GE | CGS995SELSS | Use and Care Manual | GE CGS995SELSS Use and Care Manual

GE CGS995SELSS Use and Care Manual
RANGES
Self-Cleaning Double Oven Gas
SAFETY INFORMATION
.......... 3
OWNER’S MANUAL
USING THE RANGE
CGS995
PGS960
In Case of a Power Failure . . . . . . . . . . . . . . . 8
Surface Burners . . . . . . . . . . . . . . . . . . . . . . . . 8
Griddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .10
Oven Controls . . . . . . . . . . . . . . . . . . . . . . . . . . 11
Options . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Settings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Sabbath Mode . . . . . . . . . . . . . . . . . . . . . . . . . .14
Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . .15
Aluminum Foil and Oven Liners. . . . . . . . . . .16
Cookware . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
Cooking Modes . . . . . . . . . . . . . . . . . . . . . . . . .16
Oven Air Vents . . . . . . . . . . . . . . . . . . . . . . . . . 17
Oven Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
Cooking Guide . . . . . . . . . . . . . . . . . . . . . . . . .19
CARE AND CLEANING
Range – Exterior . . . . . . . . . . . . . . . . . . . . . . . 20
Range – Interior . . . . . . . . . . . . . . . . . . . . . . . . 21
Cooktop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Door . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24
Oven Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . 24
Oven Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25
Oven Door . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26
TROUBLESHOOTING TIPS. . . . . . .
27
WARRANTY . . . . . . . . . . . . . . . . . . . . . . . 30
ACCESSORIES . . . . . . . . . . . . . . . . . . . . .31
CONSUMER SUPPORT . . . . . . . . . . .
32
Write the model and serial
numbers here:
Model # _________________
Serial # _________________
ESPAÑOL
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
You can find the rating label on the
front behind the range drawer.
GE is a trademark of the General Electric Company. Manufactured under trademark license.
49-85242-1 02-18 GEA
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.
2
49-85242-1
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
WARNING If the information in this manual is not followed exactly, a fire or
explosion may result, causing property damage, personal injury or death.
- Do not store or use gasoline or other flammable vapors and liquids in the vicinity of
this or any other appliance.
- WHAT TO DO IF YOU SMELL GAS
Ŷ 'RQRWWU\WROLJKWDQ\DSSOLDQFH
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ 'RQRWWRXFKDQ\HOHFWULFDOVZLWFKGRQRWXVHDQ\SKRQHLQ\RXUEXLOGLQJ
Ŷ ,PPHGLDWHO\FDOO\RXUJDVVXSSOLHUIURPDQHLJKERU¶VSKRQH)ROORZWKHJDV
VXSSOLHU¶VLQVWUXFWLRQV
Ŷ ,I\RXFDQQRWUHDFK\RXUJDVVXSSOLHUFDOOWKHILUHGHSDUWPHQW
- Installation and service must be performed by a qualified installer, service agency or
the gas supplier.
ANTI-TIP DEVICE
WARNING
Tip-Over Hazard
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
• Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to
install.
For Free-Standing and Slide-In Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is engaged in the bracket. On
some models, the storage drawer or kick panel can be removed for easy
inspection. If visual inspection is not possible, slide the range forward,
confirm the anti-tip bracket is securely attached to the floor or wall, and
slide the range back so the rear leveling leg is under the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat this
procedure to verify the range is properly secured by the anti-tip bracket.
Never completely remove the leveling legs or the range will not be secured
to the anti-tip device properly.
Anti-Tip
Bracket
Leveling Leg
Free-Standing and Slide-In Ranges
READ AND SAVE THESE INSTRUCTIONS
49-85242-1
3
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS
WARNING NEVER use this appliance
as a space heater to heat or warm the room.
Doing so may result in carbon monoxide
poisoning and overheating of the oven.
Ŷ 8VHWKLVDSSOLDQFHIRULWVLQWHQGHGSXUSRVHDV
described in this owner’s manual.
Ŷ +
DYH\RXUUDQJHLQVWDOOHGDQGSURSHUO\JURXQGHGE\
a qualified installer in accordance with the provided
installation instructions.
Ŷ $
Q\DGMXVWPHQWDQGVHUYLFHVKRXOGEHSHUIRUPHG
only by a qualified gas range installer or service
technician. Do not attempt to repair or replace
any part of your range unless it is specifically
recommended in this manual.
Ŷ <
RXUUDQJHLVVKLSSHGIURPWKHIDFWRU\VHWIRUXVH
with natural gas. It can be converted for use with
propane gas. If required, these adjustments must be
made by a qualified technician in accordance with
the installation instructions and local codes. The
agency performing this work assumes responsibility
for the conversion.
Ŷ +
DYHWKHLQVWDOOHUVKRZ\RXWKHORFDWLRQRIWKH
range gas shut-off valve and how to turn it off if
necessary.
Ŷ 3
OXJ\RXUUDQJHLQWRDYROWJURXQGHGRXWOHW
only. Do not remove the round grounding prong
from the plug. If in doubt about the grounding of the
home electrical system, it is your responsibility and
obligation to have an ungrounded outlet replaced
with a properly grounded, three prong outlet in
accordance with the National Electrical Code. Do
not use an extension cord with this appliance.
Ŷ %
HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKHUDQJH
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
Ŷ %
HVXUHDOOSDFNLQJPDWHULDOVDUHUHPRYHGIURPWKH
range before operating to prevent ignition of these
materials.
Ŷ $
YRLGVFUDWFKLQJRULPSDFWLQJJODVVGRRUV
cooktops, or control panels. Doing so may lead
to glass breakage. Do not cook on a product with
broken glass. Shock, fire, or cuts may occur.
Ŷ '
RQRWOHDYHFKLOGUHQDORQHRUXQDWWHQGHGLQDQ
area where an appliance is in use. They should
never be allowed to climb, sit or stand on any part
of the appliance.
Ŷ
CAUTION Do not store items of interest
to children in cabinets above an oven - children
climbing on the oven to reach items could be
seriously injured.
Ŷ 1
HYHUEORFNWKHYHQWV DLURSHQLQJV RIWKHUDQJH
They provide the air inlets and outlets that are
necessary for the range to operate properly with
correct combustion. Air openings are located at the
rear of the cooktop, at the top and bottom of the
oven door, and at the bottom of the range under the
warming drawer, lower oven drawer or kick panel.
Ŷ 8
VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch surface burners,
burner grate, or oven heating element. Do not use a
towel or other bulky cloth in place of pot holders.
Ŷ '
RQRWWRXFKWKHKHDWLQJHOHPHQWVRUWKHLQWHULRU
surface of the oven. These surfaces may be hot
enough to burn even though they are dark in color.
During and after use, do not touch, or let clothing
or other flammable materials contact any interior
area of the oven; allow sufficient time for cooling
first. Other surfaces of the appliance may become
KRWHQRXJKWRFDXVHEXUQV3RWHQWLDOO\KRWVXUIDFHV
include the burners, grates, oven vent opening,
surfaces near the opening, and crevices around the
oven door.
Ŷ '
RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH
could build up and the container could burst,
causing an injury.
Ŷ &
RRNIRRGWKRURXJKO\WRKHOSSURWHFWDJDLQVW
foodborne illness. Minimum safe food temperature
recommendations can be found at
ZZZ,V,W'RQH<HWJRYDQGZZZIVLVXVGDJRY8VH
a food thermometer to take food temperatures and
check several locations.
Ŷ '
RQRWDOORZDQ\RQHWRFOLPEVWDQGRUKDQJRQWKH
oven door, drawer or cooktop. They could damage
the range or tip it over causing severe injury or death.
READ AND SAVE THESE INSTRUCTIONS
4
49-85242-1
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
Failure to do so may result in fire or personal injury.
Ŷ 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQDQRYHQ
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
Ŷ 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
Ŷ 'RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXS
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
WUD\8VHDPXOWLSXUSRVHGU\FKHPLFDORUIRDPW\SH
fire extinguisher.
Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJVPRWKHU
the fire by closing the oven door and turning the
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJVHOIFOHDQWXUQ
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at selfclean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
WARNING COOKTOP SAFETY INSTRUCTIONS
Ŷ 1HYHUOHDYHWKHVXUIDFHEXUQHUVXQDWWHQGHGDW
medium or high heat settings. Foods, especially oily
foods, may ignite resulting in fire that could spread
to surrounding cabinets.
Ŷ 1
HYHUOHDYHRLOXQDWWHQGHGZKLOHIU\LQJ,IDOORZHG
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
FDELQHWV8VHDGHHSIDWWKHUPRPHWHUZKHQHYHU
possible to monitor oil temperature.
Ŷ 7
RDYRLGRLOVSLOORYHUDQGILUHXVHWKHPLQLPXP
amount of oil when using a shallow pan-frying
and avoid cooking frozen foods with excessive
amounts of ice.
Ŷ 8
VHSURSHUSDQVL]HDQGDYRLGSDQVWKDWDUH
unstable or easily tipped. Select cookware that is
matched to the size of the burner. Burner flames
should be adjusted so that they do not extend
beyond the bottom of the pan. Excessive flame may
be hazardous.
Ŷ $
OZD\VXVHWKH/,7(SRVLWLRQZKHQLJQLWLQJWKHWRS
burners and make sure the burners have ignited.
Ŷ :
KHQXVLQJJODVVFHUDPLFFRRNZDUHPDNHVXUHLW
is suitable for cooktop service; others may break
because of sudden change in temperature.
Ŷ 7
RPLQLPL]HWKHSRVVLELOLW\RIEXUQVLJQLWLRQRI
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby burners.
Ŷ '
RQRWXVHDZRNZLWKDURXQGPHWDOVXSSRUWULQJ
The ring may trap heat and block air to the burner
resulting in a carbon monoxide hazard.
Ŷ '
RQRWDWWHPSWWROLIWWKHFRRNWRS'RLQJVRPD\
damage the gas tubing to the surface burners
resulting in a gas leak and risk of fire.
Ŷ :
KHQGLVDEOLQJ/RFN&RQWURO RQVRPHPRGHOV make sure the surface controls are set to the OFF
position. This will prevent unintended gas flow from
the burners.
Ŷ '
RQRWXVHDOXPLQXPIRLOWRFRYHUWKHJUDWHVRU
line any part of the cooktop. Doing so may result
in carbon monoxide poisoning, overheating of the
cooktop surfaces, or a potential fire hazard.
READ AND SAVE THESE INSTRUCTIONS
49-85242-1
5
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING OVEN SAFETY INSTRUCTIONS
WARNING NEVER cover any slots,
holes, or passages in the oven bottom or
cover an entire rack with materials such as
aluminum foil or oven liners. Doing so blocks
air flow through the oven and may cause
carbon monoxide poisoning. Never place foil
or oven liners on the oven bottom. They can
trap heat causing risk of smoke or fire.
Ŷ
Ŷ
Ŷ
Ŷ 6WDQGDZD\IURPWKHUDQJHZKHQRSHQLQJWKHRYHQ
door. Hot air or steam which escapes can cause
EXUQVWRKDQGVIDFHDQGRUH\HV
Ŷ 1HYHUSODFHFRRNLQJXWHQVLOVSL]]DRUEDNLQJVWRQHV
Ŷ
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
3ODFHRYHQUDFNVLQGHVLUHGORFDWLRQZKLOHRYHQLV
cool. If rack must be moved while oven is hot, be
careful to avoid touching hot surfaces.
'RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJXWHQVLOV
or food in the oven when not in use. Items stored in
an oven can ignite.
'RQRWOHDYHLWHPVRQWKHFRRNWRSQHDUWKHRYHQ
vent. Items may overheat resulting in a risk of fire or
burns.
1HYHUEURLOZLWKGRRURSHQ2SHQGRRUEURLOLQJLV
not permitted due to overheating of control knobs.
WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
Ŷ 'RQRWWRXFKRYHQVXUIDFHVGXULQJVHOIFOHDQ
Ŷ ,IWKHVHOIFOHDQLQJPRGHPDOIXQFWLRQVWXUQWKH
operation. Keep children away from the oven during
oven off and disconnect the power supply. Have it
self-cleaning. Failure to follow these instructions
serviced by a qualified technician.
may cause burns.
Ŷ 'RQRWXVHRYHQFOHDQHUV1RFRPPHUFLDORYHQ
Ŷ %
HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHUHPRYHSDQV
cleaner or oven liner protective coating of any kind
shiny metal oven racks, and other utensils from the
should be used in or around any part of the oven.
oven. Only porcelain-coated oven racks may be left
Ŷ 'RQRWFOHDQWKHGRRUJDVNHW7KHGRRUJDVNHWLV
in the oven.
essential for a good seal. Care should be taken not
Ŷ %HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHJUHDVH
to rub, damage or move the gasket.
and food soils from the oven. Excessive amount
Ŷ IMPORTANT: The health of some birds is
of grease may ignite leading to smoke damage to
extremely sensitive to the fumes given off during
your home.
the self-cleaning cycle of any range. Move birds to
another well-ventilated room.
READ AND SAVE THESE INSTRUCTIONS
6
49-85242-1
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
STATE OF CALIFORNIA PROPOSITION 65 WARNINGS
WARNING This product contains one or more chemicals known to the State of California to cause cancer,
birth defects or other reproductive harm.
6HOIFOHDQHOHFWULFRYHQV6HOIFOHDQRYHQVFDQFDXVHORZOHYHOH[SRVXUHWRVRPHRIWKH3URSRVLWLRQ
substances, including carbon monoxide, during the cleaning cycle. Exposure to these substances can be
minimized by opening a window or using a ventilation fan or hood.
Remote Enable Equipment
7KLVGHYLFHFRPSOLHVZLWKSDUWRIWKH)&&5XOHV
2SHUDWLRQLVVXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV This device may not cause harmful interference, and
WKLVGHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHUHFHLYHG
including interference that may cause undesired operation.
The wireless communication equipment installed on this
range has been tested and found to comply with the
OLPLWVIRUD&ODVV%GLJLWDOGHYLFHSXUVXDQWWRSDUWRI
the FCC Rules. These limits are designed to:
(a) provide reasonable protection against harmful
interference in a residential installation. This equipment
generates, uses, and can radiate radio frequency energy
and, if not installed and used in accordance with the
instructions, may cause harmful interference to radio
communications. However, there is no guarantee that
interference will not occur in a particular installation. If
this equipment does cause harmful interference to radio
or television reception, which can be determined by
turning the equipment off and on, the user is encouraged
to try to correct the interference by one or more of the
following measures:
Ŷ5HRULHQWRUUHORFDWHWKHUHFHLYLQJDQWHQQD
Ŷ,QFUHDVHWKHVHSDUDWLRQEHWZHHQWKHHTXLSPHQWDQG
receiver.
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ&RQQHFWWKHHTXLSPHQWLQWRDQRXWOHWRQDFLUFXLW
different from that to which the receiver is connected.
Ŷ&RQVXOWWKHGHDOHURUDQH[SHULHQFHGUDGLR79
technician for help.
(b) accept any interference received, including interference
that may cause undesired operation of the device.
Note that any changes or modifications to the wireless
communication device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
READ AND SAVE THESE INSTRUCTIONS
49-85242-1
7
USING THE RANGE: ,Q &DVH RI D 3RZHU )DLOXUH 6XUIDFH %XUQHUV
In Case of a Power Failure
In the event of a power failure, the oven is inoperable
and no attempt should be made to operate it. However,
WKHVXUIDFHEXUQHUVPD\EHOLWZLWKDPDWFK8VLQJ
extreme caution, hold a lit match near the ports beneath
Surface Burners
Lighting a Surface Burner
WARNING Burners should be operated only
when covered by cookware. Burner flames not
covered by cookware present a risk of fire or
clothing ignition. Never let flames extend beyond the
sides of the cookware. Failure to comply may result
in serious injury.
Make sure all burners are in their correct locations and
fully assembled before attempting to operate any burner.
6HOHFWDEXUQHUDQGILQGLWVFRQWURONQRE3XVKWKHNQRE
in and turn it to the LITE position.
<RXZLOOKHDUDFOLFNLQJQRLVH²
the sound of the electric spark
igniting the burner. When one
burner is turned to LITE, all
burners will spark. Sparking will
continue as long as the knob
remains at LITE. Once gas is
3XVKWKHFRQWURONQRELQDQG
ignited, turn the knob to adjust
turn it to the LITE position.
the flame size.
Automatic Reignition (on some models)
The burners on this range will automatically relight if the
flame goes out.
Selecting a Flame Size
Watch the flame, not the knob, as you adjust heat. When
rapid heating is desired, the flame size should match the
size of the cookware you are using. Flames larger than
the bottom of the cookware will not heat faster and may
be hazardous.
These flames are too large for the pot
Using the Surface Burners
NOTES:
Ŷ 'RQRWRSHUDWHWKHEXUQHUIRUDQH[WHQGHGSHULRGRI
time without cookware on the grate. The finish on
the grate may discolor or chip without cookware to
absorb the heat.
Your rangetop has sealed gas burners that offer
convenience, cleanability and flexibility for a wide range
of cooking applications.
Ŷ %HVXUHWKHEXUQHUVDQGJUDWHVDUHFRROEHIRUH\RX
place your hand, a pot holder or cleaning materials
on them.
The extra-large burner is designed to quickly bring
large amounts of liquid to a boil. Some models have a
32:(5%2,/ŒVHWWLQJHVSHFLDOO\GHVLJQHGIRUXVHZLWK
FRRNZDUHZLWKDGLDPHWHURILQFKHVRUODUJHU
The smallest burner is the simmer burner. A simmer
burner turned down to LO provides precise cooking
Ŷ 'RQRWDWWHPSWWRGLVDVVHPEOHDQ\EXUQHUZKLOHDQRWKHU performance for foods such as delicate sauces that
burner is on. Damage to the product may occur.
require low heat for a long cooking time.
Types of Surface Burners
Round Burner
8VHWKLVEXUQHUIRUJHQHUDO
cooking purposes. Size cookware
appropriately to the flames.
8
the surface burner cap, then slowly turn the knob to the
LITE position. Once lit, surface burners will continue to
operate normally.
Multi-Ring Burner
(on some models)
8VHWKLVEXUQHUIRUODUJHFRRNZDUHRU
for simmering applications.
Dual Oval Burner
(on some models)
8VHWKLVEXUQHUWRFRRNRQWKH
griddle or with small cookware.
49-85242-1
Multi-Ring Burner (some models)
For large cookware,
activate all rings by setting
set the burner between Hi
and Med.
For small cookware or low
heating applications, only
activate the inner rings by
setting the burner between
Lo and Sim.
Dual Oval Burner (some models)
For small cookware, only
activate the round burner.
When using a griddle,
activate both the oval and
round burner sections.
Side View Of The Dual Oval Burner Knob
Side View Of The Multi-Ring Burner Knob
Top-of-Range Cookware
Aluminum: Medium-weight cookware is recommended
because it heats quickly and evenly. Most foods brown
HYHQO\LQDQDOXPLQXPVNLOOHW8VHVDXFHSDQVZLWKWLJKW
fitting lids when cooking with minimum amounts of water.
Stainless Steel: This metal alone has poor heating
properties and is usually combined with copper,
aluminum or other metals for improved heat distribution.
Combination metal skillets usually work satisfactorily if
they are used with medium heat or as the manufacturer
recommends.
Cast-Iron: If heated slowly, most skillets will give
satisfactory results.
Enamelware:8QGHUVRPHFRQGLWLRQVWKHHQDPHO
of some cookware may melt. Follow the cookware
manufacturer’s recommendations for cooking methods.
Glass:7KHUHDUHWZRW\SHVRIJODVVFRRNZDUH²WKRVH
for oven use only and those for top-of-range cooking
VDXFHSDQVFRIIHHDQGWHDSRWV *ODVVFRQGXFWVKHDW
very slowly.
Heatproof Glass Ceramic: Can be used for either
surface or oven cooking. It conducts heat very slowly and
cools very slowly. Check the cookware manufacturer’s
directions to be sure it can be used on gas ranges.
USING THE RANGE: Surface Burners
Surface Burners (Cont.)
Stove Top Grills
Do not use an after-market stove top grill on your
gas surface burners. A stove top grill will cause
incomplete combustion resulting in carbon monoxide
levels above allowable standards. This could be
hazardous to your health.
Do not use stove top grills
Using a Wok
8VHRQO\DIODWERWWRPHGZRNZLWKDGLDPHWHURILQFKHV
or less. Make sure the wok bottom sits flat on the grate.
'RQRWXVHDZRNVXSSRUWULQJ3ODFLQJWKHULQJRYHUWKH
burner or grate may cause the burner to work improperly,
resulting in carbon monoxide levels above allowable
standards. This could be hazardous to your health.
49-85242-1
8VHDIODWERWWRPHGZRN
9
USING THE COOKTOP: Griddle
Griddle (on some models)
WARNING Fire Hazard
Ŷ 8
VHFDUHZKHQFRRNLQJJUHDV\IRRGV6SLOOHGJUHDVHPD\UHVXOWLQILUH
Ŷ 1
HYHUSODFHDQ\LWHPVRQWKHJULGGOHZKHQLWLVQRWLQXVH+HDWIURPVXUURXQGLQJEXUQHUVFDQKHDW
the griddle and may result in fire.
Ŷ 3
ODFHDQGUHPRYHWKHJULGGOHRQO\ZKHQJULGGOHLVFRRODQGDOOVXUIDFHEXUQHUVDUHWXUQHG2))
Using Your Cast Iron Griddle
The ribbed side of the reversible griddle can be used for
food normally grilled.
Your griddle provides an extra-large cooking surface
for meats, pancakes and other foods usually prepared
in a skillet. Before first use, rinse with hot water and dry
WKRURXJKO\3UHSDUHWKHVXUIDFHZLWKFRRNLQJVSUD\RU
vegetable oil.
Griddle Precautions:
Ŷ '
RQRWSODFHWKHJULGGOHLQDPLFURZDYHRYHQ
Ŷ '
RQRWFOHDQ\RXUJULGGOHLQWKHGLVKZDVKHU
Ŷ ,IVRPHWKLQJKDVVSLOOHGXQGHUWKHJULGGOHLWVKRXOGEH
cleaned up as soon as possible to prevent “baked on”
food soil.
Ŷ '
RQRWDOORZJUHDVHWRDFFXPXODWHXQGHUWKHJULGGOH
as it can be a fire hazard. Clean under the griddle with
hot, soapy water as soon as it is cool.
Positioning Your Griddle
7KHFDVWLURQJULGGOHFDQRQO\EHXVHGRYHUWKHFHQWHUEXUQHU V RIWKHUDQJHWRS7RSRVLWLRQWKHJULGGOHUHPRYHWKH
FHQWHUJUDWH LISUHVHQW DQGUHSODFHLWZLWKWKHJULGGOH'RQRWWXUQRQWKHFHQWHUEXUQHU V XQWLO\RXDUHFHUWDLQWKH
griddle has been positioned correctly.
Preheating Your Griddle
)RUPRGHOVZLWKDQRQUHYHUVLEOHJULGGOHSUHKHDW\RXUJULGGOHE\VHWWLQJERWKFHQWHUEXUQHUVWRIRUPLQXWHV
before placing food on the griddle. For models with a reversible griddle, preheat your griddle by setting your center
EXUQHUWR+LIRUPLQXWHVEHIRUHSODFLQJIRRGRQWKHJULGGOH2QFHWKHJULGGOHLVSUHKHDWHGWXUQWKHNQRERQWKH
EXUQHU V WRWKHFRRNVHWWLQJRXWOLQHGLQWKHWDEOH
Preseasoned Cast-Iron Griddle
Type of Food
Preseasoned Reversible Cast-Iron Griddle
Cook Setting
Type of Food
Cook Setting
Bacon
3
Bacon
Med
Breakfast Sausage Links
3
Breakfast Sausage Links
Med
Eggs
Eggs
Grilled Cheese
2
Grilled Cheese
Med
Hamburgers
3
Hamburgers
Med
3DQFDNHV
2
3DQFDNHV
Med
Warming Tortillas
Warming Tortillas
Cook settings may need to be reduced if the griddle is used for an
extended time.
Lo
Lo
Cook settings may need to be reduced if the griddle is used for an
extended time.
Replace the center grate with the non-reversible cast iron griddle
Replace the center grate with the reversible cast iron griddle
49-85242-1
3
11
7
1
1
RQVRPH
PRGHOV
6
4
2
8 11
1. Upper Oven and Lower Oven:
Designates which oven the controls will operate.
Select an oven before following the steps for
starting a cooking or cleaning mode.
2. Convection Cooking Modes: Convection
cooking modes use increased air circulation to
improve performance. See the Cooking Modes
section for more information.
3. Traditional Cooking Modes: Your oven
has the following traditional cooking modes: Bake,
Broil, and Warm. See the Cooking Modes section
for more information.
4. Clean: Your oven has two cleaning modes: Self
Clean and Steam Clean. See the Cleaning the
Oven section for important information about using
these modes.
5. Start: Must be pressed to start any cooking,
cleaning, or timed function. Also used to start the
Warming Zone on the cooktop.
6. Cancel/Off: Cancels ALL oven operations
except the clock and timer. Does NOT cancel the
Warming Zone on the cooktop.
9
10
5
8. Remote Enable: Allows you to control your
oven remotely. The oven must be connected to
WiFi before Remote Enable can be activated. For
instructions on how to connect your oven, see
WKH:L)L&RQQHFW5HPRWH(QDEOHVHFWLRQXQGHU
Settings in this manual.
9. Oven Light (on some models): Turns
USING THE RANGE: Oven Controls
Oven Controls
the oven light on or off. If your oven control does not
have an Oven Light touch pad, there is a knob that
turns on the oven light.
10. Lock Controls: Locks out the control so that
pressing the pads does not activate the controls.
3UHVVDQGKROGWKH 0 pad, for three seconds to lock
or unlock the control. Cancel/Off is always active,
even when the control is locked.
11. Options and Settings: The Options and
Settings pads open up more detailed menus in the
display that allow access to additional functions and
cooking modes. For each you select the function in
the display using the associated number pad. You
can exit at any time by pressing the Options or
Settings pad again. See the Settings, Options, and
Cooking Modes Sections for more details.
7. Timer: :RUNVDVDFRXQWGRZQWLPHU3UHVVWKH
Timer pad and number pads to program the time in
KRXUVDQGPLQXWHV3UHVVWKHStart pad. The timer
countdown is complete. To turn the timer off press
the Timer pad.
49-85242-1
USING THE RANGE:2SWLRQV6HWWLQJV
Options
The options pad opens up a menu of more cooking modes when the oven is off. It opens a menu with additional features
if a cooking mode is already in process. You can exit the menu at any time by pressing the Options pad again.
You must first select a mode (bake, convection bake, convection roast) and then select Options to get to the
following functions.
NOTE: When using the Delay Time feature, foods that
spoil easily – such as milk, eggs, fish, stuffing, poultry,
Counts down cooking time and turns off the oven when
and port – should not be allowed to sit for more than
the cooking time is complete. Select a desired cooking
KRXUEHIRUHRUDIWHUFRRNLQJ5RRPWHPSHUDWXUH
PRGH8VHWKHQXPEHUSDGVWRSURJUDPDEDNLQJ
promotes the growth of harmful bacteria. Be sure that the
WHPSHUDWXUH3UHVVWKHOptions pad and select Cook
oven light is off because heat from the bulb will speed
Time8VHWKHQXPEHUSDGWRSURJUDPFRRNWLPHLQKRXUV
harmful bacteria growth.
and minutes. Then press Start/Enter. This can only
be used with Bake, Convection Bake, and Convection
Oven Probe (Lower Oven Only)
Roast.
NOTE: Only accessible through traditional and
Cook Time
Delay Time
convection cooking modes.
'HOD\VZKHQWKHRYHQZLOOWXUQRQ8VHWKLVWRVHWD
time when you want the oven to start. Select a desired
FRRNLQJPRGH8VHWKHQXPEHUSDGWRSURJUDPDEDNLQJ
WHPSHUDWXUH3UHVVWKHOptions pad and select Delay
Time8VHWKHQXPEHUSDGVWRSURJUDPWKHWLPHRIGD\
for the oven to turn on, and then press Start/Enter. Delay
Time is not available with all modes.
Monitors internal food temperature and turns the oven
off when the food reaches the programmed temperature.
Insert the probe, press the desired cooking mode, and
program the probe temperature. See the Cooking Modes
Section for more information. The probe can only be used
with Bake, Convection Bake, and Convection Roast.
Settings
The Options and Settings pads open up more detailed menus in the display that allow access to additional
functions. For each you select the function in the display using the associated number pad. You can exit at
any time by pressing the Options or Settings pad again.
WiFi Connect and Remote Enable
Your oven is designed to provide you with two-way
communication between your appliance and smart
device. By using the WiFi Connect features, you will
be able to control essential oven operations such as
temperature settings, timers and cooking modes using
your smartphone or tablet.*
Select Settings then Wifi - follow the instructions on your
oven display and phone app. It is necessary to turn on
WiFi before using Remote Enable on your oven.
Connected Appliance Information
FCC: ZKJ-WCATA001
IC: 10229A-WCATA001
MAC ID: XX - XX - XX - XX - XX - XX
Network: GE_XXXXXX_XXXX
Password: XXXXXXXX
PT. NO. 229C6272G001-0
Sample Label
2. Have your smart phone or tablet ready with the ability
to access the internet and download apps.
Connecting your WiFi Connect Enabled Oven
3. You will need to know the password of your home
WiFi router. Have this password ready while you are
setting up your GE Appliances oven.
What you will need
Your GE Appliances oven uses your existing home WiFi
network to communicate between the appliance and
your smart device. In order to setup your GE Appliances
oven, you will need to gather some information:
Connect your GE Appliances oven
2Q\RXUVPDUWSKRQHRUWDEOHWYLVLW
ZZZ*($SSOLDQFHVFRPFRQQHFWWROHDUQPRUHDERXW
connected appliance features and to download the
appropriate app.
(DFK*($SSOLDQFHVRYHQKDVDFRQQHFWHGDSSOLDQFH 2. Follow the app onscreen instructions to connect your
information label that includes an Appliance Network
GE Appliances oven.
1DPHDQG3DVVZRUG7KHVHDUHWKHWZRLPSRUWDQW
3. Once the process is complete, the connection light
details that you will need to connect to the appliance.
located on your GE Appliances oven display will stay
The label is typically located inside the door of the
on solid and the app will confirm you are connected.
oven or drawer.
* Compatible Apple or Android devices and home WiFi network required.
49-85242-1
WiFi Connect and Remote Enable (cont.)
Auto Conv (Auto Conversion)
4. If the connection light does not turn on or is blinking,
follow the instructions on the app to reconnect. If
issues continue, please call the Connected Call
&HQWHUDQGDVNIRUDVVLVWDQFH
regarding oven wireless connectivity.
When using Convection Bake and Convection Roast
cooking, Auto Recipe Conversion will automatically
convert the regular baking temperatures entered to
convection bake cooking temperatures when turned
on. Note that this option does not convert convection
bake cooking times, it only converts temperatures. This
feature may be turned On or Off. Select Settings, Auto
Conversion is 5th option and shows up on first display of
settings, and Auto Conversion then follow the prompts
to turn this feature on or off.
7RFRQQHFWDGGLWLRQDOVPDUWGHYLFHVUHSHDWVWHSVDQG
Note that any changes or modifications to the remote
enable device installed on this oven that are not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
REMOTE STARTING YOUR OVEN
To be able to start the oven remotely once connected to
WiFi, press the Remote Enable pad and the icon will
turn on in the display. The oven can now be remotely
started with a connected device. Opening an oven door or
turning off the oven will turn off the icon. The icon must
be lit to start the oven remotely. The icon is not required
to change the oven temperature while it is running, set a
timer or to turn the oven off from the phone app while the
icon shows it is Wifi Connected.
After using the oven, remember to verify that the icon
is lit if you wish to start the oven remotely in the future.
NOTE: )RRGVWKDWVSRLOHDVLO\²VXFKDVPLONHJJVILVK
VWXIILQJVSRXOWU\DQGSRUN²VKRXOGQRWEHDOORZHGWR
VLWIRUPRUHWKDQKRXUEHIRUHRUDIWHUFRRNLQJ5RRP
temperature promotes the growth of harmful bacteria. Be
sure that the oven light is off because heat from the bulb
will speed harmful bacteria growth.
Clock
7KLVVHWWLQJVHWVWKHRYHQFORFNWLPH3UHVVWKHSettings
pad and select Clock. Select Set Clock and follow the
instructions to set the clock. This feature also specifies
how the time of day will be displayed. You can select a
VWDQGDUGKRXUFORFN + KRXUPLOLWDU\WLPHGLVSOD\
+ RUQRFORFNGLVSOD\HG 2II 3UHVVWKHSettings pad,
select Set Clock and select either 12/24 hr or On/Off.
Bluetooth® - Chef Connect
This is a pairing feature for use with other compatible
Chef Connect enabled products like an over-therange microwave oven or range hood. To pair those
SURGXFWVWRWKHUDQJH3UHVVWKHSettings pad and select
Bluetooth®. Select Pair and follow the corresponding
instructions included with the mating Chef Connect
enabled product. The range will cancel pairing mode
after two minutes if no mating device is detected. Select
Remove to confirm product is paired or to un-pair from
UDQJH7KH3UHFLVLRQ&RRNLQJ3UREHFDQDOVREHSDLUHG
using the Bluetooth® feature.
49-85242-1
Auto Off
7KLVIHDWXUHVKXWVWKHRYHQGRZQDIWHUKRXUVRI
continuous operation. It may be enabled or disabled.
Select Settings, More, and Auto Off to turn this feature
on or off.
Sound
You can adjust the volume and type of alert your appliance
uses. Select Settings, More, and Sound. Follow prompts
for making volume adjustments or for changing between
continuous and single alert tones. A continuous setting
will continue to sound a tone until a button on the control
is pressed. The oven tone volume can be adjusted. The
control will sound the oven tone at the new volume level
each time the sound level is changed.
USING THE RANGE: Settings
Settings
F/C (Fahrenheit or Celsius)
The oven control is set to use Fahrenheit temperatures
) EXW\RXFDQFKDQJHLWWRXVH&HOVLXVWHPSHUDWXUHV
& 6HOHFWSettings, More, and F/C to alter between
temperature scales displayed.
Adjust the Oven temperature
This feature allows the oven baking and convection
baking temperature to be adjusted up to 35ºF hotter
RUGRZQWRž)FRROHU8VHWKLVIHDWXUHLI\RXEHOLHYH
your oven temperature is too hot or too cold and wish to
change it. This adjustment affects Bake and Convection
%DNHPRGHV'RHVQRWFKDQJH3URRIRU&OHDQLQJPRGHV
Select Settings and Oven Adjust to add More Heat or
Less Heat and then press Save.
Oven Info
Select Settings, More, and Oven Info to turn this
feature on or off. This setting displays Model Number and
6RIWZDUH9HUVLRQ
USING THE RANGE: Sabbath Mode
Sabbath Mode
The Sabbath mode feature complies with standards set forth by Star K. Some of these standards that will be noticed
E\WKHFRQVXPHULQFOXGHWKHGLVDEOLQJRIWRQHVGLVDEOLQJRIRYHQOLJKWVDQGGHOD\VRIDERXWVHFRQGVWRRQH
minute on display changes. Only continuous baking or timed baking is allowed in the Sabbath mode. Cooking in the
Sabbath mode is a two-step process, first the Sabbath mode must be set and then the bake mode must be set.
Setting the Sabbath Mode
Adjusting the Temperature
3UHVVWKHSettings pad, select Sabbath, and select
Turn on. A single bracket “]” will appear in the display
indicating that the Sabbath mode is set. The clock will not
be displayed. Continuous bake or timed bake can now be
programmed.
3UHVVBake (or press Lower Oven and then Bake for
ORZHURYHQLQDGRXEOHRYHQXQLW XVHWKH1 through
5 number pads to select a different preset cooking
temperature, and press Start/Enter.
2. Since no feedback is given during temperature
change, an oven thermometer can be used to confirm
temperature changes.
Starting a Continuous Bake
3UHVVWKHBakeSDG )RUGRXEOHRYHQVWKLVRSHUDWHV
the upper oven. If desiring to use Lower Oven, press
Lower Oven and then Bake
,IWKHGHVLUHGWHPSHUDWXUHLV)SUHVVStart/
Enter. If a different cooking temperature is desired,
use the 1 through 5 number pads to select a preset
cooking temperature, then press Start/Enter. Refer
to the graphic below to determine which pad sets the
desired cooking temperature.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking.
7HPSHUDWXUH ƒ)
Starting a Timed Bake
3UHVVWKHBake pad.
,IWKHGHVLUHGWHPSHUDWXUHLV)XVHWKH6 through
0 number pads to select a cooking time. If a cooking
WHPSHUDWXUHRWKHUWKDQ)LVGHVLUHGXVHWKH1
through 5 number pads to select a preset cooking
temperature, then select the cooking time. Refer to
the graphic on this page to determine which pad sets
the desired cooking temperature and cooking time.
3UHVVStart/Enter.
After a delay, a second bracket “] [“ will appear in the
display indicating that the oven is baking. When the cook
time expires, the display will change back to a single
bracket “]” indicating that the oven is no longer baking.
No tone will sound when the cook time is complete.
Exit the Sabbath Mode
7LPH KRXUV
325
2h
2.5h
3h
3.5h
Exiting the Sabbath mode should be done after the
Sabbath is over.
3UHVVCancel/Off to end any bake mode that may be
running.
3UHVVDQGKROGSettings pad until Sabbath Mode off
is displayed.
Sabbath Mode Power Outage Note
4h
ƒ) ƒ) ƒ) ƒ) ƒ)
If a power outage occurs while the oven is in Sabbath
Mode, the unit will return to Sabbath Mode when power
is restored, however the oven will return to the off state
even if it was in the middle of a bake cycle when the
power outage occurred.
KRXUV KRXUV KRXUV KRXUV KRXUV
49-85242-1
Rack Positions
Your oven has two rack positions in the upper oven
$% DQGIRXUUDFNSRVLWLRQVLQWKHORZHURYHQ 5
5HFRPPHQGHGUDFNSRVLWLRQVIRUYDULRXVW\SHV
of foods are provided in the Cooking Guide. Adjusting
rack position is one way to impact cooking results. For
example, if you would prefer darker tops on cakes,
muffins, or cookies, try moving food one rack position
higher. If you find foods are too brown on top try moving
them down next time.
When baking with multiple pans and on multiple racks,
ensure there is sufficient space between pans to allow
air to flow. This may improve cooking evenness.
8SSHU2YHQ
Lower Oven
Rack stop
position
Removing and Replacing Flat Racks
When placing and removing cookware, pull the rack out
WRWKHEXPS VWRSSRVLWLRQ RQWKHUDFNVXSSRUW
To remove a rack, pull it toward you until it reaches the
stop position, tilt up the front of the rack and pull it out.
To replace a rack, place the curved end of the rack onto
the rack supports. Tilt up the front of the rack and push
the rack in until it stops. Then lay the rack flat and push
it in until it is all the way into the oven.
Racks may become difficult to slide, especially after a
self-clean cycle. To improve sliding conditions, use a soft
cloth or paper towel to rub vegetable oil on the left and
ULJKWHGJHVRIWKHUDFNVDQGRUUDFNVXSSRUWV
NOTE: Remove unused racks when using the oven for
faster preheat, improved efficiency, and optimal cooking
performance.
Extension Racks (on some models)
Extension racks have a frame that locks into the rack
supports on both sides. Once the frame is locked into place,
always use the upper front rail to pull the rack out to its full
extension position when placing or removing cookware.
If extension racks are difficult to extend, lubricate the
racks with the graphite lubricant provided with your oven.
5HPRYHWKHUDFNIURPWKHRYHQ VHH([WHQVLRQ5DFN
5HPRYDO UHPRYHGHEULVLQWKHVOLGHWUDFNVZLWKDSDSHU
towel, shake the graphite lubricant, and place 4 small drops
on the two bottom tracks of the left and right sides. Open
and close the rack several times to distribute the lubricant.
6HHWKH$VVLVWDQFH$FFHVVRULHVVHFWLRQIRULQVWUXFWLRQVRQ
ordering additional racks and graphite lubricant.
49-85242-1
Removing racks
USING THE RANGE: Oven Racks
Oven Racks
Replacing racks
Extension Rack Removal
0DNHVXUHWKHUDFNLVSXVKHGDOOWKHZD\LQWRWKHRYHQ
2. Firmly holding onto both the upper and lower front
rails, pull the rack toward you, tilt the front end up and
pull the rack out.
Extension Rack Replacement
3ODFHWKHFXUYHGHQGRIWKHUDFNRQWRWKHUDFNVXSSRUWV
2. Tilt up the front of the rack and push the rack in until
it stops.
3. Lay the rack flat and push it in until it is all the way
into the oven.
If extension racks are difficult to replace or remove, wipe
the oven rack supports with cooking oil. Do not wipe oil
on the rack slides.
USING THE RANGE: Aluminum Foil and Oven Liners &RRNZDUH&RRNLQJ0RGHV
Aluminum Foil and Oven Liners
CAUTION Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat
or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of
these items is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on a lower rack, several inches below the food. Do not use more
IRLOWKDQQHFHVVDU\DQGQHYHUHQWLUHO\FRYHUDQRYHQUDFNZLWKDOXPLQXPIRLO.HHSIRLODWOHDVW´IURPRYHQZDOOV
to prevent poor heat circulation.
Cookware
Cookware Guidelines
The material, finish, and size of cookware affect baking
performance.
Dark, coated and dull pans absorb heat more readily
WKDQOLJKWVKLQ\SDQV3DQVWKDWDEVRUEKHDWPRUH
readily can result in a browner, crisper, and thicker crust.
If using dark and coated cookware check food earlier
than minimum cook time. If undesirable results are
obtained with this type of cookware consider reducing
RYHQWHPSHUDWXUHE\ƒ)QH[WWLPH
Shiny pans can produce more evenly cooked baked
goods such as cakes and cookies.
Glass and ceramic pans heat slowly but retain heat well.
These types of pans work well for dishes such as pies
and custards.
Air insulated pans heat slowly and can reduce bottom
browning.
Keep cookware clean to promote even heating.
Stoneware heats slowly and retains heat well. It is
recommended to preheat this type of cookware if
possible. Additional cook time may be required.
Cooking Modes
Your new oven has a variety of cooking modes to help you get the best results. These modes are described below.
Refer to the Cooking Guide section for rack position and other recommendations for specific modes and foods.
Bake
Broiling Modes
The bake mode is for baking and roasting. When
preparing baked goods such as cakes, cookies and
pastries, always preheat the oven first. To use this
mode press the Bake pad, enter a temperature with the
number pads, and then press Start/Enter.
$OZD\VEURLOZLWKWKHRYHQGRRUGUDZHUFORVHG0RQLWRU
IRRGFORVHO\ZKLOHEURLOLQJ8VHFDXWLRQZKHQEURLOLQJ
placing food close to the broil element or burner
increases smoking, spattering and the possibility of fats
igniting. It is not necessary to preheat when using the
Broil modes.
Warm
Warm mode is designed to keep hot foods hot. Cover
foods that need to remain moist and do not cover foods
WKDWVKRXOGEHFULVS3UHKHDWLQJLVQRWUHTXLUHG'R
not use warm to heat cold food It is recommended that
IRRGQRWEHNHSWZDUPIRUPRUHWKDQKRXUV3UHVVWKH
Warm pad and then press Start/Enter.
Some models may also have warming drawers. Three
settings are available - use High for items such as
stews, meats, and potatoes; use Medium for items such
as casseroles and pizzas; use Low for items such as
breads, waffles, and also for warming oven-safe dishes.
Broil Hi
The Broil High mode uses intense heat from the upper
HOHPHQWRUEXUQHUWRVHDUIRRGV8VH%URLO+LJKIRU
WKLQQHUFXWVRIPHDWDQGRUZKHQ\RXZRXOGOLNHWRKDYH
a seared surface and rare interior. To use this mode
press the Broil pad once and then press Start/Enter.
Broil Lo
The Broil Low mode uses less intense heat from the
upper element or burner to cook food thoroughly while
DOVREURZQLQJWKHVXUIDFH8VH%URLO/RZIRUWKLFNHUFXWV
RIPHDWDQGRUIRRGVWKDW\RXZRXOGOLNHFRRNHGDOOWKH
way through. To use this mode press the Broil pad twice
and then press Start/Enter.
49-85242-1
Frozen Snacks
Convection Bake Multi Rack
The Frozen Snacks modes are designed to cook frozen
foods such as potato nuggets, French fries, and similar
frozen snacks and appetizers. Most foods will cook
within package recommended time. Adjust cooking time
DFFRUGLQJWRLQGLYLGXDOSUHIHUHQFHV3UHVVOptions and
select Frozen then follow any display prompts to access
this mode.
The Convection Bake mode is intended for baking
on multiple racks at the same time. This mode uses
air movement from the convection fan to enhance
cooking evenness. Your oven is equipped with Auto
Recipe Conversion, so it is not necessary to adjust the
temperature when using this mode. Always preheat
when using this mode. Baking times may be slightly
longer for multiple racks than what would be expected
for a single rack. To use this mode press the Conv Bake
pad, enter a temperature with number pads, and then
press Start/Enter.
8VH)UR]HQ6QDFNV6LQJOHZKHQFRRNLQJIUR]HQVQDFNV
on a single rack. This mode does not require preheating
the oven. Food should be placed in the oven before or
immediately upon starting this mode.
8VH)UR]HQ6QDFNV0XOWLZKHQFRRNLQJIUR]HQVQDFNV
on two racks simultaneously. This mode includes a
preheating cycle to prepare the oven for multi-rack
baking.
Frozen Pizza
7KH)UR]HQ3L]]DPRGHVDUHGHVLJQHGWRFRRN
frozen pizzas. Most pizzas will cook within package
recommended times. Adjust cooking time according to
LQGLYLGXDOSUHIHUHQFHV3UHVVOptions and select Frozen
then follow any display prompts to access this mode.
8VH)UR]HQ3L]]D6LQJOHZKHQFRRNLQJRQDVLQJOHUDFN
This mode does not require preheating the oven. Food
should be placed in the oven before or immediately upon
starting this mode.
8VH)UR]HQ3L]]D0XOWLZKHQFRRNLQJRQWZRUDFNV
simultaneously. This mode includes a preheating cycle to
prepare the oven for multi-rack baking.
Baked Goods
The Baked Goods mode is designed for cooking cakes,
breads, cookies, and similar foods on a single rack. This
mode is designed to provide lighter top browning and
better volume. Some foods may require slightly longer
cook times relative to when cooked in the traditional bake
PRGH3UHVVOptions and select Baked Goods than
follow any display prompts to access this mode.
Convection Roast
The Convection Roast mode is intended for roasting
whole cuts of meat on a single rack. This mode uses air
movement from the convection fan to improve browning
and reduce cooking time. Check food earlier than the
recipe suggested time when using this mode, or use the
SUREH VHHWKH3UREHVHFWLRQIRUPRUHLQIRUPDWLRQ ,WLV
not necessary to preheat when using this mode. To use
this mode press the Conv Roast pad, enter a temperature
with the number pads, and then press Start/Enter.
Proof
3URRIPRGHPDLQWDLQVDZDUPHQYLURQPHQWIRUULVLQJ
\HDVWOHDYHQHGGRXJK,IWKHRYHQLVWRRZDUP3URRI
mode will not operate and the display will show "Oven
WRRKRWIRU3URRI)RUEHVWUHVXOWVFRYHUWKHGRXJK
while proofing and check early to avoid over-proofing.
3UHVVOptions and select Proof then follow any display
prompts or press the ProofSDG RQVRPHPRGHOV WR
access this mode.
CAUTION 'RQRWXVHWKH3URRIPRGHIRUZDUPLQJ
food or keeping food hot. The proofing oven temperature
is not hot enough to hold foods at safe temperatures.
USING THE RANGE:&RRNLQJ0RGHV2YHQ$LU9HQWV
Cooking Modes (Cont.)
Oven Air Vents
1HYHUEORFNWKHYHQWV DLURSHQLQJV RIWKHUDQJH7KH\
provide the air inlet and outlet that are necessary for the
range to keep cool and operate properly with correct
combustion.
Air openings are located at the rear of the cooktop, at
the top and bottom of the oven door, and at the bottom
of the range.
49-85242-1
9HQWDSSHDUDQFHDQGORFDWLRQYDU\
USING THE RANGE:2YHQ3UREH
Oven Probe
WARNING Consuming undercooked food can result in foodborne illness. Use probe according to
the following instructions to ensure all portions of the food reach minimum safe cooking temperatures.
Recommendations for minimum safe food temperatures can be found at
www.foodsafety.gov or www.IsItDoneYet.gov.
Internal food temperature is frequently used as an
indicator of doneness, especially for roasts and poultry.
7KH3UREHPRGHPRQLWRUVWKHLQWHUQDOIRRGWHPSHUDWXUH
and turns the oven off when the internal food
temperature reaches the programmed temperature.
Always check the temperature at multiple locations in
the food with a food thermometer after cooking to ensure
that all portions of the food have reached the minimum
safe internal temperature for that food.
Proper Probe Placement
After preparing the meat and placing it on the cooking
pan follow these instructions for proper probe placement.
Ŷ ,QVHUWWKHSUREHLQWRWKHIRRGVRWKDWWKHWLSRIWKH
probe will rest in the center of the thickest part of
the food. For best performance the probe should
be fully inserted into the food. If the probe is not
located properly, it may not accurately measure the
temperature of the coolest portion of the food. Some
foods, particularly small items, are not well suited for
cooking with the probe due to their shape or size.
Ŷ 7KHSUREHVKRXOGQRWWRXFKERQHIDWRUJULVWOH
Ŷ )RUZKROHSRXOWU\LQVHUWWKHSUREHLQWRWKHWKLFNHVW
part of the breast.
Ŷ )RUERQHOHVVURDVWVLQVHUWWKHSUREHLQWRWKHFHQWHU
of the roast.
Ŷ )RUERQHLQKDPRUODPELQVHUWWKHSUREHLQWRWKH
center of the lowest large muscle or joint.
Ŷ )RUFDVVHUROHVRUGLVKHVVXFKDVPHDWORDILQVHUWWKH
probe into the center of the dish.
Ŷ )RUILVKLQVHUWWKHSUREHIURPMXVWDERYHWKHJLOOLQWR
the meatiest area, parallel to the backbone.
Probe Usage
The temperature probe can only be used with Bake,
Convection Bake, and Convection Roast.
3. Once the oven is preheated, place the food in the
oven and connect the probe to the probe outlet,
PDNLQJVXUHLWLVIXOO\LQVHUWHG8VHFDXWLRQWKHRYHQ
walls and probe outlet are hot.
4. When the probe is connected, the display will prompt
you to enter the desired food temperature. The
maximum internal food temperature that you can set
LVƒ)
To use the probe without preheating:
,QVHUWWKHSUREHLQWRWKHIRRG VHH3URSHU3UREH
3ODFHPHQW 3ODFHWKHIRRGLQWKHRYHQDQGFRQQHFWWKHSUREHLQWR
the probe outlet in the oven.
3UHVVWKHCook ModeSDG Traditional Bake,
Convection Bake, or Convection Roast DQG
enter the desired cooking temperature with the
QXPEHUSDGV3UHVVOptions and select Probe then
follow the display prompts to enter the desired food
temperature.
Probe Care Guidelines
Ŷ 8VHRISUREHVRWKHUWKDQWKHRQHSURYLGHGZLWKWKLV
product may result in damage to the probe outlet.
Ŷ 8VHWKHKDQGOHVRIWKHSUREHDQGSOXJZKHQLQVHUWLQJ
and removing them from the meat and outlet
Ŷ 7RDYRLGGDPDJLQJ\RXUSUREHGRQRWXVHWRQJVWR
pull on the cable when removing it.
Ŷ 7RDYRLGEUHDNLQJWKHSUREHPDNHVXUHIRRGLV
completely defrosted before inserting the probe.
Ŷ 7RSUHYHQWSRVVLEOHEXUQVGRQRWXQSOXJWKHSUREH
from the outlet until the oven has cooled.
Ŷ 1HYHUOHDYHWKHSUREHLQVLGHWKHRYHQGXULQJDVHOIRU
steam clean cycle.
Ŷ 'RQRWVWRUHWKHSUREHLQWKHRYHQ
To use the probe with preheating:
6HOHFWWKHGHVLUHGFRRNPRGH Bake, Convection
Bake, or Convection Roast SDGDQGHQWHUWKH
desired cooking temperature with the number pads.
,QVHUWWKHSUREHLQWRWKHIRRG VHH3URSHU3UREH
3ODFHPHQW 49-85242-1
FOOD TYPE
RECOMMENDED
MODE(S)
OVEN
(Upper/Lower)
RECOMMENDED
RACK POSITION(S)
ADDITIONAL SUGGESTIONS
8VHVKLQ\FRRNZDUH
Baked Goods
Layer cakes, sheet
cakes, bundt cakes,
muffins, quick breads on
a Single Rack
Bake
8SSHU
Lower
2
3
Bake Goods
8SSHU
Lower
2
3
Layer cakes* on Multiple
Racks
Bake
Convection Bake
Lower
2 and 4
(QVXUHDGHTXDWHDLUIORZ VHHLOOXVWUDWLRQEHORZ Bake Goods
Lower
8VHVKLQ\FRRNZDUH
Bake
8SSHU
Lower
2
3
8VHVKLQ\FRRNZDUH
Bake Goods
8SSHU
Lower
2
3
Convection Bake
Lower
DQG
Ensure adequate airflow.
3URRI
Lower
2
Cover dough loosely.
Bake
8SSHU
Lower
2
Bake Goods
8SSHU
Lower
2
Hamburgers
Broil High
Lower
4
8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ
Watch food closely when broiling. For best performance center food
below the broiler element or burner.
Steaks & Chops
Broil High
Lower
3 or 4
8VHDEURLOSDQPRYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ
Watch food closely when broiling. For best performance center food
below the broiler element or burner.
Bake
Convection Roast
Lower
2
8VHDORZVLGHGSDQVXFKDVDEURLOSDQ3UHKHDWLQJLVQRWQHFHVVDU\
Bake
Convection Roast
Lower
2
8VHDORZVLGHGSDQVXFKDVDEURLOSDQ
Bone-in chicken breasts,
legs, thighs
Broil Low
Bake
Lower
2
If breaded or coated in sauce avoid Broil High modes. Broil skin side
down first. Watch food closely when broiling. For best performance
when broiling, center food below the broil heater or burner.
Boneless chicken breasts
Broil Low
Bake
Lower
2
0RYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJDQGXSIRUJUHDWHU
VHDULQJEURZQLQJZKHQEURLOLQJ)RUEHVWSHUIRUPDQFHZKHQEURLOLQJ
center food below the broil element or burner.
Whole turkey
Bake
Convection Roast
Lower
8VHDORZVLGHGSDQVXFKDVDEURLOSDQ
Turkey Breast
Bake
Convection Roast
Lower
2
8VHDORZVLGHGSDQVXFKDVDEURLOSDQ
Broil Low
Lower
LQFKWKLFNRUOHVV
!LQFK
Watch food closely when broiling. For best performance center food
below the broil heating element.
Bake
8SSHU
Lower
2
2 or 3
3L]]DRQD6LQJOH5DFN
)UR]HQ3L]]D6LQJOH
8SSHU
Lower
2
3
Do not preheat.
3L]]DRQ0XOWLSOH5DFNV
&KLIIRQFDNHV DQJHO
IRRG
Cookies, biscuits, scones
on a Single Rack
Cookies, biscuits, scones
on Multiple Racks
Yeast Breads
Beef & Pork
Roasts
USING THE RANGE: Cooking Guide
Cooking Guide
Poultry
Whole chicken
Fish
Casseroles
Frozen Convenience Foods
)UR]HQ3L]]D0XOWL
Lower
2 and 4
Stagger pizzas left to right, do not place directly over each other.
3RWDWRSURGXFWVFKLFNHQ
nuggets, appetizers on a
Single Rack
Frozen Snacks Single
8SSHU
Lower
2
3
'RQRWSUHKHDW8VHGDUNFRRNZDUHIRUPRUHEURZQLQJFULVSLQJXVH
shiny cookware for less browning.
3RWDWRSURGXFWVFKLFNHQ
nuggets, appetizers on
Multiple Racks
Frozen Snacks Multi
Lower
2 and 4
8VHGDUNFRRNZDUHIRUPRUHEURZQLQJFULVSLQJXVHVKLQ\FRRNZDUH
for less browning.
*When baking four cake layers at a time use racks
DQG3ODFHWKHSDQVDVVKRZQVRWKDWRQHSDQLVQRW
directly above another.
5HDU3ODFHPHQW
Cook food thoroughly to help protect against food
borne illness. Minimum safe food temperature
recommendations for food safety can be found at
www.IsItDoneYet.gov. Make sure to use a food
thermometer to take food temperatures.
)URQW3ODFHPHQW
49-85242-1
CARE AND CLEANING: Range – Exterior
Range – Exterior
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
WARNING If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Control Lockout
If desired, the touch pads may be deactivated before
cleaning.
See Lock Controls in the Oven Controls section in this
manual.
You may also use a glass cleaner.
Remove heavier soil with warm, soapy water. Do not use
abrasives of any kind.
Reactivate the touch pads after cleaning.
Clean up splatters with a damp cloth.
Control Panel
It’s a good idea to wipe the control panel after each use.
Clean with mild soap and water or vinegar and water,
rinse with clean water and polish dry with a soft cloth.
Do not use abrasive cleansers, strong liquid cleansers,
plastic scouring pads or oven cleaners on the control
SDQHO²WKH\ZLOOGDPDJHWKHILQLVKLQFOXGLQJ%ODFN
Stainless Steel.
Oven Exterior
Do not use oven cleaners, abrasive cleansers, strong
liquid cleansers, steel wool, plastic scouring pads, or
cleaning powders on the interior or exterior of the oven.
Clean with a mild soap and water or vinegar and water
solution. Rinse with clean water and dry with a soft cloth.
When cleaning surfaces, make sure that they are at
room temperature and not in direct sunlight.
If stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Spillage of marinades, fruit juices, tomato sauces and
basting liquids containing acids may cause discoloration
and should be wiped up immediately. Let hot surfaces
cool, then clean and rinse.
Painted Surfaces
3DLQWHGVXUIDFHVLQFOXGHWKHVLGHVRIWKHUDQJHDQGWKH
door, top of control panel and the drawer front. Clean
these with soap and water or a vinegar and water solution.
Do not use commercial oven cleaners, cleaning
powders, steel wool or harsh abrasives on any painted
surface, including Black Stainless Steel.
Stainless Steel excluding Black Stainless Steel (on some models)
Do not use a steel wool pad; it will scratch the surface.
Cleaners with oxalic acid such as Bar Keepers Friend
6RIW&OHDQVHUŒZLOOUHPRYHVXUIDFHUXVWWDUQLVKDQG
VPDOOEOHPLVKHV8VHRQO\DOLTXLGFOHDQVHUIUHHRIJULW
and rub in the direction of the brush lines with a damp,
soft sponge.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
49-85242-1
The interior of your new oven can be cleaned manually or by using Steam Clean or Self Clean modes.
Spillage of marinades, fruit juices, tomato sauces and basting liquids containing acids may cause discoloration and
should be wiped up immediately. Let hot surfaces cool, then clean and rinse.
Manual Cleaning
Do not use oven cleaners, strong liquid cleansers, steel
wool, or scouring pads on the interior of the oven. For
soils on the oven bottom and other enameled surfaces,
use a gentle abrasive containing oxalic acid, such as
Bar Keepers Friend®, with a non-scratch sponge. Take
care not to apply any abrasive cleaners or sponges to
the door glass, as it will scratch the reflective coating.
The oven interior and door glass may be cleaned using
a soft cloth with a mild soap and water, or vinegar and
water solution. After cleaning, rinse with clean water and
dry with a soft cloth.
Steam Clean Mode
The Steam Clean feature is for cleaning light soil from
your oven at a lower temperature than Self Clean.
To use the Steam Clean feature:
6WDUWZLWKWKHRYHQDWURRPWHPSHUDWXUH
<RXFDQQRWRSHQWKHGRRUGXULQJWKHPLQXWH6WHDP
Clean cycle. At the end of the Steam Clean cycle, soak
up the remaining water, and wipe the moisture-softened
soil from the oven walls and door.
2. Wipe excess grease and soils from the oven.
3RXURQHFXSRIZDWHURQWRWKHERWWRPRIWKHRYHQ
4. Close the door.
3UHVVWKHClean pad, select Steam Clean and
then press Start/Enter.
Self Clean Mode
Read Self-Cleaning Oven Safety Instructions at the
beginning of this manual before using the Self Clean
Mode. Self Clean uses very high temperatures to clean
the oven interior. For a moderately soiled oven, run a
3 hour self-clean cycle. For a heavily soiled oven, run
DKRXUVHOIFOHDQF\FOH2QO\VHOIFOHDQ EODFN UDFNV
and grates may remain in the oven during the self-clean
F\FOH$OORWKHULWHPVLQFOXGLQJQLFNHOSODWHG VLOYHU UDFNV
VKRXOGEHUHPRYHG,IQLFNHOSODWHG VLOYHU UDFNVDUHOHIW
in the oven during a self-clean cycle, the racks will tarnish.
If either type of rack is left in the oven during a self-clean
cycle, the rack may become difficult to slide. See the
Oven Racks section for instructions on how to improve.
IMPORTANT: The health of some birds is extremely
sensitive to the fumes given off during the self-cleaning
cycle of any range. Move birds to another wellventilated room.
To use the Self Clean feature:
CARE AND CLEANING: Range – Interior
Range – Interior
6WDUWZLWKWKHRYHQDWURRPWHPSHUDWXUH
2. Wipe excess grease and soils from the oven and
interior door.
5HPRYHDOOLWHPVRWKHUWKDQVHOIFOHDQ EODFN racks and grates, if desired. See Cleaning the
Cooktop to determine if your grates may be selfcleaned and for important details regarding grate
placement.
4. Close the door.
3UHVVWKHClean pad, select Self Clean and then
press Start/Enter.
You cannot open the door during the self-clean cycle.
The door will remain locked after the self-clean cycle
until the oven cools below the unlocking temperature.
At the end of the self-clean cycle, allow the oven to cool
and wipe any ash out of the oven.
Racks
All racks can be washed with warm, soapy water.
(QDPHOHG QRWVKLQ\ UDFNVFDQEHOHIWLQWKHFDYLW\
during self clean.
49-85242-1
Racks may be more difficult to slide, especially after
DVHOIFOHDQ3XWVRPHYHJHWDEOHRLORQDVRIWFORWKRU
paper towel and rub onto the left and right edges.
CARE AND CLEANING: Cooktop
Cooktop
Removal of Surface Burners for Cleaning
Turn all controls OFF. Allow cooktop to cool before removing grates and burner parts. When removing the burner
caps and heads, remember their size and location. Replace them in the same location after cleaning.
CAUTION Do not attempt to remove oval or dual oval burner caps from the burner heads.
Inner Burner Cap
5HPRYDEOH
Round Burner Cap
5HPRYDEOH
Round
Burner
Head
Outer Burner Cap
5HPRYDEOH
Round Burner Cap
5HPRYDEOH
Round
Burner
Head
Electrode
Electrode
Dual Oval Burner Caps
1RQ5HPRYDEOH
Multi-Ring Burner
(on some models)
Round Burner
Dual Oval Burner
(on some models)
Cleaning the Surface Burners
Cleaning the Burner Caps
Wash burner caps in hot, soapy water and rinse with
clean water. You may scour with a plastic scouring pad
to remove burned-on food particles. The round burner
caps may also be cleaned in your dishwasher.
Cleaning the Burner Heads
Wash the burner heads routinely, especially after bad
spillovers which could clog the burner openings. Lift
burners off when cool. Wash with hot, soapy water. Rinse
with clean water. For more stubborn stains, use a brush
with plastic bristles.
NOTE: Do not use steel wool or scouring pads to clean
the burner parts as these may clog the openings. Never
wash burner heads in your dishwasher as dishwasher.
Doing so may cause them to discolor.
The ports in the burner heads must be kept clean at all
times for an even, unhampered flame.
CAUTION Do not operate the cooktop without
all burner parts and grates in place.
Any spill on or around an electrode must be carefully
cleaned. Avoid hitting the electrode with anything hard or
it could be damaged.
Electrode
The electrode of the spark igniter is exposed
when the burner head is removed. When one
burner is turned to LITE, all the burners spark.
Do not attempt to disassemble or clean around
any burner while another burner is on.
Clogged or dirty burner ports or electrodes will not allow
the burner to operate properly.
Replacing Surface Burners
Before replacingWKHEXUQHUFDSVKHDGVDQGRYDOKHDG
cap assembly, shake out excess water and allow them to
dry thoroughly.
Replace burner heads in the correct locations according
to size. Ensure each cap is properly seated on the
burner head, as pictured below.
Burner cap is
NOT properly
seated.
22
Burner cap is
NOT properly
seated.
Burner cap is
properly seated.
49-85242-1
Burner Grates
Manual Cleaning
Grates should be washed in hot, soapy water and
rinsed with clean water. To soften burned-on food,
place grates in a solution containing ¼-cup of
household ammonia for several hours. Afterward, scrub
grates with a plastic scouring pad soaked in hot, soapy
water. Rinse well and dry.
Self Clean Mode (on some models)
If your grates do not have rubber bumpers on their
bottom surface, they may be cleaned in the oven using
the self-clean cycle. Do not attempt to clean your grates
in the oven if your grates have rubber bumpers. Doing
so will destroy the rubber bumpers and may affect the
function of your surface burners.
3RUFHODLQFRDWHGJUDWHVPD\JUDGXDOO\GXOOLIFRQWLQXDOO\
exposed to self-clean temperatures.
,I\RXURYHQLVHTXLSSHGZLWKVHOIFOHDQ EODFN UDFNV
it is recommended to follow the instructions for placing
grates on racks. If your oven is equipped with nickelSODWHG VLOYHU UDFNVLWLVUHFRPPHQGHGWRIROORZWKH
instructions for placing grates on the oven bottom.
Nickel-plated racks should not remain in the oven during
the self clean cycle. Doing so will tarnish the racks. If
either type of rack is left in the oven during a self-clean
cycle, the rack may become difficult to slide.
NOTE: When placing or removing grates from the oven,
do not slide the grates on the racks or oven bottom. Doing
so could damage the enamel on the racks or oven bottom.
To self-clean your grates on self-clean racks:
(Lower Oven Only):
,QVHUWUDFNVLQSRVLWLRQVDQGRUSRVLWLRQVDQG
2. Gently place one grate on each rack.
Grate Support Bumpers (on some models)
To self clean your grates on the oven bottom
(Lower Oven Only):
5HPRYHDOORYHQUDFNV
2. Gently place one grate on the center of the oven
bottom with the grate oriented in the upright position.
6WDFNUHPDLQLQJJUDWH V DVVKRZQEHORZ'RQRW
place or stack grates in any other configuration.
Once the grates are placed in the oven, operate the selfclean cycle per the instruction in the Cleaning the Oven
section.
NOTE:8VHFDXWLRQZKHQUHPRYLQJWKHJUDWHVIURPWKH
oven after the self-clean cycle has ended. The grates
may still be hot.
Once the self-clean cycle is complete, the grates may
carefully be removed. You may notice a white residue on
the grates. Wipe it off with a damp sponge. If white spots
SHUVLVWZHWWKHVSRQJHZLWKDVROXWLRQRIYLQHJDU
and water and wipe the grates again.
When replacing the grates on the cooktop, be sure to locate
them correctly. Grates should fit securely into the cooktop.
CARE AND CLEANING: Cooktop
Cooktop (Cont.)
Grate Support Bumpers
If any of the rubber grate support bumpers in the cooktop
are missing or damaged, replacement parts can be
REWDLQHGE\FDOOLQJ*($SSOLDQFHVDW*(&$5(6
To insert the new bumpers, simply place the coneshaped end of the bumper into the hole in the cooktop
and push down while gently twisting the bumper.
Griddles (on some models)
Cast Iron and Reversible Cast-Iron: Clean your
reversible cast-iron griddle with a stiff brush and hot
ZDWHU8VLQJVRDSLVQRWUHFRPPHQGHGDQGKDUVK
detergents should never be used as they will remove
the seasoning. Rinse with hot water and dry thoroughly.
After rinsing, preseason the griddle by applying a light
coat of cooking oil to the griddle surface. Wipe off
excess oil with a paper towel.
Store in a cool, dry place.
49-85242-1
Griddle Precautions:
Ŷ If something has spilled under the griddle, it should
be cleaned up as soon as possible to prevent the
spill from getting baked onto the cooktop.
Ŷ Do not allow grease to accumulate under the griddle
as it can be a fire hazard. Clean under the griddle
with hot, soapy water as soon as it is cool.
Ŷ Do not wash your griddle in the dishwasher.
Ŷ 'RQRWFOHDQWKHJULGGOHLQWKHVHOIFOHDQLQJRYHQ
23
CARE AND CLEANING: 'RRU2YHQ3UREH
Door
Cleaning the Oven Door
Cleaning the Door Interior
Cleaning the Door Exterior
Do not allow excess water to run into any holes or slots
in the door.
If a stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Do not use this method on any other surface.
Wipe dish soap over any baked-on spatters on the glass.
8VHDVLQJOHVLGHGVDIHW\UD]RUEODGHWRFOHDQLWRII7KHQ Stainless Steel Surfaces (on some models)
wipe over the glass with a soapy cloth to remove any
Do not use a steel wool pad; it will scratch the surface.
residue and dry off.
To clean the stainless steel surface, use warm sudsy
The area outside the gasket can be cleaned with a soap- water or a stainless steel cleaner or polish. Always wipe
filled plastic scouring pad. Do not rub or clean the door
the surface in the direction of the grain. Follow the cleaner
gasket - it has an extremely low resistance to abrasion.
instructions for cleaning the stainless steel surface.
If you notice the gasket becoming worn, frayed or
To inquire about purchasing cleaning products
damaged in any way or if it has become displaced on the including stainless steel appliance cleaner or polish,
door, you should have it replaced.
see the Accessories and Consumer Support sections
at the end of this manual.
Oven Probe
The temperature probe may be cleaned with soap and
water or a soap-filled scouring pad. Cool the temperature
probe before cleaning. Scour stubborn spots with a soapfilled scouring pad, rinse and dry.
To order additional temperature probes, see the
Accessories and Consumer Support sections at the end
of this manual.
Ŷ Do not immerse the temperature probe in water.
Ŷ Do not store the temperature probe in the oven.
Ŷ Do not leave the temperature probe inside the oven
during a self or steam clean cycle.
24
49-85242-1
Oven Light Replacement
WARNING SHOCK OR BURN HAZARD: Before replacing oven light bulb, disconnect the electrical power to the
oven at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn.
CAUTION BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with
bare hands or a damp cloth can cause burns.
NOTE: The glass cover should be removed only when
cold. Wearing latex gloves may offer a better grip.
Before replacing the bulb, disconnect electrical power to
the oven at the main fuse or circuit breaker panel. Let
the bulb cool completely before removing it. For your
safety do not touch a hot bulb with a damp cloth. If you
do the bulb may break.
To remove:
7XUQWKHJODVVFRYHUFRXQWHUFORFNZLVHWXUQXQWLOWKH
tabs of the glass cover clear the grooves of the socket
and pull the cover off. Remove the bulb.
To replace:
3XWLQDQHZZDWWDSSOLDQFHEXOE3ODFHWKHWDEVRI
the glass cover into the grooves of the socket. Turn the
JODVVFRYHUFORFNZLVHWXUQ
49-85242-1
NOTE:
Ŷ $
ZDWWDSSOLDQFH
bulb is smaller than
DVWDQGDUGZDWW
household bulb.
Socket
Ŷ R
econnect electrical
power to the oven once
the new bulb is installed.
Ŷ F
or improved lighting
inside the oven,
clean the glass cover
frequently using a wet
cloth. This should be
done when the oven is
completely cool.
3»2”
Max
length
Bulb
Tab
Glass cover
CARE AND CLEANING: Oven Light
Oven Light
25
CARE AND CLEANING: Oven Door
Oven Door
Lift-Off Oven Door
The door is very heavy. Be careful when removing and lifting the door. Do not lift door by the handle.
To Remove the Door:
)XOO\RSHQWKHGRRU
3XOOWKHKLQJHORFNVXSDQGDZD\IURPWKHUDQJH
frame to the unlocked position.
3. Firmly grasp both sides of the door near the top.
4. Close door until the top of the door is approximately
6” from the range frame.
5. Lift door up and away from the range until both hinge
arms are clear of the slots in the range frame.
To Replace the Door:
)LUPO\JUDVSERWKVLGHVRI WKHGRRUQHDUWKHWRS
2. With the door at the same angle as the removal
position, rest the notch on the underside of the left
hinge arm on the bottom edge of the left hinge slot.
The notch in the hinge arm must be fully seated into
the bottom of the slot. Repeat for the right side.
3. Fully open the door. If the door will not fully open, the
notches in the bottoms of the hinge arms have not
seated correctly in the bottom edge of the slot. Lift the
door off the range and repeat previous step.
3XVKWKHKLQJHORFNVWRZDUGWKHUDQJHFDYLW\DQG
down to the locked position.
5. Close the oven door.
3XOOKLQJHORFNVXSWRXQORFN
Removal position
Hinge arm
Bottom
edge of
slot
Notch
Rest notch on bottom edge
of hinge slot
3XVKKLQJHORFNVGRZQWR
lock
Lift-Off Upper Oven Door
The door is very heavy. Be careful when removing and lifting the door. Do not lift door by the handle.
To Remove the Door:
)XOO\RSHQWKHGRRU
2. Lift up on the hinge lock toward the oven frame until
they stop.
&ORVHWKHGRRUWRGHJUHHV \RXZLOOIHHOWKHGRRU
VWRS 7KHKLQJHORFNZLOO FRQWDFWWKHRYHQ IUDPH
4. On both sides of the door, press down on the release
buttons on each hinge.
To Replace the Door:
3XOOWKHKLQJHVGRZQDZD\IURPWKHRYHQIUDPHWR
the fully open position.
2. Lift up on the hinge locks toward the oven frame until
they stop.
3. The hinges will release to the 45-degree position. The
hinge locks will contact the oven frame.
5. Lift door up until it is clear of the hinge.
4. Slide the door back onto the hinges. Make sure the
buttons pop back out.
3XOORQKLQJHDUPVVOLJKWO\WRUHOLHYHSUHVVXUHRQWKH
locking tabs.
3XVKWKHKLQJHORFNVGRZQRQWRWKHKLQJH
3XVKWKHKLQJHORFNVGRZQRQWRWKHKLQJH
5. Fully open the door.
7. Close the oven door.
3XVKWKHKLQJHVLQWRZDUGWKHXQLWVRWKH\DUHFORVHG
3XVKLQ
Oven
frame
3XOOGRZQ
Door
frame
Release
buttons
26
49-85242-1
Save time and money! Review the charts on the following pages first and you may not need to call for service.
Problem
Possible Cause
What To Do
My new oven doesn't
cook like my old one.
Is something wrong
with the temperature
settings?
Your new oven has a different cooking
system from your old oven and therefore
may cook differently than your old oven.
For the first few uses, follow your recipe times
and temperatures carefully and use rack positions
recommended in the Cooking Guide. If you still think
your new oven is too hot or too cold, you can adjust
the temperature yourself to meet your specific cooking
preference. See the Special Features section.
Food does not bake
properly
Oven controls improperly set.
See the Cooking Modes section.
Rack position is incorrect or rack is not level. See the Cooking Modes section and Cooking Guide.
Incorrect cookware or cookware of improper
size being used.
See the Cookware section.
Oven temperature needs adjustment.
See the Special Features section.
Oven controls improperly set.
Make sure you select the appropriate broil mode.
Improper rack position being used.
See Cooking Guide for rack location suggestions.
Cookware not suited for broiling.
8VHDSDQVSHFLILFDOO\GHVLJQHGIRUEURLOLQJ
Aluminum foil on the broil pan has not been
fitted properly or slit to drain grease.
If using aluminum foil on broil pan, wrap tightly and
add slits conforming to those in the pan to allow
grease to drain.
Oven temperature too
hot or too cold
Oven temperature needs adjustment.
See the Cooking Modes section.
Oven and/or display
appears not to work
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Oven controls improperly set.
6HHWKH8VLQJWKH2YHQVHFWLRQ
Oven is in Sabbath Mode.
9HULI\WKDWWKHRYHQLVQRWLQ6DEEDWK0RGH6HHWKH
Sabbath Mode section.
The clock is turned off.
See the Settings section.
Food does not broil
properly
“Crackling” or
“popping” sound
This is the sound of the metal heating and
This is normal.
cooling during both the cooking and cleaning
functions.
Why is my range
making a "clicking"
noise when using my
oven?
Your range has been designed to maintain a This is normal.
tighter control over your oven's temperature.
You may hear your oven's heating elements
"click" on and off more frequently than in
older ovens to achieve better results during
baking, broiling, and self-clean cycles.
Sometimes the oven
takes longer to
preheat to the same
temperature
&RRNZDUHIRRGDQGRUQXPEHURIUDFNVLQ
oven.
49-85242-1
TROUBLESHOOTING TIPS
Troubleshooting Tips ... Before you call for service
Cookware, food, and racks in the oven will cause
differences in preheat times. Remove excess items to
reduce preheat time.
27
TROUBLESHOOTING TIPS
Troubleshooting Tips ... Before you call for service
Problem
Possible Cause
What To Do
Oven light does not
work
Light bulb is loose or defective.
Tighten or replace bulb. See the Maintenance section for
instructions on how to replace the bulb.
Oven will not selfclean
The temperature is too high to set a
self-clean operation.
Allow the oven to cool and reset the controls.
Oven controls improperly set.
See the Cleaning the Oven section.
Excessive soil or grease.
3UHVVWKH Cancel/Off pad. Open the windows to rid the
room of smoke. Wait until the LOCKED light goes off. Wipe
up the excess soil and reset the clean cycle.
Excessive smoking
during clean cycle
Oven not clean after a Oven controls improperly set.
clean cycle
Oven was heavily soiled.
See the Cleaning the Oven section.
Strong “burning” or
“oily” odor emitting
from the vent
This is normal in a new oven and will
disappear in time.
To speed the process, set a self-clean cycle for a minimum
of 3 hours. See the Cleaning the Oven section. This is
temporary.
Excessive smoking
during broiling
Food too close to burner element.
Lower the rack position of the food.
The oven door is locked because the
Oven door will not
open or LOCKED light temperature inside the oven has not
dropped below the locking temperature.
is on when you want
to cook.
3UHVVWKHCancel/Off pad. Allow the oven to cool below the
locking temperature.
"LOCK DOOR"
flashes in the display
The self-clean cycle has been selected
but the door is not closed.
Close the oven door.
“F— and a number
or letter” flash in the
display
You have a function error code.
3UHVVWKHCancel/Off pad. Allow the oven to cool for one
KRXU3XWWKHRYHQEDFNLQWRRSHUDWLRQ,IWKHIXQFWLRQFRGH
UHSHDWVGLVFRQQHFWDOOSRZHUWRWKHRYHQIRUDWOHDVW
seconds and then reconnect power. If the function error
code repeats again, call for service.
Power outage, clock
flashes
3RZHURXWDJHRUVXUJH
Reset the clock. If the oven was in use, you must reset
it by pressing the Cancel/Off pad, setting the clock and
resetting any cooking function.
Lock Controls or
Control Lockout
feature is activated
Burners do not light
28
Clean up heavy spillovers before starting the clean cycle.
Heavily soiled ovens may need to self-clean again or for a
longer period of time.
If LOC ON appears in the display, the range control is
locked. Turn this feature off to use the range. See the Lock
Control feature in the Oven Controls section.
3OXJRQUDQJHLVQRWFRPSOHWHO\LQVHUWHG Make sure electrical plug is plugged into a live, properly
in the electrical outlet.
grounded outlet.
Gas supply not connected or turned on.
See the Installation Instructions that came with your range.
A fuse in your home may be blown or
the circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Burner parts not replaced correctly.
See the Care and Cleaning of the range section.
Burner slots near the electrode, or the
round lighter port on the oval burner,
may be clogged.
Remove the burners and clean them. Check the electrode
area for burned-on food or grease. See the Care and
Cleaning of the range section.
Food residue on electrode
Lightly polish flat tip of electrode with nail file or sandpaper
until shiny.
49-85242-1
Problem
Possible Cause
What To Do
Top burners do not
burn evenly
Improper burner assembly.
Make sure the burner caps are seated correctly. See the Care
and Cleaning of the range section.
Burner slots on the side of the
burner may be clogged.
Remove the burners for cleaning. See the Care and Cleaning
of the range section.
Burner flames are
very large or yellow
Improper air to gas ratio.
,IUDQJHLVFRQQHFWHGWR3URSDQHJDVFRQWDFWWKHWHFKQLFLDQ
who installed your range or made the conversion.
Surface burners light
but bake and broil
burners do not.
Gas to the oven burners may have
been shut off.
The oven gas shut-off is located on the gas regulator near the
gas line attachment to your range. Locate it and flip the lever.
Lever is
shown closed.
38//7223(1
Sealed burner models
My oven door glass
appears to be "tinted"
or have a "rainbow"
color.
The inner oven glass is coated with
a heat barrier to reflect the heat
back into the oven to prevent heat
loss and keep the outer door cool
while baking.
Drawer does not slide The drawer is out of alignment.
smoothly or drags
Drawer is over-loaded or load is
unbalanced.
49-85242-1
7KLVLVQRUPDO8QGHUFHUWDLQOLJKWRUDQJOHV\RXPD\VHHWKLV
tint or rainbow color.
TROUBLESHOOTING TIPS
Troubleshooting Tips ... Before you call for service
Fully extend the drawer and push it all the way in. See the Care
and Cleaning of the range section.
Reduce weight or redistribute drawer contents.
29
WARRANTY
GE Appliances Gas Range Warranty
GEAppliances.com
All warranty service is provided by our Factory Service Centers, or an authorized Customer Care® technician. To schedule
service online, visit us at www.geappliances.com/service_and_support/RUFDOO*($SSOLDQFHVDW*(&$5(6
3OHDVHKDYH\RXUVHULDOQXPEHUDQG\RXUPRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory
service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its
products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be
sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service.
For the period of
GE Appliances will replace
One year
From the date
of the original
purchase
Any part of the range which fails due to a defect in materials or workmanship. During this
limited one-year warranty, GE Appliances will provide, free of charge, all labor and in-home
service to replace the defective part.
What GE Appliances will not cover:
Ŷ Service trips to your home to teach you how to use
Ŷ
Ŷ
Ŷ
6WDSOH\RXUUHFHLSWKHUH3URRIRIWKHRULJLQDOSXUFKDVH
date is needed to obtain service under the warranty.
Ŷ
the product.
,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
)DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHG
modified, or used for other than the intended purpose
or used commercially.
5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
breakers.
'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH
floods, or acts of God.
Ŷ 'DPDJHWRILQLVKVXFKDVVXUIDFHUXVWWDUQLVKRU
small blemishes not reported within 48 hours of
delivery.
Ŷ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
possible defects with this appliance.
Ŷ 'DPDJHFDXVHGDIWHUGHOLYHU\
Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
Ŷ 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU/('
lamps.
EXCLUSION OF IMPLIED WARRANTIES
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
This warranty is extended to the original purchaser and any succeeding owner for products purchased for home use
ZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($SSOLDQFHV$XWKRUL]HG6HUYLFHULVQRWDYDLODEOH
you may be responsible for a trip charge or you may be required to bring the product to an Authorized GE Appliances
Service location for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives you
specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights
are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances, a Haier company
Extended Warranties:3XUFKDVHD*($SSOLDQFHVH[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUH
available while your warranty is still in effect. You can purchase it online anytime at
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*($SSOLDQFHV6HUYLFHZLOOVWLOOEHWKHUHDIWHU\RXUZDUUDQW\H[SLUHV
49-85242-1
Looking For Something More?
GE Appliances offers a variety of accessories to
improve your cooking and maintenance experiences!
Refer to the Consumer Support page for phone numbers
and website information.
The following products and more are available:
Accessories
Nickel Flat Rack
ACCESSORIES
Accessories
Reinforced Nickel Flat Rack
Self Clean Flat Rack
Nickel Extension Rack
Self Clean Extension Rack
%URLOHU3DQ ô´[ó´[ò³
Roasting Rack Accessory
Cooktop Center Grate
Nonstick Aluminum Griddle
Reversible Cast-Iron Griddle
Cleaning Supplies
&LWUX6KLQHŒ6WDLQOHVV6WHHO:LSHV
&6WDLQOHVV6WHHO3ROLVKLQJ&ORWK
CERAMA BRYTE® Burnt-On Grease Remover
49-85242-1
CONSUMER SUPPORT
Consumer Support
GE Appliances Website
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
VHUYLFHVGHVLJQHGIRU\RXUFRQYHQLHQFH,QWKH86GEAppliances.com
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
WKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO,QWKH86GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
\RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU,QWKH86GEAppliances.com/service
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV
Extended Warranties
3XUFKDVHD*($SSOLDQFHVH[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH\RXU
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
ZDUUDQW\H[SLUHV,QWKH86GEAppliances.com/extended-warranty
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV
Remote Connectivity
)RUDVVLVWDQFHZLWKZLUHOHVVQHWZRUNFRQQHFWLYLW\ IRUPRGHOVZLWKUHPRWHHQDEOH visit our website at GEAppliances.com/connected-home-smart-appliances/RUFDOOLQWKH86
Parts and Accessories
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG 2UGHURQOLQHWRGD\KRXUVHYHU\GD\
,QWKH86GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/contact
32
3ULQWHGLQ0H[LFR
49-85242-1
A Gas con Horno Doble y Limpieza Automática
COCINAS
INFORMACIÓN DE SEGURIDAD . . . . . 3
USO DE LA COCINA
En Caso de Corte de Corriente . . . . . . . . . . . . . . . . 8
Quemadores . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8
Plancha . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
Controles del Horno. . . . . . . . . . . . . . . . . . . . . . . . . 11
Options (Opciones) . . . . . . . . . . . . . . . . . . . . . . . . . 12
Settings (Configuraciones) . . . . . . . . . . . . . . . . . . . 12
Modo Sabático . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14
Estantes del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Papel de Aluminio y Cobertores del Horno . . . . . 16
Utensilios . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
Modos de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . . 16
Ventilaciones de Aire del Horno . . . . . . . . . . . . . . 17
Sonda del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
Guía de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19
MANUAL DEL
PROPIETARIO
CGS995
PGS960
CUIDADO Y LIMPIEZA
Cocina - Exterior . . . . . . . . . . . . . . . . . . . . . . . . . . .20
Cocina - Interior . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Placa de Cocción . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Puerta . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24
Sonda del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . .24
Luz del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .25
Puerta del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . .26
CONSEJOS PARA LA
SOLUCIÓN DE PROBLEMAS
. . . . . . . . 27
GARANTÍA . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30
ACCESORIOS . . . . . . . . . . . . . . . . . . . . . . . . . . 31
SOPORTE PARA
EL CONSUMIDOR . . . . . . . . . . . . . . . . . . . . . 32
Escriba los números de modelo y
de serie aquí:
Nº de Modelo ____________
Nº de Serie ______________
Encontrará la etiqueta de
calificación en el frente, detrás
del cajón de la cocina.
GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca.
49-85242-1 02-18 GEA
GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR.
Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace
tenerlo en la familia.
Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de
GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico
asegura que podamos entregarle información importante del producto y detalles de la garantía
cuando los necesite.
Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles
están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con
el material embalado.
2
49-85242-1
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA
Lea todas las instrucciones de seguridad antes de utilizar este producto. No seguir estas instrucciones
puede generar un incendio, una descarga eléctrica, lesiones corporales o la muerte.
ADVERTENCIA Si la información de este manual no se sigue exactamente, se podrá
producir un incendio o explosión, ocasionando daños sobre la propiedad, lesiones o la muerte.
- No guarde ni use gasolina u otros vapores inflamables y líquidos cerca de este ni de otros
electrodomésticos.
- QUÉ DEBE HACER SI HUELE GAS
Ŷ 1RLQWHQWHLOXPLQDUQLQJ~QHOHFWURGRPpVWLFR
Ŷ 1RWRTXHQLQJ~QLQWHUUXSWRUHOpFWULFRQRXVHWHOpIRQRVHQVXHGLILFLR
Ŷ '
HLQPHGLDWROODPHDVXSURYHHGRUGHJDVGHVGHHOWHOpIRQRGHXQYHFLQR
Ŷ 6LQRVHSXHGHFRPXQLFDUFRQVXSURYHHGRUGHJDVOODPHDOGHSDUWDPHQWRGHERPEHURV
- La instalación y las reparaciones deberán ser realizadas por un instalador calificado, agencia
de servicios o el proveedor de gas.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
DISPOSITIVO ANTI-VOLCADURAS
ADVERTENCIA
Riesgo de Caída
• Un niño o adulto pueden volcar la cocina y morir.
• Instale el soporte anti-volcaduras sobre la pared o el piso.
• Asegúrese la estufa al soporte anti-volcaduras deslizando
la unidad hacia atras de tal manera que la pata niveladora
sea enganchada.
• Vuelva a adherir el soporte anti-volcaduras si la estufa
se mueve de lugar.
• Si esto no se hace, se podrá producir la muerte o
quemaduras graves en niños o adultos.
Para reducir el riesgo de volcar la cocina,
ésta debe sujetarse mediante un soporte antivolcaduras con una adecuada instalación. Ver
las instrucciones de instalación enviadas con el
soporte para obtener detalles completos antes
de iniciar la instalación.
Para Cocinas Sin Apoyo y Deslizabless
Para controlar si el soporte es instalado y
ajustado de forma apropiada, mire que debajo
de la cocina la pata niveladora trasera esté
ajustada al soporte. En algunos modelos, el
cajón de almacenamiento o el panel de protección se pueden retirar para una fácil
Soporte
inspección. Si no es posible realizar una inspección visual, deslice la cocina hacia
Anti-Volcaduras
adelante, confirme que el soporte anti-volcaduras esté ajustado de forma segura al
piso o la pared, y deslice la cocina hacia atrás de modo que la pata niveladora trasera
se encuentre debajo del soporte anti-volcaduras.
Si la cocina es expulsada de la pared por alguna razón, siempre repita este
procedimiento a fin de verificar que esté asegurado de forma correcta con un soporte
anti volcaduras.
Nunca quite las patas de nivelación por completo ya que la cocina no quedará bien
sujeta al dispositivo anti-volcaduras.
Pata
Niveladora
Cocinas Sin Apoyo y Deslizables
LEA Y GUARDE ESTAS INSTRUCCIONES
49-85242-1
3
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD
ADVERTENCIA
NUNCA use este
electrodoméstico para calentar el ambiente.
Como consecuencia de esto, se podrá producir
envenenamiento con monóxido de carbono y el
sobrecalentamiento del horno.
Ŷ 8VHHVWHHOHFWURGRPpVWLFRVyORSDUDVXSURSyVLWRRULJLQDO
como se describe en el manual del propietario.
Ŷ 6
ROLFLWHTXHXQLQVWDODGRUFDOLILFDGRLQVWDOHVXFRFLQD\
que esté correctamente conectada a tierra, de acuerdo
con las instrucciones de instalación provistas.
Ŷ &
XDOTXLHUDMXVWH\WUDEDMRGHVHUYLFLRWpFQLFRGHEHUi
ser realizado únicamente por instaladores calificados de
cocinas a gas o técnicos del servicio. No intente reparar o
reemplazar ninguna parte de la cocina, a menos que esto
se recomiende específicamente en este manual.
Ŷ 6
XFRFLQDHVHQYLDGDGHVGHODIiEULFDSDUDXVRFRQJDV
natural. Puede ser convertida para uso con gas propano.
Si se requieren, estos ajustes deben ser realizados por
un técnico calificado de acuerdo con las instrucciones de
instalación y códigos locales. La agencia que realiza este
trabajo asume la responsabilidad de la conversión.
Ŷ 6
ROLFLWHTXHHOLQVWDODGRUOHPXHVWUHODXELFDFLyQGHOD
válvula de cierre de la cocina a gas y cómo apagarla en
caso de ser necesario.
Ŷ (
QFKXIHODFRFLQDHQXQWRPDFRUULHQWHFRQFRQH[LyQ
a tierra de 120 voltios únicamente. No retire la pata
redonda de conexión a tierra del enchufe. Si tiene
dudas sobre la conexión a tierra del sistema eléctrico
para hogar, es su responsabilidad y obligación contar
con el reemplazo de un tomacorriente sin conexión a
tierra por un tomacorriente de tres patas correctamente
conectado a tierra, de acuerdo con el Código Nacional
de Electricidad. No use prolongadores con este
electrodoméstico.
Ŷ $
QWHVGHUHDOL]DUFXDOTXLHUVHUYLFLRWpFQLFRGHVHQFKXIH
la cocina o desconecte el suministro de corriente desde
el panel de distribución del hogar, retirando el fusible o
desconectando el disyuntor.
Ŷ $
VHJ~UHVHGHTXHWRGRVORVPDWHULDOHVGHHPEDODMHVHDQ
retirados de la cocina antes de su uso, a fin de evitar que
estos materiales se incendien.
Ŷ (
YLWHUDOODGXUDVRLPSDFWRVVREUHODVSXHUWDVGHPHWDO
cocinas o paneles de control. Hacer esto podrá producir la
rotura de vidrios. No cocine un producto con un vidrio roto.
Es posible que se produzcan descargas, incendio o cortes.
Ŷ 1
RGHMHDORVQLxRVVRORVRIXHUDGHVXUDGLRGHDWHQFLyQ
en el área donde el electrodoméstico se encuentre en
uso. Nunca se les deberá permitir trepar, sentarse o
pararse sobre ninguna parte del electrodoméstico.
Ŷ
ADVERTENCIA
No coloque artículos de interés
para los niños sobre los gabinetes que están sobre un
horno – si los niños se trepan sobre el horno para llegar
a estos artículos podrían sufrir lesiones graves.
Ŷ 1
XQFDEORTXHHODVYHQWLODFLRQHV DEHUWXUDVGHDLUH GHOD
cocina. Las mismas brindan las entradas y salidas de aire
que son necesarias para que la cocina opere de forma
correcta con la combustión adecuada. Las aberturas de
aire están ubicadas en la parte trasera de la cocina, en
la parte superior e inferior de la puerta del horno, y en la
parte inferior de la cocina debajo del cajón calentador, del
cajón del horno inferior o del panel de protección.
Ŷ 8VHVyORVRVWHQHGRUHVGHROODVVHFRV±ORVVRVWHQHGRUHV
húmedos sobre superficies calientes pueden producir
quemaduras debido al vapor. No permita que los
sostenedores de ollas tengan contacto con los quemadores
superficiales, la parrilla de los quemadores, o el elemento
de calefacción del horno. No use una toalla u otra tela
voluminosa para reemplazar el mango de las cacerolas.
Ŷ 1
RWRTXHHOHOHPHQWRFDOHQWDGRUQLODVXSHUILFLHLQWHULRU
del horno. Es posible que estas superficies estén
demasiado calientes como para quemar, aunque su
color sea oscuro. Durante y después del uso, no toque ni
permita que telas u otros materiales inflamables toquen
cualquier área interior del horno; espere a que haya
pasado un tiempo suficiente para que se enfríen. Otras
superficies del electrodoméstico se podrán calentar lo
suficiente como para ocasionar lesiones. Las superficies
potencialmente calientes incluyen la abertura de la
ventilación del horno, superficies cercanas a la abertura y
grietas alrededor de la puerta del horno.
Ŷ 1
RFDOLHQWHHQYDVHVGHFRPLGDTXHQRKD\DQVLGR
abiertos. Se podría acumular presión y el envase podría
explotar, ocasionando una lesión.
Ŷ &
RFLQHODFRPLGDFRPSOHWDPHQWHSDUDHYLWDUTXHVH
produzcan enfermedades a partir de la comida. Puede
encontrar recomendaciones de seguridad mínima sobre
la temperatura de la comida en www.IsItDoneYet.gov y
ZZZIVLVXVGDJRY8WLOLFHXQWHUPyPHWURSDUDWRPDUOD
temperatura de la comida y haga controles en diferentes
ubicaciones.
Ŷ 1
RSHUPLWDTXHQDGLHVHWUHSHSDUHRFXHOJXHGHOD
puerta del horno, del cajón o la cocina. Se podrá dañar la
cocina o provocar su caída, ocasionando lesiones graves
o la muerte.
LEA Y GUARDE ESTAS INSTRUCCIONES
4
49-85242-1
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA COCINA
Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios.
Ŷ 1RJXDUGHQLXVHPDWHULDOHVLQIODPDEOHVHQXQKRUQR
o cerca de la parte superior de la cocina, incluyendo
papel, plástico, sostenedores de ollas, trapos, cobertores
de pared, cortinas, paños y gasolina u otros vapores y
líquidos inflamables.
Ŷ 1XQFDXVHSUHQGDVKROJDGDVRTXHFXHOJXHQPLHQWUDV
usa el electrodoméstico. Evite acumular artículos
comúnmente usados en gabinetes sobre la cocina, y
tenga cuidado al extender la mano sobre la cocina.
La ropa que se encuentre cerca de los quemadores o
superficies calientes se podrá encender, ocasionando
quemaduras graves.
Ŷ 1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURVPDWHULDOHV
inflamables se acumulen en o cerca de la cocina. La
grasa del horno o sobre la cocina se podrá incendiar.
ADVERTENCIA EN CASO DE INCENDIO, SIGA LOS SIGUIENTES PASOS
PARA EVITAR LA PROPAGACIÓN DEL FUEGO
Ŷ 1RXVHDJXDVREUHHOIXHJRGHODJUDVD1XQFDWRPH
una olla que se esté incendiando. Apague los controles.
Extinga la olla que se esté incendiando sobre un
quemador superficial, cubriendo la olla completamente
con su tapa correspondiente, una hoja metálica de
galletas o una bandeja plana. Si es necesario, use un
químico seco multiuso o un extintor de chorro de espuma.
Ŷ 6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHHOKRUQHDGR
ahogue el fuego cerrando la puerta del horno y apagando
el mismo o usando un químico seco multipropósito o un
extintor de incendio con espuma.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
Ŷ (QFDVRGHTXHKD\DIXHJRHQHOKRUQRGXUDQWHHOSHUtRGR
de auto limpieza, apague el horno y espere a que el fuego
se extinga. No fuerce la puerta para abrirla. La entrada de
aire fresco sobre las temperaturas de auto limpieza podrá
conducir a la producción de llamas en el horno.
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DE LA PARTE SUPERIOR DE LA
COCINA
Ŷ 1XQFDSLHUGDGHYLVWDORVTXHPDGRUHVFXDQGRVH
encuentren en las configuraciones de calor media o alta.
Las comidas, especialmente las que se preparan con
aceite, se pueden incendiar, lo cual puede ocasionar un
incendio que se propague a los gabinetes próximos.
Ŷ 1XQFDSLHUGDGHYLVWDHODFHLWHFXDQGRHVWpIULHQGR6L
se calienta más allá de su punto de cocción, el aceite
se puede quemar y provocar un incendio que se puede
SURSDJDUDORVJDELQHWHVSUy[LPRV8VHXQWHUPyPHWUR
para grasas profundas siempre que sea posible, a fin de
monitorear la temperatura del aceite.
Ŷ 3DUDHYLWDUGHUUDPHVHLQFHQGLRVXVHXQDFDQWLGDG
mínima de aceite al usar una sartén poco profunda y
evite la cocción de comidas congeladas con cantidades
excesivas de hielo.
Ŷ 8VHHOWDPDxRGHROODDGHFXDGRSDUDHYLWDUTXHVHDQ
inestables o que sufran caídas fácilmente. Seleccione
utensilios que coincidan con el tamaño del quemador. Las
llamas del quemador se deberán ajustar de modo que no
VHH[WLHQGDQPiVDOOiGHODSDUWHLQIHULRUGHODROOD8QD
cantidad excesiva de llama puede representar un riesgo.
Ŷ 6LHPSUHXVHODSRVLFLyQ/,7(DOHQFHQGHUORV
quemadores superiores y asegúrese de que estos se
hayan encendido.
Ŷ $OXVDUXWHQVLOLRVGHYLGULRFHUiPLFDDVHJ~UHVHGHTXH
sean adecuados para el servicio de cocina; otros se podrán
romper debido a un cambio repentino de temperatura.
Ŷ $ILQGHPLQLPL]DUSRVLEOHVTXHPDGXUDVLQFHQGLRGH
materiales inflamables y derrames, la manija de un
envase deberá ser inclinada hacia el centro de la cocina
sin que se extienda sobre los quemadores cercanos.
Ŷ 1RXVHXQZRNFRQXQDQLOORFRQVRSRUWHGHPHWDO
redondo. El anillo podrá atrapar calor y bloquear el aire
hacia el quemador, produciendo el riesgo de emisión de
monóxido de carbono.
Ŷ 1RLQWHQWHHOHYDUODFRFLQD+DFHUHVWRSRGUtDGDxDU
la tubería de gas hasta los quemadores superficiales,
ocasionando una pérdida de gas y riesgo de incendio.
Ŷ $OLQKDELOLWDUHO%ORTXHRGHO&RQWUROGH*DV HQDOJXQRV
PRGHORV DVHJ~UHVHGHTXHORVFRQWUROHVGHVXSHUILFLH
VHHQFXHQWUHQHQODSRVLFLyQ2)) $SDJDGR (VWR
evitará que haya un flujo de gas no intencional desde los
quemadores.
Ŷ 1RXVHSDSHOGHDOXPLQLRSDUDFXEULUUHMLOODVFXDOTXLHU
parte de la cocina. Si se hace esto se podrá
producir envenenamiento con monóxido de carbono,
sobrecalentamiento de las superficies de la cocina o un
posible riesgo de incendio.
LEA Y GUARDE ESTAS INSTRUCCIONES
49-85242-1
5
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD
ADVERTENCIA
NUNCA cubra ninguna
ranura, agujeros o pasajes en el fondo del horno ni
cubra un estante entero con materiales tales como
papel de aluminio o cobertores de horno. Hacer esto
bloquea el flujo de aire a través del horno y puede
ocasionar envenenamiento con monóxido de carbono.
Nunca coloque papel de aluminio o cobertores de
horno en el fondo del horno. Podrán atrapar el calor,
ocasionando riesgos de humo o incendio.
Ŷ 0DQWpQJDVHDOHMDGRGHODFRFLQDDODEULUODSXHUWDGHO
horno. El aire caliente o el vapor que sale puede causar
TXHPDGXUDVHQODVPDQRVURVWUR\XRMRV
Ŷ 1XQFDFRORTXHORVXWHQVLOLRVGHFRFLQDSLHGUDVSDUD
pizza u horneado o cualquier otro tipo de aluminio
Ŷ
Ŷ
Ŷ
Ŷ
o cobertor en la base del horno. Este ítems pueden
atrapar el calor o derretirse, ocasionando daños sobre el
producto y el riesgo de descargas, humo o incendios.
&RORTXHORVHVWDQWHVGHOKRUQRHQODXELFDFLyQ
correspondiente mientras éste se encuentra frío. Si
es necesario retirar el estante mientras el horno se
encuentra caliente, evite tocar las superficies calientes.
1RGHMHSURGXFWRVWDOHVFRPRSDSHOXWHQVLOLRVGHFRFLQD
ni comida en el horno cuando no esté en uso. Los
artículos guardados en el horno se pueden incendiar.
1RGHMHQLQJ~QSURGXFWRVREUHODVXSHUILFLHGHFRFFLyQ
cerca de la ventilación del horno. Los artículos se pueden
sobrecalentar, y existe riesgo de incendio o quemaduras.
1XQFDDVHFRQODSXHUWDDELHUWD6HSURKtEHDVDUFRQ
la puerta abierta debido al sobrecalentamiento de las
perillas de control.
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO CON FUNCIÓN DE
AUTO LIMPIEZ
La función de auto limpieza usa el horno en temperaturas lo suficientemente altas como para consumir restos de comida
que haya dentro del mismo. Para un funcionamiento seguro, siga estas instrucciones.
Ŷ 6LHOPRGRGHDXWROLPSLH]DIXQFLRQDGHIRUPDLQFRUUHFWD
Ŷ 1RWRTXHODVVXSHUILFLHVGHOKRUQRGXUDQWHHOFLFORGH
apague el horno y desconecte el suministro de corriente.
limpieza automática. Mantenga a los niños alejados del
Solicite el servicio de un técnico calificado.
horno durante la limpieza automática. Si no se siguen
estas instrucciones, se podrán producir quemaduras.
Ŷ 1RXVHOLPSLDGRUHVSDUDKRUQR1RVHGHEHUiXVDU
limpiador para hornos comerciales ni revestimientos de
Ŷ $QWHVGHXWLOL]DUHOFLFORGHDXWROLPSLH]DUHWLUHODV
protección para hornos de ningún tipo en o alrededor de
ollas, estantes de metal brillante del horno y otros
cualquier parte del horno.
utensilios que haya dentro del mismo. Sólo se pueden
dejar dentro del horno los estantes para horno con
Ŷ 1ROLPSLHODMXQWDGHODSXHUWD/DMXQWDGHODSXHUWDHV
recubrimiento de porcelana.
esencial para un buen sellado. Se debe tener cuidado de
Ŷ $QWHVGHXWLOL]DUHOFLFORGHDXWROLPSLH]DOLPSLHODJUDVD
no frotar, dañar ni mover la junta.
\UHVWRVGHFRPLGDTXHKD\DHQHOKRUQR8QDFDQWLGDG
Ŷ IMPORTANTE: La salud de algunas aves es
excesiva de grasa se puede incendiar, lo cual puede
extremadamente sensible a los humos emitidos durante
producir daños con humo en su hogar.
el ciclo de limpieza automática de cualquier cocina.
Coloque las aves en otra habitación bien ventilada.
LEA Y GUARDE ESTAS INSTRUCCIONES
6
49-85242-1
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA DE LA PROPOSICIÓN 65 DEL ESTADO DE CALIFORNIA
ADVERTENCIA
Este producto contiene uno o más químicos que el Estado de California entiende que producen
cáncer, defectos en el nacimiento u otros daños reproductivos.
Los hornos con limpieza automática pueden ocasionar exposiciones de bajo nivel a algunas de las sustancias de la
Proposición 65, incluyendo monóxido de carbono, durante el ciclo de limpieza. La exposición a sustancias puede ser
minimizada abriendo una ventana o usando un extractor o campana.
Equipo de Acceso Remoto Instalado
Este dispositivo cumple con la Parte 15 de la Normativa de
la FCC. Su funcionamiento está sujeto a las dos condiciones
VLJXLHQWHV (VWHGLVSRVLWLYRQRSRGUiRFDVLRQDU
LQWHUIHUHQFLDVQRFLYDV\ HVWHGLVSRVLWLYRGHEHDFHSWDU
cualquier interferencia recibida, incluyendo interferencias que
puedan ocasionar un funcionamiento no deseado.
El equipo de comunicación inalámbrica instalado en esta
cocina fue probado y cumple con los límites establecidos
SDUDXQGLVSRVLWLYRGLJLWDOGH&ODVH%VHJ~QODSDUWHGHOD
Normativa de la FCC. Estos límites fueron diseñados para:
(a) brindar una protección razonable contra interferencias
nocivas en una instalación residencial. Este equipo genera,
usa y puede emitir energía de radiofrecuencia y, si no se
instala y utiliza de acuerdo con las instrucciones, puede
ocasionar interferencias perjudiciales en las comunicaciones
de radio. Sin embargo, no se garantiza que no se presenten
interferencias en una instalación en particular. Si el equipo
provoca interferencias perjudiciales para la recepción de radio
o televisión, lo cual puede comprobar encendiendo y apagando
el equipo, se aconseja al usuario que intente corregir la
interferencia con una de las siguientes medidas:
Ŷ 5HRULHQWHRUHXELTXHODDQWHQDUHFHSWRUD
Ŷ $XPHQWHODVHSDUDFLyQHQWUHHOHTXLSR\HOUHFHSWRU
Ŷ &RQHFWHHOHTXLSRDXQWRPDFRUULHQWHGHXQFLUFXLWRGLIHUHQWH
del tomacorriente al que se encuentra conectado el receptor.
Ŷ 3DUDVROLFLWDUD\XGDFRQVXOWHFRQHOSURYHHGRUPLQRULVWDRD
XQWpFQLFRH[SHULPHQWDGRGHUDGLR79
(b) tolerar cualquier interferencia recibida, incluyendo las
interferencias que puedan provocar un funcionamiento no
deseado del dispositivo.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
Observe que todos los cambios o modificaciones sobre el
dispositivo de comunicación inalámbrico instalado en este
horno que no estén expresamente aprobados por el fabricante
podrían anular la autoridad del usuario para operar el
equipamiento.
Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje
Con cuidado tome un extremo de la película protectora
de envío con los dedos y lentamente retire la misma de la
superficie del electrodoméstico. No utilice ningún producto
filoso para retirar la película. Retire toda la película antes de
usar el electrodoméstico por primera vez.
Para asegurar que no haya daños sobre el acabado del
producto, la forma más segura de retirar el adhesivo de la cinta
de embalaje en electrodomésticos nuevos es aplicando un
detergente líquido hogareño para lavar platos. Aplique con una
tela suave y deje que se seque.
NOTA: El adhesivo deberá ser eliminado de todas las partes.
No se puede retirar si se hornea con éste dentro.
LEA Y GUARDE ESTAS INSTRUCCIONES
49-85242-1
7
USO DE LA COCINA: (Q &DVR GH &RUWH GH &RUULHQWH 4XHPDGRUHV
En Caso de Corte de Corriente
En el caso de un corte de luz, el horno quedará inoperable y
no se deberá intentar usarlo. Sin embargo, los quemadores
superficiales se podrán encender con un fósforo. Con
extremo cuidado, sostenga un fósforo encendido cerca de los
Quemadores
Iluminación de un Quemador Superficial
ADVERTENCIA Los quemadores sólo deben ser
usados cuando estén cubiertos por los utensilios. Las
llamas de los quemadores que no estén cubiertas por el
utensilio presentan un riesgo de incendio o incendio de
telas. Nunca permita que las llamas se extiendan más allá
de los costados del utensilio. Si esto no se cumple, se
podrán producir lesiones graves.
Asegúrese de que todos los quemadores estén en sus
ubicaciones correspondientes y que estén totalmente
ensamblados antes de usar cualquiera de estos.
Seleccione un quemador y busque su perilla de control.
Empuje y gire la perilla hasta la posición LITE.
Escuchará un ruido de clic – el
sonido de la chispa eléctrica que
enciende el quemador. Cuando un
quemador se gire a LITE, todos los
quemadores generarán chispas.
El chispeo continuará mientras la
Empuje el mango de
SHULOODSHUPDQH]FDHQ/,7(8QDYH]
control y gire el mismo
encendido el gas, gire la perilla para
hasta la posición LITE.
ajustar el tamaño de la llama.
Reencendido Automático (en algunos modelos)
Los quemadores de esta cocina se volverán a iluminar
automáticamente si la llama se apaga.
Selección del Tamaño de la Llama
Observe la llama, no la perilla, a medida que reduce el calor.
Cuando se desee calentar de forma rápida, el tamaño de la
llama de un quemador deberá ser equivalente al tamaño del
utensilio de cocina que esté usando. Cuando las llamas sean
más grandes que la parte inferior del utensilio de cocina, no
calentarán el utensilio más rápido y podrían ser riesgosas.
Estas llamas son demasiado grandes para la olla.
Uso de los Quemadores
NOTAS:
Ŷ No utilice el quemador durante un período de tiempo
prolongado sin un utensilio de cocina sobre la parrilla. El
acabado de la parrilla se puede resquebrajar si no hay un
utensilio de cocina que absorba el calor.
Ŷ No intente desensamblar un quemador mientras otro
quemador está encendido. Es posible que se produzca una
descarga eléctrica, lo cual podría hacer que vuelque un
utensilio de cocina caliente.
Ŷ Asegúrese de que los quemadores y las parrillas estén
fríos antes de colocar la mano, tomar el mango de una olla,
trapos de limpieza u otros materiales sobre estos.
Su horno cuenta con quemadores de gas sellados que ofrecen
conveniencia, higiene y flexibilidad para una amplia variedad
de aplicaciones de cocción.
(OTXHPDGRUPiVSHTXHxRHVSDUDIXHJROHQWR8QTXHPDGRU
GHIXHJROHQWRTXHVHFRORTXHHQ/2 %DMR EULQGDXQD
cocción precisa para comidas tales como salsas delicadas que
requieren poco calor durante un tiempo de cocción prolongado.
El quemador extra grande está diseñado para llevar
rápidamente grandes cantidades de líquido a punto de hervor.
Algunos modelos cuentan con una configuración de
32:(5%2,/ŒHVSHFLDOPHQWHGLVHxDGDSDUDXVDUFRQ
utensilios de un diámetro de 11 pulgadas o más.
Tipos de Quemadores Superficiales
Quemador Redondo
8VHHVWHTXHPDGRUSDUDSURSyVLWRV
de cocción general. Olla de tamaño
adecuado a las llamas.
8
puertos debajo de la tapa del quemador superficial; luego de
IRUPDOHQWDJLUHODSHULOODKDVWDODSRVLFLyQ/,7( %DMR 8QD
vez encendidos, los quemadores superficiales continuarán
funcionando normalmente.
4XHPDGRUGH0~OWLSOHV$QLOORV
(en algunos modelos)
8VHHVWHTXHPDGRUSDUDROODVJUDQGHVR
para aplicaciones de cocción a fuego lento.
Quemador Oval Dual
(en algunos modelos)
8VHHVWHTXHPDGRUSDUDFRFLQDUHQ
la plancha o con una olla pequeña.
49-85242-1
4XHPDGRUGH$QLOORV0~OWLSOHV
(en algunos modelos)
Para utensilios grandes,
active todos los anillos
configurando el quemador
HQWUH+L $OWR \0HG 0HGLR Para utensilios pequeños o
aplicaciones con poco calor,
sólo active los anillos internos
configurando el quemador
HQWUH/R %DMR \6LP +HUYRU
D)XHJR/HQWR Quemador Oval Dual (en algunos modelos)
Para ollas pequeñas, sólo
active el quemador redondo.
Al usar una plancha, active
las secciones del quemador
oval y del redondo.
Vista Lateral de la Perilla del Quemador Oval Dual
9LVWD/DWHUDOGHOD3HULOODGHO4XHPDGRUGH$QLOORV0~OWLSOHV
Utensilio sobre la Cocina
Aluminio: Se recomienda un utensilio de peso mediano,
ya que calienta de forma rápida y pareja. La mayoría de las
comidas se doran de forma pareja en un sartén de aluminio.
8VHFDFHURODVFRQWDSDKHUPpWLFDFXDQGRFRFLQHFRQ
cantidades mínimas de agua.
Acero Inoxidable: Este metal posee propiedades de
calentamiento limitadas y normalmente se combina con cobre,
aluminio u otros materiales para una mejor distribución del
calor. Los sartenes con combinación de metales normalmente
funcionan de forma satisfactoria si se usan con calor medio,
como lo recomienda el fabricante.
Hierro Forjado: Si cocinará de forma lenta, la mayoría de los
sartenes le darán resultados satisfactorios.
Utensilios de esmalte:%DMRFLHUWDVFRQGLFLRQHVHOHVPDOWH
de algunos utensilios de cocina se pueden derretir. Siga las
recomendaciones sobre métodos de cocción del fabricante de
utensilios de cocina.
Vidrio: Existen dos tipos de utensilios de cocina de vidrio –
aquellos para uso con el horno únicamente y aquellos para
ODFRFFLyQHQODSDUWHVXSHULRUGHODFRFLQD FDFHURODVFDIp\
WHWHUDV /RVFRQGXFWRUHVGHYLGULRFDOLHQWDQGHIRUPDPX\OHQWD
USO DE LA COCINA:4XHPDGRUHV
4XHPDGRUHV &RQWLQ~D
Cerámica de Vidrio Resistente al Calor: Se pueden usar para
cualquier superficie o para cocción en el horno. Conduce el calor
de forma muy lenta y se enfría de forma muy rápida. Consulte
las instrucciones del fabricante de utensilios de cocina para
saber con seguridad si se puede usar con cocinas a gas.
Parrillas para la Parte Superior de la Cocina
No use cualquier repuesto de rejilla para la parte superior de
la cocina con sus quemadores de gas, ya que realizará una
combustión incompleta, generando niveles de monóxido de
carbono superiores a los estándares permitidos. Esto puede
ser peligroso para su salud.
No use rejillas para la parte superior de la cocina.
Cómo Usar un Wok
8VHVyORZRNVFRQEDVHSODQDGHXQGLiPHWURGHSXOJDGDV
RPHQRV$VHJ~UHVHGHTXHHOIRQGRGHOZRNVHDSR\HGH
forma plana sobre la rejilla.
1RXVHXQDQLOORGHVRSRUWHSDUDZRN&RORFDUHODQLOORVREUH
el quemador o parrilla podrá hacer que el quemador funcione
de forma inadecuada, produciendo niveles de monóxido de
carbono que superan los estándares permitidos. Esto puede
ser peligroso para su salud.
49-85242-1
8VHXQZRNFRQIRQGRSODQR
9
USO DE LA COCINA:: Plancha
Plancha (en algunos modelos)
ADVERTENCIA
Riesgo de Incendio
Ŷ 7
HQJDFXLGDGRDOFRFLQDUFRPLGDVFRQJUDVD/DJUDVDHVSDUFLGDSXHGHSURYRFDUXQLQFHQGLR
Ŷ 1
XQFDFRORTXHQLJXDUGHXQDUWtFXORHQODSODQFKDLQFOXVRFXDQGRQRHVWpHQXVR(OFDORUGHORVGHPiV
quemadores puede calentar la plancha y provocar un incendio.
Ŷ &RORTXH\UHWLUHODSODQFKDVyORFXDQGRWRGDVODVSDUULOODV\ODSODQFKDHVWpQIUtDV\WRGDVODVXQLGDGHV
superficiales estén en OFF (Apagado).
Uso de su Plancha de Hierro Fundido
El lado acanalado de la plancha reversible puede ser usado
para comidas normalmente cocinadas a la plancha.
Su plancha le brinda una superficie de cocción extra grande
para carnes, panqueques y otras comidas normalmente
preparadas en una sartén. Antes del primer uso, enjuague la
misma con agua caliente y séquela completamente. Prepare la
superficie con espray de cocina o aceite vegetal.
Precauciones de la Plancha:
Ŷ 1RFRORTXHODSODQFKDHQXQKRUQRPLFURRQGDV
Ŷ 1RODYHODSODQFKDHQHOODYDYDMLOODV
Ŷ 6
LDOJRVHGHUUDPyGHEDMRGHODSODQFKDVHGHEHUiOLPSLDU
tan pronto como sea posible para evitar la suciedad de la
comida “horneada”.
Ŷ 1
RSHUPLWDTXHVHDFXPXOHJUDVDGHEDMRGHODSODQFKD\D
que puede haber riesgo de incendio. Limpie debajo de la
plancha con agua caliente y jabón en cuanto esté fría.
Posicionamiento de la Plancha
/DSODQFKDGHKLHUURIXQGLGRVyORSXHGHVHUXVDGDVREUHHOTXHPDGRU HV FHQWUDOGHODSDUWHVXSHULRUGHODFRFLQD3DUD
SRVLFLRQDUODSODQFKDUHWLUHODUHMLOODFHQWUDO GHHVWDUSUHVHQWH \UHHPSODFHODPLVPDSRUODSODQFKD1RJLUHHOTXHPDGRU HV central hasta que esté seguro de que la plancha se posicionó correctamente.
Precalentamiento de la Plancha
En los modelos con plancha no reversible, precaliente esta última configurando ambos quemadores centrales en 4 durante
entre 5 y 10 minutos, antes de colocar comida sobre la plancha. En los modelos con plancha reversible, precaliente esta última
FRQILJXUDQGRDPERVTXHPDGRUHVFHQWUDOHVHQ+L $OWR GXUDQWHHQWUH\PLQXWRVDQWHVGHFRORFDUFRPLGDVREUHODSODQFKD
8QDYH]SUHFDOHQWDGDODSODQFKDJLUHODSHULOODGHOTXHPDGRU HV KDVWDODFRQILJXUDFLyQGHFRFFLyQUHVDOWDGDHQODWDEOD
Plancha Precurada de Hierro Fundido
Plancha Precurada de Hierro Fundido Reversible
Tipo de Comida
Tipo de Comida
Panceta
Embutidos para el Desayuno
Huevos
4XHVRDOD3ODQFKD
Hamburguesas
Panqueques
Cómo Calentar Tortillas
Configuración de Cocción
3
3
1
2
3
2
1
Es posible que sea necesario ajustar las configuraciones de la plancha
si se usará por un período prolongado.
Panceta
Embutidos para el Desayuno
Huevos
4XHVRDOD3ODQFKD
Hamburguesas
Panqueques
Cómo Calentar Tortillas
Configuración de Cocción
Med
Med
%DMR /R
Med
Med
Med
%DMR /R
Es posible que sea necesario ajustar las configuraciones de la plancha
si se usará por un período prolongado.
Reemplace la rejilla central por la plancha de hierro
fundido reversible.
Reemplace la rejilla central por la plancha de hierro
fundido reversible.
10
49-85242-1
3
11
7
1
1
HQDOJXQRV
PRGHORV
6
4
2
8 11
1. Upper Oven and Lower Oven (Horno
Superior y Horno Inferior): Designa qué horno
operarán los controles. Seleccione un horno antes de
seguir los pasos para comenzar con una cocción o con el
modo de limpieza.
2. Convection Cooking Modes (Modos de
Cocción por Convección): Los modos de
cocción por convección utilizan una circulación de aire
incrementada para mejorar el rendimiento. Para más
información, consulte la sección de Modos de Cocción.
3. Traditional Cooking Modes (Modos de
Cocción Tradicionales): Su horno cuenta con
ORVVLJXLHQWHVPRGRVGHFRFFLyQWUDGLFLRQDOHV%DNH
+RUQHDU %URLO $VDU DQG:DUP &DOHQWDU LQIRUPDFLyQ
consulte la sección de Modos de Cocción.
4. Clean (Limpieza): El horno podrá contar con dos
PRGRVGHOLPSLH]D6HOI&OHDQ /LPSLH]D$XWRPiWLFD \6WHDP&OHDQ /LPSLH]DDO9DSRU 3DUDDFFHGHUD
información importante sobre el uso de estos modos,
consulte la sección de Limpieza del Horno.
5. Start (Iniciar): Se deberá presionar para comenzar
cualquier función de cocción, limpieza o por tiempo.
6. Cancel/Off (Cancelar/ Apagar): Cancelar
TODAS las operaciones del horno excepto el reloj y el
temporizador.
7. Timer (Temporizador): Funciona como un
temporizador con cuenta regresiva. Presione la tecla
Timer (Temporizador) y las teclas +- para programar
el tiempo en horas y minutos. Presione la tecla Start
(Iniciar). La cuenta regresiva del temporizador se
completó. Para apagar el temporizador, presione la tecla
Timer (Temporizador).
49-85242-1
9
10
5
8. Remote Enable (Acceso Remoto) (en
algunos modelos): Le permite controlar el horno
de forma remota. El horno deberá estar conectado a la
UHG:L)LDQWHVGHTXH5HPRWH(QDEOH $FFHVR5HPRWR sea activado. Para acceder a instrucciones sobre cómo
FRQHFWDUHOKRUQRFRQVXOWHODVHFFLyQ:L)L&RQQHFW
5HPRWH(QDEOH :L)L&RQQHFW&RQH[LyQ5HPRWD HQOD
sección de Configuraciones de este manual.
9. Oven Light(s) (Luz(es) del Horno)
(en algunos modelos): Enciende o apaga la
OX] HV GHOKRUQR6LHOFRQWUROGHVXKRUQRQRFXHQWD
FRQODWHFODWiFWLO2YHQ/LJKW /X]GHO+RUQR XQDSHULOOD
encenderá la luz del horno.
USO DE LA COCINA: Controles del Horno
Controles del Horno
10. Lock Controls (Controles de Bloqueo):
%ORTXHDQHOFRQWUROGHPRGRTXHDOSUHVLRQDUODVWHFODV
no se activen los controles. Mantenga presionada la Lock
Controls (Controles de Bloqueo) durante tres segundos
para bloquear o desbloquear el control. Cancel/Off
(Cancelar/ Apagar) siempre está activa, incluso cuando
el control está bloqueado.
11. Options and Settings (Opciones y
Configuraciones): /DVWHFODV2SWLRQV 2SFLRQHV \6HWWLQJV &RQILJXUDFLRQHV DEUHQPHQ~VPiVGHWDOODGRV
en la pantalla, los cuales permiten acceso a funciones
adicionales y modos de cocción. Para cada uno,
seleccione la función en la pantalla a través de la tecla
numérica asociada. Puede salir en cualquier momento
SUHVLRQDQGRODWHFOD2SWLRQV 2SFLRQHV R6HWWLQJV
&RQILJXUDFLRQHV QXHYDPHQWH3DUDPiVGHWDOOHV
consulte las secciones de Configuraciones, Opciones y
Modos de Cocción.
11
USO DE LA COCINA:2SWLRQV 2SFLRQHV 6HWWLQJV &RQILJXUDFLRQHV
Options (Opciones)
La tecla de opciones abre un menú con más modos de cocción cuando el horno está apagado. Abre un menu con funciones
adicionales si un modo de cocción ya está en proceso. Puede salir del menú en cualquier momento presionando la tecla Options
(Opciones) nuevamente.
Primero deberá seleccionar un modo (hornear, hornear por convección, dorar por convección) y luego seleccionar
Options (Opciones) para acceder a las siguientes funciones.
Cook Time (Tiempo de Cocción)
IXQFLyQ'HOD\ 5HWUDVR QRHVWiGLVSRQLEOHHQWRGRVORVPRGRV
Cuenta el tiempo de cocción y apaga el horno cuando el
tiempo de cocción está completo. Seleccione un modo de
FRFFLyQGHVHDGR8VHODVWHFODVQXPpULFDVSDUDSURJUDPDU
una temperatura de horneado. Presione la tecla Options
(Opciones) y seleccione Cook Time (Tiempo de Cocción).
8VHODWHFODQXPpULFDSDUDSURJUDPDUXQWLHPSRGHFRFFLyQHQ
horas y minutos. Luego presione Start/Enter (Iniciar/ Ingresar).
(VWRVyORSXHGHVHUXVDGRFRQODVIXQFLRQHV%DNH +RUQHDU &RQYHFWLRQ%DNH +RUQHDUSRU&RQYHFFLyQ \&RQYHFWLRQ5RDVW
'RUDUSRU&RQYHFFLyQ NOTA:$OXVDUODIXQFLyQ'HOD\7LPH 7LHPSRGH5HWUDVR ODV
comidas que se echan a perder rápidamente, tales como leche,
huevo, pescado, rellenos, ave y cerdo, no se deberán dejar
reposar por más de 1 hora antes y después de la cocción. La
temperatura ambiente estimula el desarrollo de bacterias nocivas.
Asegúrese de que la luz del horno esté apagada, ya que el calor
de la lámpara acelerará el crecimiento de bacterias nocivas.
Inferior Únicamente)
Delay Time (Tiempo de Retraso)
NOTA: Sólo accesible a través de los modos de cocción
tradicional y por convección.
*HQHUDXQUHWUDVRFXDQGRHOKRUQRHVHQFHQGLGR8VHHVWD
tecla para configurar el momento en que desee que el horno
VHLQLFLH6HOHFFLRQHXQPRGRGHFRFFLyQGHVHDGR8VHOD
tecla numérica para programar una temperatura de horneado.
Presione la tecla Options (Opciones) y seleccione Delay
Time (Tiempo de Retraso)8VHODVWHFODVQXPpULFDVSDUD
programar la hora del día en que desee que el horno se
encienda, y luego presione Start/Enter (Iniciar/ Ingresar). La
Monitorea la temperatura interna de la comida y apaga el horno
cuando la comida alcanza la temperatura programada. Inserte
la sonda, presione el modo de cocción deseado, y programe
la temperatura de la sonda. Para más información, consulte la
sección de Modos de Cocción. La sonda sólo puede ser usada
FRQODVIXQFLRQHV%DNH +RUQHDU &RQYHFWLRQ%DNH +RUQHDU
SRU&RQYHFFLyQ \&RQYHFWLRQ5RDVW 'RUDUSRU&RQYHFFLyQ Oven Probe (Sonda del Horno) (Horno
Settings (Configuraciones)
/DVWHFODV2SWLRQV 2SFLRQHV \6HWWLQJV &RQILJXUDFLRQHV DEUHQPHQ~VPiVGHWDOODGRVHQODSDQWDOODORVFXDOHVSHUPLWHQ
acceso a funciones adicionales. Para cada uno, seleccione la función en la pantalla a través de la tecla numérica asociada.
Puede salir en cualquier momento presionando la tecla Options (Opciones) o Settings (Configuraciones) nuevamente.
Conexión WiFi y Acceso Remoto
Su horno de está diseñado para brindarle una comunicación
recíproca entre su electrodoméstico y dispositivos inteligentes.
Mediante el uso de las funciones WiFi Connect, usted podrá
controlar funciones esenciales de su horno tales como las
configuraciones de temperatura, temporizadores y modos de
cocción, utilizando su teléfono inteligente o tableta*.
Seleccione las Settings (Configuraciones) y luego WiFi – siga
las instrucciones de la pantalla de su horno y de la aplicación
de su teléfono. Es necesario activar la función WiFi antes de
XVDU5HPRWH(QDEOH $FFHVR5HPRWR HQVXKRUQR
Conexión de su Horno con Opción de WiFi Connect
Qué necesitará
Su horno de GE Appliances utiliza su red de WiFi
hogareña existente para realizar la comunicación entre el
electrodoméstico y su dispositivo inteligente. A fin de configurar
su horno de GE Appliances, usted necesitará reunir cierta
información:
1. Cada horno de GE Appliances cuenta con una etiqueta
informativa del electrodoméstico conectado, que incluye
un Nombre y Contraseña de Red del Electrodoméstico.
Estos son los dos detalles importantes que necesitará para
conectar el electrodoméstico. La etiqueta está ubicada
normalmente dentro de la puerta del horno o en el cajón.
Connected Appliance Information
FCC: ZKJ-WCATA001
IC: 10229A-WCATA001
MAC ID: XX - XX - XX - XX - XX - XX
Network: GE_XXXXXX_XXXX
Password: XXXXXXXX
PT. NO. 229C6272G001-0
Ejemplo de Etiqueta
2. Su teléfono inteligente o tableta deben estar preparados
con la capacidad de acceder a Internet y descargar
aplicaciones.
8VWHGGHEHUiFRQRFHUODFRQWUDVHxDGHOHQUXWDGRU:L)LGH
su hogar. Tenga esta contraseña a mano al configurar el
horno de GE Appliances.
Conexión de su horno de GE Appliances
1. A través de su teléfono inteligente o tableta, visite
ZZZ*($SSOLDQFHVFRPFRQQHFWSDUDDSUHQGHUPiV
sobre las funciones del electrodoméstico conectado y para
descargar la aplicación correspondiente.
2. Siga las instrucciones en pantalla de la aplicación para
conectar su horno de GE Appliances.
8QDYH]TXHHOSURFHVRVHKD\DFRPSOHWDGRODOX]
de conexión ubicada en la pantalla de su horno GE
Appliances, permanecerá en sólido y la aplicación
confirmará que usted está conectado.
* Se requiere el uso de dispositivos y de una red WiFi hogareña que sean compatibles con Apple o Android.
12
49-85242-1
Conexión WiFi y Acceso Remoto (cont.)
Auto Conv (Conversión Automática)
4. Si la luz de conexión no se enciende o está titilando, siga
las instrucciones en la aplicación para volver a realizar
la conexión. Si los problemas continúan, comuníquese al
&RQQHFWHG&DOO&HQWHU &HQWURGH&RQH[LyQGH/ODPDGDV al 1.866.626.2000 y solicite asistencia en relación a la
conectividad inalámbrica del horno.
$OXVDUODVRSFLRQHVGHFRFFLyQ&RQYHFWLRQ%DNH +RUQHDU
SRU&RQYHFFLyQ R&RQYHFWLRQ5RDVW 'RUDUSRU&RQYHFFLyQ $XWR5HFLSH&RQYHUVLRQ &RQYHUVLyQGH5HFHWD$XWRPiWLFD convertirá de forma automática las temperaturas de horneado
regular ingresadas a temperaturas de cocción de horneado
por convección cuando se active. Se debe observar que esta
opción no convierte los tiempos de cocción del horneado por
convección, sino sólo las temperaturas. Esta función podrá ser
encendida o apagada. Seleccione Settings (Configuraciones),
$XWR&RQYHUVLRQ &RQYHUVLyQ$XWRPiWLFD HVODTXLQWDRSFLyQ
y aparece en la primera pantalla de configuraciones, y Auto
Conversion (Conversión Automática), y luego siga las
indicaciones para activar o desactivar esta función.
Para conectar dispositivos inteligentes adicionales, repita los
pasos 1 y 2.
Observe que todos los cambios o modificaciones al dispositivo
de acceso remoto instalado en este horno que no están
expresamente aprobados por el fabricante podrían anular la
autoridad del usuario para operar el equipamiento.
INICIO DEL HORNO EN FORMA REMOTA
Para poder iniciar el horno en forma remota una vez conectado
a WiFi, presione la tecla Remote Enable (Acceso Remoto)
y el ícono se encenderá en la pantalla. El horno puede ser
iniciado ahora de forma remota con un dispositivo conectado.
Abrir una puerta del horno o apagar el horno hará que se
apague el ícono . El ícono deberá estar iluminado para
iniciar el horno de forma remota. No se requiere el ícono
para modificar la temperatura del horno mientras esté
funcionando, configurar un temporizador o apagar el horno
muestre
desde la aplicación del teléfono mientras el ícono
que está Conectado a WiFi.
Luego de usar el horno, recuerde verificar que el ícono esté
iluminado, si desea iniciar el horno de forma remota en el futuro.
NOTA: Las comidas que se echan a perder rápidamente,
tales como leche, huevos, pescado, rellenos, ave y cerdo, no
se deberán dejar reposar por más de 1 hora antes y después
de la cocción. La temperatura ambiente estimula el desarrollo
de bacterias nocivas. Asegúrese de que la luz del horno esté
apagada, ya que el calor de la lámpara acelerará el crecimiento
de bacterias nocivas.
Clock (Reloj)
Esta configuración ajusta el tiempo del reloj del horno. Presione
la tecla Settings (Configuraciones) y seleccione Clock
(Reloj). Seleccione Set Clock (Configurar Reloj) y siga las
instrucciones para configurar el reloj. Esta función también
especifica cómo se mostrará la hora del día. Puede seleccionar
HOUHORMFRQKRUDHVWiQGDUGHKRUDV + ODKRUDPLOLWDU
GHKRUDV + RTXHQRVHH[KLEDQLQJ~QUHORM 2II $SDJDGR 3UHVLRQHODWHFODSettings (Configuraciones),
seleccione Set Clock (Configurar Reloj) y seleccione la
opción 12/24 u On/Off (Encender/ Apagar).
Bluetooth® - Chef Connect
Se trata de una función de emparejamiento para uso con otros
productos compatibles con Chef Connect, tales como un horno
microondas para uso sobre la cocina o una campana de cocina.
A fin de emparejar estos productos a la cocina, presione la
tecla Settings (Configuraciones) y seleccione Bluetooth®.
Seleccione Pair (Emparejar) y siga las instrucciones
correspondientes incluidas con el producto de emparejamiento
permitido por Chef Connect. La cocina cancelará el modo de
emparejamiento luego de dos minutos, si no es detectado ningún
dispositivo para emparejar. Seleccione Remove (Retirar) para
confirmar que el producto está emparejado o para desemparejar
el mismo de su cocina. La Sonda de Cocción de Precisión
WDPELpQSXHGHVHUHPSDUHMDGDXVDQGRODIXQFLyQ%OXHWRRWK®.
49-85242-1
Auto Off (Apagado Automático)
Esta función apaga el horno luego de 12 horas de funcionamiento
continuo. Podrá estar activada o desactivada. Seleccione
Settings (Configuraciones), More (Más), y Auto Off (Apagado
Automática) para activar o desactivar esta función.
Sound (Sonido)
Podrá ajustar el volumen y el tipo de alerta que su dispositivo
utilice. Seleccione Settings (Configuraciones), More (Más),
y Sound (Sonido). Siga las instrucciones para realizar ajustes
de volumen o para cambiar entre tonos de alerta continuos o
VLPSOHV8QDFRQILJXUDFLyQFRQWLQXDVHJXLUiKDFLHQGRTXHXQ
tono suene hasta que un botón del control sea presionado. El
volumen del tono del horno podrá ser ajustado. El control hará
que el tono del horno suene en el nuevo nivel de volumen cada
vez que el nivel de sonido sea modificado.
F/C (Fahrenheit o Celsius)
El control del horno está configurado para su uso con
WHPSHUDWXUDV)DKUHQKHLW ) SHURSXHGHVHUPRGLILFDGR
DWHPSHUDWXUDV&HOVLXV & 6HOHFFLRQHSettings
(Configuraciones), More (Más), y F/C para alternar entre las
escalas de temperatura exhibidas.
USO DE LA COCINA:6HWWLQJV &RQILJXUDFLRQHV
6HWWLQJV &RQILJXUDFLRQHV &RQWLQ~D
Adjust the Oven temperature (Ajuste de la
Temperatura del Horno)
Esta función permite que la temperatura de horneado del horno
y de horneado por convección sean ajustadas hasta 35°F más
FDOLHQWHRƒ)PiVIUtD8VHHVWDIXQFLyQVLFRQVLGHUDTXHOD
temperatura de su horno está demasiado caliente o demasiado
IUtD\GHVHDPRGLILFDUOD(VWHDMXVWHDIHFWDORVPRGRV%DNH
+RUQHDU \&RQYHFWLRQ%DNH +RUQHDUSRU&RQYHFFLyQ 1R
PRGLILFDORVPRGRV3URRI /HXGDU R&OHDQLQJ /LPSLH]D Seleccione Settings (Configuraciones) y Oven Adjust
(Ajuste del Horno) para agregar More Heat (Más Calor) o
Less Heat (Menos Calor) y luego presione Save (Guardar).
Oven Info (Información del Horno)
Seleccione Settings (Configuraciones), More (Más), y Oven
Info (Información del Horno) para activar o desactivar esta
función. Esta configuración muestra el Número de Modelo y la
Versión del Software.
13
USO DE LA COCINA: Modo Sabático
Modo Sabático
/DIXQFLyQGHPRGRVDEiWLFRFXPSOHFRQORVHVWiQGDUHVHVWDEOHFLGRVSRU6WDUN.$OJXQRVGHHVWRVHVWiQGDUHVTXHVHUiQ
observados por el consumidor incluyen la desactivación de los tonos, la desactivación de las luces del horno, y retrasos de
aproximadamente 30 segundos a un minuto en relación a los cambios en la pantalla. Sólo el horneado continuo y el horneado
por tiempo están permitidos en el modo sabático. La cocción en el modo sabático es un proceso de dos pasos; primero el modo
sabático debe ser configurado y luego el modo hornear debe ser configurado.
Configuración del Modo Sabático
Ajuste de Temperatura
Presione la tecla Settings (Configuraciones), seleccione
Sabbath (Sabático) y seleccione Turn On (Encender)8QVROR
corchete “]” aparecerá en la pantalla, indicando que el modo
sabático fue configurado. El reloj no aparecerá. El horneado
continuo o el horneado por tiempo no pueden ser configurados.
1. Presione Bake (Hornear) RSUHVLRQH/RZHU2YHQ +RUQR
,QIHULRU \OXHJR%DNH +RUQHDU SDUDXVDUHOKRUQRLQIHULRU
HQXQXQLGDGFRQKRUQRGREOH XVHODVWHFODVQXPpULFDVGH
1 a 5 para seleccionar una temperatura de cocción actual
diferente, y presione Start/Enter (Iniciar/ Ingresar).
2. Debido a que no hay ninguna indicación durante el cambio
de temperatura, se puede usar un termómetro para horno
para confirmar los cambios de temperatura.
Inicio del Horneado Continuo
1. Presione la tecla Bake (Hornear) 3DUDKRUQRVGREOHV
permite utilizar el horno superior. Si se desea usar el Horno
,QIHULRUSUHVLRQH/RZHU2YHQ +RUQR,QIHULRU \OXHJR%DNH
+RUQHDU 2. Si la temperatura deseada es 350ºF, presione Start/
Enter (Iniciar/ Ingresar). Si se desea una temperatura de
cocción diferente, use las teclas numéricas de 1 a 5 para
seleccionar una temperatura de cocción predeterminada,
y luego presione Start/Enter (Iniciar/ Ingresar). Consulte
el siguiente gráfico para determinar qué tecla configura la
temperatura de cocción deseada.
Luego de una demora, un segundo corchete “] [“ aparecerá en
la pantalla, indicando que el horno está horneando.
7HPSHUDWXUD ž)
200
250
300
7LHPSR KRUDV
Inicie un Horneado por Tiempo
1. Presione la tecla Bake (Hornear).
2. Si la temperatura deseada es de 350ºF, use las teclas
numéricas de 6 a 0 para seleccionar un tiempo de cocción.
Si se desea una temperatura de cocción diferente a 350ºF,
use las teclas numéricas de 1 a 5 para seleccionar una
temperatura de cocción predeterminada, y luego seleccione
el tiempo de cocción. Consulte el gráfico en esta página
para determinar qué tecla configura la temperatura de
cocción deseada y el tiempo de cocción.
3. Presione Start/Enter (Iniciar/ Ingresar).
Luego de una demora, un segundo corchete “] [“ aparecerá en
la pantalla, indicando que el horno está horneando. Cuando el
tiempo de cocción finalice, la pantalla volverá a cambiar a un
solo corchete “]”, indicando que el horno ya no está horneando.
No sonará ningún tono cuando el tiempo de cocción se haya
completado.
Salir del Modo Sabático
325
400
2h
2.5h
3h
3.5h
Sólo se deberá salir del modo sabático una vez finalizado el
mismo.
1. Presione Cancel/Off (Cancelar/ Apagar) para finalizar
cualquier ciclo de horneado que pueda estar funcionando.
2. Mantenga presionada la tecla Settings (Configuraciones)
hasta que se muestre Sabbath Mode off (Modo Sabático
apagado).
Aviso de Corte de Corriente durante el
Modo Sabático
4h
1 = 200°F, 2 = 250°F, 3 = 300°F, 4 = 325°F, 5 = 400°F
6 = 2 horas, 7 = 2.5 horas 8 = 3 horas, 9 = 3.5 horas, 0 = 4 horas
14
Si se produce un corte de corriente mientras el horno se
HQFXHQWUDHQ6DEEDWK0RGH 0RGR6DEiWLFR ODXQLGDG
UHJUHVDUiD6DEEDWK0RGH 0RGR6DEiWLFR FXDQGRHO
suministro sea reestablecido; sin embargo, el horno regresará
al estado de apagado incluso cuando haya estado en un ciclo
de horneado en el momento del corte de corriente.
49-85242-1
Posiciones de los Estantes
Su horno cuenta con seis posiciones de estantes en el horno
principal. En la Guía de Cocción, se brindan recomendaciones
de posiciones de los estantes para diferentes tipos de
comidas. Se ajusta un estante en una dirección para afectar
los resultados de cocción. Por ejemplo, si se prefieren partes
superiores más oscuras en tartas, panecillos o galletas,
pruebe moviendo la comida a un estante que se encuentre
una posición más arriba. Si encuentra que las comidas están
demasiado doradas en la parte superior, pruebe moviendo las
mismas más abajo la próxima vez.
Al hornear con múltiples ollas y en múltiples estantes, asegúrese
de que haya suficiente espacio entre las ollas para que fluya el
aire. Esto puede mejorar la cocción haciéndola más pareja.
Horno Superior
Horno Inferior
Posición de detención
del estante
Retiro y Reemplazo de los Estantes Planos
Al colocar y retirar utensilios de cocina, empuje el estante hacia
DIXHUDGHOWRSH SRVLFLyQGHGHWHQFLyQ VREUHHOVRSRUWHGHOHVWDQWH
Para retirar un estante, empuje el mismo hacia usted hasta
alcanzar la posición donde se detiene, incline el frente hacia
arriba y empuje hacia afuera.
Para reemplazar un estante, coloque el extremo curvado del
mismo sobre los soportes de los estantes. Incline el frente del
estante hacia arriba y empuje el mismo hasta que se detenga.
Luego apoye el estante y empuje el mismo hasta que entre
completamente en el horno.
Es posible que resulte difícil deslizar los estantes,
especialmente luego de un ciclo de limpieza automática. Para
mejorar las condiciones de deslizamiento, use una tela suave
o una toalla de papel para frotar aceite vegetal sobre los
H[WUHPRVL]TXLHUGR\GHUHFKRGHORVHVWDQWHV\RVREUHORV
soportes del estante.
NOTA: Retire los estantes en desuso al usar el horno para
un precalentamiento más rápido, mayor eficiencia y un
rendimiento óptimo de la cocción.
Estantes Extensibles (en algunos modelos)
Los estantes extensibles cuentan con una estructura que se
EORTXHDHQORVVRSRUWHVGHORVHVWDQWHVDDPERVODGRV8QD
vez que la estructura está bloqueada en su lugar, siempre use
el riel frontal superior para empujar hacia afuera el estante
hasta la posición de detención en su máxima extensión, al
colocar o retirar utensilios.
Si resulta difícil extender estos estantes, lubrique los mismos
con lubricante de grafito, provisto con el horno. Retire el
HVWDQWHGHOKRUQR FRQVXOWHODVHFFLyQGH5HWLURGHO(VWDQWH
([WHQVLEOH UHWLUHFXDOTXLHUREVWUXFFLyQHQHOUHFRUULGR
deslizable con una toalla de papel, agite el lubricante de grafito
y coloque 4 gotitas en los dos recorridos inferiores de los lados
izquierdo y derecho. Abra y cierre el estante varias veces para
distribuir el lubricante.
Para acceder a instrucciones sobre cómo ordenar estantes
adicionales y lubricantes con grafito, consulte la sección de
$VLVWHQFLD$FFHVRULRV
49-85242-1
Retiro de los estantes
Reemplazo de los estantes
Retiro del Estante Extensible
1. Asegúrese de que el estante sea empujado totalmente
dentro del horno.
2. Sosteniendo de manera firme sobre los rieles frontales
superior e inferior, empuje el estante hacia usted, incline el
extremo frontal hacia arriba y empuje hacia afuera.
Reemplazo del Estante Extensible
1. Coloque los bloqueos de los estantes traseros sobre ,y en,
los soportes de los estantes
2. Incline el frente del estante hacia arriba y empuje el mismo
hasta que se detenga.
3. Apoye el estante y empuje el mismo hasta que entre
completamente en el horno.
Si resulta difícil reemplazar o retirar los estantes extensibles,
limpie los soportes de los estantes del horno con aceite
de cocina. No quite el aceite de cocina del espacio de
deslizamiento.
USO DE LA COCINA: Estantes del Horno
Estantes del Horno
15
USO DE LA COCINA:3DSHOGH$OXPLQLR\&REHUWRUHVGHO+RUQR8WHQVLOLRV0RGRVGH&RFFLyQ
16
Papel de Aluminio y Cobertores del Horno
PRECAUCIÓN
1RXVHQLQJ~QWLSRGHDOXPLQLRRFREHUWRUGHKRUQRSDUDFXEULUHOIRQGRGHOKRUQR(VWRVtWHPV
pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios.
Los daños por uso inadecuado de estos ítems no están cubiertos por la garantía del producto.
Se podrá usar aluminio para evitar derrames, colocando una hoja sobre un estante inferior varias pulgadas debajo de la comida.
No use más aluminio que el necesario y nunca cubra totalmente el estante de un horno con papel de aluminio. Mantenga el
DOXPLQLRDSRUORPHQRV´GHODVSDUHGHVGHOKRUQRSDUDHYLWDUXQDFLUFXODFLyQGHILFLHQWHGHOFDORU
Utensilios
Pautas de Uso de Utensilios
El material, el acabado y el tamaño de los utensilios afectan el
horneado.
Las ollas de vidrio y cerámica calientan con lentitud, pero
retienen bien el calor.
Las ollas oscuras, revestidas y opacas absorben el calor más
rápidamente que las ollas claras y brillantes. Al usar ollas
que absorben el calor más rápidamente, las comidas podrán
resultar más doradas, crocantes y con una capa más gruesa.
Estos tipos de ollas funcionan bien con platos tales como
tartas y postres con natilla.
Si utiliza utensilios oscuros y revestidos, controle la comida
antes del tiempo mínimo de cocción. Si se obtienen resultados
no deseados con este tipo de utensilios, considere la posibilidad
de reducir la temperatura del horno en 25°F la próxima vez.
Mantenga los utensilios limpios para una cocción más pareja.
Las ollas brillantes pueden producir resultados de horneado
más parejos en tortas y galletas.
Las ollas con aislante de aire calientan lentamente y pueden
producir fondos dorados.
La cerámica calienta de forma lenta y retiene bien el calor. Si
es posible, se recomienda precalentar este tipo de utensilios.
Se podrá requerir tiempo de cocción adicional.
Modos de Cocción
Su horno posee una variedad de modos de cocción para que pueda obtener los mejores resultados. Estos modos se describen a
continuación. Para acceder a recomendaciones para comidas específicas, consulte la sección de la Guía de Cocción. Recuerde
que es posible que su nuevo horno funcione de manera diferente que aquel que está reemplazando.
Bake (Hornear)
Modo para Asar
El modo de horneado es utilizado para hornear y dorar. Al
preparar comidas horneadas tales como tartas, galletas y
masas, siempre precaliente el horno primero. Para usar
este modo, presione la tecla Bake (Hornear), ingrese una
temperatura con las teclas numéricas, y luego presione Start/
Enter (Iniciar/ Ingresar).
6LHPSUHDVHFRQODSXHUWDGHOKRUQRFDMyQFHUUDGRV0RQLWRUHH
la comida de cerca al asar. Tenga cuidado al asar; posicionar
la comida cerca del elemento para asar o del quemador
incrementa el nivel de humo, salpicaduras y la posibilidad
de que se incendien las grasas. No es necesario realizar el
precalentamiento al usar este modo.
Warm (Calentar)
Asado Alto
Los modos para calentar fueron diseñados para mantener
calientes las comidas cocinadas. Cubra las comidas que
necesitan mantener la humedad y no cubra aquellas comidas
que deban quedar crocantes. No se requiere precalentar las
PLVPDV1RXVHODIXQFLyQ:DUP &DOHQWDU SDUDFDOHQWDU
comida fría. Se recomienda que la comida no se mantenga
caliente por más de 2 horas.
(OPRGR%URLO+LJK $VDGR$OWR XVDFDORULQWHQVRGHOHOHPHQWR
VXSHULRURGHOTXHPDGRUSDUDVRDVDUODVFRPLGDV8VH%URLO
+LJK $VDGR$OWR SDUDFRUWHVPiVILQRVGHFDUQH\RFXDQGR
desee lograr una superficie soasada y un interior jugoso. Para
usar este modo, presione la tecla Broil (Asar) una vez y luego
presione Start/Enter (Iniciar/ Ingresar).
Algunos modelos también podrán contar con cajones para
calentar. Tres configuraciones están disponibles – use High
$OWR SDUDFRPLGDVWDOHVFRPRJXLVRVFDUQHV\SDSDVXVH
0HGLXP 0HGLR SDUDFRPLGDVWDOHVFRPRFD]XHODV\SL]]DV
XVH/RZ %DMR SDUDFRPLGDVWDOHVFRPRSDQHVZDIIOHV\
también para calentar platos de uso seguro en el horno.
Asado Bajo
(OPRGR%URLO/RZ $VDGR%DMR XVDFDORUPHQRVLQWHQVRGHO
elemento superior o del quemador para cocinar la comida
FRPSOHWDPHQWHPLHQWUDVWDPELpQVHGRUDODVXSHUILFLH8VH
ODIXQFLyQ%URLO/RZ $VDGR%DMR SDUDFRUWHVGHFDUQHPiV
JUXHVRV\RFRPLGDVTXHGHVHHTXHTXHGHQFRPSOHWDPHQWH
cocinadas. Para usar este modo, presione la tecla Broil (Asar)
dos veces y luego presione Start/Enter (Iniciar/ Ingresar).
49-85242-1
Frozen Snacks (Refrigerios Congelados)
/RVPRGRV)UR]HQ6QDFNV 5HIULJHULRV&RQJHODGRV IXHURQ
diseñados para cocinar comidas congeladas tales como
medallones de papa, papas fritas, y refrigerios congelados y
aperitivos similares. La mayoría de las comidas se cocinarán
dentro de los tiempos que aparecen recomendados en
el paquete. Ajuste el tiempo de cocción de acuerdo con
sus preferencias individuales. Presione la tecla Options
(Opciones) y seleccione Frozen (Congelado), y luego siga las
instrucciones en pantalla para acceder a este modo.
8VHODIXQFLyQ)UR]HQ6QDFNV6LQJOH 5HIULJHULRV&RQJHODGRV
HQXQ6ROR(VWDQWH FXDQGRFRFLQHUHIULJHULRVHQXQVROR
estante. Este modo no requiere el precalentamiento del
horno. La comida deberá ser colocada en el horno antes o
inmediatamente al iniciar el modo.
8VHODIXQFLyQ)UR]HQ6QDFNV0XOWL 5HIULJHULRV&RQJHODGRV
HQ0~OWLSOHV(VWDQWHV FXDQGRFRFLQHUHIULJHULRVFRQJHODGRV
en dos estantes simultáneamente. Este modo incluye un ciclo
de precalentamiento para preparar el horno para hornear en
múltiples estantes.
Frozen Pizza (Pizza Congelada)
/RVPRGRVGH)UR]HQ3L]]D 3L]]D&RQJHODGD IXHURQ
diseñados para cocinar pizzas congeladas. La mayoría de
las pizzas se cocinarán dentro de los tiempos que aparecen
recomendados en el paquete. Ajuste el tiempo de cocción de
acuerdo con sus preferencias individuales. Presione la tecla
Options (Opciones) y seleccione Frozen (Congelado), y luego
siga las instrucciones en pantalla para acceder a este modo.
8VHODIXQFLyQ)UR]HQ3L]]D6LQJOH 3L]]D&RQJHODGDHQXQ
(VWDQWH FXDQGRFRFLQHHQXQVRORHVWDQWH(VWHPRGRQR
requiere el precalentamiento del horno. La comida deberá ser
colocada en el horno antes o inmediatamente al iniciar el modo.
8VHHOPRGR)UR]HQ3L]]D 3L]]D&RQJHODGD DOFRFLQDUHQ
dos estantes de forma simultánea. Este modo incluye un ciclo
de precalentamiento para preparar el horno para hornear en
múltiples estantes.
Baked Goods (Productos Horneados)
(OPRGR%DNHG*RRGV 3URGXFWRV+RUQHDGRV IXHGLVHxDGR
para cocinar tortas, panes, galletas, y comidas similares
en un solo estante. Este modo fue diseñado para brindar
un dorado superior más leve y un mejor volumen. Algunas
comidas podrán requerir tiempos de cocción más prolongados
en relación a cuando se cocina en el modo de horneado
tradicional. Presione la tecla Options (Opciones) y seleccione
Baked Goods (Productos Horneados) y luego siga las
instrucciones en pantalla para acceder a este modo.
Convection Bake Multi Rack (Estantes
0~OWLSOHVSDUD+RUQHDUSRU&RQYHFFLyQ
(OPRGR&RQYHFWLRQ%DNH +RUQHDUSRU&RQYHFFLyQ HVWi
pensado para honear en múltiples estantes al mismo tiempo.
Este modo utiliza el movimiento del aire del ventilador de
convección para mejorar la cocción haciéndola más pareja. El
horno está equipado con la función Auto Recipe Conversion
&RQYHUVLyQGH5HFHWD$XWRPiWLFD GHPRGRTXHQRHV
necesario ajustar la temperatura al usar este modo. Siempre
realice el precalentamiento al usar este modo. Es posible que
los tiempos de horneado sean un poco más prolongados con
estantes múltiples, en comparación con lo que se espera con
un solo estante. Para usar este modo, presione la tecla Conv
Bake (Hornear por Convección), e ingrese una temperatura
con las teclas numéricas, y luego presione Start/Enter
(Iniciar/ Ingresar).
Convection Roast (Dorar por Convección)
(OPRGR&RQYHFWLRQ5RDVW 'RUDGRSRU&RQYHFFLyQ HVWi
pensado para dorar cortes enteros de carne en un solo
estante. Este modo usa el movimiento del aire desde el
ventilador por convección para mejorar el dorado y reducir el
tiempo de cocción. Controle la comida antes que el tiempo
VXJHULGRHQODUHFHWDDOXVDUHVWHPRGRRXVHODVRQGD SDUD
PiVLQIRUPDFLyQFRQVXOWHODVHFFLyQGHOD6RQGD 1RHV
necesario realizar el precalentamiento al usar este modo.
Para usar este modo, presione la tecla Conv Roast (Dorar
por Convección), ingrese una temperatura con las teclas
numéricas, y luego presione Start/Enter (Iniciar/ Ingresar).
Proof (Leudar)
(OPRGR3URRI /HXGDU PDQWLHQHXQDPELHQWHFDOLHQWHSDUDOHXGDU
masa fermentada a base de levadura. Si el horno está demasiado
FDOLHQWHHOPRGR3URRI /HXGDU QRIXQFLRQDUi\ODSDQWDOOD
mostrará “Horno demasiado caliente para Leudar”. Para obtener
mejores resultados, cubra la masa mientras realiza el leudado y
haga un control a tiempo para evitar un leudado excesivo. Presione
la tecla Options (Opciones) y seleccione Proof (Leudar), y
luego siga las instrucciones en pantalla o presione la tecla Proof
(Leudar) HQDOJXQRVPRGHORV SDUDDFFHGHUDHVWHPRGR
PRECAUCIÓN
1RXVHHOPRGR3URRI /HXGDU SDUD
calentar comida o mantener la comida caliente. La temperatura
del horno al leudar no está lo suficientemente caliente como
para mantener comidas a temperaturas seguras.
Ventilaciones de Aire del Horno
1XQFDEORTXHHODVYHQWLODFLRQHV DEHUWXUDVGHDLUH GHOD
cocina. Las mismas brindan las entradas y salidas de aire
que son necesarias para que la cocina se mantenga fresca y
funcione de forma correcta con la combustión adecuada.
Las aberturas de aire se encuentran
ubicadas en la parte trasera de la
cocina, en la parte superior e inferior
de la puerta del horno, y en la parte
inferior de la cocina.
La apariencia y la ubicación
de la ventilación varían.
49-85242-1
USO DE LA COCINA:0RGRVGH&RFFLyQ9HQWLODFLRQHVGH$LUHGHO+RUQR
0RGRVGH&RFFLyQ &RQWLQ~D
17
USO DE LA COCINA: Sonda del Horno
Sonda del Horno (en algunos modelos)
ADVERTENCIA
El consumo de comida semicruda puede hacer que se contraigan enfermedades producidas
por la comida. Use la sonda de acuerdo con las siguientes instrucciones, a fin de asegurar que todas las partes
de la comida alcancen temperaturas de cocción mínimamente seguras. Puede encontrar recomendaciones de
temperaturas de cocción mínimamente seguras en www.foodsafety.gov o en www.IsItDoneYet.gov.
La temperatura interna de la comida con frecuencia se usa
como indicador de que está lista, especialmente al dorar o
SUHSDUDUFDUQHGHDYH(OPRGR3UREH 6RQGD PRQLWRUHDOD
temperatura interna de la comida y apaga el horno cuando
esta última alcanza la temperatura programada.
Controle siempre la temperatura en múltiples partes de la
comida, utilizando un termómetro de comidas luego de realizar
la cocción, a fin de asegurar que todas las partes de la misma
hayan alcanzado una temperatura interna mínimamente segura
en dicha comida.
Ubicación Correcta de la Sonda
Luego de preparar la comida y de colocarla en la olla, siga
estas instrucciones para una ubicación correcta de la sonda.
Ŷ ,QVHUWHODVRQGDHQODFRPLGDGHPRGRTXHODSXQWDGH
la sonda se apoye en el centro de la parte más gruesa de
la comida. Para un mejor rendimiento, la sonda debería
ser completamente insertada en la comida. Si la sonda
no es ubicada correctamente, es posible que no mida con
precisión la temperatura de la parte más fría de la comida.
Algunas comidas, particularmente las más pequeñas, no
son adecuadas para la cocción con el uso de una sonda,
debido a sus formas o tamaños.
Ŷ 1RGHEHUtDWRFDUHOKXHVRODJUDVDQLHOFDUWtODJR
Ŷ 3DUDFRFLQDUXQDYHHQWHUDLQVHUWHODVRQGDHQODSDUWH
más gruesa de la pechuga.
Ŷ 3DUDGRUDUVLQKXHVRVLQVHUWHODVRQGDHQHOFHQWURGHO
dorado.
Ŷ 3DUDFRFLQDUMDPyQRFRUGHURFRQKXHVRVLQVHUWHOD
sonda en el centro de la articulación o del músculo más
bajo y largo.
Ŷ 3DUDSUHSDrar cazuelas o platos tales como pastel de
carne, inserte la sonda en el centro del plato.
Ŷ 3DUDFRFLQDUSHVFDGRLQVHUWHODVRQGDMXVWRDUULEDGHOD
agalla en la zona más carnosa paralela a columna.
Uso de la Sonda
La sonda de temperatura sólo puede ser usada con las
IXQFLRQHV%DNH +RUQHDU &RQYHFWLRQ%DNH +RUQHDUSRU
&RQYHFFLyQ \&RQYHFWLRQ5RDVW 'RUDUSRU&RQYHFFLyQ 8QDYH]TXHHOKRUQRIXHSUHFDOHQWDGRFRORTXHODFRPLGD
en el mismo y conecte la sonda en su correspondiente
tomacorriente, asegurándose de que esté completamente
insertada. Tenga cuidado, ya que las paredes del horno y
el tomacorriente de la sonda están calientes.
4. Cuando la sonda esté conectada, la pantalla le indicará
que ingrese la temperatura deseada para la comida. La
temperatura interna máxima de la comida que se puede
configurar es 200° F..
Para usar la sonda sin precalentamiento:
,QVHUWHODVRQGDHQODFRPLGD FRQVXOWHVREUHOD8ELFDFLyQ
&RUUHFWDGHOD6RQGD 2. Coloque la comida en el horno y conecte la sonda en su
correspondiente tomacorriente en el horno.
3. Presione la tecla del modo de cocción deseado
Horneado Tradicional, Hornear por Convección, o
Dorar por Convección HLQJUHVHODWHPSHUDWXUDGH
cocción deseada con las teclas numéricas. Presione
Options (Opciones) y seleccione Probe (Sonda) y
luego siga las instrucciones en pantalla para ingresar la
temperatura deseada para la comida.
Pautas para el Cuidado de la Sonda
Ŷ 6LVHXVDXQDVRQGDTXHQRVHDODSURYLVWDFRQHVWH
producto, se podrán producir daños sobre la salida de la
sonda.
Ŷ 8VHODVPDQLMDVGHODVRQGDDOHQFKXIDU\GHVHQFKXIDUOD
misma, luego de insertar o de retirar la sonda de la carne o
del tomacorriente.
Ŷ 3DUDHYLWDUGDxRVVREUHODVRQGDQRXVHDJDUUDGHUDVSDUD
empujar el cable al retirarlo.
Ŷ 3DUDHYLWDUURPSHUODVRQGDDVHJ~UHVHGHTXHOD
comida haya sido completamente descongelada antes de
insertarla.
Ŷ 3DUDHYLWDUSRVLEOHVTXHPDGXUDVQRGHVHQFKXIHODVRQGD
del tomacorriente del horno hasta que este último se haya
enfriado.
Ŷ 1XQFDGHMHODVRQGDGHQWURGHOKRUQRGXUDQWHXQFLFORGH
limpieza automática o de limpieza con vapor.
Ŷ 1RJXDUGHODVRQGDGHQWURGHOKRUQR
Para usar la sonda con precalentamiento:
&RQILJXUHHOPRGRGHFRFFLyQGHVHDGR Hornear, Hornear
por Convección, o Dorar por Convección HLQJUHVHOD
temperatura de cocción deseada con las teclas numéricas.
2. Inserte la sonda en la comida FRQVXOWHVREUHOD8ELFDFLyQ
&RUUHFWDGHOD6RQGD 18
49-85242-1
HORNO
(Superior/
Inferior)
POSICIÓN(ES)
DE ESTANTES
RECOMENDADA
Hornear
Superior
Inferior
2
3
Productos Horneados
Superior
Inferior
2
3
Hornear
&RQYHFWLRQ%DNH
Inferior
2o4
$VHJ~UHVHGHTXHKD\DXQIOXMRGHDLUHDGHFXDGR 9HDODLOXVWUDFLyQ 7RUWDVGHJUDVD SDVWHO
GHiQJHO
Productos Horneados
Inferior
1
8VHXWHQVLOLRVEULOODQWHV
Galletas, galletitas,
bizcochitos en un Solo
Estante
Hornear
Superior
Inferior
2
3
8VHXWHQVLOLRVEULOODQWHV
Productos Horneados
Superior
Inferior
2
3
Horneado por
Convección
Inferior
1o3
Asegúrese de que haya un flujo de aire adecuado.
Proof
Inferior
2
Cubra la masa sin mucha rigidez.
Hornear
Superior
Inferior
1
2
Productos Horneados
Superior
Inferior
1
2
Hamburguesas
Asar Alto
Inferior
4
8VHODSDUWHSDUDDVDUPXHYDODFRPLGDPiVDEDMRSDUDTXHTXHGHPiVSUHSDUDGD
y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento,
centre la comida debajo del elemento que emite calor para asar o del quemador.
%LIHV\&KXOHWDV
Asar Alto
Inferior
3o4
8VHODSDUWHSDUDDVDUPXHYDODFRPLGDPiVDEDMRSDUDTXHTXHGHPiVSUHSDUDGD
y menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento,
centre la comida debajo del elemento que emite calor para asar o del quemador.
%DNH
Convection Roast
Inferior
2
8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU
No se requiere precalentarla.
Hornear
Dorado por Convección
Inferior
2
8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU
Pechugas, patas, muslos
con huesos
$VDGR%DMR
Hornear
Inferior
2
6LVHHPSDQyRFXEULyFRQVDOVDHYLWHORVPRGRV%URLO+LJK $VDU$OWR $VHGHO
lado de la piel hacia abajo primero. Para un mejor rendimiento al asar, centre la
comida debajo del elemento que emite calor para asar o del quemador.
Pechugas de pollo
deshuesadas
$VDGR%DMR
Hornear
Inferior
2
Mueva la comida más abajo para que quede más preparada y menos soasada y
PiVDUULEDSDUDVRDVDUGRUDUDODVDU3DUDXQPHMRUUHQGLPLHQWRDODVDUFHQWUHOD
comida debajo del elemento que emite calor para asar.
Pavo entero
Hornear
Dorado por Convección
Inferior
1
8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU
Pechuga de Pavo
Hornear
Dorado por Convección
Inferior
2
8VHXQDROODFKDWDWDOFRPRXQDROODSDUDDVDU
Pescado
$VDGR%DMR
Inferior
PLWDGGHO
JURVRURPHQRV
!SXOJDGD
Preste atención a la comida al asarla. Para un mejor rendimiento al asar, centre la
comida debajo del elemento que emite calor para asar o del quemador.
Cazuelas
Hornear
Superior
Inferior
2
2o3
Pizza en un Estante Simple
Pizza Congelada Simple
Superior
Inferior
2
3
No precalentar.
Pizza en Estantes Múltiples
Pizza Congelada
Múltiple
Inferior
2o4
Escalone las pizzas de izquierda a derecha, y no las coloque directamente una
sobre otra.
Productos con papa, patitas
de pollo fritas, aperitivos en
un Solo Estante
Refrigerios Congelados
Simples
Superior
Inferior
2
3
1RSUHFDOHQWDU8VHXQXWHQVLOLRRVFXURSDUDTXHTXHGHPiVGRUDGRFURFDQWHXVH
utensilios brillantes para un menor dorado.
Productos con papa, patitas
de pollo fritas, aperitivos en
Múltiples Estantes
Refrigerios Congelados
Múltiples
Inferior
2o4
8VHXQXWHQVLOLRRVFXURSDUDTXHTXHGHPiVGRUDGRFURFDQWHXVHXWHQVLOLRV
brillantes para un menor dorado.
TIPO DE COMIDA
MODO(S)
RECOMENDADO(S)
SUGERENCIAS ADICIONALES
Productos Horneados
Tortas con capas, tortas
rectangulares, roscas,
panecillos, pan rápido en un
Solo Estante
Tortas con capas* en
Múltiples Estantes
Galletas, galletitas, bizcochitos
en Múltiples Estantes
Panes de Levadura
8VHXWHQVLOLRVEULOODQWHV
Bife y Cerdo
Hornear
Dorado por Convección
Ave
Pollo entero
USO DE LA COCINA: Guía de Cocción
Guía de Cocción
Comidas Congeladas a Conveniencia
8ELFDFLyQ7UDVHUD
*Al hornear cuatro capas de torta a la vez, use los estantes 2 y 4.
Coloque las ollas como se muestra, de modo que no quede una
olla encima de la otra.
Cocine la comida completamente para evitar que se produzcan
enfermedades a partir de la comida. Puede encontrar
recomendaciones sobre temperatura mínima para cocinar de
forma segura en www.IsItDoneYet.gov. Asegúrese de usar un
termómetro de comidas para medir la temperatura de las mismas.
49-85242-1
8ELFDFLyQ)URQWDO
19
CUIDADO Y LIMPIEZA: Cocina - Exterior
Cocina - Exterior
Asegúrese de que todos los controles estén apagados y que las superficies estén frías antes de limpiar cualquier parte de la cocina.
ADVERTENCIA
Si se quita la cocina para efectuar una limpieza, reparaciones o cualquier
otra razón, verifique que el dispositivo anti-volcaduras se coloque de manera
adecuada cuando vuelva a instalarse la cocina. Si no toma esta precaución, la
cocina puede volcarse y provocar lesiones.
Bloqueo del Control
Si así lo desea, puede desactivar los botones de toque antes
de la limpieza.
&RQVXOWH/RFN&RQWUROV &RQWUROHVGH%ORTXHR HQODVHFFLyQ
2YHQ&RQWUROV &RQWUROHVGHO+RUQR HQHVWHPDQXDO
También puede utilizar un limpiador de vidrios.
4XLWHVXFLHGDGHVPiVUHEHOGHVFRQDJXDWLELDMDERQRVD1R
utilice abrasivos de ninguna clase.
Vuelva a activar los botones de toque después de la limpieza.
Limpie los derrames con un paño húmedo.
Panel de control
8QDEXHQDLGHDHVOLPSLDUHOSDQHOGHFRQWUROOXHJRGHFDGD
uso. Limpie con un jabón suave y agua o vinagre y agua,
enjuague con agua limpia y pula en seco con una tela suave.
No use limpiadores abrasivos, limpiadores líquidos fuertes,
almohadillas para fregar de plástico ni limpiadores de horno en
el panel de control; dañarán el acabado, incluyendo el Acero
Inoxidable Negro.
Exterior del Horno
No use limpiadores de horno, limpiadores abrasivos,
limpiadores líquidos fuertes, estropajos de acero, almohadillas
para fregar de plástico, ni polvos limpiadores en el interior
o el exterior del horno. Limpie el mismo con agua y jabón o
una solución de vinagre y agua. Enjuague con agua limpia y
seque con una tela seca. Al limpiar supeficies, asegúrese de
que estén a temperatura ambiente y fuera del contacto con
la luz solar. Si las manchas en el borde de la ventana de la
puerta son persistentes, use un limpiador abrasivo suave o
una esponja con estropajo para obtener un mejor resultado. El
derrame de adobo, jugos de fruta, salsas de tomate y líquidos
para humedecer que contengan ácidos pueden ocasionar
descoloración y se deberán limpiar de inmediato. Deje que las
superficies calientes se enfríen, y luego limpie y enjuague.
Superficies pintadas
Las superficies pintadas incluyen los lados de la cocina y la
puerta, la parte superior del panel de control y el frente del
cajón. Límpielas con jabón y agua o con una solución de
agua y vinagre.
No utilice limpiadores de horno comerciales, polvos limpiadores,
esponjillas de acero o abrasivos potentes sobre cualquier
superficie pintada, incluyendo el Acero Inoxidable Negro.
Acero Inoxidable excluyendo el Acero Inoxidable Negro (en algunos modelos)
No use virutas de acero; éstas dañarán la superficie.
/RVOLPSLDGRUHVFRQiFLGRR[iOLFRWDOHVFRPR%DU.HHSHUV
)ULHQG6RIW&OHDQVHUŒHOLPLQDUiQHOy[LGRGHVOXVWUHV\
SHTXHxDVPDQFKDVVREUHODVXSHUILFLH8VHVyORXQOLPSLDGRU
líquido libre de material abrasivo y frote en la dirección de las
líneas del cepillo con una esponja suave y húmeda.
20
Para limpiar la superficie de acero inoxidable, use agua tibia
con jabón o un limpiador o pulidor para acero inoxidable.
Siempre limpie la superficie en la dirección del veteado. Siga
las instrucciones del limpiador para limpiar la superficie de
acero inoxidable.
Para realizar consultas sobre la adquisición de productos,
incluyendo limpiadores o pulidores para electrodomésticos
de acero inoxidable, consulte las secciones de Accesorios y
Soporte al Consumidor al final de este manual.
49-85242-1
(OLQWHULRUGHVXQXHYRKRUQRSXHGHVHUOLPSLDGRGHIRUPDPDQXDORXWLOL]DQGRORVPRGRV6WHDP&OHDQ /LPSLH]DFRQ9DSRU R
6HOI&OHDQ /LPSLH]D$XWRPiWLFD El derrame de adobo, jugos de fruta, salsas de tomate y líquidos para humedecer que contengan ácidos pueden ocasionar
descoloración y se deberán limpiar de inmediato. Espere a que las superficies calientes se enfríen, y luego limpie y enjuague.
Limpieza Manual
No use limpiadores de horno, limpiadores líquidos fuertes,
estropajos de acero, ni almohadillas para fregar en el interior
del horno. Para la suciedad de la parte inferior del horno y
otras superficies esmaltadas, use un abrasivo suave que
FRQWHQJDiFLGRR[iOLFRWDOFRPR%DU.HHSHUV)ULHQG®, con
una esponja antirayaduras. Tenga cuidado de no aplicar
limpiadores abrasivos o esponjas sobre la puerta de vidrio, ya
que estos rayarán el revestimiento reflectante. El interior del
horno y la puerta de vidrio podrán ser limpiados con una tela
suave, jabón suave y agua, o con vinagre y una solución de
agua. Luego de la limpieza, enjuague con agua limpia y seque
con una tela seca.
Modo de Limpieza con Vapor
/DILQDOLGDGGHODIXQFLyQ6WHDP&OHDQ /LPSLH]DFRQ
9DSRU HVXVDUDJXDSDUDOLPSLDUODVXFLHGDGOHYHGH
su horno en una temperatura inferior a la de Self Clean
/LPSLH]D$XWRPiWLFD 3DUDXVDUODIXQFLyQ6WHDP&OHDQ /LPSLH]DFRQ9DSRU No podrá abrir la puerta durante los 30 minutos del ciclo
6WHDP&OHDQ /LPSLH]DFRQ9DSRU $OILQDOL]DUHOFLFOR
GH6WHDP&OHDQ /LPSLH]DFRQ9DSRU DEVRUEDHODJXD
restante, y limpie la suciedad ablandada por la humedad
de las paredes y la puerta del horno.
1. Comience con el horno a temperatura ambiente.
2. Limpie la grasa excesiva y la suciedad del horno.
3. Vierta una taza de agua en la parte inferior del horno.
4. Cierre la puerta.
3UHVLRQHODWHFOD&OHDQ /LPSLDU VHOHFFLRQH
6WHDP&OHDQ /LPSLH]DFRQ9DSRU \OXHJR
SUHVLRQH6WDUW(QWHU ,QLFLDU,QJUHVDU CUIDADO Y LIMPIEZA: Cocina - Interior
Cocina - Interior
Modo de Limpieza Automática
Lea las Instrucciones de Seguridad del Horno con Limpieza
Automática, en el comienzo de este manual, antes de usar
HOPRGR6HOI&OHDQ /LPSLH]D$XWRPiWLFD (VWHPRGRXVD
temperaturas muy altas para limpiar el interior del horno. Para
un horno moderadamente sucio, use un ciclo de limpieza
automática de 3 horas. Sólo los estantes del horno de limpieza
DXWRPiWLFD QHJURV \ODVUHMLOODVSRGUiQSHUPDQHFHUHQHO
horno durante el ciclo de limpieza automática. Todos los
GHPiVtWHPVLQFOX\HQGRORVHVWDQWHVQLTXHODGRV SODWHDGRV GHEHUiQVHUUHWLUDGRV6LORVHVWDQWHVQLTXHODGRV SODWHDGRV se dejan dentro del horno durante un ciclo de limpieza
automática, los estantes sufrirán deslustre. Si cualquier tipo
de estante es dejado en el horno durante el ciclo de limpieza
automática, es posible que se vuelva difícil deslizar el estante.
Para acceder a instrucciones sobre cómo mejorar esto,
consulte la sección de Estantes del Horno.
3DUDXVDUODIXQFLyQ6HOI&OHDQ /LPSLH]D$XWRPiWLFD IMPORTANTE: Las emanaciones producidas por el ciclo de
autolimpieza de cualquier horno afectan la salud de algunas
aves de manera notoria. Procure llevar sus aves a otra
habitación bien ventilada.
No podrá abrir la puerta durante el ciclo de limpieza automática.
La puerta permanecerá bloqueada luego del ciclo de limpieza
automática hasta que el horno se enfríe y se alcance la
temperatura de desbloqueo. Al finalizar el ciclo de limpieza
automática, deje que el horno se enfríe, destrabe la puerta, y
limpie cualquier ceniza que haya quedado en el horno.
1. Comience con el horno a temperatura ambiente.
2. Limpie la grasa excesiva y las suciedades del horno y
del interior de la puerta.
3. Retire cualquier ítem que no sean los estantes y
UHMLOODVGHOLPSLH]DDXWRPiWLFD QHJURV VLORGHVHD
Consulte sobre la Limpieza de la Superficie de Cocción
para determinar si sus rejillas pueden ser limpiadas
automáticamente y para detalles importantes en relación
a la colocación de las rejillas.
4. Cierre la puerta.
5. Presione la tecla Clean (Limpiar), seleccione Self
Clean (Limpieza Automática) y luego presione
Start/Enter (Iniciar/ Ingresar).
Estantes
Todos los estantes se pueden lavar con agua caliente y jabón.
/RVHVWDQWHVHVPDOWDGRV QREULOORVRV VHSXHGHQGHMDUHQOD
cavidad durante el ciclo de limpieza automática.
49-85242-1
Es posible que resulte más difícil deslizar los estantes,
especialmente luego de la limpieza automática. Coloque aceite
vegetal en una tela húmeda o toalla de papel y frote sobre los
extremos izquierdo y derecho.
21
CUIDADO Y LIMPIEZA: Placa de Cocción
Placa de Cocción
Retiro de los Quemadores Superficiales para su Limpieza
Apague todos los controles. Espere a que la placa de cocción se enfríe antes de retirar las rejillas y las partes del quemador. Al
retirar las tapas y cabezas de los quemadores, recuerde su tamaño y ubicación. Vuelva a colocarlos en la misma ubicación luego
de la limpieza.
PRECAUCIÓN
No intente retirar las tapas del quemador oval o oval dual de las cabezas de los quemadores.
7DSDGHO4XHPDGRU
5HGRQGR ([WUDtEOH
7DSDGHO4XHPDGRU
5HGRQGR ([WUDtEOH
Cabeza del
4XHPDGRU
Redondo
7DSDGHO4XHPDGRU
([WHUQR Extraíble
Cabeza del
4XHPDGRU
Redondo
Electrodo
Electrodo
7DSDVGHO4XHPDGRU2YDO
'XDO 1R([WUDtEOHV
Quemador
Redondo
Quemador Oval Dual
(en algunos modelos)
4XHPDGRUGHP~OWLSOHVDQLOORV
(en algunos modelos)
Limpieza de los Quemadores Superficiales
Limpieza de las Tapas de los Quemadores
Lave las tapas de los quemadores en agua caliente con jabón
y enjuague con agua limpia. Puede fregar con u na base de
fregado plástica para eliminar partículas de comida quemadas.
Las tapas redondas de los quemadores también se pueden
limpiar en un lavavajillas.
Limpieza de las Cabezas de los Quemadores
Limpie las cabezas de los quemadores de forma rutinaria,
especialmente luego de derrames importantes, que podrían
bloquear las aberturas del quemador. Retire los quemadores
cuando estén fríos. Lave los mismos con agua caliente y
jabón. Enjuague con agua limpia. Para eliminar las manchas
más rebeldes, use un cepillo con cerda plástica.
NOTA: No use lana de acero ni estropajos para limpiar las
partes del quemador, ya que podrán bloquear las aberturas.
Nunca lave las cabezas de los quemadores en el lavavajillas.
Esto podrá hacer que se descoloren.
Las hendiduras de las cabezas de los quemadores se deben
mantener limpias en todo momento para obtener una llama
pareja y sin obstrucción.
Las partes bloqueadas o sucias de los quemadores o los
electrodos no permitirán que el quemador funcione de forma
correcta.
Reemplazo de los Quemadores Superficiales
Antes de colocar las tapas y cabezas de los quemadores y el
HQVDPEOHGHODFDEH]DWDSDQXHYDPHQWHHVFXUUDHOH[FHVR
de agua y luego seque las mismas totalmente.
22
7DSDGHO4XHPDGRU
5HGRQGR ([WUDtEOH
Vuelva a colocar las cabezas de los quemadores en las
ubicaciones correctas, de acuerdo con sus tamaños.
Asegúrese de que cada tapa quede correctamente apoyada
sobre la cabeza del quemador, como se muestra a
continuación.
La tapa del
quemador NO está
correctamente
colocada.
La tapa del
quemador NO está
correctamente
colocada.
La tapa del
quemador está
correctamente
colocada.
PRECAUCIÓN
No use la parte superior de la
cocina sin que todas las partes de los quemadores y las
parrillas estén en sus respectivos lugares.
Cualquier derrame en o alrededor de un electrodo se deberá
limpiar de forma cuidadosa. Evite golpear el electrodo con
cualquier cosa dura, ya que podrá ser dañado.
Electrodo
El electrodo del encendedor de la chispa es
expuesto cuando la cabeza del quemador es
retirada. Cuando un quemador se gira a LITE,
todos los quemadores hacen chispa. No intente
desensamblar ni limpiar un quemador mientras
otro quemador está encendido.
49-85242-1
Parrillas de Quemadores
Limpieza Manual
Las rejillas se deberán lavar con agua caliente y jabón y
deberán ser enjuagadas con agua limpia. Para ablandar la
comida quemada, coloque las rejillas en una solución con ¼
de taza de amoníaco hogareño durante varias horas. Luego,
friegue las rejillas con un estropajo de plástico con agua
caliente y jabón. Enjuague a fondo y seque.
Modo Self Clean (Limpieza Automática)
(en algunos modelos)
Si las rejillas no cuentan con protectores de goma en la
superficie inferior, podrán ser limpiadas en el horno usando
el ciclo de limpieza automática. No intente limpiar las rejillas
en el horno si las mismas cuentan con protectores de goma.
Hacer esto destruirá los protectores de goma, afectando el
funcionamiento de los quemadores.
Las rejillas cubiertas de porcelana se podrán volver
gradualmente ásperas si son expuestas de forma continua a
las temperaturas de limpieza automática.
Si su horno está equipado con estantes de limpieza automática
QHJURV VHUHFRPLHQGDVHJXLUODVLQVWUXFFLRQHVSDUDOD
colocación de parrillas en los estantes. Si su horno está
equipado con estantes niquelados, se recomienda seguir
las instrucciones para la colocación de rejillas en el fondo
GHOKRUQR/RVHVWDQWHVFXELHUWRVGHQtTXHO SODWHDGRV QR
deben permanecer en el horno durante el ciclo de limpieza
automática. Hacer esto deslustrará los estantes. Si cualquier
tipo de estante es dejado en el horno durante el ciclo de
limpieza automática, es posible que se vuelva difícil deslizar el
estante. Para acceder a instrucciones de lubricación, consulte
la sección de Estante del Horno.
NOTA: Al colocar o retirar rejillas del horno, no deslice las
mismas sobre los estantes ni sobre el fondo del horno. Hacer
esto podría dañar el esmalte de los estantes o el fondo del horno.
Para realizar la limpieza automática de sus parrillas en los
estantes de limpieza automática (Horno Inferior Únicamente):
1. Inserte los estantes en las posiciones 1, 3 y 5 o en las
posiciones 2 y 4.
2. De forma suave, coloque una rejilla en cada estante.
Para realizar la limpieza automática de sus rejillas en el
fondo del horno (Horno Inferior Únicamente):
1. Retire todos los estantes del horno.
2. De forma suave, coloque una rejilla en el centro del
fondo del horno con la rejilla orientada en la posición
HUJXLGD$SLOHODUHMLOOD V UHVWDQWHFRPRVHPXHVWUDD
continuación. No coloque ni apile las rejillas en ninguna
otra configuración.
8QDYH]TXHODVUHMLOODVIXHURQFRORFDGDVHQHOKRUQRXVHHO
ciclo de limpieza automática siguiendo las instrucciones de la
sección de Limpieza del Horno.
NOTA: Tenga cuidado al retirar las parrillas del horno superior
una vez que el ciclo de auto limpieza haya finalizado. Es
posible que las parrillas aún estén calientes.
8QDYH]FRPSOHWDGRHOFLFORGHOLPSLH]DDXWRPiWLFDODVUHMLOODV
pueden ser retiradas de forma cuidadosa. Es posible que
observe un residuo blanco en las rejillas. Limpie el mismo con
una esponja húmeda. Si las manchas blancas persisten, moje
la esponja con una solución mitad de vinagre y mitad de agua
y vuelva a limpiar las rejillas.
Al reemplazar las rejillas en la superficie de cocción, asegúrese
de ubicarlas de forma correcta. Las rejillas se deben poder
posicionar de forma segura en la superficie de cocción.
CUIDADO Y LIMPIEZA: Placa de Cocción
3ODFDGH&RFFLyQ &RQWLQ~D
Protectores de Soportes de Rejillas (en algunos modelos)
Si uno de los protectores de goma de la rejilla de la placa
de cocción se pierde o daña, se podrán obtener piezas de
repuesto llamando al 1.800.GE.CARES.
Para insertar los nuevos protectores, simplemente coloque
el extremo del protector con forma cónica en el agujero de
la placa de cocción y empuje hacia abajo de forma suave,
doblando el protector.
Protectores para Soportes de Rejillas
Plancha (en algunos modelos)
Hierro fundido y Hierro Forjado Reversible: Limpie su
plancha de hierro fundido reversible o del chef con un cepillo
duro y agua caliente. No se recomienda el uso de jabón, y
nunca se deben usar detergentes potentes, ya que eliminarán
el curado. Enjuague la misma con agua caliente y séquela
cuidadosamente. Luego del enjuague, presazone la plancha
aplicando una capa suave de aceite de cocina sobre su
superficie. Limpie el exceso de aceite con una toalla de papel.
Guarde en un lugar frío y seco.
49-85242-1
Precauciones de la Plancha:
Ŷ Si algo se derramó debajo de la plancha, se deberá limpiar
tan pronto como sea posible para evitar que sea horneado
en la placa de cocción.
Ŷ No permita que se acumule grasa debajo de la plancha,
ya que puede haber riesgo de incendio. Limpie debajo de
la plancha con agua caliente y jabón, tan pronto como sea
posible.
Ŷ No lave la plancha en el lavavajillas.
Ŷ No limpie la plancha en el horno de limpieza automática.
23
CUIDADO Y LIMPIEZA: 3XHUWD6RQGDGHO+RUQR
24
Puerta
Limpieza de la Puerta del Horno
Limpieza del Interior de la Puerta
No permita que el excedente de agua entre a ningún agujero o
ranuras de la puerta.
Aplique detergente para lavar platos sobre cualquier
VDOSLFDGXUDTXHKD\DVREUHHOYLGULRGHELGRDOKRUQHDGR8VH
el filo de una navaja del lado seguro para despejarlo. Luego
limpie el vidrio con una tela con jabón para eliminar cualquier
residuo y seque.
El área que está fuera de la junta se puede limpiar con un
estropajo de plástico con jabón. No frote ni limpie la junta de
la puerta; posee una resistencia extremadamente baja a la
abrasión.
Si observa que la junta se empieza a gastar, se deshilacha o
daña de cualquier forma y si quedó fuera de la puerta, deberá
reemplazar la misma.
Limpieza del Exterior de la Puerta
Si las manchas en el borde de la ventana de la puerta son
persistentes, use un limpiador abrasivo suave o una esponja
con estropajo para obtener un mejor resultado. No use este
método sobre ninguna otra superficie.
Superficies de Acero Inoxidable (en algunos modelos)
No use virutas de acero; éstas dañarán la superficie.
Para limpiar la superficie de acero inoxidable, use agua tibia
con jabón o un limpiador o pulidor para acero inoxidable.
Siempre limpie la superficie en la dirección del veteado. Siga
las instrucciones del limpiador para limpiar la superficie de
acero inoxidable.
Para realizar consultas sobre la adquisición de productos,
incluyendo limpiadores o pulidores para electrodomésticos
de acero inoxidable, consulte las secciones de Accesorios y
Soporte al Consumidor al final de este manual.
Sonda del Horno
La sonda de temperatura se puede limpiar con agua y jabón
o con una almohadilla de estropajo llena de jabón. Enfríe
la sonda de temperatura antes de su limpieza. Fregue las
manchas difíciles con una almohadilla de estropajo llena de
jabón, enjuague y seque.
Para ordenar sondas de temperatura adicionales, consulte las
secciones de Accesorios y Soporte al Consumidor al final de
este manual.
Ŷ 1RVXPHUMDODVRQGDGHWHPSHUDWXUDHQDJXD
Ŷ 1RJXDUGHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQR
Ŷ 1XQFDGHMHODVRQGDGHWHPSHUDWXUDGHQWURGHOKRUQR
durante un ciclo de limpieza automática o de limpieza
con vapor.
49-85242-1
Reemplazo de la Lámpara del Horno
ADVERTENCIA
PELIGRO DE DESCARGA O QUEMADURAS: Antes de reemplazar la lámpara de luz del horno,
desconecte la conexión eléctrica del horno del fusible principal o del panel del disyuntor. Si esto no se
cumple, se podrá producir una descarga eléctrica o un incendio.
PRECAUCIÓN
RIESGO DE INCENDIO: La tapa de vidrio y la lámpara de luz se deberán retirar cuando estén frías. Tocar
el vidrio caliente sin protección en las manos o con un trapo húmedo puede ocasionar quemaduras.
NOTA: La tapa de vidrio deberá ser retirada sólo cuando esté
fría. Si usa guantes de látex, tendrá un mejor agarre.
Antes de reemplazar la lámpara, desconecte la conexión
eléctrica del horno del fusible principal o del panel del disyuntor.
Deje que la lámpara se enfríe completamente antes de retirar la
misma. Para su seguridad, no toque una lámpara caliente con
una tela húmeda. Si lo hace, la lámpara se podrá romper.
Para retirar:
Dé a la tapa de vidrio en contra de las agujas del reloj un
cuarto de giro hasta que las lengüetas de la tapa de vidrio
queden fuera de las ranuras de la ficha y empuje la tapa hacia
fuera. Retire la lámpara.
Para reemplazar:
Coloque una lámpara nueva de 40 watts para
electrodomésticos. Coloque las lengüetas de la tapa de vidrio
en las ranuras de la ficha. Dé a la tapa de vidrio un cuarto de
giro en dirección de las agujas del reloj.
49-85242-1
NOTA:
Ŷ /
DVOiPSDUDVSDUD
electrodoméstico de
Ficha
40 watts son más
pequeñas que las
lámparas hogareñas
de 40 watts.
Longitud
Ŷ 9XHOYDDFRQHFWDUHO
máxima
horno una vez que la
de 31»2”
lámpara nueva esté
Lámpara
instalada.
Ŷ 3DUDXQDPHMRU
Lengüeta
iluminación dentro
del horno, limpie
la tapa del vidrio
Tapa de vidrio
en forma frecuente
utilizando una tela
húmeda. Esto se deberá hacer cuando el horno esté
completamente frío.
CUIDADO Y LIMPIEZA: Luz del Horno
Luz del Horno
25
CUIDADO Y LIMPIEZA: Puerta del Horno
Puerta del Horno
Puerta del Horno Desmontable
La puerta es muy pesada. Tenga cuidado al retirar y levantar la puerta. No levante la puerta usando la manija.
Para retirar la puerta:
1. Abra la puerta totalmente.
2. Empuje los bloqueos de la bisagra hacia arriba y afuera de
la estructura de la cocina, hasta la posición de desbloqueo.
3. Firmemente tome ambos lados de la puerta por la parte
superior.
4. Cierre la puerta hasta que la parte superior de la misma
quede a aproximadamente 6” de la estructura de la cocina.
5. Levante la puerta hacia arriba y afuera de la cocina, hasta
que ambos brazos de las bisagras estén fuera de las
Empuje los bloqueos de las
Posición de retiro
ranuras de la estructura de la cocina.
bisagras hacia arriba para
desbloquearlos
Para reemplazar la puerta:
1. Firmemente tome ambos lados de la puerta por la parte
Empuje el
superior.
bloqueo de
la bisagra
2. Con la puerta en el mismo ángulo que en la posición de
hacia arriba
retiro, apoye la abertura sobre el fondo del brazo de la
%UD]RGHODELVDJUD
hasta que
bisagra izquierda en el extremo inferior de la ranura de la
quede
bisagra izquierda. La abertura en el brazo de la bisagra
bloqueado
deberá estar totalmente apoyada en la parte inferior de la
ranura. Repita el procedimiento del lado derecho.
3. Abra la puerta totalmente. Si la puerta no se abre
completamente, las aberturas en las partes inferiores de los
Abertura
brazos de las bisagras no se apoyaron de forma correcta
sobre el extremo inferior de la ranura. Retire la puerta de la
cocina y repita el paso anterior.
Apoye la abertura en el
Empuje trabas de la bisagra
4. Empuje los bloqueos de las bisagras hacia la cavidad de la
extremo inferior de la ranura de
hacia abajo para bloquear.
cocina y hacia abajo hasta la posición de bloqueo.
la bisagra
5. Cierre la puerta del horno.
Levante la Puerta del Horno Superior
La puerta es muy pesada. Tenga cuidado al retirar y levantar la puerta. No levante la puerta usando la manija.
Para retirar la puerta:
1. Abra la puerta totalmente.
2. Levante el bloqueo de las bisagras hacia el marco del
horno hasta que se detenga.
&LHUUHODSXHUWDDJUDGRV VHQWLUiTXHODSXHUWDVH
GHWLHQH (OEORTXHRGHODVELVDJUDVKDUiFRQWDFWRFRQHO
marco del horno.
4. A ambos lados de la puerta, presione los botones para
liberar cada bisagra.
5. Levante la puerta hasta que se libere de las bisagras.
6. Tire de los brazos de las bisagras para liberar la presione
sobre las lengüetas de bloqueo.
7. Empuje los bloqueos de las bisagras hacia abajo sobre las
bisagras.
8. Presione las bisagras hacia la unidad, de modo que se
cierren.
Marco del
horno
Para reemplazar la puerta:
1. Empuje las bisagras hacia afuera del marco del horno
hasta la posición completamente abierta.
2. Levante los bloqueos de las bisagras hacia el marco del
horno hasta que se detengan.
3. Levante los bloqueos de las bisagras hacia el marco del
horno hasta que se detengan.
4. Deslice la puerta hacia atrás sobre las bisagras. Asegúrese
de que los botones se vuelvan a levantar.
5. Abra la puerta totalmente.
6. Empuje los bloqueos de las bisagras hacia abajo sobre las
bisagras.
7. Cierre la puerta del horno.
Empuje
hacia
adentro
Empuje
hacia
abajo
Marco de
la puerta
%RWRQHV
para liberar
26
49-85242-1
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite solicitar
reparaciones.
Problema
Causa Posible
Qué Hacer
Mi horno nuevo no
cocina como el anterior.
¢+D\DOJ~QSUREOHPDFRQ
las configuraciones de
temperatura?
Su horno nuevo cuenta con un sistema de cocción
diferente con relación al anterior y, por lo tanto, es
posible que cocine de forma diferente.
Durante los primeros usos, siga los tiempos y
temperaturas de sus recetas atentamente y use
las posiciones de los estantes recomendadas en la
Guía de Cocción. Si aún piensa que su horno nuevo
cocina con demasiado calor o demasiado frío, podrá
ajustar el termostato usted mismo para aplicar su
preferencia de cocción específica. Consulte la sección
de Funciones Especiales.
La comida no se hornea
de forma apropiada
Controles del horno configurados de forma incorrecta.
Consulte la sección Modos de Cocción.
La posición del estante es incorrecta o el estante no
está nivelado.
Consulte la sección Modos de Cocción y la Guía de
Cocción.
8VRGHXQDFDFHURODLQFRUUHFWDRGHXQDFDFHURODGH
tamaño incorrecto.
&RQVXOWHODVHFFLyQ8WHQVLOLRV
La temperatura del horno debe ser ajustada.
Consulte la sección Funciones Especiales.
Controles del horno configurados de forma incorrecta.
Asegúrese de seleccionar el modo correcto para
asar.
Se usó una posición incorrecta del estante.
Para acceder a sugerencias de ubicación de
estantes, consulte la Guía de Cocción.
8WHQVLOLRGHFRFLQDLQDGHFXDGRSDUDDVDU
8VHXQDROODHVSHFtILFDPHQWHGLVHxDGDSDUDDVDU
El papel de aluminio sobre la olla para asar
no fue ajustado de forma apropiada ni cortado
apropiadamente para drenar la grasa.
Si usará papel de aluminio en la olla para asar,
envuelva de forma ajustada y agregue cortes
conforme con aquellos en la olla para permitir que la
grasa sea drenada.
La temperatura del horno
es demasiado caliente o
demasiado fría
La temperatura del horno debe ser ajustada.
Consulte la sección Modos de Cocción.
El horno y/o la pantalla
parecen no estar
funcionando
Es posible que un fusible de su hogar se haya
quemado o que el disyuntor se haya desconectado.
Reemplace el fusible o reinicie el disyuntor.
Controles del horno configurados de forma incorrecta.
&RQVXOWHODVHFFLyQ8VRGHO+RUQR
(OKRUQRVHHQFXHQWUDHQ6DEEDWK0RGH 0RGR
6DEiWLFR
Verifique que el horno no esté en Sabbath Mode
0RGR6DEiWLFR &RQVXOWHODVHFFLyQ6DEEDWK0RGH
0RGR6DEiWLFR La comida no asa de
forma apropiada
El reloj está apagado.
&RQVXOWHODVHFFLyQ6HWWLQJV &RQILJXUDFLRQHV Sonido de “chisporroteo”
o “traqueo”
Éste es el sonido de metal calentándose o enfriándose
durante las funciones de cocción y limpieza.
Esto es normal.
¿Por qué la estufa hace
un sonido de “clic”
cuando uso el horno?
Su estufa fue diseñada para mantener un control más
ajustado sobre la temperatura del horno. Es posible
que escuche que los elementos de calentamiento del
horno hagan sonidos de “clic” con mayor frecuencia
que con hornos más antiguos para lograr mejores
resultados durante los ciclos de horneado, asado,
convección y limpieza automática.
Esto es normal.
A veces el horno tarda
más en precalentarse a la
misma temperatura
8WHQVLOLRRFRPLGDHQHOKRUQR
El utensilio o la comida en el horno hará que éste
tarde más en precalentarse. Retire estos artículos para
reducir el tiempo de precalentamiento.
Número de estantes en el horno
Agregar más estantes al horno hará que éste tarde
más en precalentarse. Retire algunos estantes.
49-85242-1
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
27
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
Problema
Causa Posible
Qué Hacer
La luz del horno no
funciona
La lámpara está floja o presenta defectos.
Ajuste o reemplace la lámpara. Para acceder a
instrucciones sobre cómo reemplazar la lámpara,
consulte la sección de Mantenimiento.
El modo de limpieza
automática del horno
no funciona
La temperatura del horno es demasiado caliente como
para configurar la limpieza automática.
Espere a que el horno se enfríe y reinicie los controles.
Los controles del horno están configurados de forma
incorrecta.
Consulte la sección de Limpieza del Horno.
Exceso de humo
durante un ciclo de
limpieza
Suciedad o grasa excesiva.
Presione la tecla Cancel/Off (Cancelar/ Apagar) Abra
las ventanas para liberar el humo en la habitación.
Espere hasta que la luz de la función LOCKED
(Bloqueado) desaparezca. Limpie el exceso de
suciedad y reinicie el ciclo de limpieza.
El horno no limpia
luego de un ciclo de
limpieza
Los controles del horno están configurados de forma
incorrecta.
Consulte la sección de Limpieza del Horno.
El horno estaba demasiado sucio.
Limpie derrames excesivos antes de iniciar el ciclo de
limpieza. Es posible que, en hornos con mucha suciedad,
sea necesario usar la limpieza automática nuevamente o
usarla durante un período de tiempo más prolongado.
Fuerte olor a
“quemado” o a
“aceite” desde la
ventilación
Esto es normal en un horno nuevo y desaparecerá con
el tiempo.
Para acelerar el proceso, configure un ciclo de limpieza
automática por un mínimo de 3 horas. Consulte la
sección de Limpieza del Horno.
Humo excesivo al asar
La comida está demasiado cerca del quemador.
%DMHODSRVLFLyQGHOHVWDQWHFRQFRPLGD
La puerta del horno
no se abre o la luz
LOCKED (Bloqueado)
está encendida
cuando desea cocinar.
La puerta del horno está bloqueada debido a que la
temperatura interior del horno no descendió por debajo
de la temperatura de bloqueo.
Presione la tecla Cancel/Off (Cancelar/ Apagar).
Espere a que el horno se enfríe por debajo de la
temperatura de bloqueo.
“TRABA DE LA
PUERTA” titila en la
pantalla.
El ciclo de limpieza automática fue seleccionado pero la
puerta no está cerrada.
Cierre la puerta del horno.
³)±\XQQ~PHUR
o letra” titila en la
pantalla
Tiene un código de error de función.
Presione la tecla Cancel/Off (Cancelar/ Apagar)
Permita que el horno se enfríe durante una hora. Vuelva
a poner el horno en funcionamiento. Si el código de la
función se repite, desconecte totalmente la corriente
del horno durante por lo menos 30 minutos y vuelva a
conectar la misma. Si el código de error de función se
repite, llame al servicio técnico.
Corte de corriente, el
reloj titila
Corte o exceso de corriente
Reinicie el reloj. Si el horno estuvo en uso, deberá
reiniciar el mismo presionando la tecla Cancel/ Off
(Cancelar/ Apagar) configurando el reloj y reiniciando
cualquier función de cocción.
Controles de Bloqueo
o Control La función
de bloqueo está
activada.
El quemador no se
enciende
28
Si aparece LOC ON en la pantalla, el control de la
cocina está bloqueado. Apague esta función para usar
ODFRFLQD&RQVXOWHODIXQFLyQ/RFN&RQWURO &RQWUROGH
%ORTXHR HQODVHFFLyQGH&RQWUROHVGHO+RUQR
El enchufe en la cocina no está completamente
insertado en el tomacorriente eléctrico.
Asegúrese de que el cable de electricidad esté
enchufado en un tomacorriente correctamente conectado
a tierra.et.
El suministro de gas no fue conectado o encendido.
Consulte las Instrucciones de Instalación provistas con
su cocina.
Es posible que un fusible de su hogar se haya quemado
o que el disyuntor se haya desconectado.
Reemplace el fusible o reinicie el disyuntor.
Las piezas del quemador no fueron reemplazadas
correctamen.
Lea la sección Cuidado y limpieza de la cocina.
Es posible que las hendiduras de los quemadores, o el
puerto del encendedor redondo en el quemador oval,
estén atascados.
Retire los quemadores o limpie los mismos. Controle que
no haya comida quemada ni grasa en el área del electrodo.
Lea la sección de Cuidado y Limpieza de la cocina.
Residuos de comida en el electrodo
Suavemente pula el extremo plano del electrodo con una
lima de uñas o con una lija hasta que quede brilloso.
49-85242-1
Problema
Causa Posible
Qué Hacer
Los quemadores
superiores no queman
de forma pareja
Ensamble del quemador inapropiado.
Asegúrese de que las tapas de los quemadores estén instaladas
correctamente. Consulte Cuidado y limpieza en la sección de la cocina.
Las hendiduras al costado del quemador
se podrán atascar.
Retire los quemadores para su limpieza. Consulte la sección de Cuidado
y limpieza de la cocina.
Llamas de los
quemadores son muy
grandes o amarillas
Promedio inadecuado de aire a gas.
Si la cocina es conectada a gas Propano, contacte al técnico que instaló
la cocina o que hizo la conversión.
Los quemadores
superficiales se
iluminan pero los
quemadores para
hornear y asar no.
Es posible que los quemadores de gas
del horno hayan sido apagados.
El apagado del gas del horno está ubicado en el regulador de gas cerca
GHODDGKHUHQFLDGHODWXEHUtDGHJDVDODFRFLQD8ELTXHODPLVPD\Gp
vuelta la palanca.
La palanca se
muestra cerrada.
(038-(3$5$$%5,5
Modelos con quemador sellado
La puerta de vidrio
del horno parece
estar “teñida” o tener
un color “arcoíris”.
El vidrio del horno interno está cubierto
con una barrera de calor que refleja
este último nuevamente hacia el horno,
a fin de evitar la pérdida de calor y de
mantener fría la puerta externa mientras
se hornea.
(VWRHVQRUPDO%DMRFLHUWDVOXFHV\iQJXORVHVSRVLEOHTXHYLVXDOLFH
esta tinta o arcoíris.
El cajón no se desliza
de forma pareja o se
arrastra
El cajón está desalineado.
Extienda totalmente el cajón y empuje el mismo totalmente hacia
adentro. Consulte la sección Cuidado y limpieza de la cocina.
El cajón está sobrecargado o la carga
está des balanceada.
Reduzca peso o redistribuya los contenidos de los cajones.
49-85242-1
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
29
GARANTÍA
Garantía de la Cocina a Gas de GE Appliances
GEAppliances.com
Todo el servicio de garantía es provisto por nuestros Centros de Servicio de Fabricación, o un técnico autorizado de Customer Care®.
Para programar una visita del servicio técnico a través de Internet, visítenos en www.geappliances.com/service_and_support/, o
llame a GE Appliances al 800.GE.CARES. Cuando llame para solicitar el servicio, tenga los números de serie y modelo disponibles.
Para realizar el servicio técnico de su electrodoméstico, se podrá requerir el uso de datos del puerto de abordaje para su diagnóstico.
Esto da al técnico del servicio de fábrica de GE Appliances la habilidad de diagnosticar de forma rápida cualquier problema con
su electrodoméstico, y de ayudar a GE Appliances a mejorar sus productos al brindarle a GE Appliances la información sobre su
electrodoméstico. Si no desea que los datos de su electrodoméstico sean enviados a GE Appliances, solicitamos que le indique a su
técnico no entregar los datos a GE Appliances en el momento del servicio.
Por el Período de
GE Appliances reemplazará
Un Año
Desde la fecha de la
compra original
Cualquier parte de la cocina que falle debido a un defecto en los materiales o la fabricación. Durante
esta garantía limitada de un año, GE Appliances también proveerá, sin costo, todo el trabajo y el
servicio en el hogar para reemplazar la parte que presente defectos.
Qué no cubrirá GE Appliances:
Ŷ 9LDMHVGHOWpFQLFRGHOVHUYLFLRDVXKRJDUSDUDHQVHxDUOH
sobre cómo usar el producto.
Ŷ ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV
Ŷ )DOODVGHOSURGXFWRHQFDVRGHDEXVRPDOXVRPRGLILFDFLyQ
o uso para propósitos diferentes al original o uso comercial.
Ŷ 5HHPSOD]RGHIXVLEOHVGHODFDVDRUHLQLFLRGHGLV\XQWRUHV
Ŷ 'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH
incendio, inundaciones o catástrofes naturales.
Ŷ 'DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV
defectos sobre este producto.
Ŷ 'DxRVVREUHHODFDEDGRWDOHVFRPRy[LGRVREUHOD
superficie, deslustres o manchas pequeñas no informadas
dentro de las 48 horas luego de la entrega.
Ŷ 'DxRFDXVDGRGHVSXpVGHODHQWUHJD
Ŷ 3URGXFWRQRDFFHVLEOHSDUDEULQGDUHOVHUYLFLRUHTXHULGR
Ŷ 6ROLFLWHHOVHUYLFLRWpFQLFRSDUDUHSDUDURUHHPSOD]DUODV
lámparas, excepto las lámparas LED.
Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con
la garantía deberá contar con la prueba de la fecha original de compra.
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS
30
Su única y exclusiva alternativa es la reparación del producto, como se indica en la Garantía Limitada. Las
garantías implícitas, incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito
particular, se limitan a un año o al período más corto permitido por la ley.
Esta garantía se extiende al comprador original y a cualquier dueño subsiguiente de productos comprados para
XVRKRJDUHxRGHQWURGH((886LHOSURGXFWRHVWiHQXQiUHDGRQGHQRVHHQFXHQWUDGLVSRQLEOHXQ3URYHHGRU
Autorizado del Servicio Técnico de GE Appliances, usted será responsable por el costo de un viaje o se podrá
requerir que traiga el producto a una ubicación del Servicio Técnico de GE Appliances autorizado para recibir el
VHUYLFLR(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRDVXKRJDU$OJXQRVHVWDGRV
no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía le da derechos legales
específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer cuáles son
sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado.
Garante: GE Appliances, a Haier company
Garantías Extendidas: Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que
están disponibles mientras su garantía aún está vigente. Puede acceder a la misma a través de Internet en cualquier
momento en
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
o llamando al 800.626.2224 durante el horario comercial. Los Servicios para los GE Appliances aún estarán
disponibles cuando su garantía caduque.
49-85242-1
¿Busca Algo Más?
¡GE Appliances ofrece una variedad de accesorios para
mejorar sus experiencias de cocción y mantenimiento!
Para acceder a números telefónicos e información de sitios
Web, consulte la página de Soporte para el Consumidor.
Estos y otros productos están disponibles:
Accesorios
Estante Plano de Níquel
ACCESORIOS
Accesorios
Estante Plano Reforzado de Níquel
Estante Plano con Limpieza Automática
Estante Extensible de Níquel
Estante Extensible con Limpieza Automática
2OODSDUD$VDU ô´[ó´[ò´
Accesorio del Estante para Dorar
Rejilla Central de la Superficie de Cocción
Plancha de Aluminio No Adherente
Plancha de Hierro Forjado Reversible
Suministros de Limpieza
Limpiadores de Acero Inoxidable CitriShineŒ
Paño de Pulido de Acero Inoxidable
5HPRYHGRUGH*UDVD4XHPDGD&(5$0$%5<7(®
49-85242-1
31
SOPORTE PARA EL CONSUMIDOR
Soporte para el Consumidor
Sitio Web de GE Appliances
¿Desea realizar una consulta o necesita ayuda con su electrodoméstico? ¡Intente a través del Sitio Web de GE Appliances las
KRUDVGHOGtDFXDOTXLHUGtDGHODxR8VWHGWDPELpQSXHGHFRPSUDUPiVHOHFWURGRPpVWLFRVPDUDYLOORVRVGH*($SSOLDQFHV\
aprovechar todos nuestros servicios de soporte a través de Internet, diseñados para su conveniencia.
(Q((88GEAppliances.com
Registre su Electrodoméstico
£5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUi
una mejor comunicación y un servicio más puntual de acuerdo con los términos de su garantía, en caso de surgir la necesidad.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado.
(Q((88GEAppliances.com/register
Servicio Programado
El servicio de reparación de expertos de GE Appliances está a sólo un paso de su puerta. Conéctese a través de Internet y programe
VXVHUYLFLRDVXFRQYHQLHQFLDFXDOTXLHUGtDGHODxR(Q((88GEAppliances.com/service
o comuníquese al 800.432.2737 durante el horario de atención comercial.
Garantías Extendidas
Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su
garantía aún está vigente. La puede adquirir en cualquier momento a través de Internet. Los servicios de GE Appliances aún
estarán allí cuando su garantía caduque.
(Q((88GEAppliances.com/extended-warranty
o comuníquese al 800.626.2224 durante el horario de atención comercial.
Conectividad Remota
3DUDVROLFLWDUDVLVWHQFLDSDUDODFRQHFWLYLGDGGHUHGLQDOiPEULFD SDUDPRGHORVFRQDFFHVRUHPRWR visite nuestro sitio web en GEAppliances.com/connected-home-smart-appliances/RFRPXQtTXHVHDOHQ((88
Piezas y Accesorios
Aquellos individuos calificados para realizar el servicio técnico de sus propios electrodomésticos podrán solicitar el envío de
SLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHV VHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU 2UGHQHKR\DWUDYpVGH
,QWHUQHWGXUDQWHODVKRUDVWRGRVORVGtDV(Q((88GEApplianceparts.com o de forma telefónica al 877.959.8688 durante
el horario de atención comercial.
Las instrucciones que figuran en este manual cubren los procedimientos que serán realizados por cualquier usuario.
Otros servicios técnicos generalmente deben ser derivados a personal calificado del servicio. Se deberá tener cuidado,
ya que una reparación indebida podrá hacer que el funcionamiento no sea seguro.
Contáctenos
Si no se encuentra satisfecho con el servicio que recibió de GE Appliances, comuníquese con nosotros a través de nuestro sitio
Web con todos los detalles, incluyendo su número telefónico, o escriba a:
(Q((88*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/contact
32
49-85242-1
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising