le
premier chapitre décrit la méthodologie adoptée, et les
suivants présentenW FKDTXH pWDSH GH O¶DSSURFKH autour
de la méta-modélisation et modélisation des pratiques,
des usages et des services. 5DSSHORQV TX¶XQH DSSURFKH
TXL V¶LQVFULW GDQV XQH GpPDUFKH VFLHQWLILTXH GH
FRQFHSWLRQ VH GLVWLQJXH G¶XQH DSSURFKH G¶LQJpQLHULH
classique car elle mêle propositions et évaluations dans
XQSURFHVVXVFRQWLQXGHSXLVODSUHPLqUHLGpHMXVTX¶jOD
réalisation. Nous accordons DXWDQW G¶LPSRUWDQFH j OD
GHVFULSWLRQ GHVFRQFHSWV LQWURGXLWVTX¶DX[FDVG¶pWXGHV
qui ont permis de les identifier et les valider. Un dernier
chapitre fait état de ces FDVG¶pWXGHV, nous permettant de
WLUHU GHV FRQFOXVLRQV VXU OD SHUWLQHQFH HW O¶DSSOLFDELOLWp
de cette méthode.
138 |
Chapitre 8 ± I ntroduction de la
proposition
Ce chapitre dégage dans un premier temps les enjeux et objectifs de cette étude. Ils sont issus des
FRQWH[WHV GH GpYHORSSHPHQW GH QRWUH PpWKRGH GH FRQFHSWLRQ j VDYRLU OH FRQWH[WH G¶DSSOLFDWLRQ OH
GRPDLQH $,&HWOHFRQWH[WHG¶pWXGHFUppSDU OHVGHX[ODERUDWRLUHVHQFDGUDQWFHWWHpWXGHOH0$3CRAI et le CRP Henri Tudor). Il présente ensuite la méthodologie adoptée, les outils utilisés et le
SURFHVVXVPLVHQ°XYUHSRXUGpSOR\HUXQHPpWKRGHGHFRQFHSWLRQIDYRULVDQWOHVRSSRUWXQLWpVPpWLHU
et technologique : la méthode que nous nommons PUSH pour « Practice and Usage-based Service
enHancement ».
1.23
Enjeux de la méthode
1.23.1 Un domaine G¶DSSOLFDWLRQSDUWLFXOLHU
1RWUH SUREOpPDWLTXH G¶DGDSWDWLRQ GHV VHUYLFHV LQIRUPDWLTXHV HVW LVVXH G¶XQ FRQVWDW LQLWLDO TXH
nous avons introduit dans les premiers chapitres de cet ouvrage : un domaine particulier implique des
services particuliers, les services génériques ne répondant pas totalement aux besoins des
professionnels. Un domaine collaboratif (caractérisé par le travail coordonné de plusieurs acteurs)
nécessite des services de support à la coproduction, à la communication et la coordination dans un
contexte de travail souvent distant et réparti dans le temps (cf. 1.16.1).
3RXUpWXGLHUFRPPHQWODVSpFLILFLWpG¶XQGRPDLQHSHXWLQIOXHQFHUOHGpYHOoppement de services
nous nous sommes concentrés sur le domaine AIC. Rappelons que le projet de conception et
construction architecturales GLIIqUH G¶XQ SURFHVVXV industriel notamment car O¶REMHW SURGXLW, c'est-àdire le bâtiment, est unique. Il est également soumis à des garanties décennales qui impliquent la
UHVSRQVDELOLWpGHVFRQFHSWHXUVTXDQWjODTXDOLWpGHO¶RXYUDJHGDQVOHWHPSV. Les tâches « métier » en
conception et construction sont non répétitives et sans cesse ajustées de par le contexte de projet. Ce
contexte, appelé « FRQWH[WHGHO¶DFWLYLWpFROOHFWLYH » dans les travaux antérieurs (voir 1.1)pYROXHG¶XQ
projet à un autre mais aussi au cours même du projet sous des « influences extérieures » pareilles à
celles qui opèrent sur le « business model » des entreprises (voir 1.13.4) O¶HQYLURQQHPHQW
| Chapitre 8 ± Introduction de la proposition
139 O¶pFRQRPLe, la technique... Avec lui varient les autres contextes OLpVjO¶XVDJHGes outils pour assister
le projet : le contexte utilisateur (physique et matériel) et le contexte GHO¶acteur (cognitif) (cf. § 1.2.3).
$XMRXUG¶KXL OHV VROXWLRQV ORJLFLHOOHV SRXU OH SDUWDJH G¶LQIRUPDWLRQ VRQW QRPEUHXVHV. Elles
existent par exemple sous la forme pièces jointes dans un mail (ou via un message instantané) ou de
stockage dans le « cloud » (GoogleDrive, MicroVRIW 6N\'ULYH 'URS%R[« Cependant, dans le
contexte professionnel G¶XQ SURMHW GH FRQVWUXFWLRQ, ces outils trouvent rapidement leurs
limites (malgré des versions dédiées entreprises) /H PDQTXH G¶HVSDFH GLVSRQLEOH G¶DUFKLYDJH GH
sécurité et de traçabilité ou encore les règles de confidentialité inadaptées limitent leur adoption par
les professionnels qui privilégient pour certains des solutions « privées » développées en interne«
Les outils tels que CRTI-weB et plus particulièrement son service « documents » (cf. 1.4.3), se
démarquent par des fonctionnalités pensées pour les activités et par les acteurs du domaine de la
construction, telles que l¶XWLOLVDWLRQG¶XQH convention de nommage « métier », le filtrage par émetteur
de plans, les commentairesODYDOLGDWLRQ« Ils présentent aussi G¶DXWUHVTXDOLWpV comme la sécurité et
la confidentialité.
1.23.2 /HFRQWH[WHG¶pWXGHHWOHVREMHFWLfs
Le double contexte offert par le CRAI (Centre de Recherche en Architecture et Ingénierie) de
Nancy et le CRP (Centre de Recherche Public) Henri Tudor à LuxembourgDSHUPLVG¶LQVFULUHGHV
objectifs de recherche dans la continuité de travaux théoriques HW GDQV GHV FDV G¶pWXGHV UpHOV HW
pertinents. La thématique de recherche du CRAI est la proposition de méthodes et outils pour
O¶DVVLVWDQFHjODFRQFHSWLRQOa construction et la coordination dans le domaine AIC. &¶HVWDYDQWWRXW
un contexte académique. Les objectifs du CRP Henri Tudor sont quant à eux relatifs à la recherche et
au développement de services innovants pour le transfert vers les professionnels. Un des programmes
GH O¶RUJDQLVDWLRQ HVW GpGLp DX GRPDLQH GH OD FRQVWUXFWLRQ Par rapport à la structure de notre
recherche introduite au § 1.8.2 (et comme le rappelle la Figure 77) ce contexte a donc alimenté à la
fois notre base de connaissances (en jaune sur la figure, cf. Partie 1) et notre tHUUDLQG¶H[SpULPHQWDWLRQ
(en bleu, présenté au Chapitre 12 de ce manuscrit) ,O D SHUPLV G¶DOOLHU SUpRFFXSDWLRQV PpWLHUV HW
RSSRUWXQLWpVG¶LQQRYDWLRQ
140 Chapitre 8 ± Introduction de la proposition |
Figure 77. 3DUWLHVGHODUHFKHUFKHVXSSRUWpHVSDUOHFRQWH[WHG¶pWXGH
/HV EHVRLQV G¶DGDSWDWLRQ GHV VHUYLFHV SRXU le domaine AI& HW SDU FRQVpTXHQW OH EHVRLQ G¶XQH
PpWKRGH GH FRQFHSWLRQ RQW pWp LGHQWLILpV GDQV OD OLWWpUDWXUH HW SDU O¶REVHUYDWLRQ GH FDV FRQFUHWV
G¶XWLOLVDWLRQGHVHUYLFHVQRWDPPHQWFHX[GHO¶RXWLO&57,-weB (cf. § 1.5). En remettant en cause les
services qui paraissent peu adaptés de par les retours des utilisateurs, nous nous sommes servis de
CRTI-ZH%HWGHO¶DQDO\VHGHSURMHWVGHFRQVWUXFWLRQKpEHUJpVVXUFHWWHSODWHIRUPHFRPPHSRLQWGH
départ de notre étude. À la lumière deV WKpRULHV DQDO\VpHV DX FRXUV GH QRWUH pWDW GH O¶DUW VXU OHV
méthodes de conception logicielle, QRXVDYRQVGpSOR\pQRWUHSURSUHPpWKRGHHQO¶DSSOLTXDQWGDQVFH
contexte spécifique.
Les développeurs sont actuellement responsables des ateliers de formation avec les utilisateurs de
CRTI-weB et recueillent également leurs retours réguliers. Au coXUVG¶pFKDQJHVDYHFHX[QRXVDYRQV
relevé deux enjeux majeurs :
- faciliter le dialogue et éviter les incompréhensions, afin de lever le risque de développer des
services FRXWHX[PDLVV¶DYpUDQWLQDGDSWpV
- garder en mémoire les décisions prises afin de tracer O¶pYROXWLRQGXSURMHWGpYHORSSHPHQW
La section suivante montre comment la caractérisation des trois points de vue (organisationnel,
opérationnel et fonctionnel) définie en conclusion du chapitre précédent permet de répondre à ces
enjeux.
1.24
M éthodologie
1.24.1 La caractérisation des points de vue
Notre approche de conception de services adaptés est basée sur O¶H[SUHVVLRQ GHV SRLQWV GH YXH
organisationnel, opérationnel et fonctionnel par la modélisation des pratiques métiers, des usages
G¶XQH WHFKQRORJLH HW des services. Ces modèles (M1) décrivent des cas réels sur base de concepts
décrits dans trois Méta-Modèles (M2) qui sont agrégés en un seul : le Méta-Modèle des Services
| Chapitre 8 ± Introduction de la proposition
141 Adaptés (MMSA). Les modélisations successives nous permettent de raffiner les méta-modèles
proposés dans un premier temps à partir de la littérature analysée (Figure 78).
Figure 78. Processus de méta-PRGpOLVDWLRQjSDUWLUGHO¶DQDO\VHGHFDV et
de la littérature dans différents domaines
Dans des travaux de recherche antérieurs, menés dans le cadre du projet de recherche Dest2Co par
le CRP Henri Tudor, les points de vue et les modèles VRQWODEDVHG¶une méthode de conception de
services : la méthode Dest2Co (Zignale et al. 2011). Cette méthode propose un processus qui intègre
trois étapes (appelées vues, Figure 79) :
- la « business requirements view » (BRV), relative au point de vue des experts métiers, qui
contient les modèles décrivant les exigences générales du domaine (sous forme de pratiques
collectives),
- la « business solution view » (BSV), relative au point de vue des experts en services, qui décrit la
solution en termes de services métiers, sans aucune considération technique,
- la « technical solution view » (TSV), TXL FRUUHVSRQG D XQH SKDVH G¶DQDO\VH HW FRQFHSWLRQ
logicielle, assurée par les experts du génie logiciel.
Figure 79. Le processus de la méthode Dest2Co (tiré de (Zignale et al.
2011))
142 Chapitre 8 ± Introduction de la proposition |
En comparant le projet de conception de service à un projet architectural, nous pouvons également
créer un parallèle avec le concept de points de vue traité dans (Hanrot 2005). On peut y lire que « le
SRLQWGHYXHSRUWHVXUFHUWDLQVDVSHFWVGHO¶REMHW » (ici architectural mais dans notre cas nous parlons
GH VHUYLFH /¶DXWHXU DMRXWH TXH OH SRLQW GH YXH GpSHQG © GH O¶H[SHUWLVH GH O¶DFWHXU » et « de sa
connaissance des autres domaines ». Cette description du concept de point de vue correspond à celle
que nous lui conférons dans noWUHpWXGH,OV¶DJLWHQHIIHWGHIDLUHLQWHUYHQLUGHVDFWHXUVDX[H[SHUWLVHV
différentes (expert métier, concepteur en génie logiciel et IHM, développeur) non pas pour évaluer
mais pour assurer la qualité du service. La modélisation, activité principale dans le projet
architecturalHVWpJDOHPHQWDXF°XUGHQRWUHDSSURFKHGHFRQFHSWLRQ(OOHGRLWSHUPHWWUHG¶pYLWHUGHV
ambiguïtés, et augmenter la compréhension que les intervenants ont du travail réalisé par les autres
LQWHUYHQDQWVG¶XQSURMHWGHFRQFHSWLRQde services.
1RWUH pWXGH V¶DSSXLH VXU FHWWH QRWLRQ GH SRLQW GH YXH HQ SURSRVDQW pJDOHPHQW XQ SURFHVVXV
composé de trois étapes.
Le point de vue organisationnel porte sur les pratiques GHVDFWHXUVG¶XQSURMHW$,& (en fonction
de leur rôle), ayant des besoins spécifiques dérivés des pratiques collectives qui se mettent en place au
cours du projet. De par le contexte professionnel dans lequel se trouve notre étude, nous nous sommes
essentiellement intéressés aux besoins liés au partage de documents des architectes DYHF G¶DXWUHV
DFWHXUV GRQW QRWDPPHQW OHV HQWUHSULVHV OHV LQJpQLHXUV HW OH PDvWUH G¶RXYUDJH HW j OD YLVLWH GH
chantier. /¶DQDO\VH GH pratiques a contribué à améliorer notre compréhension des aspects métiers
relatifs à la modélisation de la collaboration. Les travaux précédents sur la méta-modélisation du
contexte coopératif (chapitre 1) et notre étude sur les processus métiers (chapitre 5) nous servent de
base à la création du méta-modèle des pratiques métiers (MMPM).
Le point de vue opérationnel prend en considération la médiatisation des pratiques par les
XVDJHVG¶RXWLOVGpGLpV/HVRXWLOVTXLQRXVLQWpUHVVHQWSDUWLFXOLqUHPHQWVRQWOHVRXWLOVG¶DVVLVWDQFHjOD
FROODERUDWLRQ GRQW QRWDPPHQW OHV SODWHIRUPHV G¶pFKDQJH GH GRFXPent. Les questions relatives à
O¶XVDJHFRQFHUQHQW :
- ODGpILQLWLRQGXFRQWH[WHGHO¶XWLOLVDWHXU
- ODGpILQLWLRQGHO¶RXWLO
- ODGpILQLWLRQGHO¶LQWHUDFWLRQHQWUHO¶XWLOLVDWHXUHWO¶RXWLO
- ODGpILQLWLRQGHO¶LQIRUPDWLRQPDQLSXOpHjWUDYHUVO¶RXWLO
(QILQ G¶XQ point de vue fonctionnel, il est nécessaire de tenir compte des caractéristiques
techniques de O¶RXWLOXWLOLVptout en implémentant au mieux les services spécifiés.
/¶HQVHPEOHGHO¶pWDWGHO¶DUWVXUOHVapproches et méthodes de conception (Partie 2) nous permet
GH FRPSUHQGUH OHV FRQFHSWV j PDQLSXOHU SRXU O¶DQDO\VH GHV XVDJHV HW OD VSpFLILFDWLRQ GHV VHUYLFHV
collaboratifs. Cela nous mène à la construction de deux autres méta-modèles : le Méta-Modèle
G¶8VDJHV008HWOH0pWD-Modèle de Services (MMS). Il s¶Dgit notamment de choisir les éléments
OHVSOXVSHUWLQHQWVDILQG¶DYRLUDVVH]G¶LQIRUPDWLRQVDQVSRXUDXWDQWHQ surcharger les destinataires des
analyses OHFRQFHSWHXUSRXUO¶XVDJHHWOHGpYHORSSHXUSRXUOHVHUYLFH
3DUO¶DVVRFLDWLRQGHVWURLVPpWD-modèles (MMPM, MMU et MMS) nous créons le Méta-Modèle
de Services Adaptés 006$ ,O V¶DJLWGH GpFULUHFRPPHQWOHVXVDJHV© médiatisent » les pratiques
| Chapitre 8 ± Introduction de la proposition
143 métiers puis comment ils sont « matérialisés » par des services. &¶HVW SRXUTXRL OHV VHUYLFHV GpFULWV
sont dits « adaptés », sous-entendu adaptés aux pratiques métiers étudiées.
1.24.2 Les formalismes et outils utilisés
Nos méta-modèles sont représentés sous la forme de diagrammes de classes UML. Nous avons
XWLOLVpO¶RXWLO6WDU80/SRXUOHVpGLWHU &RPPHO¶LOOXVWUHO¶H[HPSle de la Figure 80, nous retrouvons
dans ce type de diagrammes :
- dHVFODVVHVIDPLOOHSDUHQWV«HWOHVDWWULEXWVTXLOHVFDUDFWpULVHQWQRPkJHSURIHVVLRQ«. Les
DWWULEXWVSHXYHQWrWUHGpWHUPLQpVSDUODVDLVLHG¶XQWH[WHOLEre (ex. nom) ou par un choix parmi une
suite de valeurs (ex. type_profession). Le choix entre oui et non (ex. marié) est une énumération
SDUWLFXOLqUH/HFKRL[G¶XQHYDOHXUQXPpULTXHSHXWrWUHVSpFLILpSDUXQHSODJHGHYDOHXUV
- Des associations entre concepts avec les cardinalités qui les définissent (ex. le père est en couple
avec une seule mère et réciproquement (relation 1 - 1)), les fils sont frères de aucun ou plusieurs
autres enfants (relation 0.*)«,
- des compositions (une famille est composée de pareQWV HW G¶HQIDQWV pour lesquelles nous ne
définissons pas de cardinalités en considérant le cas le plus général à chaque fois (0.*)
- des généralisations (les fils et les filles sont des enfants), relations à travers lesquelles les sousclasses héritent des attributs de la classe au dessus.
Figure 80. Exemple de diagramme de classes UML caractérisant une
famille
Ces méta-modèles sont instanciés par des modèles dont la forme est décrite par un formalisme
particulier, selon le besoin de représentation. Nous utilisons notamment les diagrammes de cas
G¶XWLOLVDWLRQGHWkFKHVRXHQFRUHGHVpTXHQFHcf. § 1.9.3) qui sont des formalismes adaptés et adoptés
dans les domaines de la conception logicielle. Le tableau est un formalisme simple qui permet de
représenter de manière claire et structurée des données littérales (de type texte court) ou numériques.
Il est ainsi suffisant pour modéliser certains concepts qui ne demandent pas une représentation
144 Chapitre 8 ± Introduction de la proposition |
graphique particulière. Le tableau représente les données sous forme de cases alignées dans des
colonnes et des lignes.
Cependant, OHV IRUPDOLVPHV H[LVWDQWV QH SHUPHWWHQW SDV G¶LQVWDQFLHU HQWLqUHPHQW QRWUH 006$
Nous avons donc créé nos propres formalismes en utilisant O¶HQYLURQQHPHQW GH GpYHORSSHPHQW
Eclipse et plus particulièrement le framework GMF (Graphical Modelling Framework) H[WHQVLRQG¶XQ
DXWUHIUDPHZRUNTX¶HVW(0).
Le framework GMF HWO¶exploitation de nos méta-modèles
Le projet Eclipse28 est un ensemble de projets de développement logiciel autour de la plateforme
Eclipse, un environnement de développement intégré principalement écrit en Java. Le projet « Eclispe
Modeling » a été lancé par IBM dans le but d'unifier leurs outils de développement utilisant des
modèles. Comme nRXVO¶DYRQVYXGDQVODVHFWLRQLQWURGXLVDQWO¶LQJpQLHULHGLULJpHSDUOHVPRGqOHVFI
1.11.1O¶espace technique EMF (Eclispe Modeling Framework) HVWVLPLODLUHjFHOXLGHO¶DUFKLWHFWXUH
dirigée par les modèles MDA.
Ainsi, un projet EMF permet de créer des méta-modèles « ecore » (M2) basé sur le langage
EMOF (Essential Meta-Object Facility) puis les modèles (M1) conformes à ce langage. Pour
représenter le méta-modèle, le framework propose le formalisme « ecorediag » proche de celui du
diagramme de classes UML. Nous pouvons donc implémenter nos propres méta-modèles en EMF
sans changement de formalisme. Les éléments de modèle (M1) créés à partir des concepts du M2 sont
UHSUpVHQWpVVRXVIRUPHG¶XQHOLVWHOHXUVDWWULEXWVpWDQWpGLWables à partir d¶XQH fenêtre « propriétés ».
Figure 81. ([HPSOHG¶LQVWDQFLDWLRQG¶XQHFODVVHGHPpWD-modèle avec
O¶pGLWHXU(0)
Le framework GMF (Graphical Modeling Framework) est né de O¶DVVRFLDWLRQG¶(0)jXQDXWUH
framework : GEF (Graphical Editor FraPHZRUN&HGHUQLHUSHUPHWODFUpDWLRQG¶pGLWHXUVJUDSKLTXHV
ULFKHV $LQVL *0) SHUPHW O¶LQVWDQFLDWLRQ G¶XQ PpWD-modèle « ecore » par des diagrammes, par la
génération de FHJHQUHG¶pGLWHXUs entièrement personnalisables.
Le processus de création et personQDOLVDWLRQGHO¶pGLWHXUHVWDVVLVWpSDUXQ© dashboard » (Figure
82). Après la création du méta-modèle « ecore » et la génération des classes java, deux modèles sont
FUppV SRXU GpFULUH O¶DVSHFW JUDSKLTXH GHV GLDJUDPPHV HW OD SDOHWWH GH O¶pGLWHXU : le « graphical def
model » et le « tooling def model ». Dans le « tooling def model » il est par exemple possible
G¶DJUpJHUOHVRXWLOVGHODSDOHWWHGDQVGHVVRXV-menus ou de les séparer par des traits afin de mieux les
28
http://www.eclipse.org/eclipse/index.php | Chapitre 8 ± Introduction de la proposition
145 organiser. Grâce au « graphical def model », nous avons exploité une série de paramétrages basiques
mais qui répondent à nos besoins de personnalisation des formalismes :
- changement des formes utilisées pour représenter les éléments (rectangles, rectangles, arrondis,
ellipses) et variations du trait utilisé (style, épaisseur, couleur),
- variations des traits utilisés pour les relations,
- variations des polices pour chaque attribut utilisé,
- DMRXWG¶XQWLWUHSRXUFKDTXHDWWULEXW,
- DIILFKDJHG¶XQLF{QHSRXUFKDTXHpOpPHQW«
Figure 82. PrRFHVVXVGHJpQpUDWLRQG¶XQpGLWHXUGHPRGqOHVDYHF*0)
146 Chapitre 8 ± Introduction de la proposition |
3RVLWLRQQHPHQWSDUUDSSRUWjO¶DUFKLWHFWXUHGLULJpHSDUOHVPRGqOHV
Le cadre de notre étude ne couvre pas les développements et déploiements automatisés des
services informatiques couverts par certaines approches de MDA (architecture dirigée par les
modèles). Nous nous concentrons sur la spécification de ces services et leur développement dans le
FDGUH G¶H[SpULPHQWDWLRQV HQ FROODERUDWLRQ DYHF GHV GpYHORSSHXUV $XVVL QRXV SUHQRQV OH SDUWL GH
proposer des modèles contemplatifs et non productifs (Favre 2004). Nous rappelons que les modèles
contemplatifs sont utiles pour la communication et la compréhension mais ne sont pas utilisés pour la
production du code qui UHVWHO¶DFWLYLWpGHO¶LQIormaticien (cf. § 1.11.1).
&HFKDPSG¶études IDLWO¶REMHWGHSOXVLHXUVWUDYDX[GHUHFKHUFKHFI § 1.11.2) qui le font évoluer.
'DQV OD SUDWLTXH OD JpQpUDWLRQ Q¶HVW SDV HQFRUH HQWLqUHPHQW DXWRPDWLVpH HW OHV FDV G¶DSSOLFDWLRQV
UHVWHQWGHVFDVUHODWLYHPHQWVLPSOHV&HSHQGDQWLOVHUDLWLQWpUHVVDQWG¶LQFOXUHQRWUHDSSURFKHGDQVXQH
telle démarche pour en explorer les enjeux : cela consisterait à automatiser le passage de la
modélisation des pratiques métiers à la génération de services qui les supportent. Eclipse propose des
outils de transformation de modèles comme ATL29 qui pourraient nous permettre G¶LQYHVWLU XQH
recherche dans ce sens HWSRXUUDLWIDLUHO¶REMHWG¶XQHSHUVSHFWLYH de ce travail.
1.25
La méthode PUSH : « Practice and Usage-based Service enHancement
1.25.1 Un processus qui valorise les opportunités
Notre approche GH FRQFHSWLRQ GH VHUYLFHV DGDSWpV SUpFRQLVH O¶expression de trois points de vue
distincts mais conceptuellement liés : le point de vue organisationnel, le point de vue opérationnel et
le point de vue fonctionnel. Des méta-modèles caractérisent les concepts manipulés dans ces trois
points de vue et différents outils et formalismes permettent de les exprimer. &RPPH O¶LOOXVWUH OD
Figure 83 le processXVGHFRQFHSWLRQVXSSRUWpSDUO¶H[SUHVVLRQGHFHVSRLQWVGHYXHGHYUDIDYRULVHUOD
valorisation des opportunités aussi ELHQ PpWLHU TXH WHFKQRORJLTXHV /HV FKDPSV G¶pWXGHV DQDO\VpV
GDQVQRWUHpWDWGHO¶DUWLOlustrent cette double valorisation.
Figure 83. 8QHPpWKRGHGLULJpHSDUOHVPRGqOHVHWIDYRULVDQWO¶LQQRYDWLRQ
29
http://www.eclipse.org/atl/ | Chapitre 8 ± Introduction de la proposition
147 Nous parlons de valorisation des opportunités métier lorsque la méthode permet G¶XWLOLVHU OHV
DQDO\VHVG¶XQGRPDLQHFRPPHVRXUFHG¶LQQRYDWLRQGDQVOHGpYHOoppement de solutions informatiques
adaptées. Le RUP est un processus de référence de ce type.
Parallèlement, des expériences antérieures ont montré que la démarche de conception peut
également être initiée par une opportunité au niveau technolRJLTXH &¶HVW VRXYHQW OH FDV GDQV OH
GRPDLQHGHV,+0DYHFOHGpYHORSSHPHQWGHQRXYHDX[PRGHVG¶LQWHUDFWLRQTXLRXYUHQWOHFKDPSGHV
SRVVLEOHVHQWHUPHVG¶XVDJHSDUH[HPSOHO¶LQWHUIDFHJHVWXHOOH© Kinect »). Cependant, ces moyens ne
sont que rarement utilisés pour répondre à de réels besoins. Mal exploités, ils ne génèrent alors rien
au-GHOj GH O¶HQJRXHPHQW LQLWLDO TXH O¶RQ FRQIqUH j O¶LQQRYDWLRQ technologique. Avec la méthode
proposée dans cette thèse, nous voulons favoriser ce « push technologique », en identifiant les
SUDWLTXHV VXVFHSWLEOHV G¶rWUH RXWLOOpHV HW DPpOLRUpHV SDU les technologies. Dans un deuxième temps
nous pourrons voir comment les dites technologies, guidées par ces pratiques, pourront offrir des
services adaptés.
Cette double approche caractérise les démarches SOA (Architecture Orientée Services). Comme
le dit (Idoughi & Kolski 2009) citant (Avignon et al. 2002), « une démarche SOA peut être motivée et
SLORWpHSDUOHVPpWLHUVTXLLPSRVHQWjO¶LQIRUPDWLTXHRXDXV\VWqPHG¶LQIRUPDWLRQG¶XQHRUJDQLVDWLRQ
G¶pYROXHU VXLWH DX[ FKDQJHPHQWV LQFHVVDQWV HW IUpTXHQWV GHV EHVRLQV PpWLHUV (OOH SHXW DXVVL rWUH
SLORWpH SDU OHV WHFKQRORJLHV R LO V¶DJLW G¶RIIULU GHV RSSRUWXQLWpV DX[ GLIIpUHQWV PpWLHUV j WUDYHUV
O¶pPHUJHQFH GH QRXYHDX[ EHVRLQV VXLWH j O¶pYROXWLRQ GH O¶RIIUH WHFKQRORJLTXH ,QWHUQHW WpOpSKRQLH
PRELOH« ».
)UDQFKLUO¶pFDUWHQWUHOHVGRPDLQHV
Notre positionnement par rapport aux approches SOA favorisant à la fois le « push métier » et le
« push technologique » nous permet de créer un lien entre le métier et la technologie. Les concepts de
pratique et d¶XVDJH supportent ces deux dimensions. ,OV V¶LQVFULvent ainsi dans une méthode de
conception de services collaboratifs qui devrait permettre de pallier à « O¶pFKHF GH OD VROXWLRQ
collecticiel global », non pas seulement par des grands principes, mais bien par une démarche
scientifique de conception.
Cette méthode que nous nommons « PUSH » (pour « Practice and Usage based Service
enHancement », traduit en français par « amélioration des services sur la base des pratiques et
usages »), supporte la collaboration entre les experts du domaine AIC et les experts du génie logiciel
(Santos et al. 2012). Dans la section suivante, nous nous interrogeons VXU O¶LQWHUYHQWLRQ GH FHV
GLIIpUHQWV DFWHXUV G¶XQ SURMHW GH GpYHORSSHPHQW GH VHUYLFHV HQ IRQFWLRQ GH OHXU activité. Nous
présentons le support documentaire de cette collaboration OHFDKLHUG¶H[LJHQFHV.
148 Chapitre 8 ± Introduction de la proposition |
Figure 84. Représentation abstraite de la méthode PUSH
1.25.2 Le cahier « FDKLHUG¶H[LJHQFHV »
'¶DSUqV(Paetsch et al. 2003), « XQERQGRFXPHQWG¶H[LJHQFHVHVWQRQ-ambigu, complet, correct,
consistant, concis et réalisable. En fonction de la relation entre le client et le fournisseur, la
spécification des exigences peut être contractuelle ».
Le « FDKLHUG¶H[LJHQFHV pour la conception et spécification de services ICT adaptés » a été créé
pour y consigner les modèles et donc OHVGLIIpUHQWVSRLQWVGHYXHH[SULPpVDXFRXUVGHO¶DSSOLFDWLRQ
de la méthode PUSH. Il est composé de deux documents distincts OHPRGHG¶HPSORLHWOHIRUPXODLUH
de définition des exigences30/HPRGHG¶HPSORLGRQQHOHVpOpPHQWVQpFHVVDLUHVjODFRPSUpKHQVion et
O¶pGLWLRQGXIRUPXODLUH (voir annexes). Il résume notamment la description des concepts détaillée dans
les chapitres suivants. Le formulaire HVWXQGRFXPHQWGRQWO¶pGLWLRQHVWVWUXFWXUpHHWJXLGpH Nous en
avons réalisé le modèle avec les fonctionnalités de développement internes à Microsoft Word
comme :
- la création FKDPSVG¶LQVHUWLRQG¶LPDJHafin G¶LPSRUWHUOHVPRGqOHVJUDSKLTXHV,
- la création de champs de choix multiples et de saisie organisés dans des tableaux pour éditer les
modèles textuels,
- des FKDPSVGHVDLVLHVXSSOpPHQWDLUHVTXLSHUPHWWHQWG¶DMRXWHUGHVFRPPHQWDLUHVHWLQIRUPDWLRQV
additionnelles.
La première page comprend le titre donné au service à développer, les acteurs impliqués dans la
conception de ce service (selon leur rôle parmi O¶utilisateur O¶DQDO\VWH PpWLHU concepteur et le
développeur), et un suivi des versions (avec numérotation, date, et description des changements).
Le plan du formulaire suit ensuite la trame de notre approche, comprenant ainsi une partie 1 :
« pratiques métier », une partie 2 : « usages » et une partie 3 : « spécification du service ». Chacun des
30
>ĞĨŽƌŵƵůĂŝƌĞĞƚůĞƐŵŽĚğůĞƐƋƵ͛ŝůĐŽŵƉƌĞŶĚƐŽŶƚĞŶĂŶŐůĂŝƐĂĨŝŶĚ͛ġƚƌĞƉůƵƐĨĂĐŝůĞŵĞŶƚƉƵďůŝĠƐ͘>ĞŵŽĚĞ
Ě͛ĞŵƉůŽŝĞƐƚĐĞƉĞŶĚĂŶƚĞŶĨƌĂŶĕĂŝƐ͘ | Chapitre 8 ± Introduction de la proposition
149 chapitres suivants détaillant ces trois concepts et leur modélisation, se terminera par une section
LOOXVWUDQWO¶LQVHUWLRQGHVPRGqOHVGDQVOHFDKLHUG¶H[LJHQFHV.
Enjeux et utilisation du document
Dans la composition de notre document, nous avons souhaité pallier à deux problèmes (également
reconnus dans (Paetsch et al. 2003)) :
- OD FRQVWLWXWLRQ G¶XQ WHO GRFXPHQW GDQV OHV PpWKRGHV DJLOHV Hst souvent jugée trop compliquée,
voire infaisable,
- les modèles produits sont éphémères et ne « rentrent pas dans la documentation du système ».
/HFDKLHUG¶H[LJHQFHV que nous proposons se veut simple à lire et à éditer de par la présentation
G¶LQIRUPDWLRQ VRXV IRUPH JUDSKLTXH HW VWUXFWXUpH dans un format de document court (environ 10
pages). Ce document a été pensé comme une source G¶LQIRUPDWLRQV TXL DOLPHQWH les travaux de
développement lors de la proposition de services adaptés au contexte métier. Il doit permettre
également la justification de ces développements à posteriori. Les enjeux de ce document sont le
transfert (vers les développeurs) et la traçabilité des choix.
-
-
Il est destiné :
Aux analystes métier pour consigner les modèles des pratiques étudiées auprès des futurs
utilisateurs/¶pTXLSHDFWXHOOHRXXQHIXWXUH) de développement V¶\UpIpUHUDHQFDVGHGRXWHVXU
les « origines métier » des développements.
Aux concepteurs en collaboration avec les analystes pour consigner les modèles des usages
imaginés et à outiller. Les développeurs étudieront les choix formalisés pour proposer une
solution qui corresponde,FLHQFRUHO¶pTXLSH(actuelle ou une future) de développement SRXUUDV¶\
référer en cas de doute sur les choix de développements.
$X[GpYHORSSHXUVDYHFOHVFRQFHSWHXUVSRXUVSpFLILHUHWFRQVLJQHUOHVPRGqOHVGHO¶DUFKLWHFWXUH
GXVHUYLFHSURSRVp&HWWHIRUPDOLVDWLRQV¶DYqUHUDWUqVXWLOHSRXUODSpUHQQLVDWLRQGXVHUYLFHHQFDV
GHFKDQJHPHQWG¶pTXLSHGHGpYHORSSHPHQW
Figure 85. *pQpUDWLRQGXFDKLHUG¶H[LJHQFHV à partir des modèles créés
150 Chapitre 8 ± Introduction de la proposition |
1.26
Conclusion
Nous proposons une méthode pour concevoir de services informatiques adaptés aux pratiques
PpWLHUVG¶XQ projet de conception/construction architecturale. Elle est basée sur la description de trois
concepts :
- les pratiques métiers identifiées F¶HVWFHTX¶RQDSSHOOHOHSRLQWGHYXHRUJDQLVDWLRQQHOGRQWHVW
UHVSRQVDEOHO¶H[SHUWPpWLHU
- les usages associés choisis F¶HVWOHSRLQWGHYXHRSpUDWLRQQHOH[SULPppar le concepteur,
- les services à spécifier F¶HVWOHSRLQWGHYXHIRQFWLRQQHODWWULEXpDX[GpYHORSSHXUV
,O V¶DJLW GH WLUHU SURILW GX FRQWH[WH DFDGpPLTXH HW SURIHVVLRQQHO GH FHWWH pWXGH SRXU définir ces
concepts, puis de fournir les outils pour les décrire. Ces descriptions sont conformes à un métamodèle : le Méta-Modèle des Services Adaptés (MMSA). Elles sont consignées dans un cahier
G¶H[LJHQFHVTXLDVVXUHOH VXLYLGXSURFHVVXVHWODWUDoDELOLWpGHV FKRL[SHQGDQWHWDSUqVOH SURMHWGH
développement.
Les chapitres suivants (Chapitres 9, 10 et 11) détaillent chacun des trois points de vue, les
concepts associés, leur méta-modèle et leur description selon des formalismes adaptés.
| Chapitre 8 ± Introduction de la proposition
151 Chapitre 9 ± La modélisation des
pratiques : le point de vue
organisationnel
Ce chapitre est composé de trois sections. La première présente le concept de pratique, tel que
nous le définissons pour représenter les comportements de professionnels dans leur contexte de
travail collaboratif et REVHUYpV ORUV G¶XQH DQDO\VH PpWLHU /D caractérisation de ces pratiques est
OLpH DX GRPDLQH $,& TXL HVW OH GRPDLQH G¶DSSOLFDWLRQ GH FHWWH pWXGH La deuxième section
présente la construction du « méta-modèle des pratiques métier » (MMPM) qui supporte cette
caractérisation par différents concepts. Le formalisme utilisé pour le MMPM est le diagramme de
classes UML. La troisième section montre ensuite comment ce méta-modèle permet la
modélisation des pratiques métiers, notamment grâce à un éditeur dédié. Elle conclut ce chapitre
SDU O¶LQWpJUDWLRQ GH FH PRGqOH GDQV XQ FDKLHU G¶H[LJHQFHs. Le framework pour la génération de
O¶pGLWHXUà partir du MMPM HWODQDWXUHGXFDKLHUG¶H[LJHQFHV ont tous deux été introduits dans le
chapitre précédent.
1.27
Définitions et concepts
1.27.1 Les pratiques XQQRXYHDXGpFRXSDJHGHO¶DFWLYLWpGHSURMHW
Au cours du 0 (voir 1.1.3QRXVDYRQVGpFRPSRVpO¶DFWLYLWpGHSURMHW dans le domaine AIC en
phases et sous-phases (Figure 86).
Figure 86. Découpage en phases et sous-SKDVHVG¶XQSURMHW$,C
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
153 &HSHQGDQW OH SDVVDJH G¶XQH SKDVH j XQH DXWUH UHVWH IORX LO HVW G¶DLOOHXUV VRXYHQW DGPLV
TX¶HOOHVVHFKHYDXFKHQWOHGpEXWG¶XQHSKDVHQHPDUTXDQWSDVWRXWjIDLt la fin de la précédente.
'HSOXVPrPHVLO¶RQFRQQDLWOHVREMHFWLIVJpQpUDX[UHODWLIVjFKDTXHSKDVHLOHVWGLIILFLOHGHVH
représenter le déroulement exact de celles-ci, la combinaison des tâches étant particulière à
chaque opération. Comme on peut le lire dans (Bignon et al. 2009), « la lisibilité des processus en
FRXUV Q¶HVW SDV DLVpH HW HOOH HVW SHX SDUWDJpH ; la traçabilité des évolutions du projet et des
décisions est difficile OHVIOX[G¶LQIRUPDWLRQVVRQWVRXYHQWLQWHUURPSXV« ».
Pour pallier à ces limites dans la compréhension des processus métiers, nous nous orientons
vers un nouveau découpage des processus de projet AICG¶DERUGassez générique, puis en opérant
plusieurs raffinementsDILQG¶DSSUpKHQGHUOHVVSpFLILFLWpVHWYDULDELOLWpV du processus de chaque
projet. Nous cherchons alors à :
- H[SULPHUGHVREMHFWLIVSUpFLVUHODWLIVjGHVDFWHXUVSDUWLFXOLHUVHWSRXYDQWYDULHUG¶XQSURMHWj
un autre,
- H[SULPHU GHV IOX[ G¶LQIRUPDWLRQ TXL FRQFHUQHQW SOXVLHXUV SKDVHV YRLUH TXL SHXYHQW rWUH
interrompus et repris au cours du projet.
Dans notre étude, et pour cette dimension « métier », nous adoptons le terme de « pratique ».
Nous essayons à travers ce concept de pratique de prendre de la distance par rapport aux
descriptions de processus trop « figés », cherchant à décrire le caractère par nature flexible de
O¶DFWLYLWp GH SURMHW $,C. Nous retrouvons G¶DLOOHXUV ce concept dans plusieurs études que nous
évoquons ci-dessous.
Pratique : définition
Nous avons introduit ce concept en quelques lignes dans le chapitre 3 de ce mémoire. La
SUDWLTXHSHXWrWUHOLWWpUDOHPHQWGpILQLHFRPPHO¶H[HUFLFHG¶XQPpWLHUXQHPDQLqUHGHWUDYDLOOHU
un comportement habituel avec une finalité. (Q G¶DXWUHV WHUPHV F¶HVW XQ comportement adopté
par une plusieurs personnes dans le but G¶DWWHLQGUH XQ REMHFWLI PpWLHU. '¶DSUqV (Schmidt &
Wagner 2004), le travail coopératif dans un projet AIC ne peut pas être défini comme un
processus complet car les acteurs agissent de manière « hautement distribuée à travers de
nombreuses pratiques et artefacts ».
Pour (Marjanovic et al. 2007) les outils de TCAO sont souvent « conçus pour supporter des
WkFKHV LQGLYLGXHOOHV VDQV OHV SODFHU GDQV OH FRQWH[WH G¶XQ SURFHVVXV ILJp ». Les auteurs ajoutent
que « le champ du TCAO considère des activités hors des limites organisationnelles formelles,
gouvernées par des règles et politiques ». Ils introduisent les « processus métiers orientés
pratiques ª TX¶LOV GLVWLQJXHQW GHV © processus orientés procédures ». Les pratiques sont, dans le
domaine de « la gestion des connaissances » (knowledge management), relatives à une
FRQQDLVVDQFH WDFLWH DORUV TXH OHV SURFpGXUHV UHOqYHQW G¶XQH FRQQDLVVDQFH H[SOLFLWH /HV
processus orientés pratiques servent à modéliser « la coordination au travers de tâches à bas
niveau de granularité », dépendantes des décisions humaines et peu prédictibles. Ces « tâches » se
distinguent donc des tâches des processus métiers classiques (orientés procédure) car elles
pPHUJHQW DYHF O¶H[pFXWLRQ GX SURFHVVXV 1RXV UHWLHQGURQV pJDOHPHQW GH FHWWH pWXde le rôle
particulier de « O¶H[SHUWPpWLHU » qui analyse ces processus et est à même de les comprendre et les
formaliser.
154 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
'¶DXWUHVFRQFHSWVVLPLODLUHVVRQWWUDLWpVGDQVODOLWWpUDWXUH3DUH[HPSOHOHV© mécanismes de
coordination » (Schmidt & Simone 1996) sont des « protocoles qui déterminent et médiatisent la
FRRUGLQDWLRQ G¶DFWLYLWpV GLVWULEXpHV DILQ GH UpGXLUH OD FRPSOH[LWp GX WUDYDLO » (Tellioglu 2006).
Dans (Sandkuhl 2010), les « SDWURQVG¶LQIRUPDWLRQ » (Information Supply Pattern) ont pour but de
« capturer la connaissance sur des solutions prouvées pour en faciliter la réutilisation ». De tels
patrons concernent « GHV SUREOqPHV G¶LQIRUPDWLRQV UpFXUUHQWV TXL VXUYLHQQHQW SRXU GHV U{OHV HW
dans des situations spécifiques et présentent des solutions conceptuelles à ces problèmes ». Ils
sont définis par un nom, un contexte organisationnel, un problème, une solution conceptuelle, les
HIIHWVGHFHWWHVROXWLRQHWHQILQOHVDFWLRQVOLpHVjO¶LQIRUPDWLRQSURGXLWH
(Bourguin & Derycke 2005) relèvent la nécessité de « transformer, adapter les pratiques et les
PpWKRGHV GH WUDYDLO SRXU VDWLVIDLUH OHV EHVRLQV pYROXWLIV GH O¶RUJDQLVDWLRQ ». Nous retrouvons
également ici le caractère flexible souligné précédemment. Ils font émerger les apports de la
7KpRULH GH O¶$FWLvité (TA) pour la caractérisation des pratiques, caractérisation que nous
adopterons.
Rappelons que la TA décrit une structure hiérarchique composée de 3 niveaux O¶DFWLYLWp
O¶DFWLRQ HW O¶RSpUDWLRQ &RQVLGpUDQW OH SURMHW HW VHV SKDVHV FRPPH XQH DFWLYLWp structurée, nous
pouvons définir les pratiques comme des actions, « individuelles ou collectives, mais toujours
dirigées vers un but conscient » (Bourguin & Derycke 2005). Une action est en effet définie
FRPPH IRUWHPHQW GpSHQGDQWH GH O¶DFWLYLWp GH ODTXHOOH elle découle (N.B. elle peut découler de
plusieurs activités). Elle est planLILpHHQIRQFWLRQG¶XQREMHFWLIHW G¶XQHILQDOLWp(QILQHOOHJpQqUH
de la connaissance.
Tableau 11. Notre approche par rapport aux concepts de OD7KpRULHGHO¶$FWLYLWp
Pour comprendre la nature de ces pratiques dans un projet AIC nous en faisons une première
description générale répartie en 11 familles de pratiques.
1.27.2 Les familles de pratiques (ou pratiques collectives génériques)
Le domaine des projets de conception/construction AIC a pris ces dernières années un
WRXUQDQWLPSRUWDQWIDLVDQWO¶REMHWGHnombreuses évolutions. Parmi celles-ci, iOIDXWWRXWG¶DERUG
prendre en compte le contexte économique, sans cesse plus contraignant. La performance
environnementale est également devenue une dimension essentielle et complexe, poussant les
concepteurs mais aussi les techniciens à innover, à se renouveler dans leurs pratiques. Enfin, il
IDXWV¶DVVXUHUTXHODTXDOLWpDUFKLWHFWXUDOHGXEkWLPHQWQ¶HQSkWLVVHSDV
$ILQ G¶DXJPHQWHU OD SHUIRUPDQFH HQYLronnementale des bâtiments construits (et rénovés)
PDLV DXVVL DILQ G¶pYDluer ces performances, des institutions proposent des guides et référentiels
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
155 destinés aux professionnels du secteur. Leur analyse QRXV D SHUPLV G¶LGHQWLILHU HW GpILQLU objectifs principaux à atteindre. Les référentiels analysés sont31 : HQE (France), BREEAM
(Royaume-Uni), MINERGIE (Suisse) et DGNB (Allemagne). Ce dernier, le référentiel allemand
DGNB, est le plus précis et le plus complet. De la revue des ces référentiels environnementaux,
nous avons identifié les cinq objectifs suivants (Zignale, Sylvain Kubicki & Gilles Halin 2011) :
- Assurer la qualité du bâtiment : cela inclut les choix conceptuels et les choix techniques. La
TXDOLWpDUFKLWHFWXUDOHFRPPHO¶DJHQFHPHQWGHVHVSDFHVOes relations intérieur/extérieur, etc.)
est également importante. Cet objectif concerne la fiabilité structurelle ou encore la qualité
des ouvrages dans le temps. Il comprend aussi des exigences plus spécifiques comme un
LPSDFW OLPLWp VXU O¶HQYLURQQHPHQW SDr la réduction des consommations énergétiques, par
O¶XWLOLVDWLRQGHPDWpULDX[pFRORJLTXHV«
- Assurer le confort des habitants : les choix conceptuels et techniques sont également
questionnés au regard du confort thermique, acoustique et visuel. Le confort est aussi relatif
DX[DVSHFWVG¶DFFHVVLELOLWpHWGHVpFXULWp
- Assurer le rendement économique : les acteurs et particulièrement les concepteurs doivent
contrôler le budget du projet en maitrisant les coûts TX¶LPSOLTXHQWOHXUVFKRL[. Ils chercheront
aussi à rendre le bâtiment construit plus rentable dans le temps, en assurant sa flexibilité et
son adaptabilité à plusieurs usages (surtout pour les bâtiments publics).
- Assurer la qualité du site HQDFFRUGDQWGHO¶LPSRUWDQFHjVDORFDOLVDWLRQHWDX[GLYHUVULVTXes
OLpVjODTXDOLWpGHO¶HQYLURQQHPHQWjO¶DFFqVDX[WUDQVSRUWVDX[VHUYLFHVHWLQIUDVWUXFWXUHV
SUpVHQWHV«
- Assurer la qualité socioculturelle du projet en mesurant et en prenant en compte son impact
sur la population environnante, sur les administratioQV«SDUWLFXOLqUHPHQWSRXUOHVSURMHWVGH
grande envergure ou à caractère exceptionnel).
Nous avons cherché à identifier les pratiques généralement mises en place pour atteindre ces
cinq objectifs DX FRXUV G¶XQ SURMHW &H WUDYDLO V¶HVW GpURXOpVXU OD EDVH de deux brainstormings
avec respectivement 3 et 2 architectes. Pour chaque objectif il était question de recueillir leurs
expériences, habitudes et anecdotes. Nous avons synthétisé ces informations en 11 familles de
pratiques distinctes.
La description qui suit comprend, pour chaque famille de pratique, un texte explicatif
décrivant son déroulement puis un tableau comprenant un résumé des rôles impliqués, des
GRFXPHQWV XWLOLVpV HW GHV DFWLYLWpV SKDVHV HW WkFKHV GDQV OHVTXHOOHV OD SUDWLTXH V¶LQVFULW 1Rus
nous sommes inspiré GH O¶RXYUDJH © 140 séquences pour mener une opération de construction :
des études préalables à l'achèvement de l'ouvrage, actions techniques et démarches
administratives » (Armand 1997) pour mener cette synthèse.
PC1 : choix et évaluation du site
Description : le Maître G¶RXYUDJH (MO) définit la nature de l'ouvrage et justifie le choix du
terrain de par O¶LPSDFWSK\VLTXHHWVRFLDOTX¶DXUDO¶RXYUDJH, mais aussi en analysant le contexte
XUEDLQ pTXLSHPHQWV VHUYLFHV« ,O s'interroge également sur les équipements complémentaires
nécessaires. /H VLWH GRLW IDLUH O¶REMHW GH SOXVLHXUV DQDO\VHV GH OD SDUW GX 0DvWUH G¶2XYUDJH
QXLVDQFHV ULVTXHV G¶LQRQGDWLRQ SRVVLELOLWpV G¶DOLPHQWDWLRQ HW G¶pYDFXDWLRQ QDWXUH GX VRO
DFFqV«TXLVHGpURXlent avant et pendant les premières phases de la conception. Il est également
nécessaire de recueillir auprès des services adéquats (mairie ou administration communale,
31
http://assohqe.org/hqe/; http://www.breeam.org/; http://www.minergie.com/home_en.html; http://www.dgnb.de/_en/ 156 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
services techniques, opérateur de téléphonie, IRXUQLVVHXUV G¶pOHFWULFLWp GH JD] Fompagnie des
HDX[«l'ensemble des renseignements concernant la viabilité du terrain, et notamment les accès
possibles et les différents réseaux d'alimentation et d'évacuation.
Tableau 12. Éléments de caractérisation de la PC1
Acteurs impliqués
Maître G¶RXYUDJH
Maître G¶°XYUH
Ingénieurs
JpRORJXHV«
Administration
(commune)
Documents utilisés
Plans APS
Plan LRFDOG¶Urbanisme
5DSSRUWVG¶pWXGHV
Activités
7kFKHVG¶H[SHUWLVHHW
coordination
Phase Montage (études
préalables)
Phase Conception (APS)
PC2 : choix de la maîtrise G¶°XYUH
Description : lHPDvWUHG¶RXYUDJHHQJDJHOD0DvWULVHG¶°XYUHTXLGHYUDFRQFHYRLUO¶RXYUDJH
Dans le cas de projets de grande envergure, la consultation passe par les phases d'un appel
d'offres : appel public, dossier de consultation (clauses de l'engagement, du CCAP, CCTP),
critères de choix sur les compétences, choix et notifications des marchés. Chaque titulaire de
marché renseignera les buts et performances à atteindre, les techniques de base à utiliser, les
moyens en personnel et matériel à mettrH HQ °XYUH OH QLYHDX GX SUL[ GHV SUHVWDWLRQV XQ
GpFRXSDJH HQ SKDVH /H PDvWUH G¶RXYUDJH SHXW DLQVL pYDOXHU OHXU FDSDFLWp j PHQHU j ELHQ VRQ
projet dans des conditions et avec des performances optimales.
Tableau 13. Éléments de caractérisation de la PC2
Acteurs impliqués
Maître G¶RXYUDJH
Maître G¶°XYUH
Documents utilisés
Dossier de consultation
Plans APS
Documents administratifs
et contractuels
Activités
Tâches conception et
coordination
3KDVHG¶pWXGHVSUpDODEOHV
Phase Conception APS (si
DSSHOG¶offres)
PC3 : détermination des objectifs
Description : il appartient au Maître de l'ouvrage de définir le programme de l'opération. Il
définit le processus de construction qui comprend des éléments quantifiables et techniques ainsi
que des éléments fonctionnels, qualitatifs HWpYROXWLIV/¶DVVLVWDQFHjODMaîtrise G¶RXYUDJHDSRXU
U{OHGHO¶DVVLVWHUGDQVFHWWHWkFKH6¶LOYHXWSUpWHQGUHjO¶DWWULEXWLRQG¶XQODEHOHQYLURQQHPHQWDOLO
peut se référer à des experts du domaine. Il fixe ainsi les objectifs avec lesquels devra travailler la
Maîtrise G¶°XYUHORUVGH ODFRQFHSWLRQGHO¶RXYUDge. Lors de petits SURMHWVOH0DvWUHG¶RXYUDJH
SHXW Q¶DYRLU TXH WUqV SHX G¶LQIRUPDWLRQV j GRQQHU F¶HVW OH Maître G¶°XYUH TXL IL[H DORUV FHV
objectifs.
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
157 Tableau 14. Éléments de caractérisation de la PC3
Acteurs impliqués
Maître G¶RXYUDJH
Assistance à la MO
Maître G¶°XYUH
Experts
Documents utilisés
Programme
Informations et directives
techniques
Activités
Tâches conception et
coordination
3KDVHG¶pWXGHVSUpDODEOHV
Phase Conception APS (si
DSSHOG¶offres)
PC4 : détermination et gestion du budget
Description : le Maître G¶RXYUDJH DUUrWH O¶HQYHORSSH ILQDQFLqUH ORUV GX SURJUDPPH /HV
documents financiers du projet, depuis la proposition de prix jusqu'au solde de tout compte,
constituent l'une des composantes majeures du marché entre le MO et les organismes engagés.
Les documents élaborés au cours du projet (plans, descriptifs, avant-métré) qui serviront à la
consultation des entreprises permettent d'établir un coût prévisionnel des travaux par corps d'état
(ou par lot). Il y a une demande très forte auprès des économistes de la construction qui sont
FDSDEOHV GH IDLUH OH SRQW HQWUH OHV EXUHDX[ G¶études et les entreprises. Sa tâche est de définir
O¶HQYHORSSH ILQDQFLqUH G¶XQ SURMHW HQ PDvWULVDQW OHV DVSHFWV PDWpULDX[ et énergie dans une
construction tout en respectant les règles imposées.
Tableau 15. Éléments de caractérisation de la PC4
Acteurs impliqués
0DvWUHG¶RXYUDJH et
assistants
0DvWUHG¶RHXYUH
Comptable, économiste
Tout contractant
Documents utilisés
Enveloppe et documents
financiers
Plans et descriptifs liés à la
conception
Activités
Tâches de coordination
Toutes phases
PC5 : conception et compte-rendu de la conception
Description : l'esquisse constitue la première étape de la réponse architecturale et technique
au prRJUDPPH&¶HVWODIRUPDOLVDWLRQ graphique des premiers choix du concepteur. Elle instaure
un dialogue entre Maître d'ouvrage et Maître G
°XYUH /H FRQFHSWHXU H[WUDLW GX SURJUDPPH OHV
éléments nécessaires et les formalise en aide-mémoires, organigrammes de services, ou
fonctions... Les principaux éléments à retenir sont les objectifs du Maître d'ouvrage, les
considérations touchant à l'intégration de l'ouvrage dans son environnement et à l'organisation
spatiale. L'organisation générale des volumes doit être affinée en fonction du programme du
0DvWUHG¶RXYUDJH. Le choix de la structure doit se faire par la collaboration du 0DvWUHG¶°XYUHHW
de l'ingénieur structure, avec l'accord final du contrôleur technique. Cette phase comprend aussi
les choix relatifs au confort thermique et acoustique. Une notice descriptive résume les
principaux choix effectués, ainsi que les principales options retenues. C'est sur la base de ces
descriptifs, en complément des plans de l'avant-projet détaillé (APD), et après accord du Maître
G¶RXYUDJH, que les cahiers des clauses techniques particulières (CCTP) seront rédigés. La
demande de permis de construire se fait auprès de la mairie. Le MOE doit assistance au MO
durant toute la durée de l'instruction du permis de construire.
158 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
Tableau 16. Éléments de caractérisation de la PC5
Acteurs impliqués
0DvWUHG¶°XYUH
Ingénieurs
Contrôleur technique
Maître G¶RXYUDJH et
assistants
Documents utilisés
Programme
Plans de conception,
PRGqOHV'«
Documents techniques
Documents administratifs
Activités
Tâches de conception et
de coordination
Phase conception (de
O¶HVTXLVVHjO¶HQYRLGHV
documents pour
exécution)
PC6 : Choix des entreprises de construction
Description : Le dossier de consultation est remis aux entreprises par le Maître G
°XYUHDILQ
TX¶HOOHVSXLVVHnt établir leurs offreVHQYXHGHO¶DWWULEXWLRQGHVPDUFKpV. Il contient les cahiers des
clauses administratives et techniques particulières (le CCAP et le CCTP), les dossiers des plans
d'architecture et techniques, les pièces financières et éventuellement le rapport de sol, les plans
parcellaires, les plans des réseaux, les notes de calculs etc. Les entreprises soumettent alors leur
dossier lors de l'appel de candidature de l'appel d'offres. Les documents nécessaires à la
consultation étant établis, il reste à organiser la remise par le MDvWUHG¶°XYUH de ces documents et
à en assurer la diffusion auprès des entrepreneurs. Après avoir établi le dossier des pièces qui lui
sont nécessaires pour faire acte de candidature, l'entrepreneur doit transmettre son ofIUH4X¶LOVRLW
HQJDJp GLUHFWHPHQW RX j OD VXLWH G¶XQ DSSHO G¶RIIUHV O
HQWUHSUHQHXU UHWHQX GRLW rWUH UHFRQQX
comme compétent pour réaliser l'ouvrage ou un lot de l'opération. Il devra satisfaire à certains
critères vérifiables tels que le prix des services fournis ou les qualifications (obtenues par des
formations reconnues). Il pourra également fournir des garanties supplémentaires quant à la
qualité et la fiabilité de l'entreprise, au travers par exemple de la qualité des prestations antérieures
ou des rHFRPPDQGDWLRQVG¶DXWUHVSURIHVVLRQQHOV.
Tableau 17. Éléments de caractérisation de la PC6
Acteurs impliqués
Maître G¶°XYUH
Entreprises
Maître G¶RXYUDJH et
assistants
Documents utilisés
Plans divers
Documents administratifs
Pièces financières
Activités
Tâche de coordination
Phase conception (à partir de
la réalisation de plans
communicables)
PC7 : évaluation de la conception et compte-rendu
Description : lRUV GHV GHUQLqUHV SKDVHV GH OD FRQFHSWLRQ LO HVW QpFHVVDLUH G¶HQ pYDOXHU
certains critères comme ceux relatifs j OD VDQWp OD VpFXULWp O¶K\JLqQH O¶DFFHVVLELOLWp« HW GHV
spécialistes de chaque domaine sont impliqués pour mener leur évaluation. Dans des cas
SDUWLFXOLHUV GRQW OHV SURMHWV G¶DUFKLWHFWXUH HQYLURQQHPHQWDOH ou durable, les experts évaluent
également les performances énergétiques, acoustiques ou OXPLQHXVHVGHO¶RXYUDJH(QIRQFWLRQGH
la nature du projet et des objectifs fixés au début de son cycle de vie, les résultats de ces
évaluations conditionnent les choix définitifs ainsi que O¶H[pFXWLRQGXSURMHW
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
159 Tableau 18. Éléments de caractérisation de la PC7
Acteurs impliqués
Maître G¶°XYUH
Experts
Maître G¶RXYUDJH et
assistants
Documents utilisés
3ODQVG¶H[pFXWLRQ
Modèles 3D
Documents techniques
5DSSRUWVG¶H[SHUWLVHV
Activités
7kFKHVG¶pYDOXDWLRQHWGH
coordination
Phase conception (avant
exécution)
PC8 : organisation de réunions et compte-rendu
Description : pendant le montage et la conception, un certain nombre de rencontres sont
organisées HQWUH OH PDvWUH G¶RXYUDJH OH maître G¶°XYUH PDLV DXVVL OHV H[SHUWV OH SHUVRnnel
DGPLQLVWUDWLI OHV pOXV« /D SHUVRQQH TXL WLHQW OH U{OH GH FRRUGLQDWHXU RUJDQLVH FHV UpXQLRQV HW
formalise un rapport qui contiendra tous les éléments importants évoqués (ordre du jour, objectifs,
avancement depuis la dernière réunion, décisions« /RUs du chantier et de sa préparation, le
coordinateur doit organiser, en concertation avec les entreprises, un ensemble de réunions de
coordination technique. Le responsable est celui qui est défini comme animateur de la réunion. On
devra toujours y trouver une des personnes suivantes : le mDvWUHG¶°XYUH, le coordinateur désigné
pour cette mission, l'entrepreneur titulaire d'un marché unique, le mandataire ou entrepreneur
général. Avant une réunion de chantier, il est souhaitable que le MOE (éventuellement en
compagnie du coordinateur) effectue une visite de chantier, même rapide, afin de visualiser
l'avancement du chantier, de noter les travaux défectueux ou non conformes, de déceler les
difficultés qui risquent de resurgir, afin de conduire la réunion avec un maximum d'efficacité. En
cas de contentieux le compte-rendu de chantier constituera toujours une pièce importante
d'expertise.
Tableau 19. Éléments de caractérisation de la PC8
Acteurs impliqués
Maître G¶°XYUH
Experts
Maître G¶RXYUDJH et
assistants
Entreprises
Documents utilisés
Tout document servant
de base à la discussion
CR de réunion
Activités
7kFKHVG¶pYDOXDWLRQHWGH
coordination
Toutes phases (plus
formelles et structurée
pendant le chantier)
PC9 : préparation et gestion du chantier
Description : l¶RUJDQLVDWLRQ GX FKDQWLHU GRLW SUHQGUH HQ FRPSWH OD PLVH HQ SODFH G¶XQ
planning dans lequel seront réparties toutes les interventions de construction. Ce planning pourra
HWGHYUDrWUHDMXVWpHQFDVGHFKDQJHPHQWVGHUHWDUGV«&HODLPSOLTXHpJDOHPHQWODOLYUDLVRQHWle
stockage des matériaux, la mise en place et la gestion des engins, la gestion de la sécurité. Les
HQWUHSULVHV TXL LQWHUYLHQQHQW VRQW FKDUJpHV G¶H[pFXWHU OHXUV WkFKHV GDQV OHV délais impartis en
respectant O¶RUGRQQDQFHPHQW GpFULW GDQV le planning &¶HVW OH FRRUGLQDWHXU TXL V¶DVVXUH GX ERQ
déroulement du chantier et prend note des problèmes rencontrés /H PDvWUH G¶°XYUH VH GRLW GH
prendre en compte les remarques des exécutants en cas de modifications à apporter aux plans
G¶H[pFXWLRQ Beaucoup G¶ajustements sur chantier sont informels : ces modifications de petite
160 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
envergure ne sont pas consignées dans les plans ou les comptes-rendus, mais sont effectuées à
partir de remarques orales. Le Maître G¶RXYUDJHSHXWpJDOHPHQWLQWHUYHQLUHQFDVGHOLWLJHV
Tableau 20. Éléments de caractérisation de la PC9
Acteurs impliqués
Maître G¶°XYUH
Coordinateur
Maître G¶RXYUDJH et
assistants
Entreprises
Documents utilisés
3ODQVG¶H[pFXWLRQ
Documents techniques
Planning
CR de chantier
Activités
Tâches de construction,
dévaluation et de
coordination
Phase chantier
PC10 : éYDOXDWLRQGHO¶H[pFXWLRQHWFRPSWH-rendu
Description : l¶pYDOXDWLRQGXEkWLPHQWHQFRXUVG¶H[pFXWLRQHWMXVWHDYDQWODOLYUDLVRQUHYLHQW
au coordinateur et aux divers experts. Le coordinateur relève les malfaçons en cours de chantier et
les transmet aux entreprises responsables (ils pourront être sujet de discussion lors des réunions de
chantier). Les experts en sécurité et santé vérifient que les normes sont respectées pendant la mise
HQ°XYUH (port du casque, filets de VpFXULWpHWF«HWORUVGHODOLYUDLVRQJDUGH-corps, sorties de
VHFRXUV«. Les experts en thermique ou acoustique effectuent les tests nécessaires pour évaluer
OHVSHUIRUPDQFHVGXEkWLPHQWHQSDUWLFXOLHUHQFDVG¶DWWULEXWLRQG¶XQODEHO/HMaître G¶RXYUage
doit être informé du déroulement et des résultats de chaque intervention.
Tableau 21. Éléments de caractérisation de la PC10
Acteurs impliqués
Maître G¶°XYUH
Coordinateur
Maître G¶RXYUDJH
Entreprises
Experts
Documents utilisés
3ODQVG¶H[pFXWLRQ
Documents techniques
Référentiels, normes
&5G¶H[SHUWLVH
CR de chantier
Activités
Tâches de construction,
G¶pYDOXDWLRQHWGH
coordination
Phase construction
(pendant le chantier et
avant la livraison)
PC11 : implication des usagers
Description : /¶LPSOLFDWLRQGHVXVDJHUVQ¶HVWSDVV\VWpPDWLTXHVXUWRXWORUVTX¶LOVQHVRQWSDV
directement les maîtreVGHO¶RXYUDJH/HFDVOHSOXVW\SLTXHHVWO¶DMXVWHPHQWGHFHUWDLQes décisions
GH FRQFHSWLRQ RX G¶DPpQDJHPHQW SLqFHV PRELOLHU pTXLSHPHQWV«, notamment dans des
opérations de construction à grande échelle (lotissement, logement collectif). En ce qui concerne
OHVEkWLPHQWVSXEOLFVO¶LPSOLFDWLRQGHVIXWXUVXVDJHUVGXUDQWOHSURMHWFRQVLVWHHVVHQWLHOOHPHQWjOD
FRPPXQLFDWLRQ G¶LQIRUPDWLRQV 8QH IRLV OH EkWLPHQW FRQoX HW au regard des préoccupations
environnementales, son usage doit être encadré par un ensemble de « bonnes pratiques » qui
GRLYHQWrWUHWUDQVPLVHVDX[XVDJHUVUpGXFWLRQGHODFRQVRPPDWLRQG¶pQHUJLHJHVWLRQGHVGpFKHWV,
ORJLTXHGDQVO¶XWLOLVDWLRQGHVpTXLSHPHQWVGHFKDuffage/ventilation«
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
161 Tableau 22. Éléments de caractérisation de la PC11
Acteurs impliqués
Maître G¶°XYUH
Maître G¶RXYUDJH
Usagers
Documents utilisés
Posters
Articles
Règles et normes
Documents techniques
Activités
Tâches de coordination
Toutes phases
1.27.3 Enjeux dans O¶LQVWUXPHQWDWLRQGHVSUDWLTXHVPpWLHUVHWDSSURFKHVGH
modélisation
Comme introduit précédemment, O¶REMHFWLIGHFHWWHpWDSHde notre méthode est de concevoir
des services supports aux activités collectives de projet dans le domaine AIC. Ce premier travail
G¶DQDO\VH PpWLHU VXU OHV IDPLOOHV GH SUDWLTXHV QRXV SHUPHW G¶DSSUpKHQGHU GH PDQLqUH JOREDOH
O¶DFWLYLWp GH SURMHW et de la diviser en sous-ensembles compréhensibles. Cependant, pour mener
une analyse métier qui servira de base à la conception de services collaboratifs adaptés, il est
nécessaire d¶DOOHU DX-delà de ces grands principes : il nous faut pouvoir décrire finement les
pratiques observées en situation réelle de projet.
-
Dans notre approche, nous distinguons deux types de pratiques :
les pratiques collectives, relatives aux objectifs G¶XQ JURXSH G¶DFWHXUs (aux minimum deux
acteurs collaborant),
les pratiques individuelles, effectuées individuellement par chacun des acteurs de ce groupe
SRXUDWWHLQGUHO¶REMHFWLILGHQWLILp en commun.
6XU OD EDVH GH O¶analyse des onze familles précédentes, notre démarche scientifique se
poursuit en proposant une conceptualisation de ces pratiques à travers un méta-modèle dont le
SULQFLSHG¶instanciation assurera une description structurée et uniformeG¶XQSURMHWGHFRnception
à un autre WHO TX¶LQWURGXLW GDQV OD GpILQLWLRQ GH QRWUH PpWKRGRORJLH FI 1.24). Les travaux
précédents sur le Méta-Modèle du Contexte Coopératif (MMCC) décrit en 1.1, définissent déjà un
ensemble de concepts servant de base à cette description.
Nous utilisons les diagrammes de classe UML pour modéliser les concepts utiles à la
description de ces pratiques, leurs attributs et les relations sémantiques qui les relient. Le MétaModèle des Pratiques Métier (MMPM) est ainsi construit à partir de deux méta-modèles :
- le Méta-Modèle des Pratiques Collectives (MMPC),
- le Méta-Modèle des Pratiques Individuelles (MMPI).
1.28
Le M éta-M odèle des Pratiques M étier
1.28.1 Les pratiques collectives
Nombreuses sont les SUDWLTXHV FROOHFWLYHV TXL SHXYHQW rWUH LGHQWLILpHV ORUV GH O¶REVHUYDWLRQ
G¶XQ SURMHW Par exemple, la pratique suivante est extraite de la famille 5: « Le choix de la
structure doit se faLUHSDUODFROODERUDWLRQGHO¶DUFKLWHFWH et de l'ingénieur structure, avec l'accord
final du contrôleur technique ». Un nom pour identifier la pratique peut être isolé de cette
description, comme par exemple « choix de structure ».
162 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
Nous pourrions décrire de cette manière toutes les pratiques identifiées. Ainsi, le nom, la
description et la famille seront les attributs permettant de caractériser une pratique collective. La
classe « Pratique collective » dans le diagramme de classes UML suivant (Figure 87) représente
cette caractérisation. La détermination du nom et de la description se fait par saisie de texte alors
que la famille est choisie dans une énumération (voir le paragraphe « la modélisation et ses
outils » en 1.24.1).
,OV¶DJLWHQVXLWHGHGpILQLUOHVDFWHXUVles artefacts et les activités impliqués dans la pratique.
Certaines des possibilités auront peut-être déjà été identifiées dans la description comme par
exemple ici les acteurs : O¶DUFKLWHFWHO¶LQJpQLHXUVWUXFWXUHHWOHFontrôleur technique. Ces concepts
ont été définis au cours des études précédentes du laboratoire MAP-CRAI dans le MMCC (MétaModèle du Contexte Coopératif). Le MMPC que nous proposons a pour but de modéliser
O¶LPSOLFDWLRQGHFHVconcepts dans une pratique collective.
Il faut souligner que les énumérations décrites dans les méta-modèles suivants ne sont pas
toujours exhaustives et pourraient être complétées. À cet effet, un champ « autre » est inclus
FRPPHFKRL[ORUVGHO¶LQVWDQFLDWLRQ,OIDXt DORUVUHQVHLJQHUO¶LQIRUPDWLRQYRXOXHVRXVIRUme de
remarque et compléter si besoin le méta-modèle.
-
-
-
La classe acteur est spécifiée par deux classes O¶DFWHXUVLPSOHHWOHJURXSHG¶DFWHXU
/HW\SHG¶DFWHXUVLPSOH« type_acteur(simple) ») est relatif à son métier. Les choix possibles
sont : architecte, urbaniste, ingénieur structure, ingénieur sécurité, ingénieur santé, chef
G¶HQWUHSULVH, maçon, électricien, comptable, secrétaireDXWUH«
Le type de groupe (« type_acteur(groupe) ») est relatif au statut administratif du groupe
(agenceEXUHDXG¶pWXGHV, entreprise, laboratoire, organisation publique, autre«
Tout acteur (simple ou groupe) joue un rôle dans le prRMHWF¶HVWFHTXLDpWpGpILQL comme le
rôle organisationnel (« type_rôle »). On distingue les rôles suivant : Concepteur,
Dessinateur/Graphiste,
Coordinateur, Maître G¶RXYUDJH &RQVWUXFWHXU Économiste,
Conseiller, Expert, Administration, autre....
/¶DWWULEXWGpQRPLQDWLRQVHUYLUDjDSSRUWHUGHVGLVWLQFWLRQVHQWUHDFWHXUVFRPPHSDUH[HPSOH
entre « le dessinateur des façades » et « le dessinateur des plans ».
6RXVOHFRQFHSWG¶DFWLYLWpRQUHWURXYH :
les tâches de type (« type_activité(tâche) ») conception, construction et coordination,
les phases de type (« type_activité(phase) ») préparation, conception, exécution et livraison,
ainsi
que
la
caractérisation
du
projet
lui-même
par
son
type
(« type_activité(projet) ») :logement individuel, logement collectif ou bâtiment public ainsi
TX¶une éventuelle certification visée (HQE, BREEAM, MINERGIE, DGNB, autres, pas de
certification).
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
163 Figure 87. Méta-Modèle de la pratique collective (MMPC)(concepts
principaux : fond bleu, spécifications :contours bleus, énumérations :
contours verts)
Enfin, nous distinguons trois artefacts pouvant être typés (« type_artefact(document-objetmessage) ») et caractérisés par leur auteur et leur statut :
- Les documents sont les produits physiques ou numériques des tâches de conception et de
coordination (voir 1.1.2). Les « type_artefact(document) » identifiés sont : géométral,
modèle,
perspective,
photo,
compte-rendu/rapport,
exigences,
spécifications,
calendrier/planning, agenda, « ToDo ».
- Les objets sont relatifs aux ouvrages de construction (voir également 1.1.2) et sont définis à
plusieurs échelles. Ainsi, les « type_artefact(objet) » identifiés sont (du plus grand au plus
SHWLWOHVLWHOHORWOHEkWLPHQWOHQLYHDXODSLqFHO¶RXYUDJHODUpVHUYDWLRQOHPDWpULDXHW
O¶pFKDQWLOORQ 2Q \ DMRXWH OH GpIDXW (notion de malfaçon sur un ouvrage) et le véhicule de
chantier.
- /HV PHVVDJHV TX¶LOV VRLHQW IRUPDOLVpV RX SDV VRQW OHV WUDFHV GH WRXWH FRPPXQLFDWLRQ TXL
V¶LQVWDXUHDXFRXUVGHVGLIIpUHQWHVWkFKHVParmi les « type_artefact(message) », on distingue
OHVPHVVDJHVG¶LQIRUPDWLRQFODVVLTXHVG¶DXWUHVW\SHVSOXVVSpFLILTXHV comme les requêtes (qui
impliquent un retour, une réponse), les notifications (pour avertir), les réactions (qui ciblent
quelque chose en particulier) et enfin les validations (qui permettent de donner son
approbation sur quelque chose).
164 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
1RXV Q¶DYRQV SDV W\Sp OHV JURXSHV G¶DUWHIDFW OD QDWXUH SRXYDQW rWUH WUqV YDULpH VHORQ OH
FRQWHQXHQVHPEOHGHVSODQVHQVHPEOHGHVUDSSRUWVSHUPLVGHFRQVWUXLUHFDKLHUGHVFKDUJHV«
/¶DXWHXUG¶XQDUWHIDFW (simple ou groupe) est un acteur du contexte coopératif WHOTXHQRXVO¶DYRQV
défini SUpFpGHPPHQW 1RXV O¶LGHQWLILRQV DORUV SDU VRQ U{OH F¶HVW SRXUTXRL GDQV OH PpWD-modèle
O¶DWWULEXW© type_auteur ªHVWUHOLpjO¶pQXPpUDWLRQ© type-rôle ».
/H VWDWXW G¶XQ DUWHIDFW HVW XQ DWWULEXW LPSRUWDQW GDQV la modélisation des pratiques car il
SHUPHWGHVXLYUHO¶pWDWG¶DYDQFHPHQWGHVWkFKHVTXLOHXU sont liées et donc du projet. Le statut le
plus répandu dans un projet de construction est le statut « bon pour exécution » qui est attribué
aux plans à envoyer sur le chantier pour exécution des travaux. Il est primordial que les plans
« bons pour exécution ªVRLHQWjMRXUHWVDQVHUUHXUDILQG¶DVVXUHUODFRQVWUXFWLELOLWpHWODTXDOLWp
des ouvrages. /D OLVWH GHV VWDWXWV G¶XQ DUWHIDFW W\SHBVWDWXW HVW : en cours, terminé, pour
exécution, exécuté, à valider, validé, à modifier. Un artefact peut avoir plusieurs statuts (ex. un
plan « terminé » et « à valider »).
Conclusion
Cette section présente la méta-modélisation autRXUGXFRQFHSWGHSUDWLTXHHWV¶DSSXLHVXUOHV
concepts métiers du Méta-Modèle du Contexte Coopératif. La section suivante consiste à détailler
la façon dont les acteurs, artefacts et activités sont impliqués autour du concept de pratique
LQGLYLGXHOOHSXLVG¶RSpUDWLRQ
1.28.2 Les pratiques individuelles et les opérations métiers
Les pratiques individuelles (PI) peuvent être définies comme le comportement « isolé » de
chaque acteur impliqué dans une pratique collective. Elles peuvent être propres à un ou plusieurs
rôles mais toujours exécutées de manière indépendante. Celles-ci sont caractérisées par les mêmes
attributs que les PC : un « nom » et une « description ». Une des PI qui composent la PC illustrée
dans la section précédente peut par exemple être décrite ainsi : « le concepteur partage des plans
avec l¶LQJpQLHXUSRXUTX¶LOYpULILHODVWUXFWXUH ». On peut la nommer plus simplement : « partage
des plans ».
Ainsi, le méta-modèle des pratiques individuelles (MMPI, Figure 88) est une évolution du
méta-modèle des pratiques collectives (ne figurent plus les différentes énumérations pour faciliter
la lecture). Comme on peut le voir, les relations « implique » dans le MMPC sont détaillées par
des relations plus spécifiques :
- /¶DFWHXU © exécute » une pratique individuelle (ex. la produFWLRQ GH SODQ G¶H[pFXWLRQ SDU OH
concepteur). Une PI peu aussi « concerner » un ou plusieurs autres acteurs (ex. le partage de
SODQVDYHFO¶HQWUHSULVH
- Une PI « produit » des artefacts ou « manipule » ceux déjà existants.
- Une PI peut « concerner » une activité particulière (F¶HVWjGLUH une tâche dans une phase lors
G¶un projet particulier).
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
165 Figure 88. Méta-modèle de la pratique individuelle (MMPI)
Caractérisation des opérations : finalisation du MMPM
'DQVODWKpRULHGHO¶DFWLYLWp (présentée précédemment au § 1.1.3)O¶RSpUDWLRQest le troisième
niveau, défini DSUqV O¶DFWLYLWp HW O¶DFWLRQ /HV RSpUDWLRQV VRQW OHV PpFDQLVPHV TXL FRPSRVHQW
O¶DFWLRQHWTXLVRQWUpDOLVpVGHPDQLqUe inconsciente. Nous nous servons de ce même concept pour
détailler les pratiques individuelles.
Afin de définir ces opérations, nous avons adopté les sous-prRFHVVXVGHO¶LQIRUPDWLRQGpILQLV
par BO-Christopher Björk (B. C. Björk 1999; B.-C. Björk 2002) et introduit précédemment (au §
1.7.1) : la production, la communication, la diffusion, la récupération. En tant que familles
G¶RSpUDWLRQVFHVTXDWUHVRXV-SURFHVVXVFRXYUHQWO¶HQVHPEOHGHVRSpUDWLRQVDXPrPHWLWUHTXHOHV
onze familles de pratiques collectives pour les besoins métiers. Le méta-modèle des pratiques
métiers (MMPM) est une évolution du MMPI par O¶DMRXW et la caractérisation des opérations
métier qui composent une PI.
166 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
Figure 89. Méta-modèle complet des pratiques métiers (MMPM)
À ce niveau de détail, nous avoQVVRXKDLWpPDQLSXOHUXQHVXLWHH[KDXVWLYHG¶RSpUDWLRQV types
pouvant définir un maximum de situations. Les différentes opérations que nous avons identifiées
dans chacune des familles sont :
- pour les opérations de communication : contacter, demander, valider, commenter, informer,
- pour les opérations de production : créer, exécuter, modifier, réparer, lier, inclure, mettre à
jour, supprimer
- pour les opérations de diffusion : partager et rendre indisponible
- pour les opérations de récupération : obtenir, consulter, identifier, vérifier
Les relations qui lient les opérations avec les éléments du contexte coopératif (c.à.d. les
acteurs, artefacts et activités) sont les mêmes que pour les pratiques : engendre, manipule et
concerne. Dans le MMO, les couples opérations-éléments sont détaillés et suivent le schéma
suivant (Figure 90).
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
167 Figure 90. Les opérations (en rouge) et artefacts manipulés (rectangles
bleus) autour des concepts G¶HVSDFHde transition HWG¶HVSDFHSULYp
Les opérations de communication génèrent des messages pour les acteurs concernés. Par
exemple, une opération « demander » va générer une requête à laquelle va accéder la personne à
TXLO¶RQIDLWFHWWHUHTXrWH
Les opérations de production génèrent (ou manipulent) des documents et des objets. Ceux-ci
peuvent dans un premier temps rester privés et/ou être partagés par une opération de diffusion. Ils
SDVVHQWDORUVSDUXQHVSDFHGHWUDQVLWLRQTXLVHUDGpILQLSDUO¶XVDJHYRLUFKDSLWUHVXLYDQW &¶HVW
par exemple le processus habituel suivi pour les plans : ils sont produits par le concepteur puis,
une fois « bons pour exécution », ils sont diffusés aux entreprises concernées. /RUVTX¶LOV¶DJLWGH
ODSURGXFWLRQG¶XQRXYUDJH (exécution), celle-ci se fait la plupart du temps sur le chantier et donc
GH PDQLqUH SDUWDJpH 3DU FRQWUH VL O¶RQ FRQVLGqUH GHV RXYUDJHV SUpIDEULTXpV OH SURFHVVXV VH
rapproche de celui des plans (production puis diffusion dans un deuxième temps).
/¶DWWULEXW © type-support » servira à identifiHU VL O¶RSpUDWLRQ DQDO\VpH GRLW IDLUH O¶REMHW GX
GpYHORSSHPHQW G¶XQ VHUYLFH RX SDV Les « type_support » utilisés sont : « besoin de
développement G¶XQVHUYLFHª© déjà supporté par un service » et « service inutile ». En effet, dans
OHFDGUHGHO¶DGDSWDWLRQGHVHUYLFHVLOQHV¶DJLUDSDVGHWRXWreconcevoir mais au contraire de tenir
compte des solutions existantes. Savoir quand redévelopper une solution ou au contraire quand
réutiliser une solution existante est OHSUHPLHUHQMHXDILQpYLWHUG¶HQJDJHUGHVcoûts inutiles. Cela
SHUPHWDLQVLGHGLPLQXHUOHVULVTXHVG¶pFKHFGXSURMHWHWFHFLGqVVHVSUHPLqUHVpWDSHV
1.28.3 Conclusion
Le Méta-Modèle du Contexte Coopératif (MMCC), issu de travaux antérieurs, a été réutilisé
et transformé pour créer le Méta-Modèle des Pratiques Métier (MMPM). Outre les concepts
métiers du MMCC, ce dernier a été créé sur la base de trois autres concepts centraux : les
pratiques collectives, les pratiques individuelles et les opérations métier.
Ce MMPM doit nous permettre de décrire les pratiques observées dans des projets de
conception-construction collaborative grâce aux concepts TX¶LO GpILQLt, à leurs attributs et aux
relations qui les relient,OV¶DJLWHQG¶DXWUHVWHUPHV G¶LQVWDQFLHUFHPpWD-modèle unique en autant
de modèles de praWLTXHVTXHGHG¶DQDO\VHVHIIHFWXpHV
168 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
Pour cela, il V¶DJLWG¶XWLOLVHUGHVIRUPDOLVPHVDGDSWpVHWOHVRXWLOVG¶pGLWLRQTXLFRQYLHQQHQW
Tel que cela a été introduit en 1.24.1, nous avons utilisé le framework GMF GH O¶outil de
développement Eclipse pour créer notre propre éditeur de modèles.
1.29
Le modèle de pratiques
Le modèle de pratiques est une représentation conceptuelle de pratiques observées au travers
G¶XQH DQDO\VH PpWLHU ,O XWLOLVH OHV FRQFHSWV GX 0030 TX¶LO UHSUésente dans un formalisme
particulier. Nous proposons pour cela notre propre formalisme et notre propre éditeur.
1.29.1 &ULWLTXHG¶XQformalisme existant
La Figure 91 issue de travaux préliminaires (Zignale et al. 2011) illustre un premier essai de
PRGpOLVDWLRQ G¶une pratique collective (PC) que nous avons réalisée FHOOH GH O¶pYDOXDWLRQ GHV
documents de conception par un expert. Dans cette PC, le concepteur fournit les documents de
conception au mDvWUH G¶RXvrage qui les soumet à un expert pour évaluation. Souvent, le maître
G¶RXYUDJHGpOqJXHVDSUDWLTXHjXQDVVLVWDQWjODPDvWULVHG¶RXYUDJHTXLSRVVqGHUDGDYDQWDJHGH
compétences pour cela.
Le formalisme qui a été utilisé ici HVW OH GLDJUDPPH G¶DFWLYLWps UML. PC, PI et opérations
VRQW GHV DFWLRQV TXH O¶RQ GLVWLQJXH JUDSKLTXHPHQW La PC « couvre » tous les acteurs alors que
chaque Pratique Individuelle (PI) qui la compose se situe dans la « swimlane ª G¶XQ DFWHXU HQ
particulier. Il en va de même pour les opérations. Ce diagramme illustre également les flux
G¶DUWHIDFWVengendrés ou simplement manipulés par les opérations.
6XLWH j FHWWH H[SpULPHQWDWLRQ QRXV FRQVWDWRQV TXH OH GLDJUDPPH G¶DFWLYLWps Q¶LQVWDQFLH
TX¶XQH SDUWLH notre méta-modèle de pratiques : tous les attributs de chaque classe ne sont pas
WUDLWpV H[ OHV W\SHV G¶DUWHIDFWV OHV IDPLOOHV GH SUDWLTXHV«), et les types énumérés ne sont pas
utilisés. De plus, la distinction entre certains éléments doit se faire manuellement. Par exemple,
les PC, les PI et les opérations sont ici toutes représentées par des « actions » en langage UML. Il
est nécessaire, pour les distinguer lors de leur modélisation, de spécifier leur stéréotype et de
modifier leur aspect graphique. Il en va de même pour les artefacts qui sont tous indistinctement
des « objets ». Le méta-PRGqOH GX GLDJUDPPH G¶DFWLYLWps et le MMPM étant différents, le
GLDJUDPPHG¶DFWLYLWpVQHSHUPHWdonc pas une bonne instanciation du MMPM.
La modélisation des pratiques de chaque acteur dans un même modèle en alourdit la lecture et
nous parait superflue. Le séquençage des pratiques (flèches rouges dans le modèle)Q¶HVWG¶DLOOHXUV
pas décrit par notre méta-modèle, le but étant en premier lieu de comprendre ce que chacun fait et
QRQG¶Rptimiser un processus qui devra être suivi. Il ne doit donc pas être modélisé. Par contre,
répartir la modélisation de chaque PI dans des diagrammes indépendants permettra alors G¶LVROHU
les besoins de chacun et en facilitera la lecture.
1RXV SHQVRQV TX¶XQ formalisme de modélisation doit répondre aux questions que le
concepteur se pose lors de la modélisation. Dans notre cas, il est question de créer un formalisme
qui soit utilisable et compréhensible par les analystes métiers et donc à partir des concepts métiers
définis par le MMPM. De plus, nous préconisons un IRUPDOLVPH VLPSOH G¶DFFqV DXWDQW SDU OD
OHFWXUHTXHSDUO¶pGLWLRQ
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
169 Figure 91. Instanciation du MMPM SDUXQGLDJUDPPHG¶DFWLYLWpV80/
modifié
Vers une modélisation par des arbres hiérarchiques
Il nous paraît QpFHVVDLUH G¶LQWURGXLUH XQ QRXYHDX formalisme pour instancier notre MMPM
SOXW{WTXHGHUpXWLOLVHUOHGLDJUDPPHG¶DFWLYLWps. /¶REMHFWLIest de pouvoir manipuler les concepts
introduits afin de guider la modélisation, HQXWLOLVDQWXQHSDOHWWHG¶RXWLOVDGDSWée et les différentes
énumérations du méta-modèle.
Nous avons utilisé le Framework GMF G¶(FOLSVH(présenté en 1.24.1) afin de créer un éditeur
SHUPHWWDQW G¶LQVWDQFLHU QRWUH PpWD-modèle de pratiques VRXV IRUPH G¶XQ DUEUH KLpUDUFKLTXH Ce
mode de visualisation est utile pour représenter des systèmes relationnels organisés en couches
FRPPHSDUH[HPSOHODVWUXFWXUHG¶XQHHQWUHSULVHRXG¶XQHIDPLOOHFIDUEUHJpQpDORJLTXH1RXV
YHUURQVTX¶LOV¶DYqUHSOXW{WDGDSWpSRXULQVWDQFLHUle méta-modèle de pratiques.
$ILQG¶HQIDFLOLWHUODGLIIXVLRQHWO¶pYDOXDWLRQGDQVODFRPPXQDXWpVFLHQWLILTXH, cet éditeur a
été conçu en anglais.
170 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
1.29.2 /¶pGLWHXUet les modèles générés
La Figure 92 illustre un exemple de modèle de pratique WHO TXH QRXV O¶DYRQV FRQoX
accompagné de la SDOHWWH GH O¶pGLWHXU XWLOLVp pour le décrire. Le cas choisi est le même que
précédemment LO FRQFHUQH XQH SUDWLTXH FROOHFWLYH G¶pFKDQJH GH SODQV SRXU OHXU H[SHUWLVe. Le
modèle se focalise cependant sur la PI du concepteur. Cela permet, comme énoncé
précédemment, de générer un modèle relativement simple et facile à lire rapidement. Comme
nous pouvons le voir, ce modèle représente couche après couche :
- la PC considérée, définie par son nom, sa famille, une description ;
- O¶acteur W\SHDXTXHORQV¶LQWpUHVVHGpFULWSDUVRQU{OHVDGpQRPLQDWLRQVRQPpWLHUDLQVLTXH
la PI de cet acteur, définie par un nom et une description ;
- les opérations, pour lesquelles on renseigne le type et le besoin de service
- et enfin un artefact (défini par un type, une dénomination, un auteur, un état) manipulé ainsi
que le JURXSHG¶DFWHXUV concerné (nature du groupe, rôle, spécificité).
Figure 92. ,QWHUIDFHGHO¶pGLWHXU*0) G¶DUEUHVKLpUarchiques pour la
modélisation des pratiques (exemple)
Chacun de ces éléments est introduit dans le modèle à partir de la palette (à droite). Ces
éléments sont donc des concepts du méta-modèle proposé et SHUPHWWHQW G¶homogénéiser les
analyses. Chaque élément est ensuite éditable, QRWDPPHQW SDU OH FKRL[ G¶DWWULEXWV GDQV GHV
énumérations prédéfinies. L¶H[pression littérale permet de faire des descriptions qui vont au-delà
GH FHV OLVWHV HW TXL SHUPHWWHQW QRWDPPHQW G¶DSSRUWHU GH O¶LQIRUPDWLRQ VXSSOpPHQWDLUH. &¶est
QRWDPPHQWFHW\SHG¶pGLWLRQTXHQRXVXWLOLVRQVSRXUOHVDWWULEXWV© nom » ou « description ». La
FRPELQDLVRQGHVGHX[PRGHVG¶pGLWLRQRIIUHXQHGHVFULSWLRQjODIRLVJpQpUDOLVDEOHHWVSpFLILTXH
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
171 /¶DYDQWDJHGHO¶pGLWHXUGpYHORSSpHVWGHSRXYRLUIRUPDOLser de manière structurée une analyse
métier en créant un modèle adapté. Nous tirons pour cela profit de la caractérisation du contexte
coopératif et de celle des pratiques au travers de méta-modèles /¶REMHFWLI HVW GH SHUPHWWUH une
modélisation qui soit cohérente avec le domaine analysé, à savoir le projet de
conception/construction architecturale.
Ainsi, à partir de chaque classe du méta-modèle de pratiques, un élément de diagramme est
créé et peut être ajouté dans le diagramme via la palette. On instancie ainsi chaque classe puis ses
attributs, de la manière qui a été définie dans le méta-modèle, à savoir par choix dans une liste
(attributs de type énumération) ou par saisie de texte (attributs de type texte). Un attribut peut être
instancié plusieurs fois si cela a été spécifié dans le méta-modèle grâce aux cardinalités. La
création de relation entre éléments est contrainte par les relations du méta-modèle, et également
par leurs cardinalités. Par exemple, la cardinalité 0.1 sur la relation « exécute » entre un acteur et
XQH SUDWLTXH LQGLYLGXHOOH LPSOLTXH TX¶XQ VHXO pOpPHQW © acteur » pourra être relié à chaque
élément pratique individuelle dans le modèle. &HOD SHUPHW GH UHVSHFWHU OD GpILQLWLRQ G¶XQH
pratique individuelle, qui est « le comportement isolé de chaque acteur impliqué dans une pratique
collective » (voir 1.28.2).
Le framework GMF (présenté en 1.24.2) propose des fonctionnalités qui assistent la
JpQpUDWLRQ GH O¶pGLWHXU j partir du méta-modèle, notamment grâce à un tableau de bord (Figure
93). &HV IRQFWLRQQDOLWpV QRXV RQW SHUPLV G¶HQWUHSUHQGUH OD FRQFHSWLRQ GH FHW pGLWHXU VDQV
connaissances en matière de développement et à travers un apprentissage rapide. Le bémol de ces
IRQFWLRQQDOLWpV HVW TX¶XQH IRLV O¶pGLWHXU généré et personnalisé (couleurs, formes des éléments,
W\SHVGHWUDLWV«WRXWHUpJpQpUDWLRQDXWRPDWLTXHDXUDSRXUHIIHWG¶HIIDFHUla personnalisation. Il
est donc important de définir le méta-modèle de manière très précise avant de commencer la
VSpFLILFDWLRQG¶un éditeur qui sera pertinent.
Figure 93. Le tableau de bord GMF
172 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
Bien évidemment, il est toujours possible de regénérer « manuellement » et par parties. Après
un apprentissage plus approfondi, il nous est possible de modifier sensiblement le méta-modèle et
GHUpSHUFXWHUFHVFKDQJHPHQWVVXUO¶pGLWHXU&HODinclut, du plus simple à mettre en °XYUH au plus
compliqué :
- O¶DMRXWGHFKRL[GDQVXQHpQXPpUDWLRQRXOHFKDQJHPHQWG¶XQHFDUGLQDOLWp
- O¶DMRXWG¶XQDWWULEXWjXQHFODVVH,
- O¶DMRXWG¶XQHFODVVHHWRXG¶XQHUHODWLRQ.
&HWWH SRVVLELOLWp G¶DGDSWHU O¶pGLWHXU HVW WUqV LPSRUWDQWH YLV-à-vis des perspectives
expérimentales de notre travail. En effet, DX ILO G¶DSSOLFDWLRQV IXWXUHV GH QRWUH PpWKRGH il est
possible que les concepts évoluent voire que de nouveaux soient introduits au fil des analyses
métier qui seront menées. Cela a déjà été le cas au travers des trois expérimentations que nous
avons PHQpHVYRLUFKDSLWUH/¶H[HPSOHOHSOXVW\SLTXHHVWO¶DMRXWGDQVXQHpQXPpUDWLRQ G¶XQ
pOpPHQWTXLQ¶DXUDLWSDVpWpVSpFLILpGDQVXQSUHPLHUWHPSVPDLVTXLHVWUHQFRQWUpGDQVSOXVLHXUV
cas. Ainsi, les allers-retours entre modélisation et méta-modélisation assureront une analyse
métier toujours plus pertinente.
1.29.3 ,QWpJUDWLRQGDQVOHFDKLHUG¶H[LJHQFHV
LHFDKLHUG¶H[LJHQFHV a été introduit comme un moyen de rassembler les modèles de chaque
point de vue (organisationnel, opérationnel et fonctionnel). Le point de vue organisationnel,
formalisé au travers des diagrammes de pratiques, compose donc la première partie de ce
document.
Comme nous venons de le remarquer, la justesse des modèles pourra évoluer au fil des
DQDO\VHVjWUDYHUVO¶DPpOLRUDWLRQGXPpWD-modèle. Pourtant, il est important de pouvoir faire des
analyses pertinentes, même si la maturité des modèles ne le permet HQFRUHSDV &¶HVWSRXUTXRL,
FRPPH QRXV O¶DYRQV LQWURGXLW GDQV OH SDUDJUDSKH SUpsentant OH FDKLHU G¶H[LJHQFHV (§ 1.25.2),
celui-ci FRPSUHQG GHV FKDPSV G¶pGLWLRQ OLEUH TXL SHUPHttent de pallier les manques du métamodèle.
'HPDQLqUHJpQpUDOHOHVFKDPSVOLEUHVGXFDKLHUG¶H[LJHQFHV VHURQWXQVXSSRUWG¶H[SUHVVLRQ
pour les acteurs du projet de développement, quelque soit leur point de vue. Nous partons du
postulat que toute idée ou remarque au cours du processus peut avoir un impact sur la pertinence
du résultat, à savoir l¶DGDSWDWLRQGXVHUYLFHjGpYHORSSHU/HFDKLHUG¶H[LJHQFHVXSSRUWHDLQVLOD
formalisation de ces remarques et assure leur capitalisation et leur prise en compte par les
différents participants potentiellement concernés. La représentation du modèle et de ces
LQIRUPDWLRQVDGGLWLRQQHOOHVSUHQGODIRUPHG¶XQWDEOHDX (Figure 94).
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
173 Figure 94. )RUPDOLVDWLRQGHO¶DQDO\VHPpWLHUFRPELQDLVRQG¶XQ modèle
et de remarques
1.30
Conclusion
Les études sur le contexte coopératif OD WKpRULH GH O¶DFWLYLWp ou encore les processus de
O¶LQIRUPDWLRQ (c.f. § 1.1 puis 1.28.2) nous ont permis de conceptualiser nos propres analyses
SRUWpHVVXUOHGpURXOHPHQWGHODFRRUGLQDWLRQDXFRXUVG¶XQSURMHW$IC. Nous avons construit un
méta-modèle des pratiques de projet autour de trois concepts : les pratiques collectives, les
pratiques individuelles et les opérations. Nous avons ensuite développé un éditeur pour instancier
ce méta-modèle afin de décrire des pratiques observées.
Les pratiques collectives analysées dans ce chapitre ont été réparties en onze familles qui
apportent une structuration du projet plus fine que les traditionnelles phases. Elles définissent des
objectifs généraux relatifs à des groupes de projet impliqué dans des tâches collaboratives. Les
pratiques individuelles raffinent ces objectifs du point de vue de chaque acteur considéré
individuellement. Elles sont davantage précisées par des opérations réparties en quatre familles et
GRQWO¶H[pFXWLRQDSRXUEXWGHUHPSOLUO¶REMHFWLILGHQWLILpSRXUFKDTXHDFWHXU
174 Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel |
Les pratiques et opérations décrivent finement le déroulement d¶XQHDFWLYLWpPpWLHUmais elles
sont pensées indépendamment des outils qui seront utilisés pour effectuer cette activité (que ce
soient des outils matériels ou logiciels). Notre postulat est que cet outillage doit être défini à
posteriori.
/¶RXWLOODJHFRQVLVWHjPpGLDWLVHUFKDTXHRSpUation, acteur, artefact ainsi que les espaces (privé
et de transition) qui leur sont associés (rappel : voir Figure 90). Les études sur le TCAO et
notamment les dimensions fonctionnelles (distance et temporalité) nous permettront de
catégoriser ces moyens de médiatisation. Les trois scénarios illustrés dans la figure suivante
(Figure 95) montrent comment une même pratique métier peut être médiatisée différemment :
QRXVSDUOHURQVDORUVG¶XVDJHVGLIIpUHQWV/¶HVSDFHde transition y prend alors plusieurs formes et
dimensions. Par exemple, dans le premier cas (usage 1), LOV¶DJLWGH« O¶HQWUH-deux » dans le très
court instant pendant lequel le document passe de la main G¶XQDFWHXUjFHOOHG¶XQautre. Dans le
deuxième cas (usage 2) F¶HVW XQ VHUYLFH GH FRXUULHU FRPPH OD « Poste » qui assure cette
WUDQVLWLRQ (QILQ OH WURLVLqPH FDV LQWURGXLW O¶XVDJH GH VHUYLFHV LQIRUPDWLTXHV TXL PpGLDWLVHQW OH
SDUWDJH G¶LQIRUPDWLRQ VRXV IRUPH QXPpULTXH (usage 3) &¶HVW j FH W\SH G¶XVDJH TXH QRXs nous
intéressons particulièrement dans la suite de ce manuscrit, en cherchant à le caractériser de la
même manière que nous venons de le faire avec les pratiques.
Figure 95. Des usages différents pour une même pratique, exemple
G¶XQHSUDWLTXe de « partage de documents »
| Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
175 Chapitre 10 ± La modélisation des
usages :
le point
de vue
opérationnel
&H FKDSLWUH LQWURGXLW OH FRQFHSW G¶XVDJH TXH QRXV DYRQV DGRSWp SRXU FDUDFWpULVHU OD
médiatisation des pratiques métiers par des outils numériques. Concevoir un usage consiste à
FRQVLGpUHU O¶DFWHXU G¶XQ SURMHW FRPPH XWLOLVDWHXU G¶XQ RXWLO SXLV j GpILQLU O¶LQWHUDFWLRQ HQWUH OHV
GHX[ODPDQLqUHGRQWHVWWUDLWpHO¶LQIRUPDWLRQPpWLHUQXPpULVpHDLQVLTXHOHFRQWH[WHGe l¶XVDJH
La consWUXFWLRQ G¶XQ PpWD-PRGqOH G¶XVDJH QRXV SHUPHW Ge caractériser ces concepts, et les
formalismes utilisés pour les décrire sont issus des domaines du Génie Logiciel et de la
FRQFHSWLRQG¶,+01RXVYHUURQVFRPPHQWQRXVDGDSWRQVFHVIRUPDOLVPHVSRXUOLHUODGHscription
G¶XQXVDJHjFHOOHGHODSUDWLTXHTX¶LOPpGLDWLVH
1.31
Définition et concepts
1.31.1 Usage et utilisation
Au travers du point de vue opérationnel, on cherchera à exprimer la manière dont est
« médiatisée ª XQH SUDWLTXH PpWLHU SDU O¶LQWURGXFWLRQ G¶XQ RXWLO numérique. Médiatiser signifie
littéralement « DYRLU XQH IRQFWLRQ G¶LQWHUPpGLDLUH ». 1RXV GpILQLURQV GDQV TXHOOH PHVXUH O¶RXWLO
assure cette fonction G¶LQWHUPpGLDLUHjWUDYHUVOHFRQFHSWG¶XVDJH
Les termes usage et utilisation sont deux synonymes qui peuvent tous GHX[VLJQLILHUO¶HPSORL
GHTXHOTXHFKRVH2QFRQIqUHFHSHQGDQWjO¶XVDJHSOXVG¶DFFHSWLRQV 32. Il est par exemple relatif à
une habitude H[ O¶XVDJH GX FKDSHDX RX j GHV UqJOHV pWDEOLHV H[ LO HVW G¶XVDJH GH PHWWUH XQH
cravate ici). Ainsi, le terme usage définit une utilisation commune, normale, prévue alors que
O¶XWLOLVDWLRQVHUDSSRUWHplutôt à un point particulier, une situation donnée. Par exemple, on dit que
O¶XVDJHG¶XQHFKDLQHKLILHVWGHOLUHGHODPXVLTXHPDLVTXH O¶utilisation de celle-ci en extérieur
Q¶HVWSDVUHFRPPDQGpH 3DUH[WHQVLRQO¶XVDJHVHUpIqUHjO¶DSSURSULDWLRQ : on peut par exemple
32
http://french.stackexchange.com/questions/722/usages-dusage-et-dutilisation-quel-mot-utiliser
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
177 SDUOHU G¶XVDJH GpWRXUQp ORUVTX¶LO V¶DJLW G¶XQ RXWLO TXL VHUW j DXWUH FKRVH TXH FH j TXRL LO D pWp
destiné.
Pour caractériser la médiatisatiRQ G¶XQH SUDWLTXH PpWLHU SDU O¶HPSORL G¶XQ RXWLO QRXV
privilégions GRQFOHWHUPHG¶XVDJHSOXW{WTX¶XWLOLVDWLRQFDULO couvre une définition plus large que
celle du simple emploi. Nous cherchons HQ HIIHW j UHWURXYHU HQ SOXV GH OD QRWLRQ G¶HPSORL OHV
notions :
- d¶KDELWXGHTXLGpFRXOHGXFRQFHSWGHSUDWLTXHTXHO¶RQYHXWRXWLOOHU qui est par nature une
manière de travailler récurrente
- G¶REMHFWLIUHODWLIjO¶REMHFWLI métier, le but étant de se servir des outils pour les atteindre,
- HWG¶DSSURSULDWLRQSDUOHVDFWHXrs, notamment en fonction de leur rôle duquel découlent leurs
besoins.
(QJDUGDQWjO¶LGpHFHVDFFHSWLRQVGHVWHUPHVXVDJHHWXWLOLVDWLRQRQUHPDUTXHpJDOHPHQWTXH
O¶pYROXWLRQ GH O¶XVDJH SHXW-rWUH GpSHQGDQWH GH FHOOH GH O¶XWLOLVDWLRQ 2Q GLUD SDU H[HPSOH que
O¶XVDJH GHV SODWHIRUPHV FROODERUDWLYHV RX HQFRUH GHV DSSOLFDWLRQV PRELOHV D pYROXp GDQV OH
domaine AIC, car leur utilisation est devenue plus intuitive. On retrouve ici la notion de « push
technologique » introduite précédemment. Les avancées technologiques permettent en effet de
supporter une charge de travail toujours plus soutenue et contribuent DLQVL j O¶évolution des
usages.
Si du point de vue de la terminologie notre choix se tourne donc vers O¶DGRSWLRQGX concept
G¶XVDJH OD OLWWpUDWXUH UHODWLYH j OD FRQFHSWLRQ G¶+0 YDOLGH pJDOHPHQW FH FKRL[ '¶DSUqV OD
description qui a été faite au chapitre 4 (au § 1.10.1, Tableau 4) les enjeux de O¶DSSURFKH GH
conception centrée-usage de (L. L. Constantine & Lockwood 2003) semblent en effet
correspondre aux nôtres :
- ODFRQFHQWUDWLRQVXUO¶RXWLOODJHGHVSUDWLTXHVPpWLHUV,
- une approche dirigée par les modèles,
- XQHLPSOLFDWLRQVpOHFWLYHGHO¶XWLOLVDWHXU
- des processus systématiques et entièrement spécifiés,
- XQHDGDSWDWLRQDVVXUpHSDUO¶LQJpQLHULHHWQRQSDr ODUpVROXWLRQLWpUDWLYHG¶HUUHXUV
1.31.2 &DUDFWpULVDWLRQGHO¶XVDJH
/¶XVDJH HVW GRQF UHODWLI j XQ REMHFWLI TXL OH PRWLYH &HW REMHFWLI HVW GpULYp GH OD SUDWLTXH
métieU TX¶LO PpGLDWLVH RQ GpWDLOOHUD SDU O¶XVDJH OD © manière de » réaliser cette pratique. Nous
FKHUFKHURQVjGpILQLUOHVXVDJHVSRXUFKDTXHDFWHXUDLQVLF¶HVWjODSUDWLTXHLQGLYLGXHOOHTXHO¶RQ
fait référence ici. Par exemple, pour la pratique « diffuser les documents », O¶XVDJH SRXUra
consister à « diffuser les documents par mail ». En d'autres termes, RQSRXUUDGLUHTX¶LOV¶DJLWGH
« IDLUHO¶XVDJHGXPDLOSRXUGLIIXVHUOHVGRFXPHQWV ».
7HO TXH QRXV O¶DYRQV YX GDQV OH FKDSLWUH OD FRQFHSWLRQ G¶,+0 © enrichit » la conception
ORJLFLHOOHSDUO¶DQDO\VHGHWURLVpOpPHQWVSULQFLSDX[ : les tâches, le contenu et le contexte. Nous
nous servirons de ces trois concHSWVSRXUFDUDFWpULVHUO¶XVDJHjODOXPLqUHGHVGLIIpUHQWHVpWXGHV
GHO¶pWDWGHO¶DUWDQDO\Vp
178 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Les WkFKHV GpILQLVVHQW O¶LQWHUDFWLRQ HQWUH O¶XWLOLVDWHXU HW O¶RXWLO (OOHV GpWDLOOHQW FHWWH
PpGLDWLVDWLRQ HQ GpFULYDQW OH FRPSRUWHPHQW GH O¶XWLOLVDWHXU HW GH O¶RXWLO ORUV GH O¶XVDJH 1RXV
XWLOLVHURQVSOXVLHXUVQLYHDX[G¶DEVWUDFWLRQSRXUGpILQLUFHVWkFKHV
/¶LQIRUPDWLRQ PDQLSXOpH ORUV GH O¶H[pFXWLRQ GHV SUDWLTXHV HVW DXVVL PpGLDWLVpH SDU O¶RXWLO j
WUDYHUV VRQ XVDJH &¶HVW FH TXH QRXV DSSHORQV OH FRQWHQX G¶LQWHUDFWLRQ ,O HVW FRPSRVp G¶REMHWV
OHV REMHWV G¶LQWHUDFWLRQ qui sont définis par une donnée (ce qui est manipulé) et une forme
(comment il est représenté).
/HFRQWH[WHGHO¶DFWLYLWpFROOHFWLYHHWOHFRQWH[WHGHO¶DFWHXUGHX[GHVWURLVSDUWLHVGXFRQWH[WH
tri-facettes (cf. § 1.2.3), sont caractérisés par le Méta-Modèle des Pratiques Métier au travers des
FRQFHSWV GH 3UDWLTXH &ROOHFWLYH HW ,QGLYLGXHOOH ,O V¶DJLW j SUpVHQW GH FDUDFWpULser la troisième
partie qui correspond au contexte utilisateur. Conformément à notre terminologie, nous
O¶DSSHOOHURQVLFLOHFRQWH[WHG¶XVDJH.
1.32
Le méta-modèle des Usages
À partir des GpILQLWLRQVTXHQRXVYHQRQVG¶LQWURGXLUH, nous pouvons définir les deux éléments
de caractérisation G¶XQXVDJHFigure 96) :
- O¶REMHFWLIjDWWHLQGUHHQWDQWTX¶DWWULEXWGHO¶XVDJH
- la relation médiatise qui relie conceptuellement un usage à une pratique individuelle.
-
Nous pouvons dès à présent spécifier (au travers des cardinalités) que :
plusieurs usages peuvent médiatiser la même pratique (par exemple si il y a changement
G¶RXWLOGHOLHX«
un même usage peut répondre à plusieurs pratiques (si le déroulement des ces pratiques est
similaire).
Figure 96. 5HODWLRQHQWUHOHVFRQFHSWVG¶XVDJHHWGHSUDWLTXH
Nous composons le Méta-0RGqOHG¶8VDJH008SDUpartiesFRPPHQRXVO¶DYRQVIDLWSRXU
caractériser les pratiques. Les sections suivantes montrent comment cette relation « médiatise »
entre usage et pratique se répercute sur les éléments relatifs aux deux concepts :
- entre les tâches et les opérations métier,
- HQWUHOHFRQWHQXG¶LQWHUDFWLRQHWOHVLQIRUPDWLRQs manipulées par ces opérations,
- HQWUHO¶XWLOLVDWHXUGDQVVRQFRQWH[WHHWO¶DFWHXU
1.32.1 /¶LQWHUDFWLRQ
1RXV GpFRPSRVRQV O¶LQWHUDFWLRQ GH O¶XWLOLVDWHXU DYHF OH V\VWqPH HQ GHX[ SKDVHV O¶DFWion
cognitive nommée « O¶LQWHQWLRQ XWLOLVDWHXU » HW O¶DFWLRQ SK\VLTXe qui elle est appelée la « tâche
utilisateur ». La responsabilité GHO¶RXWLO est appelée « tâche outil ».
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
179 /¶LQWHQWLRQ UHOqYH G¶XQ REMHFWLI JpQpUDO H[ V¶LGHQWLILHU Certaines des intentions sont
déduites des opérations métiers qui ont été définies dans le méta-modèle des pratiques. Cela est
formalisé par la relation « supporte ». '¶DXWUHV LQWHQWLRQV VRQW LQGpSHQGDQWHV GHV RSpUDWLRQV
PpWLHUVHWUHOqYHSOXVG¶XQHFRQWUDLQWHWHFKQLTXH3DUH[HPSOH© V¶LGHQWLILHU » qui est nécessaire
SRXUEHDXFRXSG¶DSSOLFDWLRQVPDLVTXHO¶RQQ¶DVVRFLHSDVjXQHRSpUDWLRQPpWLHUSDUWLFXOLqUH
Les tâches utilisateurs sont dans un premier temps considérées comme abstraites. C'est-à-dire
TX¶HOOHVGpFULYHQWXQHDFWLRQSUpFLVHH[HQWUHUORJLQet non comment cette action est exécutée
H[WDSHUORJLQGLUHOHORJLQ«&HODUHOqYHGHODWkFKHGLWHFRQFUqWHTXLSHXWrWUHGHO¶RUGUHGH
O¶LQWHUDFWLRQRXGHODSHUFHSWLRQVHXOHPHQW
Les méthodes de conception G¶IHM et plus particulièrement dans les approches génératives
de MDA (voir § 1.11.2) introduisent des types de tâches abstraites que nous réutilisons. Cela nous
SHUPHWG¶HQYLVDJHUGHVSHUVSHFWLYHVG¶intégration de notre méthode dans de telles approches. Ces
types sont : entrée, sortie, commande, sélection, navigation, conteneur.
-
De la même manière nous typons les tâches concrètes :
G¶LQWHUDFWLRQ : écriture, choix, déclenchement, manipulation, transformation, défilement,
DXWUH«
de perception : graphique, audio, matérielle.
Trois relations caractérisent un processus de tâches. Cette dynamique était absente dans la
caractérisation des pratiques métiers1RXVSDUWLRQVHQHIIHWGXSRVWXODWTXHO¶RUGUHGHVRSpUDWLRQV
métiers Q¶LPSRUWHSDs FDULOSHXW YDULHUG¶XQHVLWXDWLRQ jXQHDXWUe et selon la manière dont ces
opérations seront outillées &HSHQGDQW GDQV OD FDUDFWpULVDWLRQ GH O¶XVDJH HW GHV WkFKHV TXL OH
FRPSRVHQWLOHVWQpFHVVDLUHG¶LQWpJUHUcette notion afin de composer la relation entre les interfaces
développées. Les relations identifiées sont :
- La relation « OU ªVSpFLILHTXHO¶RQH[pFXWHXQHGHVWkFKHVGpFULWHV
- La relation « ET » spécifie que toutes les tâches décrites doivent être exécutées
- La relation « PUIS ªDMRXWHXQRUGUHGDQVO¶H[pFXWLRQGHVWkFKHV
Nous retrouvons ici les concepts manipulés par CTT (Paternò et al. 1997) ou K-MAD (Baron
et al. 2006)OHVODQJDJHVGHPRGpOLVDWLRQGHWkFKHVG¶LQWHUDFWLRQHQPrPHWHPSVTXHOHVFRQFHSWV
G¶LQWHQWLRQ GH O¶XWLOLVDWHXU HW GH UHVSRQVDELOLWp GX V\VWqPH GDQV OHV © essential use case » de la
conception centrée-usages (L Constantine 2001) (cf. § 1.10.3). Le méta-modèle suivant (Figure
97) représente ces concepts et leurs relations.
180 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Figure 97. Caractérisation des intentions et des tâches
1.32.2 /HFRQWHQXG¶LQWHUDFWLRQ
/HFRQWHQXG¶LQWHUDFWLRQHVWFRPSRVpG¶REMHWVG¶LQWHUDFWLRQ2,TXLUHSUpVHQWHQWOHVpOpPHQWV
du contexte coopératif PDQLSXOpVDXFRXUVG¶XQHSUDWLTXHHWPpGLDWLVpVSDUXQXVDJH&Hsont les
éléments avec lesquels O¶XWLOLVDWHXUGHYUDLQWHUDJLUORUVGHO¶H[pFXWLRQG¶XQHWkFKH
8Q2,HVWODFRPELQDLVRQG¶XQHGRQQpHHWG¶XQHUHSUpVHQWDWLRQ,ODXQQLYHDXGHGHVFULSWLRQ
abstrait, PDLV GHYUD FRQWHQLU DVVH] G¶LQIRUPDWLRQ SRXU HQ IDLUH XQ REMet concret lors du
développement du système. À partir de la littérature dans le domaine des IHM, nous nous sommes
LQVSLUpVGHVREMHWVG¶LQWHUDFWLRQGHODPpWKRGH6\PSKRQ\ (S Dupuy-Chessa 2011) mais aussi du
FRQFHSWG¶REMHWG¶LQWHUDFWLRQDbstrait décrit dans (JM Vanderdonckt & F Bodart 1993) ou illustré
dans (LL Constantine 2003) (voir 1.10.3 $ILQ GH SRXYRLU GpILQLU GHV REMHWV G¶LQWHUDFWLRQ
pertinents par rapport au domaine AIC, nous avons également considéré les objets IFC dans le
BIM (J. Zhang et al. 2012) HWGDQVOHVPpWKRGHVGHFRQFHSWLRQEDVpHVVXUO¶,'0(CM Eastman &
Jeong 2010).
/HQRPG¶XQ2,HVWUHODWLIjODGRQQpHTX¶LOUHSUpVHQWH&HWWHGRQQpHSRXYDQWrWUHGpILQLHSDU
plusieurs attributs, peut être un élément du contexte coopératif comme :
- un artefact, que ce soit un document (ex. un rapport médiatisé par un fichier texte), un objet
(ex. un ouvrage médiatisé par un dessin numérique) ou un message (ex. une réaction
médiatisée par un commentaire sur un fichier)
- XQDFWHXUVRXVODIRUPHG¶XQFRQWDFWGDQVXQDQQXDLUHSDUH[HPSOH
- RXXQHDFWLYLWpFRPPHXQHWkFKHTXHO¶RQPDQLSXOHGDQVXQGLDJUDPPHGHJDQWW
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
181 ,O SHXW V¶DJLU pJDOHPHQW G¶XQH GRQQpH GLWH SULPLWLYH FRPPH SDU H[HPSOH OH QRP G¶XQ
GRFXPHQW OD GXUpH G¶XQH WkFKH GDQV XQ SODQQLQJ O¶LGHQWLILDQW G¶XQ DFWHXU« 8ne donnée
SULPLWLYHSHXWrWUHO¶DWWULEXWG¶XQHDXWUHGRQQpHPDLVQHSRVVqGHSDVG¶DWWULEXWVHOOH-même.
-
Les types de données retenus pour la caractérisation des OI sont :
(pour les données primitives) booléenne, numérique, date, texte et hypertexte
(pour les autres données) le fichier, le média et « l¶RXYUDJH numérique » (« building
information ») qui est un type de donnée propre au métier et qui nous permettra de typer plus
précisément les informations traitées.
Parmi les formes que prennent les objets, RQUHWURXYHOHVREMHWVG¶LQWHUIDFHFRPPXQVFRPPH
OHVLF{QHVOHVIHQrWUHVOHVFXUVHXUVOHVERXWRQV«2QWURXYHFHW\SHG¶REMHWGDQVWRXWHLQWHUIDFH
JUDSKLTXH'¶autres formes sont relatives au domaine lié et notamment à la nature des échanges
dans le métier considéré comme par exemple les éléments de dessin (composés de points, de
OLJQHVGHVXUIDFHVGHIRUPHVG¶HVSDFHV Vu les multiples moyens possibles pour définir ces
pOpPHQWVGHGHVVLQO¶DWWULEXW© forme » est éditable par un texte libre.
Les couples donnée/forme sont variés et permettent de traiter de multiples cas de figure dans
la spécification de O¶LQIRUPDWLRQ PpGLDWLVpH DYHF ODTXHOOH O¶XWLOLsateur interagit. Le Tableau 23
illustre trois exemples de données définies conformément à la caractérisation que nous venons de
faire : par leur nom, leur type, leurs attributs (si non primitive) et dans le cas présent deux formes
(ou représentations) possibles.
Tableau 23. ([HPSOHVGHGRQQpHVHWG¶DVVRFLDWLRQGHIRUPHV
Donnée manipulée
Document
Mur
Quantité de béton
dans un mur
Type de
donnée
Fichier
Attributs possibles
Formes possibles
Nom, type fichier,
WDLOOHGDWHFUpDWLRQ«
Ligne dans un tableau
Building
Information
Longueur, largeur,
composition,
coefficient
WKHUPLTXH«
Dessin 2D (surface)
Valeur
numérique
Donnée primitive
SDVG¶DWWULEXWV
Curseur
Icône + texte
Dessin 3D (forme)
Type de hachure dans
un dessin
Le diagramme de classes UML suivant (Figure 98) représente la partie du méta-modèle
G¶XVDJH FDUDFWpULVDQW OHV REMHWV G¶LQWHUDFWLRQ /HV UHODWLRQV © représente ª HQWUH O¶REMHW
G¶LQWHUDFWLRQHWFKDTXHpOpPHQWGXFRQWH[WHFRRSpUDWLI caractérisent à la fois la représentation de
ces éléments en tant que données « complètes » ou en en tant que données primitives.
182 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Figure 98. Caractérisation GHO¶REMHW G¶LQWHUDFWLRQ
1.32.3 /HFRQWH[WHG¶XVDJH
Définir le contexte dit « contexte G¶XVDJH ªQ¶HVWDXWUHTXHFRQVLGpUHUXQDFWHXUGXSURMHWHQ
WDQW TX¶XWLOLVDWHXU G¶XQ RXWLO SDUWLFXOLHU. Il convient alors de les définir tous deux ainsi que la
WHPSRUDOLWpHWODORFDOLVDWLRQGHO¶XVDJH (Figure 99). Les liens conceptuels créés à cet effet sont :
- la relation « représente ªHQWUHO¶XWLOLVDWHXUHWO¶DFWHXU
- la relation « utilise » HQWUHO¶XWLOLVDWHXUHWO¶RXWLO
- la relation « VHGpURXOHªHQWUHO¶XVDJHHWODWHPSRUDOLWpDLQVLTX¶HQWUHO¶XVDJHHWODORFDOLVDWLRQ
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
183 Figure 99. &DUDFWpULVDWLRQGXFRQWH[WHG¶XVDJH
2Q DWWULEXH j XQ XWLOLVDWHXU XQ U{OH RSpUDWLRQQHO W\SHBU{OHBRS TXL GpWHUPLQHUD O¶DFFqV RX
non à certains services. Ce rôle opérationnel est ainsi dépendant du type de service visé dans le
projet de développement. Il peut être attribué en fonction du rôle organisationnel qui est défini
dans le Méta-0RGqOH GHV 3UDWLTXHV 0pWLHU 0030 (Q G¶DXWUHV WHUPHV FHOD LPSOLTXH TX¶XQ
acteur respecte les usages qui lui auront été attribués. Par exemple, le rôle opérationnel de
« rédacteur ª G¶XQ FRPSWH-rendu de réunion chantier est en général attribué au coordinateur du
FKDQWLHUU{OHRUJDQLVDWLRQQHO&HWWHDVVLJQDWLRQGHU{OHSHUPHWORUVGHO¶XVDJHG¶XQRXWLOFRPPH
CRTI-weB, de rendre disponibles aux personnes concernées les services de rédaction de compterendu en ligne proposés (service « comptes-rendus »). Concernant le service « documents », les
rôles organisationnels sont « utilisateur », « administrateur projet » et « superviseur projet ». Le
choix actuellement limité aux rôles opérationnels de CRTI-weB pourra être étendu, notamment si
O¶RQ FRQVLGqUH OHV RXWLOV %,0 H[ %,0 PDQDJHU $FWXHOOHPHQW Qous ne proposons donc pas
G¶pQXPpUDWLRQGHVW\SHVGHU{OHRSpUDWLRQQHOVSRVVLEOHV mais le méta-modèle pourra évoluer.
3DU FRQWUH QRXV MXJHRQV LPSRUWDQW GH VSpFLILHU VL O¶XWLOLVDWHXU DXUD EHVRLQ GH V¶LGHQWLILHU
(identification RXLQRQ SRXU DFFpGHU j O¶XVDJH FRQVLGpUp OH PRGH G¶LGHQWLILFDWLRQ OH SOXV
184 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
IUpTXHQWHVWO¶DWWULEXWLRQG¶XQQRPG¶XWLOLVDWHXUHWG¶XQPRWGHSDVVH(QHIIHWODUHFRQQDLVVDQFH
GXU{OHRSpUDWLRQQHOSDVVHSDUFHWWHSKDVHG¶LGHQWLILFDWLRQ
Nous considérons O¶RXWLO FRPPH O¶DJUpJDWLRQ GH GHX[ pOpPHQWV : le dispositif matériel et
O¶DSSOLFDWLRQORJLFLHOOHComme nous O¶DYRQVIDLWGDQVOHPpWD-modèle précédent (MMPM), nous
incluons un type « autre ªGDQVFKDTXHpQXPpUDWLRQGDQVO¶pYHQWXDOLWpRXFHOOHV-ci ne suffiraient
SDVjGpILQLUO¶LQIRUPDWLRQYRXOXH
NRXV GLVWLQJXRQV SOXVLHXUV W\SHV G¶DSSOLFDWLRQ /HV DSSOLFDWLRQV dites natives sont
GpSHQGDQWHV GX V\VWqPH G¶H[SORLWDWLRQ 26 VXU OHTXHO HOOHV VRQW H[pFXWpHV DORUV TXH OHV
applications web sont exécutées sur serveur et accessibles via un navigateur web depuis
Q¶LPSRUWHTXHOGLVSRVLWLI/HVDSSOLFDWLRQVK\EULGHVXWLOLVent les deux modes de fonctionnement.
Dans tous les cas il sera nécessaire de déterminer la technologie de développement utilisée.
Nous définissons le dispositif matériel par plusieurs éléments. Nous pouvons inclure ici le
type « inconnu » car il se peut TXH O¶LQIRUPDWLRQ QH VRLW SDV DFFHVVLEOH GDQV XQ FDV GH ILJXUH
particulier. On identifie donc :
- un « type_dispositif » : ordinateur, tablette, smartphone, autre«
- un ou plusieurs « type_OS » (fonction du type de dispositif) : windows, macOS, linux,
windowsphone, iOS, android, autre«
- les contrôleurs de type FODYLHUVRXULVFODYLHUWRXFKSDGpFUDQWDFWLOHDXWUH«
- V¶LO\Dune connexion à internet : oui/non/inconnu
- V¶LO\DXQHHQWUpHYLGpR : oui/non/inconnu
- V¶LO\DXQHHQWUpHDXGLR : oui/non/inconnu
- V¶Ll y a une sortie vidéo : oui/non/inconnu
- V¶LO\DXQHVRUWLHDXGLR : oui/non/inconnu
Chaque usage (pour un collecticiel comme pour tout autre outil) est caractérisé par sa
temporalité (c.à.d. exécuté à des dates précises, souvent ou pas, à intervalles réguliers«) et sa
localisation (qui peut déterminer certaines conditions G¶XVDJHcomme un environnement bruyant
par exemple). Considérant les usages pendant un projet collaboratif de conception/construction
architecturale, nous pouvons typer ces caractéristiques par des valeurs connues qui pourront être
pWRIIpHVDXILOGHO¶pYROXWLRQGHO¶DSSURFKH :
- le type de temporalité : plusieurs fois par jour, tous les jours, tous les 2-3 jours, une fois par
semaine, XQHIRLVSDUPRLVPRLQVG¶XQHIRLV par mois, après chaque réunion, autre/inconnu«
- le type de localisation : au bureau, sur le chantier, au domicile, chez un client, dans un endroit
public, autreLQFRQQX«
Les relations entre usages
En comparant plusieurs usages, on pourra spécifier la relation entre les deux par ses
dimensions spatio-temporelles :
- la synchronisation, qui détermine V¶LOV VRnt effectués en même temps (synchrones) ou pas
(asynchrones),
- la colocalisation, qui détermine V¶LOV VRQW HIIHFWXpV DX PrPH HQGURLW (colocalisés) ou à
distance.
On dira que la temporalité et la localisation de chaque usage « déterminent » la relation entre
plusieurs usages (Figure 100).
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
185 Figure 100. Caractérisation de la relation entre usages
1.32.4 Conclusion : le méta-PRGqOHG¶XVDJH008
/¶association des méta-modèles que nous venons de définir compose le méta-PRGqOHG¶XVDJH
(MMU) (Figure 101). Le MMU est lié au méta-modèle de pratiques métiers (MMPM) par les
différentes relations que nous avons également définies. Conceptuellement, nous caractérisons
ainsi la médiatisation des pratiques par les usages. Comme le montre la section suivante,
O¶LQVWDQFLDWLRQGHFHPpWD-modèle se fait en plusieurs temps et à travers plusieurs formalismes.
186 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Figure 101. Représentation simplifiée du MMU (bleu) lié au MMPM
(rouge)
1.33
/HVPRGqOHVG¶XVDJH
Le MMU est un méta-modèle qui caractérise des concepts tirés du domaine du Génie Logiciel
HW GH OD FRQFHSWLRQ G¶,+0 /HV IRUPDOLVPHV XWLOLVpV SRXU O¶LQVWDQFLHU VHURQW HX[ DXVVi relatifs à
ces deux domaines. Ainsi, le point de vue opérationnel sera exprimé par les concepteurs à travers
GHV FRQFHSWV HW GHV IRUPDOLVPHV TX¶LOV FRPSUHQQHQW HW TX¶LOV RQW O¶KDELWXGH GH PDQLSXOHU Ces
formalismes sont les suivants :
- le diagramme de caVG¶XWLOLVDWLRQ,
- le diagramme de tâches,
- le maquettage G¶LQWHUIDFHVXWLOLVDWHXUV,
- et des tableaux.
1.33.1 Le « GLDJUDPPHGHFDVG¶XWLOLVDWLRQFRQWH[WXDOLVp »
Nous XWLOLVRQVOHGLDJUDPPHGHFDVG¶XWLOLVDWLRQ(Figure 102) pour modéliser dans un premier
temps toutes les LQWHQWLRQVGHO¶XWLOLVDWHXU et les réponses attendues GHO¶RXWLO (les tâches outil).
Elles sont modélisées par des use case différenciés graphiquement. Les paquets rouges sont
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
187 utilisés pour représenter O¶Rpération dont sont déduites les intentions utilisateurs. Les paquets
situés hors du FDGUHGHO¶RXWLO représentent les opérations qui ont été identifiées dans la pratique
PDLV TXL QH VRQW SDV O¶REMHW du travail de conception en cours. CRPPH QRXV O¶DYRQV GLW
SUpFpGHPPHQWWRXWFDVG¶XWLOLVDWLRQQ¶HVWSDVGLUHFWHPHQWOLp à une opération métier, comme par
H[HPSOH OHV FDV GH FRQILJXUDWLRQ V¶LGHQWLILHU SDUDPpWUHU« &HV FDV G¶XWLOLVDWLRQ TXL GRLYHQW
pourtant être spécifiés sont distingués par un package bleu.
Figure 102. Adaptation du formalisme des diagrammes de cas
G¶XWLOLVDWLRQ
À FH QLYHDX G¶DQDO\VH QRXV GpFULYRQV pJDOHPHQW OH FRQWH[WH GH O¶XVDJH ,FL OH IRUPDOLVPH
utilisé est un WDEOHDX pGLWDEOH SDU OLVWHV GH FKRL[ PXOWLSOHV RX SDU FKDPSV G¶pGLWLRQ OLEUHV /D
composition de ces deux modèles (F¶HVW j GLUH OH GLDJUDPPH GH FDV G¶XWLOLVDWLRQ HW OH WDEOHDX
IRUPH FH TXH O¶RQ D DSSHOp OH © GLDJUDPPH GH FDV G¶XWLOLVDWLRQ FRQWH[WXDOLVps » (en anglais
« contextual use case »).
Le « FDV G¶XWLOLVDWLRQ FRQWH[WXDlisé » illustré ci-après (Figure 104) représente un exemple
G¶usage particulier G¶XQ XWLOLVDWeur de CRTI-weB pour accomplir une pratique que nous avons
modélisée dans le chapitre précédent. La pratique considérée ici est « diffuse les documents de
FRQFHSWLRQjO¶pTXLSHGHFRQFHSWLRQ » (Figure 103). Au cours de cet usage O¶XWLOLVDWHXUVRXKDLWH
partager plusieurs fichiers (intention « upload multiple files ») mais attend de O¶RXWLO TX¶LOgroupe
les fichiers choisis en un seul document CRTI-weB (tâche outil « upload files as one CRTI-weB
document »). Ce nouvel XVDJHYDULHGHO¶XVDJH© traditionnel » qui consiste à créer un document
CRTI-weB pour chaque fichier partagé. ,OV¶DJLWG¶XQFDVVLPSOHPDLVTXL UHIOqWHELHQO¶DGDSWDWLRQ
à un besoin en termes G¶XVDJHGHODSDUWG¶utilisateurs dans leur contexte de projet.
188 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Figure 103. Rappel : modélisation de la pratique « diffusion des
documents »
Figure 104. « Contextual Use Case » de la pratique « diffuse design
documents for designers team »
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
189 /D WHPSRUDOLWp GH O¶XVDJH HVW LGHQWLILpH FRPPH effectué environ une fois par jour. On
LPDJLQH HQ HIIHW TX¶j OD ILQ G¶XQH MRXUQpH GH WUDYDLO XQ FRQFHSWHXU YHLOOH à SDUWDJHU FH TX¶LO D
produit. Le lieu GHO¶XVDJHHVWO¶DJHQFHGDQVODTXHOOHLl travaille.
-
Il y a plusieurs rôles opérationnels définis sur la plateforme CRTI-weB (service document) :
O¶XWLOLVDWHXU classique qui peut utiliser tous OHV VHUYLFHV GH O¶RXWLO SDUWDJH GH GRFXPHQWV
WpOpFKDUJHPHQWDMRXWG¶DFWLRQVHWF,
le superviseur projet : il peut en plus relancer des actions (par exemple les demandes de
YDOLGDWLRQDX[TXHOOHVRQQ¶DSDVUpSRQGX,
O¶DGPLQLVWUDWHXU GX SURMHW : il peut ajouter des nouveaux utilisateurs au projet et créer des
nouveaux projets.
Ici nous considérRQV O¶XWLOLVDWHXU FRPPH XQ XWLOLVDWHXU FODVVLTXH (classic user) dont le rôle
organisationnel est celui de concepteur (designer). /¶XVDJH GH OD SODWHIRUPH GHPDQGH TXH
O¶XWLOLVDWHXU V¶LGHQWLILH /¶DSSOLFDWLRQ HW OH GLVSRVLWLI VRQW pJDOHPHQW GpILQLV FRQIRUPpPent à la
caractérisation du méta-modèle.
Les relations entre usages
La modélisation GHV UHODWLRQV HQWUH O¶XVDJH VSpFLILp HW G¶DXWUHV usages SUHQG OD IRUPH G¶XQ
tableau dans lequel on renseigne SRXU FKDFXQ G¶HX[ O¶LGHQWLILDQW GX FDKLHU G¶H[LJHQFHV qui les
spécifie, O¶REMHFWLIGHO¶XVDJH, la synchronisation dans le temps (synchrone, asynchrone) et la colocalisation (co-localisé, à distance). 'DQVO¶H[HPSOHFL-dessous (Figure 105) RQFRQVLGqUHO¶XVDJH
qui consiste à récupérer les documents partagés. 3DUUDSSRUWjO¶XVDJHTXHQRXVYHQRQVGHGpFULUH
O¶H[pFXWLRQSHXWVHIDLUHGHPDQLqUHDV\QFKURQHHWjGLIIpUHQWVHQGURLWV
Figure 105. 0RGpOLVDWLRQGHODUHODWLRQDYHFG¶DXWUHVXVDJHV
1.33.2 Les diagrammes G¶interaction et maquettages G¶LQWHUIDFHV
Pour modéliser les autres niveaux de tâches, nous nous sommes inspirés des modèles de
tâches références (CTT et K-MAD). Après avoir utilisé K-MAD dans une première
expérimentation, nous avons identifié la nécessité de proposer un formalisme personnalisé (Figure
107). Le choix de ce nouveau formalisme a été guidé par deux motivations :
- l¶XQH pWDLW UHODWLYH j O¶DVSHFW JUDSKLTXH : pour assurer la correspondance avec les modèles
précédents, nous voulions pouvoir déterminer notre propre « charte graphique »,
- l¶DXWUH pWDLW UHODWLYH DX FRQWHQX : nous voulions modéliser, en plus des tâches, les objets
G¶LQWHUDFWLRQVFDUDFWpULVpVGDQVQRWUHPpWD-PRGqOHG¶XVDJH.
190 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Nous nous sommes à nouveau servis du framework GMF G¶(FOLSVHSRXUJpQpUHUO¶pGLWHXUGH
FH QRXYHDX GLDJUDPPH TXH QRXV DSSHORQV GLDJUDPPH G¶LQWHUDFWLRQV Un diagramme
G¶LQWHUDFWLRQVGpFRPSRVHXQ© contextual use case ».
Dans ce formalisme, chacune des intentions GH O¶XWLOLVDWHXU identifiées dans le use case
devient la racine (1er niveau) G¶un arbre composé de tâches utilisateurs abstraites (2e niveau)
puis concrètes (3e niveau).
Les tâches outils apparaissent également. Elles sont définies comme des tâches abstraites et
sont également décomposées en tâches concrètes. Ces tâches concrètes sont relatives à la
perception du « feedback » qui rend compte de l¶H[pFXWLRQGHOD tâche outil H[O¶DIILFKDJHG¶XQH
notification RXO¶pPLVVLRQG¶XQVRQ).
Les propriétés graphiques des intentions utilisateurs et tâches outil sont identiques à celles
utilisées GDQV OH GLDJUDPPH GH FDV G¶XWLOLVDWLRQ : ellipse au contour rouge pour O¶LQWHQWLRQ HW
ellipse au fond jaune pour la tâche outil. Cela SHUPHW G¶DVVXUHU visuellement la correspondance
entre les conFHSWV G¶XQ PRGqOH j XQ DXWUH Les tâches utilisateurs sont représentées par des
ellipses au contour jaune. Les tâches concrètes sont représentées par des rectangles gris (Figure
106).
Nous complétons cette structure traditionnelle dH O¶DUEUH GHV WkFKHV par les objets
G¶LQWHUDFWLRQ définis précédemment. /¶REMHWG¶LQWHUDFWLRQFDUDFWpULVHODGRQQpHPDQLSXOpHDLQVL
que la forme que prend cette dernière. ,OV DSSDUDLVVHQW GDQV OH GLDJUDPPH VRXV IRUPH G¶XQ
rectangle noir aux coins arrondis.
Figure 106. /pJHQGHGXGLDJUDPPHG¶LQWHUDFWLRQV
Le diagramme suivant (Figure 107) spécifie le use case modélisé précédemment qui formalise
O¶XVDJH GH &57,-ZH% GDQV OHTXHO O¶XWLOLVDWHXU VRXKDLWH SDUWDJHU Slusieurs fichiers et attend du
O¶RXWLOTX¶LOJURXSHOHVILFKLHUVFKRLVLVHQXQVHXOGRFXPHQW Cette intention « envoyer plusieurs
fichiers » (« upload multiple files ») est décomposée en deux tâches abstraites : 1) le choix des
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
191 fichiers incluant le choix du regroupement puis 2) le nommage. Le choix des fichiers se définit
par le suivi des tâches concrètes suivantes (rectangles gris sur la figure) :
- activation de la fonction « nouveau chargement »,
- sélection des fichiers,
- visualisation du chargement,
- sélection du regroupement,
- et enfin de validation de la sélection.
La tâche outil est spécifiée par une tâche concrète de perception « identification de la
notification ».
Figure 107. 'LDJUDPPHG¶LQWHUDFWLRQGpFRPSRVDQWO¶LQWHQWLRQ© upload
multiple files»
Les maquettages
Le maquettage SHUPHW GH UHSUpVHQWHU O¶LQWHUIDFH DWWHQGXH j XQ LQVWDQW SUpFLV sans perdre de
temps dans les détails graphiques. Le maquettage est un mode de modélisation complémentaire au
GLDJUDPPHG¶LQWHUDFWLRQV pour instancier une partie de notre méta-modèle d¶XVDJH Il permet en
HIIHWG¶LOOXVWUHUOHVWkFKHVFRQFUqWHVTXLRQWpWpVSpFLILpHV comme le montre la Figure 108.
Le risque lié maquettage est de le faire intervenir trop tôt dans le processus de conception.
Cela a pour conséquence de OLPLWHUODFRQFHSWLRQG¶XQV\VWqPHjFHOOHG¶une interface graphique
FRPSRVpHGHIRQFWLRQQDOLWpVVRXKDLWpHVPDLV GRQWO¶DGDSWDWLRQDXx besoins ne peut être validée.
/¶LQWpJUDWLRQGXPDTXHWWDJHDSUqVune étude des pratiques métiers VXLYLHG¶XQHLGHQWLILFDWLRQGHV
intentions et tâches utilisateurs liées permet de limiter les propositions « à ce qui est nécessaire ».
192 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Figure 108. Maquettages des tâches concrètes « loading visualization »
et « clustering mode selection»
1.33.3 ,QWpJUDWLRQGDQVOHFDKLHUG¶H[LJHQFHV
/D PRGpOLVDWLRQ GH O¶XVDJH HVW IRUPDOLVpH GDQV OD VHFRQGH SDUWLH GX FDKLHU G¶H[LJHQFHV. Le
« GLDJUDPPHGHFDVG¶XWLOLVDWLRQFRQWH[Wualisé » et le tableau spécifiant OHVUHODWLRQVDYHFG¶DXWUHV
usages sont insérés dans un premier temps. Comme lors de O¶DQDO\VHGHVSUDWLTXHVPpWLHUV, il est
également possible G¶DMRXWHUGHO¶LQIRUPDWLRQDGGLWLRQQHOOH Le but est de laisser aux concepteurs
la possibilité de consigner les LQIRUPDWLRQVTX¶LOVjugeront utiles mais que les modèles formalisés
Q¶DXUaient pas permis de prendre en compte. Ces informations supplémentaires pourront être
raffinées au fur et à mesure des verVLRQVGXFDKLHUG¶H[LJHQFHV
&HV LQIRUPDWLRQV DGGLWLRQQHOOHV SUHQQHQW OD IRUPH G¶XQ WDEOHDX GRQW OHV SDUWLHV YLVHQW j
FRPSOpWHU OD GHVFULSWLRQ GX FRQWH[WH GH O¶XVDJH GH O¶XWLOLVDWHXU HW GH O¶RXWLO DSSOLFDWLRQ dispositif).
On inclut de la même manière GDQVODGHX[LqPHSDUWLHGXFDKLHUG¶H[LJHQFHV le diagramme
G¶LQWHUDFWLRQHWOHVPDTXHWWDJHVSURGXLWV
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
193 Figure 109. Tableau de saisie des informations supplémentaires dans le
FDKLHUG¶H[LJHQFHV
1.34
Conclusion
La caractpULVDWLRQ GHV SUDWLTXHV SHUPHWWDLW G¶DSSUpKHQGHU © FH TXH OHV DFWHXUV G¶XQ SURMHW
font ªFHOOHGHO¶XVDJHHVWGpGLpHjODFRPSUpKHQVLRQGH© comment ils le font ª,OV¶DJLWLFLGH
décrire :
- O¶XWLOLVDWHXUHWO¶RXWLO,
- le contenu médiatisé manipulé,
- les tâches effectuées autour de ce contenu, par les utilisateurs et l¶RXWLO.
194 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
Figure 110. /HFKRL[G¶XQXVDJHHWVDGpILQLWLRQ
La conceptualisation, formalisée par des méta-modèles sous forme de diagrammes de classes
UML, nous a permis de lier conceptuellement les aspects organisationnels (relatifs aux pratiques)
aux aspects opérationnels (relatifs aux usages). &H OLHQ VH UHWURXYH GDQV O¶LQVWDQFLDWLRQ GH FHV
méta-modèles à travers O¶DGDSWDWLRQGHVIRUPDOLVPHVXWLOLVpVjFHWHIIHW (Figure 111).
$LQVLOHGLDJUDPPHGHFDVG¶XWLOLVDWLRQVHVWGLUHFWHPHQWFRQoXSRXUUpSRQGUHDX[RSpUDWLRQV
métiers identifiées. Il est complété par diverses informations de contexte, ce qui en fait un modèle
SHUWLQHQWSRXUGpFULUHODPpGLDWLVDWLRQG¶XQHSUDWLTXHSDUO¶Xsage.
/H WUDYDLO VXU OHV WkFKHV G¶LQWHUDFWLRQ SHXW SDUDvWUH VXSHUIOX VXU XQ FDV VLPSOH FRPPH FHOXL
présenté. Le diagUDPPH GH FDV G¶XWLOLVDWLRQ aurait suffi j GpFULUH O¶XVDJH DWWHQGX Il pourra
FHSHQGDQWrWUHSOXVXWLOHGDQVG¶DXWUHVFDVG¶pWXGHFRPPHQRXs le verrons dans le chapitre 12 de
ce manuscrit. Dans un Framework de MDA (Model-driven Architecture) comme Caméléon
introduit au § 1.11.2, le premier niveau du processus (le CIM) définit les tâches utilisateurs et les
concepts PDQLSXOpV0rPHVLFHODQ¶HVWSDVH[SORLWpLFLODGpILQLWLRQGXGLDJUDPPHG¶LQWHUDFWLRQV
pourra donc V¶LQVFULre dans ce geQUHG¶DSSURFKHVJpQpUDWLYHV&eODSRXUUDIDLUHO¶REMHWGH travaux
futurs.
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
195 Figure 111. Correspondances entre le diagramme de pratiques et les
modèleVG¶XVDJHdiagramme GHFDVG¶XWLOLVDWLRQ G¶LQWHUDFWLRQV et
maquettages)
196 Chapitre 10 ± La modélisation des usages : le point de vue opérationnel |
$ORUV TXH OH WUDYDLO VXU OHV SUDWLTXHV HVW XQ WUDYDLO G¶DQDO\VH V¶DPRUFH LFL OH WUDYDLO GH
conception. En effet, nous caractérisons le contexte attendu, les intentions ainsi que les scénarii
G¶LQWHUDFWLRQV LGpDX[ (Q G¶DXWUHV WHUPHV LO V¶DJLW LFL GH FRQFHYRLU O¶XVDJH idéal, sans
SUpRFFXSDWLRQVG¶RUGUHWHFKQLTXHHWGRQFVDQVSRXUO¶LQVWDQWDSSUpKHQGHUOHVFDVG¶HUUHXUVHWOHV
limites technologiques possibles. Les sociétés de services jouent ce rôle de concepteur en tirant
SDUWLGXWUDYDLOGHVH[SHUWVPpWLHUVTXLLQWHUYLHQQHQWGDQVO¶DQDO\VHGHVSUDWLTXHV/HSDVVDJHG¶XQ
point de vue à un autre sur la base de modèles doit assister cette collaboration.
La section suivante illustre comment la description GHO¶XVDJHQRXVJXLGH vers la spécification
de services, G¶XQSRint de vue purement fonctionnel. Dans la continuité de notre approche, nous
FRQFHSWXDOLVRQV OH VHUYLFH HQ IRQFWLRQ GHV FRQFHSWV GH O¶XVDJH SRXU DVVXUHU OD FRUUHVSRQGDnce
entre les modèles proposés &HWWH pWDSH Q¶HVW DXWUH TXH OD ILQ GX SURFHVVXV GH FRQFHSWLRQ de
services DORUV TX¶j WUDYHUV O¶XVDJH RQ SHUoRLW O¶RXWLO comme « une boite noire » (en décrivant
abstraitemHQW OHV WkFKHV GH O¶RXWLO HQ UpSRQVH au[ WkFKHV GH O¶XWilisateur), la description des
VHUYLFHV SURSRVpVGpWDLOOHODVROXWLRQWHOOHTX¶HOOHGHYUDrWUH LPSOpPHQWpH. 7HOTXHQRXV O¶DYRQV
introduit, plusieurs usages alternatifs peuvent correspondre à une même pratique. La prise en
compte de cette variation dans les usages nous permet de répercuter cette diversité dans les
services proposés pour convenir ainsi à une majorité des utilisateurs finaux.
Atteindre ce niveau de détail est nécessaire pour les développeurs. En effet, cela permet de
percevoir WRXWHVOHVOLPLWHVTX¶LOIDXGUDVXUPRQWHUSRXUGpYHORSSHUODVROXWLRQFHTXLSRXUUDIDLUH
varier la conception de celui-ci. Le dialogue et la compréhension entre concepteurs et
développeurs sont la clé de cette troisième étape.
| Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
197 Chapitre 11 ± La modélisation des
services : le point de vue
fonctionnel
Le point de vue fonctionnel porte sur la description des services qui matérialisent les usages
GpILQLVSUpFpGHPPHQW&HFKDSLWUHGpILQLWOHFRQFHSWGHVHUYLFHWHOTX¶XWLOLVpGDQVQRWUHPpWKRGH
et le caractérise par un méta-modèle de service (MMS) qui est mis en correspondance avec le
méta-PRGqOHG¶XVDJH (MMU). Cette correspondance définit la matérialisation des usages par les
services tout comme la correspondance entre le MMU et le MMPM (Méta-modèle des pratiques
métiers) caractérise la médiatisation des pratiques par les usages. Dans un projet de conception et
développement de service, le point de vue fonctionnel est celui porté par les développeurs qui
implémentent la solution pour DWWHLQGUH O¶XVDJH DWWHQGX &HWWH VROXWLRQ HVW PRGpOLVpH SDU
instanciation du MMS, et de façon à supporter le dialogue avec les concepteurs notamment
ORUVTX¶LOV¶DJLWGHUHQGUHFRPSWHGHVOLPLWHVHWFRQWUaintes techniques rencontrées. Les échanges
entre concepteurs et développeurs peuvent avoir un impact sur le point de vue opérationnel,
générant ainsi des itérations dans le déroulement de la méthode.
1.35
Définitions et concepts
1.35.1 Services métier et services informatiques I CT
La première partie du chapitre 5 de FHWWHWKqVHDpWpGpGLpHjO¶pWXGHGXFRQFHSWGHVHUYLFH
6XU OD EDVH GHV GpILQLWLRQV LQWURGXLWHV DORUV QRXV H[SULPHURQV OH VHQV TX¶DGRSWH OH FRQFHSW GH
service dans notre méthode. Nous pourrons ensuite le caractériser.
Pour rappel, nous avons défini de manière générale un service comme une prestation qui met
j GLVSRVLWLRQ G¶XQ FOLHQW © une capacité technique ou intellectuelle » pour supporter un besoin.
Nous distinguons deux types de services : les services métier et les services informatiques ICT
(ServLFHVLQIRUPDWLTXHVGH7HFKQRORJLHVGHO¶,QIRUPDWLRQHWGHOD&RPPXQLFDWLRQ.
Nous avions déjà évoqué cette distinction au chapitre 2 ORUVGHODGHVFULSWLRQGHO¶RXWLO&57,weB. En effet, celui-ci propose deux services dits métiers que sont le service « documents » et le
| Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
199 service « comptes-rendus », décomposés en services informatiques ICT comme la rédaction, la
JpQpUDWLRQ G¶XQ SGI OD FRQVXOWDWLRQ« FI 1.4.3). Le terme service métier est ici emprunté au
doPDLQHGHO¶HQWUHSULVH et réinterprété LOQ¶HVWSOXVpFKDQJpHQWUHGHX[SDUWLHVRSpUDQWHVG¶XQH
HQWUHSULVHPDLVLOHVWRIIHUWSDUXQRXWLOSRXUUpSRQGUHjXQEHVRLQPpWLHU/¶XWLOLVDWLRQGXWHUPH
VHUYLFH LQIRUPDWLTXH UHVSHFWH TXDQW j OXL OH VHQV TX¶RQ D Su lui associer, notamment dans
(Kohlborn et al. 2009) : F¶HVW XQHIRQFWLRQQDOLWpORJLFLHOOH TXLVXSSRUWH O¶H[pFXWLRQ G¶XQVHUYLFH
métier.
1RXVJDUGHURQVFHV GHX[ GpILQLWLRQV j O¶HVSULW SRXU FDUDFWpULVHU OHSRLQWGH YXHIRQFWLRQQHO
troisième et dernière étape de la méthode PUSH pour la proposition de services adaptés.
1.35.2 Caractérisation des services
(Q UHVSHFWDQW OH YRFDEXODLUH XWLOLVp GDQV OH GRPDLQH GH O¶HQWUHSULVH RULHQWpH VHUYLFHs, nous
caractérisons un service par : un nom, une description, un client et un fournisseur.
/D GHVFULSWLRQ G¶XQ VHUYLFH FRPSUHQG QRUPDOHPHQW j OD IRLV OHV SURSULpWpV IRQFWLRQQHOOHV
(capacités du service, paramètres pouvant varier) et les propriétés non fonctionnelles (qualité dans
la fourniture du service SUL[« &HV GHUQLqUHV QH IDLVDQW SDV O¶REMHW GH FH WUDYDLO QRWUH
description concernera essentiellement les capacités et paramètres du service.
Le fournisseur propose au client le service dont il a besoin. Dans notre cas, le fournisseur
Q¶HVWDXWUHTXHO¶RXWLOFRQVLGpUpOHFOLHQWUHSUpVHQWDQWDORUVO¶XWLOLVDWHXUGHFHWRXWLO
(Kohlborn et al. 2009) évoque deux caractérisations des relations qui ont lieu au cours de
O¶H[pFXWLRQGXVHUYLFH :
- le modèle interactionnel qui FDUDFWpULVH O¶interaction avec le client par des entrées et des
sorties de données (les Inputs et les Outputs),
- le modèle opérationnel qui décompose le service en un processus G¶DFWLRQVRXVRXV-services)
Le méta-modèle proposé dans la section suivante formalise ces quelques éléments de
caractérisation du service. Nous y incluons :
- la caractérisation de la « matérialisation ªG¶XQXVDJHSDUXQVHUYLFHPpWLHU
- ODFRPSRVLWLRQG¶XQVHUYLFHPpWLHU en services informatiques ICT
- ODGpFRPSRVLWLRQG¶XQVHUYLFH,&7 suivant un modèle architecture logicielle
1.36
M éta-modèle de service
1.36.1 Le service PDWpULDOLVDWLRQGHO¶XVDJH
-
5DSSHORQVTX¶jFHWWHpWDSHGHla conception de notre méthode :
QRXV FRQQDLVVRQV O¶RUJDQLVDWLRQ SURIHVVLRQQHOOH G¶XQ SURMHW $,& FDUDFWpULVpH par le métamodèle du contexte coopératif (MMCC),
nous avons caractérisé les comportements métiers sous forme de pratiques (collectives et
individuelles) HWG¶RSpUDWLRQVjSDUWLUGHVconcepts de ce MMCC et en créant le méta-modèle
des pratiques métiers MMPM),
nous avons FDUDFWpULVp OD PpGLDWLVDWLRQ GH FHV SUDWLTXHV SDU OHV XVDJHV G¶RXWLO GpGLpV
GpILQLVVDQW O¶RXWLO O¶XWLOLVDWHXU HW O¶LQWHUDFWLRQ TXL D OLHX HQWUH OHV GHX[ GDQV OHXU FRQWH[WH
particulier) en créant le méta-PRGqOHG¶XVDJe (MMU) à partir des concepts du MMPM .
200 Chapitre 11 ± La modélisation des services : le point de vue fonctionnel |
,OV¶DJLWPDLQWHQDQWGHFDUDFWpULVer la matérialisation des usages par les services en créant le
méta-modèle de services (MMS, Figure 112) dérivé du MMU. Conformément à la description que
nous en avons faite plus haut :
- le service métier PDWpULDOLVHO¶XVDJHLOHVWFDUDFWpULVpSDUXQQRPHWXQHGHVFULSWLRQ
- son fournisseur représente O¶RXWLO
- il est composé de services informatiques ICT,
- le client de ces services représente O¶XWLOLVDWHXUGHO¶RXWLO
- la relation client-VHUYLFHQ¶HVWDXWUHTXHO¶LQWHUDFWLRQHQWUHO¶XWLOLVDWHXUHWRXWLOSUpFpGHPPHQW
définie par les tâches HWREMHWVG¶LQWHUDFWLRQ.
Les inputs et outputs sont des flux de données en entrée et sortie. Ils sont définis par une
action effectuée et une donnée manipulée. Les inputs correspondent aux tâches concrètes
G¶LQWHUDFWLRQHWOHVRXWSXWVDX[WkFKHVGHSHUFHSWLRQ/DGRQQpHDpWpGpILQLHDXWUDYHUVGXFRQFHSW
G¶REMHWG¶LQWHUDFWLRQ
Figure 112. Caractérisation du service (concepts en bleu) matérialisant
O¶XVDJH (concepts en rouge)
| Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
201 1.36.2 Les composants du service I CT
Nous décrivons le service ICT comme un ensemble de composants logiciels qui
communiquent entre eux. Cette architecture pHXW rWUH FDUDFWpULVpH SDU XQ PRGqOH G¶architecture
logicielle.
1RXVDYRQVLQWURGXLWSUpFpGHPPHQWOHVPRGqOHVG¶DUFKLWHFWXUHORJLFLHOOHHWSDUWLFXOLqUHPHQW
ceux dédiés aux collecticiels (cf § 1.16.31RXVDYRQVpWHQGXO¶XQGHX[, le modèle MVC, pour y
inclure la composante collaborative, créant ainsi le modèle Co-MVC (Figure 113). Ainsi, dans la
caractérisation du service :
le Modèle caractérise les données et les méthodes pour manipuler ces données (par exemple
DMRXWHU VXSSULPHU UpFXSpUHU« /H PRGqOH SULYp FRQFHUQH OD JHVWLRQ GHV GRQQpHV SRXU
chaque utilisateur (ex. sur son ordinateur personnel). Il se synchronise avec le modèle partagé
qui met en commun les données pour tous les utilisateurs,
- la 9XH HVW O¶LQWHUIDFH DYHF ODTXHOOH O¶XWLOLVDWHXU LQWHUDJLW 3DU OH ELDLV GH IHQrWUHV G¶LF{QHV
HWF« HOOH FDSWH OHV LQWHUDFWLRQV GH O¶XWLOLVDWHXU SDU H[HPSOH OHV FOLFNV HW OXL UHQYRLH GHV
informations,
- le Contrôleur caractérise les composants logiciels qui transmettent les requêtes depuis la vue,
WUDQVPHWWHQWOHVGRQQpHVLQWHUURJHQWOHVEDVHVGHGRQQpHVUpDFWXDOLVHQWODYXH«&HVRQWGHV
applications, des services-ZHE«2QSHXWSDUOHULFLGHVRXV-services.
Figure 113. Rappel : le modèle Co-MVC
Ainsi, le méta-modèle de services (Figure 114) caractérise le service ICT comme un ensemble
de ces trois types de composants : la Vue, le Contrôleur, le Modèle spécifié par le modèle privé et
le modèle partagé. Chacun G¶HX[est caractérisé par un nom et la technologie de développement
utilisée (ex. une interface JAVA (vue), un web-VHUYLFH5(67FRQWU{OHXU«/HVpFKDQJHVTXL
V¶RSqUHQW HQWUH HX[ VRQW GHV DFWLRQV PDQLSXODQW GHV GRQQpHV au même titre que les Inputs et
Outputs.
202 Chapitre 11 ± La modélisation des services : le point de vue fonctionnel |
Figure 114. Caractérisation du service ICT et ses composants
1.36.3 Le méta-modèle des services I CT adaptés
Par la composition des deux méta-modèles présentés dans cette section, nous créons notre
Méta-Modèle de Services ICT (MMS) de la même façon que nous avons composé les métaPRGqOHV GH SUDWLTXHV HW G¶XVDJHV 0030 HW 008 &H TXH QRXV DSSHORQV 0pWD-Modèle des
6HUYLFHV $GDSWpV 006$ HVW O¶DVVRFLDWLRQ GH FHV WURLV PpWD-modèles. En effet, partant du
SRVWXODW TX¶XQ VHUYLFH HVW DGDSWp V¶LO UpSRQG j des besoins métiers, cette association qui
caractérise la médiatisation des pratiques par les usages, eux-mêmes matérialisés par les services
caractérise donc cette adaptation.
| Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
203 204 Chapitre 11 ± La modélisation des services : le point de vue fonctionnel |
Figure 115. Version simplifiée du Méta-Modèle des Services Adaptés (MMSA), composition du MMPM (en rouge) du MMU (en bleu) et du MMS (en vert)
| Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
205 206 Chapitre 11 ± La modélisation des services : le point de vue fonctionnel |
1.37
M odélisation des services et implémentation
Nous utilisons le diagramme de séquences pour décrire le comportement du client et du
service. Cette description doit être conforme au Méta-Modèle de Services qui intègre le modèle
G¶DUFKLWHFWXUH &R-MVC. Nous adoptons pour cela le diagramme de séquences UML, un
formalisme utilisé en conception logicielle pour décrire la solution dans une architecture logicielle
et matérielle (Len Bass et al. 2003) (cf. § 1.9.3, Figure 24).
1.37.1 Le diagramme de séquence
,O V¶DJLW G¶LQVWDQFLHU LFL OH Méta-Modèle GHV 6HUYLFHV 1RXV UHSUpVHQWRQV VXU OD EDVH G¶XQ
diagramme de séquences UML O¶RXWLOTXLIRXUQLWOHservice métier, la description de ce service
métier, le client, le service I CT considéré, ses composants et enfin les échanges (inputs, outputs
HWDFWLRQVTXLV¶RSqUHQW
5HSUHQRQVO¶H[HPSOHGXSDUWDJHGHGRFXPHQWVSRXU LOOXVWUHUFHWWHpWDSH,OV¶DJLWG¶HIIHFWXHU
FH SDUWDJH YLD O¶RXWLO &57,-weB, service (métier) documents (voir § 1.33). Le diagramme de
tâches qui a été créé ORUVGHODGpILQLWLRQGHO¶XVDJHest repris ci-dessous (Figure 116).
Figure 116. Rappel 'LDJUDPPHG¶LQWHUDFWLRQGpFRPSRVDQWO¶LQWHQWLRQ
« upload multiple files»
/HV WkFKHV FRQFUqWHV G¶LQWHUDFWLRQ HW GH SHUFHSWLRQ UHFWDQJOHV JULV JXLGHQW OD VSpFLILFDWLRQ
des échanges client-service. ,OV¶DJLWDORUVGe définir le comportement du service ICT en décrivant
les actions de ses composants (Figure 117).
1RXV VRPPHV GDQV XQ FDV G¶DGDSWDWLRQ G¶XQ VHUYLFH GpMj H[LVWDQW /D VROXWLRQ WHFKQLTXH
adoptée est donc dépenGDQWHGHODWHFKQRORJLHXWLOLVpHHWV¶LQVFULWGDQVOHVGpYHORSSHPHQWVGpMj
HIIHFWXpV /HV GpYHORSSHXUV UHVSRQVDEOHV GH FHV GpYHORSSHPHQWV VRQW j PrPH G¶H[SULPHU FH
SRLQWGHYXHIRQFWLRQQHOSRXUGpFULUHFHTX¶LOVYRQWLPSOpPHQWHU
L¶XWLOLVDWHXUPDQLSXOHdes fichiers « physiques » (stockés sur son orGLQDWHXUHWTX¶LOVRXKDLWH
copier sur un serveur externe) /RUVTX¶LO D FKRLVL OHV ILFKLHUV TX¶LO YHXW SDUWDJHU OH VHUYLFH
LQIRUPDWLTXH OHV FRSLH VXU OH VHUYHXU VRXV IRUPH G¶XQ ILFKLHU =,3 3XLV LO FUpH GDQV OD base de
données un document CRTI-weB DXTXHO LO DVVRFLH OH ILFKLHU =,3 TX¶LO YLHQW GH FUpHU
| Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
207 7HFKQLTXHPHQWFHWWHDVVRFLDWLRQVHIDLWSDUODGpILQLWLRQGHO¶DWWULEXW© localisation » du document
CRTI-weB avec O¶85/GXILFKLHU=,3FUppVXUOHVHUYHXU
Figure 117. Diagramme de séquence modélisant le service ICT de
téléchargement multi-fichiers YLDO¶RXWLO&57,-weB (service métier
document)
1.37.2 ,QWpJUDWLRQGDQVOHFDKLHUG¶H[LJHQFHV
La dernière partie du cDKLHU G¶H[LJHQFHV HVW pGLWpH ORUV GH O¶H[SUHVVLRQ GX SRLQW GH YXH
fonctionnel par la modélisation des services. Cette phase est directement suivie par les premières
activités de développement et se réitère pendant celles-ci. En effet, même si le service a été
spécifié correctement, il est courant que les développeurs et les concepteurs doivent revoir
FHUWDLQVGpWDLOVFRPPHODJHVWLRQGHVFDVG¶HUUHXUVSDUH[HPSOH
/¶DMRXWGHUHPDUTXHVHWFRPPHQWDLUHVVXUOHVGLDJUDPPHVGHVpTXHQces permettra de rendre
FRPSWH GHV VSpFLILFLWpV GX VHUYLFH /HV RXWLOV G¶pGLWLRQ GH PRGqOHV 80/ FRPPH 6WDU80/
208 Chapitre 11 ± La modélisation des services : le point de vue fonctionnel |
permettent cette expression de commentaires sous forme de « notes » qui peuvent être associées à
des éléments du diagramme.
Figure 118. Exemple de note ajoutée à un Input dans un diagramme de
séquences modélisant un service
'DQVFHUWDLQVFDVVLSDUH[HPSOHOHFRQFHSWHXUQ¶DYDLWSDVUpHOOHPHQWFRQVFLHQFHGHVOLPLWHV
WHFKQLTXHVGHO¶RXWLOLOVHSHXWTXHOHVFpQDULRG¶XVDJHQHSXLVVHSDVrWUHPDWpULDOLVpWHOTX¶LOD
pWp FRQoX /D PRGpOLVDWLRQ G¶XQ VHUYLFH DOWHUQDWLI SHUPHWWUD GH VXSSRUWHU OH GLDORJXH HQWUH OHV
développeurs et les concepteurs qui devront à terme repenser leur usage.
/RUV GHV PRGLILFDWLRQV TX¶HOOHV VRLHQW UHODWLYHV DX[ PRGqOHV GH VHUYLFHV RX aux modèles
G¶XVDJHODFUpDWLRQG¶XQHQRXYHOOHYHUVLRQPLVHjMRXUGXFDKLHUG¶H[LJHQFHV permettra :
- GHIRUPDOLVHUOHVGpFLVLRQVSULVHVDILQGHSRXYRLUV¶\UpIpUHU
- HWGHJDUGHUXQHWUDFHGHO¶pYROXWLRQGXSURMHWHWDLQVLMXVWLfier, à posteriori, les changements
entrepris.
1.37.3 Développements
/H SURFHVVXV OLp j O¶LPSOpPHQWDWLRQ GHV VHUYLFHV VSpFLILpV QH IDLW SDV O¶REMHW GH FHWWH pWXGH
O¶REMHFWLI GH OD PpWKRGH SURSRVpH pWDQW GH IRUPDOLVHU GHV H[LJHQFHV TXL VHUYLURQW GH EDVH DX[
développements.
Le suivi et le compte-rendu des développements par les concepteurs et développeurs peuvent
se faire VXU EDVHGXFDKLHUG¶H[LJHQFHV (cf. section précédente). Au fil des développements, des
prototypages et démonstrations peuvent être présentés pour tester le service en cours
G¶LPSOpPHQWDWLRQDes tests du service final sont effectués par les concepteurs voire par les futurs
utilisateurs, avant le transfert du service. /D JHVWLRQ GHV WHVWV Q¶HVW SDV GpFULWH GDQV OD PpWKRGH
PUSH. Certaines méthodes (agiles) préconisent la rédaction des tests en même temps que les
besoins (cf. § 1.9.4).
/D ILJXUH VXLYDQWH SUpVHQWH TXHOTXHV FDSWXUHV G¶pFUDQ GX VHUYLFH GpFULW SUpFpGHPPHQW XQH
fois implémenté. Y sont représentés OH FKRL[ G¶XQ QRXYHDX SDUWDJH FOLTXHU VXU © ajouter un
nouveau document »), le parcours des fichiers (cliquer sur « parcourir » puis sélectionner les
ILFKLHUV OH FKRL[ GX OLHQ FRFKHU O¶RSWLRQ © les documents sont liés »). Le résultat est, comme
VSpFLILpOHSDUWDJHG¶XQILFKLHU]LS contenant les documents.
| Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
209 Figure 119. Illustration dHO¶XWLOLVDWLRQGX service ICT de téléchargement
multi-fichier une fois implémenté (cf. diagramme de séquences
Figure 117)
210 Chapitre 11 ± La modélisation des services : le point de vue fonctionnel |
1.38
Conclusion
Le méta-modèle des services caractérise la partie fonctionnelle qui servira de base au
développement. À SDUWLUGHVEHVRLQVLGHQWLILpVHQWHUPHVGHSUDWLTXHVHWG¶XVDJHVFHWWHWURLVLqPH
phase de modélisation spécifie le service qui sera le plus adapté. Les liens entre le méta-modèle de
services et le méta-PRGqOHG¶XVDJHVDVVXUHQWO¶DGDSWDWLRQGHVVHUYLFHVGpYHORSSpVSDUUDSSRUWDX[
attentes des concepteurs.
Le diagramme de séquence est un formalisme utilisé par les développeurs et constitue le
support du dialogue entre ces derniers et les concepteurs/¶pYROXWLRQGHVVSpFLILFDWLRQVUHSRUWpH
GDQV OHV FDKLHUV G¶H[LJHQFHV trace les choix de développement (point de vue fonctionnel) et
pYHQWXHOOHPHQWOHVUHWRXUVVXUODFRQFHSWLRQGHO¶XVDJHSRLQWGHYXHRSpUDWLRQQHO.
/¶DSSURFKH de conception de services orientée usage permet des spécifications précises qui
ciblent des besoins clairement identifiés. &¶HVWXQHDSSURFKHTXLV¶DSSOLTXHSDUWLFXOLqUHPHQWELHQ
GDQV OH FDGUH GH O¶DPpOLRUDWLRQ G¶XQ outil existant. La base du développement est en effet déjà
FRQVWUXLWH FH TXL SHUPHW GH OLPLWHU OHV VSpFLILFDWLRQV WHFKQLTXHV HQ UpXWLOLVDQW O¶H[LVWDQW
Cependant, cette base existante peut également devenir une limite car elle rend certains choix
impossibles à implémenter. /¶LWpUDWLRQ GX SURFHVVXV HVW QpFHVVaire pour adapter ces choix aux
limites. &¶HVW SRXUTXRL LO HVW LPSRUWDQW GH SULYLOpJLHU OD FROODERUDWLRQ et le dialogue entre
concepteurs et développeurs pour FRQWRXUQHUOHVSUREOqPHVTXLSRXUUDLHQWVHSUpVHQWHUORUVG¶XQH
phase plus avancée du projet.
À WHUPH QRXV SHQVRQV TXH OD FRPELQDLVRQ G¶XQ HQVHPEOH G¶H[LJHQFHV ainsi spécifiées
permettra de concevoir un système entier. /¶XQLIRUPLVDWLRQ des choix par des concepts récurrents
et structurés est la clé de cette combinaison.
/¶H[HPSOHXWLOLVpSRXULOOXVWUer les trois étapes de la méthode (chapitres 9-10-11) est un cas
VLPSOH TXL QRXV D SHUPLV GH SUpVHQWHU O¶DSSURFKH HW OHV FRQFHSWV GpYHORSSpV &HW H[HPSOH ne
reflète cependant pas un besoin métier WUqV SDUWLFXOLHU O¶XVDJH DVVRFLp HW OH VHUYLFH GpYHORSSp
restant donc relativement communs. Nous illustrons plus précisément O¶LQWpUrW GH FHWWH PpWKRGH
au cours du chapitre suivant, à travers trois expérimentations. À défaut de valider le processus
entier à chaque fois, chacune de ces expérimentations nous permettra G¶pYDOXHU un aspect
particulier de la méthode. 1RXV HVVDLHURQV G¶HQ WLUHU parti pour mener une analyse critique
JpQpUDOHGHO¶DSSURFKH
| Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
211 212 | Chapitre 12 ± La méthode PUSH :
expérimentations et bilan
1.39
I ntroduction aux expérimentations
1.39.1 Rappel : application d¶XQHPpWKRGHGLULJpHSDUOHVPRGqOHV
Au travers les précédents chapitres (9-10-11) nous avons cherché à caractériser plusieurs
points de vue différents portés sur le travail collaboratif. Adopter chacun de ces points de vue
permet de construire, pas à pas, un méta-modèle qui décrit des services adaptés aux besoins
métiers :
- le point de vue organisationnel porte sur les pratiques métiers
- le point de vue opérationnel porte sur les usages qui médiatisent ces pratiques
- le point de vue fonctionnel porte sur les services qui matérialisent ces usages
Figure 120. Représentation conceptuelle du lien entre les points de vue
Chacun des concepts (pratique, usage et service) est décrit par son propre méta-modèle (le
MMPM, le MMU et le MMS). Les liens conceptuels « médiatise » et « matérialise » (Figure 120)
sont définis par plusieurs correspondances entre ces trois méta-modèles et forment le MétaModèle des Services Adaptés (MMSA) (cf. Figure 115, page 197).
&HV FRUUHVSRQGDQFHVVRQWLGHQWLILDEOHVJUDSKLTXHPHQW ORUV GH O¶LQVWDQFLDWLRQ GX006$SDU
O¶DGDSWDWLRQ GHV IRUPDOLVPHV XWLOLVpV (Figure 121). Ces formalismes sont le diagramme
hiérarchique pour le modèle de pratiques, OHGLDJUDPPHGHFDVG¶XWLOLVDWLRQSXLVO¶DUEUHGHWkFKHV
pour modéliser O¶XVDJHHWHQILQOHVGLDJUDPPHVGHVpTXHQFHVSRXUOHVHUYLFH Les transformations
sont les suivantes :
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
213 -
/¶DFWHXUGHODSUDWLTXHGLDJUDPPHGHSUDWLTXHVGHYLHQWXWLOLVDWHXUGXV\VWqPH (diagramme
de FDVG¶XWLOLVDWLRQ)
8QHRSpUDWLRQPpWLHUGLDJUDPPHGHSUDWLTXHVGHYLHQWXQHQVHPEOHG¶LQWHQWLRQVXWLOLVDWHXUV
(package de FDVG¶XWLOLVDWLRQ dans le diagramme)
Une intention utilisateur (GLDJUDPPH GH FDV G¶XWLOLVDWLRQ GHYLHQW OD UDFLQH G¶XQ DUEUH GH
WkFKHVXWLOLVDWHXUVGLDJUDPPHG¶LQWHUDFWLRQV
Les tâches outils (LGHQWLTXHV GDQV OH GLDJUDPPH GH FDV G¶XWLOLVDWLRQ HW OH diagramme
G¶LQWHUDFWLRQV VRQW GpFRPSRVpHV HQ DFWLRQV GHV FRPSRVDQWV GX VHUYLFH GLDJUDPPH de
séquences)
/HV LQIRUPDWLRQV PpWLHUV GLDJUDPPH GH SUDWLTXH GHYLHQQHQW GHV REMHWV G¶LQWHUDFWLRQ
GLDJUDPPHG¶LQWHUDFWLRQ
/HVREMHWVG¶LQWHUDFWLRQGLDJUDPPHG¶LQWHUDFWLRQVHUYHQWj spécifier les données échangées
lors dHO¶H[pFXWLRQGXVHUYLFH (diagramme de classes)
214 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Figure 121. Correspondances entre la modélisation des pratiques, des
usages et des services
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
215 1.39.2 Contexte des expérimentations
Pour rappel, nRWUH WUDYDLO V¶HVW LQVFULW GDQV OH FDGUe du développement de la plateforme de
gestion documentaire CRTI-web. Les expérimentations menées se sont inscrites dans ce contexte
technologique particulier OHV GHX[ SUHPLqUHV H[SpULPHQWDWLRQV FRQFHUQHQW O¶DPpOLRUDWLRQ GX
service métier « Documents » tandis que la troisième consiste à proposer un nouveau service
métier, PDLVXWLOLVDQWO¶LQIRUPDWLRQWUDLWpHSDUOHVHUYLFHPpWLHU© Comptes-rendus ».
/D QDWXUH GH OD SUHPLqUH H[SpULPHQWDWLRQ pWDLW O¶DSSOLFDWLRQ GH OD PpWKRGH 386+ SRXU OH
WUDQVIHUW G¶H[LJHQFHV vers une société externe (Kitry consulting) qui est en charge de deux
activités :
- les développements informatiques sur la plateforme
- OHWUDQVIHUWYHUVOHVSURIHVVLRQQHOVHWO¶DFFRPSDJQHPHQWDXWUDYHUVG¶DWHOLHUV.
Ce contexte partenarial nous a permis G¶LGHQWLILHU OHV EHVRLQV HQ WHUPHV G¶pFKDQJHV HQWUH
O¶XWLOLVDWHXUOHFRQFHSWHXUHWOHGpYHORSSHXUGDQVXQSURMHWGHGpYHORSSHPHQW logiciel dédié aux
professionnels du secteur de la construction (Figure 122). Il nous a également donné matière à
réflH[LRQVXUO¶DQDO\VHGHVEHVRLQVHQWHUPHVGHSUDWLTXHVPpWLHUV HWG¶XVDJHVGHVXWLOLVDWHXUVGDQV
la recherche de solutions à des problèmes rencontrés par des professionnels.
Figure 122. Le contexte de projet de développement lors de la première
expérimentation
Deux autres expérimentations RQW SHUPLV G¶pYDOXHU OHV K\SRWKqVHV IDLWHV au cours de la
première. La deuxième expérimentation a été menée en collaboration avec un autre informaticien
jouant le rôle de développeur dans le projet, et visaLWjDXWRPDWLVHUOHVHUYLFHG¶HQYRLGHILFKLHUV
sur la plateforme CRTI-weB. La dernière était une expérience de conception seule, sans objectif
de développement à court terme, visant à spécifier un service de surveillance de chantier supporté
par un tableau de bord numérique sur tablette tactile.
Figure 123. Répartition des expérimentations dans le temps
216 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
1.39.3 Objectifs des expérimentations
Comme nous venons GH O¶H[SOLTXHU FL-dessus, nous avons mené trois expérimentations de
nature et de durées différentes. Elles ont permis de construire, évaluer et améliorer notre
approche. Les objectifs à atteindre à travers les expérimentations étaient :
- justifier la méthode, en identifiant si au cours des expérimentations un réel besoin était
ressenti et si la méthode y répondait,
- évaluer (et améliorer) ODFRPSUpKHQVLRQHWO¶XWLOLVDWLRQGHVFRQFHSWVLQWURGXLWVSRXUGpILQLUOHV
étapes de la méthode (pratiques, usages, services),
- évaluer (et améliorer) OD FRPSUpKHQVLRQ HW O¶XWLOLVDWLRQ GHV PRGqOHV j WUDYHUV OHV RXWLOV HW
formalismes proposés,
- valider ODUpHOOHDGDSWDWLRQGHVVHUYLFHVGpYHORSSpVJUkFHjO¶DSSOLFDWLRQGHODPpWKRGH
Comme le montrent les sections suivantes, chaque expérimentation ne portait pas sur
O¶HQVHPEOH Ge cHV REMHFWLIV PDLV D IDLW UHVVRUWLU GHV SRLQWV G¶LQWpUrW SDUWLFXliers sur lesquels
V¶DSSX\HU SRXU pYDOXHU HW DPpOLRUHU O¶DSSURFKH /H WDEOHDX FL-dessous résume les attentes en
WHUPHV G¶pYDOXDWLRQ TXH QRXV DYLRQV YLV-à-vis de chaque expérimentation (en fonction de leur
nature).
Tableau 24. Évaluations attendues en fonction des expérimentations
$WWHQWHV«
Upload multiple
Évaluer le besoin des
développeurs
Upload Automatique
Évaluer O¶LPSRUWDQFH
des points de vue
Tableau de bord
Évaluer O¶intérêt de
structurer les exigences
cf. concepts
Évaluer O¶DQDO\VH
métier et la description
GHO¶XVDJH
Évaluer la distinction
pratique/usages/
services
Évaluer la description
des pratiques et de
O¶XVDJH
cf. modèles
Évaluer les
formalismes des
pratiques et des usages
Évaluer les différents
formalismes
Évaluer les formalismes
de pratiqueVHWG¶XVDJH
ainsi que le passage
G¶un jO¶DXWUH
cf. adaptation
Évaluer O¶DGRSWLRQpar
les utilisateurs lors du
transfert du service
Évaluer O¶DGRSWLRQGHV
utilisateurs par des
tests
Non concerné
cf. méthode
1.40
Expérimentation n°1 /¶DPpOLRUDWLRQGXVHUYLFHG¶XSORDd de CRTI -weB
1.40.1 I ntroduction et déroulement
Nous revenons ici plus en détail VXU O¶H[HPSOH © fil rouge ª GH FRQFHSWLRQ G¶XQ VHUYLFH
« G¶XSORDGPXOWLSOH » présenté au cours des chapitres précédents pour illustrer nos propos. Initié
très tôt dans les phases de proposition de ce travail de recherche, il nous a servi à :
- composer les méta-modèles,
- choisir les formalismes pour les modèles,
- et définir la structure de la méthode PUSH.
Le besoin remonté au travers des ateliers avec des utilisateurs était celui de pouvoir partager
plusieurs documents à la fois sur la plateforme CRTI-weB sans UpSpWHUOHSURFHVVXVGHGpS{WG¶XQ
document depuis le début. ,O V¶DJLVVDLW GRQF G¶XQ EHVRLQ G¶RSWLPLVDWLRQ GH OD PDQLqUH GRQW OHV
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
217 utilisateurs travaillent avec leur outil. De nombreux services de partage de documents permettent
actuellement FH JHQUH GH PDQLSXODWLRQ &HSHQGDQW LO V¶HVW UpYpOp SHUWLQHQW GH PHWWUH HQ SODFH
notre méthode afin G¶LGHQWLILHUGHVH[LJHQFHVSOXVVSpFLILTXHV au secteur que celles relatives à des
services informatiques plus « généralistes ». Dans un contexte « marché », avec une approche
commerciale, la démarche proposée devait permettre de lHYHU OH ULVTXH G¶HQJDJHU GHV FR€WV GH
développement dans une solution qui pourrait V¶DYprer inadaptée. Cet argumentaire a convaincu
QRWUHSDUWHQDLUHSULYpODVRFLpWpGHVHUYLFHVH[WHUQHTXLV¶HVWSUrWpDXMHXGHO¶H[SpULPHQWDWLRQj
travers notamment trois séances de travail (Figure 124).
Objet des séances de travail
LD SUHPLqUH V¶HVW GpURXOée en février 2012. À partir des besoins exprimés lors des ateliers,
nous avons présenté notre étude des pratiques relatives à ces besoins HW GH O¶XVDJH j FRQFHYRLU
pour y répondre (point de vue organisationnel et opérationnel). Les modèles présentés étaient un
diagramme de pratiquesXQGLDJUDPPHGHFDVG¶XWLOLVDWLRQV et un diagramme de tâches exprimé
en K-MAD. Ces modèles ont permis respectivement de justifier le besoin métier (en montrant
TX¶LOUHOqYHGHSUDWLTXHVFRXUDQWHVHWGHGpILQLUles scénarios d¶XVDJH© idéaux ». Trois scénarios
RQWpWpLGHQWLILpV,OVpWDLHQWFRQVLJQpVGDQVXQHSUHPLqUHYHUVLRQGXFDKLHUG¶H[LJHQFHV. Au terme
de cette réunion, les développeurs nous ont demandé de préciser le service à développer (point de
vue fonctionnel). Un diagramme de séquences serait plus pertinent que le diagramme de tâches
qui Q¶DSSRUWe pas assez de précisions fonctionnelles.
La seconde séance (mars 2012) D IDLW O¶REMHW GH GLVFXVVLRQV DXWRXU GHV GLDJUDPPHV GH
séquence proposés. Il était question de repenser le service de partage de documents en fonction
des trois VFpQDULRV G¶XVDJH LPDJLQpV HW HQ VSpFLILDQW OD JHVWLRQ GHV FDV G¶HUUHXUV /¶REMHW GH OD
réunion était de valider les diagrammes proposés en y apportant éventuellement des
modifications.
Les développeurs ont ensuite pu appréhender OHV SRVVLELOLWpV G¶LPSOpPHQWDWLRQ GX VHUYLFH
spécifié. Au cours de la troisième séance, ils nous ont proposé des maquettages qui illustraient
O¶LQWHUIDFHGXVHUYLFHWHOTX¶LODOODLWrWUHGpYHORSSé. Au regard de certaines contraintes techniques,
il y aurait quelques différences entre le service développé et sa spécification. Après validation des
choix par tout le monde, le projet est entré en phase de développements. Le service de partage
ainsi modifié a été implémenté sur une plateforme de tests dans un premier temps puis sur la
version commercialisée.
Figure 124. 'pURXOHPHQWGHO¶H[SpULPHQWDWLRQ
218 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
1.40.2 Les pratiques de partage
Nous avons pu distinguer deux pratiques individuelles différentes réalisées par le rôle de
« concepteur ª JpQpUDOHPHQW O¶DUFKLWHFWH FKDFXQH LVVXH G¶XQH SUDWLTXH FROOHFWLYH SDUWLFXOLqUH
pendant la phase de conception du projet :
- une première consistant à partager des plans et autres spécifications techniques avec les
GHVVLQDWHXUV GH O¶DJHQce pour créer les différentes vues du bâtiment (dans la Pratique
Collective « échanges de document pour le partage de la conception »)une deuxième
FRQVLVWDQWjSDUWDJHUOHVSODQVHWGRFXPHQWVWHFKQLTXHVDYHFO¶HQWUHSULVHGHFRQVWUXFWLRQGDQV
la PC « échange des documents pour exécution »). Une pratique individuelle similaire serait
FHOOHGXSDUWDJHGHGRFXPHQWVDYHFO¶pFRQRPLVWHFKDUJpGHGpWHUPLQHUOHVFRûts du bâtiment.
Figure 125. /HVSUDWLTXHVGHSDUWDJHG¶XQFRQFHSWHXU
Le modèle réalisé à partir de cette analyse métier (Figure 125), représente cette situation
collaborative :
- la phase de projet est « la phase de conception »,
- les 2 PC considérées « échange de documents pour le partage de la conception « et « pour
O¶H[pFXWLRQ »,
- O¶acteur « concepteur » DXTXHORQV¶LQWpUHVVH,
- ses PI « GLIIXVH OHV GRFXPHQWV GH FRQFHSWLRQ SRXU O¶pTXLSH GH FRQFHSWHXUV » et « pour
O¶HQWUHSULVHGHFRQVWUXFWLRQ »,
- les opérations « partage » et « informe » pour chaque PI
- et enfin les artefacts manipulés à savoir les documents de type géométral (ex. les plans) et de
type spécifications (ex. cahier des charges), les messages de notifications ainsi que les autres
acteurs impliqués OHGHVVLQDWHXUHWO¶HQWUHSULVHGHFRQVWUXFWLRQ
Nous observons comment, dans un même projet, la diIIXVLRQ G¶LQIRUPDWLRQV Q¶HVW SDV XQ
processus unique mais peut se décliner en plusieurs pratiques. Seules les observations faites en
FROODERUDWLRQDYHFOHVSURIHVVLRQQHOVGXVHFWHXUSHUPHWWHQWGHFDSWHUFHVVSpFLILFLWpV,OV¶DJLWLFL
de les représenter au travers de cas réels et non pas de modéliser un processus général. Le
formalisme utilisé supporte cette représentation.
Ce diagramme permet donc de comprendre comment se déroule un projet avec un certain
deJUpGHGpWDLO0DLVO¶LQWpUêt de cette distinction des pratiques réside dans la manière dont on va
les médiatiser. En effet nous verrons que les usages peuvent varier en fonction de la pratique.
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
219 HRUVFHVYDULDWLRQVTXLDVVXUHQWO¶DGDSWDWLRQ G¶XQRXWLOet son appropriation par les utilisateurs, ne
sont souvent pas prises en compte dans les démarches de conception « classiques ».
1.40.3 /HVYDULDQWHVG¶XVDJH
Les professionnels utilisant CRTI-weB avaient relevé la nécessité de partager plusieurs
GRFXPHQWVG¶XQFRXSHQVLPSOLILDQWOHSURFHVVXV G¶HQYRLdéjà contraignant de par les multiples
saisies relatives au nommage des documents et au choix de la zone et des actions). La première
VROXWLRQ pWDLW G¶LPSOpPHQWHU XQ VHUYLFH JpQpULTXH SHUPHWWDQW GH FKRLVLU SOXVLHXUV ILFKLHUV à
partager et de créer autant de documents CRTI-weB que de fichiers partagés. Mais au regard des
usages spécifiques au métier, nous avons pu proposer une solution alternative adaptée à différents
scénarios de pratique validés.
Deux pratiques, deux usages
À partir GHO¶DQDO\VHdes pratiques, nous avons pu mettre en évidence que les professionnels
peuvent vouloir diffuser des documents indépendants (PI diffusion aux autres concepteurs) ou
préférer partager un groupe de documents avec un seul objectif (PI diffusion des plans
G¶H[pFution DYHFO¶HQWUHSULVH). À ces deux pratiques correspondent deux « intentions » en termes
de médiatisation par un outil et donc deux usages.
220 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Figure 126. 'HODSUDWLTXHjO¶XVDJH YDULDWLRQGHVLQWHQWLRQVG¶XQXWLOLVDWHXUHQIRQFWLRQGXEHVRLQPpWLHU
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
221 222 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Une spécificité du premier usage concerne le format des documents échangés. Les plans sont
partagés VRXV OD IRUPH G¶XQ ILFKLHU .GZJ IRUPDW G¶HQUHJLVWUHPHQW G¶XQ plan éditable avec le
logiciel autocad) et plusieurs autres fichiers souvent sous forme de pdfs : des « représentations
figées » des plans (par exemple chaque étage), des spécifications techniques ou G¶autres
GRFXPHQWV QpFHVVDLUHV j OD PLVH HQ °XYUH ,FL OH IRUPDW GHV ILFKLHUV Q¶HVW SDV XQH LQIRUPDWLRQ
déterminante, mais nous verrons qu¶HOOH SHXW DYRLU XQ impact non négligeable. Elle doit donc
apparaitre dans notre modèle.
Vers un troisième usage
Nous avons identifié une variante dHO¶usage de chargement groupé, au cours duquel le format
des fichiers est particulièrement important.
,O V¶DJLW GX SDUWDJH GH plusieurs documents au format dwg parmi lesquels il y a un fichier
« maître » et des fichiers liés qui correspondent à des parties du fichier maître (fichiers identifiés
comme des « xrefs » auxquels fait référence le fichier maître). Le service de partage de ces
fichiers devra permettre de les grouper, mais ne devra pas les renommer afin que le lien soit
conservé techniquement.
Ces informations VRQW W\SLTXHPHQW OH JHQUH G¶LQIRUPDWLRQV j FRQVLJQHU GDQV un cahier
G¶H[LJHQFHV pour garder traces des besoins identifiés. 7HOTXHQRXVO¶DYRQVGpFULWGDQVOHFKDSLWUH
10, notre méthode propose de les modéliser dans le « contextual use case » (Figure 127).
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
223 Figure 127. Une partie du « contextual use case » spécifié pour le
SDUWDJHG¶XQSODQGZJHWVHV© xrefs » (troisième usage)
1.40.4 Le choix et la spécification de la solution à implémenter
8QH IRLV TXH OHV XVDJHV RQW pWp LGHQWLILpV HW VSpFLILpV LO V¶DJLW GH FKRLVLU FH TX¶LO IDXW
implémenter et comment cela peut être réalisable'DQVXQFDVG¶DPpOLRUDWLRQGHVHUYLFHs comme
ceux de CRTI-weB, TXL IDLW O¶REMHW GH FHWWH SUHPLqUH H[SpULPHQWDWLRQ les choix sont fortement
FRQGLWLRQQpVSDUOHVVSpFLILFLWpVWHFKQLTXHVGHO¶H[LVWDQW
224 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
La phase de spécification du service se fait à travers O¶DVVRFLDWLRQ du point de vue de
concepteur avec celui des développeurs. En tant que concepteurs, nous avons proposé un
diagramme de séquences « non technique ªFRQVLJQpHQDQQH[HV F¶HVWjGLUH QHGpWDLOODQWSDV
O¶DUFKitecture du service, mais sur la base duquel nous avons pu collaborer avec les développeurs.
Cette étape doit permettre de lever deux risques majeurs :
- celui de rencontrer des problèmes techniques qui empêchent le bon développement de la
solution spécifiée,
- cHOXL GH V¶HQJDJHU GDQV GHV GpYHORSSHPHQWV G¶HQYHUJXUH longs et onéreux au lieu de
privilégier une solution plus simple mais qui répondrait au besoin identifié.
Dans cette optique, il a finalement été choisi de ne jamais renommer les fichiers qui sont
partagés sous la fRUPH G¶XQ VHXO GRFXPHQW PDWpULDOLVDQW ainsi en un même service O¶XVDJH
G¶XSORDG JURXSp « général » et celui plus spécifique avec les « xrefs ». &¶HVW DLQVL TX¶D pWp
proposé XQVHUYLFHG¶XSORDGPXOWLSOHVRXVIRUPHGHGHX[© sous-services », O¶XQSRXUO¶HQYRLGH
documents indépendantVHWO¶DXWUHSRXUO¶HQYRLJURXSpVRXVODIRUPHG¶XQ document unique.
Nous rejoignons ici le cas illustré dans le chapitre 11 décrivant OD FUpDWLRQ G¶XQ ILFKLHU ]LS
agrégeant tous les fichiers sous un même document (Figure 128).
Figure 128. Rappel : le service « G¶XSORDGPXOWLSOH » développé
1.40.5 Conclusion
Cette expérimentation a permis de dérouler un processus entier de développement de service
informatique dans un cadre professionnel et sur la base de besoins identifiés avec des de vrais
utilisateurs de la plateforme CRTI-weB. La collaboration entre notre équipe et les développeurs
V¶HVWHIIHFWXpHDXWRXUGHSOXVLHXUVUpXQLRQVPDMHXUHVGpGLpHVjO¶DQDO\VHGHVEHVRLQVHWDX[ choix
conceptuels. Les développements qui ont suivi ont ainsi pu être menés sans spécifications
supplémentaires.
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
225 Évaluation de la pertinence
1RVSUHPLHUVHQWUHWLHQV DYHF O¶pTXLSH GH la société de services Kitry Consulting ont mis en
avant la nécessité de maîtriser les risques comme une préoccupation importante. Les risques sont
définis comme la possibilité qu'un projet ne soit pas exécuté conformément aux prévisions de
dates, de coûts ou que le résultat ne satisfasse pas les besoins exprimés.
Les utilisateurs de CRTI-weB qui se projettent dans leur activité expriment des besoins très
particuliers OLpV DX FRQWH[WH GH FROODERUDWLRQ GDQV OHTXHO LOV XWLOLVHQW O¶RXWLO W\SH GH SURMHW
TXDQWLWpG¶LQIRUPDWLRQpFKDQJpHDXWUHVDFWHXUVHQSUpVHQFH.). Dès lors, les risques qui peuvent
être rencontrés sont :
- une demande impossible à réaliser techniquement, car incompatible avec le développement
GpMjHQSODFHRXGHPDQGDQWWURSGHWHPSVjO¶LPSOpPHQWDWLRQ,
- une demande incomprise par les développeurs, menant à des choix erronés qui ne satisferont
SDVO¶XWLOLVDWHXUHWGRQW la correction sera coûteuse.
&¶HVWSRXUTXRLODbonne JHVWLRQG¶XQWHOSURMHWHQV¶DVVXUDQWTXHOHVEHVRLQVLGHQWLILpVVRQWOHV
bons dès les premières phases, est primordiale. Dans un secteur comme celui de la construction,
nous avons vu que les besoins peuvent être très spécifiques. Ils sont dépendant du contexte métier
DXVVLELHQG¶XQSRLQWGHYXHRUJDQLVDWLRQQHOTX¶RSpUDWLRQQHOAu cours de cette expérimentation,
nous avons pu valider :
- l¶LQWpUrWG¶XQHPpWKRGHSHUPHWWDQWde prendre en compte ces points de vue
- l¶LQWpUrWG¶XQGRFXPHQWWUDoDQWOHVXLYLGHFHWWHPpWKRGH
/¶DSSURFKHGHFRQFHSWLRQSDUVHUYLFHVest de plus WRXWjIDLWDSSURSULpHjO¶RXWLO&57,-weB
lui-même ayant été défini comme un ensemble de services métiers répondant à des pratiques
collectives génériques (Kubicki, et al. 2009).
Évaluation et évolution des concepts (méta-modèles) et des modèles
Cette première expérimentation a permis de valider la distinction faite entre point de vue
organisationnel et opérationnel à travers les concepts de pratiques et usages. La correspondance
entre pratiques et usages peut suivre plusieurs scénarii qui ont été envisagés lors de la conception
du méta-modèle G¶XVDJHV 008. Nous montrons ainsi que trois relations ont un sens dans un
contexte de collaboration outillé par les services informatiques (Figure 129) :
- un usage est défini par pratique,
- pOXVLHXUVXVDJHVRXYDULDQWHVG¶XVDJHsont envisagés pour une même pratique,
- le même usage médiatise plusieurs pratiques.
Figure 129. Rappel UHODWLRQHQWUHOHVFRQFHSWVG¶XVDJHHWGHSUDWLTXH
telle que caractérisée par le MMU
226 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
/HFRQFHSWGHSUDWLTXHSHUPHWG¶DVVRFLHUOHVUHTXrWHVGHODSDUWGHVXWLOLVDWHXUVjGHVEHVRLQV
métiers généralisables et ainsi de les justifier auprès des développeurs. A ce propos, le diagramme
de pratiques proposé (1.40.2) pour UHWUDQVFULUHOHVEHVRLQVV¶HVWDYpUpFRPSUpKHQVLEOHHWXWLOH
La définition SUpFLVHGXFRQWH[WHGHO¶XVDJH DYDLWSHXG¶LQWpUrWLFLFDUOHcontexte était connu
des développeurs qui aVVXUHQWGpMjODFRPPHUFLDOLVDWLRQGHO¶RXWLO, les ateliers de formation et le
recueil des retours des utilisateurs. Il permet cependant, a posteriori, de garder une trace des choix
effectués. Le « contextual use case» était compréhensible mais V¶HVW DYpUp peu utile. Seule la
partie diagramme était intéressante pour résumer de manière générale les intentions à outiller.
Nous avions proposé des diagrammes de tâches K-MAD (la conception de notre propre
éditeur de tâches particulier Q¶D été entreprise que plus tard). La description des tâches (utilisateur
et système) GDQV O¶XVDJH était utile dans un premier temps (première réunion) mais insuffisante
pour la suite des discussions. Les besoins en termes de description étaient plus importants que
ceux supportés par les arbres de tâches &¶HVW SRXUTXRL QRXV DYRQV LQWroduit le diagramme de
VpTXHQFHTXLV¶HVWDYpUpOHPRGqOHOHSOXVXWLOHSRXUODGLVFXVVLRQDYHFOHVGpYHORSSHXUVCela ne
UHPHWSDVHQFDXVHO¶LQWpUrWG¶XQDUEUHGHWkFKHs GDQVODPpWKRGHPDLVLOV¶DYqUHSOXVXWLOHORUVTXH
O¶LQWHUDFWLRQ RFFXSHXQHSODFHSOXVLPSRUWDQWHGDQVO¶XVDJH
Notons enfin que les différences entre les formats de documents (dwg, xref, pdf) manipulés
auraient pu être modéliséeV SDU OH FRQFHSW G¶REMHW G¶LQWHUDFWLRQ FI 1.32.2 &H FRQFHSW Q¶D pWp
introduit que plus tard, mais cette expérimentation en a motivé la création.
1.41
Expérimentation 2 : O¶DXWRPDWLVDWLRQGXVHUYLFHG¶XSORDGGH&57,-weB
1.41.1 I ntroduction et déroulement
Lors de cette deuxième expérience, nous avons collaboré avec un nouveau développeur,
LQWpJUpGDQVO¶pTXLSHGHFRQFHSWLRQ pour une courte durée. Les échanges ont ainsi été favorisés et
nous avons mis en place une collaboration étroite entre analystes métiers, concepteurs et
développeurs (la plupart étant localisés au même endroit). Nous avons ainsi pu évaluer les
FDSDFLWpV GH O¶DSSURFKH j WUDQVPHWWUH OHV LQIRUPDWLRQV QpFHVVDLUHV DX ERQ GpYHORSSHPHQW G¶XQ
service, et ce, sans connaissance initiale du contexte (à la fois professionnel et technique). Malgré
les échanges informels réguliers, nous avons menés trois séances de travail particulières ayant
leurs objectifs respectifs.
La première séance (mars 2012) consistait à présenter le contexte SURIHVVLRQQHOO¶RXWLO&57,weB, et les services (métiers et informatiques) TX¶LO SURSRVH /¶REMHFWLI JpQpUDO GX SURMHW D pWp
présenté afin que le développeur puisse rechercher une technologie qui lui permette
G¶LPSOpPHQWHUOHIXWXUVHUYLFH
Au cours de la deuxième séance (quelques jours après) nous avons présenté les points de vue
RUJDQLVDWLRQQHO HW RSpUDWLRQQHO DX WUDYHUV GX FDKLHU G¶H[LJHQFHV (c'est-à-dire les pratiques et
usages). Au terme de cette réunion, la tâche demandée au développeur a été de formaliser le point
de vue fonctionnel (sous forme de diagrammes de séquences comme le préconise la méthode) en
PrPHWHPSVTX¶LOGpYHORSSHUDLWOHVHUYLFH.
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
227 De la même manière que lors de la première expérimentation, la séance suivante (mai 2012)
avait pour but de rendre compte des développements menés en fonction des exigences. Elle a
SHUPLV G¶H[SULPHU OHV FKRL[ HIIHFWXpV HQ WHUPHV G¶LPSOpPHQWDWLRQ PDLV DXVVL GH VH TXHVWLRQQHU
sur la geVWLRQ GH FHUWDLQV FDV G¶HUUHXUV (Q HIIHW VL OH point de vue opérationnel exprime des
VFpQDULRV LGpDX[ G¶XVDJH OH SRLQW GH YXH IRQFWLRQQHO GRLW SUHQGUH HQ FRPSWH WRXWHV OHV
possibilités à implémenter, y compris les manipulations non prévues. Au cours des
développements, ces phases de précision se sont UpLWpUpHVMXVTX¶jREWHQLUXQVHUYLFHTXLUpSRQGH
soit fonctionnel, en plus de répondre aux exigences initiales.
Figure 130. 'pURXOHPHQWGHO¶H[SpULPHQWDWLRQ
1.41.2 Un nouvel usage G¶XSORDG
La pratique analysée dans cette expérimentation est une pratique de partage de documents
proche de celles que nous avons décrites GDQV O¶H[HPSOH SUpFpGHQW 6DVSpFLILFLWpHVW TX¶HOOHVH
déroule dans un milieu universitaire et non dans un contexte professionnel habituel (Figure 131).
,O V¶DJLW HQ HIIHW G¶XQ SURjet universitaire de conception en situation de collaboration à distance
entre des étudiants de Nancy et de Liège (le Studio Digital Collaboratif (Kubicki, Guerriero,
Leclercq, et al. 2009)). Les rôles dans ce projet de développement ont été attribués de la manière
suivante :
- Utilisateurs : les étudiants
- Experts métiers : les encadrants académiques LOVSRVVqGHQWOHUHFXOQpFHVVDLUHjO¶DQDO\VHGX
travail)
- Concepteurs : notre équipe
- Développeur : un stagiaire informaticien LQWpJUpjO¶pTXLSHSRXUOHSURMHW
228 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Figure 131. Diagramme de la pratique analysée
Les étudiants disposent, pour se coordonner au cours de ce projet, du service de partage de
documents de CRTI-weB et du système de Bureau Virtuel présentés précédemment (voir 1.2.2).
Ils peuvent également XWLOLVHUWRXWDXWUHRXWLOTX¶LOVMXJHURQWXWLOHjODJHVWLRQGHOHXUWUDYDLO
Les étudiants sont habitués à utiliser les services de Dropbox ou Facebook pour travailler en
groupe, car ils ne sont pas soumis aux restrictions du milieu professionnel (en particulier les
clauses de confidentialité) et ces outils font partie de leurs usages personnels réguliers. Ainsi,
QRXV DYRQV SX FRQVWDWHU GDQV OHV DQQpHV DQWpULHXUHV TX¶ils jugent souvent CRTI-weB trop
complexe et, dans la plupart des cas, abandonnent son usage au profit de solutions plus simples.
Des requêtes G¶XWLOLVDWHXUV GpILQLHV HQ WHUPHV GH QRXYHDX[ VHUYLFHV Q¶RQW SDV pWp IRUPDOLVpHV
FRPPH F¶pWDLW OH FDV SRXU ORUV GH O¶H[SpULPHQWDWLRQ SUpFpGHQWH &HSHQGDQW, les professeurs
encadrant le projet et MRXDQWOHU{OHG¶H[SHUWPpWLHUQRXVRQWUDSSRUWpXQHDQDO\VHGH ces limites
actuelles de CRTI-weB : la ORXUGHXUGHVpWDSHVG¶LGHQWLILFDWLRQORJLQoubli régulier des mots de
passe), le temps nécessaire à la phase de nommage des documents envoyés (trop contraignant
dans un tel contexte et peu adaptée à la nature des documents envoyés) et le temps G¶DWWHQWHOLpDX
SURFHVVXVG¶XSORDGHQOXL-même. Pour franchir ces limites, un nouvel usage a été proposé dans le
FDGUH GH O¶H[SpULPHQWDWLRQ. Le travail de cRQFHSWLRQ pWDLW EDVp VXU O¶LQWHUSUpWDWLRQ j WUDYHUV OHV
FRQFHSWVGHODPpWKRGH386+G¶XQXVDJHqui nous semblait répondre à certaines de ces limites
(celui de O¶RXWLO dropbox) et son adaptation à notre contexte.
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
229 Aussi, QRXV DYRQV SURSRVp XQ VHUYLFH G¶Xpload automatique lié à CRTI-weB dont les
caractéristiques principales sont :
lDVXUYHLOODQFHG¶XQGRVVLHUSDUWLFXOLHUDYHFODGpWHFWLRQGHWRXWQRXYHDXILFKLHUDMRXWpGDQV
ce dossier,
- le chargement automatique des fichiers détectés sur la plateforme avec nommage automatique
(selon une convention de nommage volontairement simplifiée LQLWLDOHV GH O¶DXWHXU B premières lettres du nom du fichier _ indice)
- la mise à jour automatique avec incrémentatioQ GH O¶LQGLFH HQ FDV GH QRXYHOOH YHUVLRQ G¶XQ
fichier.
- lH UHSRUW GH O¶DMRXW « G¶DFWLRQV » à un document vers un usage ultérieur qui nécessitera de
UHSDVVHUSDUO¶LQWHUIDFHZHE
La figure suivante illustre le « contextual use case » qui décrit cette proposition (Figure 132).
&¶HVWDXFRXUVGHFHWWHH[SpULPHQWDWLRQTXHQous avons introduit dans la modélisation (sous forme
du package bleu) la distinction des spécifications fonctionnelles indépendantes du contexte métier
mais nécessaires à la spécification du service. Ces use case « non métier » sont relatifs ici à
O¶LGHQWLILFDWLRQ GH O¶XWLOLVDWHXU OH FKRL[ GX GRVVLHU TXL VHUD SDUWDJp HW OH FKRL[ GX SURMHW &57,weB sur lequel les documents seront envoyés. Les deux autres packages définissent le chargement
et la suppression de fichiers sur CRTI-weB à partir du dossier partagé.
230 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Figure 132. « Contextual use case ªGXVHUYLFHG¶XSORDGDXWRPDWLTXH
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
231 -
Les diagrammes G¶LQWHUDFWLRQ suivants (Figure 133) décomposent :
/¶LQWHQWLRQ© V¶LGHQWLILH » en tâches « saisit le login » et « saisit le mot de passe ». Les objets
G¶LQWHUDFWLRQFRQFHUQpVORJLQHWPRWGHSDVVHVRQWGHVGRQQpHVSULPLWLYHV Le système devra
vérifier ces données.
O¶LQWHQWLRQ © charge les fichiers à partir du dossier partagé » en « Copie », « modifie » et
« renomme les fichiers dans le dossier ». Les objets avec lesquels interagissent ces tâches sont
des fichiers. À partir de ces fichiers, le système devra créer un autre objet « document crtiweb ».
Figure 133. 'LDJUDPPHVG¶LQWHUDFWLRQSRXUOHV intentions « V¶LGHQWLILH »
et « partage les fichiers depuis un dossier partagé »
1.41.3 Spécifications techniques et développements
Une application nommée CRTI-ER[ FRPSRVpH G¶XQH LQWHUIDFH -$9$ HW G¶XQ © daemon »
(logiciel permettant de surveiller les flux de fichiers dans un dossier) a été développée pour
implémenter le service conçu. Celle-FL VHUW GH SDVVHUHOOH HQWUH OHV VHUYLFHV ZHE HW O¶XWLOLVDWHXU
ainsi que le dossier partagé. Elle devra être paramétrée la première fois pour effectuer les tâches
G¶LGHQWLILFDWLRQ SUHPLHU SDFNDJH SXLV SDUWLFLSHUD HQ WkFKH GH IRQG j O¶H[pFXWLRQ GHV WkFKHV
suivantes. /H GLDJUDPPH GH VpTXHQFH VXLYDQW LOOXVWUH XQH SDUWLH GH O¶H[pFXWLRQ GX VHUYLFH et
pJDOHPHQWXQFDVG¶HUUHXU. Le service web de nommage existant sur la plateforme CRTI-weB a dû
être modifié, pour répondre à O¶H[LJHQFH de nommage automatique selon la convention « Initiales
232 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Auteur _ 8 premières lettres du nom du fichier _ version ». Le contenu de la base de données
CRTI-web n¶DSDVFKDQJp.
Au cours de cette expérimeQWDWLRQQRXVDYRQVFRQILpO¶pGLWLRQGHVGLDJUDPPHVGHVpTXHQFH
DX GpYHORSSHXU DILQ G¶pYDOXHU OHXU XWLOLWp j UHQGUH FRPSWH GHV FKRL[ GH GpYHORSSHPHQW DXSUqV
des concepteurs) et à les capitaliser (pour les futurs développeurs). La figure suivante en
représente un extrait (Figure 134).
Figure 134. Partie du diagramme de séquence spécifiant le service
Au fil des itérations nous avons pu détailler les exigences, comme par exemple la
VSpFLILFDWLRQ G¶XQ PHVVDJH GH QRWLILFDWLRQ SRXU DYHUWLU du GpPDUUDJH GH O¶DSSOLFDWLRQ DSUqV OD
phase identification. La figure suivante (Figure 135) illustre le service développé, et la façon dont
il répond aux exigences LFLUHSUpVHQWpHVSDUXQHYHUVLRQVLPSOLILpHGXGLDJUDPPHG¶LQWHUactions).
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
233 Figure 135. ,OOXVWUDWLRQGXUpVXOWDWREWHQXDXQLYHDXGHO¶LQWHUIDFHSDU
rapport aux exigences
1.41.4 Conclusion
Cette expérimentation a permis de mener un processus de développement de service pour
CRTI-weB mais dans XQ FRQWH[WH GLIIpUHQW GH O¶H[SpULPHQWDWLRQ Qƒ1. Les utilisateurs étaient
GLIIpUHQWVSXLVTX¶LOVpWDLHQWpWXGLDQWVHWQRQGHVSURIHVVLRQQHOVFHTXLDYDLWXQLPSDFWVXUOHXUV
usages. De plus, le contexte de développement était également différent étant donné que le
développeur ne connaissait pas du tout O¶RXWLO. La collaboration V¶HVWégalement effectuée autour
de réunions de synchronisation SRXUO¶DQDO\VHGHVEHVRLQVHWOHs choix conceptuels. Ce contexte a
GRQFIDYRULVpO¶DSSOLFDWLRQGHODPpWKRGHGDQVVRQHQVHPEOHHQSUHQDQWOHWHPSVGHUpDOLVHUWRXV
OHVPRGqOHVDWWHQGXV(QHIIHWFHWWHGHPDQGHIDLVDLWSDUWLHGHVH[LJHQFHVGHO¶pTXLSHYLV-à-vis du
GpYHORSSHXUVWDJLDLUHHWQ¶DXUDLWSDVSXrWUHDWWHQGXHG¶XQHpTXLSHGHGpYHORSSHPHQWVRXPLVHj
234 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
des objectifs de rentabilité, comme celle intervenant dans l¶H[SpULPHQWDWLRQ Qƒ Les
développements ont donc été davantage suivis et tracés.
Évaluation de la pertinence
/¶LQWpUrWGHODPpWKRGHUpVLGHSRXUFHFDVG¶pWXGHGDQVODSRVVLELOLWpG¶LGHQWLILHUHWVSpFLILHU
un nouvel usage SODXVLEOHHWTXLLOOXVWUHELHQO¶impact de la variation du contexte métier. Après
avoir identifié OHVRSpUDWLRQVHVVHQWLHOOHVjPpGLDWLVHUDXWUHPHQWTXHSDUO¶XVDJHFODVVLTXe CRTIweB SDUO¶LQWHUIDFHZHE, un usage alternatif plus simple a été conçu/RUVGHO¶LPSOLFDWLRQG¶XQ
nouveau membre dans un projet de développement (ici le développeur), les risques liés au manque
G¶LQIRUPDWLRQ HW j O¶LQFRPSUpKHQVLRQ GHV EHVRLQV VRQW SOXV LPSRUWDQWV /¶DSSOLFDWLRQ GH OD
méthode pour mener ce projet a permis de réduire ces risques en favorisant la collaboration autour
des différents modèles et donc le partage de connaissances explicites.
Évaluation et évolution des concepts (méta-modèles) et des formalismes
1RXV DYRQV SX pYDOXHU O¶LQWpUrW G¶XQ GLDJUDPPH GH SUDWLTXHs pour expliquer rapidement
comment se positionnent les exigences métiers du point de vue organisationnel. Après la
GHX[LqPHUpXQLRQGHGLVFXVVLRQDXWRXUGXFDKLHUG¶H[LJHQFHV, le contexte métier était compris et
le diagramme de pratiques servait de rappel en cas de doutes. Son caractère synthétique et ciblé
sur un cas précis est un atout.
/¶DSSURFKH GH PRGpOLVDWLRQ SDU « contextual use case » et GLDJUDPPHV G¶LQWHUDFWLRQ (et
O¶DVVRFLDWLRQGHVGHX[ SHUPHWG¶H[SULPHUFHTXLHVWDWWHQGXHQWHUPHG¶LQWeraction. Choisissant
de nous affranchir du formalisme de K-MAD, nous avons généré notre propre éditeur à partir du
méta-PRGqOHG¶XVDJH (MMU). Étant ainsi plus libres, nous avons pu faire évoluer le MMU pour
TX¶LO décrive exactement les concepts que nous voulions manipuler. Pour cette expérimentation,
ces modèles VHVRQWPRQWUpVSOXVXWLOHVTXHSUpFpGHPPHQWFDULOpWDLWQpFHVVDLUHG¶LQWURGXLUHXQH
QRXYHOOHIDoRQG¶LQWHUDJLUDYHFOHV\VWqPH$ORUVTXHO¶H[SpULPHQWDWLRQSUpFpGHQWHpWDLWXQWUDYDLO
portant essentLHOOHPHQW VXU O¶DUFKLWHFWXUH GX VHUYLFH, les exigences portaient ici à la fois sur le
fond et la forme de celui-ci (fonctionnalités et interactions). /¶XWLOLWp GH PRGpOLVHU OHV REMHWV
G¶LQWHUDFWLRQQ¶DSDVpWpYDOLGpHLFLpWDQWGRQQpODVLPSOLFLWpGHFHVGerniers.
Enfin, les diagrammes de séquences ont été entièrement spécifiés par le développeur luimême. Ainsi, il a pu rendre compte de sa production mais aussi des difficultés techniques
auxquelles il était confronté. Les concepteurs sont bien souvent trop attachés à leurs choix
conceptuels sans considérer les limites techniques. Nous concluons que la discussion autour de
ces diagrammes permet de faciliter la compréhension entre ces deux mondes. &¶HVWà partir de ces
diagrammes de séquence « techniques » que nous avons pu spécifier le méta-modèle de services
TXLJXLGHPDLQWHQDQWOHXUFUpDWLRQDXFRXUVGHO¶DSSOLFDWLRQGHODPpWKRGH386+
1.42
Expérimentation 3 : VSpFLILFDWLRQG¶XQWDEOHDXGHERUG
1.42.1 I ntroduction et déroulement
Au cours de cette troisième expérimentation, la méthode Q¶a été appliquée que partiellement.
/¶HQMHXSRUWDLW HVVHQWLHOOHPHQWVXUODVSpFLILFDWLRQG¶XVDJHVHWOHVOLHQVavec des pratiques et non
sur le développement des services à proprement dit &¶HVW XQ WUDYDLO TXL D pWp PHQp SDU GHX[
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
235 personnes jouant O¶XQH MRXDQW OH U{OH GH FRQFHSWHXU O¶DXWUH HW G¶H[SHUW PpWLHU. Dans cette
expérimentation, la volonté était de proposer un nouvel outil qui réponde à des pratiques
existantes mais peut-être peu ou pas encore médiatisées. &HFDVUHOqYHGRQFSOXW{WG¶une volonté
G¶LQQRYDWLRQ SDU OD WHFKQRORJLH SOXW{W TXH G¶XQH UpSRQVH j XQ EHVRLQ PpWLHU REVHUYp ,O QRXV
SHUPHWG¶pYDOXHUOHSRWHQWLHOGHQRWUHPpWKRGHHWQRVPpWD-modèles dans un autre type de projet
de conception de services.
Le tableau de bord envisagé ici est un outil de collaboration GRQWO¶REMHFWLIHVWGHIRXUQLUXQH
information synthétique sur le projet de construction au cours des différentes étapes de chantier
PDWpULDX[WkFKHVG¶H[pFXWLRQ PDOIDoRQV«,OHVWGHVWLQp jDVVLVWHUOHU{OHGH FRRUGLnateur au
FRXUV GHV YLVLWHV GH FKDQWLHU UpJXOLqUHV /¶XVDJH TXH QRXV LQWURGXLVRQV LFL HVW GRQF UHODWLI j XQ
contenu et à un contexte spatio-temporel particulier. Il est également lié à un matériel particulier,
à savoir une tablette tactile pouvant être géolocalisée.
/¶H[SpULPHQWDWLRQEHDXFRXSSOXVFRXUWHTXHOHVGHX[SUpFpGHQWHV, a été composée de deux
VpDQFHVGHWUDYDLO/DSUHPLqUHDYDLWSRXUEXWG¶LQLWLHUOHSURMHWjSDUWLUGHPDTXHWWDJHVLOOXVWUDQW
OHV DWWHQWHV GH O¶H[SHUW PpWLHU &H GHUQLHU DYDLW GRQc une idée plutôt formalisée du service à
concevoir.
Lors de la deuxième séance de travail, les différents modèles préconisés par la méthode ont
pWpFRPSRVpV/HFRQFHSWHXUDHQVXLWHSXIRUPDOLVHUOHFDKLHUG¶H[LJHQFHV à partir des modèles et
des notes prises au cours de la séance de travail.
Figure 136. 'pURXOHPHQWGHO¶H[SpULPHQWDWLRQ
1.42.2 Analyse des besoins métier : un maquettage comme point de départ
/¶LGpHGHGpSDUWSURSRVpHSDUO¶H[SHUWPpWLHUétait de concevoir un tableau de bord proposant
un certain nombre de services liés à la localisation du coordinateur sur le chantier, pendant sa
visite. À partir de ses connaissances du domaine et de sHVDWWHQWHVTXDQWjO¶XVDJHG¶XQWHORXWLO
O¶H[SHUWPpWLHUDSURSRVp un ensemble de maquettages qui pourraient servir de première impulsion
à un projet de développement.
236 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Figure 137. 3URSRVLWLRQG¶XQQRXYHORXWLOVXUODEDVHGHPDTXHWWDJHV
(tiré de (Guerriero et al. 2012))
&HVPDTXHWWDJHVVRQWGHVYXHVGHO¶RXWLOWHOOHVTX¶HOOHVGHYUDLHQWVHFRmposer en fonction de
« O¶pFKHOOH » considérée (ou niveau de détail), à savoir OH VLWH OH EkWLPHQW O¶pWDJH OD SLqFH HW
O¶RXYUDJH,OVVRQWFRPSOpWpVSDUXQHGHVFULSWLRQOLWWpUDOHGHO¶LQIRUPDWLRQjDIILFKHUGDQVFKDFXQH
de ces vues à chacun de ces niveaux
Du point de vXHRUJDQLVDWLRQQHOLOV¶DJLWG¶DVVLVWHUXQHSUDWLTXHGXFRRUGLQDWHXUTXLVRXKDLWH
DQDO\VHU O¶DYDQFement du chantier en visitant le bâtiment lui-même mais aussi au travers des
comptes-rendus de chantier et des remarques faites sur le bâtiment. 6¶LO LGHQWLILH GHV défauts, il
voudra en informer les entreprises concernées au travers de remarques. Nous avons pu
caractériser cette pratique grâce au diagramme de pratiques. Il aura fallu compléter le métamodèle afin de pouvoir G¶DMRXWHUGHVpOpPHnts de description comme par exemple les défauts.
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
237 Figure 138. Diagramme de la pratique de surveillance du chantier
1.42.3 I dentification et conception GHO¶XVDJH, perspectives de développement
'¶XQ SRLQW GH YXH RSpUDWLRQQHO O¶LQWHQWLRQ GH O¶XWLOLVDWHXU est dans un premier temps
G¶DFFpGHUDX[pOpPHQWVGXFRPSWH-rendu et aux remarques en fonction de sa localisation dans le
EkWLPHQW j O¶pFKHOOH GX VLWH GX EkWLPHQW GH OD SLqFH HW GH O¶RXYUDge. Le système sera chargé
G¶DIILFKHU OD ERQQH LQIRUPDWLRQ HQ IRQFWLRQ GH OD ORFDOLVDWLRQ 1RXV LPDJLQRQV TX¶LGHQWLILHU XQ
ouvrage pour en afficher les informations relatives pourrait se faire de deux façons : en
sélectionnDQWO¶RXYUDJHGDQVOHPRGqOH'ou en scannant un QR Code voire une puce RFID sur
O¶RXYUDJH2QSRXUra définir ainsi deux YDULDQWHVGHO¶XVDJH. À O¶pFKHOOHGHO¶ouvrage, il sera alors
possible de recenser tout nouveau défaut remarqué et pas encore référencé DILQG¶HQLQIRUPHUOHV
entreprises.
238 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Figure 139. Extrait du « contextual use case » SRXUO¶XVDJHGXWDEOHDXGH
bord (niveau ouvrage)
/HGLDJUDPPHG¶LQWHUDFWLRQVVXLYDQWGpWDLOOHO¶LQWHQWLRQ© ajoute une nouvelle remarque ». La
WkFKHGHVpOHFWLRQGHO¶RXYUDJHWkFKHDEVWUDLWHHVWLFLVSpFLILpHSDUXQ© FOLFNVXUO¶RXYUDJHGDQV
le modèle » ou « un scan de la puce RFID ªWkFKHVFRQFUqWHVWHOTXHQRXVO¶DYRQVGpFULWSOXV
haut. /HV REMHWV G¶LQWHUDFWLRQ VRQW O¶RXYUDJH HW OD UHPDUTXH GpFULYDQW OH GpIDXW VXU FHW RXYUDJH
/¶RXYUDJHHVWXQREMHWGXPRGqOHTX¶RQFDUDFWpULVHFRPPHREMHW%,0ODUHPDUTXHHVWjODIRLV
élément du modèle (objet BIM) et élément du rapport de chantier (document).
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
239 Figure 140. 'LDJUDPPHG¶LQWHUDFWLRQVSRXUO¶DMRXWGHUHPDUTXHV
Recommandations et pistes pour le développement du service
Les remarques sur le chantier sont les informations clés de cet usage et sont, comme nous
venons de le dire, des éléments du rapport de chantier. Sachant que le service métier « comptesrendus » de CRTI-weB propose déjà des services informatiques pour la gestion de ces rapports et
des remarques, nous pourrLRQVOHVLQWpJUHUGDQVO¶LPSOpPHQWDWLRQGXQRXYHDXVHUYLFH&HVHUYLFH
métier de « surveillance de chantier » devra aussi contenir des services relatifs au BIM.
1.42.4 Conclusion
&HWWHH[SpULPHQWDWLRQQRXVDSHUPLVG¶DSSOLTXHUODPpWKRGHGHPDQLqUHGLIIpUHQWHHWpour un
type de service différent. /¶LGpHLQQRYDQWH initiale (un tableau de bord utilisant les remarques des
comptes-rendus CRTI-weB) a pu être en partie concrétisée en réponse à des pratiques métiers
modélisées grâce à notre méthode et par une définition des usages liés.
Évaluation de la pertinence
/RUVTX¶XQ utilisateur ou un expert métier propose un service très précis à travers un
maquettage, OH ULVTXH PDMHXU HVW TX¶LO QH SHUoRLYH SDV OHV OLPLWHV GX UpDOLVDEOH dans le contexte
technologique dans lequel il se trouve. Il ne peut pas non plus évaluer les coûts et le temps requis
pour mener le projet de développement à bien'¶XQSRLQWGHYXHFROODERUDWLIXQHSURSRVLWLRQVXU
simple maquettage ne pourra donc pas suIILUH DXSUqV G¶XQH VRFLpWp GH VHUYLFHV FDU, avant tout
début de projet :
- il faudra vérifier TX¶LO\DLWGHUpHOVEHVRLQVPpWLHUVjRXWLOOHU,
- iOIDXGUDpYDOXHUO¶LPSDFWG¶XQHWHOOHproposition en termes de développements.
La méthode PUSH permet, par la modéOLVDWLRQ G¶DQFUHU XQH YRORQWp G¶LQQRYDWLRQ GDQV XQ
SURFHVVXV GH FRQFHSWLRQ MXVWLILp (OOH HQFRXUDJH DLQVL O¶DPRUFH G¶XQ SURMHW GH GpYHORSSHPHQW
auprès de ses acteurs.
240 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Évaluation et évolution des concepts
Nous avons dû faire évoluer les méta-modèles afin de pouvoir décrire les situations de la
manière la plus fidèle. Nous avons par exemple DMRXWp O¶REMHW © défaut » nécessaire ici dans la
caractérisation de la pratique. Par extension, en nous questionnant sur les éléments relatifs au
FKDQWLHUTXLQ¶pWDLHQWpas encore caractérisés, nous avons également ajouté les engins de chantier,
les matériaux et les échantillons. /¶DSSURFKH GLULJpH SDU OHV PRGqOHV, et en particulier la
génération de notre propre interface de modélisation, permet donc une évolution qui sera
V€UHPHQWQpFHVVDLUHDXILOG¶DXWUHVapplications de la méthode.
Dans cette expérimentation, nous avons pu exploiter le concept G¶REMHW G¶LQWHUDFWLRQ et décrire
ainsi les ouvrages du bâtiment et les remarques du compte-rendu comme de réels « éléments
métiers médiatisés ». Cela nous permet de définir un usage au plus proche des pratiques métiers
identifiées en amont.
Évaluation des formalismes
1RXV DYRQV FRQVWDWp TXH ORUVTX¶XQH VLWXDWLRQ GHYLHQW SOXV FRPSOH[H DYHF GH PXOWLSOHV
opérations, des liens entre les artefacts«) le diagramme de pratiques perd en lisibilité. Cela fait
UHVVRUWLU O¶LPSRUWDQFH GH WUDLWHU OHV H[LJHQFHV DX FDV SDU FDV VDQV GpILQLU GHV SURFHVVXV WURS
complets. Les correspondances graphiques entre modèles permettent de tenir un discours cohérent
DYHF XQ FROODERUDWHXU TXL Q¶D SDV O¶KDELWXGH GH PDQLSXOHU autant de modèles. Les diagrammes
G¶LQWHUDFWLRQVJDJQHQWpJDOHPHQWjrWUHGLYLVpVHQSOXVLHXUVHQWLWpVSRXUXQHPHLOOHXUHOLVLELOLWp
1.43
Conclusion : apports des expérimentations
1.43.1 Résumé
/D SUHPLqUH H[SpULPHQWDWLRQ QRXV D SHUPLV GH PHWWUH HQ pYLGHQFH O¶LPSRUWDQFH GH OD
spécification des besoins métiers et les différences entre les usages qui peuvent en découler. Elle a
PRQWUpO¶LPSRUWDQFHGHODFROODERUDWLRQHQWUHH[SHUWs métiers, concepteurs et développeurs autour
de modèles appropriés. Elle a également permis de valider les concepts de pratique, usage et
VHUYLFHFRPPHFRQFHSWVFOpVGHVpWDSHVGHFRQFHSWLRQG¶XQVHUYLFH
La deuxième expérimentation a montré un autre cas G¶DPpOLRUDWLRQ GH VHUYLFH HQ VH
FRQFHQWUDQW VXU OD VLPSOLILFDWLRQ GH O¶LQWHUDFWLRQ DX QLYHDX GH O¶XVDJH. Elle a fait ressortir
O¶LPSRUWDQFH :
- GHGpFULUHOHFRQWH[WHPpWLHUHWO¶XWLOLWpGHODPRGpOLVDWLRQGHSUDWLTXH,
- de décrire le contexte technique, ce quLHVWDWWHQGXHWO¶XWLOLWpGHODPRGpOLVDWLRQGHO¶XVDJH,
- GHGpFULUHFHTXLHVWSURSRVpHWO¶XWLOLWpGHODPRGpOLVDWLRQGXVHUYLFH.
/DWURLVLqPHH[SpULPHQWDWLRQDYDOLGpO¶LQWpUrWGHODPpWKRGHHQWDQWTXHPR\HQGHIRUPDOLVHU
un processus de conception à pDUWLU G¶XQH LGpH GH VHUYLFH (décrite par un maquettage). Elle a
permis de préciser les concepts utilisés et G¶LQWURGXLUHOHV REMHWVG¶LQWHUaction HQWDQWTX¶pOpPHQW
GHGHVFULSWLRQGHO¶LQIRUPDWLRQPpWLHUPpGLDWLVpH
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
241 7UDQVPHWWUHO¶LQIRUmation : le rôle des modèles
Un projet de conception de services est un projet collaboratif en lui-même, ce qui implique
O¶LQWHUYHQWLRQGHSOXVLHXUVSRLQWVGHYXHVXUOe processus. Nous avons associé à ces points de vue
plusieurs modèles qui permettent de les exprimer (Figure 141). Les expérimentations ont permis
G¶REVHUYHUOHU{OHGHFHVPRGqOHV
Les modèles de pratiques permettent aux experts métier de décrire de manière simple une
situation observée. Les utilisateurs eux-mêmes ne peuvent être impliqués dans une description
complète de leur travail. &HSHQGDQW ORUVTX¶LOV¶DJLW GHSURSRVHURX G¶DPpOLRUHUXQVHUYLFHSRXU
les assister, ils peuvent mettre en avant des problèmes particuliers auxquels ils sont confrontés.
Un modèle de pratique devra permettre de formaliser de telles situations particulières tout en les
FRQFHSWXDOLVDQWDILQGHSRXYRLUDVVRFLHUFHPRGqOHjG¶DXWUHVFDVREVHUYpV/¶H[SHUWPpWLHUFUpH
ce modèle et le communique aux concepteurs de services.
/HVFRQFHSWHXUVIRQWpWDWGXFRQWH[WHGHO¶XVDJHjWUDYHUVOH© contextual use case ». Celui-ci
est présenté aux experts métier pour une description générale de la solution qui sera implémentée
et permet une première phase de validation. Dans un deuxième temps, il est complété de
GLDJUDPPHV G¶LQWHUDFWLRQ (voire de maquettages) et soumis aux développeurs pour ouvrir la
discussion sur les aspects techniques. Un premier ensemble de diagrammes de séquences « non
technique » (sans détail de O¶architecture du service) présentant un scénario idéal peut également
être proposé par les concepteurs.
Les développeurs mènent la production du service et produisent de manière ponctuelle une
version détaillée des diagrammes afin de supporter la discussion,OV¶DJLWDORUVG¶pFKDQJHUVXUOHV
alternatives à proposer en cas de limites techniques ou VXUODJHVWLRQGHVFDVG¶HUUHXU
Figure 141. Collaboration pour la conception de services autour de la
production de modèles
/¶LPSRUWDQFHGHVIRUPDOLVPHV
1RWUH FKRL[ V¶HVW SRrté sur une association des modèles graphiques et des modèles textuels
pour une expression des points de vue alliant synthèse et précision. Les diagrammes sont adaptés
pour décrire les comportements en présentant de manière synthétique les acteurs et les entités
manipulées que ce soit au niveau des pratiques métiers FRPPH DX QLYHDX GH O¶XVDJH RX HQFRUH
pour la description du service. /HXUOHFWXUHHVWVLPSOHVLSHXG¶pOpPHQWVOHVFRPSRVHQW$ILQGH
limiter la détérioration de la lecture, il faudra donc privilégier la décomposition des cas trop
242 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
complexes en cas simples. /¶DYDQWDJHG¶XQHDSSURFKHJUDSKLTXHHVWGHSRXYRLUOLHUYLVuellement
les modèles entre eux, et représenter ainsi les liens conceptuels entre les points de vue. Si les
diagrammes de FDVG¶XWLOLVDWLRQ ou de tâches font parties des modèles adoptés par la communauté,
O¶XWLOLVDWLRQ GHV DUEUHV KLpUDUFKLTXHV SRXU OD GHVFULSWLRQ GX PpWLHU GLIIqUH TXDQW j HOOH GHV
habituels diagrammes de processus comme BPMN. Instanciés à partir G¶XQ PpWD-modèle de
pratiques FRQVWUXLWVXUODEDVHG¶XQHpWXGHGXFRQWH[WHG¶XQSURMHW$,C, ils permettent cependant
une description à la fois spécifique et pertinente du métier.
La description textuelle qui complète les modèlHVGDQVOHFDKLHUG¶H[LJHQFHV permet quant à
HOOH GH GpWDLOOHU FHUWDLQV pOpPHQWV VXU OHVTXHOV LO VHUD LPSRUWDQW GH V¶DWWDUGHU Les éléments à
décrire sont précisés et formatés dans des tableaux. Leur édition est guidée par choix multiple ou
totalement libre. Les choix multiples doivent permettre de couvrir tous les cas de figure ou à
GpIDXW G¶rWUH FRPSOpWpV VL EHVRLQ /¶pGLWLRQ OLEUH SUpVHQWH O¶LQWpUrW GH SRXYRLU V¶H[SULPHU
librement sans contrainte. Il peut néanmoins être difficile dans certains cas de savoir quoi
répondre.
Vis-à-vis des expérimentations menées, QRXV SHQVRQV TX¶XQ PRGqOH SHUWLQHQW Q¶HVW SDV
forcément un modèle complet (dans lequel on aura utilisé et défini tout les concepts) mais un
PRGqOHFRQFLVTXLUHSUHQGUDO¶information strictement nécessaire à la conception du service final.
Résumé des réponses des expérimentations
Le début de ce chapitre (cf. § 1.39.3, Tableau 24) évoquait nos attentes en termes de
validation vis-à-vis des expérimentations. Nous pouvons à présent conclure sur les apports réels
de ces expérimentations (Tableau 25). /HVIOqFKHVURXJHVV\PEROLVHQWO¶pYROXWLRQGHODPpWKRGH
(notamment des concepts et formalismes utilisés) grâce aux expérimentations. Les symboles « + »
montrent que les expérimentations se complètent dans la validation de la méthode, chacune
apportant un élément différent.
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
243 Tableau 25. Apports des différentes expérimentations
$SSRUWV«
Upload multiple
cf. méthode
En favorisant le
transfert des
exigences, la méthode
permet de lever des
risques
Upload Automatique
La méthode permet
G¶LQWpJUHUOHV
développeurs dans le
projet et favorise le
dialogue avec les
concepteurs
Tableau de bord
La méthode permet aux
experts métiers et aux
concepteurs de
V¶DFFRUGHUVXUXQXVDJH
à spécifier en fonction
des besoins métier
cf. concepts
Les descriptions des
pratiques et usages
sont pertinentes mais
ne suffisent pas à
décrire le service
La composition des
trois points de vue
forme un modèle de
développement
complet
Les concepts peuvent
être améliorés et
complétés de manière
régulière pour raffiner
O¶DQDO\VH
cf. modèles
Le diagramme de
pratique est utile mais
les diagrammes relatifs
aux usages restent
insuffisants sans plus
de précisions
techniques
/HSDVVDJHG¶XQ
PRGqOHjO¶DXWUHHVW
explicite et favorise
le dialogue entre
concepteurs et
développeurs
/HSDVVDJHG¶XQ
PRGqOHjO¶DXWUHHVW
explicite et favorise le
dialogue entre expert
métier et concepteur de
service
cf.
adaptation
Les utilisateurs
SULYLOpJLHQWO¶XSORDG
multiple et en font
O¶XVDJHSRXUOHTXHOLOD
été développé
Peu de tests on été
effectués, ils valident le
fonctionnement du
service mais pas son
adaptation
Aucun développement
Q¶DpWpHIIHFWXp
1.43.2 Les trois « push »
/HV WURLV H[SpULPHQWDWLRQV PHQpHV QRXV RQW SHUPLV G¶LGHQWLILHU WURLV LPSXOVLRQV SRVVLEOHV
SRXU OH GpYHORSSHPHQW G¶XQ VHUYLFH DGDSWp F¶HVW FH TXH QRXV GpILQLVVRQV FRPPH OHV WURLV
« push » de la méthode.
Le push métier
Le push PpWLHU F¶HVW O¶LPSXOVLRQ LVVXH G¶XQ EHVRLQ G¶DVVLVWDQFH j GHV SUDWLTXHV H[pFXWpHV
GDQV XQ FRQWH[WH PpWLHU SDUWLFXOLHU &HWWH DVVLVWDQFH GHYUD SHUPHWWUH G¶DWWHLQGUH OHV REMHFWLIV
métiers identifiés en assurant la satisfaction des utilisateurs ORUVGHODFUpDWLRQRXO¶DGDSWDWLRQGH
services. La création de CRTI-weB ainsi que les phases ultérieures de développement comme
FHOOHFRQVWLWXDQWQRWUHSUHPLqUHH[SpULPHQWDWLRQVRQWLVVXHVG¶XQHWHOOHLPSXOVLRQ
Le push technique
Le push technique SHUPHW G¶DVVLVWHU XQH SUDWLTXH GH PDQLqUH GLIIpUHQWH SDU XQH UpSRQVH
technologique alternative à des solutions existantes ,O V¶DJLW GH GpILQLU XQ DXWUH XVDJH qui sera
perçu comme plus VLPSOHSDUOHVXWLOLVDWHXUVWRXWHQDVVXUDQWO¶H[pFXWLRQGHOHXUSUDWLTXHPpWLHU
La définition de CRTI-ER[GHX[LqPHH[SpULPHQWDWLRQHVWLVVXHG¶XQHWHOOHLPSXOVLRQ basée sur
O¶pWXGH HWO¶DGDSWDWLRQ des services de DropBox.
244 Chapitre 12 ± La méthode PUSH : expérimentations et bilan |
Le push innovation
Le push LQQRYDWLRQHVWEDVpVXUODFUpDWLRQGHQRXYHDX[FRQWH[WHVTXHFHVRLWG¶XQSRLQWGH
YXH PpWLHU RX WHFKQRORJLTXH (Q G¶DXWUHV WHUPHV, on cherchera à faire émerger de nouvelles
pratiques ou de nouveaux usages par la conception de services. /DSURSRVLWLRQG¶XQ7DEOHDXGH
bord sur tablette tactile et profitant de la géolocalisation pour assister la coordination G¶XQ
FKDQWLHU pWDLW W\SLTXHPHQW V\QRQ\PH G¶XQH YRORQWp G¶LQQRYDWLRQ. Le risque dans un tel cas de
figure est cependanWGHQHSDVPHVXUHUOHVOLPLWHVTX¶LOIDXGUDIUDQFKLUSRXUGpYHORSSHUOHVHUYLFH
voulu.
| Chapitre 12 ± La méthode PUSH : expérimentations et bilan
245 246 |
Conclusion et perspectives
Le travail décrit dans cette thèse a porté sur deux points essentiels O¶DQDO\VH métier et la
conception de services informatiques. Nous avons mis en avant les relations qui existaient entre
ces deux points à travers la modélisation et afin de répondre à une problématique : la conception
GHVHUYLFHVFROODERUDWLIVDGDSWpVDX[SUDWLTXHVG¶XQSURMHW$,&
Concevoir une méthode de conception : recul sur une approche orientée « design
science »
Le cycle itératif composé des phases « connaissance, suggestion, développement, évaluation
et conclusion » a été suivi dans la conception de la méthode proposée (Figure 142). Les
paragraphes suivants en résument succinctement le contenu.
La connaissance multidisciplinaire a été construite autour de trois axes de recherche
principaux :
- des études initiales sur le contexte coopératif G¶XQSURMHW$,C,
- du projet de conception des services de la plateforme CRTI-weB,
- HWG¶XQpWDWGHO¶DUWVXUOHVPpWKRGHVGHFRQFHSWLRQORJLFLHOOHVHORQSOXVLHXUVDSSURFKHV
À partir de ces connaissances, plusieurs processus de conception et développement ont été
menés et évalués au cours de trois expérimentations. Nous avons ainsi proposé :
- une modélisation des pratiques métiers qui complète les études antérieures sur le contexte
coopératif,
- et O¶LQWpJUDWLRQGHFHWWHPRGpOisation dans un processus de conception de services, inspiré des
PpWKRGHVDQDO\VpHVHWDSSOLTXpSRXUO¶DPpOLRUDWLRQGHVVHUYLFHVGH&57,-weB.
Les expérimentations ont également permis de prendre un certain recul sur le déroulement
G¶XQe méthode de conception de services en concluant sur divers points :
- il est important de supporter chaque point de vue apporté dans un processus de conception en
GLVWLQJXDQW OHV FRQFHSWV PDQLSXOpV SDU FKDFXQ G¶HX[, et en facilitant le transfert de
O¶LQIRUPDWLRQHVVHQWLHOOHHQWre ces points de vue,
| Conclusion et perspectives
247 -
LOHVWLPSRUWDQWG¶XWLOLVHUGHVODQJDJHVHWIRUPDOLVPHVTXLVRLHQWDGDSWpVaux différents points
de vue, en considérant les langages existants et les habitudes de chacun.
Enfin, il a évidemment été question à travers les expérimentations de valider la réponse à la
SUREOpPDWLTXHLQLWLDOHjVDYRLUO¶DGDSWDWLRQGHVHUYLFHVSURSRVpVDX[EHVRLQVPpWLHUV
Figure 142. Rappel : Démarche suivie dans notre recherche basée sur la
conception
/¶DSSURFKHIDLWSUHXYHFHSHQGDQWGHTXHOTXHVODFXQHVVXUSOXVLHXUVSRLQWV&¶HVWFHGRQWQRXV
discuterons dans les paragraphes suivants.
/HVOLPLWHVGHO¶DSSURFKH
Les premières OLPLWHV VRQW G¶RUGUH WKpRULTXH HW VRQW UHODWLYHV j O¶H[SORUDWLRQ GHV GLYHUV
champs de recherche. Malgré une étude approfondie des méthodes de conception de service, le
PDQTXHG¶H[SHUWLVHLQLWLDOHGDQVFHGRPDLQHSRXUUDVHUHIOpWHUGDQVO¶pWDWGHO¶DUWSURSRVp Notre
approche non-experte a permis de prendre du recul par rapport aux références du domaine et de
théoriser celles-ci pour en extraire une méthodologie générale. Cependant, on pourra reprocher à
cette étude de ne pas entrer dans les détails, notamment techniques et relatifs au développement.
Il est LPSRUWDQWGHUDSSHOHUTXHO¶DSSURFKHSURSRVpHQ¶DSDVODSUpWHQWLRQGHYRXORLUJpQpUHU
des services adaptés à la manière des approches MDA. La manière de typer les tâches et les
données que nous proposons HVWXQHSUHPLqUHpWDSHGDQVFHWWHRSWLTXHPDLVFHWWHUpIOH[LRQQ¶DSDV
été éprouvée. Notre approche fournit par contre les éléments nécessairHV HQ YXH G¶DPpOLRUHU la
spécification de services GDQV OH FDGUH G¶XQ SURMHW GH FRQFHSWLRQ ORJLFLHOOH © classique ».
/¶DWWHQWLRQDQRWDPPHQWpWpSRUWpHVXU la gestion et la coordination des différents points de vue au
cours du processus de conception de services.
Trois expérimentations ont été menées afin de valider la proposition formulée. Cependant, on
pourra se demander dans quelle mesure les méta-modèles ne seraient pas perfectibles et
améliorables SDUOHXULQVWDQFLDWLRQGDQVG¶DXWUHVFDVG¶pWXGHV,OVHrait intéressant de les tester de
248 Conclusion et perspectives |
PDQLqUH pWHQGXH MXVTX¶j FH TX¶LOV se stabilisent pour ainsi valider leur pertinence de manière
UHSUpVHQWDWLYHSRXUO¶HQVHPEOHGHVSURMHWV. ,OIDXGUDSRXUoDVXUYROHUXQSDQHOG¶H[SpULPHQWDWLRQV
plus étendu. Étendre les exppULPHQWDWLRQV SHUPHWWUD pJDOHPHQW G¶pYDOXHU O¶DSSURSULDWLRQ G¶XQH
telle approche par des équipes différentes. $FWXHOOHPHQWQRXVQ¶DYRQVSXVRXPHWWUHO¶DSSURFKH à
G¶DXWUHV H[SHUWV PpWLHUV ou concepteurs que ceux impliqués dans le projet CRTI-weB et les
services parallèles. Le projet CRTI-box a introduit un nouveau développeur mais cela ne permet
SDVGHYDOLGHUO¶DSSOLFDWLRQGHODPpWKRGHGHPDQLqUHpWHQGXH
On pourra remarquer également que, au contraire des DSSURFKHV G¶LQJpQLHULH GHV H[LJHQFHV
classiques, cette méthode ne prend pas en compte de manière explicite les exigences non
fonctionnelles. &RPSDUpH DX[ PpWKRGHV GH FRQFHSWLRQ G¶,+0 HOOH QH SHUPHW SDV QRQ SOXV
G¶LQFOXUHGHVFULWqUHVG¶pYDOXDWLRQHUJRQRPLTXH
Perspectives
Les champs de recherche couverts ouvrent des perspectives multiples à ce travail, notamment
par rapport aux limites identifiées ci-dessus.
,ODGpMjpWppYRTXpODQpFHVVLWpG¶pWHQGUHO¶DSSOLFDWLRQGHFHWWHPpWKRGHjGHSOXVQRPEUHX[
FDV G¶pWXGHV SRXU HQ pYDOXHU OD SHUWLQHQFH j OD IRLV Whéorique et pratique. Pour cela, il sera
LQGLVSHQVDEOH G¶DPpOLRUHU O¶pGLWLRQ GHV GLIIpUHQWV PRGqOHV SDU OHV DFWHXUV FRQFHUQpV 3OXVLHXUV
pistes sont à suivre :
- intégrer les éditeurs de modèles dans un seul outil qui permettra de les faire évoluer de
manière homogène, sans avoir à gérer de nombreuses applications,
- O¶DXWRPDWLVDWLRQ GHV WUDQVIRUPDWLRQV GH PRGqOHV QRWDPPHQW ORUVTXH F¶HVW SRVVLEOH SDU OD
JpQpUDWLRQDXWRPDWLTXHGHVpOpPHQWVG¶XQPRGqOHjSDUWLUGXPRGqOHSUpFpGHQW. Cela réduira
le temps de modélisation et assurera la bonne correspondance entre les modèles.
- La génération automatisée et incrémentale GHVYHUVLRQVGXFDKLHUG¶H[LJHQFHs pour chaque cas
traité.
Au fur et à mesXUH GHV DSSOLFDWLRQV QRXV SRXUURQV EpQpILFLHU G¶XQ répertoire de pratiques
SUpGpILQLHV HW RXWLOOpHV VXU ODTXHOOH QRXV SRXUURQV QRXV DSSX\HU SRXU G¶DXWUHV GpYHORSSHPHQWV
/¶REMHFWLI j ORQJ WHUPH HVW GH SRXYRLU DVVRFLHU GH SOXV HQ SOXV G¶DQDO\VHV PpWLHU j GHV EHVRLQV
déjà traités pour réutiliser, ne serait-FHTX¶HQSDUWLHOHWUDvail de conception déjà effectué.
Par la séparation des points de vue et la « transformation ªGHVPRGqOHVG¶XQSRLQWGHYXHj
XQ DXWUH FHWWH PpWKRGRORJLH V¶LQVSLUH GHV DSSURFKHV 0'$ GRQW QRXV DYRQV SUpVHQWp OHV
caractéristiques précédemment (voir 1.11.21RXVQ¶DYRQVSDVH[SORUpSRXUODPpWKRGH386+
OHV SRVVLELOLWpV GH WUDQVIRUPDWLRQ DXWRPDWLVpH &HSHQGDQW DVVLVWHU OH SDVVDJH G¶XQ PRGqOH j
O¶DXWUH UHVWH XQH RSSRUWXQLWp JUkFH j O¶DSSURFKH SDU FRPSRVLWLRQ GH PpWD-modèles. Une
SHUVSHFWLYH VHUDLW G¶DXWRPDWLVHU OD FUpDWLRQ GX VTXHOHWWH G¶XQ PRGqOH j SDUWLU GX PRGqOH
SUpFpGHQW3DUH[HPSOHODEDVHGXGLDJUDPPHGHFDVG¶XWLOLVDWLRQVO¶XWLOLVDWHXUOHV\VWqPHHWOHV
packages) pourrait être créée à partir du diagramme de pratiquesQHODLVVDQWDXFRQFHSWHXUTX¶j
VSpFLILHU OHV FDV G¶XWLOLVDWLRQ SRXU FKDTXH SDFNDJH /D FUpDWLRQ GX GLDJUDPPH G¶LQWHUDFWLRQV
pourrait être assistée de la même façon. Dans une dernière étape, la méthode PUSH pourra ainsi
VHUYLUG¶LQSXWjXQHDSSURFKHJpQpUative comme Caméléon (Calvary et al. 2003),OV¶DJLUDDORUV
de réduire la phase 3 de spécification du service, par la génération automatique de code avec une
intervention limitée des développeurs.
| Conclusion et perspectives
249 '¶XQDXWUHFRWpOa prise en compte des exigences non fonctionnelles et leur intégration dans
OH SURFHVVXV G¶pGLWLRQ GHV GLIIpUHQWV PRGqOHV HVW pJDOHPHQW j HQYLVDJHU SRXU SDUYHQLU j GHV
spécifications qui soient contractuellement pertinentes. Il en va de même pour les critères
ergonomiques qui seront à intégrer pour proposer des solutions satisfaisantes en termes
G¶XWLOLVDELOLWp
La méthode trouvera aussi sa place dans la tendance actuelle de gestion de projets de
construction basée sur la maquette numérique BIM. Comme abordée dans le chapitre 7 (section
1.21 O¶DSSURFKH %,0 D GHX[ FRPSRVDQWHV O¶XWLOLVDWLRQ SDUWDJpH G¶RXWLOV GH PDTXHWWHV
QXPpULTXHVFHQWUDOLVpHVRXGpFHQWUDOLVpHVG¶XQHSDUWHWODPLVHHQSODFHGHpratiques collectives
maîtrisées et amélioréeV G¶DXWUH SDUW /¶HIIRUW de standardisation entrepris depuis une quinzaine
G¶années a conduit à la normalisation d¶XQ VWDQGDUG GH GHVFULSWLRQ GHV RXYUDJHV ,)& ISO
&HSHQGDQW OD GHVFULSWLRQ GHV SURFHVVXV VRXV OD IRUPH G¶,QIRUPDWLRQ 'HOLYHU\
0DQXDOVHQUHVWHDXMRXUG¶hui à ses débuts, et les chercheurs reconnaissent une certaine lourdeur
de ces modèles et une difficulté à définir des processus reproductibles. Notre proposition pourrait
donc certainement apporter un nouveau point de vue à ces travaux.
Nous avons envisagp O¶DSSOLFDELOLWp GH FHWWH PpWKRGH j XQ DXWUH VHFWHXU TXH FHOXL GX SURMHW
$,& (Q HIIHW G¶DXWUHV FRQWH[WHV GH SURMHW GH FRQFHSWLRQ FROODERUDWLYH SRXUUDLHQW rWUH DQDO\VpV
grâce aux outils proposés afin de concevoir des services adaptés à leurs pratiques (comme par
exemple OHVSUDWLTXHVG¶LQJpQLHULHFLYLOHRXHQFRUHGH conception automobile). Cependant, il sera
QpFHVVDLUHG¶pYDOXHUGDQVTXHOOHPHVXUHOHVPpWD-modèles et formalismes devront évoluer afin de
permettre la description de ces contextes différents. Leur structure est générique, on pourra ainsi
UpXWLOLVHU OHV FRQFHSWV LQWURGXLWV DFWHXUV DUWDIHFWV RXWLOV« Cependant, il faudra adapter
O¶LQVWDQFLDWLRQ GH FHV FRQFHSWV en fonction du domaine analysé, notamment à travers les types
énumérés W\SHG¶DFWHXUW\SHGHGRFXPHQWW\SHG¶RXWLO«
250 Conclusion et perspectives |
Table des matières
Liste des abréviations et acronymes........................................................................................................... 15
I ntroduction ................................................................................................................................................. 17
8QHWKqVHjODFURLVpHGHVFKHPLQVHQWUHVFLHQFHVGHO¶DUFKLWHFWXUHHWJpQLHORJLFLHO ............................... 18
Problématique générale ............................................................................................................................. 18
Conceptualiser les méthodes de GL ...................................................................................................... 18
Conceptualiser les pratiques architecturales ......................................................................................... 19
Proposer des services informatiques pour le secteur AIC ..................................................................... 19
Plan de la thèse .......................................................................................................................................... 20
Partie 1 : assister la collaboration dans les projets de construction....................................................... 20
Partie 2 : théories et méthodes, concevoir des services collaboratifs adaptés ....................................... 20
Partie 3 : guider la conception de services collaboratifs adaptés au secteur de la construction ............ 20
PARTI E 1 : ASSI STER LA COLLABORATI ON DANS LES PROJETS DE
CONSTRUCTI ON. DEFI NI 7,21'¶81(352%/(0$7I QUE ET RECUL
THEORI QUE. .................................................................................................................. 21
.................... Chapitre 1 ± La coordination dans les projets de conception/ construction architecturale
....................................................................................................................................................................... 23
1.1
La caractérisation du secteur dans les travaux précédents ........................................................... 23
1.1.1 Les acteurs et leur caractérisation ............................................................................................ 24
1.1.2 Les artefacts et les outils .......................................................................................................... 25
1.1.3 /¶DFWLYLWp.................................................................................................................................. 25
1.1.4 Conclusion ............................................................................................................................... 27
1.2
Les projets de construction et les outils de TCAO ....................................................................... 29
1.2.1 3RXUTXRLPpGLDWLVHUO¶DFWLYLWpFROOHFWLYH ? ............................................................................... 29
1.2.2 /HVW\SHVG¶RXWLOV ..................................................................................................................... 31
1.2.3 /¶DGDSWDWLRQDXFRQWH[WH.......................................................................................................... 34
1.3
Conclusion ................................................................................................................................... 35
............................................. Chapitre 2 ± 8QFDVGHGpYHORSSHPHQWG¶XQRutil de TCAO : CRTI -weB
....................................................................................................................................................................... 37
| Table des matières
251 2.1
'HVFULSWLRQGHO¶H[SpULHQFH .......................................................................................................... 37
2.1.1 Identification des besoins métiers et bonnes pratiques ............................................................ 38
2.1.2 Caractérisation des comptes-rendus et autres documents ........................................................ 39
2.1.3 Services proposés..................................................................................................................... 40
2.2
Analyse critique ........................................................................................................................... 42
2.2.1 &RQWH[WHHWSURWRFROHG¶DQDO\VH ............................................................................................... 42
2.2.2 $QDO\VHGHO¶XWLOLVDWLRQ ............................................................................................................ 42
2.2.3 Analyse du développement et conclusion ................................................................................ 43
2.3
Conclusion ................................................................................................................................... 45
............................................................................... Chapitre 3 - Problématique et méthode de travail
....................................................................................................................................................................... 47
3.1
Construction de la problématique ................................................................................................ 47
3.1.1 Objectifs et concepts vis-à-vis du contexte tri-facettes ............................................................ 47
3.1.2 Formulation de la problématique ............................................................................................. 50
3.2
Méthode de recherche .................................................................................................................. 50
3.2.1 La science de la conception ..................................................................................................... 50
3.2.2 « Concevoir une méthode de conception » .............................................................................. 52
PARTI E 2 : THEORI ES ET M ETHODES. CONCEVOI R DES SERVI CES
COLLABORATI FS ADAPTES ..................................................................................... 53
................................................... Chapitre 4 - 'HO¶XWLOLVDWHXUjODFRQFHSWLRQORJLFLHOOHHWG¶LQWHUIDFHV
....................................................................................................................................................................... 55
4.1
Les méthodes et activités relatives à la conception logicielle ...................................................... 55
4.1.1 /¶pYROXWLRQGHVSURFHVVXVGHFRQFHSWLRQ................................................................................. 56
4.1.2 Vers un processus itératif ......................................................................................................... 57
4.1.3 Les activités de développement et leurs modèles .................................................................... 58
LES ACTI VI TES DE TEST ET LE DEPLOI EM ENT. .............................................. 65
4.1.4 Les méthodes agiles ................................................................................................................. 66
4.1.5 Constat et conclusion ............................................................................................................... 68
4.2
/DFRQFHSWLRQG¶,+0 GHO¶XWLOLVDWHXUjO¶LQWHUIDFH ..................................................................... 69
4.2.1 Vers une méthodologie de la conception enrichie ................................................................... 69
4.2.2 /DPRGpOLVDWLRQGHO¶XWLOLVDWHXUHWGHVRQFRQWH[WH .................................................................. 72
4.2.3 La modélisation des tâches et du contenu ................................................................................ 75
4.2.4 Constat et conclusion ............................................................................................................... 81
4.3
/HVHQMHX[GHO¶,QJpQLHULHHWGHO¶$UFKLWHFWXUH'LULJpHSDUOHV0RGqOHV .................................... 82
4.3.1 ,QWURGXFWLRQjO¶,QJpnierie Dirigée par les Modèles (IDM) ..................................................... 82
4.3.2 /¶DUFKLWHFWXUHGLULJpHSDUOHVPRGqOHV ..................................................................................... 83
4.4
Conclusion : vers « une méthode centrée usages » ...................................................................... 87
.................... Chapitre 5 - 'HO¶HQWUHSULVHRULHQWpHVHUYLFHVjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQ
....................................................................................................................................................................... 89
5.1
/¶HQWUHSULVHRUientée service ........................................................................................................ 89
5.1.1 Le concept de service............................................................................................................... 89
5.1.2 /¶DUFKLWHFWXUHRULHQWpHVHUYLFHV ............................................................................................... 90
5.1.3 Le service informatique ICT .................................................................................................... 92
5.1.4 La place des services ICT dans un business model compétitif ................................................ 95
5.2
'HODPRGpOLVDWLRQGHV3URFHVVXV0pWLHUDX6\VWqPHG¶,QIRUPDWLRQ........................................... 96
252 Table des matières |
5.2.1 ,QWURGXFWLRQjODFRQFHSWLRQGH6\VWqPHVG¶,QIRUPDWLRQV6, ................................................ 96
5.2.2 La modélisation du métier et des processus ............................................................................. 98
5.2.3 Du service métier au service informatique ............................................................................ 101
5.2.4 Les limites des approches basées sur le Business Process Modeling (BPM) ........................ 102
5.3
Conclusion : vers « des services adaptés aux pratiques métiers » .............................................. 103
............................. Chapitre 6 ± Travail Collaboratif Assisté par Ordinateur et Services Collaboratifs
..................................................................................................................................................................... 105
6.1
Description des outils de TCAO et des services collaboratifs.................................................... 105
6.1.1 Les dimensions fonctionnelles et spatio-temporelles............................................................. 105
6.1.2 Les types de services collaboratifs......................................................................................... 106
6.1.3 Description fonctionnelle....................................................................................................... 107
6.2
Vers une réponse à « O¶pFKHFGHODVROXWLRQFROOHFWLFLHO » .......................................................... 109
6.2.1 /HVFRQVWDWVG¶pFKHF .............................................................................................................. 109
6.2.2 /HVSULQFLSHVG¶XQFROOHFWLFLHODGDSWp .................................................................................... 110
6.2.3 « Loose coupling » et conception de services collaboratifs ................................................... 110
6.3
Conclusion : « concevoir des services collaboratifs » ................................................................ 111
................................................... Chapitre 7 ± Les méthodes de conception de services : études de cas
..................................................................................................................................................................... 115
7.1
CoCSys, une méthode de conception de collecticiels dirigée par des modèles ......................... 115
7.1.1 Déroulement de la méthode ................................................................................................... 116
7.1.2 Analyse critique ..................................................................................................................... 121
7.2
La méthode Symphony et les modèles pour la collaboration ..................................................... 123
7.2.1 Symphony et symphony étendue ........................................................................................... 123
7.2.2 La branche fonctionnelle ....................................................................................................... 125
7.2.3 La branche technique et la conception ................................................................................... 127
7.2.4 Analyse critique et conclusion ............................................................................................... 127
7.3
/¶,'0,QIRUPDWLRQ'HOLYHU\0DQXDO) pour la conception de services BIM ............................ 129
7.3.1 BIM, IFC, IDM : une brève introduction ............................................................................... 129
7.3.2 'pILQLWLRQGHVREMHWVG¶pFKDQJHsur la base de processus ...................................................... 130
7.3.3 Analyse critique et conclusion ............................................................................................... 132
7.4
Conclusion et mise en place de la méthode................................................................................ 134
PARTI E 3 : GUI DER LA CONCEPTI ON DE SERVI CES COLLABORATI FS
ADAPTES AU SECTEUR DE LA CONSTRUCTI ON. ETUDES, PROPOSI TI ONS
ET PERSPECTI VES. .................................................................................................... 137
......................................................................................... Chapitre 8 ± I ntroduction de la proposition
..................................................................................................................................................................... 139
8.1
Enjeux de la méthode ................................................................................................................. 139
8.1.1 8QGRPDLQHG¶DSSOLFDWLRQSDUWLFXOLHU .................................................................................... 139
8.1.2 /HFRQWH[WHG¶pWXGHHWOHVREMHFWLIV........................................................................................ 140
8.2
Méthodologie ............................................................................................................................. 141
8.2.1 La caractérisation des points de vue ...................................................................................... 141
8.2.2 Les formalismes et outils utilisés ........................................................................................... 144
8.3
La méthode PUSH : « Practice and Usage-based Service enHancement ................................... 147
8.3.1 Un processus qui valorise les opportunités ............................................................................ 147
8.3.2 Le cahier « FDKLHUG¶H[LJHQFes »............................................................................................ 149
8.4
Conclusion ................................................................................................................................. 151
| Table des matières
253 .......................................Chapitre 9 ± La modélisation des pratiques : le point de vue organisationnel
..................................................................................................................................................................... 153
9.1
Définitions et concepts ............................................................................................................... 153
9.1.1 Les pratiques XQQRXYHDXGpFRXSDJHGHO¶DFWLYLWpGHSURMHW................................................ 153
9.1.2 Les familles de pratiques (ou pratiques collectives génériques) ............................................ 155
9.1.3 (QMHX[GDQVO¶LQVWUXPHQWDWLRQGHVSUDWLTXHVPpWLHUVHWDSSURFKHVGHPRGpOLVDWLRQ .............. 162
9.2
Le Méta-Modèle des Pratiques Métier ....................................................................................... 162
9.2.1 Les pratiques collectives ........................................................................................................ 162
9.2.2 Les pratiques individuelles et les opérations métiers ............................................................. 165
9.2.3 Conclusion ............................................................................................................................. 168
9.3
Le modèle de pratiques .............................................................................................................. 169
9.3.1 &ULWLTXHG¶XQIRUPDOLVPHH[LVWDQW ......................................................................................... 169
9.3.2 /¶pGLWHXUHWOHVPRGqOHVJpQpUpV ............................................................................................ 171
9.3.3 ,QWpJUDWLRQGDQVOHFDKLHUG¶H[LJHQFHV ................................................................................... 173
9.4
Conclusion ................................................................................................................................. 174
.............................................. Chapitre 10 ± La modélisation des usages : le point de vue opérationnel
..................................................................................................................................................................... 177
10.1
Définition et concepts ................................................................................................................ 177
10.1.1
Usage et utilisation ............................................................................................................ 177
10.1.2
&DUDFWpULVDWLRQGHO¶XVDJH.................................................................................................. 178
10.2
Le méta-modèle des Usages ....................................................................................................... 179
10.2.1
/¶LQWHUDFWion ...................................................................................................................... 179
10.2.2
/HFRQWHQXG¶LQWHUDFWLRQ .................................................................................................... 181
10.2.3
/HFRQWH[WHG¶XVDJH ........................................................................................................... 183
10.2.4
Conclusion : le méta-PRGqOHG¶XVDJH008 .................................................................. 186
10.3
/HVPRGqOHVG¶XVDJH .................................................................................................................. 187
10.3.1
Le « GLDJUDPPHGHFDVG¶XWLOisation contextualisé » ......................................................... 187
10.3.2
/HVGLDJUDPPHVG¶LQWHUDFWLRQHWPDTXHWWDJHVG¶LQWHUIDFHV ............................................... 190
10.3.3
Intégration dans le cahieUG¶H[LJHQFHV............................................................................... 193
10.4
Conclusion ................................................................................................................................. 194
.............................................. Chapitre 11 ± La modélisation des services : le point de vue fonctionnel
..................................................................................................................................................................... 199
11.1
Définitions et concepts ............................................................................................................... 199
11.1.1
Services métier et services informatiques ICT .................................................................. 199
11.1.2
Caractérisation des services ............................................................................................... 200
11.2
Méta-modèle de service ............................................................................................................. 200
11.2.1
Le service PDWpULDOLVDWLRQGHO¶Xsage .............................................................................. 200
11.2.2
Les composants du service ICT ......................................................................................... 202
11.2.3
Le méta-modèle des services ICT adaptés......................................................................... 203
11.3
Modélisation des services et implémentation ............................................................................. 207
11.3.1
Le diagramme de séquence ............................................................................................... 207
11.3.2
,QWpJUDWLRQGDQVOHFDKLHUG¶H[LJHQFHV............................................................................... 208
11.3.3
Développements ................................................................................................................ 209
11.4
Conclusion ................................................................................................................................. 211
.............................................................. Chapitre 12 ± La méthode PUSH : expérimentations et bilan
..................................................................................................................................................................... 213
12.1
Introduction aux expérimentations ............................................................................................. 213
12.1.1
Rappel DSSOLFDWLRQG¶XQHPpWKRGHGLULJpHSDUOHVPRGqOHV ............................................ 213
254 Table des matières |
12.1.2
Contexte des expérimentations .......................................................................................... 216
12.1.3
Objectifs des expérimentations.......................................................................................... 217
12.2
Expérimentation n°1 /¶DPpOLRUDWLRQGXVHUYLFHG¶XSORDGGH&57,-weB ................................ 217
12.2.1
Introduction et déroulement .............................................................................................. 217
12.2.2
Les pratiques de partage .................................................................................................... 219
12.2.3
/HVYDULDQWHVG¶XVDJH ........................................................................................................ 220
12.2.4
Le choix et la spécification de la solution à implémenter.................................................. 224
12.2.5
Conclusion......................................................................................................................... 225
12.3
Expérimentation 2 O¶DXWRPDWLVDWLRQGXVHUYLFHG¶XSORDGGH&57,-weB ................................. 227
12.3.1
Introduction et déroulement .............................................................................................. 227
12.3.2
Un nouvel usagHG¶XSORDG ................................................................................................. 228
12.3.3
Spécifications techniques et développements.................................................................... 232
12.3.4
Conclusion......................................................................................................................... 234
12.4
Expérimentation 3 VSpFLILFDWLRQG¶XQWDEOHDXGHERUG ............................................................. 235
12.4.1
Introduction et déroulement .............................................................................................. 235
12.4.2
Analyse des besoins métier : un maquettage comme point de départ................................ 236
12.4.3
,GHQWLILFDWLRQHWFRQFHSWLRQGHO¶XVDJHSHUVSHFWLYHVGHGpYHORSSHPHQW .......................... 238
12.4.4
Conclusion......................................................................................................................... 240
12.5
Conclusion : apports des expérimentations ................................................................................ 241
12.5.1
Résumé .............................................................................................................................. 241
12.5.2
Les trois « push » .............................................................................................................. 244
Conclusion et perspectives........................................................................................................................ 247
Concevoir une méthode de conception : recul sur une approche orientée « design science »................. 247
/HVOLPLWHVGHO¶DSSURFKH ........................................................................................................................ 248
Perspectives ............................................................................................................................................. 249
Table des matières..................................................................................................................................... 251
Bibliographie.............................................................................................................................................. 257
Glossaire..................................................................................................................................................... 273
Table des illustrations ............................................................................................................................... 277
Liste des figures ...................................................................................................................................... 277
Liste des tableaux .................................................................................................................................... 281
Annexes....................................................................................................................................................... 283
Analyse des « tickets » de conception de CRTI-weB ............................................................................. 283
&DKLHUG¶H[LJHQFHV PRGHG¶HPSORL ....................................................................................................... 288
&DKLHUG¶H[LJHQFHVSDUWLHpGLWDEOH ........................................................................................................ 294
| Table des matières
255 Bibliographie
Aalst, W., 1998. The application of Petri nets to workflow management. Journal of circuits,
systems, and computers, pp.1±53.
Abras, C. & Maloney-Krichmar, D., 2004. User-centered design. Bainbridge, W. Encyclopedia of,
pp.1±14.
Aguilar-Savén, R.S., 2004. Business process modelling: Review and framework. International
Journal of Production Economics, 90(2), pp.129±149.
Andersen, P., Carstensen, P.H. & Nielsen, M., 2000. Dimensions of coordination. In M. Schoop
& C. Quix, eds. LAP 2000. The fifth International Workshop on the Language-Action
Perspective on Communication Modelling. Aachen, Germany, pp. 41±60.
Anderson, R., 1994. Representations and requirements: The value of ethnography in system
design. Human-computer interaction.
Armand, J., 1997. 140 séquences pour mener une opération de construction: Des études
SUpDODEOHVjO¶DFKqYHPHQWGHO
RXYUDJHDFWLRQVWHFKQLTXHVHWGpPDUFKHVDGPLQLVWUDWLYHV,
Le Moniteur.
Arsanjani, A., 2004. Service-oriented modeling and architecture. IBM developer works, (January),
pp.1±15.
Avignon, L. et al., 2002. Architectures dH6\VWqPHVG¶,QIRUPDWLRQ Livre blanc,
Baida, Z., Gordijn, J & Omelayenko, B., 2004. A shared service terminology for online service
provisioning. In M. Janssen, H. Sol, & R. Wagenaar, eds. Proceedings of the 6th
international Conference on Electroinic Commerce. pp. 1±10.
%DLQ'&KDORQ5'DYLG%75pDOLWp0L[WHGHODFRQFHSWLRQjO¶LPSOpPHQWDWLRQ
méthodologie de transformation de modélisations IRVO vers la plateforme WComp. In
$FWHVGHVTXDWULqPHVMRXUQpHVGHO¶$)59. Lyon, France.
| Bibliographie
257 Baron, M. et al., 2006. K-MADe: un environnement pour le noyau du modèle de description de
O¶DFWLYLWpIn ,+0³3URFHHGLQJVRIWKHWK,QWHUQDWLRQDO&RQIHUHQFHRIWKH$VVRFLDWLRQ
)UDQFRSKRQHG´,QWHUDFWLRQ+RPPH-Machine. pp. 287 ± 288.
Bass, L, Faneuf, R. & Little, R., 1992. A metamodel for the runtime architecture of an interactive
system. ACM SIGCHI
Bass, L, Clements, P. & Kazman, R., 2003. Software Architecture in Practice, Addison-Wesley
Professional.
Beck, K, 2003. Test-Driven Development by Example, Addison-Wesley Professional.
Beck, K, 2006. Extreme Programming Explained,
Bennett, K. & Layzell, P., 2000. Service-based software: the future for flexible software. In
Software Engineering Conference, 2000. APSEC 2000. Proceedings. Seventh Asia-Pacific.
pp. 214±221.
Berard, O. & Karlshoej, J., 2012. Information delivery manuals to integrate building product
information into design. ITcon Electronic Journal of Information Technology in
Construction, 17, pp.64±74.
Bignon, J.-C., Halin, G. & Kubicki, S., 2009. Qualité et processus de mise en oeuvre du bâtiment.
In Ramau 5 - La qualité architecturale, Acteurs et enjeux. pp. 127±142.
Bispo, C.P. et al., 2010. Applying a model-driven process for a collaborative service-oriented
architecture. The 2010 14th International Conference on Computer Supported Cooperative
Work in Design, pp.378±383.
Bjekovic, M. & Kubicki, S, 2011. Service quality description²a business perspective. In 2011
Federated Conference on Computer Science and Information Systems. pp. 513±520.
Björk, B.C., 2002. A formalised model of the information and materials handling activities in the
construction process. Construction Innovation: Information, Process, Management, 2(3),
pp.133±149.
Björk, B.C., 1999. Information Technology in Construction±domain definition and research
issues. International Journal of Computer Integrated Design And Construction, 1(1), pp.3±
16.
Bobroff, J. et al., 1993. /HVIRUPHVG¶RUJDQLVDWLRQGHVSURMHWV,QEcosip, Pilotages de projet et
entreprises: diversité et convergences. Paris, France, pp. 35±39.
Bodart, F. & Vanderdonckt, J., 1996. Widget standardisation through abstract interaction objects.
In In Advances in Applied Ergonomics. USA publishing, pp. 300±305.
Boehm, B., 1988. A spiral model of software development and enhancement. Computer, 21(5),
pp.61±72.
Booch, G. et al., 2007. Object Oriented Analysis & Design with Application, Addison-Wesley
Professional.
258 Bibliographie |
Booth, P.A., 1989. An Introduction To Human-Computer Interaction, Lawrence Erlbaum
Associates.
Bose, D., 2002. Component-Based Development - Application in software engineering,
Bouattour, M., 2005. Assistance à la conception coopérative fondée sur la sémantique des
ouvrages. Application au domaine du bois. Nancy Université.
Boucher, E., 2009. Software as a Service - Quelle est la maturité de ce marché et les possibilités
G¶XWLOLVDWLRQSDUOHVHQWUHSULVHV" HEC Paris.
Bourguin, G. & Derycke, A., 2005. Systèmes Interactifs en Co-évolution Réflexions sur les
DSSRUWVGHOD7KpRULHGHO¶$FWLYLWpDXVXSSRUWGHV3UDtiques Collectives Distribuées. Revue
G¶,QWHUDFWLRQ+RPPH-Machine, 6(1), pp.1±31.
Brown, A., Conallen, J. & Tropeano, D., 2005. Introduction: Models, modeling, and model-driven
architecture (mda). In S. Beydeda, M. Book, & V. Gruhn, eds. Model-driven Software
Development. Springer, pp. 1±16.
Bézivin, J. & Kurtev, I., 2005. Model-based technology integration with the technical space
concept. In Metainformatics Symposium. Springer Verlag.
Calvary, G. et al., 2003. A unifying reference framework for multi-target user interfaces.
Interacting with Computers, 15(3), pp.289±308.
Cardoso, J. et al., 2004. Quality of service for workflows and web service processes. Web
Semantics: Science, Services and Agents on the World Wide Web, 1(3), pp.281±308.
Cesare, S. & Lycett, M., 2003. Business modelling with UML: distilling directions for future
research. In Enterprise information systems IV. Kluwer Academic Publishers, pp. 153±162.
Chang, Y., Lim, Y. & Stolterman, E., 2008. Personas: from theory to practices. In Proceedings of
WKHWK1RUGLFFRQIHUHQFH«. pp. 439±442.
Chen, G., 2009. Architectural Practice Simplified: A Survival Guide and Checklists for Building
Construction and Site Improvements as Well as Tips on Architecture, Building Design,
Construction and Project Management, Denver, Colorado: Outskirts Press.
Cherbakov, L. et al., 2005. Impact of service orientation at the business level. IBM Systems
Journal, 44(4), pp.653±668.
&ORW<'HO¶DQDO\VHGHVSUDWLTXHVDXGpYHORSSHPHQWGHVPpWLHUVÉducation et didactique,
1(1).
Cockburn, A., 2000. Writing Effective Use Cases, Addison-Wesley Professional..
Cockburn, A. & Jones, S., 1995. Four principles of groupware design. Interacting with
Computers, 7(2), pp.195±210.
Cohn, M., 2003. User stories applied: For agile software development,
| Bibliographie
259 Constantine, L, 2001. Structure and style in use cases for user interface design. In Object
Modeling and User Interface Design: Designing Interactive Systems. Addison-Wesley
Professional.
Constantine, L., 2002. Process Agility and Software Usability: Toward Lightweight UsageCentered Design. Development, 1(June 2001), pp.1±10.
Constantine, L., 2006. Users, Roles, and Personas. In The Persona Lifecycle. Morgan-Kaufmann.
Constantine, L. & Lockwood, L. a. D., 2003. Usage-centered software engineering: an agile
approach to integrating users, user interfaces, and usability into software engineering
practice. In Software Engineering. IEEE Computer Society, pp. 746±747.
Constantine, L. & Windl, H., 2003. Usage-Centered Design: Scalability and Integration with
Software Engineering. Human-Computer Interaction: theory and Practice.
Constantine, L, 2003. Canonical abstract prototypes for abstract visual and interaction design. In
J. Jorge, N. Jardim Nunes, & J. Falcão e Cunha, eds. Information Systems - Design,
Specification, and Verification. Springer-Verlag Berlin Heidelberg 2003, pp. 1±15.
Constantine, L, 1998. Rapid abstract prototyping. In Software Development. pp. 1±9.
Cooper, A., 1996. Goal-directed design.
Crawford, C., Bate, G. & Cherbakov, L., 2005. Toward an on demand service-oriented
architecture. IBM Systems, 44(1), pp.81±107.
Crnkovic, I., Larsson, S. & Chaudron, M., 2005. Component-based development process and
component lifecycle. Computing and Information Technology - CIT 13, 4, pp.321±327.
Curtis, B., 1992. Process modeling. Communications of the ACM, 35(9), pp.75±90.
David, B, 2001. IHM pour les collecticiels. Réseaux et systèmes répartis, Hermès, Paris, 13,
pp.169±206.
Davis, F., 1989. Perceived usefulness, perceived ease of use, and user acceptance of information
technology. MIS quarterly, 13(3), pp.319±340.
Davis, W., 1999. The requirements specification.
Delgado, A., 2010. Tool support for Service Oriented development from Business Processes. In
2nd International Workshop on Model-'ULYHQ6HUYLFH(QJLQHHULQJ026(¶.
Delotte, O., 2006. &R&6\VXQHDSSURFKHEDVpHVXUODFRQVWUXFWLRQG¶XQPRGqOHFRPSRUWHPHQWDO
pour la conception de systèmes collaboratifs mobiles. Ecole Centrale de Lyon.
Dewan, P., 2001. An integrated approach to designing and evaluating collaborative applications
and infrastructures. In Computer Supported Cooperative Work (CSCW). Kluwer Academic
Publishers, pp. 75±111.
Dey, A., 2001. Understanding and using context,
260 Bibliographie |
Dibbern, J. et al., 2009. Design, implementation, and evaluation of an ICT-supported
collaboration methodology for distributed requirements determination,
Dubois, E., Gray, P. & Nigay, L., 2002. ASUR ++: a Design Notation for Mobile Mixed Systems.
In Proceedings of the 4th International Symposium on Mobile Human-Computer
Interaction. Springer-Verlag London, UK, pp. 123±139.
Dupuy-Chessa, S, 2011. Modélisation en Interaction Homme-Machine et en Système
G¶,QIRUPDWLRQ$ODFURLVpHGHVFKHPLQV. /DERUDWRLUHG¶,QIRUPDWLTXHGH*UHQREOH
Dupuy-Chessa, S. et al., 2010. A software engineering method for the design of mixed reality
systems. In The Engineering Of Mixed Reality Systems. Springer London, pp. 313±334.
Eastman, C. & Sacks, R., 2010. Introducing a new methodology to develop the information
delivery manual for AEC projects. In CIB W78 2010. Cairo, Egypt, pp. 16±18.
Eastman, CM & Jeong, Y., 2010. Exchange model and exchange object concepts for
implementation of national BIM standards. Journal of Computing in Civil Engineering, 27,
pp.25±34.
Ellis, C. & Wainer, J., 1994. A conceptual model of groupware. Proceedings of the 1994 ACM
conference on Computer supported cooperative work - CSCW ¶, pp.79±88.
Eloranta, L. & Kallio, E., 2006. A Notation Evaluation of BPMN and UML Activity Diagrams,
Emig, C. & Weisser, J., 2006. Development of SOA-based software systems-an evolutionary
programming approach. In Advanced International Conference on Telecommunications and
International Conference on Internet and Web Applications and Services (AICT/ICIW
2006). IEEE Computer Society.
Endrei, M. et al., 2004. Patterns: Service-Oriented Architecture and Web Services, IBM Corp.,
International Technical Support Organization.
Engeström, Y., 1987. Learning by Expanding. An Activity-theoretical approach to developmental
research,
Favre, J.-M., 2004. Towards a Basic Theory to Model Model Driven Engineering. In Workshop
on Software Model Engineering, WISME 2004. Lisboa, Portugal.
Favre, L. & Pereira, C., 2007. Improving MDA-based Process Quality through Refactoring
Patterns. In Proc. of the 1st International Workshop on Software Patterns and Quality.
Citeseer.
Fernandez, A., 2010. Les nouveaux tableaux de bord des managers Eyrolles, ed.,
Fielding, R., 2000. Architectural styles and the design of network-based software architectures.
University of California, Irvine.
)UDQNHO'HWDO7KH=DFKPDQ)UDPHZRUNDQGWKH20*¶V0RGHO'ULYHQ$UFKLWHFWXUH
Business Process, pp.1±14.
| Bibliographie
261 Front, A., Rieu, D. & Giraudin, J.-P., 2009. Une vision sur les problématiques actuelles de la
recherche en Systèmes d ¶,QIRUPDWLRQsigma.imag.fr, p.27.
Gabay, J. & Gabay, D., 2008. UML 2 Analyse et conception - Mise en oeuvre guidée avec études
de cas, Paris: Dunod.
Gifford, B. & Enyedy, N., 1999. Activity centered design: Towards a theoretical framework for
CSCL. In Proceedings of the 1999 conference on Computer support for collaborative
learning.
Giraldo, W., Molina, A. & Collazos, C., 2008. A Model Based Approach for GUI development in
groupware systems. In R. . Briggs, ed. CRIWG. Springer-Verlag Berlin Heidelberg 2008, pp.
324±339.
Godart, C et al., 2001. Implicit or explicit coordination of virtual teams in building design. In
Computer-Aided Architectural Design Research In Asia-&$$'5,$¶.
Gordijn, J., Akkermans, H. & Van Vliet, H., 2000. Business modelling is not process modelling.
Conceptual Modeling for E-Business and the Web, pp.40±51.
Gottschalk, K., Graham, S. & Kreger, H., 2002. Introduction to web services architecture. IBM
systems, 41(2).
Greenberg, S., 1991. Personalizable groupware: Accommodating individual roles and group
differences. In Proceedings of the second conference on European Conference on
Computer-Supported Cooperative Work. Kluwer Academic Publishers, pp. 17±32.
Greenberg, S., 2006. Toolkits and interface creativity. Multimedia Tools and Applications, 32(2),
pp.139±159.
Greer, D. & Hamon, Y., 2011. Agile software development. In Software - Practice and
experience. pp. 943±944.
Gregor, S., 2009. Building theory in the sciences of the artificial. Proceedings of the 4th
International Conference on Design Science Research in Information Systems and
Technology - DESRIST ¶.
Grinter, R., Herbsleb, J. & Perry, D., 1999. The geography of coordination: dealing with distance
in R&D work. In Proceedings of the international ACM SIGGROUP conference on
Supporting group work.
Grudin, J., 1994. Computer-supported cooperative work: History and focus. Computer, 27(5),
pp.19±26.
Grudin, J., 1988. Why CSCW applications fail: problems in the design and evaluation of
organization of organizational interfaces. Proceedings of the 1988 ACM conference on
Computer-supported cooperative work - CSCW ¶, pp.85±93.
Guerriero, A., 2009. /DUHSUpVHQWDWLRQGHODFRQILDQFHGDQVO¶DFWLYLWpFROOHFWLYH- Application à la
coordination de l'activité de chantier de construction. Université Henri Poincaré - Nancy 2.
262 Bibliographie |
Guerriero, A., Zignale, D. & Halin, G, 2012. A Zoomable Location-Based Dashboard for
Construction Management. In CDVE2012. Osaka, Japan.
Guibert, O., 2007. &RXUVG¶$QDO\VHHW&RQFHSWLRQGHV6\VWqPHVG¶,QIRUPDWLRQG¶2XWLOVHW
Modèles pour le Génie Logiciel),
Göransson, B., Lif, M. & Gulliksen, J., 2003. Usability Design-Extending Rational Unified
Process with a New Discipline. In Interactive Systems: Design, Specification and
Verification, 10th International Work-shop, DSV-IS 2003. Madeira Island, Portugal:
Springer-Verlag Berlin Heidelberg 2003, pp. 316±330.
Hanrot, S., 2005. Une évaluation de la qualité architecturale relative aux points de vue des
acteurs. Cahiers RAMAU, 5, pp.pp. 111±126.
Hanser, D., 2003. 3URSRVLWLRQG¶XQPRGqOHG
DXWR-coordination en situation de conception,
application au domaine du bâtiment. Institut National Polytechnique de Lorraine
He, H., 2003. What is service-oriented architecture. Publicação eletrônica em, 30, pp.1±5.
Henri, F. & Lundgren-Cayrol, K., 2001. Apprentissage collaboratif à distance: pour comprendre
HWFRQFHYRLUOHVHQYLURQQHPHQWVG¶DSSUHQWLVVDJHYLUWXHOV,
Heuvel, W., 2009. Software service engineering: Tenets and challenges. In 3(626¶.
Vancouver, Canada: IEEE, pp. 26±33.
Hevner, A. et al., 2004. Design science in information systems research. MIS quarterly, 28(1),
pp.75±105.
Hietanen, J., 2006. IAI Official IFC Model View Definition Format,.
Hodgson, G., 2003. Capitalism, complexity, and inequality. Journal of Economic Issues, 37(2),
pp.471±478.
Huang, E. & Mynatt, E., 2006. Secrets to success and fatal flaws: The design of large-display
groupware. IEEE Computer Graphics and Applications, 26(1), pp.37±45.
Hussain, S. et al., 2010. Mapping of SOA and RUP: DOA as Case Study. Journal of computing,
2(1), pp.104±109.
Ibrahim, M. & Krawczyk, R., 2003. The level of knowledge of CAD objects within the building
information model. In Association for Computer-Aided Design in Architecture. pp. 172±177.
Idoughi, D. & Kolski, C., 2009. Vers un développement orienté services des applications
interactives dans le domaine de la logistique, étude de cas. In Workshop International IEEE
Logistique et Transport. Sousse, Tunisie.
Jackson, M. & Zave, P., 1995. Deriving specifications from requirements: an example. In
Proceedings of the 17th international conference on Software engineering. ACM, pp. 15±
24.
| Bibliographie
263 Kaindl, H. & Jezek, R., 2002. From usage scenarios to user interface elements in a few steps. In
C. Kolski & Jean Vanderdonckt, eds. Computer-Aided Design of User Interfaces III.
Valenciennes, France, pp. 91±102.
Kalnins, A. et al., 2010. From requirements to code in a model driven way. In D. Grundspenkis,
ed. Advances in Databases and Information Systems. Springer-Verlag Berlin Heidelberg
2010, pp. 161±168.
Kaner, C. & Falk, J., 1999. Testing Computer Software,
Katsumata, M., 2007. Personalized groupware service for collaborative communities. In IADIS
International Conference Applied Computing. pp. 510±514.
Kavakli, E., 2002. Goal-Oriented Requirements Engineering: A Unifying Framework.
Requirements Engineering, 6(4), pp.237±251.
Kohlborn, T. et al., 2009. Identification and Analysis of Business and Software Services²A
Consolidated Approach. IEEE Transactions on Services Computing, 2(1), pp.50±64.
Kohlmann, F. & Alt, R., 2007. Business-driven service modeling-a methodological approach
from the finance industry. In L. Maciaszek & W. Abramovic, eds. Business Process and
6HUYLFHV&RPSXWLQJ%36&¶7). Leipzig, Germany, pp. 180±193.
Kroll, P. & Kruchten, P, 2003. 7KHUDWLRQDOXQLILHGSURFHVVPDGHHDV\DSUDFWLWLRQHU¶VJXLGHWR
the RUP, Addison-Wesley Professional.
Kruchten, P., 2001. What Is the Rational Unified Process? , p.11.
Kubicki, S. et al., 2006. Assistance to building construction coordination ± towards a multi-view
cooperative platform. ITcon Vol. 11, 11(December 2005), pp.565±586.
Kubicki, S., 2006. $VVLVWHUODFRRUGLQDWLRQIOH[LEOHGHO¶DFWLYLWpGHFRQVWUXFWLRQGHEkWLPHQWV8QH
approche par les modèles pour la proposition d'outils de visualisation du contexte de
coopération. Université Henri Poincaré - Nancy 2.
Kubicki, S., Guerriero, A., Leclercq, P., et al., 2009. Cooperative design studios in education
Lessons learnt from two experiments. In 13th Congress of Iberoamerican Society of Digital
Graphics. From Modern to Digital: the Challenges of a Transition.
, Brazil.
Kubicki, S., Dubois, E., et al., 2009. Towards a Sustainable Services Innovation in the
Construction Sector. Advanced Information Systems Engineering, pp.319±333.
Kubicki, S., Guerriero, A. & Johannsen, L., 2009. A service-based innovation process for
improving cooperative practices in AEC. ITcon Electronic Journal of Information
Technology in Construction, XX(January), pp.1±21.
.XUWHY,%p]LYLQ-$NúLW07HFKQRORJLFDOVSDFHV$QLQLWLDODSSUDLVDOS
Kuutti, K., 1996. Activity theory as a potential framework for human-computer interaction
research. Context and consciousness: Activity theory and human-computer interaction,
pp.9±22.
264 Bibliographie |
Kvan, T., 2000. Collaborative design: what is it? Automation in Construction, 9(4), pp.409±415.
Laaroussi, A., 2007. Assister la conduite de la conception en architecture: vers un système
G¶LQIRUPDWLRQRULHQWpSLORWDJHGHVSURFHVVXV. Institut National Polytechnique de Lorraine.
Lamsweerde, A. Van, 2001. Goal-oriented requirements engineering: A guided tour.
Requirements Engineering, 2001.
Lamsweerde, A. Van, 2003. Goal-oriented requirements engineering: From system objectives to
UML models to precise software specifications. «&RQIHUHQFHRQ6RIWZDUH(QJLQHHULQJ,
(May), pp.1±81.
Lapouchnian, A., 2005. Goal-oriented requirements engineering: An overview of the current
research,
Laurillau, Y., 2002. Conception et réalisation logicielles pour les collecticiels centrées sur
O¶DFWLYLWpGHJURXSHOHPRGqOHHWODSODWH-forme Clover.
Laurillau, Y. & Nigay, L., 2002. Clover architecture for groupware. Proceedings of the 2002
ACM conference on Computer supported cooperative work - CSCW ¶, p.236.
Leontiev, A., 1978. Activity, consciousness, and personality, Prentice Hall.
List, B., 2006. An evaluation of conceptual business process modelling languages. In Proceedings
of the 2006 ACM symposium on Applied computing. Dijon, France: ACM.
Loniewski, G., Armesto, A. & Insfran, E., 2011. Incorporating Model-Driven Techniques into
Requirements Engineering for the Service-Oriented Development Process. In Engineering
Methods in the Service-Oriented Context. IFIP International Federation for Information
Processing, pp. 102±107.
Loucopoulos, P. & Karakostas, V., 1995. System Requirements Engineering, McGraw-Hill, Inc.
New York, NY, USA ©1995.
Lovelock, C. & Wirtz, J., 1981. Services marketing, Prentice-Hall, Englewood Cliffs, New Jersey.
Lu, S. & Paris, C., 1999. Towards the automatic generation of task models. Engineering for
Human-Computer Interaction.
Lucquiaud, V.3URSRVLWLRQG¶XQQR\DXHWG
XQHVWUXFWXUHSRXUOHVPRGqOHVGHWkFKHV
orientés utilisateurs. Proceedings of the 17th conference on 17ème Conférence Francophone
VXUO¶,QWHUDFWLRQ+RPPH-Machine - IHM 2005, pp.83±90.
Lê, L.S., Ghose, A. & Morrison, E., 2010. Definition of a description language for business
service decomposition. In Proceedings of First International Conference on Exploring
Services Sciences (IESS 1.0), Geneva, Switzerland. Springer, pp. 96±110.
MacKenzie, C.M. et al., 2006. Reference Model for Service Oriented Architecture 1.0.
Architecture, 2006(October), pp.1±31.
Maglio, P.P. & Spohrer, J., 2007. Fundamentals of service science. Journal of the Academy of
Marketing Science, 36(1), pp.18±20.
| Bibliographie
265 Malone, T.W. & Crowston, K., 1994. The interdisciplinary study of coordination. ACM
Computing Surveys, 26(1), pp.87±119.
March, S., 1995. Design and natural science research on information technology. Decision
support systems.
Marjanovic, O. et al., 2007. Collaborative practice-oriented business processes Creating a new
case for business process management and CSCW synergy. 2007 International Conference
on Collaborative Computing: Networking, Applications and Worksharing (CollaborateCom
2007), pp.448±455.
Martin, R.C., 2003. Agile Software Development: Principles, Patterns, and Practices, Prentice
Hall PTR.
Masserey, G. & Samaan, K., 2006. Implémentation du modèle AMF. In ,+0³06 Proceedings of
WKHWK,QWHUQDWLRQDO&RQIHUHQFHRIWKH$VVRFLDWLRQ)UDQFRSKRQHG´,QWHUDFWLRQ+RPPHMachine.
Mintzberg, H., 1989. Le management: voyage au centre des organisations, Paris: Lavoisier.
Misra, S. & Kumar, V., 2005. Goal-oriented or scenario-based requirements engineering
technique - what should a practitioner select? Canadian Conference on Electrical and
Computer Engineering, 2005., (May), pp.2288±2292.
Mori, G., Paterno, F. & Santoro, C., 2002. CTTE: support for developing and analyzing task
models for interactive system design. IEEE Transactions on Software Engineering, 28(8),
pp.797±813.
Nitithamyong, P. & Skibniewski, M.-J., 2007. Key success/failure factors and their impacts on
system performance of web-based project management systems in construction. ITcon,
pp.39±59.
Noran, O., 2000. Business modelling: UML vs. IDEF. School of CIT, Griffith University.
Available at:
http://scholar.google.com/scholar?hl=en&btnG=Search&q=intitle:Business+Modelling+:+U
ML+vs.+IDEF#0 [Accessed June 20, 2012].
Norman, D., 1986. User-centred System Design: New Directions in Human-Computer Interaction.
Nuseibeh, B. & Easterbrook, S., 2000. Requirements engineering: a roadmap. In Proceedings of
the Conference on the Future of Software Engineering. ACM, pp. 35±46.
Oaks, P., Ter Hofstede, A.H.M. & Edmond, D., 2003. Capabilities: Describing what services can
do. In Service-Oriented Computing-ICSOC 2003. Springer.
Olsen, G., 2004. Personas creation and usage toolkit.
Olson, J., 1996. Groupware in the wild: lessons learned from a year of virtual collocation. In
Proceedings of the 1996 ACM conference on. pp. 419±427.
Osterwalder, A., 2004. The business model ontology: A proposition in a design science approach.
(FROHGHV+(&GHO¶8QLYHUVLWpGH/DXVDQQH
266 Bibliographie |
2¶)DUUHOl, P., 1991. An interaction model of business service production and consumption. British
Journal of Management.
2¶5HJDQ*&RPSXWHU3URJUDPPLQJ/DQJXDJHV,QA Brief History of Computing.
2¶6XOOLYDQ--Towards a precise understanding of service properties. Queensland
University of Technology.
Paetsch, F., Eberlein, a. & Maurer, F., 2003. Requirements engineering and agile software
development. WET ICE 2003. Proceedings. Twelfth IEEE International Workshops on
Enabling Technologies: Infrastructure for Collaborative Enterprises, 2003., pp.308±313.
Papazoglou, M.P. & Georgakopoulos, D., 2003. Service-oriented computing. Communications of
the ACM, 46(10), pp.25±28.
Papazoglou, Michael P. & Heuvel, W.-J. Van Den, 2006. Service-oriented design and
development methodology. International Journal of Web Engineering and Technology, 2(4),
p.412.
Paterno, F., 2001. Towards a UML for interactive systems. In M. Reed Little & L Nigay, eds.
Engineering for human-computer interaction. Springer-Verlag Berlin Heidelberg 2001, pp.
7±18.
Paternò, F., Mancini, C. & Meniconi, S., 1997. ConcurTaskTrees: A diagrammatic notation for
specifying task models. In Proceedings of the IFIP TC13 Interantional Conference on
Human-Computer Interaction. Citeseer, pp. 362±369.
Peffers, K. et al., 2007. A Design Science Research Methodology for Information Systems
Research. Journal of Management Information Systems, 24(3), pp.45±77.
Peixoto, D., Batista, V. & Atayde, A., 2008. A comparison of bpmn and uml 2.0 activity
diagrams. In VII Simposio Brasileiro de Qualidade de Software.
Pereira, CM, 2004. A method to define an Enterprise Architecture using the Zachman Framework.
In Proceedings of the 2004 ACM symposium on Applied computing. ACM.
Pinelle, D. & Gutwin, C., 2005. A groupware design framework for loosely coupled workgroups.
In ECSCW 2005. pp. 65±82.
Piquet, A., 2009. Guide pratique du travail collaboratif: Théories , méthodes et outils au service
de la collaboration,
Pribeanu, C., 2005. An Approach to Task Modeling for User Interface Design. World Academy of
Science, Engineering and Technology, 5, pp.5±8.
Pruitt, J. & Grudin, J, 2003. Personas: practice and theory. In Proceedings of the 2003 conference
on Designing for user experiences. ACM.
Pérochon, L., 2008. Ingénierie dirigée par les modèles Model Driven Architecture,
| Bibliographie
267 Quartel, D., Dijkman, R. & Van Sinderen, M., 2004. Methodological support for service-oriented
design with ISDL. Proceedings of the 2nd international conference on Service oriented
computing - ICSOC ¶
Rameau, G. & Samyn, E., 2006. LE TRAVAIL COLLABORATIF ASSISTE PAR
25',1$7(857&$2([HPSOHG¶XQHVROXWLRQWHFKQRORJLTXHDYHF;-TEK. In 23 ème
FRQJUpVGHO¶$,38. Monastir, pp. 1±22.
Ramollari, E. & Dranidis, D., 2007. A survey of service oriented development methodologies. In
Workshop on Service Oriented. pp. 75±80.
Rosemann, M. et al., 2009. Business Service Management. Service Management, p.16.
Saffin, S. & Leclercq, P., 2010. Studio digital collaboratif, un environnement multimodal de
conception collaborative a distance: application et perspectives. In ,+0¶- Atelier
Collecticiels. pp. 16±18.
Safin, S., Kubicki, S. & Hanser, D., 2012. Enseigner la co-conception à distance: Retour sur cinq
DQQpHVG¶H[SpULHQFH,QSCAN12 - Complexité (s) des mRGqOHVGHO¶DUFKLWHFWXUHQXPpULTXH.
Presses Universitaires de Nancy.
6DOEHU'HWDO'HO¶REVHUYDELOLWpHWGHO
KRQQqWHWpOHFDVGXFRQWUROHG
DFFqVGDQVOD
Communication Homme-Homme Médiatisée. In ,+0¶.
Salinesi, C., 2004. Authoring Use Cases. Scenarios and Use Cases, Stories through the System
Life-Cycle.
Salvador, T., Scholtz, J. & Larson, J., 1996. The Denver model for groupware design. ACM
SIGCHI Bulletin, 28(1), pp.52±58.
Samaan, K., 2006. 3ULVHHQ&RPSWHGX0RGqOHG¶,QWHUDFWLRQGDQVOe Processus de Construction et
d'Adaptation d'Applications Interactives. Ecole dentrale de Lyon.
Sandkuhl, K., 2010. Supporting Collaborative Engineering with Information Supply Patterns. In
18th Euromicro Conference on Parallel, Distributed and Network-based Processing. Ieee,
pp. 375±384.
Santos, L., Lopes, J. & Leitao, A., 2012. Collaborative Digital Design - When the architect meets
the software engineer. In H. Achten et al., eds. 30th eCAADe conference vol.2 physical
digitality. Prague, pp. 87±97.
Satyanarayanan, M., 1996. Fundamental challenges in mobile computing. In Proceedings of the
fifteenth annual ACM symposium on Principles of distributed computing - PODC ¶. New
York, New York, USA: ACM Press.
Saïkali, K., 2001. Flexibilité des Workflows paUO¶DSSURFKHREMHW)/2:XQIUDPHZRUNSRXU
Workflows flexibles. Ecole centrale de Lyon.
Schmidt, K. & Simone, C., 1996. Coordination mechanisms: Towards a conceptual foundation of
CSCW systems design. Computer Supported Cooperative Work (CSCW), 5(2-3), pp.155±
200.
268 Bibliographie |
Schmidt, K. & Wagner, I., 2004. Ordering Systems: Coordinative Practices and Artifacts in
Architectural Design and Planning. Computer Supported Cooperative Work (CSCW), 13(56), pp.349±408.
Schwaber, K & Sutherland, J., 2011. The scrum guide
Schwaber, Ken & Beedle, M., 2001. Agile Software Development with Scrum, Prentice Hall.
Seffah, A., Kolski, C. & Idoughi, D., 2009. Persona comme outil de design de services interactifs:
principes et exemple en e-maintenance. In ,+0¶. Grenoble, France: ACM, pp. 13±16.
Sierhuis, M. & J.Clancey, W., 2002. Modeling and Simulating Work Practice: A Method for
Work Systems Design. IEEE Intelligent Systems, 17(05), pp.32±41.
Simon, H.A., 2004. The sciences of artificial, MIT Press.
Sohlenkamp, M., Prinz, W. & Fuchs, L., 2000. POLIAwaC: Design and evaluation of an
awareness-enhanced groupware client. AI & SOCIETY, 14, pp.31±47.
Sommerville, I., 2005. Integrated requirements engineering: A tutorial. Software, IEEE, 22(1),
pp.16±23.
Sommerville, I., 1996. Introduction to Software Engineering
Sottet, J.-S., Calvary, G. & Favre, J.-M., 2005. ,QJpQLHULHGHO¶,QWHUDFWLRQ+RPPH-Machine
Dirigée par les Modèles. ,'03UHPLqUHV-RXUQpHVVXUO¶,QJpQLHULH'LULJpHSDUOHV0RGqOHV.
Soulier, E. & Lewkowicz, M., 2006. Simulation des pratiques collaboratives pour la conception
des SI basés sur les processus métier. 5HYXHGHV6FLHQFHVHW7HFKQRORJLHVGHOO¶,QIRUPDWLRQ,
11(3), pp.73±94.
Soulier, E., Lewkowicz, M. & Corouge, N., 2007. Gestion des processus métier et travail
collaboratif. myriam.lewkowicz.free.fr, p.25.
Suchman, L., 1987. Plans and Situated Actions: The Problem of Human-Machine Communication
(Learning in Doing: Social, Cognitive and Computational Perspectives), Cambridge
University Press.
Sutcliffe, A., 2005. Applying small group theory to analysis and design of CSCW systems. ACM
SIGSOFT Software Engineering Notes, pp.1±6.
Sutcliffe, A., 2007. Requirements Engineering from an HCI Perspective. In Requirements
Engineering Activities and Processes. pp. 1±39.
Sutcliffe, A., 2003. Scenario-based requirements engineering. Journal of Lightwave Technology,
pp.320±329.
Tarpin Bernard, F., 1997. Travail coopératif synchrone assisté par ordinateur : Approche AMFC. Ecole centrale de Lyon.
Tazari, M., Grimm, M. & Finke, M., 2003. Modelling user context. Proceedings of 10th
International Conference on Human-Computer Interaction.
| Bibliographie
269 Tellioglu, H., 2006. Coordination Design. In Proceedings of the 20th International Conference on
Advanced Information Networking and Applications. 1: IEEE Computer Society, pp. 425±
432.
Thevenin, D, 2001. Adaptation en Interaction Homme-Machine : le cas de la Plasticité.
Touzi, J. et al., 2009. A model-driven approach for collaborative service-oriented architecture
design. International Journal of Production Economics, 121(1), pp.5±20.
Vaishnavi, V. & Kuechler, W., 2007. Design science research methods and patterns: innovating
information and communication technology, Auerbach Publications.
Vanderdonckt, JM & Bodart, F, 1993. Encapsulating knowledge for intelligent automatic
interaction objects selection. 3URFHHGLQJVRI,17(5$&7¶
Veer, G. Van Der et al., 2000. Task based groupware design: putting theory into practice. In
Proceedings of the 3rd conference on Designing interactive systems: processes, practices,
methods, and techniques. New York, NY, USA: ACM, pp. 326±337.
Veer, G. van der, 1996. The Design of Computer Supported Cooperative Work and Groupware
Systems, North Holland Elsevier Science.
Vissers, C., Lankhorst, M. & Slagter, R., 2004. Reference models for advanced e-services. In
Digital Communities in A Networked Society. Springer, pp. 369±393.
White, S., 2004. Introduction to BPMN,
Wieringa, R., 1998. A survey of structured and object-oriented software specification methods
and techniques. ACM Computing Surveys (CSUR), 30(4), p.69.
Williams, A., 2009. User-centered design, activity-centered design, and goal-directed design: a
review of three methods for designing web applications. In SIGD2&¶. Bloomington,
Indiana: ACM, pp. 1±8.
Winckler, M., Palanque, P. & CMDS, 2004. Tasks and scenario-based evaluation of information
visualization techniques. Proceedings of the 3rd conference on Task models and diagrams
pp. 165-172.
Yamin, R. & Harmelink, D., 2001. Comparison of linear scheduling model (LSM) and critical
path method (CPM). Journal of Construction Engineering And Management, 127(5),
pp.374±381.
Yeh, R.T. & Zave, P., 1980. Specifying software requirements. Proceedings of the IEEE, 68(9),
pp.1077±1085.
Yin, C., 2010. 6DPFFRXQ6\VWqPHG¶$SSUHQWLVVDJH0RELOH&RQWH[WXHOHW&ROODERUDWLIGDQVGHV
Situations Professionnelles. Ecole Centrale de Lyon.
Zachman, J. a., 1987. A framework for information systems architecture. IBM Systems Journal,
26(3), pp.276±292.
270 Bibliographie |
Zhang, J. et al., 2012. Development and Implementation of an Industry Foundation Classes-Based
Graphic Information Model for Virtual Construction. Computer-Aided Civil and
Infrastructure Engineering.
Zhang, Z., Liu, R. & Yang, H., 2005. Service identification and packaging in service oriented
reengineering. In Proceedings of the 17th International Conference on Software
Engineering and Knowledge Management. pp. 219±226.
Zignale, D., Kubicki, S., Ramel, S., et al., 2011. A model-based method for the design of services
in collaborative business environments. In Proceedings of IESS 1.1: Second International
Conference on Exploring Services Sciences. Geneva, Switzerland, p. 15.
Zignale, D., Kubicki, S. & Halin, G., 2011. Business practices analysis for the adaptation of IT
services to AEC projects. Case study of design assessment related practices. In CIB w078w102 2011. Sophia-Antipolis, France.
Zimmermann, O., 2004. Elements of service-oriented analysis and design. IBM developerworks.
| Bibliographie
271 Glossaire
Activité :
/¶DFWLYLWp(humaine) est un ensemble de tâches dirigées vers une finalité et organisées au sein
d'un processus, notamment dans le cadre de O¶H[HUFLFHG¶XQHIRQFWLRQG¶XQPpWLHU La théorie de
O¶DFWLYLWp la décompose en trois sous-ensembles O¶DFWLYLWpO¶DFWLRQHWO¶RSpUDWLRQ Le projet AIC
est une activité F¶HVW XQ GRXEOH SURFHVVXV FRPSRVp G¶XQH pWDSH SUpSDUDWRLUH OLpH j OD
FRQFHSWLRQHWG¶XQHpWDSHRSpUDWRLUHOLpHjODFRQVWUXFWLRQ.
Artefact :
/¶DUWHIDFW HVW XQ SURGXLW DUWLILFLHO UpDOLVp SDU O¶KRPPH 'DQV FHWWH pWXGH LO UHJURXSH OHV
GRFXPHQWV UHODWLIV DX GRPDLQH $,& OHV SODQV OHV GHVFULSWLIV WH[WHV OHV SKRWRV« DLQVL TXH OHV
objets (c.à.d. OHVRXYUDJHVRXpOpPHQWVG¶RXYUDJHVDUFKLWHFWXUDX[
Collecticiel :
Le collecticiel HVW XQ ORJLFLHO GpGLp DX VXSSRUW GH O¶DFWLYLWp FROOHFWLYH TXH FH VRLW SDU
O¶DVVLVWDQFH j OD FRPPXQLFDWLRQ OD FRRUGLQDWLRQ RX OD FR-production, de manière synchrone ou
asynchrone, co-localisée ou à distance.
Contexte :
Le contexte est un ensemble de circonstances déterminées par un environnement ou une
situation, et GpWHUPLQDQWHVGDQVOHFRPSRUWHPHQWGHTXHOTXHFKRVHRXTXHOTX¶XQ
M éthode de conception :
Une méthode de conception est un processus créatif itératif composé de plusieurs étapes : la
connaissance du besoin, la suggestion, la proposition, la validation et la conclusion. Elle est
supportée par modèles et des outils et associe plusieurs points de vue.
| Glossaire
273 M odèle :
Un modèle est la représentation de quelque chose à traversVRXVIRUPHG¶REMHWSK\VLTXHH[
XQHPDTXHWWH RXGH GHVFULSWLRQXQWH[WH XQGHVVLQ« 8QPRGqOHSHXWVHUYLU jODGHVFULSWLRQ
H[ OH SODQ G¶XQH YLOOH FRPPH j OD FRQFHSWLRQ H[ OH SODQ G¶XQH PDLVRQ j FRQVWUXLUH Un
modèle abstrait FHTX¶LOUHSUpVHQWHjWUDYHUVGHVFRQFHSWV
Outil :
3K\VLTXHRXQXPpULTXHO¶RXWLODVVLVWHVRQXVDJHUGDQVO¶H[pFXWLRQG¶XQHRXSOXVLHXUVWkFKHV
/¶DGDSWDWLRQG¶XQRXWLOVHPHVXUHSDUVRQXWLOLWpVDFDSDFLWpjUpSRQGUHDXEHVRLQGHO¶XVDJHUHW
son utilisabilité (UHODWLYHjODIDFLOLWpODUDSLGLWpG¶XWLOLVDWLRQRXHQFRUHOHEHVRLQG¶DSSUHQWLVVDJH
réduit).
Paradigme / Point de vue :
Le paradigme ou point de vue est la manière de voir ou de considérer quelque chose. Il est
UHODWLIjO¶LQWHUSUpWDWLRQ G¶XQ contenu et au rapport HQWUHO¶DFWHXUTXLDFHSRLQWGHYXHHWO¶REMHW
de son étude.
Pratique (collective et individuelle) :
La pratique est O¶H[HUFLFH G¶XQ PpWLHU XQH PDQLqUH GH WUDYDLOOHU XQ FRPSRUWHPHQW KDELWXHO
avec une finalité. Les pratiques dites collectives (PC), à savoir relatives à un objectif commun à
plusieurs personnes, sont décomposées en pratiques individuelles (PI) exécutées par chacune de
FHV SHUVRQQHV /¶H[pFXWLRQ GH WRXWHV OHV 3, TXL FRPSRVHQW XQH 3& GRLW SHUPHWWUH G¶DWWHLQGUH
O¶REMHFWif de cette dernière.
Service (et service informatique) :
Un service HVW XQH SUHVWDWLRQ TXL PHW j GLVSRVLWLRQ G¶XQ FOLHQW une capacité technique ou
intellectuelle pour supporter un besoin. En informatique, un service est une fonctionnalité ou
partie de fonctionnalité mise à disposition par un composant logiciel pour assurer une tâche
particulière.
Usage :
/H WHUPH XVDJH GpILQLW XQH XWLOLVDWLRQ FRPPXQH QRUPDOH SUpYXH DORUV TXH O¶XWLOLVDWLRQ VH
rapporte plutôt à un point particulier, une situation donnée. 3DU H[WHQVLRQ O¶XVDJH VH UpIqUH j
O¶DSSURSULDWLRQ3RXUFDUDFWpULVHU OD PpGLDWLVDWLRQ G¶XQH SUDWLTXH PpWLHUSDU O¶HPSORLG¶XQ RXWLO
QRXV XWLOLVRQV OH WHUPH G¶XVDJH SOXW{W TX¶XWLOLVDWLRQ FDU LO FRXYUH XQH GpILQLWLRQ SOXV ODUJH TXH
celle du simple emploi. 2Q FKHUFKH j UHWURXYHU HQ SOXV GH OD QRWLRQ G¶HPSORL OHV
notions G¶KDELWXGHG¶REMHFWLIHWG¶DSSURSULDWLRQSDUOHVDFWHXUV
.
274 Glossaire |
I ndex
A architecture dirigée par les modèles, 88, 89 C ĐĂŚŝĞƌĚ͛ĞdžŝŐĞŶĐĞƐ͕ϭϱϰ͕ϭϱϱ͕ϭϱϲ͕ϭ59, 180, 196, 199, 200, 214, 215, 224, 231, 235, 243, 244, 251, 300 CoCSys, 121, 122, 127 collecticiel, 112, 114, 115, 116, 117, 118, 139, 154, 191, 285 conception centrée usage, 75, 76, 79, 80 contexte acteur, 41, 42, 53 contexte coopératif, 33, 34, 114, 115, 171, 174, 179, 181, 187, 188, 206, 253, 304 ĐŽŶƚĞdžƚĞĚĞů͛ĂĐƚŝǀŝƚĠ collective, 54 contexte tri-­‐facettes, 42, 53, 56 contexte utilisateur, 41, 42, 49, 54, 127, 130, 146, 189 M maquettage, 38, 86, 198, 244, 248, 249 modèle de pratiques, 176, 177, 179, 192, 251 modèle de tâches, 81 MVC, 70, 71, 118, 119, 120, 132, 208 P pratiques métiers, 1, 25, 149, 153, 159, 183, 184, 186, 198, 199, 205, 219, 222, 248, 249, 250, 253, 300, 301 Processus métier, 102 push PUSH, 154, 184, 252 R RUP, 63, 84, 103, 104, 107, 117, 118, 154, 203 D diagramme de séquences, 83, 220, 305 E entreprise orientée service, 95 G GMF, 21, 151, 152, 176, 177, 178, 179, 197 S scenario, 66, 82, 83 service ICT, 98, 206, 207, 208, 213, 214, 292, 305 service métier, 46, 97, 98, 99, 107, 206, 207, 213, 214, 222, 248, 292 Symphony, 128, 129, 130, 132, 187 T ƚŚĠŽƌŝĞĚĞů͛ĂĐƚŝǀŝƚĠ͕ϯϮ͕ϭϰϴ͕ϭϳϯ͕ϭϴϭ͕Ϯϴϱ I Information Delivery Manual, 134, 135 U use case, 68, 73, 82, 83, 118, 186, 193, 194, 197, 220, 231, 232, 235, 238, 239, 243, 247, 250, 303, 304 | Index
275 276 | Table des illustrations
Liste des figures
FIGURE 1.
CONCEPTUALISATION D¶UN PROJET DE CONCEPTION ARCHITECTURALE POUR LA SPECIFICATION
D¶UN PROJET DE CONCEPTION LOGICIELLE ............................................................................................. 19
FIGURE 2.
EVOLUTION DES CONCEPTS DU CONTEXTE DE L¶ACTIVITE COLLECTIVE DE 2003 A 2006 (ISSU DE
(GUERRIERO 2009)) ............................................................................................................................... 28
FIGURE 3.
EXTRAIT DU META-MODELE DU CONTEXTE DE L¶ACTIVITE COLLECTIVE (ISSU DE (GUERRIERO
2009) 28
FIGURE 4.
DISTINCTION ENTRE COORDINATION HIERARCHIQUE, ADHOCRATIQUE ET TRANSVERSALE (TIRE
DE (KUBICKI 2006))............................................................................................................................... 30
FIGURE 5.
CARACTERISATION DES ACTIVITES DE COORDINATION DANS UN PROJET AIC (ADAPTE DE
(KUBICKI 2006)).................................................................................................................................... 31
FIGURE 6.
EXEMPLE DE DIAGRAMME DE GANTT .................................................................................... 32
FIGURE 7.
PROCESSUS DE CONCEPTION ALTERNANT CONCEPTION DISTRIBUEE ET POINTS DE SYNTHESE
(TIRE DE (HANSER 2003)) ...................................................................................................................... 33
FIGURE 8.
FONCTIONNALITES COLLABORATIVES DANS L¶OUTIL DE CAO AUTOCAD ................................ 34
FIGURE 9.
UTILISATION DU DISPOSITIF « BUREAU VIRTUEL + SKETSHA » AU COURS DU PROJET SDC
(PHOTOS TIREES DE (SAFFIN & LECLERCQ 2010)) ................................................................................. 34
FIGURE 10. LE CONTEXTE « TRI-FACETTES » SELON (KUBICKI 2006) ......................................................... 35
FIGURE 11. INTERFACE DE CRTI-WEB SERVICE « DOCUMENTS » .............................................................. 41
FIGURE 12. INTERFACE DE CRT-WEB SERVICE « COMPTES-RENDUS » ...................................................... 41
FIGURE 13. VERS DES OUTILS DE TCAO ADAPTES AU CONTEXTE « TRI-FACETTES » .................................. 44
FIGURE 14. SCHEMA DU PROCESSUS DE CONCEPTION DEVELOPPEMENT ET TRANSFERT DES SERVICES DE
CRTI-WEB ............................................................................................................................................ 45
FIGURE 15. PROCESSUS DE CONCEPTION, FLUX DE CONNAISSANCE ET RESULTATS (TIRE DE (VAISHNAVI &
KUECHLER 2007)) ................................................................................................................................. 51
FIGURE 16. STRUCTURE DE NOTRE RECHERCHE BASEE SUR LA CONCEPTION .............................................. 52
FIGURE 17. STRUCTURE DES METHODES TRADITIONNELLES DE CONCEPTION LOGICIELLE .......................... 56
FIGURE 18. SCHEMA DE LA METHODE EN SPIRALE ...................................................................................... 57
FIGURE 19. PROCESSUS, CYCLES, PHASES ET ACTIVITES D¶UN PROJET DE DEVELOPPEMENT LOGICIEL ........ 58
| Table des illustrations
277 FIGURE 20.
FIGURE 21.
FIGURE 22.
FIGURE 23.
FIGURE 24.
EXEMPLE DE MODELE METIER SOUS FORME DE DIAGRAMME E-R ............................................. 59
EXEMPLE DE DIAGRAMME DE BUTS .......................................................................................... 61
EXEMPLE DE DIAGRAMME UML DE CAS D¶UTILISATION .......................................................... 62
EXEMPLE DE DIAGRAMME DE SEQUENCE SYSTEME ................................................................... 63
REPRESENTATION DES EVENEMENTS INTERNES AU SYSTEME PAR UN DIAGRAMME DE SEQUENCE
TECHNIQUE ............................................................................................................................................ 63
FIGURE 25. EXEMPLE DE REPRESENTATION D¶UN CONCEPT METIER EN ELEMENT DE MODELE STRUCTUREL
64
FIGURE 26. SCHEMA D¶UNE ARCHITECTURE LOGICIELLE REPRESENTEE PAR LE MODELE MVC .................. 65
FIGURE 27. VALEURS DES METHODES AGILES FACE AUX CONCEPTS DES METHODES CLASSIQUES .............. 66
FIGURE 28. CYCLE DE DEVELOPPEMENT DANS LA METHODE XP................................................................. 67
FIGURE 29. PROCESSUS DE LA METHODE SCRUM ...................................................................................... 68
FIGURE 30. LE PROCESSUS DE CONCEPTION « EN V », REPRIS PAR (LAURILLAU 2002) ............................... 70
FIGURE 31. MODELISATION D¶UN ROLE UTILISATEUR DANS LA CONCEPTION CENTREE USAGE (TIRE DE (L. L.
CONSTANTINE 2006)) ............................................................................................................................ 74
FIGURE 32. CIO SIMILAIRES DANS DIFFERENTS ENVIRONNEMENTS ............................................................ 75
FIGURE 33. DIFFERENTES REPRESENTATIONS GRAPHIQUES POUR LA DECOMPOSITION D¶UN USE CASE ....... 77
FIGURE 34. EXEMPLE D¶ARBRE DE TACHES CTTE DANS [PRIBEANU, 2005] ............................................... 79
FIGURE 35. LES CINQ TYPES DE TACHES QUI COMPOSENT UN ARBRE K-MAD ............................................ 79
FIGURE 36. EXEMPLE DE MAQUETTAGE (OUTIL « BALSAMIQ MOCKUP ») .................................................. 80
FIGURE 37. TACHES ET ELEMENTS D¶INTERACTION ABSTRAITS .................................................................. 81
FIGURE 38. EXEMPLE DE PROTOTYPE ABSTRAIT.......................................................................................... 81
FIGURE 39. ESPACES TECHNIQUES DE L¶,'0 ET NIVEAUX DE MODELISATION ............................................ 83
FIGURE 40. ILLUSTRATION DES TRANSFORMATIONS ENTRE MODELES DANS LE CAS D¶ETUDE DE (SOTTET ET
AL. 2005) ............................................................................................................................................... 84
FIGURE 41. LES MODELES ET LEUR TRANSFORMATION DANS L¶APPROCHE MDA DE (KALNINS ET AL. 2010)
86
FIGURE 42. POINTS D¶ENTREE DE LA CONCEPTION LOGICIELLE AU COURS DE L¶EVOLUTION DES METHODES
87
FIGURE 43. LE CYCLE DE VIE DE DEVELOPPEMENT D¶UN SERVICE (TIRE DE [BIRNBAUM, 2004]) ................ 90
FIGURE 44. SERVICES METIER ET ICT DANS LA SOA ................................................................................. 91
FIGURE 45. META-MODELE DU BSDL [LE, 2010] ....................................................................................... 92
FIGURE 46. ROLES ET INTERACTIONS DANS UNE SOA (TIRE DE (ENDREI2004)) ......................................... 93
FIGURE 47. ROLES ET INTERACTIONS DANS UNE ARCHITECTURE DE SERVICES WEB11 ................................. 94
FIGURE 48. CORRELATION ENTRE BUSINESS MODEL, ENVIRONNEMENT, STRATEGIE, PROCESSUS ET
SYSTEMES D¶,NFORMATION [OSTWALDER, 2004 - P.16] ........................................................................ 96
FIGURE 49. LE FRAMEWORK ZACHMAN ET LES MODELES DE LA MDA [FRANKEL, 2003] .......................... 97
FIGURE 50. REPRESENTATIONS D¶UN MEME PROCESSUS AVEC BPMN (EN HAUT) ET AD UML (EN BAS) ... 99
FIGURE 51. UN EXEMPLE DE DIAGRAMME IDEF3 POUR LA DESCRIPTION DES PROCESSUS ........................ 100
FIGURE 52. REPRESENTATION DES APPROCHES DE CONCEPTION DE SERVICES ICT DANS L¶ARCHITECTURE
DE L¶ENTREPRISE ................................................................................................................................. 103
FIGURE 53. LE MODELE EVOLUE DU « TREFLE FONCTIONNEL » ................................................................ 106
FIGURE 54. REPARTITION DES TYPES D¶USAGES DANS LE MODELE SPATIO-TEMPOREL.............................. 106
FIGURE 55. POSITIONNEMENT DES SERVICES PAR RAPPORT AUX CARACTERISTIQUES D¶UNE ACTIVITE
COLLECTIVE ......................................................................................................................................... 107
FIGURE 56. LE MODELE D¶ARCHITECTURE CO-MVC POUR DECRIRE UN SERVICE COLLABORATIF ............ 108
FIGURE 57. VERS UN NOUVEAU CHANGEMENT DE PARADIGME DANS LA CONCEPTION LOGICIELLE .......... 112
FIGURE 58. SCHEMA DU PROCESSUS COCSYS (TIRE DE [DELOTTE2006]) ................................................. 116
FIGURE 59. UN EXEMPLE DE SCENARIO CONTEXTUALISE DANS SON EDITEUR ........................................... 116
FIGURE 60. REPRESENTATION D¶UN ACTEUR ET D¶UNE LIMITE ENTRE DEUX « ESPACES DE VIE » DANS
CBME 117
278 Table des illustrations |
FIGURE 61. REPRESENTATION DES CONTEXTES GEOGRAPHIQUE ET TEMPOREL DANS CBME ................... 117
FIGURE 62. REPRESENTATION DE L¶ARTEFACT, DU DISPOSITIF ET DU SYSTEME DANS CBME................... 117
FIGURE 63. REPRESENTATIONS DES RELATIONS DU SCENARIO CONTEXTUALISE DANS CBME ................. 117
FIGURE 64. REPRESENTATION DES DEUX TYPES DE PRE-CONDITION DU SCENARIO CONTEXTUALISE DANS
CBME 118
FIGURE 65. UTILISATION DE CBME POUR ECRIRE LES SCENARIOS CONTEXTUALISES (TIRE DE
[DELOTTE2006]) ................................................................................................................................. 118
FIGURE 66. EXEMPLE DE REPRESENTATION DE TROIS PROCESSUS ALTERNATIFS (ENCADRES COLORES) AVEC
LE FORMALISME « 2FLOW » ................................................................................................................. 119
FIGURE 67. MIGRATION DES SERVICES VERS LE DISPOSITIF ...................................................................... 121
FIGURE 68. CYCLE DE SYMPHONY ETENDUE............................................................................................. 124
FIGURE 69. PROTOTYPAGE DE L¶IDENTIFICATION D¶UN DEGAT A TRAVERS UN SYSTEME DE REALITE MIXTE
125
FIGURE 70. DESCRIPTION GENERALE DU CONTEXTE MATERIEL ET DES DONNEES A TRAITER AVEC LE
FORMALISME ASUR ............................................................................................................................ 126
FIGURE 71. /¶ARCHITECTURE SYMPHONY (TIRE DE (S DUPUY-CHESSA 2011)) ........................................ 127
FIGURE 72. INTERVENTION DES DIFFERENTS ACTEURS DE LA METHODE SYMPHONY AU COURS DE LA
SPECIFICATION DES BESOINS (ISSU DE (S DUPUY-CHESSA 2011)) ........................................................ 129
FIGURE 73. VUE D¶ENSEMBLE D¶UN PROCESSUS (BERARD & KARLSHOEJ 2012) ...................................... 131
FIGURE 74. « CAS D¶UTILISATION » DU PRODUIT VIRTUEL (BERARD & KARLSHOEJ 2012) ....................... 131
FIGURE 75. VUE D¶ENSEMBLE DES ETAPES POUR LE DEPLOIEMENT DE SOLUTIONS BASEES SUR L¶,)&
(ADAPTE DE (HIETANEN 2006)) ........................................................................................................... 132
FIGURE 76. CONSTRUCTION DE NOTRE METHODE EN FONCTIONS DES APPROCHES ANALYSEES ET LEURS
APPORTS RESPECTIFS ........................................................................................................................... 135
FIGURE 77. PARTIES DE LA RECHERCHE SUPPORTEES PAR LE CONTEXTE D¶ETUDE.................................... 141
FIGURE 78. PROCESSUS DE META-MODELISATION A PARTIR DE L¶ANALYSE DE CAS ET DE LA LITTERATURE
DANS DIFFERENTS DOMAINES .............................................................................................................. 142
FIGURE 79. LE PROCESSUS DE LA METHODE DEST2CO (TIRE DE (ZIGNALE ET AL. 2011)) ......................... 142
FIGURE 80. EXEMPLE DE DIAGRAMME DE CLASSES UML CARACTERISANT UNE FAMILLE ........................ 144
FIGURE 81. EXEMPLE D¶INSTANCIATION D¶UNE CLASSE DE META-MODELE AVEC L¶EDITEUR EMF .......... 145
FIGURE 82. PROCESSUS DE GENERATION D¶UN EDITEUR DE MODELES AVEC GMF ................................... 146
FIGURE 83. UNE METHODE DIRIGEE PAR LES MODELES ET FAVORISANT L¶INNOVATION ........................... 147
FIGURE 84. REPRESENTATION ABSTRAITE DE LA METHODE PUSH ........................................................... 149
FIGURE 85. GENERATION DU CAHIER D¶EXIGENCES A PARTIR DES MODELES CREES.................................. 150
FIGURE 86. DECOUPAGE EN PHASES ET SOUS-PHASES D¶UN PROJET AIC .................................................. 153
FIGURE 87. META-MODELE DE LA PRATIQUE COLLECTIVE (MMPC) ........................................................ 164
FIGURE 88. META-MODELE DE LA PRATIQUE INDIVIDUELLE (MMPI) ....................................................... 166
FIGURE 89. META-MODELE COMPLET DES PRATIQUES METIERS (MMPM)................................................ 167
FIGURE 90. LES OPERATIONS AUTOUR DU CONCEPT D¶ESPACE DE TRANSITION......................................... 168
FIGURE 91. INSTANCIATION DU MMPM PAR UN DIAGRAMME D¶ACTIVITES UML.................................... 170
FIGURE 92. INTERFACE DE L¶EDITEUR GMF D¶ARBRES HIERARCHIQUES POUR LA MODELISATION DES
PRATIQUES (EXEMPLE)......................................................................................................................... 171
FIGURE 93. LE TABLEAU DE BORD GMF ................................................................................................... 172
FIGURE 94. FORMALISATION DE L¶ANALYSE METIER, COMBINAISON D¶UN MODELE ET DE REMARQUES ... 174
FIGURE 95. DES USAGES DIFFERENTS POUR UNE MEME PRATIQUE, EXEMPLE D¶UNE PRATIQUE DE « PARTAGE
DE DOCUMENTS » ................................................................................................................................ 175
FIGURE 96. RELATION ENTRE LES CONCEPTS D¶USAGE ET DE PRATIQUE ................................................... 179
FIGURE 97. CARACTERISATION DES INTENTIONS ET DES TACHES .............................................................. 181
FIGURE 98. CARACTERISATION DU CONTENU D¶INTERACTION .................................................................. 183
FIGURE 99. CARACTERISATION DU CONTEXTE D¶USAGE ........................................................................... 184
FIGURE 100.
CARACTERISATION DE LA RELATION ENTRE USAGES .......................................................... 186
| Table des illustrations
279 FIGURE 101.
FIGURE 102.
FIGURE 103.
FIGURE 104.
REPRESENTATION SIMPLIFIEE DU MMU (BLEU) LIE AU MMPM (ROUGE) .......................... 187
ADAPTATION DU FORMALISME DES DIAGRAMMES DE CAS D¶UTILISATION ......................... 188
RAPPEL : MODELISATION DE LA PRATIQUE « DIFFUSION DES DOCUMENTS » ...................... 189
« CONTEXTUAL USE CASE » DE LA PRATIQUE « DIFFUSE DESIGN DOCUMENTS FOR
DESIGNERS TEAM » .............................................................................................................................. 189
FIGURE 105.
MODELISATION DE LA RELATION AVEC D¶AUTRES USAGES ................................................ 190
FIGURE 106.
LEGENDE DU DIAGRAMME D¶INTERACTIONS ...................................................................... 191
FIGURE 107.
DIAGRAMME D¶INTERACTION DECOMPOSANT L¶INTENTION « UPLOAD MULTIPLE FILES» .. 192
FIGURE 108.
MAQUETTAGES DES TACHES CONCRETES « LOADING VISUALIZATION » ET « CLUSTERING
MODE SELECTION» ............................................................................................................................... 193
FIGURE 109.
TABLEAU DE SAISIE DES INFORMATIONS SUPPLEMENTAIRES DANS LE CAHIER D¶EXIGENCES
194
FIGURE 110.
LE CHOIX D¶UN USAGE ET SA DEFINITION ........................................................................... 195
FIGURE 111.
CORRESPONDANCE ENTRE LE DIAGRAMME DE PRATIQUES ET LES MODELES D¶USAGE
(DIAGRAMME DE CAS D¶UTILISATION, D¶INTERACTIONS ET MAQUETTAGES)........................................ 196
FIGURE 112.
CARACTERISATION DU SERVICE (CONCEPTS EN BLEU) MATERIALISANT L¶USAGE (CONCEPTS
EN ROUGE) 201
FIGURE 113.
RAPPEL : LE MODELE CO-MVC.......................................................................................... 202
FIGURE 114.
CARACTERISATION DU SERVICE ICT ET SES COMPOSANTS ................................................. 203
FIGURE 115.
VERSION SIMPLIFIEE DU META-MODELE DES SERVICES ADAPTES (MMSA), COMPOSITION
DU MMPM (EN ROUGE) DU MMU (EN BLEU) ET DU MMS (EN VERT) ................................................. 205
FIGURE 116.
RAPPEL : DIAGRAMME D¶INTERACTION DECOMPOSANT L¶INTENTION « UPLOAD MULTIPLE
FILES»
207
FIGURE 117.
DIAGRAMME DE SEQUENCE MODELISANT LE SERVICE ICT DE TELECHARGEMENT DE
DOCUMENTS VIA L¶OUTIL CRTI-WEB (SERVICE METIER DOCUMENT) .................................................. 208
FIGURE 118.
EXEMPLE DE NOTE AJOUTEE A UNE INPUT DANS UN DIAGRAMME DE SEQUENCES
MODELISANT UN SERVICE .................................................................................................................... 209
FIGURE 119.
ILLUSTRATION DU SERVICE DE TELECHARGEMENT MULTI-FICHIER UNE FOIS IMPLEMENTE 210
FIGURE 120.
REPRESENTATION CONCEPTUELLE DU LIEN ENTRE LES POINTS DE VUE .............................. 213
FIGURE 121.
LES MODELES ET LEURS CORRESPONDANCES ..................................................................... 215
FIGURE 122.
LE CONTEXTE DE PROJET DE DEVELOPPEMENT LORS DE LA PREMIERE EXPERIMENTATION. 216
FIGURE 123.
REPARTITION DES EXPERIMENTATIONS DANS LE TEMPS ..................................................... 216
FIGURE 124.
DEROULEMENT DE L¶EXPERIMENTATION ........................................................................... 218
FIGURE 125.
LES PRATIQUES DE PARTAGE D¶UN CONCEPTEUR ............................................................... 219
FIGURE 126.
DE LA PRATIQUE A L¶USAGE : VARIATION DES INTENTIONS D¶UN UTILISATEUR EN FONCTION
DU BESOIN METIER ............................................................................................................................... 221
FIGURE 127.
UNE PARTIE DU « CONTEXTUAL USE CASE » SPECIFIE POUR LE PARTAGE D¶UN PLAN DWG ET
SES « XREFS » (TROISIEME USAGE) ...................................................................................................... 224
FIGURE 128.
RAPPEL : LE SERVICE « D¶UPLOAD MULTIPLE » DEVELOPPE ............................................... 225
FIGURE 129.
RAPPEL : RELATION ENTRE LES CONCEPTS D¶USAGE ET DE PRATIQUE TELLE QUE
CARACTERISEE PAR LE MMU .............................................................................................................. 226
FIGURE 130.
DEROULEMENT DE L¶EXPERIMENTATION ........................................................................... 228
FIGURE 131.
DIAGRAMME DE LA PRATIQUE ANALYSEE .......................................................................... 229
FIGURE 132.
« CONTEXTUAL USE CASE » DU SERVICE D¶UPLOAD AUTOMATIQUE .................................. 231
FIGURE 133.
DIAGRAMMES D¶INTERACTION POUR LES INTENTIONS « S¶IDENTIFIE » ET « PARTAGE LES
FICHIERS DEPUIS UN DOSSIER PARTAGE » ............................................................................................ 232
FIGURE 134.
PARTIE DU DIAGRAMME DE SEQUENCE SPECIFIANT LE SERVICE ......................................... 233
FIGURE 135.
ILLUSTRATION DU RESULTAT OBTENU AU NIVEAU DE L¶INTERFACE PAR RAPPORT AUX
EXIGENCES........................................................................................................................................... 234
FIGURE 136.
DEROULEMENT DE L¶EXPERIMENTATION ........................................................................... 236
280 Table des illustrations |
FIGURE 137.
PROPOSITION D¶UN NOUVEL OUTIL SUR LA BASE DE MAQUETTAGES (TIRE DE (GUERRIERO ET
AL. 2012)) 237
FIGURE 138.
DIAGRAMME DE LA PRATIQUE DE SURVEILLANCE DU CHANTIER........................................ 238
FIGURE 139.
EXTRAIT DU « CONTEXTUAL USE CASE » POUR L¶USAGE DU TABLEAU DE BORD (NIVEAU
OUVRAGE) 239
FIGURE 140.
DIAGRAMME D¶INTERACTIONS POUR L¶AJOUT DE REMARQUES .......................................... 240
FIGURE 141.
COLLABORATION POUR LA CONCEPTION DE SERVICES AUTOUR DE LA PRODUCTION DE
MODELES 242
FIGURE 142.
RAPPEL : STRUCTURE DE NOTRE RECHERCHE BASEE SUR LA CONCEPTION ......................... 248
FIGURE 143.
GRILLE D¶ANALYSE DES TICKETS (PARTIE 1/ 4).................................................................. 284
FIGURE 144.
GRILLE D¶ANALYSE DES TICKETS (PARTIE 2/ 4).................................................................. 285
FIGURE 145.
GRILLE D¶ANALYSE DES TICKETS (PARTIE 3/ 4).................................................................. 286
FIGURE 146.
GRILLE D¶ANALYSE DES TICKETS (PARTIE 4/ 4).................................................................. 287
Liste des tableaux
TABLEAU 1. BESOINS METIERS A OUTILLER ET BONNES PRATIQUES LIEES .................................................... 38
TABLEAU 2. LES 15 SERVICES INFORMATIQUES COMPOSANT L¶OUTIL CRTI-WEB ....................................... 40
TABLEAU 3. ACTIVITÉS DE RE ET TYPE DE BUTS LES SUPPORTANT .............................................................. 60
TABLEAU 4. DIFFERENCES MAJEURES ENTRE CC-UTILISATEUR ET CC-USAGE (CONSTANTINE, 2003) ....... 71
TABLEAU 5. IMPLICATION DE L¶ACTEUR EN TANT QUE CLIENT ET UTILISATEUR ........................................... 72
TABLEAU 6. NIVEAU ET PORTEE DES TACHES SELON [WINCKLER2004] ....................................................... 75
TABLEAU 7. /¶ENSEMBLE DES AIO REPARTIS EN 6 FAMILLES ...................................................................... 76
TABLEAU 8. LES DIAGRAMMES UML ET LEUR POTENTIEL DE MODELISATION DU METIER (CESARE & LYCETT
2003) 100
TABLEAU 9. RESUME DES APPROCHES DE CONCEPTION BASEE SUR LE CONCEPT DE « LOOSE COUPLING » . 111
TABLEAU 10. AVANTAGES ET LIMITES DES CHAMPS ETUDIES .................................................................. 112
TABLEAU 11. NOTRE APPROCHE PAR RAPPORT AUX CONCEPTS DE LA THEORIE DE L¶$CTIVITE .............. 155
TABLEAU 12. ELEMENTS DE CARACTERISATION DE LA PC1 .................................................................... 157
TABLEAU 13. ELEMENTS DE CARACTERISATION DE LA PC2 .................................................................... 157
TABLEAU 14. ELEMENTS DE CARACTERISATION DE LA PC3 .................................................................... 158
TABLEAU 15. ELEMENTS DE CARACTERISATION DE LA PC4 .................................................................... 158
TABLEAU 16. ELEMENTS DE CARACTERISATION DE LA PC5 .................................................................... 159
TABLEAU 17. ELEMENTS DE CARACTERISATION DE LA PC6 .................................................................... 159
TABLEAU 18. ELEMENTS DE CARACTERISATION DE LA PC7 .................................................................... 160
TABLEAU 19. ELEMENTS DE CARACTERISATION DE LA PC8 .................................................................... 160
TABLEAU 20. ELEMENTS DE CARACTERISATION DE LA PC9 .................................................................... 161
TABLEAU 21. ELEMENTS DE CARACTERISATION DE LA PC10 .................................................................. 161
TABLEAU 22. ELEMENTS DE CARACTERISATION DE LA PC11 .................................................................. 162
TABLEAU 23. EXEMPLES DE DONNEES ET D¶ASSOCIATION DE FORMES .................................................... 182
TABLEAU 24. EVALUATIONS ATTENDUES EN FONCTION DES EXPERIMENTATIONS ................................... 217
TABLEAU 25. APPORTS DES DIFFERENTES EXPERIMENTATIONS ............................................................... 244
| Table des illustrations
281 282 Table des illustrations |
Annexes
Analyse des « tickets » de conception de CRTI -weB
/¶analyse évoquée au § 1.5.3 DYDLWSRXUEXWG¶pYDOXHUOHQRPEUHGH développements sur les
services CRTI-weB en rapport avec un « besoin métier », à savoir une exigence issue du domaine
professionneOOHHWQRQOLpHjGHVSUREOqPHVG¶XWLOLVDELOLWp
'¶DSUqV O¶DQDO\VH PHQpH OD PRLWLp GHV GpYHORSSHPHQWV LQLWLpV RQW SRXU RULJLQH XQ EHVRLQ
métier clairement identifié. Nous avons également pu évaluer les modifications impliquées dans
O¶XVDJHJpQpUDOHVXUles tâches, sur le contexte ou sur le contenu)
| Annexes
283 Figure 143. *ULOOHG¶DQDO\VHGHVWLFNHWVSDUWLH 4)
284 Annexes | Figure 144. *ULOOHG¶DQDO\VHGHVWLFNHWVSDUWLH 4)
| Annexes
285 Figure 145. *ULOOHG¶DQDO\VHGHVWLFNHWVSDUWLH 4)
286 Annexes | Figure 146. *ULOOHG¶DQDO\VHGHVWLFNHWVSDUWLH 4)
| Annexes
287 Cahier G¶H[LJHQFHV : modHG¶HPSORL
/HV SDJHV TXL VXLYHQW FRQVWLWXHQW OH PRGH G¶HPSORL GX FDKLHU G¶H[LJHQFHV WHO TX¶LO HVW
actuellement proposé,ODSRXUEXWG¶DVVLVWHUOHVH[SHUWVPpWLHUFRQFHSWHXUVHWGpYHORSSHXUVGDQV
leurs phases de modélisation respectives et dans la lecture générale du document.
&DKLHUG¶H[LJHQFHVSRXUOH
développement de services
informatiques spécifiques
0RGHG¶HPSORL
1. Description du document
a. But du document
Ce document a pour but de définir les exigences qui guideront le développement de services
informatiques. Il devra décrire synthétiquement les pratiques métiers du client ainsi que les usages
LQGXLWVTX¶LODGRSWHUDHQWDQWTX¶XWLOLVDWHXUGXV\VWqPHjGpYHORSSHURXDPpOLRUHU&HVpOpPHQWV
auront étpLGHQWLILpVSDUO¶DQDO\VWHPpWLHUJUkFHjO¶LPSOLFDWLRQGHO¶XWLOLVDWHXUOXL-même dans la
SKDVHG¶pWXGH/DFRPELQDLVRQGHFHVH[LJHQFHVGRQQHUDOLHXjXQHVSpFLILFDWLRQWHFKQLTXHGX
VHUYLFHVRXVIRUPHG¶XQGLDJUDPPH80/
b. Portée du document
Ce cahier des charges servira de base à la conception de services spécifiques. Il est destiné à
JXLGHUOHGpYHORSSHXUGDQVVRQWUDYDLOGHFRQFHSWLRQVDQVTX¶LOQ¶DLWEHVRLQG¶DYRLUXQUHFRXUV
ultérieur aux futurs utilisateurs. Des premiers maquettages serviront de support à la discussion
avant de passer au prototypage de la solution.
c. Définitions, Acronymes et Abréviations
PC (Pratique Collective) FRPSRUWHPHQWG¶XQJURXSHDGRSWpGDQVOHEXWGHUpSRQGUHjXQEHVRLQ
métier récurrent.
PI (Pratique Individuelle) : comportHPHQWG¶XQLQGLYLGXLPSOLTXpGDQVXQH3&DGRSWpGDQVOH
EXWG¶DSSRUWHUVDFRQWULEXWLRQjODUpSRQVHDXEHVRLQPpWLHU
Opération GpFRPSRVLWLRQG¶XQH3,YLVDQWjGpFULUHFHTXHIDLWUpHOOHPHQWO¶DFWHXU
Artefact : élément produit, utilisé ou référé lors G¶XQHRSpUDWLRQTXHFHVRLWXQGRFXPHQWXQ
message, un objet physique, une tâche ou tout autre élément support du travail collaboratif.
Usage PpGLDWLVDWLRQGHVSUDWLTXHVjWUDYHUVO¶XWLOLVDWLRQG¶XQHWHFKQRORJLH
Tache GpFRPSRVLWLRQG¶XQXVDJHYLVDQW jGpFULUHFHTXHIRQWUpHOOHPHQWO¶XWLOLVDWHXUHWOH
système.
2. Organisation du document
288 Annexes | Afin de définir les exigences du service à développer, le document modélisera, à travers des
IRUPDOLVPHVGLIIpUHQWVGLDJUDPPHVWDEOHDX[WH[WHVPDTXHWWDJHV« :
Partie 1 : Une analyse métier, décrivant les pratiques collectives et individuelles à outiller
Partie 2 : Une analyse fonctionnelle, décrivant les usages relatifs aux pratiques
Partie 3 : La spécification technique du service
Partie 1 : pratiques métiers
Le diagramme définit / à définir ici schématise une Pratique Collective (Collective Practice, CP)
décomposée en une ou plusieurs Pratiques Individuelles (Individual Practices, IP) adoptées par le
client ou dans un cas similaire. IdenWLILHUOHV3UDWLTXHV,QGLYLGXHOOHVG¶XQDFWHXUG¶XQSURMHWGH
construction permettra de connaître ses besoins.
Légende et précisions :
La pratique collective (Collective Practice ± CP) est définie par :
- Un nom (name) décrivant en quelques mots en
quoi elle consiste
- Une famille (family) choisie parmi un ensemble
définit (11 familles possibles)
- 8QHGHVFULSWLRQD\DQWSRXUEXWG¶H[SOLTXHUSOXV
précisément la nature de la pratique.
La pratique individuelle (Individual Practice ± IP)
définie par :
- Un nom (name) décrivant en quelques mots en quoi elle consiste
- 8QHGHVFULSWLRQD\DQWSRXUEXWG¶H[SOLTXHUSOXVSUpFLVpPHQWODQDWXUHGHODSUDWLTXH
est
Les opérations(Operations) qui composent une pratique
individuelle sont de type :
- « Communication » : Contacter (Contact), Avertir
(Advertise), Demander (Ask for), Valider (Validate),
Commenter (Comment).
- « Production » : Créer (Create), Modifier (Modify),
Mettre à jour (Update), Effacer (Delete)), Exécuter
(Execute), Lier (Link), Inclure(Include)
- « Diffusion » (Availability) : Partager (Share), Annuler
partage (Unshare)
- « Recherche » (Research) : Rechercher (Look for),
Obtenir (Get), Consulter (Consult), Identifier (Identify),
Vérifier (Verify).
Les artefacts (artifacts), éléments produits, utilisés
référés loUVG¶XQHRSpUDWLRQVRQWGHW\SH :
- Document : géométral (geometral), modèle
(model), perspective (perspective), photos
(photos),
rapport
(report),
exigences
(requirements), spécifications (specifications),
agenda, planning, to do
- Objet (object) : bâtiment (building), lot (plot),
étage (level), pièce (room), élément de
ou
| Annexes
289 construction (element), réservation (reservation), matériau (material), échantillon de matériau
(material sample), véhicule (vehicle), défaut (defect)
- Message : Information, Réaction (Reaction), Notification, Requête (request), Validation
- *URXSHG¶DUWHIDFWVJURXSRIDUWLIDFWV
Les artefacts sont également définit par :
- Une description plus spécifique
- Un statut (status): en cours (ongoing), final, à valider (to validate), validé (valid), à exécuter
(to execute), exécuté (executed), à modifier (to modify)
- Un auteur (author) : défini par son rôle (role)
Un acteur DFWRUSHXWrWUHUHVSRQVDEOHG¶XQHSUDWLTXHLQGLYLGXHOOHRXVLPSOHPHQWLPSOLTXpF¶HVW
jGLUHFRQFHUQpSDUO¶RSpUDWLRQG¶XQDXWUHDcteur). Dans tout les cas il est définit par :
- Un rôle organisationnel (organizational role) :
Concepteur (designer), Maître G¶RXYUDJH RZQHU
Expert, Constructeur (constructor), Coordinateur
(coordinator), Administration, Conseiller (advisor),
autre (other)
- Un métier (job) : architecte (architect), ingénieur
structure/ santé/sécurité (structure, safety, health
engineer), urbaniste (urbaniste), Maçon (Mason),
Electricien (Electrician), Charpentier (Carpenter), autre
RWKHU«
- Une description plus spécifique
/HVJURXSHVG¶DFWHXUVRQWGpILQLWSDUOHVPrPHVDWWULEXWVHWSDUXQW\SHGHJURXSH
Le projet (project) dans lequel se déroule la pratique
collective est défini par :
- Un type : Habitat individuel (Individual Housing), Habitat
collectif (Mass Housing), Bâtiment public (Public
building)
- Une certification environnementale (certification type)
La phase de projet dans laquelle se déroule la pratique
collective est définie par :
- Un type : Préparation, Conception (Design), Exécution, Livraison (Delivery)
La Tâche métier est définie par :
- Un type GH FRQFHSWLRQ GHVLJQ G¶H[pFXWLRQ H[HFXWLRQ G¶pYDOXDWLRQ DVVHVVPHQW GH
synthèse (synthesis), de coordination (coordination)
- Un auteur : défini par son rôle organisationnel
Le projet, les phases et les tâches sont considérées comme des activités et sont également définie
par :
- des dates relatives GHGpEXWVWUDWLQJGDWHGHILQHQGLQJGDWHG¶LQWHUUXSWLRQLQWHUUXSWLRQ
GDWHHWF«
- Un type de durée : long (long) ou court (short)
Chaque élément possède un chDPSG¶pGLWLRQOLEUHGHVWLQpjHQFRPSOpWHUODGpILQLWLRQSDUWRXWH
information supplémentaire jugée utile à la description de la pratique.
On retrouve plusieurs types de relations liant les différents éléments présentés ci-dessus :
Les relations de composition (is composed of): une Pratique Collective est composée de Pratiques
,QGLYLGXHOOHVXQH3,pWDQWFRPSRVpHG¶2SpUDWLRQV
La relation exécute (executes) relie un acteur à une Pratique Individuelle.
290 Annexes | La relation produit (creates) relie une opération à un artefact lorsque ce dernier est le fruit de
O¶RSpUDWLRQTXLOHPDQLSXOHH[FUpHUXQGRFXPHQW
La relation utilise (uses) UHOLHXQHRSpUDWLRQjXQDUWHIDFWORUVTXHFHGHUQLHUQ¶HVWSDVOHIUXLWGH
O¶RSpUDWLRQTXLOHPDQLSXOHH[SDUWDJpXQGRFXPHQWFUpp)
La relation cible (targets) relie une opération à un acteur auquel elle a recours (ex. avertir le
concepteur)
Partie 2 : Usages
&RPPHLQWURGXLWGDQVODGHVFULSWLRQGHO¶DQDO\VHPpWLHUYRLULOV¶DJLWjSUpVHQWGHGpFULUHOD
médiatisation des Pratiques métier Individuelles (PI) et donc des Opérations qui les composent à
WUDYHUVO¶8VDJHG¶XQVHUYLFHLQIRUPDWLTXHDGDSWp
/DGpILQLWLRQGHO¶XVDJHVHIDLWjWUDYHUV :
- XQ GLDJUDPPH GH FDV G¶XWLOLVDWLRQ XVH FDVH diagram) dans lequel chaque opération
RSHUDWLRQVHUDGpFRPSRVpHHQFDVG¶XWLOLVDWLRQVXVHFDVHV
- une définition du contexte à travers des tableaux
- des modèles de tâches IHM détaillant chaque use case et si besoin des maquettages pour les
illustrer
- une définitiRQ GX FRQWHQX j WUDYHUV GHV WDEOHDX[ GpFULYDQW O¶LQIRUPDWLRQ SURGXLWH HWRX
utilisée
NB : Dans le cas ou une caractéristique ne peut être définie, cela sera précisé par une des 2
mentions suivantes :
- NIL : pas de réponse possible (ex. le système ne possèGHSDVGHW\SHG¶HQWUpHYLGpR
- NC : réponse non communiquée (ex. le système possède peut-rWUHXQW\SHG¶HQWUpHYLGpRPDLV
on ne sait pas laquelle).
Légende et précisions :
Le GLDJUDPPHGHFDVG¶XWLOLVDWLRQuse case diagram):
/¶DFWHXUHVt définit par son rôle
organisationnel. Chaque opération devient
SDTXHWSDFNDJHGHFDVG¶XWLOLVDWLRQXVH
cases). Les paquets des opérations à
spécifier sont représentés dans le système et
décomposés. Le système peut aussi
contenir des paquets de cas G¶XWLOLVDWLRQ
LVVXVG¶DXFXQHRSpUDWLRQPpWLHUPDLV
néanmoins nécessaires et donc à définir.
paquets des opérations non traitées sont
TXDQWjHX[VLWXpVjO¶H[WpULHXUGXV\VWqPH
un
Les
Le contexte :
Il est définit sous forme de tableaux.
Le contexte général rappelle le nom de la Pratique Individuelle (Individual Practice) à outiller et
UpVXPHOHEXWGHO¶XVDJHH[SDUWDJHUGHVGRFXPHQWVjO¶DLGHG¶XQHSODWHIRUPHG¶pFKDQJHVKDULQJ
documents with a groupware). Il définit également :
| Annexes
291 -
/D IUpTXHQFH GH O¶usage (frequency) : rarement (rare), souvent (often), très souvent (very
often)
- OD ORFDOLVDWLRQ GH O¶XVDJH (location) : au bureau (at office), sur le chantier (on site), au
domicile (at home), chez le client (at customer), dans un lieu public (in public location)
/HFRQWH[WHGHO¶DFWHXUUDSSHOOHOHPpWLHUGHO¶DFWHXUHWGpILQLWVRQU{OHRSpUDWLRQQHORSHUDWLRQQDO
role), c.à.d. son rôle vis-à-YLVGXV\VWqPHH[DGPLQLVWUDWHXUXWLOLVDWHXU«,OGpWHUPLQHDXVVLVL
O¶XWLOLVDWHXUGRLWrWUHLGHQWLILp
Le contexte logLFLHOVRIWZDUHGpILQLWO¶DSSOLFDWLRQjVSpFLILHUW\SHHWGHVFULSWLRQHWOHV
technologies à utiliser pour cela.
Le contexte matériel (hardware) définit le support physique utilisé à savoir :
- OH W\SH G¶DSSDUHLO GHYLFH : ordinateur personnel (computer), ordinateur portable (laptop),
VPDUWSKRQHVPDUWSKRQHWDEOHWWHWDFWLOHWDEOHW«
- /HV\VWqPHG¶H[SORLWDWLRQ26 :LQGRZVPDF26OLQX[DQGURLGL26:LQGRZV3KRQH«
- /HW\SHGHGLVSRVLWLIG¶LQWHUDFWLRQLQWHUDFWLRQGHYLFH : clavier (keyboard) + souris (mouse),
SDYpWDFWLOHWRXFKSDGpFUDQWDFWLOHWRXFKVFUHHQ«
- La connexion à internet : connecté (online), déconnecté (offline)
- Le type de sortie vidéo YLGHRRXWSXWpFUDQVFUHHQSURMHFWHXUSURMHFWRU«
- Le type de sortie audio (audio output) : haut-paUOHXUVVSHDNHUVpFRXWHXUVHDUVSHDNHUV«
- /H W\SH G¶HQWUpH YLGpR (video input) : caméra (video camera), appareil photo numérique
SKRWRFDPHUD«
- /HW\SHG¶HQWUpHDXGLR (audio input) : microphone (microphone)
Chaque élément du contexte peut être précisé dans un deuxième tableau (additional information
about context), le but étanWG¶DSSRUWHUWRXWHLQIRUPDWLRQTXLSRXUUDV¶DYpUHUXWLOHDX
développement de la solution.
Les tâches HWOHFRQWHQXG¶LQWHUDFWLRQ:
Chaque intention utilisateur sera décomposée pour former un arbre
GHWkFKHVFRPSUHQDQWSOXVLHXUVQLYHDX[G¶DEVWUDFWLRQ
/DWkFKHDEWVUDLWHGpFULWO¶LQWHUDFWLRQGHPDQLqUHJpQpUDOHHW
indépendante de la technologie. Elle est définie par un nom et un
type.
Deux types de tâches concrètes sont possibles : la tâche
G¶LQWHUDFWLRQDFWLRQSK\VLTXHGHO¶XWLOLVDWHXUVXUOHV\VWqPHHWOD
tâche de perception (retour visuel ou sonore du système pour
LQIRUPHUO¶XWLOLVDWHXU
Les tâches système qui auront été identifiées dans le use case
apparaissent également.
Chaque élément du contexte coopératif manipulé par une opération
ainsi que défini dans la partie 1, devient un contenu à médiatiser
ORUVGHO¶XVDJHG¶XQVHUYLFHLQIRUPDWLTXHVRXVIRUPHG¶REMHW
G¶LQWHUDFWLRQ. Ce contenu est alors identifié par un nom, une
spécificité graphique, des attributs, un type de donnée et des
propriétés.
Les relations entre tâches peuvent être de composition (is composed of)
processus (AND, OR, THEN). Une relation tâche-objet se nomme
« interagit avec » (« interact with »).
/DGHVFULSWLRQGHO¶LQWHUDFWLRQSHXWrWUHFRPSOpWpHSDUGHVPDTXHWWDJHVDEVWUDLWVRXFRQFUHWV
292 Annexes | ou de
Partie 3 : Spécification du service
La spécification du service apporte la réponse technologique aux usages définiVGDQVO¶pWDSH
précédente. Le formalisme utilisé est le diagramme de séquences.
Légende et précisions :
Les diagrammes de cette partie décrivent O¶XWLOLVDWLRQG¶XQVHUYLFH,&7 par un client, l¶DUFKLWHFWXre
de ce service (chaque composant ayant un stéréotype « modèle privé », « modèle partagé »,
« vue » ou « contrôleur » et les flux de données (inputs du client vers la vue, outputs de la vue
vers le client et actions entre les composants du service). Ces diagrammes prennent en compte des
scénarios idéau[HWOHVFDVG¶pFKHFVSRVVLEOHV,OVSRXUURQWpYROXHUHQIRQFWLRQGHO¶DYDQFHPHQW
du projet.
| Annexes
293 &DKLHUG¶H[LJHQFHVSDUWLHpGLWDEOH
Requirements Specification Form for adapted ICT services design and development Requirement Form ID:
Click here to enter text.
Name of the service to develop: Click here to enter text.
Actors of the development project:
Service designer: Click here to enter text.
Business analyst: Click here to enter text.
Developer: Click here to enter text.
Service consumer: Click here to enter text.
Versioning:
Versions
v x.x
v x.x
v x.x
v x.x
v x.x
v x.x
v x.x
v x.x
v x.x
v x.x
Dates
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
Click here to enter a date.
294 Annexes | Description of the project phase
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
PART 1: BUSINESS PRACTICES PRACTICES DIAGRAM
Insert here the diagram illustrating the business practices.
ADDITIONAL INFORMATION
Do you want to add any information about the business context and the practice to perform?
Click here to enter text.
Do you want to add any information about the information to manage (artifacts, activities, actors)?
Click here to enter text.
| Annexes
295 PART 2: USAGE Related Individual Practice
Usage Objective
USAGE DESCRIPTION
Click here to enter text.
Click here to enter text.
USER INTENTIONS
Insert here the use case diagram
USAGE CONTEXT
Choose an item.
Location
Temporality
User
Operational role
Identification
Device type
OS
Interaction device
Connection
296 Annexes | Choose an item.
Application
Choose an item.
Application
type
Dev.
Click here to enter text.
Choose an item.
technology
Device
Choose an item.
Choose an item.
Video Output
Choose an item.
Choose an item.
Audio Output
Choose an item.
Choose an item.
Video Input
Choose an item.
Choose an item.
Audio Input
Click here to enter text.
ADDITIONAL INFORMATION ABOUT CONTEXT
Do you want to add any functional or non-IXQFWLRQDOUHTXLUHPHQWVDERXW«
The general context of the usage?
You can describe here the pre-conditions and post-conditions of the usage. It can refer to the relations with
other usages.
Click here to enter text.
7KHDFWRU¶VVSHFLILFLW\DVDXVHU"
What do you know about the actor using the system? Eventually precise here, his skills, knowledge,
DELOLWLHVSUHIHUHQFHV«
Click here to enter text.
The application specificity?
Is there already a developed application to adapt? You can describe it here.
Click here to enter text.
What about the new services to develop?
Click here to enter text.
The device specificity?
Does it have a particularity in terms of mobility, performancHDXWRQRP\FDSDFLW\«"'R\RXWKLQNDERXW
a specific model?
Click here to enter text.
| Annexes
297 Form ID
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
Click here to enter text.
RELATED USAGES
You can specify the link between the usage you described and others
Usage description
Relation in time
Click here to enter text.
Choose an item.
Click here to enter text.
Choose an item.
Click here to enter text.
Choose an item.
Click here to enter text.
Choose an item.
Click here to enter text.
Choose an item.
PART 3: SERVICE SERVICE SPECIFICATION
Insert here the sequence diagram
298 Annexes | Relation in
space
Choose an item.
Choose an item.
Choose an item.
Choose an item.
Choose an item.
Designing collaborative services adapted to business practices: a usage-centered
method ± Application to the construction sector
Abstract
In the sector of the architectural design-construction project, the management of the
collaboration between the different actors of a project is an important issue. From a project to
another, considering the project type and also the actors involved, business practices vary. In
parallel, many services are proposed and used to assist the collaboration, some of them being
generic and others more specific to professional usage. The CRTI-weB experience is a groupware
development project lead with and for professionals of the Luxembourgish sector. It actually
proposes two services in its commercial version: the documents exchange and management
VHUYLFH SODQV WHFKQLFDO GRFXPHQWV« DQG WKH site meeting report redaction and management
service. Despite the analysis of business needs lead before development, the tool has some lacks
RI DGDSWDWLRQ 7KLV VWDWHPHQW LVQ¶W isolated; in general, this type of tools GRHVQ¶W IXOO\ VDWLVI\
SURIHVVLRQDOV¶ H[SHFWDWLRQV 7KLV GRFWRUDO ZRUN SURSRVHV DQ DQDO\VLV IUDPHZRUN VXSSRUWHG E\
XVHUV¶ EHKDYLRUV PRGHOLQJ :H DGRSW VHYHUDO YLHZSRLQWV UHODWHG WR VHYHUDO UHVHDUFK ILHOGV
software engineering, human-computer interactions design, service-oriented enterprise and
information system design, and finally computer-supported collaborative work (CSCW). From an
organizational viewpoint, we identify collective practices performed by groups of actors involved
in the project. Then, we deduce the individual practice, i.e. the responsibilities of each actor
considering his role in the group. From an operational viewpoint, are interested in the mediation
of these responsibilities by the usages of different technological solutions. The definition of these
XVDJHVLVOLQNHGWRWKHFRQFHSWRIFRQWH[WWKHWHFKQLFDOFRQWH[WKDUGZDUHVRIWZDUH«WKHplace
FRQWH[W ORFDWLRQ HQYLURQPHQW« DQG WKH WHPSRUDO FRQWH[W IUHTXHQF\ UHJXODULW\
V\QFKURQL]DWLRQ«)LQDOO\WKHIXQFWLRQDOYLHZSRLnt aims at defining the business service, i.e. the
behavior of the system that answers to one business need. We propose the PUSH method
(Practice and Usages based Service enhancement) that orchestrates the different viewpoints to
generate an amount of requirements for the development of adapted services. The communication
and the traceability are supported by this design method. The context of study, both research and
development-oriented (through the collaboration of the MAP-CRAI laboratory in Nancy and the
CRP Henri Tudor in Luxembourg) allows us evaluating and enhancing the definition of our
concepts and the applicability of the PUSH method through three experimentations.
Keywords: Construction, Business Practices, Collaborative services, Software Engineering,
Human-Computer Interactions, Usage-centered design, Design science.
RAM EAU Keywords: Groupware, Software ± Development, Collaborative work, User
centered design, Design patterns, Architecture ± Software engineering, Architecture -- Practices
Concevoir des services collaboratifs adaptés à des pratiques métiers : une méthode
centrée usages - Application au domaine de la construction
Résumé
Dans le domaine du projet de conception-construction architecturale, la gestion de la
collaboration entre les GLIIpUHQWV DFWHXUV G¶XQ SURMHW HVW XQ HQMHX LPSRUWDQW '¶XQ SURMHW j XQ
autre, en fonction du projet, mais aussi des acteurs qui y interviennent, les pratiques de travail
varient. Parallèlement, de nombreux services sont proposés et utilisés pour assister la
collaboration, certains sur un modèle « grand public ª HW G¶DXWUHV SOXV RULHQWpV YHUV XQ XVDJH
SURIHVVLRQQHO /¶H[SpULHQFH CRTI-weB HVW XQ SURMHW GH GpYHORSSHPHQW G¶XQ FROOHFWLFLHO PHQp
avec et pour les professionnels du secteur au Luxembourg. Il propose actuellement deux services
dans sa version commerciale OHVHUYLFHG¶pFKDQJHVHWJHVWLRQGHGRFXPHQWVSODQVGRFXPHQWV
WHFKQLTXHV HW OH VHUYLFH GH UpGDFWLRQ HW JHVWLRQ GHV UDSSRUWV GH FKDQWLHU 0DOJUp O¶pWXGH GHV
besoins métiers menée en amont du dévelRSSHPHQW O¶RXWLO SUpVHQWH FHSHQGDQW GHV PDQTXHV
G¶DGDSWDWLRQ&HFRQVWDWG¶LQDGDSWDWLRQQ¶HVWSDVXQFDVLVROpLOUHIOqWHXQHODFXQHJpQpUDOHGHFH
JHQUH G¶RXWLOV j VDWLVIDLUH SOHLQHPHQW OHV DWWHQWHV GHV SURIHVVLRQQHOV &¶HVW SRXUTXRL ce travail
doctoral propose XQ FDGUH G¶DQDO\VH VXSSRUWp SDU OD PRGpOLVDWLRQ GHV FRPSRUWHPHQWV GHV
utilisateurs. Nous adoptons alors plusieurs points de vue relatifs à différents champs de
recherches OH JpQLH ORJLFLHO OD FRQFHSWLRQ G¶LQWHUIDFHV KRPPH-PDFKLQH O¶HQWUHSULVH orientée
VHUYLFHV HW OD FRQFHSWLRQ GH V\VWqPH G¶LQIRUPDWLRQ HW HQILQ OH WUDYDLO FROODERUDWLI DVVLVWp SDU
RUGLQDWHXU7&$2'¶XQSRLQWGHYXHRUJDQLVDWLRQQHOQRXVLGHQWLILRQVOHVSUDWLTXHVFROOHFWLYHV
H[HUFpHV SDU OHV JURXSHV G¶DFWHXUV LPSOLTXpV GDQV OH projet. Nous en déduisons ensuite les
pratiques individuelles, à savoir les responsabilités de chacun en fonction de son rôle dans le
JURXSH '¶XQ SRLQW GH YXH RSpUDWLRQQHO QRXV QRXV LQWpUHVVRQV j OD PpGLDWLVDWLRQ GH FHV
UHVSRQVDELOLWpV SDU O¶XVDJH GH GLIférentes solutions technologiques. La caractérisation de ces
usages est liée à la notion de contexte OH FRQWH[WH WHFKQLTXH PDWpULHO ORJLFLHO« OH FRQWH[WH
VSDWLDO ORFDOLVDWLRQ HQYLURQQHPHQW« OH FRQWH[WH WHPSRUHO IUpTXHQFH UpJXODULWp
synchronisaWLRQ«(QILQOHSRLQWGHYXHIRQFWLRQQHOYLVHjGpILQLUOHVHUYLFHXWLOLVpF
HVW-à-dire
OH FRPSRUWHPHQW QRQ SOXV GH O¶utilisateur, mais du système qui répond à son besoin. Nous
proposons la méthode PUSH (Practices and Usages based Services enHancement) qui orchestre
FHVGLIIpUHQWVSRLQWVGHYXHHWSHUPHWGHJpQpUHUXQHQVHPEOHG¶H[LJHQFHVSRXUOHGpYHORSSHPHQW
de services dits « adaptés ». Communication et traçabilité sont les maitres mots de cette méthode
de conception. /H FRQWH[WH G¶pWXGH j OD IRLV RULenté recherche et développement nous a permis
G¶pYDOXHUHWG¶DPpOLRUHUODGpILQLWLRQGHVFRQFHSWVPLVHQDYDQWDLQVLTXHODPLVHHQSODFHGHOD
méthode PUSH à travers trois expérimentations.
M ots-clés : Construction, Pratiques métiers, Services collaboratifs, Génie Logiciel, Interfaces
Homme-Machines, Conception centrée usages, Science de la conception.
M ots-clés RAM EAU : Logiciels de groupe, Logiciels ± Développement, Travail collaboratif,
Conception centrée sur l'utilisateur, Design patterns, Architecture ± Informatique, Architecture ±
Pratique.
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising