GE | PVM1790SRSS | Use and Care Manual | GE CVM1790SSSS Use and Care Manual

GE CVM1790SSSS Use and Care Manual
CONVECTION/
MICROWAVE OVEN
SAFETY INFORMATION
. . . . . . . . .3
USING THE MICROWAVE
Features . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .6
Controls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7
Available Cooking Options . . . . . . . . . . . . . .8
Time and Auto Features . . . . . . . . . . . . . . . .9
Power Level. . . . . . . . . . . . . . . . . . . . . . . . . . 12
Sensor Features . . . . . . . . . . . . . . . . . . . . . . 13
Baking and Roasting Features . . . . . . . . . . 16
Fast Bake Features . . . . . . . . . . . . . . . . . . . 17
Cookware tips . . . . . . . . . . . . . . . . . . . . . . . . 18
Best Method of Cooking . . . . . . . . . . . . . . . 19
Warming Features . . . . . . . . . . . . . . . . . . . 20
Other Features . . . . . . . . . . . . . . . . . . . . . . 20
OWNER’S MANUAL
CVM1790
PVM1790
CARE AND CLEANING
Oven . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24
Replacing the Light Bulb . . . . . . . . . . . . . .25
Exhaust Feature . . . . . . . . . . . . . . . . . . . . . .25
TROUBLESHOOTING . . . . . . . . . . . .27
WARRANTY . . . . . . . . . . . . . . . . . . . . .
30
ACCESSORIES . . . . . . . . . . . . . . . . . . . 31
CONSUMER SUPPORT . . . . . . . . . .32
Write the model and serial
numbers here:
Model # _________________
Serial # _________________
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
You can find them on a label when
the door is open.
GE is a trademark of the General Electric Company. Manufactured under trademark license.
49-40773-2 08-17 GEA
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.
2
49-40773-2
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING To reduce the risk of burns, electric shock, fire, injury to persons, or exposure to
excessive microwave energy:
When using electrical appliances, basic safety precautions should be followed, including the following:
Ŷ 5
HDGDOOLQVWUXFWLRQVEHIRUHXVLQJWKLVDSSOLDQFH
Ŷ 5
HDGDQGIROORZWKHVSHFLILFSUHFDXWLRQVLQWKH
PRECAUTIONS TO AVOID POSSIBLE EXPOSURE
TO EXCESSIVE MICROWAVE ENERGY section on
page 5.
Ŷ 8
VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGXVHDV
described in this manual. Do not use corrosive
chemicals or vapors in this appliance. This oven is
specifically designed to heat, dry or cook food, and is
not intended for laboratory or industrial use.
Ŷ 7
KLVDSSOLDQFHPXVWRQO\EHVHUYLFHGE\TXDOLILHG
service personnel. Contact nearest authorized
service facility for examination, repair or adjustment.
INSTALLATION
Ŷ ,QVWDOORUORFDWHWKLVDSSOLDQFHRQO\LQDFFRUGDQFH
with the provided installation instructions.
Ŷ This appliance must be grounded. Connect only
to properly grounded outlet. See “GROUNDING
INSTRUCTIONS” found on page 5.
Ŷ 7KLVPLFURZDYHRYHQLV8/OLVWHGIRULQVWDOODWLRQRYHU
both gas (less than 60,000BTU) and electric ranges.
Ŷ 7KLVRYHUWKHUDQJHRYHQLVGHVLJQHGIRUXVHRYHU
UDQJHVQRZLGHUWKDQƎ,WPD\EHLQVWDOOHGRYHU
ERWKJDVDQGHOHFWULFFRRNLQJHTXLSPHQW
Ŷ Do not operate this appliance if it has a damaged
power cord or plug, if it is not working properly, or if it
has been damaged or dropped.
Ŷ .HHSFRUGDZD\IURPKHDWHGVXUIDFHV
Ŷ Do not let cord hang over the edge of the table or
counter
Ŷ 'RQRWLPPHUVHFRUGRUSOXJLQZDWHU
Ŷ '
RQRWFRYHURUEORFNDQ\RSHQLQJVRQWKH
appliance.
Ŷ '
RQRWVWRUHWKLVDSSOLDQFHRXWGRRUV'RQRWXVHWKLV
product near water—for example, in a wet basement,
near a swimming pool, near a sink or in similar
locations.
TO REDUCE THE RISK OF FIRE IN THE CAVITY:
Ŷ Do not overcook food. Carefully attend appliance
when paper, plastic or other combustible materials
are placed inside the oven to facilitate cooking.
Ŷ 5
HPRYHZLUHWZLVWWLHVDQGPHWDOKDQGOHVIURP
paper or plastic containers before placing them in
the oven.
Ŷ ,IPDWHULDOVLQVLGHWKHRYHQLJQLWHNHHSWKHRYHQ
door closed, turn the oven off and disconnect the
power cord or shut off power at the fuse or circuit
breaker panel.
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ '
RQRWVWRUHDQ\PDWHULDOVLQWKLVRYHQZKHQQRWLQ
use. Do not leave paper products, cooking utensils
or food in the cavity when not in use. All racks
should be removed from oven when not in use.
Ŷ '
RQRWRSHUDWHWKHPLFURZDYHIHDWXUHZLWKRXWIRRGLQ
the oven.
Ŷ '
RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQVXFFHVVLRQ
on the same food portion. If food is undercooked
DIWHUWKHILUVWFRXQWGRZQXVH&22.%<7,0(IRU
additional cooking time.
TO REDUCE THE RISK OF BURNS:
Ŷ %HFDUHIXOZKHQRSHQLQJFRQWDLQHUVRIKRWIRRG8VH
pot holders and direct steam away from face and
hands.
Ŷ 9
HQWSLHUFHRUVOLWFRQWDLQHUVSRXFKHVRUSODVWLF
bags to prevent build-up of pressure.
Ŷ %
HFDUHIXOZKHQWRXFKLQJWKHWXUQWDEOHGRRUUDFNV
or walls of the oven which may become hot during
use.
Ŷ /LTXLGVDQGFHUWDLQIRRGVKHDWHGLQWKHPLFURZDYH
oven can present a risk of burn when removing
them from the microwave. The potential for a burn is
greater in young children, who should not be allowed
to remove hot items from the microwave.
Ŷ 'RQRWPRXQWWKLVDSSOLDQFHRYHUDVLQN
READ AND SAVE THESE INSTRUCTIONS
49-40773-2
3
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING Continued
OPERATING
Ŷ $
VZLWKDQ\DSSOLDQFHFORVHVXSHUYLVLRQLV
necessary when used by children.
Ŷ '
RQRWRSHUDWHWKHRYHQZLWKRXWWKHWXUQWDEOHLQ
place. The turntable must be unrestricted so it can
turn.
Ŷ 0
DNHVXUHDOOFRRNZDUHXVHGLQ\RXUPLFURZDYH
oven is suitable for microwaving. Most glass
casseroles,cooking dishes, measuring cups, custard
cups, pottery or china dinnerware which does not
have metallic trim or glaze with a metallic sheen can
be used in compliance with cookware manufacturer’s
recommendations.
Ŷ '
RQRWVWRUHDQ\WKLQJGLUHFWO\RQWRSRIWKH
microwave oven surface when the microwave oven
is in operation.
Ŷ 6
RPHSURGXFWVVXFKDVZKROHHJJVDQGVHDOHG
containers—for example, closed jars—are able to
explode and should not be heated in this oven.
Ŷ '
RQRWRYHUFRRNSRWDWRHV7KH\FRXOGGHK\GUDWHDQG
catch fire, causing damage to your oven.
Ŷ '
RQRWFRYHUDQ\SDUWRIWKHRYHQZLWKPHDOIRLO7KLV
will cause overheating of the oven.
Ŷ &
RRNPHDWDQGSRXOWU\WKRURXJKO\²
PHDWWRDWOHDVWDQ,17(51$/WHPSHUDWXUHRIƒ)
and poultry to at least an INTERNAL temperature
RIƒ)&RRNLQJWRWKHVHWHPSHUDWXUHVXVXDOO\
protects against foodborne illness.
CLEANING
Ŷ .HHSWKHRYHQIUHHIURPJUHDVHEXLOGXS
Ŷ :
KHQFOHDQLQJVXUIDFHVRIGRRUDQGRYHQWKDW
comes together on closing the door, use only mild,
nonabrasive soaps, or detergents applied with a
clean sponge or soft cloth. Rinse well.
SUPER HEATED WATER
Ŷ /LTXLGVVXFKDVZDWHUFRIIHHRUWHDDUHDEOHWR
be overheated beyond the boiling point without
appearing to be boiling. Visible bubbling or boiling
when the container is removed from the microwave
oven is not always present. THIS COULD RESULT
IN VERY HOT LIQUIDS SUDDENLY BOILING
OVER WHEN THE CONTAINER IS DISTURBED
OR A SPOON OR OTHER UTENSIL IS INSERTED
INTO THE LIQUID.
Ŷ 7RUHGXFHWKHULVNRILQMXU\WRSHUVRQV
'RQRWRYHUKHDWWKHOLTXLG
6WLUWKHOLTXLGERWKEHIRUHDQGKDOIZD\WKURXJK
heating it.
- Do not use straight-sided containers with narrow
necks.
- After heating, allow the container to stand in the
microwave oven for a short time before removing
the container.
- Use extreme care when inserting a spoon or other
utensil into the container.
Ŷ 7KLVRYHQLVQRWDSSURYHGRUWHVWHGIRUPDULQHXVH
NOTICE: PACEMAKERS
Most pacemakers are shielded from interference from electronic products, including microwaves. However,
patients with pacemakers may wish to consult their physicians if they have concerns.
STATE OF CALIFORNIA PROPOSITION 65 WARNINGS
WARNING This product contains one or more chemicals known to the State of California to cause cancer,
and birth defects or other reproductive harm.
READ AND SAVE THESE INSTRUCTIONS
4
49-40773-2
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
PRECAUTIONS TO AVOID POSSIBLE EXPOSURE
TO EXCESSIVE MICROWAVE ENERGY
(a) Do Not Attempt to operate this oven with the
door open since open-door operation can result
in harmful exposure to microwave energy. It is
important not to defeat or tamper with the safety
interlocks.
(b) Do Not Place any object between the oven front
face and the door or allow soil or cleaner residue to
accumulate on sealing surfaces.
(c) Do Not Operate the oven if it is damaged.
It is particularly important that the oven door close
properly and that there is no damage to the:
(1) door (bent),
(2) hinges and latches (broken or loosened),
(3) door seals and sealing surfaces.
(d) The Oven Should Not be adjusted or repaired by
DQ\RQHH[FHSWSURSHUO\TXDOLILHGVHUYLFHSHUVRQQHO
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
GROUNDING INSTRUCTIONS
WARNING Improper use of the grounding plug can result in a risk of electric shock.
This appliance must be
grounded. In the event of
an electrical short circuit,
grounding reduces the
risk of electric shock by
Ensure proper ground
providing an escape wire
exists before use.
for the electric current.
7KLVDSSOLDQFHLVHTXLSSHGZLWKDSRZHUFRUGKDYLQJD
grounding wire with a grounding plug. The plug must
be plugged into an outlet that is properly installed and
grounded.
&RQVXOWDTXDOLILHGHOHFWULFLDQRUVHUYLFHWHFKQLFLDQLI
the GROUNDING INSTRUCTIONS are not completely
understood, or if doubt exists as to whether the
appliance is properly grounded.
If the outlet is a standard 2-prong wall outlet, it is
your personal responsibility and obligation to have it
replaced with a properly grounded 3-prong wall outlet.
Do not under any circumstances cut or remove the
third (ground) prong from the power cord.
Do not use an extension cord. If the power cord is too
VKRUWKDYHDTXDOLILHGHOHFWULFLDQRUVHUYLFHWHFKQLFLDQ
install an outlet near the appliance.
)RUEHVWRSHUDWLRQSOXJWKLVDSSOLDQFHLQWRLWVRZQ
electrical outlet to prevent flickering of lights, blowing
of fuse or tripping of circuit breaker.
THE VENT FAN
The fan will operate automatically under certain
FRQGLWLRQV VHH9HQW)DQVHFWLRQ 7DNHFDUHWR
prevent the starting and spreading of accidental
cooking fires while the vent fan is in use.
Ŷ Clean the underside of the Advantium often. Do not
allow grease to build up on the Advantium or the fan
filters.
Ŷ In the event of a grease fire on the surface units
below the Advantium, smother a flaming pan on the
surface unit by covering the pan completely with a
lid, a cookie sheet or a flat tray.
Ŷ Use care when cleaning the vent fan filters.
Corrosive cleaning agents, such as lye-based oven
cleaners, may damage the filters.
Ŷ When preparing flaming foods under the Advantium,
turn the fan on.
Ŷ Never leave surface units beneath your Advantium
unattended at high heat settings. Boilovers cause
smoking and greasy spillovers that may ignite and
spread if the Advantium vent fan is operating. To
PLQLPL]HDXWRPDWLFIDQRSHUDWLRQXVHDGHTXDWH
sized cookware and use high heat on surface units
only when necessary.
READ AND SAVE THESE INSTRUCTIONS
49-40773-2
5
USING THE MICROWAVE: )HDWXUHV
Features
Throughout this manual, features and appearance may vary from your model.
1. Door Handle
2. Door Latch
3. Window with Metal Sheild
Screen allows cooking to be viewed while keeping
microwaves confined in the oven.
4. Control Panel and Selector Dial
5. Removable Turntable
Do not operate the oven in the microwave mode
without the turntable and turntable support seated and
in place.
6
6. Removable Turntable Support
Do not operate the oven in the microwave mode
without the turntable and turntable support seated and
in place.
7. Shelves. Use with CONVECTION BAKE,
CONVECTION ROAST or COMBINATION FAST
BAKE. (Do not use when microwave cooking.)
)RUEHVWUHVXOWVXVHRQHVKHOILQWKHORZHUSRVLWLRQ
and leave at least a 1-inch gap between the cooking
GLVKDQGWKHVLGHVRIWKHRYHQ)RUWZROHYHO%DNLQJ
RU)DVW%DNLQJXVHERWKVKHOYHV
49-40773-2
<RXFDQFRRNE\0LFURZDYH&RQYHFWLRQ%DNH&RQYHFWLRQ5RDVWRU&RPELQDWLRQ)DVW%DNH.HHSKRW
cooked foods at serving temperature with the Warm feature.
POPCORN
REHEAT
BEVERAGE
AUTO
COOK
TIME
COOK
POWER
DEFROST
MICRO
EXPRESS
CONVECTION
BAKE
OS
RN T ELECT
TU
CONVECTION
ROAST
Dial Selector
Dial Selector
COMBI
FAST BAKE
CLEAR
OFF
HELP
WARM
OPTIONS
CLOCK
AM/PM
PVM1790
PR
TIMER
ESS TO E NTE
R
START
PAUSE
TURNTABLE
ON/OFF
VENT
FAN
SURFACE
LIGHT
CVM1790
1. Microwave Cooking Time and Auto Features
Press
Turn and push dial to enter
TIME COOK
Press once (Time Cook I) to microwave
any time between 15 seconds and 95
minutes.
Press twice (Time Cook II) to change
power levels automatically during cooking.
Amount of cooking time
MICRO EXPRESS cook/Add 30 sec.
Starts immediately!
DEFROST
3UHVVRQFH )DVW
Press twice (Auto)
Press three times (Time)
)RRGZHLJKWXSWRRQHSRXQG
)RRGZHLJKWXSWRVL[SRXQGV
Amount of defrosting time
BEVERAGE
Press once (6-7 oz.)
Press twice (8-9 oz.)
Press three times (10-12 oz.)
Starts immediately!
POWER Level
Power level 1-10
USING THE MICROWAVE: Controls
Controls
Sensor Features
Press
Turn and push dial to enter
Option
POPCORN
Starts immediately!
more/less time
REHEAT
Press once (plate)
Press twice (pasta)
Press three times (1/2 to 1 cup)
Press four times (1 to 2 cups)
Starts immediately!
more/less time
AUTO COOK
)RRG7\SH
more/less time
2. Convection Baking or Convection Roasting
Press
Turn and press dial to enter
CONVECTION BAKE or
CONVECTION ROAST
Oven temperature and cook time
3. Combination Fast Baking
Press
Turn and press dial to enter
COMBINATION FAST BAKE
Oven temperature and cook time
4. Warming
Press
Turn and press dial to enter
WARM
Oven temperature and warm time
49-40773-2
7
USING THE MICROWAVE: Available Cooking Options
Available Cooking Options
Microwave Cooking
Your oven uses microwave energy to cook by a set time or weight, or automatically by sensor.
Sensor microwave works by detecting the increasing humidity released during cooking. The
oven automatically adjusts the cooking time to various types and amounts of food.
Cooking Method
Heat Source
Heat Conduction
Benefits
Microwave energy
is distributed evenly
throughout the oven
for thorough, fast
cooking of food.
Microwave energy.
Heat produced
within food by
instant energy
penetration.
)DVWKLJKHIILFLHQF\
cooking. Oven and
surroundings do
not get hot.
Easy clean-up.
Do not use the shelves when
microwave cooking.
Convection Baking and Convection Roasting
During baking or roasting, a heating element is used to raise the temperature of the air inside
WKHRYHQ$Q\RYHQWHPSHUDWXUHIURPƒ)WRƒ)PD\EHSURJUDPPHG$IDQJHQWO\
circulates this heated air throughout the oven, over and around the food, producing golden
brown exteriors and rich moist interiors. This circulation of heated air is called convection.
Because the heated air is kept constantly moving, not permitting a layer of cooler air to
develop around the food, some foods cook faster than in regular oven cooking.
Cooking Method
Heat Source
Heat Conduction
Benefits
Hot air circulates
around food to
produce browned
exteriors and seal
in juices.
Circulating heated
air
(Convection).
Heat conducted
from outside of food
to inside.
Aids in browning
and seals in flavor.
Cooks some foods
faster than regular
ovens.
Always use the shelf when
EDNLQJ)RUEHVWUHVXOWVXVH
one shelf in the lower position.
)RUWZROHYHOFRRNLQJRQO\
use both shelves.
Combination Fast Baking
<RXURYHQDOVRRIIHUVWKHRSWLRQRI&RPELQDWLRQ)DVW%DNHXVLQJPLFURZDYHHQHUJ\DORQJ
with convection cooking. You cook with speed and accuracy, while browning and crisping to
perfection.
Cooking Method
Heat Source
Heat Conduction
Benefits
Microwave energy
and convection
heat combine to
cook foods up to
25% faster than
regular ovens,
while browning and
sealing in juices.
Microwave energy
and circulating
heated air.
)RRGKHDWVIURP
instant energy from
penetration and
heat conducted
from outside of
food.
Shortened
cooking time from
microwave energy,
plus browning
and crisping from
convection heat.
Always use the shelf with
)DVW%DNH)RUEHVWUHVXOWV
use one shelf in the lower
SRVLWLRQ)RUWZROHYHOFRRNLQJ
only, use both shelves.
Warming
The warming feature will keep hot, cooked foods at serving temperature. Always start with
KRWIRRG8VHFRRNZDUHDQGXWHQVLOVWKDWFDQZLWKVWDQGWHPSHUDWXUHVXSWRƒ)
8
Cooking Method
Heat Source
Heat Conduction
Benefits
Warm air circulates
around food to keep
previously cooked
food warm.
Circulating heated
air (Convection).
Warmth conducted
from outside of food
to inside.
.HHSVKRWFRRNHG
foods at serving
temperature.
Always use the shelf when
warming.
49-40773-2
Using the Dial
You can make selections on the oven by turning the dial
and pressing it to enter the selection.
Pressing the dial can also be used in place of the
START/PAUSE EXWWRQIRUTXLFNHUSURJUDPPLQJRIWKH
oven.
Time Cook
(Do not use the shelves when microwave cooking.)
Time Cook I
Time Cook II
Allows you to microwave for any time between 15
seconds and 95 minutes.
Lets you change power levels automatically during
cooking. Here’s how to do it:
Power level 10 (High) is automatically set, but you may
change it for more flexibility.
1. Press the TIME COOK button.
1. Press the TIME COOK button.
2. Turn the dial to set the cook time and press the dial
to enter.
3. Change power level if you don’t want full power.
(Press POWER. Turn the dial to select. Press the dial
to enter.)
4. Press the dial or the START/PAUSE button to start
cooking.
You may open the door during Time Cook to check
the food. Close the door and press the dial or START/
PAUSE to resume cooking.
NOTE: You may change the cook time at any time
during cooking by turning the dial. You may also change
the power level by pressing the POWER button.
Micro Express Cook
7KLVLVDTXLFNZD\WRVHWDQGVWDUWFRRNLQJ
in 30 second blocks each time the MICRO EXPRESS
button is pressed. The cook time may be changed by
turning the dial at any time during cooking.
49-40773-2
2. Turn the dial to set the first cook time and press the
dial to enter.
3. Change the power level if you don’t want full power.
(Press POWER. Turn the dial to select. Press the dial
to enter.)
4. Press the TIME COOK button again.
5. Turn the dial to set the second cook time and press
the dial to enter.
6. Change the power level if you don’t want full power.
(Press POWER. Turn the dial to select. Press the dial
to enter.)
7. Press the dial or the START/PAUSE button to start
cooking.
At the end of Time Cook I, Time Cook II counts down.
NOTE: You may change the cook time at any time
during cooking by turning the dial. You may also change
the power level by pressing the POWER button.
USING THE MICROWAVE: 7LPHDQG$XWR)HDWXUHV
Time and Auto Features
The power level will automatically be set at 10 and the
oven will start immediately.
The power level can be changed as time is counting
down. Press the POWER button, turn the dial and press
to enter.
9
USING THE MICROWAVE: 7LPHDQG$XWR)HDWXUHV
Time and Auto Features
Fast Defrost
(Cont.)
(Do not use the shelves when microwave cooking.)
Fast Defrost automatically sets the defrosting times and
power levels to give even defrosting results for meats,
poultry and fish weighing up to one pound.
Ŷ 5
HPRYHPHDWIURPSDFNDJHDQGSODFHRQ
microwave-safe dish.
1. Press the DEFROST button once.
Conversion Guide
If the weight of food is stated in pounds and ounces, the
ounces must be converted to tenths (.1) of a pound.
Weight of Food
in Ounces
Enter Food Weight
(tenths of a pound)
1–2
.1
3
.2
4–5
.3
6–7
.4
2. Turn the dial to the food weight, using the Conversion
*XLGHDWULJKW)RUH[DPSOHGLDOIRUSRXQGV oz.) Press the dial to enter.
3. Press the START/PAUSE button to start defrosting.
4. Turn the food over if the oven signals TURN FOOD
OVER.
8
.5
9–10
.6
Ŷ 5
HPRYHGHIURVWHGPHDWRUVKLHOGZDUPDUHDVZLWK
small pieces of foil.
11
.7
12–13
.8
14–15
.9
Ŷ $
IWHUGHIURVWLQJPRVWPHDWVQHHGWRVWDQGPLQXWHV
to complete defrosting.
Auto Defrost
(Do not use the shelves when microwave cooking.)
Use Auto Defrost for meat, poultry and fish weighing
up to six pounds. Use Time Defrost for most other
frozen foods.
Auto Defrost automatically sets the defrosting times
and power levels to give even defrosting results for
meats, poultry and fish.
Conversion Guide
If the weight of food is stated in pounds and ounces, the
ounces must be converted to tenths (.1) of a pound.
Weight of Food
in Ounces
Enter Food Weight
(tenths of a pound)
Ŷ 5
HPRYHPHDWIURPSDFNDJHDQGSODFHRQ
microwave-safe dish.
1–2
.1
3
.2
3
UHVVWKH'()5267EXWWRQWZLFH
4–5
.3
2. Turn the dial to the food weight, using the Conversion
*XLGHDWULJKW)RUH[DPSOHGLDOIRUSRXQGV oz.) Press the dial to enter.
6–7
.4
8
.5
9–10
.6
3. Press the START/PAUSE button to start defrosting.
11
.7
4. Turn the food over if the oven signals TURN FOOD
OVER.
12–13
.8
14–15
.9
Ŷ 5
HPRYHGHIURVWHGPHDWRUVKLHOGZDUPDUHDVZLWK
small pieces of foil.
Ŷ $
IWHUGHIURVWLQJPRVWPHDWVQHHGWRVWDQGPLQXWHV
to complete defrosting. Large roasts should stand for
about 30 minutes.
10
49-40773-2
Time Defrost
(Cont.)
(Do not use the shelves when microwave cooking.)
Use Time Defrost to defrost for a selected length of
time.
Defrosting Tips
1. Press the DEFROST button three times.
2. Turn the dial to select the time you want. Press the dial
to enter.
Ŷ )RRGVIUR]HQLQSDSHURUSODVWLFFDQEHGHIURVWHGLQ
the package. Closed packages should be slit, pierced
RUYHQWHG$)7(5IRRGKDVSDUWLDOO\GHIURVWHG3ODVWLF
storage containers should be partially uncovered.
3. Press the START/PAUSE button to start defrosting.
4. Turn the food over if the oven signals TURN FOOD
OVER.
You may change the defrost time at any time during
defrosting by turning the dial.
Power level is automatically set at 3, but can be changed.
<RXFDQGHIURVWVPDOOLWHPVTXLFNO\E\UDLVLQJWKHSRZHU
level after entering the time. Power level 7 cuts the total
defrosting time in about half; power level 10 cuts the total
time to approximately 1/3. However, food will need more
IUHTXHQWDWWHQWLRQWKDQXVXDO
A dull thumping noise may be heard during defrosting. This
is normal when oven is not operating at High power.
Beverage
Ŷ )RRGVWKDWVSRLOHDVLO\VKRXOGQRWEHDOORZHGWRVLW
out for more than one hour after defrosting. Room
temperature promotes the growth of harmful bacteria.
Ŷ )RUPRUHHYHQGHIURVWLQJRIODUJHUIRRGVVXFKDV
roasts, use Auto Defrost. Be sure large meats are
completely defrosted before cooking.
Ŷ :KHQGHIURVWHGIRRGVKRXOGEHFRROEXWVRIWHQHGLQ
all areas. If still slightly icy, return to the microwave
very briefly, or let it stand a few minutes.
(Do not use the shelves when microwave cooking.)
The BEVERAGE feature heats beverages from 6 to 12
ounces.
Press once for 6–7 oz.
Press twice for 8–9 oz.
Press three times for 10–12 oz.
49-40773-2
Ŷ )DPLO\VL]HSUHSDFNDJHGIUR]HQGLQQHUVFDQEH
defrosted and microwaved. If the food is in a foil
container, transfer it to a microwave-safe dish.
Drinks heated with the Beverage feature may be very
hot. Remove the container with care.
USING THE MICROWAVE: 7LPHDQG$XWR)HDWXUHV
Time and Auto Features
11
USING THE MICROWAVE: Power Level
Power Level
Power Level
The power level may be entered or changed immediately
after entering the time for Time Cook, Time Defrost or
Express Cook. The power level may also be changed
during time countdown.
1. )LUVWIROORZGLUHFWLRQVIRU Time Cook, Time Defrost
or Express Cook.
2. Press the POWER button.
3. Turn the dial clockwise to increase and
counterclockwise to decrease the power level. Press
the dial to enter.
4. Press the START/PAUSE button to start cooking.
Variable power levels add flexibility to microwave
cooking. The power levels on the microwave oven can
be compared to the surface units on a range. Each
power level gives you microwave energy a certain
percent of the time. Power level 7 is microwave energy
70% of the time. Power level 3 is energy 30% of the
time. Most cooking will be done on High (power level
10) which gives you 100% power. Power level 10 will
FRRNIDVWHUEXWIRRGPD\QHHGPRUHIUHTXHQWVWLUULQJ
rotating or turning over.
A lower setting will cook more evenly and need less
stirring or rotating of the food. Some foods may have
better flavor, texture or appearance if one of the lower
settings is used. Use a lower power level when cooking
foods that have a tendency to boil over, such as
scalloped potatoes.
Rest periods (when the microwave energy cycles off)
JLYHWLPHIRUWKHIRRGWR³HTXDOL]H´RUWUDQVIHUKHDWWR
the inside of the food. An example of this is shown with
power level 3—the defrost cycle. If microwave energy
did not cycle off, the outside of the food would cook
before the inside was defrosted.
Here are some examples of uses for various power
levels:
High 10:)LVKEDFRQYHJHWDEOHVKHDWLQJOLTXLGV
Med-High 7: Gentle cooking of meat and poultry;
baking casseroles and reheating.
Medium 5: Slow cooking and tenderizing for stews and
less tender cuts of meat.
Low 2 or 3: Defrosting; simmering; delicate sauces.
Warm 1:.HHSLQJIRRGZDUPVRIWHQLQJEXWWHU
Microwave terms
Term
Definition
Arcing
Arcing is the microwave term for sparks in the oven. Arcing is caused by:
Ŷ the metal shelf being installed incorrectly and touching the microwave walls.
Ŷ metal or foil touching the side of the oven.
Ŷ foil that is not molded to food (upturned edges act like antennas).
Ŷ metal such as twist-ties, poultry pins, gold-rimmed dishes.
Ŷ recycled paper towels containing small metal pieces.
Ŷ the turntable ring support being installed incorrectly.
Covering
Covers hold in moisture, allow for more even heating and reduce cooking time. Venting plastic wrap or
covering with wax paper allows excess steam to escape.
Shielding
In a regular oven, you shield chicken breasts or baked foods to prevent over-browning. When microwaving,
you use small strips of foil to shield thin parts, such as the tips of wings and legs on poultry, which would
cook before larger parts.
Standing Time When you cook with regular ovens, foods such as roasts or cakes are allowed to stand to finish cooking or
to set. Standing time is especially important in microwave cooking. Note that a microwaved cake is not
placed on a cooling rack.
Venting
12
After covering a dish with plastic wrap, you vent the plastic wrap by turning back one corner so excess
steam can escape.
49-40773-2
Humidity Sensor
:KDWKDSSHQVZKHQXVLQJWKH6HQVRU)HDWXUHV
7KH6HQVRU)HDWXUHVGHWHFWWKHLQFUHDVLQJKXPLGLW\
released during cooking. The oven automatically adjusts
the cooking time to various types and amounts of food.
'RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQVXFFHVVLRQ
on the same food portion—it may result in severely
overcooked or burnt food. If food is undercooked after
the countdown, use Time Cook for additional cooking
time.
NOTE: Sensor features will not operate when the oven
is hot. If one of the sensor cooking buttons is pressed
when the temperature inside the oven is greater than
ƒ)³29(1722+27)256(1625&22.,1*
USING ALTERNATE METHOD” will be displayed. The
oven will automatically change to cook by time (follow
the directions in the display) or once the oven is cool
enough, the sensor features will function normally.
The proper containers and covers are essential for best
sensor cooking.
49-40773-2
Ŷ$OZD\VXVHPLFURZDYHVDIHFRQWDLQHUVDQGFRYHUWKHP
with lids or vented plastic wrap. Never use tight sealing
plastic containers—they can prevent steam from
escaping and cause food to overcook.
Ŷ%HVXUHWKHRXWVLGHRIWKHFRRNLQJFRQWDLQHUVDQG
the inside of the oven are dry before placing food in
the oven. Beads of moisture turning into steam can
mislead the sensor.
Ŷ%HYHUDJHVDUHEHVWKHDWHGXQFRYHUHG
Covered
Vented
Dry off dishes so they
don’t mislead the sensor.
USING THE MICROWAVE: 6HQVRU)HDWXUHV
Sensor Features
13
USING THE MICROWAVE: 6HQVRU)HDWXUHV
Sensor Features
(Cont.)
Auto Cook
(Do not use the shelves when microwave cooking.)
NOTE: If the door was open while the control was being
set, close the door and press the START/PAUSE button
to begin cooking.
NOTE: Do not use this feature twice in succession
on the same food portion—it may result in severely
overcooked or burnt food.
If food is undercooked after the countdown, use Time
Cook for additional cooking time.
Because most cooking containers must be covered
during Auto Cook, this feature is best with foods that
you want to steam or retain moisture.
Do not open the oven door before the countdown time
is displayed—steam escaping from the oven can affect
cooking performance. If the door is opened, close the
door and press START/PAUSE immediately.
NOTE: Use of the metal shelf with Auto Cook is not
recommended.
If ground meat was selected, the oven may signal you to
drain and stir the meat. Open the door, drain the meat
and close the door. Press the START/PAUSE button if
necessary to resume cooking.
Recommended Foods
A wide variety of foods
including meats, fish and
vegetables can be cooked
using this feature.
Cooking Tips
Ŷ :
KHQRYHQVLJQDOVDQGFRXQWGRZQWLPHLVGLVSOD\HG
the door may be opened for stirring, turning or
rotating food. To resume cooking, close the door and
press START/PAUSE.
Foods not recommended
)RRGVWKDWPXVWEHFRRNHG
XQFRYHUHGIRRGVWKDWUHTXLUH
constant attention, foods that
UHTXLUHDGGLWLRQRILQJUHGLHQWV
during cooking and foods
calling for a dry look or crisp
surface after cooking should
not be cooked using this
feature. It is best to Time
Cook them.
Ŷ 0
DWFKWKHDPRXQWRIIRRGWRWKHVL]HRIFRQWDLQHU)LOO
containers at least 1/2 full.
Ŷ %
HVXUHRXWVLGHRIFRQWDLQHUDQGLQVLGHRIRYHQDUH
dry.
Ŷ $
IWHUFRPSOHWLRQRI&RRNF\FOHLIIRRGQHHGV
additional cooking, return food to oven and use Time
Cook to finish cooking.
1. Place covered food in the oven and close the door.
Press the AUTO COOK button. ENTER FOOD TYPE
appears in the display.
How to Adjust the Oven’s Automatic Settings for a
Shorter or Longer Cook Time (Not available for all
food types)
2. Turn the dial to the desired food type. Press to enter.
To subtract 10% from the automatic cooking time:
Within the first 30 seconds after the oven starts, turn the
dial counterclockwise, until
a minus (“–”) sign appears, and press to enter.
6HHWKH6HQVRU)RRG7\SH*XLGHEHORZIRUVSHFLILF
foods and instructions.
The oven starts immediately.
To add 10% to the automatic cooking time:
Within the first 30 seconds after the oven starts, turn the
dial clockwise, until a plus (“+”) sign appears, and press
to enter.look or crisp surface after cooking should not be
cooked using this feature. It is best to Time Cook them.
Sensor Food Type Guide
Food Type
14
Servings
Serving Size Comments
Chicken Pieces
1 to 4
2 to 8 pieces
8VHREORQJVTXDUHRUURXQGGLVK&RYHUZLWKYHQWHGSODVWLFZUDS
Fish
1 to 4
4 to 16 oz.
8VHREORQJVTXDUHRUURXQGGLVK&RYHUZLWKYHQWHGSODVWLFZUDS
Ground Meat
(Beef, Pork, Turkey)
-
8 to 32 oz.
Use round casserole dish. Crumble meat into dish. Cover with vented plastic
wrap.
Potatoes
1 to 4
8 to 32 oz.
Piece skin wiht fork. Arrange in a star pattern in center of turntable.
Canned Vegetables
1 to 4
4 to 16 oz.
Use microwave-safe casserole or bowl. Cover with a lid or vented plastic wrap.
Fresh Vegetables
1 to 4
4 to 16 oz.
Use microwave-safe casserole or bowl. Add 2 tablespoons of water for each
serving. Cover with lid or vented plastic wrap.
Frozen Vegetables
1 to 4
4 to 16 oz.
8VHPLFURZDYHVDIHFDVVHUROHRUERZO)ROORZSDFNDJHLQVWUXFWLRQVIRUDGGLQJ
water. Cover with lid or vented plastic wrap.
49-40773-2
(Cont.)
Popcorn
(Do not use the shelves when microwave cooking.)
To use the Popcorn feature:
How to Adjust the Automatic Popcorn Setting to
Provide a Shorter or Longer Cook Time
Use only with prepackaged microwave popcorn weighing
If you find that the brand of popcorn you use underpops
1.5 to 3.5 ounces.
or overpops consistently, you can add or subtract 20–30
NOTE: Do not use this feature twice in succession
seconds to the automatic popping time.
on the same food portion—it may result in severely
To subtract time:
overcooked or burnt food.
Within the first 30 seconds after the oven starts, turn the
)ROORZSDFNDJHLQVWUXFWLRQVXVLQJ7LPH&RRNLIWKH
dial counterclockwise, until a minus (“–”) sign appears,
package is less than 1.5 ounces or larger than 3.5
for 20 seconds less cooking time. Press to enter. Turn
ounces. Place the package of popcorn in the center
again, until two minus (“– –”) signs appear, to reduce
of the turntable.
cooking time another 10 seconds for a total of 30
seconds less time. Press to enter.
2. Press the POPCORN button. The oven starts
immediately.
To add time:
Within the first 30 seconds after the oven starts, turn
If you open the door while POPCORN SENSOR is
displayed, an error message will appear. Close the door, the dial clockwise, until a plus (“+”) sign appears, for
an extra 20 seconds cooking time. Press to enter. Turn
press CLEAR/OFF and begin again.
again, until two plus (“++”) signs appear, to add another
If food is undercooked after the countdown, use Time
10 seconds for a total of 30 seconds additional time.
Cook for additional cooking time.
Press to enter.
Reheat
(Do not use the shelves when microwave cooking.)
The Reheat feature reheats servings of previously
Some Foods Not Recommended for Use With Reheat
It is best to use Time Cook for these foods:
cooked foods or a plate of leftovers.
Ŷ %UHDGSURGXFWV
NOTE: Do not use this feature twice in succession
Ŷ )oods that must be reheated uncovered.
on the same food portion—it may result in severely
Ŷ )oods that need to be stirred or rotated.
overcooked or burnt food.
Ŷ )oods calling for a dry look or crisp surface after
reheating.
3
ODFHWKHFXSRIOLTXLGRUFRYHUHGIRRGLQWKHRYHQ
Press REHEAT once, twice, three times or four times. How to Adjust the Oven’s Automatic Settings for a
The oven starts immediately.
Shorter or Longer Time
Press once for a plate of leftovers.
To subtract 10% from the automatic cooking time:
Within the first 30 seconds after the oven starts, turn the
Press twice for a pasta.
dial counterclockwise, until a minus (“–”) sign appears,
Press three times for 1/2 to 1 full cup.
and press to enter.
Press four times for 1 to 2 full cups.
To add 10% to the automatic cooking time:
2. The oven signals when steam is sensed and the time Within the first 30 seconds after the oven starts, turn the
remaining begins counting down.
dial clockwise, until a plus (“+”) sign appears, and press
Do not open the oven door until time is counting down.
to enter.
If the door is opened, close it and press START/PAUSE
immediately.
After removing food from the oven, stir, if possible, to
even out the temperature. Reheated foods may have
wide variations in temperature. Some areas of food may
be extremely hot.
If food is not hot enough after the countdown use Time
Cook for additional reheating time.
49-40773-2
USING THE MICROWAVE: 6HQVRU)HDWXUHV
Sensor Features
15
USING THE MICROWAVE: %DNLQJDQG5RDVWLQJ)HDWXUHV
Baking and Roasting Features
Baking or roasting uses a heating element to raise the temperature of the air inside the oven.
$Q\RYHQWHPSHUDWXUHIURPƒ)WRƒ)PD\EHVHW$IDQJHQWO\FLUFXODWHVWKLVKHDWHG
air throughout the oven, over and around the food, producing golden brown exteriors and
rich, moist interiors. This circulation of heated air is called convection.
Because the heated air is kept constantly moving, not permitting a layer of cooler air to
develop around the food, some foods cook faster than in regular oven cooking.
Correct shelf position
For Best Results…
Use one shelf in the lower position and leave at least a 1-inch gap between the cooking dish
DQGWKHVLGHVRIWKHRYHQ)RUWZROHYHOFRRNLQJRQO\XVHERWKVKHOYHV
7KHVKHOILVUHTXLUHGIRUJRRGDLUFLUFXODWLRQDQGHYHQEURZQLQJ
See the Cookware Tips section for information on suggested cookware.
Incorrect shelf position
Bake or Roast with Preheat
1. Press the BAKE or ROAST button.
2. Turn the dial to set the oven temperature and press
dial to enter. Do not enter bake time now. (The
cook time will be entered later, after the oven is
preheated.) See the Auto Recipe™ Conversion
section below.
3. Press the dial or the START/PAUSE button to start
preheating.
6. Close the oven door. Turn the dial to set the cook
time and press the dial or START/PAUSE to start
cooking.
7. When cooking is complete, the oven will signal and
turn off.
NOTE: You may change the cook time at any time
during cooking by turning the dial.
4. When the oven is preheated, it will signal. If you do
not open the door within 1 hour, the oven will turn off
automatically.
You may change the oven temperature at any time
during cooking by pressing the POWER button. Turn the
dial to set the oven temperature and press the dial to
enter.
5. Open the oven door and, using caution, place the
food in the oven.
To view the cook time and oven temperature during
cooking, press the BAKE button.
Bake or Roast without Preheat
1. ,I\RXUUHFLSHGRHVQRWUHTXLUHSUHKHDWLQJSUHVVWKH
BAKE or ROAST button. See the Auto Recipe™
Conversion section below.
2. Turn the dial to set the oven temperature and press
to enter.
3. Turn the dial to set the cook time and press to enter.
4. Press the dial or the START/PAUSE button to start
the oven.
NOTE: You may change the cook time at any time
during cooking by turning the dial.
You may change the oven temperature at any time
during cooking by pressing the POWER button. Turn the
dial to set the oven temperature and press the dial to
enter.
To view the cook time and oven temperature during
FRRNLQJSUHVVWKH%$.(EXWWRQ
Auto Recipe™ Conversion
When using CONVECTION BAKE, the Auto Recipe™
Conversion feature will automatically convert entered
regular baking temperatures to convection baking
temperatures.
This feature is activated so that the display will show
2))6(721DQGWKHDFWXDOFRQYHUWHG UHGXFHG WHPSHUDWXUH)RUH[DPSOHLI\RXHQWHUDUHJXODUUHFLSH
WHPSHUDWXUHRIƒ)DQGSUHVVWKHSTART button, the
GLVSOD\ZLOOVKRZWKHFRQYHUWHGWHPSHUDWXUHRIƒ)
16
This feature can be turned off in the OPTIONS menu.
See the Auto Recipe™ Conversion Selection in the
About the other features section.
NOTE: If convection baking and the Auto Recipe™
Conversion feature is turned off, reduce the
RYHQWHPSHUDWXUHƒ)IURPWKHUHFLSHWRSUHYHQW
overbrowning on the top of baked goods.
49-40773-2
Fast BakeRႇHUVWKHEHVWIHDWXUHVRIPLFURZDYHHQHUJ\DQGFRQYHFWLRQFRRNLQJ0LFURZDYHV
cook food fast and convection circulation of heated air browns foods beautifully. Any oven
WHPSHUDWXUHIURPƒ)WRƒ)PD\EHVHW
For Best Results…
Use one shelf in the lower position and leave at least a 1-inch gap between the cooking dish
DQGWKHVLGHVRIWKHRYHQ)RUWZROHYHOFRRNLQJRQO\XVHERWKVKHOYHV
Correct shelf position
7KHVKHOILVUHTXLUHGIRUJRRGDLUFLUFXODWLRQDQGHYHQEURZQLQJ
See the Cookware Tips section for information on suggested cookware.
See the Best Method of Cooking section to determine the which foods are appropriate to cook
using Fast Bake.
Incorrect shelf position
Fast Bake with Preheat
1. Press the Fast Bake button.
2. Turn the dial to set the oven temperature and press
dial to enter. Do not enter Fast Bake cook time now.
(The cook time will be entered later, after the oven is
preheated.)
3. Press the dial or the START/PAUSE button to start
preheating.
4. When the oven is preheated, it will signal. If you do
not open the door within 1 hour, the oven will turn off
automatically.
5. Open the oven door and, using caution, place the
food in the oven.
6. Close the oven door. Turn the dial to set the cook
time and press the dial or START/PAUSE to start
cooking.
7. When cooking is complete, the oven will signal and
turn off.
NOTE: You may change the cook time at any time
during cooking by turning the dial.
You may change the oven temperature and microwave
power level at any time during cooking by pressing
the POWER button. Turn the dial to set the oven
temperature and press the dial to enter. Then, turn the
dial to set microwave power level 1 through 4 and press
the dial to enter. The default power level is 4.
To view the cook time and oven tempera-ture during
FRRNLQJSUHVVWKH)$67%$.(EXWWRQ
ŶCheck the Cookware Tips section for correct cookware
ZKHQXVLQJ)DVW%DNH
Ŷ'RQRWXVHPHWDOFRRNZDUHZLWK
)DVW%DNH
ŶReduce the recipe cook time by 25%.
USING THE MICROWAVE: )DVW%DNH)HDWXUHV
Fast Bake Features
ŶSee the Best Method of Cooking section
to determine the which foods are appropriate to cook
XVLQJ)DVW%DNH
Fast Bake without Preheat
1. ,I\RXUUHFLSHGRHVQRWUHTXLUHSUHKHDWLQJSUHVVWKH
Fast Bake button.
To view the cook time and oven temperature during
FRRNLQJSUHVVWKH)$67%$.(EXWWRQ
2. Turn the dial to set the oven temperature and press
to enter.
NOTE:
3. Turn the dial to set the cook time and press to enter.
ŶCheck the Cookware Tips section for correct cookware
ZKHQXVLQJ)DVW%DNH
4. Press the dial or the START/PAUSE button to start
the oven.
NOTE: You may change the cook time at any time
during cooking by turning the dial.
You may change the oven temperature and microwave
power level at any time during cooking by pressing
the POWER button. Turn the dial to set the oven
temperature and press the dial to enter. Then, turn the
dial to set microwave power level 1 through 4 and press
the dial to enter. The default power level is 4.
49-40773-2
ŶSome recipes call for preheating.
ŶDo not use metal cookware with
)DVW%DNH
ŶSee the Best Method of Cooking section
to determine the which foods are appropriate to cook
XVLQJ)DVW%DNH
ŶReduce the recipe cook time by 25%.
17
USING THE MICROWAVE: Cookware Tips
Cookware Tips
Convection Bake or Roast
Metal Pans are recommended for all types of baked products, but especially where browning is important.
Dark or dull finish metal pans are best for breads and pies because they absorb heat and produce crisper crust.
Shiny aluminum pans are better for cakes, cookies or muffins because they reflect heat and help produce a light
tender crust.
Glass or Glass-Ceramic casserole or baking dishes are best suited for egg and cheese recipes due to the
cleanability of glass.
Combination Fast Bake
Glass or Glass-Ceramic baking containers are recommended. Be sure not to use items with metal trim as it may
cause arcing (sparking) with oven wall or oven shelf. This can damage the cookware, the shelf or the oven.
Heat-Resistant PlasticPLFURZDYHFRRNZDUH VDIHWRƒ) PD\EHXVHGEXWLWLVQRWUHFRPPHQGHGIRUIRRGV
UHTXLULQJDOODURXQGEURZQLQJEHFDXVHWKHSODVWLFLVDSRRUFRQGXFWRURIKHDW
Microwave
Convection Bake
or Roast
Combination
Fast Bake
Heat-Resistant Glass, Glass-Ceramic
(Pyrex ®, Fire King ®, Corning Ware ®, etc.)
Yes
Yes
Yes
Metal
No
Yes
No
Non Heat-Resistant Glass
No
No
No
Microwave-Safe Plastics
Yes
No
Yes*
Plastic Films and Wraps
Yes
No
No
Paper Products
Yes
No
No
Straw, Wicker and Wood
Yes
No
No
Cookware
* Use only microwave cookware that is safe to 450°F.
18
49-40773-2
Use the following guide to select the best method of cooking. Recipes can be adapted using the guidelines below to
determine the appropriate cooking mode.
Foods
Appetizers
Dips and Spreads
Pastry Snacks
Beverages
Sauces and Toppings
Soups and Stews
Meats
Defrosting
Roasting
Poultry
Defrosting
Roasting
Fish and Seafood
Defrosting
Cooking
Casseroles
Eggs and Cheese
Scrambled, Omelets
Quiche, Souffle
Vegetables, (fresh)
Breads
Muffins, Coffee Cake
Quick
Yeast
Desserts
Cakes, Layer and Bundt
$QJHO)RRGDQG&KLIIRQ
Custard and Pudding
Bar Cookies
)UXLW
Pies and Pastry
Candy
Blanching Vegetables
Frozen Convenience Foods
Microwave
9
9
9
9
9
Bake
Roast
9
9
9
9
Fast Bake
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
USING THE MICROWAVE: Best Method of Cooking
Best Method of Cooking
9
Recipe Conversions
Combination Fast Bake
When using Combination Fast Bake, reduce recipe cook time by 25%.
)RUH[DPSOH$UHFLSHVWDWHVWRFRRNDURDVWIRUPLQXWHVDWƒ)
60 minutes x 0.25 = 15 minutes saved.
So the new cook time in Fast Bake mode will be 60 minutes - 15 minutes = 45 minutes.
49-40773-2
19
USING THE MICROWAVE: :DUPLQJ)HDWXUHV
Warming Features
The WARM feature will keep hot, cooked foods at serving temperature. Always start with hot
IRRG8VHFRRNZDUHDQGXWHQVLOVWKDWFDQZLWKVWDQGWHPSHUDWXUHVXSWRƒ)
For Best Results…
$OZD\VXVHWKHVKHOILQLWV³ORZ´SRVLWLRQZKHQZDUPLQJ7KHVKHOILVUHTXLUHGIRUJRRGDLU
circulation and even warming.
Correct shelf position
See the Cookware Tips section for information on suggested cookware.
Incorrect shelf position
Warming
1. Press the Warming button.
2. Turn the dial to select the oven temperature. See the
chart and tips below. Press the dial to enter.
/2:
0(',80
+,*+
ƒ)
ƒ)
ƒ)
If the oven door is opened during warming, PAUSE will
appear in the display. Close the door and press START/
PAUSE.
To Crisp Stale Items:
ŶPlace food or dishes directly on the shelf in the low
position.
3. Press the dial or the START/PAUSE button to start
preheating.
Ŷ8VH/2:VHWWLQJ
ŶCheck crispness after 45 minutes. Add time as
needed.
Temperature Selection Chart
Food Type
Control Setting
Moist/Crisp
Bread, Hard Rolls
Medium
Crisp
Bread, Soft Rolls
Medium
Moist
Casseroles
Medium
Moist
Fried Foods
High
Crisp
Medium
Crisp
Pancakes, Waffles
High
Crisp
Pizza
High
Crisp
Potatoes, Baked
High
Crisp
Medium
Moist
Poultry
High
Moist
Tortilla Chips
Low
Crisp
Medium
Moist
Meats* and Fish
Potatoes, Mashed
Vegetables
* USDA/FSIS recommends an internal temperature of 145°F as the minimum doneness for beef.
Use a portable meat thermometer to check internal temperatures.
20
Tips for Crisp Foods:
Tips for Moist Foods:
Ŷ /HDYHIRRGXQFRYHUHG
Ŷ &RYHUIRRGZLWKOLGRUDOXPLQXPIRLO
Ŷ 'RQRWXVHSODVWLFFRQWDLQHUVRU
plastic wrap.
Ŷ 'RQRWXVHSODVWLFFRQWDLQHUVRUSODVWLF
wrap.
49-40773-2
Help
The HELP button displays feature information and
helpful hints.
Press HELP, then turn the dial to select a feature and
press the dial to enter.
Cooking Complete Reminder
To remind you that you have food in the oven, the oven
ZLOOGLVSOD\<285)22',65($'<DQGEHHSRQFHD
minute until you either open the oven door or press the
CLEAR/OFF button.
Resume
The cooking program just used stays in memory for 5
minutes. After that you will need to begin the program
again. To turn this option off, see the More Time
Message section.
1. If your food needs to cook a bit longer, you can
restart the oven by pressing the START/PAUSE
button or selector dial.
2. RESUME COOKING will be displayed and the oven
will restart immediately at 10% of the original time.
Clock
Press to enter the time of day or to check the time of day
while cooking.
1. Press the CLOCK button.
2. Turn the dial to set hours. Press the dial to enter.
3. Turn the dial to set minutes. Press the dial to enter.
4. Turn the dial to select AM or PM. Press the dial to
enter.
The clock is designed to turn off when unit is idle for
30 seconds to minimize the standby power usage. The
clock will turn on when unit is in use or door is opened.
There is not an override option available based on the
'2(HQHUJ\UHTXLUHPHQWV
USING THE MICROWAVE: 2WKHU)HDWXUHV
Other Features
Start/Pause
In addition to starting many functions, START/PAUSE
allows you to stop cooking without opening the door or
clearing the display.
Clear/Off
Press the CLEAR/OFF button to stop and cancel
cooking at any time.
Control Lock-Out
You may lock the control panel to prevent the oven from
being accidentally started during cleaning or being used
by children.
49-40773-2
To lock or unlock the controls, press and hold the CLEAR/
OFF button for about three seconds. When the control panel
LVORFNHG&21752//2&.('ZLOOEHGLVSOD\HGEULHIO\
anytime a button or dial is pressed. (The control lock-out
GRHVQRWDSSO\WRWKH9(17)$1DQG685)$&(/,*+7
21
USING THE MICROWAVE: 2WKHU)HDWXUHV
Other Features
Auto Nite Light
The Auto Nite Light can be set to come on and go off at
desired times.
1. Press the OPTIONS button and turn the dial to select
AUTO NITE LIGHT. Press the dial to enter.
2. Turn the dial to select SET TIMES. Press the dial to
enter.
3. Enter the time of day for the light to come on by
turning the dial to select the hour, minutes and AM or
PM. Press the dial to enter after each selection.
4. Enter the time of day for the light to
go off by turning the dial to select the hour, minutes
and AM or PM. Press the dial to enter after each
selection.
NOTE: The NITE indicator will be lit whenever the nite
light is set to operate.
To review the nite light settings, turn the dial to select
REVIEW SETTINGS after selecting the Auto Nite Light
option. Press the dial to enter.
To clear the nite light settings, turn the dial to select
CLEAR SETTINGS after selecting the Auto Nite Light
option. Press the dial to enter.
Bake Temp. Adjust
Use to set the oven to automatically adjust set
temperatures by 5, 10, 15, 20 or 25 degrees.
1. Press the OPTIONS button and turn the dial to select
BAKE TEMP ADJUST. Press the dial to enter.
2. Turn the dial to select NO CHANGE, 5, 10, 15, 20 or
25 degrees and press to enter.
Beeper Volume
The beeper sound level can be adjusted.
1. Press the OPTIONS button and turn the dial to select
BEEPER VOLUME. Press the dial to enter.
2. Turn the dial to select mute to loud. Press the dial to
enter.
NOTE: The MUTE indicator will be lit whenever the
beeper volume is set to mute.
Auto Recipe™ Conversion Selection
When ON the oven will automatically convert entered
regular baking temperatures to convection baking
temperatures. See Auto Recipe™ Conversion in the
About the baking and roasting features section.
1. Press the OPTIONS button and turn the dial to select
OFFSET. Press the dial to enter.
2. Turn the dial to select CONVECTION BAKE TEMP
OFFSET-ON/OFF and press to enter.
Display Language
The language for the scrolling display can be set to
either English or Spanish.
1. Press the OPTIONS button and turn the dial to select
DISPLAY LANGUAGE. Press the dial to enter.
2. Turn the dial to select ENGLISH or SPANISH. Press
the dial to enter.
Display Speed
The scroll speed of the display can be changed.
1. Press the OPTIONS button and turn the dial to select
DISPLAY SPEED. Press the dial to enter.
2. Turn the dial to select slowest to fastest. Press the
dial to enter.
22
49-40773-2
(Cont.)
Measures
Measurements can be set to display in Default (English)
or metric.
1. Press the OPTIONS button and turn the dial to select
MEASURES. Press the dial to enter.
2. Turn the dial to select DEFAULT or METRIC and
press to enter.
More Time Message
After cooking is complete, a message can be displayed
giving you the option to cook the food longer at the same
settings. See the Resume section.
1. Press the OPTIONS button and turn the dial to select
MORE TIME MESSAGE. Press the dial to enter.
2. Turn the dial to select MESSAGE ON or OFF and
press to enter.
Surface Light
Press SURFACE LIGHT once for bright light, twice for
the night light or a third time to turn the light off.
Timer
The Timer operates as a minute timer and can be used
at any time, even when the oven is operating.
1. Press the TIMER button.
2. Turn the dial to select the minutes. Press the dial to
enter.
3. Turn the dial to select the seconds. Press the dial to
enter.
4. Press the dial or TIMER to start.
To cancel, press the TIMER button.
When time is up, the oven will signal.
To turn off the timer signal, press TIMER.
NOTE: The TIMER indicator will be lit while the timer is
operating.
USING THE MICROWAVE: 2WKHU)HDWXUHV
Other Features
Turntable On/Off
)RUEHVWFRRNLQJUHVXOWVOHDYHWKHWXUQWDEOHRQ,WFDQEH Sometimes the turntable can become too hot to touch.
Be careful touching the turntable during and after
turned off for large dishes.
cooking.
1. Press the TURNTABLE ON/OFF button.
2. Purn the dial to select ON or OFF. Press the dial to
enter.
Vent Fan
The vent fan removes steam and other vapors from
surface cooking.
Press VENT FAN once for high fan speed,
twice for medium fan speed, three times for low fan
speed or a fourth time to turn the fan off.
Automatic Fan
An automatic fan feature protects the microwave from
too much heat rising from the cooktop below it. It
automatically turns on if it senses too much heat.
49-40773-2
NOTE: 7KH)$1LQGLFDWRUZLOOEHOLWZKLOH
the fan is operating.
If you have turned the fan on you may find that you
cannot turn it off. The fan will automatically turn off when
the internal parts are cool. It may stay on for 30 minutes
or more after the cooktop and microwave controls are
turned off.
23
CARE AND CLEANING
Oven
Helpful Hints
An occasional thorough wiping with a solution of baking
soda and water keeps the inside fresh.
Be certain the oven control is turned off before
cleaning any part of this oven.
How to clean the Inside
Walls, Floor, Inside Window, Metal and Plastic Parts
on the Door
Some spatters can be removed with a paper towel;
RWKHUVPD\UHTXLUHDGDPSFORWK5HPRYHJUHDV\
spatters with a sudsy cloth, then rinse with a damp cloth.
Do not use abrasive cleaners or sharp utensils on oven
walls.
Never use a commercial oven cleaner on any part of
your microwave.
Removable Turntable and Turntable Support
To prevent breakage, do not place the turntable into
water just after cooking. Wash it carefully in warm, sudsy
water or in the dishwasher. The turntable and support
can be broken if dropped. Remember, do not operate the
oven in the microwave mode without the turntable and
support seated and in place.
Shelves
Clean with mild soap and water or in the dishwasher.
Do not clean in a self-cleaning oven.
How to clean the Outside
We recommend against using cleaners with ammonia
or alcohol, as they can damage the appearance of
the microwave oven. If you
choose to use a common
household cleaner, first apply
the cleaner directly to a clean
cloth, then wipe the soiled
area.
Case
Clean the outside of the microwave with a sudsy cloth.
Rinse and then dry. Wipe the window clean with a damp
cloth.
Control Panel
Wipe with a damp cloth. Dry thoroughly. Do not use
cleaning sprays, large amounts of soap and water,
abrasives or sharp objects on the panel—they can
damage it. Some paper towels can also scratch the
control panel.
Door Panel
Before cleaning the front door panel, make sure you
know what type of panel you have. Refer to the eighth
digit of the model number. “S” is stainless steel, “L” is
CleanSteel and “B”, “W” or “C” are plastic colors.
24
Stainless Steel (on some models)
The stainless steel panel can be cleaned with Stainless
Steel Magic or a similar product using a clean, soft cloth.
Apply stainless cleaner carefully to avoid the surrounding
plastic parts. Do not use appliance wax, polish, bleach or
products containing chlorine on Stainless Steel finishes.
Plastic Color Panels
Use a clean, soft, lightly dampened cloth, then dry
thoroughly.
Door Seal
It’s important to keep the area clean where the door
seals against the microwave. Use only mild, nonabrasive detergents applied with a clean sponge or soft
cloth. Rinse well.
Bottom
Clean off the grease and dust
on the bottom often. Use a
solution of warm water and
detergent.
49-40773-2
Cooktop Light/Nite Light
Replace with a 120 volt, 40 watt (max.) halogen bulb.
Order WB08X10051 from your GE supplier.
1. To replace the cooktop light/nite light, first disconnect
the power at the main fuse or circuit breaker panel, or
pull the plug.
2. Remove the screw from the side of the light
compartment cover and lower the cover until it stops.
3. Be sure the bulb is cool before removing. Break the
adhesive seal by gently unscrewing the bulb.
4. Screw in the new bulb, then raise the light cover and
replace the screw. Connect electrical power to the
oven.
Remove screw.
CARE AND CLEANING
Replacing the Light Bulb
Exhaust Feature
Vent Fan
Charcoal filter (on some models).
The vent fan has two metal reusable vent filters.
Models that recirculate air back into the room also use
a charcoal filter.
Reusable vent filters
(on all models).
Reusable Vent Filter
The metal filters trap grease released by foods on the
cooktop. They also prevent flames from foods on the
cooktop from damaging the inside of the oven.
)RUWKLVUHDVRQWKHILOWHUVPXVWDOZD\VEHLQSODFHZKHQ
the hood is used. The vent filters should be cleaned
once a month, or as needed.
Removing and Cleaning the Filters
To remove, slide them to the rear using the tabs. Pull
down and out.
To clean the vent filters, soak them and then swish
around in hot water and detergent. Don’t use ammonia
or ammonia products because they will darken the metal.
Light brushing can be used to remove embedded dirt.
To replace, slide the filters into the frame slots on the
back of each opening. Press up and to the front to lock
into place.
Rinse, shake and let dry before replacing.
49-40773-2
25
CARE AND CLEANING
Exhaust Feature
Charcoal Filter
The charcoal filter cannot be cleaned. It must be
replaced. Order Part No. WB02X10943 from your GE
Appliances supplier.
If the model is not vented to the outside, the air will be
recirculated through a disposable charcoal filter that
helps remove smoke and odors.
The charcoal filter should be replaced when it is
noticeably dirty or discolored (usually after 6 to 12
PRQWKVGHSHQGLQJRQXVDJH 6HH³2SWLRQDO.LWV´SDJH
12, for more information.
To Remove the Charcoal Filter
To remove the charcoal filter, first disconnect power at
the main fuse or circuit breaker, or pull the plug. Remove
the top grille by removing the two screws that hold it
in place. You may need to open the cabinet doors to
remove the screws.
Lift the filter at the bottom until it comes free of the tabs.
Slide the filter down and out.
Remove 2 grille screws to
remove the grille.
To Install the Charcoal Filter
To install a new charcoal filter, remove plastic and
other outer wrapping from the new filter.
Insert the top of the filter up and into the grooves on the
inside of the top opening. Push the bottom of the filter in
until it rests in place behind the tabs.
26
49-40773-2
Save time and money! Review the charts on the following pages first and you may not need to call for service.
Problem
Possible Cause
What To Do
The display is blank
The clock is designed to turn off
when unit is idle for 30 seconds
to minimize the standby power
usage.
The clock will turn on when unit is in use or door is
opened. There is not an override option available
EDVHGRQWKH'2(HQHUJ\UHTXLUHPHQWV
Oven will not start
A fuse in your home may be
blown or the circuit breaker
tripped.
Replace fuse or reset circuit breaker.
Power surge.
Unplug the microwave oven, then plug it back in.
Plug not fully inserted into wall
outlet.
Make sure the 3-prong plug on the oven is fully
inserted into wall outlet.
Door not securely closed.
Open the door and close securely.
Door not securely closed.
Open the door and close securely.
START/PAUSE button not pressed
after entering cooking selection.
Press START/PAUSE.
Another selection entered already
in oven and CLEAR/OFF button
not pressed to cancel it.
Press CLEAR/OFF.
Cooking time not entered after
pressing TIME COOK.
Make sure you have entered cooking time after
SUHVVLQJ7,0(&22.
CLEAR/OFF was pressed
accidentally.
Reset cooking program and press START/PAUSE.
Food weight not entered after
selecting AUTO DEFROST or
FAST DEFROST
Make sure you have entered food weight after selecting
AUTO DEFROST or FAST DEFROST.
Food type not entered after
pressing AUTO COOK.
Make sure you have entered food type.
CONTROL LOCKED
appears on display
The control has been locked
Press and hold CLEAR/OFF for about 3 seconds to
unlock the control.
OVEN TOO HOT FOR
SENSOR COOKING USING ALTERNATE
METHOD appears on
display
One of the sensor cooking buttons
was pressed when the temperature
inside the oven was greater than
200° F
These features will not operate when the oven is hot.
The oven will automatically change to cook by time
(follow the directions in the display) or once the oven is
cool enough, the sensor features will function normally.
Floor of the oven is warm
even when the oven has
not been used.
The cooktop light is located below
the oven floor. When light is on,
the heat it produces may make the
oven floor get warm.
This is normal.
You hear an unusual
low-tone beep
You have tried to change the power
level when it is not allowed.
Many of the oven’s features are preset and cannot be
changed.
Oven emits a smoky odor
and gray smoke after
using the Bake feature
Oils on the stainless steel cavity
are burning off after using the
Bake feature the first few times.
This is normal.
Control panel lighted, yet
oven will not start
49-40773-2
TROUBLESHOOTING TIPS
Troubleshooting Tips... Before you call for service
27
TROUBLESHOOTING TIPS
28
Troubleshooting Tips... Before you call for service
Problem
Possible Cause
What To Do
Food browns on top much
faster than on the bottom
Rack has been placed in the
“high” position.
Always use the rack in its “low” posisiton.
Oven temperature
fluctuates during cooking
The cooking element cycles on
and off to maintain the oven
temperatures a the desired setting.
This is normal.
Vent fan comes on
automatically
The vent fan automatically turns
on to protect the microwave if it
senses too much heat rising from
the cooktop below.
This is normal.
During Bake, Roast, or Fast bake
(after preheating), the vent fan will
automatically come on to cool the
oven components.
This is normal.
When using a Sensor feature the
door was opened before steam
could be detected.
Do not open door until steam is seasoned and time is
shown counting down on the display.
Steam was not detected in a
maximum amount of time.
Use Time Cook to heat for more time.
SENSOR ERROR appears
on the display
49-40773-2
Things That Are Normal With Your Microwave Oven
Ŷ Moisture on the oven door and walls while cooking.
Wipe the moisture off with a paper towel or soft cloth.
Ŷ Moisture between the oven door panels when cooking
certain foods. Moisture should dissipate shortly after
cooking is finished.
Ŷ Steam or vapor escaping from around the door.
Ŷ Light reflection around door or outer case.
Ŷ Dimming oven light and change in the blower sound at
power levels other than high.
Ŷ Dull thumping sound while oven is operating.
Ŷ TV-radio interference might be noticed while using the
microwave. Similar to the interference caused by other
small appliances, it does not indicate a problem with
the microwave. Plug the microwave into a different
electrical circuit, move the radio or TV as far away
from the microwave as possible or check the position
and signal of the TV/radio antenna.
Ŷ The clock is designed to turn off when unit is idle for
30 seconds to minimize the standby power usage. The
clock will turn on when unit is in use or door is opened.
There is not an override option available based on the
'2(HQHUJ\UHTXLUHPHQWV
Ŷ The vent fan operating while the microwave is
operating. The vent fan will not go off nor can it be
turned off until the microwave is off.
Ŷ Warm, convection bake, convection roast and
combination fast bake have a maximum cooking time
of 179 minutes (2 hours and 59 minutes). When
the maximum cooking time is reached, the oven will
automatically indicate that cooking is complete and
turn off the cooking element.
TROUBLESHOOTING TIPS
Troubleshooting Tips... Before you call for service
FEDERAL COMMUNICATIONS COMMISSION RADIO FREQUENCY
INTERFERENCE STATEMENT (U.S.A. ONLY)
7KLVHTXLSPHQWJHQHUDWHVDQGXVHV,60IUHTXHQF\
energy and if not installed and used properly, that is in
strict accordance with the manufacturer’s instructions,
may cause interference to radio and television
reception. It has been type tested and found to comply
ZLWKOLPLWVIRU,60(TXLSPHQWSXUVXDQWWRSDUWRI
)&&5XOHVZKLFKDUHGHVLJQHGWRSDUWRI)&&
Rules, which are designed to provide residential
installation.
Ŷ5HRULHQWWKHUHFHLYLQJDQWHQQDRIWKHUDGLRRU
television.
However, there is no guarantee that interference will not
RFFXULQDSDUWLFXODULQVWDOODWLRQ,IWKLVHTXLSPHQWGRHV
cause interference to radio or television reception, which
FDQEHGHWHUPLQHGE\WXUQLQJWKHHTXLSPHQWRIIDQGRQ
the user is encouraged to try to correct the interference
by one or more of the following:
The manufacturer is not responsible for any radio of TV
interference caused by unauthorized modification to this
microwave oven. It is the responsibility of the user to
correct such interference.
49-40773-2
Ŷ5HORFDWHWKH0LFURZDYH2YHQZLWKUHVSHFWWRWKH
receiver.
Ŷ0RYHWKHPLFURZDYHRYHQDZD\IURPWKHUHFHLYHU
Ŷ3OXJWKHPLFURZDYHRYHQLQWRDGLIIHUHQWRXWOHWVRWKDW
the microwave oven and the receiver are on different
branch codes.
29
WARRANTY
GE Appliances Microwave Oven Warranty
GEAppliances.com
$OOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH® technician. To schedule
service online, visit us at www.geappliances.com/service_and_support/, or call GE Appliances at 800.GE.CARES
(800.432.2737). Please have your serial number and your model number available when calling for service.
6HUYLFLQJ\RXUDSSOLDQFHPD\UHTXLUHWKHXVHRIWKHRQERDUGGDWDSRUWIRUGLDJQRVWLFV7KLVJLYHVD*($SSOLDQFHVIDFWRU\
VHUYLFHWHFKQLFLDQWKHDELOLW\WRTXLFNO\GLDJQRVHDQ\LVVXHVZLWK\RXUDSSOLDQFHDQGKHOSV*($SSOLDQFHVLPSURYHLWV
products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be
sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service.
For the period of
GE Appliances will replace
One year
)URPWKHGDWH
of the original
purchase
Any part of the microwave oven which fails due to a defect in materials or workmanship.
During this limited one-year warranty, GE Appliances will provide, free of charge, all labor
and in-home service to replace the defective part.
Five years
)URPWKHGDWH
of the original
purchase
The magnetron tube, if the magnetron tube fails due to a defect in materials or
workmanship. During this five-year limited warranty, you will be responsible for any labor or
in-home service costs.
What GE Appliances will not cover:
Staple your receipt here. Proof of the original purchase
date is needed to obtain service under the warranty.
Ŷ 6HUYLFHWULSVWR\RXUKRPHWRWHDFK\RXKRZWRXVH
the product.
Ŷ ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
Ŷ )DLOXUHRIWKHSURGXFWRUGDPDJHWRWKHSURGXFWLILWLV
abused, misused (for example, cavity arcing from wire
rack or metal/foil), or used for other than the intended
purpose or used commercially.
Ŷ 5HSODFHPHQWRIWKHFRRNWRSOLJKWEXOEV
Ŷ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
breakers.
Ŷ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH
floods or acts of God.
Ŷ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
possible defects with this appliance.
Ŷ 'DPDJHFDXVHGDIWHUGHOLYHU\
EXCLUSION OF IMPLIED WARRANTIES
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
This warranty is extended to the original purchaser and any succeeding owner for products purchased for home use
within the USA. If the product is located in an area where service by a GE Appliances Authorized Servicer is not available,
\RXPD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG*($SSOLDQFHV
Service location for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home.
6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\JLYHV\RX
specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights
are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances, a Haier company
Extended Warranties: Purchase a GE Appliances extended warranty and learn about special discounts that are
available while your warranty is still in effect. You can purchase it online anytime at
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
or call 800.626.2224 during normal business hours. GE Appliances Service will still be there after your warranty expires.
30
49-40773-2
ACCESSORIES
Accessories
Looking For Something More?
GE Appliances offers a variety of accessories to
improve your cooking and maintenance experiences!
Refer to the Consumer Support page for phone numbers
and website information.
The following products and more are available at extra
cost from your GE supplier:
Filler Panel Kits
Filter Kits
Ŷ JX40WH—White
Ŷ JX41—Black
Ŷ JX81D—Recirculating Charcoal Filter Kit
When replacing a 36" range hood, filler panel kits fill in the
additional width to provide a custom built-in appearance.
)RULQVWDOODWLRQEHWZHHQFDELQHWVRQO\QRWIRUHQGRIFDELQHW
installation. Each kit contains two 3" wide filler panels.
49-40773-2
JX81D
)LOWHUNLWVDUHXVHGZKHQWKH
oven cannot be vented to the
outside.
Available at extra cost from your
GE supplier. See the back cover
for ordering by phone or
at GEAppliances.com.
JX40, JX41
31
CONSUMER SUPPORT
Consumer Support
GE Appliances Website
+DYHDTXHVWLRQRUQHHGDVVLVWDQFHZLWK\RXUDSSOLDQFH"7U\WKH*($SSOLDQFHV:HEVLWHKRXUVDGD\DQ\GD\
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
services designed for your convenience. In the US: GEAppliances.com
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
the pre-printed registration card included in the packing material. In the US: GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
your convenience any day of the year. In the US: GEAppliances.com/ge/service-and-support/service.htm
or call 800.432.2737 during normal business hours.
Extended Warranties
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
warranty expires. In the US: GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm
or call 800.626.2224 during normal business hours.
Remote Connectivity
)RUDVVLVWDQFHZLWKZLUHOHVVQHWZRUNFRQQHFWLYLW\ IRUPRGHOVZLWKUHPRWHHQDEOH visit our website at GEAppliances.com/ge/connected-appliances/ or call 800.220.6899 in the US.
Parts and Accessories
,QGLYLGXDOVTXDOLILHGWRVHUYLFHWKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQWGLUHFWO\WRWKHLUKRPHV
(VISA, MasterCard and Discover cards are accepted). Order on-line today 24 hours every day.
In the US: GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/ge/service-and-support/contact.htm
32
Printed in the United States
49-40773-2
HORNO DE CONVECCIÓN/
MICROONDAS
INFORMACIÓN
DE SEGURIDAD . . . . . . . . . . . . . . . . .3
MANUAL DEL
PROPIETARIO
USO DEL MICROONDAS
CVM1790
Funciones . . . . . . . . . . . . . . . . . . . . . . . . . . . .6
Controles . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7
Opciones de cocción disponibles . . . . . . . .8
Funciones por tiempo y automático . . . . .9
Nivel de potencia . . . . . . . . . . . . . . . . . . . . . 12
Functiones de Sensor . . . . . . . . . . . . . . . . . 13
Funciones del Horneado y Asado . . . . . . . 16
Función de horneado rápido . . . . . . . . . . . 17
Consejos de utensilios de cocina. . . . . . . . 18
Mejor método de coccióng. . . . . . . . . . . . . 19
Función Calentar . . . . . . . . . . . . . . . . . . . . 20
Otras funciones. . . . . . . . . . . . . . . . . . . . . . 20
PVM1790
CUIDADO Y LIMPIEZA
Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24
Reemplazo de bombilla . . . . . . . . . . . . . . .25
Función de Escape . . . . . . . . . . . . . . . . . . . .25
RESOLUCIÓN
DE PROBLEMAS . . . . . . . . . . . . . . .27
GARANTÍA
. . . . . . . . . . . . . . . . . . . . . . 30
ACCESORIOS
. . . . . . . . . . . . . . . . . . . . 31
AYUDA AL CLIENTE
. . . . . . . . . . . .32
Anote aquí los números de modelo
y de serie:
Modelo número __________
Número de seri___________
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
Los encontrará en una etiqueta al
abrir la puerta.
GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca.
49-40773-2 08-17 GEA
GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR.
Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace
tenerlo en la familia.
Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de
GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico
asegura que podamos entregarle información importante del producto y detalles de la garantía
cuando los necesite.
Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles
están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con
el material embalado.
2
49-40773-2
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA
Para reducir el riesgo de quemaduras, descargas eléctricas, incendio, lesiones o exposición
a energía de microondas excesiva:
Cuando utilice aparatos eléctricos, se deben seguir las precauciones de seguridad básicas, entre las que se incluyen las
siguientes:
Ŷ /HDWRGDVODVLQVWUXFFLRQHVDQWHVGHXWLOL]DUHVWHDSDUDWR
Ŷ /
HD\VLJDODVSUHFDXFLRQHVHVSHFtILFDVGHODVHFFLyQ
Precauciones para evitar una posible exposición a
excesiva energía de microondas la página 5.
Ŷ 8
WLOLFHHVWHDSDUDWRVyORSDUDORVILQHVGHVFULWRVHQHVWH
manual. No utilice químicos corrosivos o vapores en este
aparato.Este horno está específicamente diseñado para
calentar, deshidratar y cocinar alimentos, no se diseñó
para uso en laboratorios o para uso industrial.
Ŷ (
VWHDSDUDWRVyORGHEHVHUUHSDUDGRSRUSHUVRQDOGH
servicio calificado. Contacte a la empresa de servicio
autorizada para la revisión, reparación o ajuste de este
aparato.
INSTALLATION
Ŷ ,QVWDOH\FRORTXHHVWHDSDUDWRGHDFXHUGRFRQODV
Instrucciones de Instalación suministradas.
Ŷ Este aparato debe contar con una conexión a tierra.
Conecte sólo a un tomacorriente con adecuada conexión a
tierra. Ver la sección Instrucciones de conexión a tierra de
la página 5.
Ŷ (VWHKRUQRGHPLFURRQGDVVHHQFXHQWUDDSUREDGRSRU
8/SDUDODLQVWDODFLyQVREUHFRFLQDVDJDV PHQRVGH
%78 \HOpFWULFDV
Ŷ (VWHKRUQRSDUDXVDUVREUHODHVWXIDHVWiGLVHxDGRSDUD
usarse sobre estufas de un ancho no superior a 36”.
Puede instalarse sobre equipamientos de cocción a gas y
eléctricos.
Ŷ No utilice este aparato si tiene el cable eléctrico o el
enchufe dañados, si no funciona bien o si ha sufrido una
avería o una caída.
Ŷ 0DQWHQJDHOFDEOHDOHMDGRGHVXSHUILFLHVFDOLHQWHV
Ŷ No permita que el cable eléctrico cuelgue sobre el borde
de la mesa o del mostrador de encimera.
Ŷ 1RVXPHUMDHOFDEOHHOpFWULFRRHOHQFKXIHHQDJXD
Ŷ 1RFXEUDQLEORTXHHQLQJXQDDEHUWXUDGHODSDUDWR
Ŷ 1
RJXDUGHHVWHDSDUDWRHQHOH[WHULRU1RORXWLOLFHFHUFD
del agua – por ejemplo, en un sótano mojado, cerca de
una piscina, cerca de un grifo o en ubicaciones similares.
PARA REDUCIR EL RIESGO DE INCENDIO EN LA
CAVIDAD DEL HORNO:
Ŷ 1RFRFLQHGHPiVORVDOLPHQWRV3UHVWHDWHQFLyQDO
aparato cuando se coloquen papel, plástico u otros
materiales combustibles dentro del horno durante la
cocción.
Ŷ 4
XLWHORVJDQFKLWRVGHDODPEUH\ODVPDQLMDVGHPHWDOGH
los recipientes de papel o de plástico antes de colocarlos
en el horno.
Ŷ 6
LORVPDWHULDOHVXELFDGRVGHQWURGHOKRUQRVHSUHQGHQ
fuego, mantenga cerrada la puerta del horno, apáguelo y
desconecte el cable eléctrico, o corte la energía desde el
panel de fusibles o del interruptor de circuitos. Si se abre
la puerta, el fuego puede propagarse.
Ŷ 1
RXWLOLFHHOKRUQRSDUDDOPDFHQDUHOHPHQWRV1RGHMH
productos de papel, utensilios de cocina o alimentos en
el horno cuando no lo esté usando. Todos los estantes
deberán ser retirados del horno cuando no se encuentren
en uso.
Ŷ 1
RRSHUHHOKRUQRVLQDOLPHQWRVDGHQWUR
Ŷ 1
RXWLOLFHODVIXQFLRQHVGHOVHQVRUGRVYHFHVVHJXLGDV
en la misma porción de comida. Si los alimentos no se
cocinaron después de la primera cuenta regresiva, utilice
&22.%<7,0( FRFLQDUSRUWLHPSR SDUDREWHQHUWLHPSR
de cocción adicional.
A FIN DE REDUCIR RIESGOS DE QUEMADURAS:
Ŷ7HQJDFXLGDGRDODEULUHQYDVHVFRQFRPLGDFDOLHQWH8VH
manijas y aleje el vapor del rostro y las manos.
Ŷ9HQWLOHSHUIRUHRFRUWHHQYDVHVEROVDVREROVDVSOiVWLFDV
para evitar la acumulación de presión.
Ŷ7HQJDFXLGDGRDOWRFDUHOSODWRJLUDWRULRODSXHUWDHVWDQWHV
o paredes del horno, los cuales se podrán calentar durante
el uso.
Ŷ/RVOtTXLGRV\FLHUWDVFRPLGDVFDOHQWDGDVHQHOKRUQR
microondas pueden presentar riesgos de quemaduras,
DOVHUUHWLUDGRVGHOKRUQRPLFURRQGDV/DSRVLELOLGDGGH
quemaduras es mayor en niños pequeños, a los cuales
no se les deberá permitir retirar ítems calientes del horno
microondas.
Ŷ 1RPRQWHHVWHDSDUDWRDUULEDGHOIUHJDGHUR
LEA Y GUARDE ESTAS INSTRUCCIONES
49-40773-2
3
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA Continuado
USO
Ŷ (OXVRGHFXDOTXLHUHOHFWURGRPpVWLFRSRUSDUWHGHQLxRV
debería ser supervisado de cerca por un adulto.
Ŷ (VWHKRUQRQRHVWiDSUREDGRQLSUREDGRSDUDXVRPDULQR
Ŷ 1
RKDJDIXQFLRQDUHOKRUQRVLQHOSODWRJLUDWRULRHQVX
lugar. El plato giratorio no debe tener ninguna clase de
bloqueo para que pueda girar.
Ŷ (
VLPSRUWDQWHPDQWHQHUOLPSLDHOiUHDGRQGHODSXHUWDVH
sella contra el microondas. Sólo use detergentes suaves
no abrasivos aplicados con una esponja limpia o un paño
suave. Enjuague bien.
Ŷ $
VHJ~UHVHGHTXHWRGRVORVXWHQVLOLRVXVDGRVHQHOKRUQR
microondas sean para uso en el mismo. Podrán ser
usadas la mayoría de las cacerolas de vidrio, platos de
cocción, tazas graduadas, tazas para postre, vajillas de
cerámica o porcelana que no posean bordes metálicos o
vidriados con un brillo metálico, en cumplimiento con las
recomendaciones del fabricante de utensilios.
Ŷ 1
RDOPDFHQHQLQJ~QHOHPHQWRGLUHFWDPHQWHVREUHOD
superficie del horno de microondas cuando éste se
encuentre en funcionamiento.
Ŷ $
OJXQRVSURGXFWRVFRPRKXHYRVHQWHURV\UHFLSLHQWHV
sellados – por ejemplo, botes sellados – pueden explotar
y no deben calentarse en este horno. Si lo utiliza de esta
manera puede resultar en una lesión.
Ŷ 1
RFRFLQHODVSDSDVH[FHVLYDPHQWH3XHGHQ
deshidratarse y provocar fuego, causando daños al horno.
Ŷ 1
RFXEUDQLQLQJXQDSLH]DGHOKRUQRFRQOiPLQDGHPHWDO
Esto puede sobrecalentar el horno.
Ŷ &
RFLQHODFDUQHGHUHVKDVWDDOFDQ]DUXQDWHPSHUDWXUD
INTERNA de por lo menos 160°F y las carnes de ave a
XQDWHPSHUDWXUD,17(51$GHSRUORPHQRVƒ)/D
cocción a estas temperaturas generalmente protege de
enfermedades transmitidas por los alimentos.
LIMPIEZA
Ŷ 0
DQWHQJDHOKRUQROLEUHGHDFXPXODFLRQHVGHJUDVD
AGUA SOBRECALENTADA
Ŷ 2VOtTXLGRVFRPRHODJXDFDIpRWpSXHGHQFDOHQWDUVH
arriba del punto de hervor sin que aparenten que están
hirviendo. No siempre existen burbujas visibles o hervor
cuando retira el recipiente del horno microonda. ESTO
38('(5(68/7$5(1/Ë48,'2608<&$/,(17(6
48(+,(59(15(3(17,1$0(17(&8$1'26(
08(9((/5(&,3,(17(2,1752'8&(81$&8&+$5$
8275287(16,/,2(1(//Ë48,'2
Ŷ 3DUDUHGXFLUHOULHVJRGHXQDOHVLyQSHUVRQDO
- No sobrecaliente el líquido.
- Mueva el líquido antes y a la mitad del calentamiento.
- No utilice recipientes rectos con cuellos angostos.
'HVSXpVGHFDOHQWDUSHUPLWDTXHHOUHFLSLHQWHGHVFDQVH
en el horno microonda por un período corto de tiempo,
antes de retirar el recipiente.
- Tenga mucho cuidado cuando inserte una cuchara u otro
utensilio adentro del recipiente.
AVISO: MARCAPASOS
/DPD\RUtDGHORVPDUFDSDVRVVHHQFXHQWUDQSURWHJLGRVFRQWUDODLQWHUIHUHQFLDGHSURGXFWRVHOHFWUyQLFRVLQFOX\HQGRORV
microondas. Sin embargo, los pacientes que tengan marcapasos deberían consultar a sus médicos si tienen alguna duda.
ADVERTENCIAS DE LA PROPOSICIÓN 65 DEL ESTADO DE CALIFORNIA:
ADVERTENCIA
Este producto contiene uno o más químicos que el Estado de California entiende que producen
cáncer, y defectos en el nacimiento u otros daños reproductivos.
LEA Y GUARDE ESTAS INSTRUCCIONES
4
49-40773-2
PRECAUCIONES PARA EVITAR LA POSIBLE
EXPOSICIÓN A ENERGÍA DE MICROONDAS EXCESIVA
(a) No intente hacer funcionar el horno con
la compuerta abierta ya que ésto puede provocar
exposición peligrosa a la energía de microondas. Es
importante no forzar ni dañar los seguros.
(b) No coloque ningún objeto entre la parte frontal del horno
y la compuerta, ni permita que se acumulen residuos de
producto limpiador o detergente, suciedad o polvo en las
superficies de sellado.
(c) No haga funcionar el horno si se encuentra dañado. Es
particularmente importante cerrar bien la compuerta
ODFRPSXHUWD GREODGDRFXUYDGD ODVELVDJUDV\SHVWLOORV URWRVRIORMRV V HOORVGHODFRPSXHUWD\VXSHUILFLHVGHVHOODGR
(d) El horno no debe ser ajustado o reparado por ninguna
persona, excepto por personal de mantenimiento
calificado.
INSTRUCCIONES DE CONEXIÓN A TIERRA
ADVERTENCIA El uso inadecuado del enchufe de conexión a tierra puede provocar un riesgo de
descarga eléctrica.
Asegúrese de contar con
una conexión a tierra
adecuada antes de usar.
Tste aparato debe contar con
una conexión a tierra. En caso
de un cortocircuito, la conexión
a tierra reduce el riesgo de una
descarga eléctrica al brindar
un cable de escape para la
corriente eléctrica.
Este aparato se encuentra
equipado con un cable eléctrico que contiene un cable de
conexión a tierra con un enchufe de conexión a tierra. El
enchufe debe conectarse en un tomacorriente con adecuada
instalación y conexión a tierra.
Consulte a un electricista o técnico calificado si no comprende
por completo las instrucciones de conexión a tierra, o si no
sabe si el aparato cuenta con una adecuada conexión a
tierra.
Para el uso de este aparato, es su responsabilidad y
obligación cambiar un tomacorriente de pared estándar de 2
clavijas por uno de 3 clavijas con adecuada conexión a tierra.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
Bajo ninguna circunstancia corte o quite la clavija a tierra del
cable eléctrico.
No utilice un enchufe adaptador con este aparato.
No utilice un cable de extensión con este aparato. Si el
cable eléctrico es demasiado corto, solicite a un electricista o
técnico calificado la instalación de un tomacorriente cerca del
aparato.
Para un mejor funcionamiento, enchufe este aparato en su
propio circuito eléctrico para evitar que las luces parpadeen,
que el fusible se queme o que el interruptor de circuitos salte.
EL VENTILADOR EXTRACTOR
El ventilador se pondrá en funcionamiento de forma
DXWRPiWLFDEDMRFLHUWDVFLUFXQVWDQFLDV YHUIXQFLyQGH
9HQWLODGRU$XWRPiWLFR 3UHYHQJDHOTXHHPSLHFHDOJ~Q
fuego al cocinar y que se extienda mientras el ventilador del
respiradero está en marcha.
Ŷ /LPSLHDPHQXGRODSDUWHLQIHULRUGHOPLFURRQGDV1R
permita que se acumule grasa en el microondas o en los
filtros del ventilador.
Ŷ 6LODJUDVDVHLQFHQGLDUDHQODVXQLGDGHVGHODFRFLQD
IRJRQHV EDMRHOKRUQRPLFURRQGDVVRIRTXHFXDOTXLHU
sartén en llamas de la unidad de cocina por completo con
una tapa, una bandeja de galletas o cualquier otra bandeja
plana.
Ŷ 7
HQJDFXLGDGRDOOLPSLDUORVILOWURVGHOYHQWLODGRUH[WUDFWRU
/RVSURGXFWRVGHOLPSLH]DFRUURVLYRVFRPRORVOLPSLD
hornos a base de lejía, pueden dañar los filtros.
Ŷ 3RQJDHQPDUFKDHOH[WUDFWRUFXDQGRHVWpFRFLQDQGR
comidas con llama bajo el microondas.
Ŷ 1XQFDGHMHODVXQLGDGHVGHODFRFLQD IRJRQHV EDMRVX
microondas sin atención cuando se esté trabajando a
altas temperaturas. Cuando la comida entra en ebullición
se generan humos y se derraman grasas que pudieran
incendiarse y propagarse si el ventilador del microondas
está funcionando. Para minimizar el funcionamiento del
extractor automático, use utensilios de cocina de tamaño
adecuado y use el fuego rápido en las unidades de la
FRFLQD IRJRQHV VyORFXDQGRVHDQHFHVDULR
LEA Y GUARDE ESTAS INSTRUCCIONES
49-40773-2
5
USO DEL MICROONDAS: Funciones
Funciones
Su modelo puede tener otras características y apariencia que las ilustradas en este manual.
1. Tirador
2. Enganches de puerta
3. Ventana con escudo metálico
/DYHQWDQDSHUPLWHYHUFRPRVHFRFLQDQORVDOLPHQWRV\
evita que salgan microondas del horno.
4. Panel de control y dial selector
5. Dispositivo giratorio extraíble
No ponga en marcha el horno en el modo microondas sin
que estén la base y el soporte de la base colocados en su
lugar.
6
6. Soporte del plato giratorio extraíble
El soporte del plato giratorio debe estar en su lugar cuando
se use el horno.
7. Estantes. 8WLOtFHORVFRQ Convection Bake (horneado por
convección), Convection Roast (asado por convección)
o Combinaton Fast Bake (horneado rápido combinado)
QRORVXWLOLFHPLHQWUDVHOPLFURRQGDVHVWiFRFLQDQGR Para obtener mejores resultados, utilice un estante en la
posición inferior y deje al menos una brecha de una pulgada
entre el plato que está cocinando y los laterales del horno.
3DUD+RUQHDGRDGRVQLYHOHVX+RUQHDGRUiSLGRXWLOLFH
ambos estantes.
49-40773-2
(VSRVLEOHFRFLQDUHQPRGR0LFURRQGDV+RUQHDGRSRUFRQYHFFLyQ$VDGRSRUFRQYHFFLyQX+RUQHDGRUiSLGRFRPELQDGR
Gracias a la función “Calentar” puede mantener calientes los alimentos ya horneados y servirlos a una temperatura apropiada.
POPCORN
REHEAT
BEVERAGE
AUTO
COOK
TIME
COOK
POWER
DEFROST
MICRO
EXPRESS
CONVECTION
BAKE
OS
RN T ELECT
TU
CONVECTION
ROAST
Selector
Selector
COMBI
FAST BAKE
PR
CLEAR
OFF
HELP
WARM
OPTIONS
CLOCK
AM/PM
PVM1790
TIMER
ESS TO E NTE
R
START
PAUSE
TURNTABLE
ON/OFF
VENT
FAN
SURFACE
LIGHT
CVM1790
1. Funciones de tiempo de cocción por microondas y automáticas
Presione
Gire y apriete el dial para aceptar
TIME COOK (cocción por tiempo)
3XOVHXQDYH]7LPH&RRN, 7LHPSRGHFRFFLyQ, SDUDXWLOL]DU
la función microondas en un intervalo de tiempo de entre 15
segundos y 95 minutos.
3XOVHGRVYHFHV7LPH&RRN,, 7LHPSRGHFRFFLyQ,, SDUD
cambiar los niveles de potencia de forma automática durante la
cocción.
Cantidad de tiempo de cocción
MICRO EXPRESS cocinar/ Añadir 30 seg.
¡Empieza inmediatamente!
DEFROST (descongelar)
3XOVHXQDYH] 5iSLGR
3XOVHGRVYHFHV $XWR
3XOVHWUHVYHFHV 7LHPSR
Cantidad de tiempo de descongelación
Peso de alimentos hasta seis libras
Peso de alimentos hasta una libra
BEVERAGE (bebida)
3UHVLRQHXQDYH] R]
3UHVLRQHGRVYHFHV R]
3UHVLRQHWUHVYHFHV R]
¡Empieza inmediatamente!
POWER Level (Nivel de POTENCIA)
Nivel de potencia 1–10
USO DEL MICROONDAS: Controles
Controles
Funciones de sensor
Presione
Gire y apriete el dial para aceptar
Opción
POPCORN (rosetas o palomitas de maíz)
¡Empieza inmediatamente!
Más/menos tiempo
REHEAT
3UHVLRQHXQDYH] SODWR
3UHVLRQHGRVYHFHV SDVWD
3UHVLRQHWUHVYHFHV DXQDWD]D
3UHVVIRXUWLPHV DWD]DV
¡Empieza inmediatamente!
Más/menos tiempo
AUTO COOK (cocinar automáticamente)
Tipo de comida
Más/menos tiempo
2. Convection Baking o Convection Roasting (Horneado por convección o Asado por convección)
Presione
Gire y apriete el dial para aceptar
CONVECTION BAKE (Horneado por convección) o
CONVECTION ROAST (Asado por convección)
Temperatura de horno y tiempo de cocción
3. Combination Fast Baking (Horneado rápido combinado)
Presione
Gire y apriete el dial para aceptar
COMBINATION FAST BAKE (Horneado rápido combinado)
Temperatura de horno y tiempo de cocción
4. Warming (Calentamiento)
Presione
Gire y apriete el dial para aceptar
WARM (Calentar)
Temperatura del horno y tiempo de calentamiento
49-40773-2
7
USO DEL MICROONDAS: Opciones de cocción disponibles.
Opciones de cocción disponibles
Cocción por microondas
Su horno usa energía de microondas para cocinar según un período de tiempo predeterminado,
según el peso o de forma automática por medio de un sensor.
El microondas por sensor funciona detectando el incremento de humedad liberada durante la cocción.
El horno ajusta de forma automática el tiempo de cocción a varios tipos y cantidades de alimentos.
Método de cocción
Fuente de calor
/DHQHUJtDPLFURRQGDV Energía microondas..
se distribuye de forma
pareja en todo el horno
para que la comida se
cocine de forma rápida
y completa.
Conducción del calor
Calor producido
dentro de la comida
por penetración
instantánea de energía.
Beneficios
Rápida, alta eficacia
de cocción. El horno y
sus alrededores no se
calientan.
Fácil de limpiar.
No utilice los estantes cuando
cocine por microondas.
Convection Baking (horneado por convección) y Convection
Roasting (asado por convección)
'XUDQWH HO SURFHVR GH KRUQHDGR R DVDGR VH XWLOL]D XQ HOHPHQWR GH FDOHIDFFLyQ SDUD DXPHQWDU OD
temperatura del aire interior del horno. Puede seleccionarse cualquier temperatura entre 225°F y
ƒ)8QYHQWLODGRUKDFHFLUFXODUOLJHUDPHQWHHODLUHSRUWRGRHOKRUQRSRUHQFLPD\DOUHGHGRUGHOD
comida, produciendo que se dore por fuera y que los interiores sean ricos y jugosos. Esta circulación de
aire caliente es llamada convección. Because the heated air is kept constantly moving, not permitting
a layer of cooler air to develop around the food, some foods cook faster than in regular oven cooking.
Método de cocción
El aire caliente circula
alrededor de la
comida para producir
exteriores dorados y
mantener los jugos en
el interior.
Fuente de calor
Aire caliente en
circulación.
&RQYHFFLyQ
Conducción del
calor
El calor se conduce
desde el exterior de
la comida hacia su
interior.
Beneficios
Ayuda a dorar y
sella el sabor en
el interior. Algunos
alimentos se cocinan
más rápidamente
que en hornos
convencionales.
8VHVLHPSUHHOHVWDQWH
cuando esté horneando. Para
obtener mejores resultados
utilice un estante en la
posición inferior. Para cocción
a dos niveles exclusivamente,
utilice ambos estantes.
Combination Fast Baking (Horneado rápido combinado)
6X KRUQR WDPELpQ WLHQH OD RSFLyQ GH FRFFLyQ UiSLGD )DVW %DNLQJ XVDQGR OD HQHUJtD PLFURRQGDV
MXQWRDODFRFFLyQSRUFRQYHFFLyQ'HHVWDIRUPDFRFLQDFRQYHORFLGDG\SUHFLVLyQSURSRUFLRQDQGRDO
mismo tiempo alimentos dorados y crujientes.
Método de cocción
/DHQHUJtD
microondas y el calor
por convección se
combinan para cocinar
alimentos hasta un 25%
más rápido que los
hornos convencionales
y dorar por fuera y,
a la vez, mantener
líquidos.
Fuente de calor
Energía microondas
y aire caliente en
circulación.
Conducción del calor
/DFRPLGDVHFDOLHQWD
por energía instantánea
por penetración y calor
proveniente del exterior
de los alimentos.
Beneficios
Tiempo de cocción
acortado por la energía
microondas, además
el calor de convección
dora y produce
crujientes exteriores.
8WLOLFHVLHPSUHHOHVWDQWHGXUDQWH
+RUQHDGRUiSLGR3DUDREWHQHU
mejores resultados utilice un estante
en la posición inferior. Para cocción
a dos niveles exclusivamente, utilice
ambos estantes.
Warming (Calentar)
/D IXQFLyQ ³&DOHQWDU´ PDQWHQGUi ORV DOLPHQWRV D OD WHPSHUDWXUD LGHDO SDUD VHUYLUORV &RPLHQFH
VLHPSUH FRQ FRPLGD FDOLHQWH 8WLOLFH UHFLSLHQWHV \ XWHQVLOLRV GH FRFLQD TXH SXHGDQ VRSRUWDU
temperaturas de hasta 230º F..
Método de cocción
El aire caliente
circula alrededor de
los alimentos para
mantener caliente la
comida previamente
cocinada.
8
Fuente de calor
Aire caliente
en circulación
FRQYHFFLyQ Conducción de calor
El calor se conduce
desde el exterior
hacia el interior de los
alimentos.
Beneficios
Mantiene la comida
horneada caliente, a
temperatura óptima
para servirla.
8WLOLFHVLHPSUHHOHVWDQWHFXDQGR
caliente.
49-40773-2
Cómo usar el dial
Podrá hacer selecciones en el horno girando el dial y
presionando para ingresar la selección.
8VWHGWDPELpQSXHGHSUHVLRQDUHOGLDOHQYH]GHERWyQ
START/PAUSE para una programación más rápida del horno.
Time Cook (cocción por tiempo)
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
Time Cook I (cocción por tiempo I)
Time Cook II (cocción por tiempo II)
/HSHUPLWHXVDUHOPLFURRQGDVSRUXQSHUtRGRGHHQWUH
segundos y 95 minutos.
/HSHUPLWHFDPELDUORVQLYHOHVGHSRWHQFLDGHIRUPD
automática mientras cocina.
Se hace de la siguiente forma:
El Nivel de potencia 10 (alto) (power level 10 [High]) se
selecciona de forma automática pero puede cambiarlo para
mayor flexibilidad.
1. Presione el botón TIME COOK (cocción por tiempo).
2. Gire el dial para ajustar el tiempo de cocción y presione el
dial para seleccionar
3. Cambie el nivel de potencia si no quiere que cocine a toda
SRWHQFLD 3UHVLRQHPOWER. Gire el dial para buscar.
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
1. Presione el botón TIME COOK FRFFLyQSRUWLHPSR 2. Gire el dial para ajustar el primer tiempo de cocción y
presione el dial para seleccionar.
3. Cambie el nivel de potencia si no quiere que cocine a toda
SRWHQFLD 3UHVLRQHPOWER. Gire el dial para seleccionar.
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
4. Presione el botón TIME COOK FRFFLyQSRUWLHPSR GH
nuevo.
4. Presione el dial o el botón START/PAUSE para empezar a
cocinar.
5. Gire el dial para ajustar el segundo tiempo de cocción y
presione el dial para seleccionar.
Cuando use Time Cook puede abrir la puerta para revisar la
comida. Cierre la puerta y presione el dial o START/PAUSE
para seguir cocinando.
6. Cambie el nivel de potencia si no quiere que cocine a toda
SRWHQFLD 3UHVLRQHPOWER. Gire el dial para seleccionar.
3UHVLRQHHOGLDOSDUDVHOHFFLRQDU
NOTA: El tiempo de cocción puede cambiarse en cualquier
PRPHQWRPLHQWUDVVHFRFLQDJLUDQGRHOGLDO8VWHGSXHGH
también cambiar el nivel de energía presionando el botón de
energía POWER.
7. Presione el el dial o el botón START/PAUSE para empezar
a cocinar.
Cuando acaba Time Cook I, Time Cook II empieza a
funcionar.
NOTA: El tiempo de cocción puede cambiarse en cualquier
PRPHQWRPLHQWUDVVHFRFLQDJLUDQGRHOGLDO8VWHGSXHGH
también cambiar el nivel de energía presionando el botón de
energía POWER.
Micro Express Cook (cocción micro express)
Esta es la forma rápida de ajustar y empezar a cocinar en
bloques de 30 segundos cada vez que se aprieta el botón
MICRO EXPRESS. El tiempo de cocción puede cambiarse en
cualquier momento mientras se cocina girando el dial.
49-40773-2
USO DEL MICROONDAS: Funciones por tiempo y automático
Funciones por tiempo y automático
El nivel de potencia estará automáticamente seleccionado a 10
y el horno empezará inmediatamente.
El nivel de potencia puede cambiarse mientras el tiempo se va
agotando. Presione el botón POWER gire el dial y presiónelo
para seleccionar.
9
USO DEL MICROONDAS: Funciones de microondas
Funciones por tiempo y automático
Fast Defrost (Descongelación rápida)
(Cont.)
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
Fast Defrost ajusta de forma automática
los tiempos de descongelación y los niveles de potencia para
producir resultados de descongelación parejos para carnes,
aves y pescado que pesen hasta una libra.
Tabla de conversión
Si el peso de la comida se calcula en libras y onzas, las onzas
GHEHUiQFRQYHUWLUVHDGpFLPDV GHOLEUD
Ŷ6DTXHODFDUQHGHOSDTXHWH\FROyTXHODHQXQSODWRDSWR
para microondas.
1. Presione el botón DEFROST GHVFRQJHODU WUHVYHFHV
2. Gire el dial hasta alcanzar el peso de la comida usando
la Tabla de Conversión a la derecha. Por ejemplo, ponga
HOGLDODSDUDOLEUDV RQ]DV 3UHVLRQHHOGLDOSDUD
seleccionar.
3. Presione el botón START/PAUSE para empezar a
descongelar.
'HODYXHOWDDODFRPLGDVLDSDUHFHHOPHQVDMH7URN FOOD
OVER.
Ŷ5HWLUHODFDUGHGHVFRQJHODGDRFXEUDODViUHDVFDOLHQWHVFRQ
pequeños recortes de papel de aluminio.
Peso de la
comida en
onzas
Introduzca el
peso de la comida
(décimas de libra)
1–2
.1
3
.2
4–5
.3
6–7
.4
8
.5
9–10
.6
11
.7
12–13
.8
14–15
.9
Ŷ8QDYH]GHVFRQJHODGDVODPD\RUtDGHFDUQHVQHFHVLWDQ
minutos en reposo para que acaben de descongelarse.
Auto Defrost (descongelación automática)
8VH Auto Defrost para carne, aves y pescados que pesen
KDVWDVHLVOLEUDV8VHTime Defrost para la mayoría del resto
de comidas congeladas.
Auto Defrost ajusta de forma automática los tiempos de
descongelación y los niveles de potencia para producir
resultados de descongelación parejos para carnes, aves
y pescado.
Ŷ6DTXHODFDUQHGHOSDTXHWH\FROyTXHODHQXQSODWRDSWR
para microondas.
3UHVLRQHHOERWyQ'()5267 GHVFRQJHODU GRVYHFHV
2. Gire el dial hasta alcanzar el peso de la comida usando la
Tabla de Conversión a la derecha. Por ejemplo, ponga el
GLDODSDUDOLEUDV OLEUDRQ]DV 3UHVLRQHHOGLDO
para seleccionar.
3. Presione el botón START/PAUSE para empezar a
descongelar.
'HODYXHOWDDODFRPLGDVLDSDUHFHHOPHQVDMHTURN FOOD
OVER.
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
Tabla de conversión
Si el peso de la comida se calcula en libras y onzas, las onzas
GHEHUiQFRQYHUWLUVHDGpFLPDV GHOLEUD
Peso de la
comida en
onzas
Introduzca el
peso de la comida
(décimas de libra)
1–2
.1
3
.2
4–5
.3
6–7
.4
8
.5
9–10
.6
11
.7
12–13
.8
14–15
.9
Ŷ 5HWLUHODFDUQHGHVFRQJHODGDRFXEUDODViUHDVFDOLHQWHV
con pequeños recortes de papel de aluminio.
Ŷ 8QDYH]GHVFRQJHODGDVODPD\RUtDGHODVFDUQHV
necesitan 5 minutos en reposo para que acaben de
GHVFRQJHODUVH/RVDVDGRVJUDQGHVGHEHUtDQGHMDUVH
reposar por unos 30 minutos.
10
49-40773-2
Time Defrost (Descongelación por tiempo)
8VH7LPH'HIURVWSDUDGHVFRQJHODUSRUXQSHUtRGRGHWLHPSR
seleccionado.
3UHVLRQHHOERWyQ'()5267 GHVFRQJHODU XQDYH]
2. Gire el dial para seleccionar el tiempo que desee. Presione
el dial para seleccionar.
3UHVLRQHHOERWyQ67$573$86(SDUDHPSH]DUD
descongelar.
'pODYXHOWDDODFRPLGDVLDSDUHFHHOPHQVDMH7851
)22'29(5
Puede variar el tiempo de descongelación en cualquier momento
mientras se descongela girando el dial.
El nivel de potencia está preseleccionado
a 3, pero puede cambiarlo. Puede descongelar artículos pequeños
rápidamente elevando el nivel de potencia una vez introducido el
tiempo. El nivel de potencia 7 (power level 7) recorta el tiempo
total de descongelación a la mitad; el nivel de potencia 10 (power
level 10) recorta el tiempo total en, aproximadamente, una tercera
parte. Sin embargo, la comida necesitará más atención de lo
normal.
'XUDQWHODGHVFRQJHODFLyQSRGUtDRtUVHXQUXLGRGHJROSHV
sordo. Esto es normal cuando el horno no está funcionando en la
potencia High (Alta).
Beverage (bebida)
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
Consejos de descongelación
Ŷ /DFRPLGDFRQJHODGDHQSDSHORSOiVWLFRSXHGH
GHVFRQJHODUVHHQHOSDTXHWH/RVSDTXHWHVFHUUDGRV
deberían cortarse, pincharse o debería proveerse cualquier
WLSRGHYHQWLODFLyQ'(638e6GHKDEHUGHVFRQJHODGROD
comida parcialmente.
/RVUHFLSLHQWHVGHSOiVWLFRGHEHUtDQGHMDUVHSDUFLDOPHQWH
destapados.
Ŷ /DVFRPLGDVSUHHPSDTXHWDGDVFRQJHODGDVGHWDPDxR
familiar pueden descongelarse y hacerse en el microondas.
Si la comida está en un contenedor de aluminio, pásela a
un plato seguro para su uso en microondas.
Ŷ /DVFRPLGDVTXHVHHFKDQDSHUGHUUiSLGDPHQWHQR
deberían dejarse fuera por un período de más de una
KRUDWUDVVXGHVFRQJHODFLyQ/DWHPSHUDWXUDDPELHQWH
promueve el crecimiento de bacterias dañinas.
Ŷ 3DUDODGHVFRQJHODFLyQPiVLJXDODGD
de alimentos mayores, como asados,
XVH$XWR'HIURVW$VHJ~UHVHGHTXHODVFDUQHVJUDQGHV
estén completamente descongeladas antes de cocinarlas.
Ŷ &XDQGRHVWpGHVFRQJHODGDODFRPLGDGHEHUtDHVWDUIUtD
pero blanda en todas sus áreas. Si aún está ligeramente
helada, devuélvala al microondas por muy poco tiempo, o
déjela fuera unos minutos.
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
/DIXQFLyQBEVERAGE (Bebida) calienta bebidas de entre 6 y
/DVEHELGDVFDOHQWDGDVFRQODIXQFLyQBeverage pueden estar
12 onzas.
muy calientes. Saque el recipiente con cuidado.
Pulse una vez para 6-7 oz.
Pulse dos veces para 8-9 oz.
Pulse tres veces para 10-12 oz.
49-40773-2
USO DEL MICROONDAS: Funciones por tiempo y automático
Funciones por tiempo y automático (Cont.)
11
USO DEL MICROONDAS: Nivel de potencia
Nivel de potencia
Nivel de potencia
El nivel de potencia puede introducirse o cambiarse de forma
LQPHGLDWDWUDVLQWURGXFLUHOWLHPSRGHFRFFLyQ Time Cook HO
WLHPSRGHGHVFRQJHODFLyQ Time Defrost RExpress Cook.
El nivel de potencia también puede cambiarse durante la
cuenta atrás.
1. Primero, siga las instrucciones para el tiempo de cocción
Time Cook HOWLHPSRGHGHVFRQJHODFLyQ Time Defrost o Express Cook.
2. Presione el botón POWER.
3. Gire el dial, en el sentido de las agujas del reloj, para
aumentar y en el sentido contrario para disminuir la
potencia. Presione el dial para seleccionar.
4. Presione el botón START/PAUSE para empezar a cocinar.
/RVQLYHOHVGHSRWHQFLDYDULDEOHVDxDGHQIOH[LELOLGDGDOD
FRFLQDFRQPLFURRQGDV/RVQLYHOHVGHSRWHQFLDGHOKRUQR
microondas pueden compararse con las unidades de la
HQFLPHUD IRJRQHV HQXQDFRFLQD&DGDQLYHOGHSRWHQFLD
le proporciona energía microondas durante cierto porcentaje
del tiempo. Nivel de potencia 7 (power level 7) es energía
microondas al 70% del tiempo. Nivel de potencia 3 (power
level 3) es energía al 30% del tiempo. Normalmente se
cocinará en Alto (nivel de potencia 10) (High, power level
10) que proporciona una potencia del 100%. Power level 10
le permitirá cocinar más rápido, pero la comida, posiblemente,
necesitará que la agite, gire o dé la vuelta más a menudo.
8QQLYHOLQIHULRUFRFLQDUiODFRPLGDGHIRUPDPiVSDUHMD\
no necesitará que la agite, gire o dé la vuelta tanto. Algunas
comidas pueden tener mejor sabor, textura o aspecto si se usa
XQQLYHOLQIHULRU8VHXQQLYHOGHSRWHQFLDLQIHULRUFXDQGRHVWp
cocinando comidas que tengan tendencia a hervir, como las
papas gratinadas.
/RVSHUtRGRVGHGHVFDQVR FXDQGRVHDFDEDHOFLFORGHOD
HQHUJtDPLFURRQGDV OHGDQWLHPSRDODFRPLGDD³LJXDODUVH´R
transferir el calor a su interior. Se muestra un ejemplo de esto
con el ciclo de descongelación--power level 3 Si la energía
microondas no funcionara en ciclos, la parte externa de la
comida se cocinaría antes de que el interior se descongelara.
Estos son algunos ejemplos de aplicaciones para diferentes
niveles de potencia:
Alta 10: Pescado, bacon, verduras, calentar líquidos.
Media alta 7: Cocción suave de carne y aves, sirve para
cocinar guisos y para recalentar.
Media 5: Cocina lenta y tierna para estofados o guisos y para
partes menos tiernas de carne.
Baja 2 o 3: Para descongelar, cocer a “fuego” lento, para
salsas delicadas.
Algo caliente 1: Mantener la comida caliente, ablandar la
mantequilla.
Terminología de microondas
Término
Definición
Arco
eléctrico
El arco eléctrico es lo que, en la terminología de los microondas, describe las chispas en el horno. El arco eléctrico se
produce cuando:
Ŷel estante de metal se ha instalado de forma incorrecta y está tocando las paredes del microondas.
Ŷhay un metal o papel de aluminio tocando el lateral del horno.
ŶKD\SDSHOGHDOXPLQLRQRHVWiHQYROYLHQGRELHQODFRPLGD KD\ERUGHVGREODGRVKDFLDDUULEDTXHDFW~DQFRPR
DQWHQDV Ŷhay algún metal, como cintas de cierre con metal, pinchos de pollo, o platos con decoración de oro.
Ŷhay papel toalla reciclado que contiene pequeñas piezas de metal.
Ŷel soporte del aro del plato giratorio está instalado incorrectamente.
Cubierto
/DVFXELHUWDVPDQWLHQHQODKXPHGDGGHQWURSHUPLWLHQGRXQFDOHQWDPLHQWRPiVSDUHMR\UHGXFLHQGRHOWLHPSRGH
cocción. Cuando se agujerea el envoltorio de plástico o se cubre con papel de cera se permite la salida del vapor.
Resguardar
En un horno convencional, se tapan o resguardan las pechugas de pollo o las comidas horneadas para que no se
doren demasiado. Al usar el microondas, use pequeñas cintas de papel de aluminio para cubrir partes finas, como las
puntas de las alas en las aves, que podrían cocinarse antes que las partes mayores.
Tiempo de
reposo
Cuando cocina en hornos regulares, las comidas como los asados o pasteles se dejan reposar para que acaben de
cocinarse o se asienten. El tiempo de reposo es especialmente importante al cocinar con microondas. Tenga en cuenta
que un pastel cocido en horno microondas no se coloca en un estante de enfriamiento.
Abrir
8QDYH]TXHKD\DFXELHUWRXQSODWRFRQILOPSOiVWLFRGHEHUiDEULUXQRULILFLRGHVSOHJDQGRXQDHVTXLQDSDUDTXHSXHGD
respiraderos escapar el vapor.
12
49-40773-2
Sensor de humedad
4XpVXFHGHFXDQGRXVDODVIXQFLRQHVGHVHQVRUHV
/DVIXQFLRQHVGH6HQVRUGHWHFWDQODPD\RUKXPHGDGOLEHUDGD
durante la cocción. El horno ajusta automáticamente el tiempo
de cocción a los diferentes tipos y cantidades de comida.
No utilice las funciones de Sensor dos veces consecutivas
en la misma porción de comida. Puede resultar en que los
alimentos se cocinen en exceso o se quemen. Si la comida no
se ha cocinado por completo después de la cuenta regresiva,
use la función Time Cook para tiempo de cocción adicional.
127$/DVIXQFLRQHVGHVHQVRUQRHVWDUiQGLVSRQLEOHVFXDQGR
el horno está caliente. Si se pulsa uno de los botones de
cocinar por sensor cuando la temperatura dentro del horno es
VXSHULRUDORVž)DSDUHFHUiHOPHQVDMH³29(1722+27
)256(1625&22.,1*86,1*$/7(51$7(0(7+2'´
+RUQRGHPDVLDGRFDOLHQWHSDUDFRFLQDUSRUVHQVRU6HHVWi
XWLOL]DQGRRWURPpWRGR (OKRUQRFDPELDUiDXWRPiWLFDPHQWH
DODIXQFLyQ³FRRNE\WLPH´ FRFLQDUSRUWLHPSR VLJDODV
LQGLFDFLRQHVGHODSDQWDOOD RXQDYH]TXHHOKRUQRHVWpOR
suficientemente frío, las funciones del sensor se ejecutarán de
forma normal.
/RVUHFLSLHQWHV\WDSDVRFXELHUWDVDSURSLDGDVVRQHVHQFLDOHV
para obtener los mejores resultados con la cocción por sensor.
49-40773-2
Ŷ8VHVLHPSUHUHFLSLHQWHVDSWRVSDUDPLFURRQGDV\F~EUDORV
con tapas o film de plástico agujereado. No use nunca
recipientes cerrados por completo—pueden hacer que el
vapor no salga y causar que la comida se cocine demasiado.
Ŷ$VHJ~UHVHTXHWDQWRHOH[WHULRUGHORVUHFLSLHQWHVFRPRHO
interior del horno microondas estén secos antes de poner la
FRPLGDHQHOKRUQR/DVDFXPXODFLRQHVGHKXPHGDGTXHVH
convierten en vapor pueden engañar al sensor.
Ŷ/DVEHELGDVVHFDOLHQWDQPHMRUHVWDQGRGHVFXELHUWDV
Agujereado
Cubierto
Seque los platos para que
no engañen al sensor.
USO DEL MICROONDAS: Funciones del sensor
Funciones del sensor
13
USO DEL MICROONDAS: Funciones del sensor
Funciones del sensor
(Cont.)
Auto Cook (cocinar automáticamente)
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
NOTA: No utilice las function dos veces en sucesión
en la misma porción de comida ya que puede dar como
resultado comida severamente sobrecocinada o quemada.
'DGRTXHODPD\RUtDGHORVUHFLSLHQWHVGHEHQHVWDUFXELHUWRV
durante Auto Cook, esta función trabaja mejor con comidas
que quiera hacer al vapor o en las que quiera mantener la
humedad.
NOTA: No se recomienda el uso del estante de metal con Auto
Cook.
Comidas recomendadas
Con esta función se pueden cocinar una gran variedad de
comidas incluyendo carnes,
pescado y vegetales.
Comidas no recomendadas
No deberían cocinarse
usando esta función aquellas
comidas que deban cocinarse
descubiertas, aquellas que
requieran atención constante,
aquellas que requieran añadir
ingredientes durante su cocción
y comidas que deban tener
apariencia seca o con una
superficie crujiente. Es mejor
cocinar todas estas usando Time
Cook.
1. Ponga la comida cubierta en
el horno y cierre la puerta.
3XOVHHOERWyQ$872&22.
FRFFLyQDXWRPiWLFD $SDUHFHHQSDQWDOOD(17(5)22'
7<3( LQWURGX]FDHOWLSRGHFRPLGD 2. Gire el dial al tipo de comida deseado. Presione para
seleccionar
Ver la Tabla de Tipos de Comidas con Sensor de más abajo
para tipos específicos de comidas e instrucciones.
El horno empieza a funcionar inmediatamente.
NOTA: Si la puerta se abre mientras se está seleccionando
el control, ciérrela y presione el botón START/PAUSE para
empezar a cocinar.
Si la comida no se ha cocinado por completo después de la
cuenta regresiva, use la función Time Cook para tiempo de
cocción adicional.
No abra la puerta del horno antes de que el tiempo de cuenta
atrás aparezca en la pantalla—el vapor que se escapa del
horno puede afectar la cocción. Si se abre la puerta, ciérrela y
SUHVLRQH67$573$86(LQPHGLDWDPHQWH
6LVHOHFFLRQDFDUQHSLFDGD JURXQGPHDW HOKRUQRSXHGH
que le indique que le extraiga el líquido y la remueva. Abra
la puerta, seque la carne y cierre la puerta. Presione el botón
67$573$86(VLIXHUDQHFHVDULRSDUDVHJXLUFRQODFRFFLyQ
Consejos de cocción
nCuando el horno hace una señal y aparece el tiempo hacia
atrás, la puerta puede abrirse para remover, girar o dar la
vuelta a la comida. Cierre la puerta y presione START/PAUSE
para seguir cocinando.
Ŷ$MXVWHODFDQWLGDGGHFRPLGDDOWDPDxRGHOUHFLSLHQWH/OHQH
los recipientes por lo menos hasta la mitad.
Ŷ$VHJ~UHVHGHTXHODSDUWHH[WHULRUGHOUHFLSLHQWH\HOLQWHULRU
del horno estén secos.
Ŷ8QDYH]FRPSOHWDGRHOFLFORGH&RFFLyQVLODFRPLGD
necesita cocerse más, vuélvala a poner en el horno y use
Time Cook para acabar de cocinarla.
Cómo ajustar la configuración automática del horno
para un tiempo de cocción más corto o más largo (no
disponible para todos los tipos de alimentos)
Para restar el 10% del tiempo de cocción automático: En
los primeros 30 segundos tras el horno comienza a funcionar,
gire el dial en el sentido contrario de las agujas del reloj hasta
TXHDSDUH]FDXQVLJQRPHQRV ³±´ \SXOVHSDUDLQWURGXFLUOD
selección.
Para agregar el 10% al tiempo de cocción automático:
'HQWURGHORVSULPHURVVHJXQGRVWUDVHOKRUQRFRPLHQ]D
a funcionar, gire el dial en el sentido de las agujas del reloj
KDVWDTXHDSDUH]FDXQVLJQRPiV ³´ \SXOVHSDUDLQWURGXFLU
la selección.
Tabla de tipos de comidas con sensor
14
Tipo de comida
Raciones
Tamaños de
las raciones
Comentarios
Piezas de pollo
1a4
2 a 8 pieces
8VHXQSODWRRYDODGRFXDGUDGRRUHGRQGR&XEUDFRQHQYROWXUD
plástica ventilada.
Pescado
1a4
4 a 16 oz.
8VHXQSODWRRYDODGRFXDGUDGRRUHGRQGR
Carne picada
7HUQHUD3XHUFR3DYR
-
8 a 32 oz.
8VHSODWRGHJXLVRVUHGRQGR5HSDUWDODFDUQHHQHOSODWR&~EUDOR
con un papel de cera o un en el plato. Cúbralo con un papel de cera
o un film plástico agujereado.
Papas
1a4
8 a 32 oz.
Rompa la piel con un tenedor. Arréglelas en un patrón en forma de
estrella al centro del plato giratorio.
Vegetales enlatados
1a4
4 a 16 oz.
8VHFD]XHODGHJXLVRVSDUDPLFURRQGDVWD]yQRERO&~EUDORFRQ
una tapa o un film plástico agujereado.
Vegetales frescos
1a4
4 a 16 oz.
8VHFD]XHODGHJXLVRVSDUDPLFURRQGDVWD]yQRERO$xDGDGRV
cucharadas de agua por cada ración. Cúbralo con una tapa o un
film plástico agujereado.
Vegetales congelados
1a4
4 a 16 oz.
8VHFD]XHODGHJXLVRVSDUDPLFURRQGDVWD]yQRERO6LJDODV
instrucciones del paquete en cuanto al agua a añadir. Cúbralo con
una tapa o un film plástico agujereado.
49-40773-2
(Cont.)
Popcorn (rosetas o palomitas de maíz)
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
Para usar la función Popcorn:
8VHVyORFRQSDORPLWDVRURVHWDVSUHHPSDTXHWDGDVSDUD
microondas que pesen de 1,5 a 3,5 onzas.
NOTA: No utilice esta función dos veces consecutivas en
la misma porción de comida. Puede resultar en que los
alimentos se cocinen en exceso o se quemen.
1. Siga las indicaciones del paquete, use Time Cook si el
paquete pesa menos de 1,5 onzas o es mayor de 3,5 onzas.
Sitúe el paquete de rosetas en el centro del plato giratorio.
2. Presione el botón POPCORN una o dos veces. El horno
empieza a funcionar inmediatamente.
Si abre la puerta mientras aparece en pantalla POPCORN
SENSOR (sensor de palomitas), aparecerá un mensaje de
error. Cierre la puerta, pulse CLEAR/OFF ERUUDUGHVDFWLYDU \
comience de nuevo.
Si la comida no se ha cocinado por completo después de la
cuenta regresiva, use la función Time Cook para tiempo de
cocción adicional.
Reheat (recalentar)
Cómo ajustar la configuración automática para palomitas
de maíz para un mayor o menor tiempo de cocción
Si se da cuenta de que en la bolsa de la marca de palomitas
que usa queda mucho maíz sin reventar o lo cuece
demasiado, puede añadir o substraer 20–30 segundos al
tiempo automático de cocción.
Para sustraer tiempo:
Antes de que acaben los primeros 30 segundos desde que
el horno se pone en funcionamiento, gire el dial en el sentido
FRQWUDULRDODVDJXMDVGHOUHORMSDUDVHJXQGRV ± PHQRV
de tiempo de cocción. Pulse para introducir la selección. Gire
GHQXHYRKDVWDTXHDSDUH]FDQGRVVLJQRVPHQRV ³´ SDUD
reducir el tiempo de cocción en otros 10 segundos hasta una
cantidad de reducción de tiempo de 30 segundos. Pulse para
introducir la selección.
Para añadir tiempo:
Antes de que acaben los primeros 30 segundos desde que el
horno se pone en funcionamiento, gire el dial en el sentido de
ODVDJXMDVGHOUHORMVHJXQGRV PiVDOWLHPSRGHFRFFLyQ
Pulse para introducir la selección. Gire de nuevo, hasta
TXHDSDUH]FDQGRVVLJQRVPiV ³´ SDUDDxDGLURWURV
segundos, hasta un total de 30 segundos de tiempo adicional.
Pulse para introducir la selección.
QRXWLOL]DUORVHVWDQWHVFXDQGRFRFLQDSRUPLFURRQGDV
No está recomendado el uso de reheat para algunas
/DIXQFLyQGHUHFDOHQWDU 5HKHDW YXHOYHDFDOHQWDU
comidas
raciones de comidas previamente cocinadas o un plato de
Es mejor usar Time Cook en estos casos:
sobras.
Ŷ 3URGXFWRVGHSDQ
NOTA: No utilice esta función dos veces consecutivas en
la misma porción de comida. Puede resultar en que los
Ŷ &RPLGDVTXHGHEHQUHFDOHQWDUVHVLQFXEULU
alimentos se cocinen en exceso o se quemen.
Ŷ $OLPHQWRVTXHQHFHVLWHQUHPRYHUVHRURWDUVH
1. Coloque la taza de líquido o comida cubierta en el horno.
Ŷ &RPLGDVTXHQHFHVLWHQWHQHUXQDVSHFWRVHFRRXQD
Pulse REHEAT UHFDOHQWDU XQDGRVWUHVRFXDWURYHFHV
superficie crujiente tras ser recalentados.
El horno empieza a funcionar automáticamente.
Cómo ajustar la configuración automática del horno para
Presione una vez para un plato de sobras.
un mayor o menor tiempo de cocción
Pulse dos veces para pasta.
Para sustraer un 10% del tiempo de cocción automático:
Presione tres veces para cantidades de 1/2 a 1 taza llena.
Antes de que acaben los primeros 30 segundos desde que
el horno se pone en funcionamiento, gire el dial en el sentido
Pulse cuatro veces para entre 1 y 2 tazas llenas.
contrario a las agujas del reloj y presiónelo para seleccionar
2. El horno da una señal cuando advierte que hay vapor y
Para añadir un 10% del tiempo de cocción automático:
empieza a mostrarse hacia atrás el tiempo que queda.
Antes de que acaben los primeros 30 segundos desde que el
No abra la puerta del horno hasta que el tiempo en el horno
horno se pone en funcionamiento, gire el dial en el sentido de
aparezca en cuenta atrás. Si se abre la puerta, ciérrela y
las agujas del reloj y presiónelo para seleccionar.
presione START/PAUSE inmediatamente.
8QDYH]TXHKD\DUHWLUDGRODFRPLGDGHOKRUQRUHPXpYDOD
VLHVSRVLEOHSDUDLJXDODUODWHPSHUDWXUD/DVFRPLGDV
recalentadas pueden tener grandes diferencias de
temperatura. Algunas áreas pueden estar extremadamente
calientes.
Si la comida no está suficientemente caliente después de
la cuenta regresiva, use Time Cook tiempo adicional para
recalentar.
49-40773-2
USO DEL MICROONDAS: Funciones del sensor
Funciones del sensor
15
USO DEL MICROONDAS:)XQFLRQHVGHO+RUQHDGR\$VDGR
Funciones del Horneado y Asado
El proceso de horneado o asado utiliza un elemento de calefacción para aumentar el aire del interior
GHO KRUQR 3XHGH HVWDEOHFHUVH FXDOTXLHU WHPSHUDWXUD GH KRUQR HQWUH ž) \ ž) 8Q YHQWLODGRU
hace circular ligeramente el aire por todo el horno, por encima y alrededor de la comida, produciendo
que se dore por fuera y que los interiores sean ricos y jugosos. Esta circulación de aire caliente es
llamada convección.
'HELGRDTXHHODLUHVHPDQWLHQHHQFRQVWDQWHPRYLPLHQWRDOQRSHUPLWLUVHODIRUPDFLyQGHXQDFDSD
de aire más frío alrededor de la comida, algunas comidas se cocinan más rápidamente que en un
horno de cocina normal.
Para conseguir mejores resultados..
8WLOLFHXQHVWDQWHHQODSRVLFLyQLQIHULRU\GHMHXQDEUHFKDGHDOPHQRVXQDSXOJDGDHQWUHHOSODWRGH
cocción y los laterales del horno. Para cocción a dos niveles exclusivamente, utilice ambos estantes.
El estante se necesita para la buena circulación del aire y para dorar.
9HDODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQDSDUDLQIRUPDFLyQVREUHXWHQVLOLRVUHFRPHQGDGRV
Posición correcta del estante.
Posición correcta del estante.
Horneado o asado con precalentamiento
1. Presione el botón BAKE KRUQHDU RROAST DVDU 2. Gire el dial para ajustar el tiempo del horno y presiónelo
para seleccionar. No introduzca el tiempo de horneado
D~Q (OWLHPSRGHFRFFLyQVHLQWURGXFLUiPiVDGHODQWH
XQDYH]TXHHOKRUQRVHKD\DUHFDOHQWDGR &RQVXOWHOD
sección siguiente Conversión Auto Recipe™.
3. Presione el botón START/PAUSE para empezar a
precalentar.
4. El horno dará una señal cuando esté recalentado. Si no
abre la puerta en menos de una hora, el horno se apagará
de forma automática.
5. Abra la puerta del horno y, con cuidado, introduzca la
comida en el mismo.
6. Cierre la puerta del horno. Gire el dial para ajustar el tiempo
de cocción y presione START/PAUSE para empezar a
cocinar.
7. Cuando se acabe de cocinar, el horno dará una señal y se
apagará.
NOTA: Podrá cambiar el tiempo de cocción en cualquier
momento durante la cocción girando el dial.
Podrá cambiar la temperatura del horno
en cualquier momento durante la cocción presionando el botón
POWER. Gire el dial para fijar la temperatura del horno y
presione el dial para seleccionar.
Para ver el tiempo de cocción y la
temperatura del horno durante el tiempo de cocinado, presione
el botón BAKE +RUQHDU Horneado o asado sin precalentamiento
1. Si su receta no necesita precalentar el horno, presione
el botón BAKE o ROAST. Consulte la sección siguiente
Conversión Auto Recipe™.
2. Gire el dial para ajustar la temperatura del horno y
presiónelo para seleccionar.
3. Gire el dial para ajustar el tiempo de cocción y presiónelo
para seleccionar.
4. Presione el botón START/PAUSE para poner el horno en
marcha.
NOTA: Podrá cambiar el tiempo de cocción en cualquier
momento durante la cocción girando el dial.
Podrá cambiar la temperatura del horno en cualquier momento
durante la cocción presionando el botón POWER. Gire el
dial para fijar la temperatura del horno y presione el dial para
seleccionar.
Para ver el tiempo de cocción y la temperatura del horno
durante el tiempo de cocinado, presione el botón BAKE
+RUQHDU Conversión Auto Recipe™
Cuando use el HORNEADO POR CONVECCIÓN, la función
de Conversión Auto Recipe™ convertirá automáticamente
las temperaturas de horneado regulares a temperaturas de
horneado por convección.
Cuando esta función se activa, el visor mostrará la leyenda
2))6(721\ODWHPSHUDWXUDUHDOFRQYHUWLGD UHGXFLGD Por ejemplo, si ingresa una temperatura regular de receta
de 350°F y oprime el botón START, el visor mostrará la
temperatura convertida de 325°F.
16
Esta función se puede apagar en el menú de opciones
OPTIONS. Consulte la sección Conversión Auto Recipe™ en
ODVHFFLyQ/DVRWUDVIXQFLyQHV
NOTA: Si el horneado es por convección y la función de
Conversión Auto Recipe™ está apagada, reduzca la
temperatura del horno 25°F de la que indique la receta para
evitar que se doren demasiado los alimentos horneados.
49-40773-2
Fast Bake KRUQHDGR UiSLGR OH RIUHFH ODV PHMRUHV IXQFLRQHV GH OD HQHUJtD GH PLFURRQGDV FRQ
OD FRFLQD SRU FRQYHFFLyQ /DV PLFURRQGDV FRFLQDQ OD FRPLGD GH IRUPD UiSLGD \ OD FLUFXODFLyQ GH
convección del aire caliente dora los alimentos de forma maravillosa. Puede programarse cualquier
temperatura entre los 225°F y los 450°F.
Para conseguir mejores resultados...
Correct shelf position
8WLOLFHXQHVWDQWHHQODSRVLFLyQLQIHULRU\GHMHXQHVSDFLRGHDOPHQRVXQDSXOJDGDHQWUHHOSODWRTXH
HVWpFRFLQDQGR\ORVODGRVGHOKRUQR8WLOLFHDPERVHVWDQWHV~QLFDPHQWHSDUDFRFLQDUDGRVQLYHOHV
El estante se necesita para la buena circulación del aire y para dorar.
9HDODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQDSDUDLQIRUPDFLyQVREUHXWHQVLOLRVUHFRPHQGDGRV
Ver la Sección Mejor Método de Cocción para determinar cuáles alimentos son apropiados para
cocinar usando Fast Bake.
Incorrect shelf position
Horneo rápido con precalentamiento
1. Presione el botón FAST BAKE.
2. Gire el dial para ajustar el tiempo del horno y presiónelo
para seleccionar. No introduzca el tiempo de cocción
FAST BAKE D~Q (OWLHPSRGHFRFFLyQVHLQWURGXFLUi
PiVDGHODQWHXQDYH]TXHHOKRUQRVHKD\DUHFDOHQWDGR 3UHVLRQHHOGLDORHOERWyQ67$573$86(SDUDHPSH]DUD
precalentar.
4. El horno dará una señal cuando esté recalentado. Si no
abre la puerta en menos de una hora, el horno se apagará
de forma automática.
5. Abra la puerta del horno y, con cuidado, introduzca la
comida en el mismo.
6. Cierre la puerta del horno. Gire el dial para ajustar el tiempo
de cocción y presiónelo para seleccionar. Presione el dial
o el botón START/PAUSE para empezar a cocinar.
7. Cuando se acabe de cocinar, el horno dará una señal y se
apagará.
NOTA: Podrá cambiar el tiempo de cocción en cualquier
momento durante la cocción girando el dial.
Podrá cambiar la temperatura del horno y el nivel de potencia
del microondas en cualquier momento durante la cocción
presionando el botón POWER. Gire el dial para fijar la
temperatura del horno y presione el dial para seleccionar.
/XHJRJLUHHOGLDOSDUDILMDUHOQLYHOGHOPLFURRQGDVGHKDVWD
4 y presione el dial para seleccionar. El nivel predeterminado
del horno es 4.
Para ver el tiempo de cocción y la temperatura del horno
durante el tiempo de cocción, presione el botón FAST BAKE
(Hornear rápido).
Ŷ5HYLVHODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQDSDUD
usar los utensilios correctos al usar Fast Bake.
ŶNo use utensilios metálicos con Fast Bake.
ŶReduzca el tiempo de cocinado de la receta
en 25%.
ŶVer la Sección Mejor Método de Cocción para determinar
cuáles alimentos son apropiados para cocinar usando Fast
Bake.
Horneo rápido sin precalentamiento
1. Si su receta no necesita precalentar el horno, presione el
botón FAST BAKE.
2. Gire el dial para ajustar la temperatura del horno y
presiónelo para seleccionar.
3. Gire el dial para ajustar el tiempo de cocción y presiónelo
para seleccionar.
4. Presione el dial o el botón START/PAUSE para poner el
horno en marcha.
NOTA: Podrá cambiar el tiempo de cocción en cualquier
momento durante la cocción girando el dial.
Podrá cambiar la temperatura del horno y el nivel de potencia
del microondas en cualquier momento durante la cocción
presionando el botón POWER. Gire el dial para fijar la
temperatura del horno y presione el dial para seleccionar.
/XHJRJLUHHOGLDOSDUDILMDUHOQLYHOGHOPLFURRQGDVGHKDVWD
4 y presione el dial para seleccionar. El nivel predeterminado
del horno es 4.
49-40773-2
USO DEL MICROONDAS: Función de horneado rápido
Función de horneado rápido
Para ver el tiempo de cocción y la temperatura del horno
durante el tiempo de cocción, presione el botón FAST BAKE
(Hornear rápido).
NOTA:
Ŷ$OJXQDVUHFHWDVUHTXLHUHQHOSUHFDOHQWDPLHQWR
Ŷ5HYLVHODVHFFLyQGH&RQVHMRVGH8WHQVLOLRVGH&RFLQDSDUD
usar los utensilios correctos al usar Fast Bake.
Ŷ1RXVHXWHQVLOLRVPHWiOLFRVFRQ)DVW%DNH
Ŷ9HUOD6HFFLyQ0HMRU0pWRGRGH&RFFLyQSDUDGHWHUPLQDU
cuáles alimentos son apropiados para cocinar usando Fast
Bake.
Ŷ5HGX]FDHOWLHPSRGHFRFLQDGRGHODUHFHWDHQ
17
USO DEL MICROONDAS: Consejos de utensilios de cocina.
18
Consejos de utensilios de cocina
Horneado o asado por convección
Se recomienda el uso de bandejas metálicas para todo tipo de productos horneados, pero especialmente cuando es
importante que estén dorados.
/DVEDQGHMDVFRQDFDEDGRVRVFXURVRPDWHVVRQPHMRUHVSDUDSDQHV\SDVWHOHVUHOOHQRV\DTXHDEVRUEHQFDORU\SURGXFHQXQ
exterior más crujiente.
/DVEDQGHMDVGHDOXPLQLREULOODQWHVVRQPHMRUHVSDUDSDVWHOHVJDOOHWDVRPDJGDOHQDV PXIILQV \DTXHODVPLVPDVUHIOHMDQHO
calor y ayudan a producir un exterior suavemente crujiente y tierno.
Las cazuelas o platos de horno de cristal o de cerámica acristalada son mejores para recetas de huevos y queso ya que el
cristal se limpia fácilmente.
Horneado rápido combinado
Se recomienda usar recipientes de cristal o cerámica acristalada. Asegúrese de que no usa artículos con decoraciones
PHWiOLFDV\DTXHSRGUtDQFDXVDUDUFRVHOpFWULFRV FKLVSDV FRQODVSDUHGHVRHOHVWDQWHGHOPLFURRQGDV(VWRSXHGHGDxDUORV
utensilios, el estante o el horno.
Pueden usarse utensilios de microondas de plástico resistente al calor VHJXURVSDUDXVRHQƒ) SHURQRVHUHFRPLHQGD
para comidas que necesiten estar doradas por completo ya que el plástico es un pobre conductor de calor.
Microondas
Horneado o Asado
de convección
Horneado
rápido combinado
Cristal resistente al calor, cerámica acristalada
(Pyrex®, Fire King®, Corning Ware®, etc.)
Sí
Sí
Sí
Metal
No
Sí
No
Cristal no resistente al calor
No
No
No
Plásticos aptos para microondas
Sí
No
Sí*
Films plásticos o envoltorios
Sí
No
No
Productos de papel
Sí
No
No
Paja, mimbre y madera
Sí
No
No
Utensilios
*8VDUVyORFRQXWHQVLOLRVSDUDPLFURRQGDVTXHSXHGDQVRSRUWDUƒ)GHWHPSHUDWXUD
49-40773-2
8VHODWDEODVLJXLHQWHSDUDVHOHFFLRQDUHOPHMRUPpWRGRSDUDFRFLQDU/DVUHFHWDVSXHGHQVHUDGDSWDGDVXVDQGRODWDEODDFRQWLQXDFLyQ
para determinar el modo de cocción apropiado.
Comidas
Microondas
Aperitivos
Sa lsas para mojar y untar
Snacks de pastelería
Bebidas
Salsas y acabados
Sopas y estofados
Carnes
'HVFRQJHODFLyQ
Asados
Aves
'HVFRQJHODFLyQ
Asados
Pescado y mariscos
'HVFRQJHODFLyQ
Cocción
Guisos
Huevos y queso
Revueltos, tortillas
4XLFKHVRXIOp
Vegetales, (frescos)
Panes
Magdalenas, pastel de té
Masa de levadura
/HYDGXUD
Postres
Pasteles, pasteles con capas y bundt
Cabello de angel y pasta fina
Flan y pudín
Galletas alargadas
Fruta
Pasteles rellenos y pastelería
'XOFHV
Vegetales blanqueados
Alimentos preparados congelados
9
9
9
9
9
Horneado
Asado Hornear rápido
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
9
USO DEL MICROONDAS: Mejor método de cocción
Mejor método de cocción
9
Conversiones de Recetas
Horneado rápido combinado
Al utilizar la función HORNEADO RÁPIDO COMBINADO, reduzca el tiempo de cocción indicado en la receta en un 25%.
Por ejemplo:8QDUHFHWDLQGLFDFRFLQDUXQDVDGRGXUDQWHPLQXWRVDž)
60 minutos x 0.25 = se ahorran 15 minutos.
Por lo tanto, el nuevo tiempo de cocción en el modo HORNEADO RÁPIDO será:
60 minutos – 15 minutos = 45 minutos.
49-40773-2
19
USO DEL MICROONDAS: Función Calentar
Función Calentar
/DIXQFLyQCALENTAR mantendrá calientes las comidas ya horneadas, a una temperatura óptima
SDUDVHUYLUODV&RPLHQFHVLHPSUHSRUFRPLGDFDOLHQWH8WLOLFHUHFLSLHQWHV\XWHQVLOLRVGHFRFLQDTXH
puedan resistir temperaturas de hasta 230ºF.
Para obtener mejores resultados...
8WLOLFHVLHPSUHHOHVWDQWHHQVXSRVLFLyQ³EDMD´DOFDOHQWDU(OHVWDQWHHVQHFHVDULRSDUDXQDEXHQD
circulación del aire e incluso para calentar de forma pareja.
Consulte la sección Consejos sobre instrumentos de cocina para obtener información sobre los
instrumentos de cocina aconsejados.
Correct shelf position
Incorrect shelf position
Calentar
1. Pulse el botón WARM (Calentar).
2. Gire el dial para seleccionar la temperatura del horno.
Consulte el gráfico y los consejos a continuación. Pulse el
dial para introducir la selección.
BAJO
0(',2
$/72
ISi se abre la puerta del horno durante la función “Calentar”,
DSDUHFHUiHQSDQWDOOD3$86( 3DXVD &LHUUHODSXHUWD\SXOVH
START/PAUSE (Inicio/Pausa).
Para hacer que los elementos secos estén crujientes:
ŶColoque los alimentos o los platos directamente en el
estante, en la posición inferior.
150°F
ƒ)
ƒ)
Ŷ8WLOLFHHODMXVWHLOW (BAJO).
3
XOVHHOGLDORHOERWyQ67$573$86( ,QLFLR3DXVD SDUD
comenzar a calentar.
ŶRevise qué tan crujiente está el alimento tras 45 minutos.
Añada tiempo, según se necesite.
Tabla de selección de temperatura
Tipo de alimento
Ajuste
Húmedo/Crujiente
Pan, rollitos duros
0HGLXP 0HGLR &ULVS &UXMLHQWH
Pan, rollitos blandos
0HGLXP 0HGLR 0RLVW +~PHGR
Guisados
0HGLXP 0HGLR 0RLVW +~PHGR
+LJK $OWR &ULVS &UXMLHQWH
Carnes* y pescados
0HGLXP 0HGLR &ULVS &UXMLHQWH
Panqueques, wafles
+LJK $OWR &ULVS &UXMLHQWH
+LJK $OWR &ULVS &UXMLHQWH
Papas, horneadas
+LJK $OWR &ULVS &UXMLHQWH
Papas, puré
0HGLXP 0HGLR 0RLVW +~PHGR
Carne de ave
+LJK $OWR 0RLVW +~PHGR
Trozos de tortilla
/RZ %DMR &ULVS &UXMLHQWH
0HGLXP 0HGLR 0RLVW +~PHGR
Comidas fritas
Pizza
Verduras
* La USDA/FSIS recomienda una temperatura interna de 145°F como el nivel de cocción mínimo
de res. Utilice un termómetro portátil de carne para revisar las temperaturas internas.
Trucos para alimentos crujientes:
Trucos para alimentos húmedos:
Ŷ 1RFXEUDORVDOLPHQWRV
Ŷ &XEUDORVDOLPHQWRVFRQXQDWDSDRFRQ
papel de aluminio.
Ŷ 1RXWLOLFHFRQWHQHGRUHVQLHQYROWXUDV
de plástico.
20
Ŷ 1RXWLOLFHFRQWHQHGRUHVQLHQYROWXUDV
de plástico.
49-40773-2
Help (ayuda)
El botón HELP le muestra información de características y
consejos prácticos.
Presione HELP, gire el dial para seleccionar una función y
presione el dial para seleccionar.
Señal de final de cocción
Para recordarle que tiene comida en el horno, aparecerá el
mensaje YOUR FOOD IS READY (Su comida está lista)
y sonará un pitido cada minuto hasta que abra la puerta del
horno o presione el botón CLEAR/OFF.
Resume (Continuar)
El programa de cocción que acaba de utilizar permanece en
memoria durante 5 minutos. Tras esto, es necesario que inicie
el programa de nuevo. Para desactivar esta función, consulte
la sección Mensaje “Más tiempo”.
1. Si necesita cocinar los alimentos un poco más, puede
UHLQLFLDUHOKRUQRSXOVDQGRHOERWyQ67$573$86( ,QLFLR
3DXVD RHOGLDOVHOHFWRU
5(680(&22.,1* &RQWLQXDUFRFFLyQ DSDUHFHUiHQ
pantalla y el horno se reiniciará inmediatamente al 10 del
tiempo original.
Reloj
Presione para introducir la hora del día o para revisar la hora
de día mientras cocina.
1. Presione el botón CLOCK (reloj).
2. Gire el dial para configurar las horas. Presione el dial para
seleccionar.
3. Gire el dial para configurar los minutos. Presione el dial para
seleccionar.
El reloj fue diseñado para apagar la unidad cuando quede
inactiva durante 30 segundos, a fin de minimizar el uso de
la energía en suspensión. El reloj se encenderá cuando la
unidad se encuentre en uso, la puerta sea abierta, la tecla
&$1&(/2)) &DQFHODU$SDJDU VHDSUHVLRQDGDRHOGLDOVHD
presionado. No hay una opción de anulación disponible basada
HQORVUHTXLVLWRVGHHQHUJtD'2(
USO DEL MICROONDAS: Otras funciones
Otras funciones
4. Gire el dial para seleccionar AM o PM. Presione el dial para
seleccionar.
Start/Pause (inicio / pausa)
Además de poner en marcha muchas funciones, START/
PAUSE le permite parar la cocción sin tener que abrir la puerta
o borrar lo que haya en pantalla.
Clear/Off (borrar/apagado)
Presione el botón CLEAR/OFF para parar y cancelar la
cocción en cualquier momento.
Bloqueo del control
Puede bloquear el panel de control para evitar que enciendan
el horno accidentalmente durante la limpieza o paraque no lo
utilicen los niños.
49-40773-2
Para bloquear y desbloquear los controles, apriete y mantenga
el botón CLEAR/OFF durante un período de tres segundos.
Con el panel de control bloqueado aparecerá brevemente el
mensaje CONTROL LOCKED cada vez que se apriete un
ERWyQRHOGLDO (OEORTXHRGHOFRQWUROQRIXQFLRQDFRQ9(17
)$1 ([WUDFWRU \685)$&(/,*+7 /X]GHOD6XSHUILFLH 21
USO DEL MICROONDAS: Otras funciones
Otras funciones
Luz nocturna automática
La luz nocturna automática puede configurarse para que se
encienda y se apague a horas determinadas.
1. Presione el botón OPTIONS y gire el dial para seleccionar
AUTO NITE LIGHT. Presione el dial para seleccionar.
2. Gire el dial para seleccionar SET TIMES. Presione el dial
para seleccionar.
3. Introduzca la hora del día para que la luz se encienda
girando el dial para seleccionar la hora, minutos y AM o PM.
Presione el dial para seleccionar cada cambio que quiera
realizar.
4. Introduzca la hora del día para que la luz se apague girando
el dial para seleccionar la hora, minutos y AM o PM.
Presione el dial para seleccionar cada cambio que quiera
realizar.
NOTA: El indicador NITE (noche) se encenderá cuando la luz
de noche se haya fijado para operar.
Para revisar la configuración de la luz nocturna, gire el dial
para seleccionar REVIEW SETTINGS después de seleccionar
la opción Auto Nite Light. Presione el dial para seleccionar.
Para borrar la configuración de la luz nocturna, gire el dial para
seleccionar CLEAR SETTINGS después de seleccionar la
opción Auto Nite Light. Presione el dial para seleccionar.
Ajuste de temp. de cocción
Se utiliza para hacer que el horno ajuste las temperaturas
establecidas automáticamente en 5, 10, 15, 20 o 25 grados.
1. Presione el botón OPTIONS y gire el dial para seleccionar
BAKE TEMP ADJUST Pulse el dial para introducir la
selección.
2. Gire el dial para seleccionar NO CHANGE 6LQFDPELRV 5, 10, 15, 20 o 25 grados y pulse para introducir la
selección.
Volumen de señal de aviso
El volumen de la señal de aviso puede ajustarse.
1. Presione el botón OPTIONS y gire el dial para seleccionar
BEEPER VOLUME. Presione el dial para seleccionar.
2. Gire el dial para seleccionar desde mudo a alto. Presione el
dial para seleccionar.
NOTA: (OLQGLFDGRU087( VLOHQFLRVR VHHQFHQGHUiFXDQGRHO
volumen se haya fijado en silencioso.
Selección de Conversión Auto Recipe™
Cuando esta función se activa, convertirá automáticamente
las temperaturas de horneado regulares a temperaturas de
horneado por convección. Consulte la sección Conversión Auto
5HFLSHŒHQODVHFFLRQ³$FHUFDGHODVIXQFWLRQHVGH+RUQHDGR
y Asado“.
1. Presione el botón OPTIONS y gire el dial para seleccionar
OFFSET. Presione el dial para seleccionar.
2. Gire el dial para seleccionar CONVECTION BAKE TEMP
OFFSET-ON/OFF &RPSHQVDFLyQGHWHPSGHKRUQHDGR
SRUFRQYHFFLyQDFWLYDGRGHVDFWLYDGR 3UHVLRQHHOGLDOSDUD
seleccionar.
Idioma de pantalla
El idioma del menú de pantalla puede configurarse para Inglés
y Español.
1. Presione el botón OPTIONS y gire el dial para seleccionar
DISPLAY LANGUAGE. Presione el dial para seleccionar.
2. Gire el dial para seleccionar ENGLISH o SPANISH.
Presione el dial para seleccionar.
Velocidad de pantalla
/DYHORFLGDGGHOPHQ~GHSDQWDOODSXHGHFDPELDUVH
1. Presione el botón OPTIONS y gire el dial para seleccionar
DISPLAY SPEED. Presione el dial para seleccionar.
2. Gire el dial para seleccionar desde el más lento al más
rápido. Presione el dial para seleccionar
22
49-40773-2
(Cont.)
Medidas
Pueden configurarse las medidas para que aparezcan de la
IRUPDSRUGHIHFWR LQJOHVD RPpWULFD
1. Pulse el botón OPTIONS (Opciones) y gire el dial para
seleccionar MEASURES (Medidas). Pulse el dial para
introducir la selección.
2. Gire el dial para seleccionar DEFAULT (Preestablecido) o
METRIC (Métrico) y pulse para introducir la selección.
Mensaje “Más tiempo”
8QDYH]TXHVHFRPSOHWHODFRFFLyQSXHGHPRVWUDUVHXQ
mensaje que le ofrezca la opción de cocinar la comida durante
más tiempo utilizando la misma configuración. Consulte la
sección Continuar.
1. Pulse el botón OPTIONS (Opciones) y gire el dial para
seleccionar MORE TIME MESSAGE (Mensaje “Más
tiempo”). Pulse el dial para introducir la selección.
2. Gire el dial para seleccionar MESSAGE ON (Mensaje
activado) o MESSAGE OFF (Mensaje desactivado) y
pulse para introducir la selección.
Luz de superficie
Presione SURFACE LIGHT una vez para una iluminación
fuerte, dos veces para la luz nocturna o una tercera vez para
apagarla
Temporizador
El Timer (temporizador) funciona como temporizador de
minutos y se puede usar en cualquier momento, incluso
cuando el horno está en marcha.
1. Presione el botón TIMER.
2. Gire el dial para configurar los minutos. Presione el dial para
seleccionar.
3. Gire el dial para configurar los segundos. Presione el dial
para seleccionar.
4. Presione el dial o TIMER para empezar.
Para cancelar, presione el botón TIMER.
Cuando se acabe el tiempo, el horno dará una señal. Para
apagar la señal del temporizador, presione TIMER.
NOTA: El indicador del temporizador se encenderá mientras el
temporizador esté en marcha.
USO DEL MICROONDAS: Otras funciones
Otras funciones
Dispositivo giratorio activado/desactivado
Para obtener mejores resultados de cocción, deje el dispositivo
giratorio activado. Puede desactivarse si va a cocinar platos
grandes.
1. Pulse el botón TURNTABLE ON/OFF (Dispositivo
giratorio activado/ desactivado).
2. Gire el dial para seleccionar ON (Activado) u OFF
(Desactivado). Pulse el dial para introducir la selección.
En determinadas ocasiones el dispositivo giratorio puede
calentarse demasiado como para tocarlo.
Tenga cuidado al tocarlo durante la cocción o posteriormente
a ella.
Ventilador extractor
El extractor aspira el vapor de agua y otros vapores de la
encimera de la cocina.
Pulse VENT FAN (Ventilador extractor) una vez para alta
velocidad de ventilación, dos veces para velocidad media, tres
veces para velocidad baja y una cuarta vez para desactivar el
ventilador.
NOTA: El indicador del extractor estará prendido mientras el
extractor esté operando.
Extractor automático
El extractor automático protege al horno microondas del calor
excesivo que surge de la estufa debajo de éste. Se enciende
de forma automática si percibe demasiado calor.
Si ha encendido el extractor, es posible que sienta que no
lo puede apagar. El extractor se apagará automáticamente
49-40773-2
cuando las partes internas se hayan enfriado. Puede
permanecer encendido hasta por 30 minutos o más después
de que los controles de la estufa y del microondas se hayan
apagado.
23
CUIDADO Y LIMPIEZA
Horno
Consejos prácticos
Para mantener el interior fresco pásele un paño con una
solución de agua y bicarbonato sódico de cuando en cuando.
Asegúrese de que esté apagado (en off) antes de limpiar
cualquier parte de este horno.
Cómo limpiar el interior
Paredes, suelo, ventana interior y piezas de plástico de la
puerta
Algunas salpicaduras pueden limpiarse con un papel
WRDOODRWUDVSXHGHQQHFHVLWDUXQSDxRK~PHGR4XLWHODV
salpicaduras con un paño enjabonado y aclare con un paño
húmedo. No use limpiadores abrasivos ni utensilios afilados en
las paredes del horno.
Nunca use un limpiador comercial de horno en ninguna parte
del microondas.
Base giratoria extraíble y soporte de base giratoria
Para que no se rompa, no ponga el plato giratorio en agua
MXVWRGHVSXpVGHFRFLQDU/tPSLHORFRQFXLGDGRHQDJXDWLELD
con jabón o en el lavavajillas. El plato giratorio y el soporte
pueden romperse si se caen. Recuerde no hacer funcionar el
horno en el modo microondas sin el dispositivo giratorio y el
soporte colocados en su lugar.
Estantes
/tPSLHORFRQDJXD\MDEyQVXDYHRHQHOODYDYDMLOODV
No la limpie si tiene un horno autolimpiable.
Cómo limpiar el exterior
No recomendamos el uso de
limpiadores con amoniaco o
alcohol, ya que pueden dañar el
aspecto del horno microondas.
Si opta por usar un limpiador
casero, primero aplique el
limpiador directamente en un
paño limpio, luego limpie el área
sucia.
Acero inoxidable (en algunos modelos)
La caja
/LPSLHODSDUWHH[WHUQDGHOKRUQRGHPLFURRQGDVFRQXQSDxR
humedecido con agua jabonosa. Enjuáguela y luego séquela.
Pásele un paño humedecido limpio a la ventana para limpiarla.
8WLOLFHXQSDxRVXDYHOLPSLR\OLJHUDPHQWHKXPHGHFLGR\D
continuación, seque bien toda la zona.
El panel de control
Pásele un paño humedecido para limpiar. Seque
completamente. No use esprays limpiadores, grandes
cantidades de detergente y agua, abrasivos u objetos filosos
sobre el panel, ya que lo podría dañar. Algunas toallas de
papel podrían también dañar el panel de control.
Panel de puerta
Antes de limpiar el panel de puerta frontal, asegúrese de que
sabe qué tipo de panel tiene. Consulte el octavo dígito del
Q~PHURGHPRGHOR³6´HVDFHURLQR[LGDEOH³/´HV&OHDQ6WHHO\
“B”, “W” o “C” son colores plásticos.
24
El panel de acero inoxidable puede limpiarse con Stainless
Steel Magic o un producto similar, utilizando un paño suave y
limpio. Aplique el limpiador de superficies de acero inoxidable
cuidadosamente para evitar tocar las piezas de plástico que
rodean al acero. No utilice cera, pulimento, lejía ni productos
que contengan clorina en acabados en acero inoxidable.
Paneles plásticos de color
Los sellos de la puerta
Es importante mantener el área donde la puerta se sella con
el horno de microondas limpia. Solamente use detergentes no
abrasivos suaves aplicados con una esponja limpia o con un
paño suave. Enjuague bien.
El fondo
/LPSLHODJUDVD\HOLPLQHHOSROYRGHOIRQGRDPHQXGR8VH
una solución de agua cálida y
detergente.
49-40773-2
Luz de encimera/luz nocturna
Cámbiela por una bombilla halógena de 120 voltios, 40
watt (max.). Pida WB36X10213 de su suministrador GE
Appliances.
4. Enrosque la nueva bombilla, luego levante la cubierta y
vuelva a poner el tornillo. Conecte el horno a la corriente
eléctrica.oven..
1. Para cambiar la luz de encimera/luz nocturna, primero
desconecte la corriente del fusible principal o del panel de
diferencial o estire del enchufe.
4XLWHHOWRUQLOORGHOODWHUDOGHODFXELHUWDGHOFRPSDUWLPLHQWR
de la bombilla y baje la cubierta hasta
que pare.
4XLWHHOWRUQLOOR
3. Asegúrese que la bombilla está fría antes de retirarla.
Rompa el sello adhesivo desenroscando con cuidado la
bombilla.
CUIDADO Y LIMPIEZA
Cambio de Bombillas
Función de Escape
Ventilador extractor
El ventilador extractor tiene dos filtros de metal reutilizables.
Filtro de carbón vegetal
HQDOJXQRVPRGHORV
/RVPRGHORVTXHKDFHQUHFLUFXODUHODLUHGHQXHYRDOD
habitación usan un filtro de carbón vegetal
Filtros de extractor reutilizables
HQWRGRVORVPRGHORV Filtros de extractor reutilizables
/RVILOWURVPHWiOLFRVDWUDSDQODJUDVDOLEHUDGDSRUODFRPLGDHQ
la cocina encimera. También evitan que las llamas de la cocina
encimera puedan dañar en interior del horno.
Por esta razón, los filtros deben estar siempre en su lugar
FXDQGRVHHVWpXVDQGRODFDPSDQD/RVILOWURVGHOH[WUDFWRU
deben limpiarse una vez al mes o según sea necesario.
Cómo quitar y limpiar los filtros
Para quitarlos, usando las lengüetas, deslícelos hacia atrás.
Estire hacia abajo y afuera.
Para limpiar los filtros del extractor, empápelos y páselos de
un lado a otro en agua con detergente. No use amoniaco ni
productos que lo contengan ya que oscurecerían el metal.
Se pueden cepillar ligeramente para quitar suciedad pegada.
Aclárelos, sacúdalos y déjelos secar antes de volverlos a
poner.
49-40773-2
Para volver a colocarlos, deslice los filtros en los marcos por
la parte trasera de cada apertura. Presione hacia arriba y hacia
la parte frontal para ajustarlos en su lugar.
25
CUIDADO Y LIMPIEZA
Función de Escape
(Cont.)
Filtros de carbón vegetal
El filtro de carbón vegetal no puede limpiarse. Debe
cambiarse por otro. Pida el recambio No. WB02X10943 de
su suministrador GE Appliances.
Si el modelo no realiza la extracción al exterior, el aire
recirculará a través de un filtro de carbón vegetal no
reutilizable que ayuda a quitar olores y humos.
El filtro de carbón vegetal debería cambiarse cuando está
YLVLEOHPHQWHVXFLRRGHVFRORULGR QRUPDOPHQWHWUiVR
PHVHVVHJ~QHOXVR &RQVXOWH³.LWVRSFLRQDOHV´HQODSiJLQD
12 para obtener más información.
Cómo quitar el filtro de carbón vegetal
Para quitar el filtro de carbón vegetal, primero desconecte la
corriente del fusible principal o del panel de diferencial o estire
del enchufe. Retire la parrilla superior quitando los dos tornillos
que lo sujetan.Puede ser que necesite abrir las puertas del
armario para quitar los tornillos.
/HYDQWHHOILOWURGHODSDUWHLQIHULRUKDVWDTXHVHOLEHUHGHODV
SHVWDxDV'HVOLFHHOILOWURKDFLDDEDMR\KDFLDIXHUD
Retire la parrilla superior quitando
los dos tornillos que lo sujetan.
Cómo instalar el filtro de carbón vegetal
Para instalar un nuevo filtro de carbón vegetal, retire el
plástico y cualquier otro envoltorio del nuevo filtro.
Introduzca la parte superior del filtro hacia arriba y dentro de
los huecos en la parte interior de la apertura superior. Apriete
la parte inferior del filtro hacia dentro hasta que se coloque tras
las pestañas.
26
49-40773-2
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite solicitar
reparaciones.
Problema
Posibles causas
Qué Hacer
El reloj fue diseñado para apagar
la unidad cuando quede inactiva
durante 30 segundos, a fin de
minimizar el uso de la energía en
suspensión.
El reloj se encenderá cuando la unidad se encuentre
en uso, la puerta sea abierta. No hay una opción
de anulación disponible basada en los requisitos de
HQHUJtD'2(
Puede que se haya fundido un
fusible de su casa o que haya
saltado el diferencial.
Cambie el fusible o reconecte el diferencial.
Apagón de corriente.
'HVHQFKXIHHOKRUQRPLFURRQGDVGHODFRUULHQWH\
vuélvalo a enchufar.
El enchufe no está completamente
insertado en la toma de corriente
de la pared.
Asegúrese de que el enchufe de 3 clavijas del horno
esté completamente insertado en la toma de corriente
de la pared.
La puerta no está cerrada del
todo.
Abra la puerta y ciérrela por completo.
La puerta no está cerrada del
todo.
Abra la puerta y ciérrela por completo.
No se presionó el botón START/
PAUSE tras seleccionar el modo
de cocción.
Presione START/PAUSE.
Ya se ha realizado otra selección
en el horno y no se presionó
CLEAR/OFF para cancelarla.
Presione CLEAR/OFF.
No se introdujo un tiempo de
cocción tras apretar TIME COOK.
Asegúrese de introducir un tiempo de cocción tras
presionar TIME COOK.
Se presionó CLEAR/OFF sin
querer.
Vuelva a programar la cocción y presione START/
PAUSE.
No se introdujo el peso tras
seleccionar AUTO DEFROST o
FAST DEFROST.
Asegúrese de introducir el peso de la comida tras
seleccionar AUTO DEFROST o FAST DEFROST.
No se introdujo el tipo de comida
tras apretar AUTO COOK.
Asegúrese de entrar un tipo de comida.
CONTROL BLOQUEADO
para (CONTROL LOCKED)
aparece en la pantalla
El control ha sido bloqueado.
Presione y mantenga CLEAR/OFF durante 3 segundos
desbloquear el control.
OVEN TOO HOT FOR
SENSOR COOKING USING ALTERNATE
METHOD appears on
display
One of the sensor cooking buttons
was pressed when the temperature
inside the oven was greater than
200° F
7KHVHIHDWXUHVZLOOQRWRSHUDWHZKHQWKHRYHQLVKRW
7KHRYHQZLOODXWRPDWLFDOO\FKDQJHWRFRRNE\WLPH
IROORZWKHGLUHFWLRQVLQWKHGLVSOD\ RURQFHWKHRYHQLV
FRROHQRXJKWKHVHQVRUIHDWXUHVZLOOIXQFWLRQQRUPDOO\
El suelo del horno está
templado incluso cuando
el horno no se ha usado
La luz de la encimera está situada
bajo el suelo del horno. Cuando
la luz está puesta, el calor que
produce puede calentar el suelo
del horno.
Esto es normal.
Se escucha un pitido con
un tono inusualmente
bajo
Ha intentado cambiar el nivel nivel
de potencia cuando no estaba
permitido.
Muchas de las funciones del horno están
preseleccionadas y no pueden cambiarse.
El horno desprende un
olor a humo y sale humo
gris después de usar la
función de horneado
Se están quemando aceites en
la cavidad de acero inoxidable
después de usar la función de
Horneado las primeras veces.
Esto es normal.
La pantalla está en blanco.
El horno no se pone en
marcha
El panel de control está
encendido pero el horno
no se pone en marcha
49-40773-2
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
27
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
28
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
Problema
Posibles causas
Qué Hacer
La comida se dora mucho
más rápido en la parte de
arriba que en la parte de
abajo
La parrilla se fijó en la posición
alta.
Siempre use la parrilla en la posición baja.
La temperatura del horno
fluctúa durante la cocción
El elemento de cocina pasa
de encendido a apagado para
mantener la temperatura del horno
en los niveles deseados.
Esto es normal.
El extractor del
horno se enciende
automáticamente
El extractor se enciende
automáticamente para proteger
el microondas si percibe que
hay demasiado calor en la estufa
debajo de éste.
Esto es normal.
Durante los niveles de Bake
(horneado) o Fast Bake (horneado
rápido), después de precalentado,
el extractor del horno se
encenderá para enfriar los
componentes del horno.
Esto es normal.
Se abrió la puerta mientras se
utilizaba la función de sensor
antes antes de que pudiera
detectarse el vapor.
No abra la puerta hasta que se perciba el vapor y
aparezca en pantalla la cuenta de tiempo regresiva.
El vapor no se detectó en la
cantidad de tiempo máxima.
8WLOLFH7LPH&RRN 7LHPSRGHFRFFLyQ SDUDFDOHQWDU
durante más tiempo.
Aparece en la pantalla
SENSOR ERROR (Error de
sensor)
49-40773-2
Cosas normales de su horno microondas
Ŷ +XPHGDGHQODSXHUWD\SDUHGHVGHOKRUQRDOFRFLQDU)URWH
la humedad con una toallita de papel o un paño suave.
Ŷ +XPHGDGHQWUHORVSDQHOHVGHODVSXHUWDVGHOKRUQRDO
FRFLQDUGHWHUPLQDGRVDOLPHQWRV/DKXPHGDGVHGLVLSDUi
poco después de terminar de cocinar.
Ŷ (OYDSRUVHHVFDSDSRUODSXHUWD
Ŷ 8QDOX]GHUHIOH[LyQDOUHGHGRUGHODSXHUWDRHQODSHULIHULD
de la caja del horno.
Ŷ /DOX]GHOKRUQRVHGHELOLWD\HOVRQLGRGHOVRSODGRUFDPELD
cuando se usan niveles de potencia diferentes al alto.
Ŷ 8QVRQLGRVRUGRGHJROSHFXDQGRHOKRUQRGHPLFURRQGDV
está en operación.
Ŷ 6HSXHGHQRWDUXQDLQWHUIHUHQFLDGHWHOHYLVLyQ\UDGLR
mientras se usa el horno de microondas. Similar a la
interferencia casada por otros electrodomésticos, lo cual no
indica un problema. Conecte el horno de microondas en un
tomacorriente de un circuito diferente, mueva la televisión o
el radio tan lejos del horno de microondas como sea posible
o inspeccione la posición de la antena de la televisión o el
radio.
Ŷ /DSDQWDOODIXHGLVHxDGDSDUDDSDJDUVHFXDQGRODXQLGDG
quede inactiva durante 30 segundos, a fin de minimizar
HOXVRGHHQHUJtDHQPRGRGHVXVSHQVLyQ/DSDQWDOODVH
encenderá cuando el control esté en uso o cuando se abra
la puerta.
Ŷ (OYHQWLODGRURSHUDPLHQWUDVHOKRUQRGHPLFURRQGDVHVWi
operando. El ventilador no se apagará ni se puede apagar
hasta que el horno de microondas se apague.
Ŷ Calentar, horneado por convección, asado por convección
y horneado rápido combinado tienen un tiempo de
FRFFLyQPi[LPRGHPLQXWRV KRUDV\PLQXWRV Cuando el tiempo de cocción máximo se alcanza, el horno
automáticamente indicará que la cocción finalizó y apagará
el elemento de cocción.
DECLARACIÓN DE INTERFERENCIA POR RADIOFRECUENCIA DE LA FEDERAL
COMMUNICATIONS COMMISSION (COMISIÓON FEDERAL DE COMUNICACIONES)
(EE.UU. ÚNICAMENTE)
Este equipamiento genera y utiliza energía de frecuencia ISM
y si no es instalado y usado de forma adecuada, estando en
estricto cumplimiento con las instrucciones del fabricante,
podrá generar interferencia en la recepción de radio y
televisión. Fue evaluado de forma específica y se comprobó
que cumple con los límites de Equipamientos ISM, de
acuerdo con la parte 18 de las Reglas de la FCC, que fueron
diseñadas para brindar una instalación residencial.
Sin embargo, no se garantiza que no se presenten
interferencias en una instalación en particular. Si este
equipamiento genera interferencias en la recepción de
radio o televisión, lo que se puede comprobar encendiendo
y apagando el equipo, se aconseja al usuario que intente
corregir la interferencia a través de una de las siguientes
medidas:
49-40773-2
Ŷ5HRULHQWHODDQWHQDUHFHSWRUDGHODUDGLRRHOWHOHYLVRU
Ŷ5HXELTXHHO+RUQR0LFURRQGDVHQUHODFLyQDOUHFHSWRU
Ŷ$OHMHHOKRUQRPLFURRQGDVGHODSRVLFLyQGHOUHFHSWRU
Ŷ(QFKXIHHOKRUQRPLFURRQGDVHQXQWRPDFRUULHQWHGLIHUHQWH
de modo que el horno microondas y el receptor estén en
diferentes recepciones de códigos.
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
El fabricante no es responsable por ninguna interferencia
de radio o TV generada por modificaciones no autorizadas
sobre este horno microondas. Es responsabilidad del usuario
corregir tales interferencias.
29
GARANTÍA
Garantía de Horno Microondas GE Appliances
GEAppliances.com
Todos los servicios de garantía los proporcionan nuestros Centros de Reparación de Fábrica o nuestros técnicos
Customer Care® autorizados. Pare concertar una cita de reparación, en línea, 24 horas al día, visite GEAppliances.com,
ROODPHDO*(&$5(6 &XDQGROODPHSDUDVROLFLWDUVHUYLFLRSRUIDYRUWHQJDDPDQRHOQ~PHURGH
serie y el número de modelo.
Para realizar el servicio técnico de su electrodoméstico, se podrá requerir el uso de datos del puerto de abordaje para su diagnóstico.
Esto da al técnico del servicio de fábrica de GE Appliances la habilidad de diagnosticar de forma rápida cualquier problema con
su electrodoméstico, y de ayudar a GE Appliances a mejorar sus productos al brindarle a GE Appliances la información sobre su
electrodoméstico. Si no desea que los datos de su electrodoméstico sean enviados a GE Appliances, solicitamos que le indique a su
técnico no entregar los datos a GE Appliances en el momento del servicio.
Durante el
período de
GE Appliances reemplazará
Un año
Cualquier recambio del horno microondas que falle debido a un defecto en sus materiales
'HVGHODIHFKDGH RHQVXIDEULFDFLyQ'XUDQWHHVWDgarantía limitada de un año, GE proporcionará, sin costo
compra original
adicional, mano de obra y servicio relacionado para reemplazar las partes defectuosas.
Cinco años
El magnetrón, el tubo magnetrón fallase debido a un defecto en sus materiales o en
'HVGHODIHFKDGH VXIDEULFDFLyQ'XUDQWHHVWRVcinco años adicionales de garantía limitada, usted será
compra original
responsable de cualquier costo de mano de obra o servicio a domicilio.
Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con
la garantía deberá contar con la prueba de la fecha original de compra.
Lo que GE Appliances no cubrirá:
Ŷ 9LDMHVGHUHSDUDFLyQDVXKRJDUSDUDHQVHxDUOHFyPR
usar el producto.
Ŷ ,QVWDODFLyQRHQWUHJDLQDSURSLDGDRPDQWHQLPLHQWR
impropio.
Ŷ 3URGXFWRQRDFFHVLEOHSDUDIDFLOLWDUHOVHUYLFLRUHTXHULGR
Ŷ )DOORVGHOSURGXFWRVLKD\DEXVRPDOXVR SRUHMHPSOR
chispas dentro de horno microondas del estante metálico/
SDSHOGHDOXPLQLR RXVRSDUDRWURVSURSyVLWRVTXHORV
propuestos, o si se usa con fines comerciales.
Ŷ 5HHPSOD]RGHERPELOODVGHODOX]GHODHVWXID
Ŷ 5HHPSOD]RGHIXVLEOHVGHVXKRJDURUHDMXVWHGHORV
diferenciales.
Ŷ 'DxRDOSURGXFWRFDXVDGRSRUDFFLGHQWHIXHJR
LQXQGDFLRQHVRDFWRVGH'LRV
Ŷ 'DxRLQFLGHQWDORFRQVHFXHQFLDODVXSURSLHGDGFDXVDGR
por posibles defectos con el aparato.
Ŷ &DXVDUGDxRVGHVSXpVGHODHQWUHJD
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS
Su único y exclusivo derecho es la reparación del producto, tal y como se indica en esta Garantía limitada.
Cualquier garantía implícita, incluyendo las garantías implícitas de comerciabilidad o adecuación para un fin
determinado, están limitadas a un año o el período de tiempo más breve permitido por la ley.
Esta garantía se extiende al comprador original y cualquier comprador posterior de productos comprados para uso
UHVLGHQFLDOGHQWURGH(VWDGRV8QLGRV6LHOSURGXFWRHVWiVLWXDGRHQXQiUHDTXHQRGLVSRQHGHVHUYLFLRSRUSDUWH
de un proveedor de servicio autorizado de GE, podría tener que hacerse cargo de los costes de envío o bien podría
solicitársele que lleve el producto a una centro de servicio de GE autorizado para realizar la reparación. En Alaska, la
garantía excluye el costo de envío o las visitas de servicio a su casa.
Algunos estados no permiten la exclusión o limitación de daños incidentales o consecuenciales. Esta garantía le
proporciona derechos legales específicos, y puede tener otros derechos que pueden variar de un estado a otro. Para
conocer los derechos legales de su estado, consulte con su oficina local de asuntos del consumidor o al procurador
general de su estado.
Garantizador: GE Appliances, a Haier company
Garantías Extendidas: Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales
que están disponibles mientras su garantía aún está vigente. Puede acceder a la misma a través de Internet en
cualquier momento en
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
ROODPDQGRDOGXUDQWHHOKRUDULRFRPHUFLDO/RV6HUYLFLRVSDUDORV*($SSOLDQFHVD~QHVWDUiQ
disponibles cuando su garantía caduque.
30
49-40773-2
ACCESORIOS
Accesorios
¿Busca Algo Más?
¡GE Appliances ofrece una variedad de accesorios
para mejorar sus experiencias de cocción y
mantenimiento!
Refer to the Consumer Support page for phone numbers
DQGZHEVLWHLQIRUPDWLRQ
Estos y otros productos están disponibles en su
distribuidor GE Appliances por un costo adicional:
Kits de panel de relleno
Kits de filtros
Ŷ JX40WH—Blanco
Ŷ JX81D—Kit de filtro de carbón vegetal de
Ŷ JX41—Negro
recirculación
Al cambiar la tapa de una cocina encimera de 36” los kits de
paneles de relleno ocupan el espacio adicional proveyendo un
aspecto de montaje a medida.
/RVNLWVGHILOWURVVHXVDQFXDQGRHO
horno no puede tener una salida al
exterior.
Sólo para instalarse entre armarios, no pueden instalarse al
final de los armarios. Cada kit contiene dos paneles de relleno
de 3”.
/RVNLWVGHILOWURVHVWiQGLVSRQLEOHV
a un costo adicional en su
abastecedor GE. Para pedir, llame
a GE Appliances o visite nuestro
sitio Web, GEAppliances.com.
49-40773-2
-;'
JX40, JX41
31
SOPORTE PARA EL CONSUMIDOR
Soporte para el Consumidor
Sitio Web de GE Appliances
¢'HVHDUHDOL]DUXQDFRQVXOWDRQHFHVLWDD\XGDFRQVXHOHFWURGRPpVWLFR"£,QWHQWHDWUDYpVGHO6LWLR:HEGH*($SSOLDQFHVODV
KRUDVGHOGtDFXDOTXLHUGtDGHODxR8VWHGWDPELpQSXHGHFRPSUDUPiVHOHFWURGRPpVWLFRVPDUDYLOORVRVGH*($SSOLDQFHV\
aprovechar todos nuestros servicios de soporte a través de Internet, diseñados para su conveniencia.
(Q((88GEAppliances.com
Registre su Electrodoméstico
£5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUi
una mejor comunicación y un servicio más puntual de acuerdo con los términos de su garantía, en caso de surgir la necesidad.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado.
(Q((88GEAppliances.com/register
Servicio Programado
El servicio de reparación de expertos de GE Appliances está a sólo un paso de su puerta. Conéctese a través de Internet y
programe su servicio a su conveniencia cualquier día del año.
(Q((88GEAppliances.com/ge/service-and-support/service.htm o comuníquese al 800.432.2737 durante el horario de
atención comercial.
Garantías Extendidas
Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su
JDUDQWtDD~QHVWiYLJHQWH/DSXHGHDGTXLULUHQFXDOTXLHUPRPHQWRDWUDYpVGH,QWHUQHW/RVVHUYLFLRVGH*($SSOLDQFHVD~Q
estarán allí cuando su garantía caduque.
(Q((88GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm
o comuníquese al 800.626.2224 durante el horario de atención comercial.
Conectividad Remota
3DUDVROLFLWDUDVLVWHQFLDSDUDODFRQHFWLYLGDGGHUHGLQDOiPEULFD SDUDPRGHORVFRQDFFHVRUHPRWR YLVLWHQXHVWURVLWLRZHEHQGEAppliances.com/ge/connected-appliances/RFRPXQtTXHVHDOHQ((88
Piezas y Accesorios
Aquellos individuos calificados para realizar el servicio técnico de sus propios electrodomésticos podrán solicitar el envío de
SLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHV VHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU 2UGHQHKR\DWUDYpVGH
,QWHUQHWGXUDQWHODVKRUDVWRGRVORVGtDV(Q((88GEApplianceparts.com o de forma telefónica al 877.959.8688 durante
el horario de atención comercial.
Las instrucciones que figuran en este manual cubren los procedimientos que serán realizados por cualquier usuario.
Otros servicios técnicos generalmente deben ser derivados a personal calificado del servicio. Se deberá tener cuidado,
ya que una reparación indebida podrá hacer que el funcionamiento no sea seguro.
Contáctenos
Si no se encuentra satisfecho con el servicio que recibió de GE Appliances, comuníquese con nosotros a través de nuestro sitio
Web con todos los detalles, incluyendo su número telefónico, o escriba a:
(Q((88*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/ge/service-and-support/contact.htm
32
,PSUHVRHQORV(VWDGRV8QLGRV
49-40773-2
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising