GE GSS25ETHWW Installation instructions


Add to my manuals
64 Pages

advertisement

GE GSS25ETHWW Installation instructions | Manualzz
Refrigerators
Side by Side
SAFETY INFORMATION
Connect Electricity. . . . . . . . . . . . . . . . . . .
Extension Cords . . . . . . . . . . . . . . . . . . . . .
Proper Disposal . . . . . . . . . . . . . . . . . . . . .
Safety Precautions . . . . . . . . . . . . . . . . . . .
3
2
2
2
OWNER’S MANUAL &
INSTALLATION
INSTRUCTIONS
Models 20, 22, 25
OPERATING INSTRUCTIONS
Automatic Icemaker. . . . . . . . . . . . . . . . . . 8
Controls . . . . . . . . . . . . . . . . . . . . . . . . . . . 6
Crispers and Pans . . . . . . . . . . . . . . . . . . . . 5
How to Install Features . . . . . . . . . . . . . . . 4
Ice and Water Dispenser . . . . . . . . . . . . . . 7
Shelves and Bins. . . . . . . . . . . . . . . . . . . . . 4
Water Filter Cartridge . . . . . . . . . . . . . . . . 9
CARE AND CLEANING
CLEANING . . . . . . . . . . . . . . . . . . . . . . 10
Light Bulbs . . . . . . . . . . . . . . . . . . . . . . . . . 11
ENGLISH/FRANÇAISE/
ESPAÑOL
INSTALLATION INSTRUCTIONS
Preparing to Install . . . . . . . . . . . . . . . . . 12
Water Line Installation . . . . . . . . . . . .13–15
TROUBLESHOOTING TIPS
Before You Call For Service . . . . . . . .16–18
Normal Operating Sounds . . . . . . . . . . . 18
CONSUMER SUPPORT . Back page
Performance Data Sheet . . . . . . . . . . . . . 19
Warranty . . . . . . . . . . . . . . . . . . . . . . . . . . 20
Write the model and serial
numbers here:
Model # _________________
Serial # _________________
Find these numbers on a
label inside the refrigerator
compartment at the top on the
right side behind the controls..
197D3351P020
49-60514-9
04-16 GEA
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
SAFETY
GE Appliances website
For more information on your refrigerator’s operation, visit GEAppliances.com or call 800.
GECARES (800.432.2737). In Canada visit GEAppliances.ca or call 800.561.3344.
REFRIGERATOR SAFETY INFORMATION
This is the safety alert symbol. This symbol alerts you to potential hazards that can kill or hurt you and others. All safety
messages will follow the safety alert symbol and the word “DANGER”, “WARNING”, or “CAUTION”. These words are defined as:
DANGER
Indicates a hazardous situation which, if not avoided, will result in death or serious injury.
WARNING Indicates a hazardous situation which, if not avoided, could result in death or serious injury.
CAUTION
Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of fire, explosion, electric shock, or injury when using your
WARNING
refrigerator follow these basic safety precautions:
„ This refrigerator must be properly installed and located
in accordance with the Installation Instructions before it
is used.
„ Unplug the refrigerator before making repairs, replacing
a light bulb, or cleaning.
Note: Power to the refrigerator cannot be disconnected
by any setting on the control panel.
Note: Repairs must be performed by a qualified service
professional.
„ Replace all parts and panels before operating.
„ Do not store or use gasoline or other flammable vapors
and liquids in the vicinity of this or any other appliance.
„ Because of potential safety hazards under certain
conditions, we strongly recommend against the use
CAUTION
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of injury when using your refrigerator, follow these basic
safety precautions.
„ Do not clean glass shelves or covers with warm water
when they are cold. Glass shelves and covers may break if
exposed to sudden temperature changes or impact, such
as bumping or dropping. Tempered glass is designed to
shatter into many small pieces if it breaks.
„ Keep fingers out of the “pinch point” areas; clearances
between the doors and between the doors and cabinet are
necessarily small. Be careful closing doors when children
are in the area.
2
of an extension cord. However, if you must use an
extension cord, it is absolutely necessary that it be a
UL-listed (in the United States) or a CSA certified (in
Canada), 3-wire grounding type appliance extension
cord having a grounding type plug and outlet and
that the electrical rating of the cord be 15 amperes
(minimum) and 120 volts.
„ To prevent suffocation and entrapment hazards to
children, remove the fresh food and freezer doors from
any refrigerator before disposing of it or discontinuing
its use.
„ Do not allow children to climb, stand or hang on the
door handles or the shelves in the refrigerator. They
could seriously injure themselves.
„ Do not touch the cold surfaces in the freezer compartment
when hands are damp or wet, skin may stick to these
extremely cold surfaces.
„ Do not refreeze frozen foods which have thawed
completely.
„ In refrigerators with automatic icemakers, avoid contact
with the moving parts of the ejector mechanism, or with
the heating element that releases the cubes. Do not place
fingers or hands on the automatic ice making mechanism
while the refrigerator is plugged in.
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
SAFETY
GEAppliances.com
(CONT.)
INSTALLATION
WARNING
Explosion Hazard.
Keep flammable materials and vapors, such as gasoline, away from refrigerator. Failure to do so can
result in fire, explosion, or death.
CONNECTING ELECTRICITY
WARNING
Electrical Shock Hazard.
Plug into a grounded 3-prong outlet
Do not remove the ground prong
Do not use an adapter
Failure to follow these instructions can result in death, fire, or electrical shock.
Do not, under any circumstances, cut or remove the third (ground) prong from the power cord.
For personal safety, this appliance must be properly grounded.
The power cord of this appliance is equipped with a 3-prong
(grounding) plug which mates with a standard 3-prong
(grounding) wall outlet to minimize the possibility of electric
shock hazard from this appliance.
Have the wall outlet and circuit checked by a qualified
electrician to make sure the outlet is properly grounded.
Where a standard 2-prong wall outlet is encountered, it is your
personal responsibility and obligation to have it replaced with a
properly grounded 3-prong wall outlet. Do not use an adapter.
The refrigerator should always be plugged into its own individual
electrical outlet which has a voltage rating that matches the
rating plate.
A 115 Volt AC, 60 Hz, 15- or 20-amp fused, grounded electrical
supply is required. This provides the best performance and also
prevents overloading house wiring circuits which could cause a
fire hazard from overheated wires.
Never unplug your refrigerator by pulling on the power cord.
Always grip plug firmly and pull straight out from the outlet.
Repair or replace immediately all power cords that have
become frayed or otherwise damaged. Do not use a cord that
shows cracks or abrasion damage along its length or at either
end.
When moving the refrigerator away from the wall, be careful
not to roll over or damage the power cord.
PROPER DISPOSAL OF YOUR OLD REFRIGERATOR
WARNING Suffocation and child entrapment hazard.
Remove fresh-food and freezer doors from the refrigerator, prior to disposal. Failure to do so can result
in child entrapment which can lead to death or brain damage.
IMPORTANT:
Child entrapment and suffocation are not problems
of the past. Junked or abandoned refrigerators are
still dangerous even if they will sit for “just a few
days.” If you are getting rid of your old refrigerator,
please follow the instructions below to help prevent
accidents.
Refrigerants
All refrigeration products contain refrigerants,
which under federal law must be removed prior
to product disposal. If you are getting rid of an old
refrigeration product, check with the company
handling the disposal about what to do.
Before You Throw Away Your Old Refrigerator or
Freezer:
■ Take off the fresh food and freezer doors.
■ Leave the shelves in place so that children may
not easily climb inside.
READ AND FOLLOW THIS SAFETY INFORMATION CAREFULLY.
SAVE THESE INSTRUCTIONS
3
How to install features. (Not all features are on all models.)
c TOP FREEZER SHELF
d
Make sure the shelf front locks into
position.
e
FILTER CARTRIDGE
Remove Bypass Plug
DAIRY COVER
Install Filter Cartridge
Top Freezer Shelf
f BOTTLE RETAINER
iFREEZER DOOR SHELF FRONTS
Make sure that the shelf front locks
into position.
NOTE: On dispenser models, the
longer shelf fronts go in the top
two positions.
g ADJUSTABLE DOOR BINS
DOOR BIN SNUGGERS
Door Shelf
Front
Door
Shelf
h LOWER FIXED DOOR BINS
Make sure the bin fronts lock into position.
To remove: Lift the shelf extender
straight up, then pull out.
To replace: Engage the shelf
extender in the molded supports
of the door and push in. It will lock
in place.
To remove: Lift the
front of the bin up,
then pull out.
To replace or relocate:
Engage the bin in the
molded supports of
the door, and push in.
Bin will lock in place.
Lower Door Bin
About the shelves and bins. (Not all features are on all models.)
Rearranging the Shelves
Refrigerator Shelves:
Freezer Pan:
To Remove
Lift up and out
To Replace
To Remove
Tilt up
Insert
top hook
Lower to
lock in
place
4
Remove the pan by pulling it
forward, lifting up the front and
sliding it past the stop location.
Freezer Shelves: (on some models)
To Remove
GEAppliances.com
Freezer Shelves: (on some models)
1
Bracket
Bracket
1
2
2
1
2
3
Bracket
4
1. Lift the right side of the shelf, front and
back, until you hear a snap.
2. Push the shelf to the right into the top
portion of the bracket. The left ends of the
shelf will come free from the left brackets.
3. Tilt the left side down to release the right
ends from the right brackets.
4. Pull forward to remove the shelf from the
refrigerator.
5. Follow the steps from 4 to 1 to install the
shelf in the new location.
Slide-Out Spillproof Shelf (on some models)
The slide-out spillproof shelf allows you to
reach items stored behind others. The special
edges are designed to help prevent spills from
dripping to lower shelves.
NOTE: Make sure you push the shelves all
the way back in before you close the door.
Spillproof Shelves (on some models)
Spillproof shelves have special edges to help
prevent spills from dripping to lower shelves.
About the crispers and pans. (Not all features are on all models.)
Adjustable Humidity Crispers and Snack Pan (on some models)
HIGH
LOW
Slide the control all the way to the High setting
to provide high humidity recommended for
most vegetables.
HIGH
Slide the control all the way to the Low setting
to provide lower humidity levels recommended
for most fruits.
LOW
Normal
Convertible Meat Pan (on some models)
The convertible meat pan has its own cold
air duct to allow a stream of cold air from the
freezer compartment to flow around the pan.
The variable temperature control regulates the
air flow from the freezer compartment.
Coldest
Set control lever up to convert the pan to
normal refrigerator temperature and provide
extra vegetable storage space. Cold air duct
is turned off. Variable settings between these
extremes can be selected.
Set control lever down to the coldest setting to
store fresh meats. If lever is left in meat position
for a long period of time, some frost may form
on the inside of the pan.
Crisper Removal
Crispers can easily be removed by tilting up
slightly and pulling past stop location.
If the door prevents you from taking out the
crispers, the refrigerator will need to be rolled
forward until the door opens enough to slide
the crispers out. In some cases, when you roll
the refrigerator out, you will need to move the
refrigerator to the left as you roll it out.
When replacing the crispers, make
sure you slide them through the
crisper guides.
5
About the controls on the refrigerator.
Not all features are on all models. Your controls may be similar to the following:
Freezer
Refrigerator
The temperature controls are preset in the factory at 37°F
for the refrigerator compartment and 0°F for the freezer
compartment. Allow 24 hours for the temperature to
stabilize to the preset recommended settings.
The temperature controls can display both the SET
temperature as well as the actual temperature in the
refrigerator and freezer. The actual temperature may vary
slightly from the SET temperature based on usage and
operating environment.
The temperature controls are preset in the factory at “5”
for the refrigerator compartment and “5” for the freezer
compartment. Allow 24 hours for the temperature to
stabilize to the preset recommended settings.
NOTE: Display settings are “1” warmest, “9” coldest, and
“0” off.
Locking the Dispenser
Press the Lock Controls pad for 3 seconds to lock
the dispenser and control panel. To unlock, press
and hold the key pads again for 3 seconds.
Dispenser Light
This pad turns the light in the dispenser on and
off. The light also comes on when the dispenser
cradle is pressed. If this light burns out, it should be
replaced with a 6 watt maximum, 12 volt DC bulb.
Using the Dispenser (on some models)
Select
or
Press the glass gently against the top of the dispenser
cradle.
6
Water Filter Replacement Indicator
The light on this button will illuminate when the water filter
needs to be changed. After the filter has been changed,
press and hold for 3 seconds to turn the light off. For more
details, see “About the Water Filter Catridge” section.
About the ice and water dispenser. (On some models.)
GEAppliances.com
To Use the Dispenser
Spill
Shelf
The spill shelf is not self-draining. To reduce water
spotting, the shelf and its grille should be cleaned
regularly.
If no water is dispensed when the refrigerator
is first installed, there may be air in the water
line system. Press the dispenser arm for at
least two minutes to remove trapped air from
the water line and to fill the water system. To
flush out impurities in the water line, throw
away the first six glassfuls of water.
CAUTION
Never put fingers or any
other objects into the ice crusher discharge
opening.
Ice Storage Drawer on Dispenser Models
To remove:
Slide the icemaker power switch to the OFF position.
Pull the drawer straight out and then lift past the stop
position.
To replace:
When replacing the drawer, make sure to push it firmly
into place. If it does not go all the way back, remove it
and rotate the drive mechanism 1/4 turn. Then push
the drawer back again.
Rotate
Drive
Mechanism
Important Facts About Your Dispenser
„ Do not add ice from trays or bags to the storage bin. It may
not crush or dispense well.
„ Avoid overfilling glass with ice and use of narrow glasses.
Backed-up ice can jam the chute or cause the door in the
chute to freeze shut. If ice is blocking the chute, poke it
through with a wooden spoon.
„ Beverages and foods should not be quick-chilled in the ice
storage bin. Cans, bottles or food packages in the storage bin
may cause the icemaker or auger to jam.
„ To keep dispensed ice from missing the glass, put the glass
close to, but not touching, the dispenser opening.
„ Some crushed ice may be dispensed even though you
selected Cubed. This happens occasionally when a few cubes
have been left in the crusher.
„ After crushed ice is dispensed, some water may drip from the
chute.
„ Sometimes a small mound of snow will form on the door in
the ice chute. This condition is normal and usually occurs
when you have dispensed crushed ice repeatedly. The snow
will eventually evaporate.
„ The first glass of water dispensed may be warmer than the
following ones. This is normal.
„ Dispensed water is not ice cold. For colder water, simply add
crushed ice or cubes before dispensing water.
7
About the automatic icemaker.
A newly-installed refrigerator may take 12–24 hours to begin making ice.
Icemaker
Power Switch
8
Feeler Arm
Automatic Icemaker (on some models)
When the refrigerator has been connected to
the water supply, slide the power switch to the
ON position.
The icemaker will fill with water when it cools
to 15°F. When the bin fills to the level of the
feeler arm, the icemaker will stop producing
ice.
Be sure nothing interferes with the sweep of
the feeler arm.
Throw away the first few batches of ice to
allow the water line to clear.
The icemaker will produce seven cubes
SHUF\FOH³DSSUR[LPDWHO\²
cubes in a 24-hour period, depending on
freezer compartment temperature, room
temperature, number of door openings and
other use conditions.
You will hear a buzzing sound each time the
icemaker fills with water.
It is normal for several cubes to be joined
together.
If ice is not used frequently, old ice cubes will
become cloudy, taste stale, and shrink.
CAUTION
Avoid contact with the
moving parts of the ejector mechanism, or
with the heating element (located on the
bottom of the ice maker) that releases the
cubes. Do not place fingers or hands on the
automatic ice making mechanism while the
refrigerator is plugged in.
Icemaker Accessory Kit
If your refrigerator did not come already
equipped with an automatic icemaker, an
icemaker accessory kit is available at extra
cost. Check the back of the refrigerator for the
specific icemaker kit needed for your model.
About the water filter cartridge. (On some models.)
Water filter cartridge
The water filter cartridge is located in the back upper right corner of
the refrigerator compartment.
When to replace the filter on models
with a replacement indicator light
There is a replacement indicator light for the water filter cartridge
on the dispenser. This light will turn orange to
tell you that you need to replace the filter soon.
The filter cartridge should be replaced when the replacement
indicator light turns red or if the flow of water to the dispenser or
icemaker decreases.
GEAppliances.com
Installing the filter cartridge
1 Fill the replacement cartridge with water from the tap
to allow for better flow from the dispenser immediately
after installation.
2 Line up the arrow on the cartridge and the cartridge holder. Place
the top of the new cartridge up inside the holder.
Do not push it up into the holder.
3 Slowly turn it to the right until the filter
cartridge stops. DO NOT OVERTIGHTEN.
As you turn the cartridge, it will
automatically raise itself into position.
The cartridge will move about a ½ turn.
Cartridge
ridge
Holder
older
4 Run water from the dispenser for 1-1/2 gallons (about three
When to replace the filter on models
without a replacement indicator light
The filter cartridge should be replaced every six months
or earlier if the flow of water to the dispenser or
icemaker decreases.
Removing the filter cartridge
If you are replacing the cartridge, first remove the old one
by slowly turning it to the left. Do not pull down on the cartridge. A
small amount of water may drip down.
CAUTION: To reduce the risk associated with property damage due
to water leakage, read and follow instructions before installation
and use of this system. Installation and use MUST comply with all
state and local plumbing codes.
minutes) to clear the system and prevent sputtering.
5 Press and hold the RESET WATER FILTER pad (on some models) on
the dispenser for three seconds.
NOTE: A newly installed water filter cartridge may cause water
to spurt from the dispenser.
Filter bypass plug
You must use the filter bypass plug when a replacement filter
cartridge is not available. The dispenser and the icemaker will not
operate without the filter or filter bypass plug.
Filter Bypass
Plug
SmartWater
Filter Bypass
Plug
ter
ss
Water by Culligan
ug
To use the filter bypass plug on Water by Culligan™ models,
you must first remove the filter adaptor from the cartridge holder by
turning it to the left.
WARNING
WARNING
To reduce the risk associated with choking, do not allow children under 3 years of age to have access to small parts
during the installation of this product. The disposable filter cartridge should be replaced every
6 months at the rated capacity, or sooner if a noticeable reduction in flow rate occurs.
For the maximum benefit of your filtration system, GE recommends the use of GE-branded filters only. Using
GE-branded filters in GE and Hotpoint® refrigerators provides optimal performance and reliability. GE filters
meet rigorous industry NSF standards for safety and quality that are important for products that are filtering your water. GE has not
qualified non-GE-branded filters for use in GE and Hotpoint refrigerators and there is no assurance
that non-GE-branded filters meet GE's standards for quality, performance and reliability.
If you have questions, or to order additional filter cartridges, visit our website at www.gewaterfilters.com
or call GE Parts and Accessories, 800.626.2002.
Customers in Canada should consult the yellow pages for the nearest Camco Service Center.
9
Care and cleaning of the refrigerator.
Cleaning the Outside
The dispenser drip area, (on some models)
beneath the grille, should be wiped dry. Water
left in this area may leave deposits. Remove
the deposits by adding undiluted vinegar to
the well. Soak until the deposits disappear or
become loose enough to rinse away.
The dispenser cradle (on some models). Before
cleaning, lock the dispenser by pressing and
holding the Lock pad for 3 seconds. Clean with
ZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³DERXW
a tablespoon (15 ml) of baking soda to a quart
(1 l) of water. Rinse thoroughly and wipe dry.
The door handles and trim. Clean with a cloth
dampened with soapy water. Dry with a soft
cloth.
Keep the outside clean. Wipe with a clean
cloth lightly dampened with kitchen appliance
wax or mild liquid dish detergent. Dry and
polish with a clean, soft cloth.
The stainless steel doors and door handles
(on some models) can be cleaned with a
commercially available stainless steel cleaner.
Cleaners with oxalic acid such as Bar Keepers
Friend Soft Cleanser™ will remove surface rust,
tarnish and small blemishes. Use only a liquid
cleanser free of grit and rub in the direction
of the brush lines with a damp soft sponge.
Do not use appliance wax or polish on the
stainless steel.
Do not wipe the refrigerator with a soiled dish
cloth or wet towel. These may leave a residue
that can erode the paint. Do not use scouring
pads, powdered cleaners, bleach or cleaners
containing bleach because these products can
scratch and weaken the paint finish.
Cleaning the Inside
To help prevent odors, leave an open box of
baking soda in the refrigerator and freezer
compartments.
Unplug the refrigerator before cleaning. If this
is not practical, wring excess moisture out of
sponge or cloth when cleaning around switches,
lights or controls.
8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³
about a tablespoon (15 ml) of baking soda
to a quart (1 l) of water. This both cleans and
neutralizes odors. Rinse and wipe dry.
After cleaning the door gaskets, apply a thin
layer of petroleum jelly to the door gaskets at
the hinge side. This helps keep the gaskets from
sticking and bending out of shape.
Drain opening in freezer compartment. During
yearly cleaning, remove bottom freezer pan and
IOXVKDVROXWLRQRIEDNLQJVRGD³WHDVSRRQ
10
(5 ml) and 2 cups (500 ml) of hot (not boiling)
ZDWHU³WKURXJKWKHGUDLQOLQHZLWKWKHKHOSRI
a meat baster. This will help eliminate odor and
reduce the likelihood of a clogged drain line. If
drain becomes clogged, use a meat baster and
baking soda solution to force the clog through
the drain line.
CAUTION
Do not clean glass shelves
or covers with warm water when they are
cold. Glass shelves and covers may break
if exposed to sudden temperature changes
or impact such as bumping or dropping.
Tempered glass is designed to shatter into
many small pieces if it breaks.
Do not wash any plastic refrigerator parts in
the dishwasher.
GEAppliances.com
Behind the Refrigerator
Be careful when moving the refrigerator away from the wall. All
types of floor coverings can be damaged, particularly cushioned
coverings and those with embossed surfaces.
Pull the refrigerator straight out and return it to position by
pushing it straight in. Moving the refrigerator in a side direction
may result in damage to the floor covering or refrigerator.
When pushing the refrigerator back, make sure you don’t
roll over the power cord or icemaker supply line (on some
models).
Preparing for Vacation
For long vacations or absences, remove food and unplug the
refrigerator. Clean the interior with a baking soda solution of
one tablespoon (15 ml) of baking soda to one quart (1 l) of water.
Leave the doors open.
Slide the icemaker power switch to the OFF position and shut
off the water supply to the refrigerator.
Preparing to Move
Secure all loose items such as grille, shelves and drawers by
taping them securely in place to prevent damage.
Be sure the refrigerator stays in an upright position during
moving.
Replacing the Light Bulbs
WARNING Before replacing a burned-out light bulb, the refrigerator should be unplugged in order to avoid contact with a
live wire filament. (A burned-out light bulb may break when being replaced.)
Turning the control to the OFF position does not remove power to the light circuit.
Unplug the refrigerator.
Remove the shelf just below the light shield.
Replace with an appliance bulb of the same or lower
wattage.
Reinstall the shelf and plug the refrigerator back in.
11
Installation Instructions
Models 20, 22, 25
Questions? Call 800.GE.CARES (800.432.2737) or Visit our Website at: GEAppliances.com
Questions? In Canada, call 1.800.561.3344 or Visit our Website at: geappliances.ca
BEFORE YOU BEGIN
WATER SUPPLY TO THE ICEMAKER (on
some models)
Read these instructions completely and carefully.
•
Save these instructions for
local inspector’s use.
IMPORTANT –
• IMPORTANT – Observe all governing
If the refrigerator has an icemaker, it will have to be
connected to a cold water line. A GE Appliances water
supply kit is available at extra cost from your dealer, by
visiting our Website at GEAppliances.com (in Canada, at
GEAppliances.ca), or from Parts and Accessories,
877.959.8688.
codes and ordinances.
•
Note to Installer – Be sure to leave these
•
Note to Consumer – Keep these instructions
instructions with the Consumer.
for future reference.
• Skill level – Installation of this appliance requires
basic mechanical skills.
• Completion time – Refrigerator Installation
15 minutes
• Proper installation is the responsibility of installer.
• Product failure due to improper installation is not
covered under the Warranty.
CLEARANCES
Allow the following clearances for ease of installation,
proper air circulation and plumbing and electrical
connections.
REFRIGERATOR LOCATION
• Sides 1/8Ý (4 mm) • Top 1Ý (25 mm) • Back 1Ý (25 mm)
A door clearance of 3/4Ý (19 mm) is needed for a 90º door
opening which provides better access to food storage area.
• Do not install the refrigerator where the temperature will
go below 60°F (16°C) because it will not run often enough
to maintain proper temperatures.
• Do not install the refrigerator where the temperature will
go above 100°F (37°C) because it will not perform properly.
• Do not install the refrigerator in a location exposed to water
(rain, etc.) or direct sunlight.
• Install it on a floor strong enough to support it fully loaded.
DOOR ALIGNMENT
After leveling, make sure that doors are even at the top.
To make the doors even, adjust the refrigerator door.
8VLQJDÝVRFNHWZUHQFKWXUQWKHGRRUDGMXVWLQJ
screw to the right to raise the door, to the left to lower
it. (A nylon plug, embedded in the threads of the pin,
prevents the pin from turning unless a wrench is used.)
After one or two turns of the wrench, open and close the
refrigerator compartment door and check the alignment
at the top of the doors.
ROLLERS
The rollers have 3 purposes:
„ Rollers adjust so the door closes easily when opened
about halfway.
„ Rollers adjust so the refrigerator is firmly positioned on
the floor and does not wobble.
„ Rollers allow you to move the refrigerator away from the
wall for cleaning.
To adjust the rollers, remove the
base grille by pulling it out at the
bottom.
Turn the roller adjusting
screws clockwise to raise the
refrigerator, counterclockwise
to lower it. Use an adjustable
wrench (3/8ļ hex head bolt) or
pliers.
To replace base grille, line up the
clips on back of grille between
the bar and the bottom of the
cabinet. Push forward until grille
snaps into place.
Ý6RFNHW
Wrench
To remove the
base grille, open
the doors and
then pull the
grille straight out.
12
Raise
Installation Instructions
INSTALLING THE WATER LINE
BEFORE YOU BEGIN
WHAT YOU WILL NEED (CONT.)
Recommended copper water supply kits are WX8X2,
WX8X3 or WX8X4, depending on the amount of tubing
you need. Approved plastic water supply lines are GE
SmartConnect™ Refrigerator Tubing (WX08X10002,
WX08X10006, WX08X10015 and WX08X10025).
When connecting your refrigerator to a GE Appliances
Reverse Osmosis Water System, the only approved
installation is with a GE Appliances RVKit. For other
reverse osmosis water systems, follow the manufacturer’s
recommendations.
If the water supply to the refrigerator is from a Reverse
Osmosis Water Filtration System AND the refrigerator
also has a water filter, use the refrigerator’s filter bypass
plug. Using the refrigerator’s water filtration cartridge in
conjunction with the RO filter can result in hollow ice cubes
and slower water flow from the water dispenser.
This water line installation is not warranted by the
refrigerator or icemaker manufacturer. Follow these
instructions carefully to minimize the risk of expensive
water damage.
Water hammer (water banging in the pipes) in house
plumbing can cause damage to refrigerator parts and
lead to water leakage or flooding. Call a qualified plumber
to correct water hammer before installing
the water supply line to the refrigerator.
To prevent burns and product damage, do not hook
up the water line to the hot water line.
If you use your refrigerator before connecting the water
line, make sure the icemaker power switch is in the OFF
position.
Do not install the icemaker tubing in areas where
temperatures fall below freezing.
All installations must be in accordance with local plumbing
code requirements.
NOTE: The only GE Appliances approved plastic tubing
is that supplied in GE SmartConnect™ Refrigerator
Tubing kits. Do not use any other plastic water supply
line because the line is under pressure at all times.
Certain types of plastic will crack or rupture with age
and cause water damage to your home.
• A GE Appliances water supply kit (containing tubing,
shutoff valve and fittings listed below) is available
at extra cost from your dealer or from Parts and
Accessories, 877.959.8688.
• A cold water supply. The water pressure must be
between 20 and 120 p.s.i. (1.4–8.2 bar) on models
without a water filter and between 40 and 120 p.s.i.
(2.8–8.2 bar) on models with a water filter.
• Power drill.
• 1/2Ý or adjustable wrench.
• Straight and Phillips blade screwdriver.
• Two 1/4Ý outer diameter compression nuts and
2 ferrules (sleeves)³WRFRQQHFWWKHFRSSHUWXELQJ
to the shutoff valve and the refrigerator water valve.
OR
• If you are using a GE SmartConnect™ Refrigerator
Tubing kit, the necessary fittings are preassembled to
the tubing.
WARNING Connect to potable water supply only.
• If your existing copper water line has a flared fitting
at the end, you will need an adapter (available at
plumbing supply stores) to connect the water line to
the refrigerator OR you can cut off the flared fitting
with a tube cutter and then use a compression fitting.
Do not cut formed end from GE SmartConnect™
Refrigerator tubing.
WHAT YOU WILL NEED
• Copper or GE SmartConnect™ Refrigerator Tubing kit,
1/4Ý outer diameter to connect the refrigerator to the
water supply. If using copper, be sure both ends of the
tubing are cut square.
To determine how much tubing you need: measure
the distance from the water valve on the back of the
refrigerator to the water supply pipe. Be sure there is
sufficient extra tubing to allow the refrigerator to move
out from the wall after installation.
GE SmartConnect™ Refrigerator Tubing Kits are available
in the following lengths:
2’ (0.6 m)
– WX08X10002
8’ (2.4 m)
– WX08X10006
15’ (4.6 m)
– WX08X10015
25’ (7.6 m)
– WX08X10025
• Shutoff valve to connect to the cold water line.
The shutoff valve should have a water inlet with a
minimum inside diameter of 5/32Ý at the point of
connection to the COLD WATER LINE. Saddle-type
shutoff valves are included in many water supply kits.
Before purchasing, make sure a saddle-type valve
complies with your local plumbing codes. Install the
shutoff valve on the nearest frequently used drinking
water line.
13
Installation Instructions
1 SHUT OFF MAIN WATER SUPPLY
5 CONNECT THE TUBING TO THE VALVE
2 DRILL THE HOLE FOR THE VALVE
Place the compression nut and ferrule (sleeve) for
copper tubing onto the end of the tubing and connect
it to the shutoff valve.
Make sure the tubing is fully inserted into the valve.
Tighten the compression nut securely.
For plastic tubing from a GE SmartConnect™
Refrigerator Tubing kit, insert the molded end
of the tubing into the shutoff valve and tighten
compression nut until it is hand tight, then tighten one
additional turn with a wrench. Overtightening may
cause leaks.
Choose a location for the valve that is easily
accessible. It is best to connect into the side of a
vertical water pipe. When it is necessary to connect
into a horizontal water pipe, make the connection to
the top or side, rather than at the bottom, to avoid
drawing off any sediment from the water pipe.
'ULOODÝKROHLQWKHZDWHUSLSH HYHQLIXVLQJDVHOI
piercing valve) using a sharp bit. Remove any burrs
resulting from drilling the hole in the pipe. Take care
not to allow water to drain into the drill. Failure to
GULOODÝKROHPD\UHVXOWLQUHGXFHGLFHSURGXFWLRQ
or smaller cubes.
Saddle-Type
Shutoff Valve
Compression
Nut
SmartConnect™
Tubing
Packing Nut
Outlet Valve
Ferrule (sleeve)
NOTE: Commonwealth of Massachusetts Plumbing
Codes 248CMR shall be adhered to. Saddle valves
are illegal and use is not permitted in Massachusetts.
Consult with your licensed plumber.
3 FASTEN THE SHUTOFF VALVE
Fasten the shutoff valve to the cold water pipe with
the pipe clamp.
Tighten the clamp screws until the sealing washer
begins to swell.
NOTE: Do not overtighten or you may crush the
tubing.
6 FLUSH OUT THE TUBING
Turn the main water supply on and flush out the
tubing until the water is clear.
Washer
Pipe Clamp
Inlet End
Clamp
Screw
Saddle-Type
Shutoff Valve
Vertical Cold
Water Pipe
7 CONNECT THE TUBING TO THE
NOTE: Commonwealth of Massachusetts Plumbing
Codes 248CMR shall be adhered to. Saddle valves
are illegal and use is not permitted in Massachusetts.
Consult with your licensed plumber.
REFRIGERATOR
NOTES:
• Before making the connection to the refrigerator,
be sure the refrigerator power cord is not plugged
into the wall outlet.
• If your refrigerator does not have a water filter, we
recommend installing one if your water supply has
sand or particles that could clog the screen of the
refrigerator’s water valve. Install it in the water line
near the refrigerator. If using a GE SmartConnect™
Refrigerator Tubing kit, you will need an additional
tube (WX08X10002) to connect the filter. Do not cut
plastic tube to install filter.
4 ROUTE THE TUBING
Route the tubing between the cold water line and the
refrigerator.
Route the tubing through a hole drilled in the wall
or floor (behind the refrigerator or adjacent base
cabinet) as close to the wall as possible.
NOTE: Be sure there is sufficient extra tubing to
allow the refrigerator to move out from the wall after
installation.
14
Installation Instructions
7 CONNECT THE TUBING TO THE
REFRIGERATOR (CONT.)
7 CONNECT THE TUBING TO THE
REFRIGERATOR (CONT.)
Some models have the refrigerator connection at
the end of tubing located outside the compressor
compartment access cover. On other models,
the compressor compartment access cover must
be removed in order to access the refrigerator
connection at the water valve.
Tubing
Clamp
Ý
Compression
Ý
Nut
Tubing
Ferrule
(sleeve)
Refrigerator
Connection
On models using the refrigeration connection at the
water valve, remove the plastic flexible cap.
SmartConnect™
Tubing
8 TURN THE WATER ON AT THE
SHUTOFF VALVE
Tighten any connections that leak.
Place the compression nut and ferrule (sleeve)
onto the end of the tubing as shown. On a GE
SmartConnect™ Refrigerator Tubing kit, the nuts
are already assembled to the tubing.
Insert the end of the tubing into the refrigerator
connection as far as possible. While holding the
tubing, tighten the fitting.
For plastic tubing from a GE SmartConnect™
Refrigerator Tubing kit, insert the molded end of the
tubing into the refrigerator connection and tighten
the compression nut until it is hand tight, then tighten
one additional turn with a wrench. Overtightening
may cause leaks.
Fasten the tubing into the clamp provided as shown
to keep it in position. You may need to pry open the
clamp.
One of the illustrations below will look like the
connection on your refrigerator.
Tubing
Clamp
Reattach the access cover.
9 PLUG IN THE REFRIGERATOR
Arrange the coil of tubing so that it does not vibrate
against the back of the refrigerator or against the
wall. Push the refrigerator back to the wall.
10
1/4ļ
Tubing
.
Ý
Compression
Nut
Ferrule
(sleeve)
Refrigerator
Connection
START THE ICEMAKER
Slide the icemaker power switch to the ON position.
The icemaker will not begin to operate until it reaches
its operating temperature of 15°F (-9°C) or below.
It will then begin operation automatically if the
icemaker power switch is in the ON position.
SmartConnect™
Tubing
15
Normal operating sounds.
Newer refrigerators sound different from older refrigerators. Modern refrigerators have more features and
use newer technology.
Do you hear what I hear? These sounds are normal.
HUMMM...
WHOOSH...
„The new high efficiency compressor may run faster
and longer than your old refrigerator and you may
hear a high-pitched hum or pulsating sound while
it is operating.
„Sometimes the refrigerator runs for an extended period,
especially when the doors are opened frequently. This
means that the Frost Guard™ feature is working to
prevent freezer burn and improve food preservation.
„You may hear a whooshing sound when the doors close.
This is due to pressure equalizing within the refrigerator.
„You may hear the fans spinning at high speeds.
This happens when the refrigerator is first plugged in, when
the doors are opened frequently or when
a large amount of food is added to the refrigerator or
freezer compartments. The fans are helping to maintain the
correct temperatures.
„If either door is open for over 3 minutes, you may hear the
fans come on in order to cool the light bulbs.
„The fans change speeds in order to provide optimal cooling
and energy savings.
CLICKS, POPS,
CRACKS and CHIRPS
WATER SOUNDS
„You may hear cracking or popping sounds when the
refrigerator is first plugged in. This happens as the
refrigerator cools to the correct temperature.
„Electronic dampers click open and closed to provide
optimal cooling and energy savings.
„The compressor may cause a clicking or chirping
sound when attempting to restart (this could take
up to 5 minutes).
„The electronic control board may cause a clicking
sound when relays activate to control refrigerator
components.
„Expansion and contraction of cooling coils during and
after defrost can cause a cracking or popping sound.
„On models with an icemaker, after an icemaking cycle,
you may hear the ice cubes dropping into
the ice bucket.
„The flow of refrigerant through the freezer cooling coils
may make a gurgling noise like boiling water.
„Water dropping on the defrost heater can cause a sizzling,
popping or buzzing sound during the defrost cycle.
„A water dripping noise may occur during the defrost cycle
as ice melts from the evaporator and flows into the drain
pan.
„Closing the door may cause a gurgling sound due to
pressure equalization.
Before you call for service…
Troubleshooting Tips
Save time and money! Review the charts on the following
pages first and you may not need to call for service.
Problem
Refrigerator does not operate
Refrigerator or freezer
compartment too warm
16
Possible Causes
Refrigerator in defrost cycle.
Freezer control in 0 (off) position.
Refrigerator is unplugged.
The fuse is blown/circuit breaker
is tripped.
Energy Smart™ feature is altering
refrigerator performance
Temperature control not set cold
enough.
Warm weather or frequent door
openings.
Door left open.
Energy Smart™ feature is altering
refrigerator performance
What To Do
Wait about 30 minutes for defrost cycle to end.
Move the freezer control to a lower temperature setting.
Push the plug completely into the outlet.
Replace fuse or reset the breaker.
Wait about 2 hours for normal operation to continue.
See About the controls.
Set the temperature control one step colder. See About
the controls.
Check to see if package is holding door open.
See About Energy Smart™ Models.
GEAppliances.com
Problem
Possible Causes
What To Do
Vibration or rattling
Motor operates for long
periods or cycles on and
off frequently. (Modern
refrigerators with more
storage space and a
larger freezer require more
operating time. They start and
stop often to maintain even
temperatures.)
Front rollers need adjusting.
Normal when refrigerator is first
plugged in.
Often occurs when large amounts
of food are placed in refrigerator.
Door left open.
Hot weather or frequent door
openings.
Temperature controls set at the
coldest setting.
Door left open.
Too frequent or too long door
openings.
Automatic energy saver system
circulates warm liquid around front
edge of freezer compartment.
Icemaker power switch is in the
OFF position.
Water supply turned off or not
connected.
Freezer compartment too warm.
See Rollers. Slight vibration is normal.
Wait 24 hours for the refrigerator to completely cool
down.
This is normal.
Frost or ice crystals on frozen
food (frost within package is
normal)
Divider between refrigerator
and freezer compartments
feels warm
Automatic icemaker does not
work (on some models)
Piled up cubes in the storage bin
cause icemaker to shut off.
Ice cubes stuck in icemaker.
Ice cubes have odor/taste
Ice storage bin needs cleaning.
Food transmitting odor/taste to ice
cubes.
Interior of refrigerator needs
cleaning.
Small or hollow cubes
Water filter clogged.
Slow ice cube freezing
Door left open.
Temperature control not set cold
enough.
Energy Smart™ feature is .altering
refrigerator performance
Door not closing properly
Door gasket on hinge side sticking
or folding over.
Orange glow in freezer
Defrost heater is on.
Cube dispenser does not work Icemaker or water supply turned
(on some models)
off.
Ice cubes are frozen to icemaker
feeler arm.
Irregular ice clumps in storage
container.
Dispenser is LOCKED.
Check to see if package is holding door open.
This is normal.
See About the controls.
Check to see if package is holding door open.
This helps prevent condensation on the outside.
Slide the power switch to the ON position.
See Installing the water line.
Wait 24 hours for the refrigerator to completely cool
down.
Level cubes by hand.
Turn off the icemaker, remove cubes and turn the
icemaker back on.
Empty and wash bin. Discard old cubes.
Wrap foods well.
See Care and cleaning.
Replace filter cartridge with new cartridge or with plug.
Check to see if package is holding door open.
See About the controls.
See About Energy Smart™ Models
Apply petroleum jelly on face of gasket
This is normal.
Turn on icemaker or water supply.
Remove cubes.
Break up with fingertip pressure and discard remaining
clumps.
Freezer may be too warm. Adjust the freezer control to a
colder setting, one position at a time, until clumps do not
form.
Press and hold the Lock pad for 3 seconds.
17
Before you call for service…
Problem
Possible Causes
What To Do
Water has poor tas te/odor
(on some models)
Water dispenser has not been used
for a long time.
Dispense water until all water in system is replenished.
Water in first glass is warm
(on some models)
Normal when refrigerator
Wait 24 hours for the refrigerator to completely cool
down.
Water dispenser has not been used
for a long time.
Dispense water until all water in system is replenished.
Water system has been drained.
Allow several hours for replenished supply to chill.
Water supply line turned off or
not connected.
See Installing the water line.
Water filter clogged.
Replace filter cartridge or remove filter and install plug.
Air may be trapped in the water
system.
Press the dispenser arm for at least two minutes.
Dispenser is LOCKED.
Press and hold the Lock pad for 3 seconds.
Water spurting from
dispenser
Newly-installed filter cartridge.
Run water from the dispenser for 3 minutes (about 11/2
gallons).
Water is not dispensed
Water in reservoir is frozen.
Call for service.
No water or ice cube
production
Supply line or shutoff valve is
clogged.
Call a plumber.
Water filter clogged.
Replace filter cartridge or remove filter and install plug.
Dispenser is LOCKED.
Press and hold the Lock pad for 3 seconds.
Foods transmitting odor to
refrigerator.
Foods with strong odors should be tightly wrapped.
Water dispenser does not
work (on some models)
Refrigerator has odor
Keep an open box of baking soda in the refrigerator;
replace every three months.
Interior needs cleaning.
See Care and cleaning.
Defrost water drainage system
needs cleaning.
See Care and cleaning.
Moisture forms on outside
of refrigerator
Not unusual during periods of high
humidity.
Wipe surface dry.
Moisture collects inside
Too frequent or too long door
openings.
Interior light does not work
No power at outlet.
Replace fuse or reset the breaker.
Light bulb burned out.
See Replacing the light bulbs.
Drain in the bottom of the freezer
clogged.
See Care and cleaning.
Cubes jammed in chute.
Poke ice through with a wooden spoon.
Water on kitchen floor or on
bottom of freezer
Hot air from bottom of
refrigerator
Normal air flow cooling motor.
In the refrigeration process, it is
normal that heat be expelled in the
area under the refrigerator. Some
floor coverings are sensitive and
will discolor at these normal and
safe temperatures.
Cubed Ice was selected but
Crushed Ice was dispensed
(on some models)
Last setting was Crushed Ice.
A few cubes were left in the crusher from the previous
setting. This is normal.
Frequent “buzzing” sound
Icemaker power switch is in the
Slide the power switch to the OFF position. Keeping it in
the ON position will damage the water valve.
18
Performance Data Sheet
SmartWater™ Filtration System³MWF Cartridge
Performance Data Information
Capacity: 300 Gallons (1,135 Liters)
7KHFRQFHQWUDWLRQRIWKHFRQWDPLQDQWVWHVWHGIRUWKLV¿OWHULQZDWHUHQWHULQJWKHV\VWHPZDVUHGXFHGWR
DFRQFHQWUDWLRQOHVVWKDQRUHTXDOWRWKHSHUPLVVLEOHOLPLWIRUZDWHUOHDYLQJWKHV\VWHPDVVSHFL¿HGLQ
16)$16,6WDQGDUGDQG6WDQGDUG6\VWHPWHVWHGDQGFHUWL¿HGE\16),QWHUQDWLRQDODJDLQVW16)
ANSI Standard 42 and Standard 53.
Please see geappliances.com for complete listing of the contaminants tested and the amounts reduced
The following pharmaceutical reduction claims have not been certi¿ed by NSF International or the state of California.
Claims tested and veri¿ed by independent laboratory:
Contaminant
Reduction
Atenolol
Fluoxetine
Ibuprofen
Progesterone
Trimethoprim
AvHUDJH,Q¾XHQW
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
16)VSHFL½HG
Challenge Concentration
N/A
N/A
N/A
N/A
N/A
Avg %
Reduction
99.5%
99.4%
94.1%
99.5%
99.5%
Average Product
Water
Concentration
5.0 ng/L
5.4 ng/L
52.3 ng/L
5.0 ng/L
2.0 ng/L
Max Permissible
Product Water NSF Reduction
Concentration Requirements
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
NSF
Test Report
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Application Guidelines/Water Supply Parameters
Service Flow
Water Supply
0.5 gpm (21.9 lpm)
Potable Water
Water Pressure
Water Temperature
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
It is essential that the manufacturer’s recommended installation, maintenance and filter replacement requirements be carried out for the product to perform as advertised.
See Installation Manual for Warranty information.
Note: While the testing was performed under standard laboratory conditions,
actual performance may vary.
Replacement Cartridge: MWF. For estimated costs of replacement elements
please call 1-800-626-2002 or visit our website at www.geapplianceparts.com.
WARNING
To reduce the risk associated with ingestion of contaminants:
• Do not use with water that is microbiologically unsafe or of unknown quality
without adequate disinfection before and after the system. Systems certL¿ed
for cyst reduction may be used on disinfected water that may contain ¿lterable
cysts. EPA Establishment Number 10350-MN-005.
For conditions of use, health claims certified by the California Department of Public
Health, and replacements, see performance data sheet. California Department
of Public Health Certification #05-1698. The contaminants or other substances
removed or reduced by this water filter are not necessarily in all users’ water.
REPLACEMENT
ELEMENT
NOTICE
To reduce the risk associated with property damage due to water leakage:
• Read and follow use instructions before installation and use of this system.
• Installation and use MUST comply with all state and local plumbing codes.
• Do not install if water pressure exceeds 120 psi (8.2 bar). If your water pressure
exceeds 80 psi, you must install a pressure-limiting valve. Contact a plumbing
professional if you are uncertain how to check your water pressure.
• Do not install where water hammer conditions may occur. If water hammer
conditions exist you must install a water hammer arrester. Contact a plumbing
professional if you are uncertain how to check for this condition.
• Do not install on hot water supply lines. The maximum operating water
temperature of this ¿lter system is 100º F (38º C).
• Protect ¿lter from freezing. Drain ¿lter when temperatures drop
below 33ºF (0.6ºC).
•
must be replaced every 6 months at the
rated capacity, or sooner if a noticeable reduction in ÀRw rate occurs.
Tested and cerWL½ed by NSF International
against NSF/ANSI Standard 42 and
Standard 53 in model MWF for the
reduction of the claims speci½Hd on the
performance data sheet.
19
Refrigerator Warranty.
For US Customers, all warranty service provided by our Factory Service
Centers, or an authorized Customer Care® technician. To schedule
service, on-line, 24 hours a day, visit us at GEAppliances.com, or call
800.GE.CARES (800.432.2737). Please have serial number and model
number available when calling for service.
In Canada, call 800.561.3344 or visit GEAppliances.ca.
Staple your receipt here.
Proof of the original
purchase date is needed
to obtain service under the
warranty.
For The Period Of: GE Appliances Will Replace:
GE and GE PROFILE MODELS:
One Year
From the date of the
original purchase
Any part of the refrigerator which fails due to a defect in materials or workmanship.
During this limited one-year warranty, GE Appliances will also provide, free of charge, all labor and
related service to replace the defective part.
Thirty Days
(Water filter, if included)
From the original
purchase date of
the refrigerator
Any part of the water filter cartridge which fails due to a defect in materials or workmanship.
During this limited thirty-day warranty, GE Appliances will also provide, free of charge, a replacement
water filter cartridge.
GE PROFILE MODELS ONLY:
Five Years
(GE Profile models only)
From the date of the
original purchase
Any part of the sealed refrigerating system (the compressor, condenser, evaporator and all
connecting tubing) which fails due to a defect in materials or workmanship. During this limited
five-year sealed refrigerating system warranty, GE Appliances will also provide, free of charge,
all labor and related service to replace the defective part in the sealed refrigerating system.
What GE Appliances Will Not Cover:
„ Service trips to your home to teach you how to use
the product.
„ Improper installation, delivery or maintenance.
„ Failure of the product if it is abused, misused, or used for
other than the intended purpose or used commercially.
„ Loss of food due to spoilage.
„ Replacement of house fuses or resetting of circuit breakers.
„ Damage caused after delivery.
„ Replacement of the water filter cartridge, if included, due
to water pressure that is outside the specified operating
range or due to excessive sediment in the water supply.
„ Replacement of the light bulbs, if included, or water filter
cartridge, if included, other than as noted above.
„ Damage to the product caused by accident, fire, floods
or acts of God.
„ Incidental or consequential damage caused by possible
defects with this appliance.
„ Product not accessible to provide required service.
„ Damage caused by a non-GE Appliances brand water filter.
■ Damage to finish, such as surface rust, tarnish, or small blemishes
not reported within 48 hours of delivery.
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG
Warranty. Any implied warranties, including the implied warranties of merchantability or fitness for a particular purpose,
are limited to one year or the shortest period allowed by law.
For US Customers: This warranty is extended to the original purchaser and any succeeding owner for products purchased
for home use within the USA. If the product is located in an area where service by a GE Appliances Authorized Servicer is
not available, you may be responsible for a trip charge or you may be required to bring the product to an Authorized GE
Appliances Service location for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives you specific
legal rights, and you may also have other rights which vary from state to state. To know what your legal rights are, consult
your local or state consumer affairs office or your state’s Attorney General.
Warrantor US: General Electric Company. Louisville, KY 40225
For Customers in Canada: This warranty is extended to the original purchaser and any succeeding owner for products
purchased in Canada for home use within Canada. In-home warrant service will be provided in areas where it is available
and deemed reasonable by Mabe to provide.
Warrantor Canada: MC Commercial, Burlington, Ontario, L7R 5B6
20
Réfrigérateurs
Cote à Cote
MESURES DE SÉCURITÉ
Comment vous débarrasser
convenablement de votre
ancien réfrigérateur . . . . . . . .
Cordons prolongateurs . . . . .
Mesures de sécurité . . . . . . . .
Raccordement électrique . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.3
.2
.2
.3
MANUEL
D’UTILISATION
ET D’INSTALLATION
Modèles 20, 22, 25
FONCTIONNEMENT
Bacs à légumes . . . . . . . . . . . . . . . . . . . .5
Cartouche du filtre à eau . . . . . . . . . . .8
Clayettes et bacs . . . . . . . . . . . . . . . . . 4
Installation des accessoires . . . . . . . . 4
Le distributeur d’eau et de glaçons . .7
Les commandes . . . . . . . . . . . . . . . . . . .6
Machine à glaçons automatique . . . 7-8
FRANÇAISE
ENTRETIEN ET NETTOYAGE
NETTOYAGE . . . . . . . . . . . . . . . . . . . .9
Remplacement des ampoules . . . . . . .9
INSTALLATION
Installation de la
conduite d’eau . . . . . . . . . . . . . . . . . 11-13
Préparation . . . . . . . . . . . . . . . . . . . . . . 10
CONSEILS DE DÉPANNAGE
Avant d’appeler un réparateur . . . 15-17
Bruits de fonctionnement
normaux . . . . . . . . . . . . . . . . . . . . . . . . . 14
SERVICE À LA CLIENTÈLE
Feuillet de données relatives à la
performance de la
cartouche HWF . . . . . . . . . . . . . . . . . . . 19
Garantie . . . . . . . . . . . . . . . . . . . . . . . . 18
Service à la clientèle . . . . . . . . . . . . . 20
1
INSTRUCTIONS IMPORTANTES DE SÉCURITÉ.
LISEZ TOUTES LES INSTRUCTIONS AVANT
D’UTILISER VOTRE RÉFRIGÉRATEUR.
SÉCURITÉ
Site Internet d’Électroménagers GE
Pour de plus amples informations sur le fonctionnement de votre réfrigérateur, consultez le
site electromenagersge.ca ou composez le 800.561.3344.
CONSIGNES DE SÉCURITÉ POUR LE RÉFRIGÉRATEUR
Ce symbole représente une alerte de sécurité. Ce symbole vous avise de dangers possibles pouvant causer
la mort, des blessures ou autres. Tous les messages de sécurité seront précédés du symbole d’alerte de sécurité
ainsi que des mots « DANGER », « AVERTISSEMENT » ou « MISE EN GARDE ». Ces messages sont les suivants :
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
Signale une situation qui présente
. un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
AVERTISSEMENT
blessures graves, voire la mort.
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
ATTENTION
blessures mineures ou graves.
DANGER
AVERTISSEMENT
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque d’incendie, d’explosion, de choc électrique ou de blessures
lorsque vous utilisez votre réfrigérateurde , veuillez suivre ces consignes de sécurité :
„ Ce réfrigérateur doit être correctement installé conformément aux
Consignes d’Installation avant toute utilisation.
„ Débranchez le réfrigérateur avant d’effectuer une réparation, de
remplacer une ampoule ou de le nettoyer.
Remarque : L’alimentation du réfrigérateur ne peut être
déconnectée par aucune des fonctions sur le panneau de
commande.
Remarque : Les réparations doivent être effectuées par un
professionnel qualifié.
„ Remettez toutes les pièces et panneaux en place avant d’utiliser
l’appareil.
„ Ne stockez pas ou n’utilisez pas d’essence ou d’autres vapeurs et
liquides inflammables à proximité de cet appareil ou de tout autre
appareil électroménager.
„ Nous déconseillons fortement l’utilisation d’une rallonge à cause
des risques potentiels dans certaines conditions. Cependant, si
l’utilisation d’un cordon prolongateur est nécessaire, ce dernier doit
obligatoirement être homologué UL (aux USA) ou CSA (au Canada),
à trois brins avec mise à la terre pour appareil électroménager et
doit être équipé d’une fiche et d’une prise femelle avec terre. Les
caractéristiques électriques du cordon prolongateur doivent être
de 15 ampères (minimum) et de 120 volts.
„ Pour éviter les risques d’asphyxie et d’enfermement pour les
enfants. Démontez les portes du congélateur et du compartiment
de réfrigération avant de le mettre au rebut ou d’interrompre son
utilisation.
„ Ne laissez pas les enfants grimper, se mettre debout ou se
suspendre aux poignées de portes dans le réfrigérateur ou aux
clayettes du réfrigérateur. Ils pourraient se blesser gravement.
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque de blessures lorsque vous utilisez votre réfrigérateurde , veuillez
ATTENTION suivre ces consignes de sécurité.
„ Ne nettoyez pas les clayettes ou les couvercles en verre avec de
l’eau tiède quand ceux-ci sont froids. Les clayettes et couvercles
en verre peuvent se casser s’ils sont exposés à des changements
soudains de température ou si vous les cognez ou les faites
tomber. Le verre trempé est conçu pour se briser en petits
morceaux en cas de casse
„ Éloignez les doigts des parties du congélateur où l’on peut
facilement se pincer : les espaces entre les portes, et entre les
portes et les placards sont toujours étroits. Soyez prudent lorsque
vous fermez les portes en présence d’enfants.
2
„ Ne touchez pas les surfaces froides du congélateur lorsque vous
avez les mains humides ou mouillées. La peau risque d’adhérer à
ces surfaces extrêmement froides.
„ Ne recongelez pas les aliments surgelés qui ont complètement
dégelé.
„ Si votre réfrigérateur est doté d’une machine à glaçons
automatique, évitez le contact avec les pièces mobiles du
mécanisme éjecteur, ou avec l’élément chauffant qui libère les
glaçons. Ne posez pas les doigts ou les mains sur le mécanisme
de la machine à glaçons automatique pendant que le
réfrigérateur est branché.
INSTRUCTIONS IMPORTANTES DE SÉCURITÉ.
LISEZ TOUTES LES INSTRUCTIONS AVANT
D’UTILISER VOTRE RÉFRIGÉRATEUR.
SÉCURITÉ
(CONT.)
INSTALLATION
Risque d’explosion.
Conservez les matériaux et vapeurs inflammables tels que l’essence à l’écart de votre réfrigérateur.
Une explosion, un incendie voire la mort pourrait en résulter.
AVERTISSEMENT
BRANCHEMENTS ÉLECTRIQUES
AVERTISSEMENT
Risque de choc électrique.
Branchez l’appareil dans une prise triple avec terre.
Ne retirez pas la broche de terre.
N’utilisez pas d’adaptateur.
Le non-respect de ces instructions peut entraîner des risques d’incendies, des chocs électriques ou la mort.
Ne coupez pas ou n’enlevez pas, sous aucun prétexte, la troisième broche de mise à la terre du cordon
d’alimentation. Pour des raisons de sécurité, cet appareil doit être correctement mis à la terre.
Le cordon d’alimentation de cet appareil est équipé d’une fiche
à trois broches (pour une mise à la terre) qui s’adapte à la prise
de courant standard à 3 broches (pour une mise à la terre) pour
minimiser les risques de chocs électriques par cet appareil.
Faites vérifier la prise murale et le circuit électrique par
un électricien qualifié pour s’assurer que le système est
correctement mis à la terre.
Dans le cas d’une prise biphasée, l’installateur a la responsabilité
et l’obligation de la remplacer par une prise triphasée
correctement mise à la terre. N’utilisez pas d’adaptateur.
Le réfrigérateur doit toujours être branché à sa propre prise
électrique d’une tension nominale correspondant à celle
indiquée sur sa plaque signalétique.
Une alimentation électrique à 115 volts CA, 60 Hz, avec
un fusible de 15 ou 20 ampères et une mise à la terre est
nécessaire. Ceci permet d’obtenir un meilleur rendement et
évite de surcharger les circuits électriques du domicile qui risque
d’occasionner un incendie en surchauffant.
Ne débranchez jamais le réfrigérateur en tirant sur le cordon
d’alimentation. Prenez toujours fermement la fiche en main et
tirez pour la sortir de la prise.
Réparez ou remplacez immédiatement tout cordon électrique
usé ou endommagé. N’utilisez pas un cordon fissuré ou
présentant des dommages dus aux frottements soit sur sa
longueur ou aux extrémités.
Lorsque vous éloignez votre réfrigérateur du mur, faites
attention à ne pas le faire rouler sur le cordon d’alimentation
afin de ne pas l’endommager.
MISE AU REBUT APPROPRIÉE DE VOTRE ANCIEN RÉFRIGÉRATEUR
Un enfant risque de suffoquer ou d’y être emprisonné.
Démontez les portes du compartiment de réfrigération et du compartiment de congélation du
réfrigérateur, avant mettre celui-ci au rebut. Le non-respect de cette recommandation peut entraîner
l’enfermement d’un enfant qui peut entraîner la mort ou des lésions cérébrales.
AVERTISSEMENT
IMPORTANT: Les enfants pris au piège ou morts d’asphyxie
sont toujours d’actualité. Les réfrigérateurs jetés ou abandonnés
restent dangereux même si vous ne les laissez au rebut que pour
« quelques jours ». Si vous voulez jeter votre ancien réfrigérateur,
suivez les instructions suivantes pour empêcher les accidents.
Avant de jeter votre ancien réfrigérateur ou congélateur:
„ Démontez les portes du compartiment de réfrigération et du
compartiment de congélation.
„ Laissez les clayettes en place, pour éviter que des enfants
puissent facilement grimper dans votre réfrigérateur.
Fluides frigorigènes
Les appareils réfrigérants contiennent des fluides
frigorigènes qui conformément à la législation fédérale
doivent être retirés avant la mise au rebut de l’appareil. Si
vous mettez au rebut un ancien réfrigérateur contenant des
fluides frigorigènes, vérifiez la procédure à suivre auprès de
la compagnie responsable de l’élimination.
LISEZ ET SUIVEZ SOIGNEUSEMENT CES MESURES DE SÉCURITÉ.
CONSERVEZ CES INSTRUCTIONS
3
Installation des accessoires. (Tous les modèles ne sont pas dotés de tous les accessoires.)
➀ BALCONNET SUPÉRIEUR
➁ CARTOUCHE DU FILTRE
DU CONGÉLATEUR
Enlevez le bouchon
de dérivation
Assurez-vous que le balconnet
s’enclenche en place.
➂ PORTILLON DU CASIER
Installez la cartouche
du filtre
À PRODUITS LAITIERS
Balconnet supérieur
du congélateur
➃ SUPPORT
À BOUTEILLE
➆ FRONTONS DE BALCONNET
DU CONGÉLATEUR
Assurez-vous que le balconnet s’enclenche
en place.
NOTE : Sur les modèles à distributeur, les
frontons les plus longs occupent
les deux positions supérieures.
➄ CONTENANTS À
PORTILLON RÉGLABLES
DISPOSITIFS
D’AJUSTEMENT
DE PORTILLON DU
CONTENANT
Fronton du
balconnet
➅PORTILLONS DES
Balconnet
CONTENANTS INFÉRIEURS DE PORTE
Assurez-vous que le contenant s’enclenche en place.
Pour enlever : Soulevez la partie
extensible de la clayette verticalement
puis tirez-la vers l’extérieur.
Pour replacer : Engagez la partie
extensible de la clayette dans les
supports moulés de la porte et poussez
vers l’intérieur. Ceci assurera le
verrouillage.
Pour enlever : Soulevez l’avant du bac
et tirez.
Portillon de contenants inférieurs de
porte
Pour replacer ou relocaliser : Engagez
le bac dans les supports moulés de la
porte puis poussez vers l’intérieur. Le
bac sera verrouillé en place.
Clayettes et bacs. (Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.)
Réarrangement des clayettes
Clayettes du réfrigérateur :
Pour replacer
Pour enlever
Soulevez et tirez
Casserole du congélateur :
Basculez
vers le
haut
Pour enlever
2
Insérez
le crochet
supérieur
Abaissez
pour
verrouiller
en place
4
Pour enlever
Clayettes du congélateur
(sur certains modèles):
3
4
Enlevez la casserole en le tirant vers l’avant, en soulevant
la partie avant et en le faisant glisser au delà de la butée.
1
Clayettes et bacs.
(Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.)
1
Support
1
Support
2
2
1
2
3
Clayettes du congélateur (sur certains modèles):
1. Soulever le côté droit de la clayette, avant
et arrière, jusqu’à entendre un bruit sec.
2. Pousser la clayette vers la droite dans
la partie supérieure du support. Les
extrémités gauches de la clayette vont se
dégager des supports gauches.
4
3. Pencher le côté gauche vers le bas
pour dégager les extrémités droites des
supports droits.
4. Tirer vers l’avant pour retirer la clayette du
réfrigérateur.
5. Suivez les étapes 4 à 1 pour insérer la
clayette à sa nouvelle position.
Clayette coulissante anti-déversement (sur certains modèles)
Grâce à la clayette glissante anti-déversement, vous
pouvez atteindre des articles placés derrière d’autres.
Ses bords spéciaux sont conçus pour empêcher tout
déversement aux clayettes inférieures.
fond pour refermer la porte.
NOTE : Prenez soin de pousser la clayette jusqu’au
Clayettes anti-débordements (sur certains modèles)
Ces clayettes sont dotées de rebords spéciaux afin
de faciliter la prévention des débordements sur les
clayettes inférieures.
Bacs à légumes. (Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.)
Bacs à légumes à humidité réglables et bac à en-cas (sur certains modèles)
HIGH
HIGH
LOW
Réglez la commande à High (haut) pour que le
tiroir conserve un degré d’humidité élevé pour la
conservation des légumes.
LOW
Normale
Plus froide
Bac à viande transformable (sur certains modèles)
Le bac à viande transformable a sa propre arrivée
d’air froid pour permettre à un courant d’air en
provenance du compartiment congélateur d’arriver
au bac.
la disponibilité d’un espace supplémentaire pour
le rangement des légumes. Le débit d’air froid
s’arrête. Il est donc possible de choisir entre ces deux
extrêmes de température.
La commande de température réglable permet la
régulation du débit d’air provenant du compartiment
du congélateur.
Placez le levier sur bas sur la position la
plus froide pour le rangement de viandes fraîches. Si
le levier demeure longtemps sur cette position, il est
possible que du givre se forme à l’intérieur du bac.
Placez le levier sur haut pour que la température du
bac soit à la température normale du réfrigérateur,
assurant ainsi
Guides
du bac
Réglez la commande à Low (bas) pour abaisser le
degré d’humidité dans le tiroir pour la conservation
des fruits.
Enlèvement du bacs à légumes
Il est facile de retirer les bacs en les soulevant
légèrement puis en les tirant au delà de la butée.
Lorsque vous remettez les bacs en place, assurezvous que vous les glissez dans les guides.
Si la porte du réfrigérateur empêche le retrait des
bacs, il sera nécessaire de déplacer celui-ci vers
l’avant jusqu’à ce qu’il soit possible d’ouvrir la porte
suffisamment pour faire glisser les bacs à l’extérieur.
Dans certains cas, il sera nécessaire de déplacer
le réfrigérateur vers la gauche au cours de cette
opération.
5
Les commandes.
Toutes les options ne sont pas disponibles sur tous les modèles. Les commandes de votre appareil peuvent se présenter ainsi:
Freezer
Refrigerator
Les commandes de températures sont préréglées en usine à 3°C
(37°F) pour le compartiment réfrigérateur et à -18°C (0°F) pour le
compartiment congélateur. Veuillez attendre 24 heures pour que la
température se stabilise au préréglage recommandé.
Les commandes de températures peuvent afficher les
températures SET (fixées) ainsi que les températures réelles à
l’intérieur du réfrigérateur et du congélateur. La température
actuelle peut légèrement varier de la température SET (fixée) suivant
les conditions d’utilisation et de fonctionnement.
Verrouillage du distributeur (Alarme porte ouverte certains modèles)
Appuyez sur la touche Lock Controls (verrouillage du
distributeur) pendant 3 secondes pour verrouiller le
distributeur et le panneau de réglage. Pour déverrouiller,
appuyez sur la touche et tenez-la enfoncée pendant
encore 3 secondes.
Pour utiliser le distributeur (certains modèles)
Sélectionnez
ou
Appuyez doucement le verre contre le haut du bras de
distribution.
6
Les commandes de températures sont préréglées en usine à « 5 »
pour le compartiment réfrigérateur et à « 5 » pour le compartiment
congélateur. Veuillez attendre 24 heures pour que la température
se stabilise au préréglage recommandé.
REMARQUE : Les réglages de température représentés sont « 1 »
pour la température la plus basse, « 9 » pour la température la plus
froide et « 0 » pour indiquer l’arrêt.
Lumière du distributeur
Cette touche allume et éteint la lumière du
distributeur. Vous allumez également la lumière en
appuyant sur le bras de distribution. Si cette ampoule brûle,
vous devez la remplacer par une ampoule d’au maximum
6 watts.
Témoin de remplacement du filtre à eau
Ce témoin s’allumera pour indiquer la nécessité de
remplacer le filtre à eau. Après avoir changé le filtre,
appuyez et maintenez le bouton enfoncé pendant 3
secondes pour que le témoin s’éteigne. Consultez le
chapitre « Au sujet de la cartouche du filtre à eau » pour
obtenir plus de détails
Le distributeur d’eau et de glaçons. (sur certains modèles)
Bac de
trop-plein
La clayette de trop-plein n’est pas munie
d’un système d’écoulement. Pour réduire
les taches d’eau, vous devez nettoyer
régulièrement la clayette et sa grille.
ATTENTION
Ne mettez jamais les
doigts ou d’autres objets dans l’ouverture
du distributeur.
S’il n’y a pas d’eau distribuée lorsque le
réfrigérateur est initialement installé, il y a
peut-être de l’air dans la conduite d’eau.
Appuyez sur la commande de distribution
pendant deux minutes au minimum pour
expulser l’air de la conduite d’eau et
remplir le réservoir d’eau. Afin d’éliminer
les éventuelles impuretés provenant de
la conduite d’eau, jetez les six premiers
verres d’eau.
Tiroir à glace dans les modèles à
distributeur de glaçons
Tournez
Enlèvement : Glissez l’interrupteur du
distributeur de glace à la position OFF (arrêt).
Tirez le tiroir droit, puis soulevez-le pour
dépasser la position d’arrêt.
Remise en place : Pour remettre le tiroir, prenez
soin d’appuyer fort en place. S’il n’entre pas
jusqu’au fond, enlevez-le et faites tourner le
mécanisme d’un quart de tour. Poussez à
nouveau le tiroir jusqu’au fond.
Mécanisme
d’entraînement
Renseignements importants concernant votre distributeur de glaçons
„
N’ajoutez pas dans le bac à glaçons des glaçons non
fabriqués par votre machine à glaçons. Ils risquent d’être
difficiles à concasser ou à distribuer.
„
Évitez de trop remplir les verres de glaçons et d’utiliser des
verres étroits. Le conduit peut se bloquer et le volet peut
geler et coincer. S’il y a des glaçons qui bloquent le conduit,
faites-les passer au moyen d’une cuillère en bois.
„
Ne placez pas de boissons ou d’aliments dans le bac
à glaçons pour les rafraîchir. Les boîtes, bouteilles et paquets
alimentaires peuvent coincer la machine à glaçons ou la vis
sans fin.
„
Afin que la glace distribuée ne puisse manquer le verre, placer
le verre à proximité mais sans toucher l’ouverture
du distributeur.
„
Même si vous avez sélectionné Cubed, il est possible que de la
glace concassée tombe dans votre verre. Cela se produit de
temps à autre lorsque plusieurs glaçons sont acheminés vers
le broyeur.
„
Après distribution de la glace concassée, de l’eau peut
s’écouler du conduit.
„
Parfois, un peu de givre se forme sur le volet du conduit à
glace. Ce phénomène est normal et se produit en général
après des distributions répétées de glace concassée. Le givre
va éventuellement évaporer.
„
Le premier verre d’eau fourni pourrait être plus chaud que les
suivants. Ceci est normal.
„
L’eau fournie n’est pas glacée. Pour de l’eau plus froide,
ajoutez tout simplement de la glace concassée ou des
cubes de glace avant de verser de l’eau.
Machine à glaçons automatique.
Il est normal que plusieurs glaçons soient collés entre eux.
Lorsque vous n’utilisez pas souvent de glaçons, les vieux glaçons
perdent leur transparence, prennent un goût désagréable, et
diminuent de taille.
Nécessaire de machine à glaçons
Si votre réfrigérateur n’est pas déjà doté d’une machine à
glaçons automatique, un nécessaire de machine à glaçons
est disponible moyennant supplément. Vérifiez sur l’étiquette
à l’arrière du réfrigérateur quel est le nécessaire de machine à
glaçons spécifique à votre modèle.
7
Machine à glaçons automatique.
Il faut prévoir entre 12 et 24 heures avant qu’un réfrigérateur nouvellement installé commence à produire des glaçons.
Machine à glaçons
Interrupteur
d’alimentation
Bras régulateur
Machine à glaçons automatique
(sur certains modèles)
Lorsque la conduite d’eau est raccordée au réfrigérateur,
glissez l’interrupteur d’alimentation à la position ON
(marche).
La machine à glaçons se remplit d’eau lorsqu’elle atteint
-9°C (15°F). Si le bac à glaçons est plein jusqu’au niveau du
bras régulateur, la machine
à glaçons s’arrêt de produire des glaçons.
Assurez-vous que rien ne gêne le mouvement
du bras régulateur.
Jetez les premiers lots de glaçons afin d’éliminer les
impuretés provenant de la conduite d’eau.
/DPDFKLQHjJODoRQVSURGXLUDJODoRQVSDUF\FOH³VRLW
HQYLURQ²JODoRQVWRXWHVOHVKHXUHV³VHORQOD
température du congélateur, la température ambiante, la
fréquence d’ouverture des portes et d’autres conditions
d’utilisation.
Vous entendrez un bourdonnement chaque fois que la
machine à glaçons se remplit d’eau.
ATTENTION
Évitez le contact avec les
pièces mobiles du mécanisme d’éjection et
O·pOpPHQWFKDXȺDQW VLWXpGDQVOHEDVGHOD
machine à glaçons) qui libère les cubes. Ne placez
ni les doigts ni les mains sur le mécanisme de
production de glace automatique lorsque le
réfrigérateur est branché.
La cartouche du filtre à eau. (sur certains modèles)
Cartouche du filtre à eau
La cartouche du filtre à eau se trouve dans le coin droit
arrière supérieur du compartiment réfrigérateur.
À quel moment remplacer le filtre des modèles avec
témoin de remplacement
Ce témoin indique la nécessité de remplacer la cartouche du filtre
à eau du distributeur. Ce témoin devient orange pour vous avertir
de remplacer bientôt le filtre.
Vous devez remplacer la cartouche de filtre lorsque le témoin
devient rouge ou quand le débit de l’eau du distributeur d’eau
ou de glace diminue.
Installation de la cartouche du filtre à eau
1 Remplissez la cartouche de rechange avec de l’eau du robinet
immédiatement après l’installation afin de permettre un meilleur
débit du distributeur.
2 Alignez la flèche de la cartouche avec celle de porte-cartouche.
Placez le dessus de la nouvelle cartouche vers le haut à l’intérieur
du porte-cartouche. Ne l’enfoncez pas dans le porte-cartouche.
3 Tournez lentement la cartouche vers la droite
jusqu’à ce que la cartouche s’immobilise. NE SERREZ
PAS TROP FORT. Lorsque vous la tournez, elle
Porte-cartouche
se relèvera automatiquement en place.
idge
La cartouche fera approximativement un demi-tour.older
4 Faites couler six litres d'eau du distributeur (environ
À quel moment remplacer le filtre des modèles sans
témoin de remplacement
La cartouche du filtre doit être remplacée tous les six mois
ou moins si le débit d’eau du distributeur d’eau ou de glace diminue.
Retrait de la cartouche du filtre
Lorsque vous devez remplacer la cartouche, enlevez d’abord
la cartouche usagée en la tournant lentement vers la gauche.
Ne tirez pas sur la cartouche. Un peu d’eau peut s’écouler.
MISE EN GARDE : Pour réduire le risque associé aux dommages
matériels causés par des fuites d’eau, lisez et suivez les instructions
avant de procéder à l’installation et d’utiliser votre système.
L’installation et l’utilisation DOIVENT être conformes à tous
les codes locaux et nationaux de plomberie.
trois minutes) pour rincer le système et éviter les égouttements.
5 Appuyez et maintenez la touche RESET WATER FILTER (Réinitialiser
le filtre à eau) du distributeur enfoncée pendant trois secondes.
REMARQUE : Il est possible que de l’eau jaillisse du distributeur
après l’installation d’une cartouche neuve.
Bouchon de dérivation du filtre
YVous devez utiliser le bouchon de dérivation du filtre si vous n’avez pas
de cartouche de rechange. Les distributeurs d’eau et de glace ne
fonctionneront pas si le filtre ou le bouchon de dérivation n’est pas installé.
Bouchon de
dérivation du filtre
SmartWater
Bouchon de ter
dérivation dussfiltre
Water by Culligan
ug
Pour utiliser le bouchon de dérivation du filtre sur les modèles
Water by Culligan™, vous devez d’abord retirer l’adaptateur du
filtre du porte-cartouche en le faisant pivoter vers la gauche.
AVERTISSEMENT
! AVERTISSEMENT
Interdissez tout accès aux petites pièces à tout enfant de moins de trois (3) ans pendant l’installation pour éviter les risques
d’étouffement associés à ces pièces. La cartouche du filtre jetable doit être remplacée tous les six mois suivant sa durée
d’origine ou plus tôt si l’on remarque une diminution du débit d’eau.
Pour obtenir des résultats optimums de votre système de filtration, GE vous recommande d’utiliser uniquement des filtres GE SmartWater.
L’utilisation de filtres GE dans les réfrigérateurs GE et Hotpoint® vous garantit une performance optimale et une bonne fiabilité.
Les filtres GE SmartWater répondent aux normes rigoureuses de sécurité et de qualité NSF primordiales pour les produits de filtration
d’eau. GE n’a pas agréé des filtres de marques différentes pour une utilisation dans les réfrigérateurs GE et Hotpoint. Aucune assurance
n’est donnée que les filtres d’autres marques puissent respecter la qualité, performance et fiabilité exigées par GE.
Si vous avez des questions ou pour commander des cartouches de rechange supplémentaires, visitez notre site internet à l’adresse
www.gewaterfilters.com ou appelez le Service des pièces et accessoires GE au 1-800-626-2002.
8
Les clients canadiens peuvent consulter les pages jaunes pour connaître le Centre de service Camco le plus près.
Entretien et nettoyage du réfrigérateur.
Nettoyage de l’extérieur
Le bac de trop-plein du distributeur (sur certains
modèles) devrait être soigneusement essuyé.
Vous pouvez éliminer les dépôts calcaires laissés par
les taches d’eau en trempant le bac dans du vinaigre
non dilué. Laissez tremper jusqu’à ce que les dépôts
disparaissent ou soient suffisamment ramollis pour être
éliminés par rinçage.
Le bras de distribution (sur certains modèles). Avant
nettoyage, appuyez pendant 3 secondes sur la touche
Lock. Nettoyez-la au moyen d’une solution d’eau et de
ELFDUERQDWHGHVRXGH³HQYLURQXQHFXLOOqUHjVRXSH
(15 ml) de bicarbonate de soude par pinte (1 liter) d’eau.
Rincez bien et essuyez.
Les poignées de porte et leur garniture. Nettoyezles au moyen d’un linge humecté d’eau savonneuse.
Séchez avec un linge doux.
Gardez l’extérieur du réfrigérateur propre. Essuyez-le avec
un linge propre légèrement humecté de cire pour appareils
électroménagers ou d’un détergent liquide doux pour la
vaisselle. Séchez et polissez avec un linge doux et propre.
Vous pouvez nettoyer les portes et les poignées
de porte en acier inoxydable (sur certains modèles)
avec un nettoyant d’acier inoxydable vendu sur le
marché. Les nettoyants qui contiennent de l’acide
oxalique, tels que Bar Keepers Friend Soft Cleanser™,
éliminent la rouille de surface, le ternissement et les
petites taches. Utilisez uniquement un nettoyant liquide
exempt d’abrasif et frottez dans la direction des lignes
de brossage à l’aide d’une éponge souple imbibée.
N’utilisez pas de cire pour appareils ménagers sur l’acier
inoxydable.
N’essuyez pas le réfrigérateur avec un linge à vaisselle
sale ou une serviette humide : ils pourraient laisser un
résidu qui pourra endommager la peinture. N’utilisez pas
de tampons à récurer, de produits nettoyants en poudre,
de javellisants ou de produits nettoyants contenant
un javellisant, car ces produits peuvent égratigner la
peinture et la rendre moins résistante.
Nettoyage de l’intérieur
Pour éviter les mauvaises odeurs, laissez une
boîte ouverte de bicarbonate de soude dans les
compartiments réfrigérateur et congélateur.
Débranchez le réfrigérateur avant de le nettoyer. S’il
est trop difficile de le faire, essorez bien votre linge ou
votre éponge pour enlever l’excès d’eau lorsque vous
nettoyez autour des interrupteurs, des lampes ou des
commandes.
Utilisez une solution d’eau tiède et de bicarbonate de
soude–environ une cuillère à soupe (15 ml) de bicarbonate
GHVRXGHSDUSLQWH OLWHU G·HDX³DILQGHQHWWR\HUWRXWHQ
neutralisant les odeurs. Rincez et essuyez bien.
Après avoir nettoyé les joints de porte, appliquez une fine
couche de vaseline sur les joints du côté des charnières
pour empêcher les joints de coller et de se déformer.
Orifice de vidange du compartiment du congélateur.
Lors du nettoyage annuel, retirez la casserole inférieure
du congélateur et faites passer une solution de
bicarbonate de soude (1 cuillerée ou 5 ml) et d’eau
chaude (pas bouillante) (2 tasses ou 500 ml) au travers
du tuyau de vidange à l’aide d’une pipette d’arrosage
de sauces : ce mélange facilite l’élimination des odeurs
et la réduction des risques de bouchage du tuyau
d’évacuation. Si le tuyau est bouché, utilisez la pipette et
une solution de bicarbonate de soude afin de forcer
le passage de la matière obstruante.
ATTENTION
Ne nettoyez pas les tablettes ou
couvercles en verre avec de l’eau chaude lorsqu’ils sont
froids. Les tablettes et couvercles en verre peuvent se
briser s’ils sont exposés à une variation de température
soudaine, ou soumis à un impact s’ils sont heurtés ou
échappés. S’il se brise, le verre trempé est conçu pour
se fracturer en un grand nombre de petits éclats. Ne
lavez aucune pièce en plastique du réfrigérateur au
lave-vaisselle.
Derrière le réfrigérateur
Prenez un soin particulier lorsque vous éloignez le réfrigérateur du
mur. Tous les types de revêtements de sol peuvent être endommagés,
particulièrement ceux qui sont coussinés ou dont la surface est gaufrée.
Tirez le réfrigérateur en ligne droite et, lorsque vous le remettez
en place, poussez-le vers le mur en ligne droite. Les déplacements
latéraux du réfrigérateur pourraient endommager le revêtement de sol
ou le réfrigérateur.
Lorsque vous remettez le réfrigérateur en place en le poussant,
veillez à ne pas le faire rouler sur le cordon d’alimentation ou sur la
conduite d’eau de la machine à glaçons (sur certains modèles).
Départ en vacances
Lorsque vous vous absentez pendant une période prolongée, videz les
aliments et débranchez le réfrigérateur. Nettoyez l’intérieur avec une
solution d’eau et de bicarbonate de soude, à raison d’une cuillère à soupe
(15 ml) de bicarbonate par pinte (1 liter) d’eau. Laissez les portes ouvertes.
Glissez l’interrepteur d’alimentation de la machine à glaçons à la
position OFF (arrêt) et fermez l’alimentation d’eau au réfrigérateur.
Déménagement
Immobilisez tous les éléments amovibles, tels que les clayettes et les bacs, à l’aide de ruban gommé pour éviter de les endommager.
Assurez-vous que le réfrigérateur demeure debout pendant son déménagement.
Remplacement des ampoules
REMARQUE : La mise en arrêt du réfrigérateur en mettant le bouton de réglage en position 0 (arrêt) à l’aide des commandes n’entraîne pas sa
mise hors tension.
Remplacez l’ampoule par une ampoule de même taille
Débranchez le réfrigérateur.
et de même puissance.
Enlevez la clayette qui se trouve juste au dessous
Remontez la clayette et rebranchez le réfrigérateur.
du protecteur de l’ampoule.
9
Instructions
d’installation
Réfrigérateur
Modèles 20, 22 et 25
Si vous avez des questions, appelez le 1.800.561.3344 ou visitez notre site Web à l’adresse : electromenagersge.ca
AVANT DE COMMENCER
Lisez ces instructions complètement et attentivement.
IMPORTANT – Conservez ces instructions
pour utilisation éventuelle par un inspecteur local.
• IMPORTANT – Respectez tous les codes et
•
règlements officiels.
•
Note à l’installateur – Assurez-vous de laisser ces
•
Note au consommateur – Conservez ces
•
•
•
•
instructions au consommateur.
instructions pour référence future.
Niveau de connaissances – L’installation de cet appareil
requiert des connaissances de base en mécanique.
Temps requis – L’installation du réfrigérateur demande
15 minutes.
L’installateur est responsable de l’installation correcte
du réfrigérateur.
Toute panne de cet appareil causée par une installation
inadéquate n’est pas couverte par la garantie.
EMPLACEMENT DU RÉFRIGÉRATEUR
• N’installez pas le réfrigérateur dans une pièce où la
température ambiante risque d’être inférieure à 16°C (60°F)
parce qu’il ne se mettra pas en marche suffisamment souvent
pour maintenir les températures convenables.
• N’installez pas le réfrigérateur dans un endroit où la
température ambiante sera supérieure à 37°C, il ne
fonctionnera pas correctement.
• N’installez pas le réfrigérateur dans un endroit exposé à
l’eau (pluie, etc.) ou directement aux rayons solaires.
• Installez le réfrigérateur sur un plancher suffisamment
solide pour le supporter lorsqu’il est plein.
ALIMENTATION D’EAU À LA MACHINE À
GLAÇONS (sur certains modèles)
Si le réfrigérateur est équipé d’une machine à glaçons,
celle-ci devra être raccordée à une conduite d’eau froide.
Vous pouvez acheter une trousse d’alimentation d’eau GE
Appliances (contenant la tuyauterie, le robinet d’arrêt, les joints
et les instructions) chez votre revendeur, ou en vous adressant
à notre site Web à l’adresse electromenagersge.ca
ou à notre service de Pièces et accessoires au numéro
de téléphone 1.888.261.3055.
DÉGAGEMENTS
Prévoyez les dégagements suivants pour faciliter l’installation,
assurer une circulation d’air adéquate, et permettre les
raccordements de plomberie et d’électricité :
• Côtés mm 1/8po)• Dessus mm 1po)• Arrière mm 1po)
Il est nécessaire de ménager un espace de 19 mm (3/4po) pour
que la porte puisse être ouverte sur 90°,ce qui assure un meilleur
accès aux compartiments de rangement des aliments.
10
ROULETTES DE NIVELLEMENT
Les roulettes de nivellement jouent trois rôles :
„ Elles peuvent être réglées pour que les portes se referment
automatiquement lorsqu’elles sont à moitié ouvertes.
„ Elles peuvent être réglées de manière à permettre
à l’appareil de reposer solidement sur le sol et l’empêcher ainsi
de branler.
„ Elles vous permettent d’éloigner le réfrigérateur
du mur pour le nettoyage.
Pour régler la hauteur des roulettes,
retirez la grille de la base du
réfrigérateur en la tirant par le bas.
Pour élever le réfrigérateur, tournez
les vis de réglage dans le sens horaire
et pour l’abaisser, dans le sens antihoraire. Utilisez une clef à molette pour
écrous hexagonaux de 3/8 po ou des
pinces.
Pour remettre la grille de la base,
alignez ses attaches arrière entre
la barre et la partie inférieure de
l’armoire. Poussez jusqu’à ce que la grille s’enclenche dans le
logement.
ALIGNEMENT DES PORTES
Après avoir réglé les roulettes de nivellement, assurez-vous
que les portes sont bien alignées à la partie supérieure.
Pour aligner les portes, réglez la porte du compartiment
réfrigérateur.
À l’aide d’une clé
à douille de 5/16 po,
tournez la vis de
réglage de la porte
vers la droite pour
relever la porte, ou
vers la gauche pour
l’abaisser. (Une douille
de nylon, encastrée
dans les filets de l’axe,
empêchera celui-ci de
tourner si l’on ne se
sert pas d’une clé.)
Après avoir
tourné la clé une
Pour enlever la
ou deux fois,
grille de la base
ouvrez et fermez
du réfrigérateur,
la porte du
ouvrez les portes
compartiment
et ensuite, tirez la
réfrigérateur
grille hors de son
et vérifiez
logement.
l’alignement des
portes à la partie supérieure.
Clé à douille de
5/16 po
Relevez
Instructions d’installation
INSTALLATION DE LA CONDUITE D’EAU
AVANT DE COMMENCER
CE DONT VOUS AUREZ BESOIN (suite)
Nous recommandons les trousses d’alimentation d’eau en cuivre
WX8X2, WX8X3, WX8X4, selon le montant de conduite dont vous avez
besoin. Nous approuvons les conduites d’eau en matière plastique
GE SmartConnect™ Refrigerator Tubing (WX08X10002, WX08X10006,
WX08X10015 et WX08X10025).
Si vous installez un système d’eau GE Appliances Reverse Osmosis
dans votre réfrigérateur, la seule installation approuvée est celle de
la trousse GE Appliances RVKIT. Pour les autres systèmes d’osmose de
l’eau, suivez les recommandations du fabricant.
Si le réfrigérateur est alimenté en eau à partir d’un système de
filtration d’eau par osmose inversée, et si le réfrigérateur comporte
également un filtre à eau, utiliser le bouchon du circuit de dérivation
du filtre du réfrigérateur. Si la cartouche de filtration d’eau du
réfrigérateur est utilisée en conjonction avec le système de filtration
par osmose inversée, on peut observer une réduction du débit d’eau
au point de puisage, et la production de cubes de glace creux.
Cette installation de conduite d’eau n’est pas garantie par le
fabricant de réfrigérateur ou de machine à glaçons. Suivez
soigneusement ces instructions pour minimiser le risque de
dommages onéreux d’inondation.
Les coups de bélier (eau qui donne des coups dans les tuyaux) dans la
tuyauterie de la maison peuvent occasionner des dommages aux pièces
de votre réfrigérateur, ainsi que des fuites ou des inondations. Appelez
un plombier certifié pour corriger les coups de bélier avant d’installer la
conduite d’eau de votre réfrigérateur.
Pour prévenir toute brûlure et tout dommage à votre réfrigérateur,
ne branchez jamais la conduite d’eau à une canalisation d’eau
chaude.
Si vous utilisez votre réfrigérateur avant de brancher la conduite
d’eau, assurez-vous de laisser le commutateur de la machine à
glaçon en position OFF (arrêt).
N’installez jamais les tuyaux de la machine à glaçon dans des
endroits où la température risque de descendre en dessous du point
de congélation.
Vous devez procéder à toutes vos installations conformément aux
exigences de votre code local de plomberie.
NOTE : Les seuls tuyaux en matière plastique approuvés
par GE Appliances sont ceux qui font fournis dans les trousses
GE SmartConnect™ Refrigerator Tubing. N’utilisez jamais un
autre tuyau en matière plastique, car le tuyau d’alimentation
d’eau est tout le temps sous pression. Certaines catégories de
tuyaux en matière plastique peuvent devenir cassants avec
l’âge et peuvent se fendre, en occasionnant des dommages
d’inondation dans votre maison.
• Vous pouvez acheter une trousse d’alimentation d’eau GE
Appliances (contenant un tuyau, un robinet d’arrêt et les joints
énumérés ci-dessous) chez votre distributeur local ou en
le commandant au service de pièces et accessoires, au
800.626.2002.
• Une alimentation d’eau froide. La pression de l’eau doit
être entre 20 et 120 p.s.i. (1,4 et 8,2 bar) sur les modèles non
équipés de filtre à eau et entre 40 et 120 psi (2,8 et 8,2 bar)
pour ceux qui le sont.
• Une perceuse électrique.
• Une clé de 1/2po ou une clé anglaise.
• Un tournevis à lame plate et un tournevis Phillips.
AVERTISSEMENT
Branchez seulement à une source d’eau
potable.
CE DONT VOUS AUREZ BESOIN
• Tuyaux en cuivre ou trousse GE SmartConnect™ Refrigerator
Tubing, diamètre extérieur de 1/4po pour brancher le
réfrigérateur à l’alimentation d’eau. Si vous utilisez un tuyau en
cuivre, assurez-vous que les deux extrémités du tuyau soient
coupées bien droit.
Pour trouver la longueur de tuyau dont vous aurez besoin :
mesurez la distance qui va du robinet d’eau situé derrière le
réfrigérateur jusqu’au tuyau d’alimentation d’eau. Assurez-vous
qu’il y ait assez de tuyau en trop pour vous permettre de décoller
le réfrigérateur du mur après l’installation.
Les trousses GE SmartConnect™ Refrigerator Tubing sont
disponibles dans les dimensions suivantes :
0,6 m (2 pi) – WX08X10002
4,6 m (15 pi) – WX08X10015
2,4 m (8 pi) – WX08X10006
7,6 m (25 pi) – WX08X10025
• Deux écrous à compression d’un diamètre extérieur
de 1/4SRHWGHX[EDJXHV PDQFKRQV ³SRXUEUDQFKHUOH
tuyau en cuivre au robinet d’arrêt et au robinet d’eau
du réfrigérateur.
OU BIEN
• Si vous utilisez une trousse GE SmartConnect™ Refrigerator
Tubing, les garnitures nécessaires sont déjà montées au
tuyau.
• Si votre canalisation d’eau actuelle a un raccord évasé à
une extrémité, vous aurez besoin d’un adaptateur (que vous
trouverez dans votre magasin de matériel de plomberie) pour
brancher le tuyau d’eau au réfrigérateur, OU BIEN vous pouvez
couper le raccord évasé à l’aide d’un coupe-tube,
puis utiliser un raccord à compression. Ne coupez jamais
l’extrémité finie d’un tuyau de la trousse GE SmartConnect™
Refrigerator Tubing.
• Un robinet d’arrêt pour brancher le tuyau d’eau froide. Le
robinet d’arrêt doit avoir une entrée d’eau avec un diamètre
intérieur minimal de 5/32po au point de jonction avec LA
CONDUITE D’EAU FROIDE. Des robinets d’arrêt à étrier sont
souvent inclus dans les trousses d’alimentation d’eau. Avant
d’acheter, assurez-vous que le robinet à étrier se conforme à
vos codes de plomberie locaux. Installez le robinet d’arrêt sur
la canalisation d’eau potable la plus fréquemment utilisée.
11
Instructions d’installation
5 BRANCHEZ LE TUYAU AU ROBINET
1 FERMEZ L’ALIMENTATION
PRINCIPALE D’EAU
2 PERCEZ UN TROU POUR
LE ROBINET
Choisissez, pour le robinet, un emplacement facilement
accessible. Il vaut mieux le brancher de côté à un tuyau
vertical. Si vous devez le brancher à un tuyau horizontal,
faites le branchement en haut ou de côté, plutôt qu’en bas
du tuyau, pour éviter de recevoir des sédiments du tuyau
d’alimentation d’eau.
Percez un trou de 1/4po dans le tuyau d’eau, à l’aide d’un
foret dur. Enlevez toute barbure due au perçage du trou
dans le tuyau. Faites attention de ne pas
laisser de l’eau couler dans votre perceuse
électrique. Si vous ne percez pas un trou
de 1/4po, vous obtiendrez une alimentation
d’eau réduite et des glaçons plus petits.
Placez un écrou de compression et une bague (manchon) à
l’extrémité du tuyau et branchez-les au robinet d’arrêt.
Assurez-vous que le tuyau soit bien inséré dans le robinet.
Serrez fort l’écrou de compression.
Pour le tuyau en matière plastique d’une trousse GE
SmartConnect™ Refrigerator Tubing, insérez l’extrémité
moulée du tuyau dans le robinet d’arrêt et serrez l’écrou de
compression à la main, puis serrez un autre demi tour avec
une clé. Si vous serrez trop fort, vous pouvez occasionner
des fuites.
Robinet d’arrêt
à étrier
Écrou de
compression
Tuyau
SmartConnect™
Presse-joint
Robinet de sortie
Bague (manchon)
NOTE : Vous devez vous conformer aux Codes de plomberie
248CMR du Commonwealth of Massachusetts. Les robinets
d’arrêt à étrier sont illégaux et leur utilisation n’est pas
autorisée au Massachusetts. Consultez votre plombier local.
3 FIXEZ LE ROBINET D’ARRÊT
Fixez le robinet d’arrêt au tuyau d’eau froide à l’aide
du collier de serrage.
Serrez les vis du collier jusqu’à ce que la rondelle
d’étanchéité commence à enfler.
NOTE : Ne serrez pas trop. Vous risquez d’écraser
le tuyau de cuivre.
Rondelle
6 PURGEZ LE TUYAU
Ouvrez le robinet d’alimentation principale d’eau et
purgez le tuyau jusqu’à ce que l’eau soit claire.
Entrée
Collier de serrage
Vis du collier
Robinet d’arrêt
à étrier
Tuyau vertical
d’eau froide
NOTE : Vous devez vous conformer aux Codes
de plomberie 248CMR du Commonwealth of
Massachusetts. Les robinets d’arrêt à étrier sont illégaux
et leur utilisation n’est pas autorisée au Massachusetts.
Consultez votre plombier local.
4 ACHEMINEZ LE TUYAU
Acheminez le tuyau du tuyau d’eau froide au réfrigérateur.
Faites passer le tuyau par un trou percé dans le mur ou le
plancher (derrière le réfrigérateur ou au niveau de l’armoire de
cuisine adjacente), aussi près du mur que possible.
NOTE : Assurez-vous qu’il y ait assez de tuyau en trop pour
vous permettre de décoller le réfrigérateur du mur après
l’installation.
12
7 BRANCHEZ LE TUYAU À VOTRE
RÉFRIGÉRATEUR
NOTES :
• Avant de brancher le tuyau à votre réfrigérateur,
assurez-vous que le cordon d’alimentation électrique du
réfrigérateur ne soit pas branché à la prise murale.
• Si votre réfrigérateur n’est pas équipé d’un filtre à eau,
nous vous recommandons d’en installer un si votre
alimentation d’eau contient du sable ou des particules
qui peuvent boucher la grille du robinet d’eau de votre
réfrigérateur. Installez-le sur la conduite d’eau près
de votre réfrigérateur. Si vous utilisez une trousse GE
SmartConnect™ Refrigerator Tubing, vous aurez besoin
d’un tuyau additionnel (WX08X10002) pour brancher le
filtre. Ne coupez jamais un tuyau en matière plastique
pour installer votre filtre.
Instructions d’installation
7 BRANCHEZ LE TUYAU À VOTRE
RÉFRIGÉRATEUR (suite)
7 BRANCHEZ LE TUYAU À VOTRE
RÉFRIGÉRATEUR (suite)
Sur certains modèles de réfrigérateurs, le raccord se
trouve à l’éxtrémité du tuyau situé à l’extérieur de
couvercle d’accès de compartiment du compresseur. Sur
d’autres modèles, le couvercle d’accès au compartiment
du compresseur doit être retiré pour accéder au raccord
du réfrigérateur au robinet d’alimentation d’eau.
Collet à
tuyau
Tuyau de
1/4 po
Écrou de
compression
de 1/4 po
Collet
(manchon)
Branchement au réfrigérateur
Tuyau de
SmartConnect™
8 FERMEZ L’EAU AU NIVEAU
Sur les modèles dotés du raccord au robinet d’alimentation
d’eau, retirez le bouchon en plastique flexible.
Placez l’écrou de compression et la bague (manchon) à
l’extrémité du tuyau comme l’indique l’illustration. Si vous
utilisez une trousse GE SmartConnect™ Refrigerator Tubing,
les écrous sont déjà assemblés au tuyau.
Insérez l’extrémité du tuyau dans le raccord du réfrigérateur
le plus loin que possible. Tout en tenant le tuyau, serrez le
raccord.
Si vous utilisez un tuyau en matière plastique d’une trousse
GE SmartConnect™ Refrigerator Tubing, insérez l’extrémité
moulée du tuyau dans le raccord du réfrigérateur et serrez
l’écrou de compression à la main, puis serrez un autre
tour avec une clé. Si vous serrez trop fort, vous pouvez
occasionner des fuites.
Fixez le tuyau au collet fourni pour le tenir en position
verticale. Il est possible que vous ayez à disjoindre le collet.
L’un des schémas ci-dessous sera similaire au montage
du raccord de votre réfrigérateur.
Collet à
tuyau
Tuyau de
1/4 po
Écrou de
compression
de 1/4 po
Collet
(manchon)
Branchement
au réfrigérateur
DU ROBINET D’ARRÊT
Resserrez tout joint qui fuit.
Remettez en place le couvercle d’accès.
9 BRANCHEZ VOTRE RÉFRIGÉRATEUR
Disposez la spirale de tuyau en cuivre de manière
à ce qu’elle ne vibre pas contre l’arrière de votre
réfrigérateur ou contre le mur. Mettez votre réfrigérateur à
sa place contre le mur en le poussant.
10 METTEZ EN MARCHE
LA MACHINE À GLAÇONS
Glissez le commutateur de la machine à glaçon
à la position ON (marche). La machine à glaçons
ne se met en marche que lorsqu’elle atteint
une température de fonctionnement de – 9°C (15°F)
ou moins. Elle commence immédiatement à fonctionner
si le commutateur de la machine à glaçons est en position
ON (marche).
Tuyau de
SmartConnect™
13
Bruits normaux de fonctionnement.
Les réfrigérateurs plus récents font des bruits différents de ceux des
anciens. Les réfrigérateurs modernes présentent plus de fonctions et
sont plus avancés sur le plan technologique.
Entendez-vous ce que j’entends ? Ces bruits sont normaux.
HUMMM...
OUUCH....
OUIR !
„Le nouveau compresseur à rendement élevé peut
fonctionner plus longtemps et plus vite que votre
ancien réfrigérateur et vous pouvez entendre un
son modulé ou un ronflement aigu pendant son
fonctionnement.
„Parfois le réfrigérateur fonctionne pendant une période
prolongée, surtout lorsque les portes sont ouvertes
fréquemment. Cela signifie que la fonction Frost Guard ™
est active pour empêcher la brûlure de congélation et
améliorer la conservation des aliments.
„Vous pouvez entendre un sifflement lorsque les portes
se ferment. Cela vient de l’équilibrage de pression dans le
réfrigérateur.
CLICS, CLAQUEMENTS,
CRAQUEMENTS et
GRÉSILLEMENTS
„Vous pouvez entendre les ventilateurs tourner
à hautes vitesses. Cela se produit lorsque le réfrigérateur
vient d’être branché, lorsque les portes sont ouvertes
fréquemment ou lors de l’ajout d’une grande quantité
d’aliments dans les compartiments congélateur ou
réfrigérateur. Les ventilateurs permettent de maintenir
les bonnes températures.
„Si une des portes est ouverte pendant plus de
3 minutes, vous pouvez entendre l’activation des
ventilateurs permettant de refroidir les ampoules.
„Les ventilateurs changent de vitesses pour assurer des
économies d’énergie et un refroidissement optimaux.
BRUITS D’EAU
„Vous pouvez entendre des craquements ou des
„Le passage de l’agent
„Les registres électroniques s’ouvrent et se ferment pour
„L’eau tombant sur l’élément chauffant de dégivrage
„Le compresseur peut causer un clic ou un grésillement
„Un bruit de suintement d’eau peut être entendu
claquements lorsque le réfrigérateur est branché pour
la première fois. Cela se produit lorsque le réfrigérateur
se refroidit à la bonne température.
assurer des économies d’énergie et un refroidissement
optimaux.
lors de la tentative de redémarrage (cela peut prendre
5 minutes).
„Le tableau de commande électronique peut causer un
clic lorsque les relais s’activent pour commander les
composants du réfrigérateur.
„L’expansion et la contraction des serpentins de
refroidissement pendant et après le dégivrage peuvent
causer un craquement ou un claquement.
„Sur les modèles équipés d’une machine à glaçons,
après un cycle de fabrication de glaçons, vous pouvez
entendre les glaçons tomber dans le bac.
14
frigorifique dans les serpentins de refroidissement
du congélateur peut être accompagné d’un
gargouillement semblable à celui de l’eau en ébullition.
peut faire un bruit de grésillement, de claquement ou
de bourdonnement pendant le cycle de dégivrage.
pendant le cycle de dégivrage lorsque la glace
de l’évaporateur fond et tombe dans le bac de
récupération.
„ Fermer la porte peut causer un gargouillement
en raison de l’équilibrage de pression.
Avant d’appeler un réparateur…
&RQVHLOVGHGpSDQQDJH³eFRQRPLVH]GXWHPSVHWGH
l’argent! Consultez d’abord les tableaux qui suivent et vous
pourrez peut-être éviter de faire appel à un réparateur.
Problème
Causes possibles
Correctifs
Le réfrigérateur ne
fonctionne pas
Le cycle de dégivrage est peut-être en
cours.
Attendez environ 30 minutes afin que le cycle de
dégivrage puisse terminer.
Les commandes de température sont
réglées sur 0 (arrêt).
Changez le réglage du compartiment congélateur
en position de refroidissement plus inférieure.
Le réfrigérateur est débranché.
Enfoncez la fiche de l’appareil dans la prise murale.
Le disjoncteur ou le fusible peut avoir
sauté.
Remplacez le fusible ou réenclenchez le
disjoncteur.
Vibration ou bruit métallique
(une légère vibration est
normale)
Les roulettes de nivellement avant
doivent être réglées.
Consultez Roulettes.
Le moteur fonctionne
pendant de longues
périodes ou démarre et
s’arrête fréquemment. (Les
réfrigérateurs modernes et
leurs congélateurs étant
plus grands, leur moteur doit
fonctionner plus longtemps.
Ils démarrent et s’arrêtent
afin de maintenir des
températures uniformes.)
Ceci est normal lorsque le réfrigérateur
vient d’être branché.
Attendez 24 heures pour que le réfrigérateur
refroidisse complètement.
Une grande quantité d’aliments a été
mise au réfrigérateur.
C’est normal.
Porte laissée ouverte.
Vérifiez qu’il n’y a pas un paquet qui empêche la
porte de fermer.
Temps chaud ou ouverture fréquente des
portes.
C’est normal.
Les commandes de température ont été
réglées à la température la plus froide.
Consultez Les commandes.
La commande de température n’a pas
été réglée à une température assez
basse.
Consultez Les commandes.
Temps chaud ou ouverture fréquente des
portes.
Abaissez la commande de température d’une
position. Consultez Les commandes.
Porte laissée ouverte.
Vérifiez qu’il n’y a pas un paquet qui empêche la
porte de fermer.
Givre sur les aliments
surgelés (il est normal que du
givre se forme à l’intérieur
du paquet)
Porte laissée ouverte.
Vérifiez qu’il n’y a pas un paquet qui empêche la
porte de fermer.
La séparation entre
le réfrigérateur et le
congélateur est chaude
Le système automatique d’économie
d’énergie fait circuler du liquide chaud
autour du rebord avant du congélateur.
Ceci empêche la formation de condensation sur
l’extérieur du réfrigérateur.
Odeur/saveur anormale des
glaçons
Il faut nettoyer le bac à glaçons.
Videz et lavez le bac à glaçons. Jetez les vieux
glaçons.
Des aliments ont transmis leur odeur/
goût aux glaçons.
Emballez bien les aliments.
Il faut nettoyer l’intérieur du
réfrigérateur.
Consultez Entretien et nettoyage.
Porte laissée ouverte.
Vérifiez qu’il n’y a pas un paquet qui empêche
la porte de fermer.
La commande de température du
congélateur n’est pas réglée à une
température assez froide.
Consultez Les commandes.
Température trop élevée
dans le congélateur ou le
réfrigérateur
Formation lente des
glaçons
Les portes ont été ouvertes trop souvent
ou pendant trop longtemps.
15
Avant d’appeler un réparateur…
Problème
Causes possibles
Correctifs
Petits glaçons ou glaçons
creux à l’intérieur
Le filtre à eau est bouché.
Remplacez la cartouche du filtre avec une nouvelle.
La porte ne se referme pas
entièrement
Le joint de la porte colle ou se replie
du côté des charnières.
Appliquez un peu de vaseline sur la surface du joint.
Lueur orange dans le
congélateur
Le cycle de dégivrage est en cours.
C’est normal.
Le distributeur de glaçons ne
fonctionne pas (sur certains
modèles)
La machine à glaçons est éteinte ou
l’alimentation en eau a été coupée.
Mettez en marche la machine à glaçons ou
rétablissez l’alimentation en eau.
Des glaçons sont collés au bras
régulateur.
Retirez les glaçons.
Blocs de glace irréguliers dans le bac
à glaçons.
Brisez-en autant que possible avec vos doigts et jetez
ceux qui restent.
Le congélateur est peut-être trop chaud. Réglez la
commande du congélateur sur une température plus
basse, en abaissant la commande d’une position à la
fois jusqu’à ce que les blocs de glace disparaissent.
Distributeur est VERROUILLÉ.
Appuyez et maintenez enfoncée la touche Lock
(verrouillage) pendant 3 secondes.
Mauvais goût/odeur de l’eau
(sur certains modèles)
Le distributeur d’eau n’a pas été
utilisé depuis longtemps.
Faites couler l’eau jusqu’à ce que l’eau du système
soit remplacée par de l’eau fraîche.
L’eau versée dans le premier
verre est chaude (sur certains
modèles)
Normal lorsque le réfrigérateur est
initialement installé.
Attendez 24 heures pour que la température du
réfrigérateur se stabilise.
Le distributeur d’eau n’a pas été
utilisé depuis longtemps.
Faites couler l’eau jusqu’à ce que l’eau du système
soit remplacée par de l’eau fraîche.
Le réservoir d’eau vient d’être vidangé.
Attendez plusieurs heures pour que l’eau refroidisse.
Le distributeur d’eau ne
fonctionne pas (sur certains
modèles)
L’alimentation en eau est coupée ou
n’est pas raccordée.
Consultez Installation de la conduite d’eau.
Le filtre à eau est bouché.
Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Il y a de l’air dans la conduite d’eau.
Appuyez sur le bras de distribution pendant au moins
deux minutes.
Distributeur est VERROUILLÉ.
Appuyez et maintenez enfoncée la touche Lock
(réglage du verrouillage) pendant 3 secondes.
L’eau jaillit du distributeur
La cartouche du filtre vient d’être
installée.
Faites couler l’eau du distributeur pendant 3 minutes
(environ 6 litres).
Ne distribue pas d’eau
L’eau du réservoir est gelée.
Appelez un réparateur.
La machine à glaçons ne
distribue ni eau ni glaçons
La conduite d’eau ou le robinet
d’arrêt est bouché.
Appelez un plombier.
Le filtre à eau est bouché.
Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Distributeur est VERROUILLÉ.
Appuyez et maintenez enfoncée la touche Lock
(verrouillage) pendant 3 secondes.
Des aliments ont transmis leur odeur
au réfrigérateur.
Les aliments à odeur forte doivent être emballés
hermétiquement.
Odeur dans le réfrigérateur
Gardez une boîte ouverte de bicarbonate de soude
dans le réfrigérateur.
16
Il faut nettoyer l’intérieur.
Consultez Entretien et nettoyage.
Il faut nettoyer le système
d’évacuation de l’eau de dégivrage.
Consultez Entretien et nettoyage.
Problème
Causes possibles
Correctifs
De la condensation
s’accumule à l’extérieur
Cela n’est pas inhabituel pendant les
périodes de forte humidité.
Essuyez bien la surface extérieure.
De la condensation
s’accumule à l’intérieur (par
temps humide, l’ouverture
des portes laisse entrer de
l’humidité)
Les portes sont ouvertes trop
fréquemment ou pendant trop
longtemps.
L’éclairage intérieur ne
fonctionne pas
Il n’y a pas de courant au niveau de
la prise.
Remplacez le fusible ou réenclenchez le disjoncteur.
L’ampoule est grillée.
Consultez Remplacement des ampoules.
L’orifice d’écoulement au fond du
congélateur est peut-être bouché.
Consultez Entretien et nettoyage.
Il y a des glaçons bloqués dans le
conduit.
Faites passer les glaçons à l’aide d’une cuillère en
bois.
Eau sur le sol ou au fond du
congélateur
Air chaud à la base du
réfrigérateur
Courant d’air normal provenant du
moteur. Pendant le processusde
réfrigération, il est normal que de la
chaleur soit expulsée à la base du
réfrigérateur. Certains revêtements
de sol sont sensibles et peuvent
se décolorer sous l’effet de cette
température de fonctionnement
normale qui est sans danger.
Cubed Ice (glaçons) était
choisi mais Crushed Ice (glace
concassée) a été distribuée
(sur certains modèles)
Le réglage précédent était Crushed
Ice (glace concassée).
Quelques cubes sont restés et ont été concassés à
cause du réglage précédent. C’est normal.
La machine à glaçons ne
fonctionne pas (sur certains
modèles)
L’interrupteur de marche est à la
position OFF (arrêt).
Glissez l’interrupteur de marche à la position ON
(marche).
L’alimentation en eau est coupée ou
n’est pas raccordée.
Consultez Installation de la conduite d’eau.
Le compartiment congélateur est
trop chaud.
Attendez 24 heures pour que la température du
réfrigérateur se stabilise.
Un amas de glaçons dans le bac
provoque l’arrêt de la machine à
glaçons.
Nivelez les glaçons à la main.
Cubes de glace sont coincés dans la
machine à glaçons.
Arrêtez la machine à glaçons, retirez les cubes de
glace et remettez la machine en marche.
L’interrupteur de marche de la
machine à glaçons est à la position
ON (marche) mais l’alimentation
en eau du réfrigérateur n’est pas
branchée.
Glissez l’interrupteur de marche à la position OFF
(arrêt). Vous endommagerez le robinet d’eau en le
conservant en position ON (marche).
Bruit fréquent de vibrations
17
Garantie du réfrigérateur.
Toutes les réparations en vertu de la garantie sont fournis par nos Centre
de Service d’Usine ou par un technicien autorisé Customer Care®. Pour
prévoir une réparation, consultez notre site GEAppliances.com ou appelez le
800.GE.CARE5 (800.432.2737). Veuillez avoir votre numéro de série et votre
numéro de modèle à portée de main lorsque vous appelez pour obtenir un
service. Au Canada, appelez le 800.561.3344.
Agrafez votre facture ici.
Pour bénéficier du service
de réparation sous garantie,
une preuve de la date d’achat
initial est nécessaire.
Pendant la période de
garantie de :
GE Appliances remplacera :
Un An
A compter de la date d’achat
initial
Toute pièce du réfrigérateur qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée d’un an, GE Appliances fournira
également gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse.
Trente jours
Toute pièce de la cartouche filtrante qui ne fonctionne pas à cause d’un vice de matériau ou de
(filtre à eau, si inclus) A compter de main d’œuvre. Pendant la validité de la présente garantie limitée de 30 jours, GE Appliances fournira
la date d’achat initial
gratuitement une cartouche filtrante de remplacement.
SEULEMENT MODÈLES GE PROFILE™
Cinq Ans
Toute pièce du système fermé du réfrigérateur (compresseur, condenseur, évaporateur et tous
A compter de la date d’achat les tuyaux de raccordement) qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée de cinq an, GE Appliances fournira
également gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse dans le
système fermé du réfrigérateur.
Ce qui n’est pas couvert par GE Appliances :
■ Les déplacements à votre domicile pour vous expliquer
l’utilisation de ce produit
■ Une installation, livraison ou maintenance défectueuse.
■ Une panne du produit par abus d’utilisation, par mauvaise
utilisation, par modification ou s’il a été utilisé dans un but autre
que celui pour lequel il a été fabriqué.
■ Détérioration des aliments.
■ Le remplacement des fusibles ou le réenclenchement du
disjoncteur du domicile.
■ Les dommages causés après la livraison.
■ Le remplacement de la cartouche filtrante, si incluse, à cause
d’une pression d’eau en dehors de la gamme de fonctionnement
recommandée ou à cause d’une concentration excessive de
sédiments dans l’eau d’alimentation.
■ Le remplacement des ampoules, si incluses, ou la cartouche
filtrante, si incluse, et dans des conditions autres que celles
susmentionnées.
■ Tout dommage causé par accident, incendie, inondation ou une
catastrophe naturelle.
■ Tout dommage fortuit ou indirect causé par des défauts
éventuels de cet appareil.
■ Le service s’il est impossible d’avoir accès au produit.
■ Dommages causés par l’utilisation d’un filtre qui n’est pas de
marque GE Appliances.
■ Tout dommage au fini de l’appareil doit être signalé auprès du
magasin où a été effectué l’achat dans les 48 heures suivant
la livraison de l’appareil.
EXCLUSION DES GARANTIES TACITES - Votre recours exclusif est l’échange du produit suivant les modalités de
la Garantie Limitée. Toutes garanties tacites, y compris les garanties de valeurs marchandes ou d’adéquation
à des fins particulières, sont limitées à une durée d’un an ou à la durée la plus courte autorisée par la loi.
Pour les clients des États-Unis : Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants
pour tout produit acheté pour une utilisation domestique aux États-Unis. Si le produit est installé dans une région
où ne se trouve aucun réparateur autorisé GE Appliances, vous devrez peut-être assumer les frais de transport
ou apporter l’appareil à un centre de service autorisé GE Appliances. En Alaska, cette garantie exclut le coût
d’expédition ou de dépannage à votre domicile.
Certains états n’acceptent pas d’exclusion ou de limites aux dommages indirects consécutifs. Certains droits
particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres droits qui
varient selon votre lieu de résidence. Pour connaître vos droits juridiques, veuillez consulter le bureau local ou le
bureau d’état des affaires aux consommateurs ou le Procureur Général de votre état.
Garant : États-Unis : General Electric Company. Louisville, KY 40225
Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants pour tout produit acheté aux
Canada pour une utilisation domestique aux Canada.Le service à domicile en vertu de la garantie sera fourni
dans les régions où il est disponible et où Mabe estime raisonnable de le fournir.
Garant Canada: MC Commercial, Burlington, Ontario, L7R 5B6
18
Fiche technique de performance
Système de filtration SmartWaterMC - Cartouche MWF
Données relatives au rendement
Capacité : 300 gallons (1135 litres)
/DFRQFHQWUDWLRQGHVFRQWDPLQDQWVWHVWpVSRXUFH¿OWUHGDQVO·HDXHQWUDQWGDQVOHV\VWqPHDpWpUpGXLWH
à une valeur inférieure ou égale à la limite admissible dans l’eau sortant du système, conformément aux
QRUPHVHWGHOD16)$16,/HV\VWqPHDpWpWHVWpHWFHUWL¿pSDU16),QWHUQDWLRQDOFRQIRUPpPHQW
aux normes 42 et 53 de la NSF/ANSI.
Veuillez visiter geappliances.com pour connaître la liste complète des contaminants testés et des
concentrations réduites.
Les énoncés de réduction pharmaceutiques n’ont pas été certifiés par la NSF International ou l’état de la Californie.
Énoncés éprouvés et vérifiés par un laboratoire indépendant :
Réduction
de contaminant
Aténolol
Fluoxétine
Ibuprofène
Progestérone
Triméthoprime
Moyenne pour l’eau
d’alimentation
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
Concentration d’amorce
spécifiée par NSF
N/A
N/A
N/A
N/A
N/A
Concentration
Concentration
max permissible
moyenne de
% réduction
en sortie
substance en sortie
moyenne
99.5%
5.0 ng/L
N/A
99.4%
5.4 ng/L
N/A
94.1%
52.3 ng/L
N/A
99.5%
5.0 ng/L
N/A
99.5%
2.0 ng/L
N/A
Exigences de
réduction NSF
N/A
N/A
N/A
N/A
N/A
Rapport
d’essai NSF
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Directives et paramètres de l’alimentation en eau
Débit fourni
Alimentation en eau
0.5 gpm (21.9 lpm)
Eau potable
Pression d’eau
Température de l’eau
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
Il est impératif que les méthodes d’installation, d’entretien et de remplacement du filtre recommandées par le fabricant de ce produit soient respectées.
Consultez le manuel d’installation pour connaître les renseignements de la garantie.
Remarque : Bien que les essais aient été effectués dans des conditions normales
de laboratoire, la performance actuelle peut varier.
Cartouche de rechange : MWF. Pour connaître les coûts évalués des articles de
rechange, veuillez appeler au 800.661.1616 ou visitez notre site internet au
geapplianceparts.com.
AVIS
Pour réduire le risque associé aux dommages matériels causés par des fuites d’eau :
• Lisez et suivez les instructions avant de procéder à l’installation et d’utiliser votre système.
• L’installation et l’utilisation DOIVENT être conformes à tous les codes locaux
et nationaux de plomberie.
• Ne procédez pas à l’installation si la pression de l’eau dépasse 120 lb/po² (8,2 bars).
AVERTISSEMENT
Si votre pression d’eau dépasse 80 lb/po² (552 kPa), il est nécessaire d’installer un système
Pour réduire le risqué associé à l’ingestion de contaminants :
de limitation de pression. Communiquez avec un plombier professionnel si vous n’êtes
• N’utilisez pas l’eau dont la salubrité microbiologique est inconnue ou
pas sûr de la méthode de vérification de la pression d’eau.
dangereuse sans avoir effectué une désinfection des composants d’arrivée
• N’installez pas le système s’il y a des possibilités de coups de bélier. En cas de coup
et de sortie du système. Les systèmes certifiés pour la réduction de kystes
de bélier, vous devez installer un dispositif anticoup de bélier. Communiquez avec un
peuvent être utilisés pour de l’eau désinfectée contenant des kystes filtrables.
plombier professionnel si n’êtes pas sûr de la méthode permettant de vérifier cette condition.
Établissement EPA no 10350-MN-005.
• Ne raccordez pas le système à des conduites d’alimentation d’eau chaude.
Consultez la fiche technique de performance pour connaître les conditions d’utilisation, La température de service maximale de ce système de filtre est de 38 °C (100 °F).
les énoncés de santé certifiés par le service de santé publique de la Californie et les
• Protégez le filtre contre le gel. Vidangez l’eau du filtre lorsque la température se situe
remplacements. Certification du service de santé publique de la Californie
sous 0,6 °C (33 °F).
no 05-1698. Les contaminants qui peuvent être réduits ou éliminés par ce filtre à eau • La cartouche du filtre jetable doit être remplacée tous les six (6) mois ou moins si
ne sont pas obligatoirement présents dans votre eau.
le débit d’eau du distributeur d’eau ou du distributeur de glace diminue.
ARTICLE
DE RECHANGE
Mis à l’essai et certifié par NSF International
conformément aux normes 42 et 53 de la
ANSI/NSF du modèle MWF pour les
énoncés de réductions mentionnés à la
fiche technique de performance.
19
Service à la clientèle.
Site Web appareils électroménagers GE
electromenagersge.ca
Vous avez une question ou vous avez besoin d’aide pour votre appareil électroménager? Contactez-nous par
Internet au site electromenagersge.ca 24 heures par jour, tous les jours de l’année.
Service de réparations
1.800.561.3344
Service de réparations GE Appliances est tout près de vous.
Pour faire réparer votre électroménager GE Appliances, il suffit de nous téléphoner.
Studio de conception réaliste
Sur demande, GE Appliances peut fournir une brochure sur l’aménagement d’une cuisine pour les personnes
à mobilité réduite.
Écrivez: Directeur, Relations avec les consommateurs, Mabe Canada Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Prolongation de garantie
electromenagersge.ca
Achetez un contrat d’entretien GE avant que votre garantie n’expire et bénéficiez d’un rabais substantiel. Ainsi
le service après-vente GE sera toujours là après expiration de la garantie.
Visitez notre site Web ou appelez-nous au 1.800.290-9029.
Pièces et accessoires
Ceux qui désirent réparer eux-mêmes leurs électroménagers peuvent recevoir pièces et accessoires
directement à la maison (cartes VISA, MasterCard et Discover acceptées).
Les directives stipulées dans le présent manuel peuvent être effectuées par n’importe quel utilisateur. Les
autres réparations doivent généralement être effectuées par un technicien qualifié. Soyez prudent, car
une réparation inadéquate peut affecter le fonctionnement sécuritaire de l’appareil.
Vous trouverez dans les pages jaunes de votre annuaire le numéro du Centre de service Mabe le plus proche.
Autrement, appelez-nous au 1.800.661.1616.
Contactez-nous
Si vous n’êtes pas satisfait du service après-vente dont vous avez bénéficié :
Premièrement, communiquez avec les gens qui ont réparé votre appareil.
(QVXLWHVLYRXVQ·rWHVWRXMRXUVSDVVDWLVIDLWHQYR\H]WRXVOHVGpWDLOV³QXPpURGHWpOpSKRQHFRPSULV³DX
Directeur, Relations avec les consommateurs, Mabe Canada Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Inscrivez votre appareil électroménager
electromenagersge.ca
Inscrivez votre appareil électroménager en direct, aussitôt que possible. Cela améliorera nos communications
et notre service après-vente. Vous pouvez également nous envoyer par la poste le formulaire d’inscription
joint à votre documentation.
20
Refrigeradores
Lado a lado
INFORMACIÓN DE SEGURIDAD
Cables de extensión . . . . . . . . . . . . . . . .
Conectar la electricidad . . . . . . . . . . . . .
Deshacerse debidamente
de su refrigerador . . . . . . . . . . . . . . . . . .
Precauciones de seguridad . . . . . . . . . .
3
2
MANUAL DEL
PROPIETARIO E
INSTALACIÓN
3
2
Modelos 20, 22, 25
INSTRUCCIONES DE OPERACIÓN
Cartucho del filtro de agua . . . . . . . . . . 8
Controles del refrigerador . . . . . . . . . . . 6
Dispensador . . . . . . . . . . . . . . . . . . . . . . . 7
Dispositivo automático
para hacer hielo . . . . . . . . . . . . . . . . . . 7-8
Entrepaños y recipientes . . . . . . . . . 4-5
Gavetas de almacenamiento. . . . . . . . . 5
Instalación de las características . . . . . 4
ESPAÑOL
CUIDADO Y LIMPIEZA
Limpieza. . . . . . . . . . . . . . . . . . . . . . . . 9-10
Reemplazo de bombillas . . . . . . . . . . . 10
INSTRUCCIONES DE
INSTALACIÓN
Instalación de la línea
de agua. . . . . . . . . . . . . . . . . . . . . . . . . 13-16
Preparación para
instalar el refrigerador . . . . . . . . . . . 11-12
SOLUCIONAR PROBLEMAS
Antes de solicitar un servicio . . . . 18-20
Sonidos normales
de la operación. . . . . . . . . . . . . . . . . . . . .17
SERVICIO AL CONSUMIDOR
Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . .21
Hoja de datos de
funcionamiento . . . . . . . . . . . . . . . . . . . 22
Servicio al consumidor . . . . . . . . . . . . . 23
1
IMPORTANTE INFORMACIÓN DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
SEGURIDAD
Sitio Web de GE Appliances
Para más información sobre el funcionamiento de su refrigerador, visite
GEAppliances.com o comuníquese al 1-800-GECARES (432-2737).
INFORMACIÓN DE SEGURIDAD DEL REFRIGERADOR
Éste es el símbolo de alerta de seguridad. El mismo alerta sobre potenciales riesgos de muerte o lesiones tanto para usted
con para otras personas. Todos los mensajes de seguridad estarán a continuación del símbolo de alerta de seguridad y con la
palabra “PELIGRO”, “ADVERTENCIA” o “PRECAUCIÓN”. Estas palabras se definen como:
PELIGRO
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
ADVERTENCIA
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures graves, voire la mort. .
PRECAUCIÓN Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures mineures ou graves.
ADVERTENCIA
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
A fin de reducir el riesgo de incendio, explosión, descargas eléctricas o lesiones al usar
su refrigerador, siga estas precauciones básicas de seguridad:
„ Este refrigerador se deberá instalar y ubicar adecuadamente
de acuerdo con las Instrucciones de Instalación antes de ser
usado.
„ Desenchufe el refrigerador antes de hacer reparaciones,
reemplazar una lámpara de luz o hacer una limpieza.
Nota: La corriente que va al refrigerador no puede ser
desconectada por ninguna configuración del panel de control.
Nota: Las reparaciones deberán ser realizadas por un Profesional
del Servicio Técnico calificado.
„ Reemplace todas las piezas y paneles antes del uso.
„ No guarde ni use gasolina u otros vapores inflamables y líquidos
cerca de este u otros electrodomésticos.
„ Debido a los posibles riesgos sobre la seguridad bajo
ciertas condiciones, recomendamos enfáticamente no usar
PRECAUCIÓN
„ A fin de evitar riesgos de que los niños sufran asfixia o queden
atrapados, retire las puertas de comidas frescas y del freezer de
cualquier refrigerador antes de deshacerse o dejar de usar el
mismo.
„ No permita que los niños se trepen, paren o cuelguen de
las manijas de la puerta o de los estantes del refrigerador.
Podrían sufrir lesiones graves.
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
$¿QGHUHGXFLUHOULHVJRGHOHVLRQHVDOXVDUHOUHIULJHUDGRUVLJDHVWDVSUHFDXFLRQHV
básicas.
„ No limpie estantes de vidrio ni tapas con agua caliente cuando
estén fríos. Los estantes de vidrio y las tapas se pueden romper si
son expuestos a cambios de temperatura repentinos o impactos,
tales como sacudones o caídas. El vidrio templado está diseñado
para destruirse en pequeñas piezas en caso de rotura.
„ Mantenga los dedos fuera de los espacios de “riesgo de
lastimaduras”; los despejes entre las puertas y entre las puertas y
el gabinete son necesariamente pequeños. Tenga el cuidado de
cerrar las puertas cuando los niños se encuentren en el área.
2
prolongadores. Sin embargo, si se debe usar un prolongador,
es absolutamente necesario que sea un prolongador para
electrodoméstico de la lista UL (en Estados Unidos) o uno
certificado por CSA (en Canadá), de 3 cables con conexión a
tierra, que cuente con un enchufe con conexión a tierra y un
tomacorriente con una graduación eléctrica del cable de 15
amperes (mínimo) y 120 volts.
„ No toque las superficies frías del compartimiento del freezer
cuando las manos estén húmedas o mojadas, ya que la piel se
podrá adherir a estas superficies extremadamente frías.
„ No vuelva a congelar comidas que hayan estado totalmente
congeladas en forma previa.
„ En refrigeradores con máquinas de hacer hielo automáticas,
evite el contacto con las partes móviles del mecanismo
eyector o con el elemento de calefacción que libera los
cubos. No coloque los dedos ni las manos en el mecanismo
de la máquina de hielo automática mientras el refrigerador
esté enchufado.
IMPORTANTE INFORMACIÓN DE SEGURIDAD.
LEA TODAS LAS INSTRUCCIONES ANTES DE SU USO.
SEGURIDAD
GEAppliances.com
(CONT.)
ADVERTENCIA
Riesgo de Explosión.
Mantenga cualquier material y vapores inflamables, tales como gasolina, alejados del refrigerador. Si
no se cumple con esto se podrá producir una explosión, incendio o la muerte.
CONEXIÓN DE LA ELECTRICIDAD
ADVERTENCIA
Riesgo de Descarga Eléctrica.
Enchufe en un tomacorriente con conexión a tierra de 3 cables.
No elimine el cable de conexión a tierra.
No use un adaptador.
Si no se siguen estas instrucciones se podrá producir a muerte, incendios o descargas eléctricas.
Nunca, bajo ninguna circunstancia, corte o elimine el tercer cable (tierra) del cable de corriente.
Para su seguridad personal, este electrodoméstico debe estar adecuadamente conectado a tierra.
El cable de corriente de este electrodoméstico contiene un enchufe
de 3 cables (conexión a tierra) que se conecta a un tomacorriente
de pared estándar de 3 cables (conexión a tierra) para minimizar la
posibilidad de riesgos de descargas eléctricas por parte del mismo.
Contrate a un electricista calificado para que controle el tomacorriente
y el circuito eléctrico, a fin de asegurar que el enchufe esté
correctamente conectado a tierra.
En caso de contar con un tomacorriente de pared de 2 cables, es
su responsabilidad y obligación reemplazarlo por un tomacorriente
de pared de 3 cables correctamente conectado a tierra. No use un
adaptador.
El refrigerador debería estar siempre conectado a un enchufe
específico con un índice de voltaje equivalente al que figura en su
etiqueta de características técnicas.
Se requiere un suministro eléctrico con fusible y conexión a tierra de
115 voltios de CA, 60 Hz, 15 o 20 amperes. Esto garantiza el mejor
funcionamiento y además previene la sobrecarga de los circuitos
del hogar, lo cual podría ocasionar riesgos de incendio debido al
recalentamiento de cables.
Nunca desenchufe el refrigerador tirando del cable de corriente.
Siempre tome su enchufe firmemente y empuje el mismo hacia afuera
para retirarlo.
Repare o reemplace de inmediato todos los cables de corriente pelados
o con cualquier tipo de daño. No use un cable con cortaduras o
abrasión sobre su extensión o extremos.
Al alejar el refrigerador de la pared, se deberá tener cuidado de que no
ruede sobre ni dañe el cable de corriente.
FORMA ADECUADA DE DESCARTAR SU ANTIGUO REFRIGERADOR
ADVERTENCIA
: Riesgo de que los niños sufran asfixia o y queden atrapados.
Retire del refrigerador las puertas de comidas frescas y del freezer, antes de descartar el refrigerador.
Si esto no se realiza, los niños podrán quedar atrapados y ocasionar la muerte o daño cerebral.
IMPORTANTE:
Que un niño quede atrapado o que sufra una asfixia no son problemas
del pasado. Los refrigeradores antiguos o abandonados aún son
peligrosos, incluso aunque se conserven por “sólo unos pocos días”. Si
se deshará de su antiguo refrigerador, siga las siguientes instrucciones
a fin de evitar accidentes.
Antes de Descartar su Antiguo Refrigerador o Freezer:
Refrigerantes
Todos los productos de refrigeración cuentan con refrigerantes,
que de acuerdo con la ley federal deberán ser eliminados antes
de descartar el producto. Si se deshará de un producto de
refrigeración antiguo, consulte a la compañía a cargo sobre cómo
deshacerse del mismo.
„ Retire las puertas de comidas frescas y del freezer.
„ Deje los estantes en su lugar de modo que los niños no puedan
trepar dentro con facilidad.
LEA Y SIGA ESTA INFORMACIÓN DE SEGURIDAD CUIDADOSAMENTE.
GUARDE ESTAS INSTRUCCIONES
3
Cómo instalar los accesorios.
(No todos los modelos tienen todos los accesorios)
➀ (175(3$³2683(5,25
➁ CARTUCHO DEL FILTRO
DEL CONGELADOR
Retire el tapón
de derivación
Cerciórese de que la parte frontal
del entrepaño ajusta en su posición.
➂ TAPA DE LOS PRODUCTOS
Instale el cartucho
del filtro
LÁCTEOS
Entrepaño superior
del congelador
➃ CONSERVADOR DE LAS
BOTELLAS
➆ )5(17(6'(/26(175(3$³26
DE LA PUERTA DEL CONGELADOR
Cerciórese de que la parte frontal del
entrepaño ajusta en su posición.
NOTA: En los modelos con dispensador,
los frentes de los entrepaños más largos
van en las dos posiciones superiores.
➄ CUBOS DE LA PUERTA
AJUSTABLES
ACOMODADORES
DEL CUBO DE LA PUERTA
Frente del
entrepaño
de la puerta
Entrepaño
de la
puerta
➅ CUBOS INFERIORES
FIJOS DE LA PUERTA
Para retirarlos: Levante el extensor Cerciórese de que los frentes de los cubos ajustan en su posición.
del entrepaño hacia arriba, después
hálelo.
Para reemplazarlo: Enganche
el extensor del entrepaño en los
soportes moldeados de la puerta y
empújelo hasta que se asegure en
su lugar.
Cubo inferior de la puerta
Para retirar: Levante el frente
del cajón y después hálelo.
Para reemplazar o cambiar
de lugar: Encaje el cajón en
los soportes moldeados
de la puerta y empuje hacia
adentro. El cajón se ajustará
en su lugar.
Los entrepaños y recipientes. (No todos los modelos tienen todos los accesorios)
Reubicación de los entrepaños
Entrepaños del refrigerador:
Para reemplazar
Para retirar
Levante y hale
Cacerola del congelador:
Entrepaños del congelador
(en algunos modelos) :
Para retirar
Para retirar
Inclínelo
2
Inserte
el gancho
superior
Bájelo para
asegurarlo
en su lugar
4
3
4
Retire la cacerola empujándola
hacia el frente, levantando
el frente y deslizándola hasta
pasar el punto de parar.
1
GEAppliances.com
Entrepaños del congelador (en algunos modelos) :
1
Soporte
Soporte
1
2
2
1
2
3
Soporte
1. Levante el lado derecho de la repisa, desde
el frente y la parte trasera, hasta que
escuche un chasquido.
2. Empuje la repisa hacia la derecha sobre la
parte superior del soporte. Los extremos
izquierdos de la repisa se liberarán de los
soportes izquierdos.
3. Incline el lado izquierdo hacia abajo para
liberar los extremos derechos de los soportes
derechos.
4. Empuje hacia delante para retirar la repisa
del refrigerador.
5. Siga los pasos del 4 al 1 para instalar la
repisa en la nueva ubicación.
4
Entrepaño deslizable a prueba de derramamientos (en algunos modelos)
El entrepaño deslizable permite alcanzar artículos
guardados atrás de otros. Los bordes especiales
están diseñados para ayudar a prevenir
derramamientos o goteos a los entrepaños que se
encuentran más abajo.
NOTA: Asegúrese de haber empujado los
entrepaños hasta el fondo antes de cerrar
la puerta.
Entrepaños a prueba de derrames (en algunos modelos)
Los entrepaños a prueba de derrames tienen
bordes especiales que ayudan a evitar que los
derrames goteen hacia los estantes siguientes.
Sobre las gavetas de almacenamiento. (No todos los modelos tienen todos los accesorios)
Gavetas preservadoras de humedad ajustable y bandeja de refrigerios
HIGH
HIGH
LOW
LOW
Normal
Más fria
Guías de
la gaveta
Cuando se encuentre reemplazando
las gavetas, cerciórese de deslizarlas
a lo largo de las guías.
(en algunos modelos)
Deslice el control hasta llegar a la posición High
(alto) para proporcionar el alto nivel de humedad
recomendado para la mayoría de los vegetales.
Deslice el control hasta llegar a la posición Low
(bajo) para proporcionar el nivel de baja humedad
recomendado para la mayoría de las frutas.
Contenedor convertible para carnes (en algunos modelos)
Esto contenedor convertible para carnes tiene su
propio conducto de refrigeración, el cual permite
la circulación en dicha contenedor de aire frío
proveniente del congelador.
El control de temperatura variable regula el flujo
de aire del compartimiento del congelador.
Fije la palanca de control arriba (up) para
convertir el contenedor a la temperatura normal
del refrigerador y ofrecer espacio adicional de
almacenamiento para los vegetales. El conducto
del aire frío se apaga. Se pueden seleccionar
diferentes niveles entre estos extremos.
Fije la palanca de control abajo (down) para la
posición más fría para almacenar carnes frescas.
Si la palanca se deja en la posición de carnes por
un largo período de tiempo, se puede formar algo
de hielo dentro del contenedor.
Como sacar la gaveta preservadora de alimentos
Las gavetas se pueden retirar fácilmente
inclinándolas levemente y empujándolas hasta
pasar el punto de freno.
Si la puerta le impide sacar las gavetas,
el refrigerador tendrá que rodarse hacia adelante
hasta que la puerta se abra lo suficiente para
deslizar las gavetas hacia afuera. En algunos
casos, cuando ruede el refrigerador hacia afuera
deberá moverlo hacia la izquierda mientras lo
rueda.
5
Los controles del refrigerador.
No todas las funciones corresponden a todos los modelos. Es posible que sus controles sean similares a los siguientes:
Freezer
Refrigerator
Los controles de temperatura fueron configurados previamente
en la fábrica en 37°F para el compartimiento del refrigerador
y en 0°F para el compartimiento del freezer. Espere 24 horas
hasta que la temperatura se estabilice en los ajustes de
preconfiguración recomendados.
Es posible que los controles de temperatura muestren la
temperatura en SET (Ajustada) y la temperatura real en el
refrigerador y en el freezer. La temperatura real puede variar
levemente en relación a la temperatura en SET (Ajustada) en
base al uso y al ambiente donde se usa.
Para bloquear el dispensador (en algunos
modelos)
Presione la tecla Lock Controls (bloqueo)
durante 3 segundos para cerrar el
dispensador y el panel de control. Para
desbloquearlo, presione la misma tecla durante 3
segundos nuevamente.
Cómo usar el dispensador (en algunos modelos)
Seleccione
o
Presione el vaso suavemente contra el brazo del
dispensador.
6
Los controles de temperatura fueron configurados previamente
en la fábrica en “5” para el compartimiento del refrigerador
y en “5” para el compartimiento del freezer. Espere 24 horas
hasta que la temperatura se estabilice en los ajustes de
preconfiguración recomendados.
NOTA: Las configuraciones en pantalla son “1” nivel más
caliente, “9” nivel más frío y “0” apagado
Luz del dispensador
Esta tecla enciende y apaga la luz del
dispensador. La luz también se enciende al
presionar el brazo del dispensador. Si esta luz se
funde debería reemplazarse con una bombilla de
un máximo de 6 vatios.
Indicador de Reemplazo del Filtro de Agua
La luz sobre este botón se iluminará cuando sea
necesario realizar el cambio del filtro de agua. Una
vez cambiado el filtro, mantenga presionado este
botón durante 3 segundos para apagar la luz. Para
más detalles, lea la sección “Acerca del Cartucho
del Filtro de Agua”.
El dispensador. (en algunos modelos)
GEAppliances.com
El estante antiderrame no se vacía de
forma automática. Para reducir las
manchas de agua, el estante y su parrilla
se deberán limpiar de forma regular.
Recogedor
Si no se dispensa agua luego de la
instalación del refrigerador, es posible
que haya aire en el sistema de la tubería
de agua. Si no se dispensa agua cuando
el refrigerador se instala por primera vez,
es posible que la cañería de agua posea
aire. Presione el brazo dispensador
durante por lo menos dos minutos para
eliminar el aire atrapado de la cañería de
agua y para llenar el sistema de agua. A
fin de limpiar las impurezas en la cañería
de agua, descarte los seis primeros
vasos de agua.
PRECAUCIÓN Nunca coloque los
dedos o cualquier otro objeto en la
abertura de descarga de la picadora de
hielo.
Gaveta de almacenamiento
de hielo en modelos con dispensador
Para sacar: Deslice el interruptor de marcha del
dispositivo de hielo en la posición OFF (apagado).
Jale de la gaveta directamente hacia fuera y
luego levántela hasta pasar el punto donde se
atranca.
Para devolver: Al devolver la gaveta, asegúrese
de presionarla firmemente en su sitio. Si no
llega hasta el final, vuelva a sacarla y gire el
mecanismo de manejo 1/4 de vuelta. Luego
empuje de nuevo el entrepaño.
Gire
Mecanismo
de manejo
Datos importantes de su dispensador
„
No agregue hielo de charolas o de bolsas en el recipiente. Podría
provocar que no salga bien o que no se triture adecuadamente.
„
Evite los vasos demasiado llenos de hielo y el uso de vasos
estrechos o demasiado altos. El hielo amontonado podría
obstruir el orificio o hacer que se congele la puerta del orifico de
manera que no se pueda abrir. Si hubiera hielo bloqueándolo,
desprenda con una cuchara de madera.
„
Las bebidas y los alimentos no se deberán enfriar rápidamente
en el recipiente del hielo. Las latas, botellas
o paquetes de comida en el recipiente de hielos podrían causar
la obstrucción del dispositivo para hacer hielo o
del recipiente.
„
Para evitar que el hielo dispensado caiga fuera del vaso, ponga
el vaso cerca, pero sin tocar, la apertura del dispensador.
„
Un poco de hielo triturado puede surtir aunque había
seleccionado Cubed (cubos). Esto sucede en ocasiones cuando
algunos cubos se canalizan en el triturador.
„
Después de usar hielo triturado, un poco de agua puede gotear
del vertedero.
„
A veces, se formará un pequeño montón de nieve en la salida
del hielo situada en la puerta. Esto es normal y, por regla general,
sucede cuando ha dispensado hielo picado repetidamente. La
nieve se evaporará por sí misma.
„
El agua del primer vaso servido puede estar más caliente que la
de los siguientes vasos. Eso es normal.
„
El agua del dispensador no es agua helada. Para obtener agua
más fría, simplemente agregue hielo picado o cubitos de hielo
antes de servirla.
El dispositivo automático para hacer hielo.
Es normal que algunos cubos salgan pegados.
Kit accesorio para hielos
Si no se usa hielo con frecuencia, los cubos de hielo viejos se opacan,
adquieren un sabor rancio y se contraen.
Si su refrigerador no viene equipado con un dispositivo para hacer
hielo, un kit accesorio para hielos está disponible a un costo adicional.
Consulte en la parte posterior del refrigerador el kit específico para
hielos que su modelo necesita.
7
El dispositivo automático para hacer hielo.
Un refrigerador recién instalado puede tardar hasta 12 a 24 horas antes de empezar a hacer hielo.
Dispositivo para
hacer hielo
Interruptor de Brazo detector
alimentación
El dispositivo automático para hacer
hielo (en algunos modelos)
Cuando el refrigerador está conectado al suministro
de agua, deslice el interruptor de alimentación
eléctrica en la posición ON (encendido).
El dispositivo para hacer hielo se llenará de agua
cuando la temperatura alcance el punto de -9°C
(15°F). Cuando el recipiente está lleno (al nivel del
brazo detector), el dispositivo para hacer hielo no
producirá hielo.
Asegúrese de que nada impide el movimiento del
brazo detector.
Deshaga las primeras cargas de cubos de hielo para
permitir que la línea de agua se limpie.
El dispositivo para hacer hielo producirá siete cubos
SRUFLFOR³DSUR[LPDGDPHQWH²FXERVHQXQ
ciclo de 24 horas, dependiendo de la temperatura
del congelador, de la temperatura ambiente, del
número de veces que se abra la puerta y de otras
condiciones del uso.
Escuchará un zumbido cada vez que el dispositivo
para hacer hielo se llene de agua.
PRECAUCIÓN
Evite el contacto con las
partes en movimiento del mecanismo expulsor
o con el elemento de calefacción (ubicado en la
parte inferior de la máquina de hielos) que expulsa
los cubos. No coloque los dedos ni las manos en el
mecanismo de la máquina de hielos automática
mientras el refrigerador esté enchufado.
El cartucho delfiltro de agua. (en algunos modelos)
Cartucho del filtro de agua
El cartucho del filtro de agua está ubicado en el extremo superior
trasero derecho del compartimiento del refrigerador.
Cuándo se debe reemplazar el filtro en modelos
con luz indicadora de reemplazo
Se cuenta con una luz indicadora de reemplazo del cartucho del filtro
de agua en el dispensador. Cuando esta luz se vuelva anaranjada,
significa que se deberá reemplazar el filtro de forma rápida.
El cartucho del filtro deberá ser reemplazado cuando la luz
indicadora de reemplazo se vuelva roja o si se reduce el flujo
de agua hacia el dispensador o la máquina de hacer hielo.
Cuándo se debe reemplazar el filtro en modelos
sin luz indicadora de reemplazo
El cartucho del filtro se debería reemplazar cada seis meses
o antes si se observa una reducción en el flujo de agua hacia
el dispensador o en la máquina de hacer hielo.
Retiro del cartucho del filtro
Si se reemplazará el cartucho, primero retire el anterior girando
lentamente el mismo hacia la izquierda. No empuje el cartucho
hacia abajo. Es posible que gotee una pequeña cantidad de agua.
PRECAUCIÓN: A fin de reducir el riesgo asociado con daños
sobre la propiedad debido a una pérdida de agua, lea y siga
las siguientes instrucciones antes de instalar y usar este sistema.
La instalación y el uso DEBERÁN cumplir con todos los códigos
de plomería estatales y locales.
Instale el cartucho del tiltro
1 Llene el cartucho de reemplazo con agua del grifo para permitir
un mejor flujo desde el dispensador inmediatamente después
de la instalación.
2 Alinee la flecha del cartucho con el recipiente del cartucho. Coloque
la parte superior del cartucho nuevo hacia arriba dentro del recipiente.
No lo empuje dentro del recipiente.
3 De forma lenta, gire el mismo hacia la derecha hasta
que el cartucho del filtro se detenga. NO AJUSTE
Recipiente
EN EXCESO. A medida que gire el cartucho, éste
delridge
Cartucho
older
se elevará de forma automática hasta su posición.
El cartucho se dará aproximadamente ½ giro.
4 Deje correr 1-1/2 galones de agua del dispensador (unos
tres minutos) a fin de despejar el sistema y evitar una salida irregular.
5 Mantenga presionada la tecla RESET WATER FILTER (Reiniciar Filtro
de Agua) (en algunos modelos) del dispensador durante tres segundos.
NOTA: Un cartucho del filtro de agua instalado en forma reciente
puede hacer que chorree agua del dispensador.
Tapón del bypass del filtro
Deberá usar el tapón de bypass del filtro cuando no disponga de un
cartucho del filtro para su reemplazo. El dispensador y la máquina
de hacer hielo no funcionarán sin el filtro o el tapón del bypass del filtro.
Tapón de
Bypass del Filtro
SmartWater
Tapón de ter
Bypass del Filtro
ss
Water by Culligan
ug
Para usar el tapón del bypass del filtro en modelos de Water by Culligan™,
primero se deberá retirar el adaptador del filtro que se encuentra
en el recipiente del cartucho, girando el mismo hacia la izquierda.
ADVERTENCIA
ADVERTENCIA
A fin de reducir el riesgo asociado con descargas, no permita que los niños menores de 3 años tengan acceso a las partes pequeñas
durante la instalación de este producto. El cartucho del filtro descartable debería ser reemplazado cada 6 meses luego
de un uso normal, o antes si se produce una reducción notoria en el caudal.
Para obtener el máximo beneficio de su sistema de filtrado, GE recomienda el uso de los filtros de la marca GE únicamente. El uso de filtros
de la marca GE en refrigeradores GE y Hotpoint® brinda un óptimo funcionamiento y confiabilidad. Los filtros GE cumplen con rigurosos
estándares NSF de la industria sobre seguridad y calidad, que son importantes para los productos que están filtrando su agua. GE no posee
filtros de la marca GE que no estén calificados para su uso en refrigeradores GE y Hotpoint, y no existe seguridad de que los filtros que no
son de la marca GE cumplan con los estándares de GE en relación a calidad, funcionamiento y confiabilidad.
Ante cualquier consulta, o para ordenar cartuchos de filtros adicionales, visite nuestro sitio web en www.gewaterfilters.com,
o llame a GE Parts and Accessories (Piezas y Accesorios de GE), 800.626.2002.
Los clientes de Canadá deberán buscar el Centro de Servicio Técnico Camco en las páginas amarillas.
8
Cuidado y limpieza del refrigerador.
GEAppliances.com
Limpiar el exterior
El pozo del dispensador (en algunos modelos),
por debajo de la parrilla, se debe mantener
limpio y seco. El agua que se queda en el pozo
puede dejar depósitos. Quite los depósitos
agregando vinagre sin diluir al pozo. Remoje
hasta que desaparezcan los depósitos o hasta
que se desprendan lo suficiente para quitarlos.
El brazo del dispensador (en algunos modelos).
Antes de limpiar, oprima y detenga la tecla
Lock (bloqueo) durante
3 segundos. Se limpia con una solución
GHDJXDWLELD\ELFDUERQDWRGHVRGLR³
aproximadamente una cucharada (15 ml) de
bicarbonato de sodio por cada cuarto
(1 litro) de agua. Enjuague completamente con
agua y seque.
Las manijas de la puerta y los ornamentos.
Se limpian con un paño humedecido con una
solución de detergente suave y agua. Seque
con un paño suave.
Los puertas y las manijas de las puertas
de acero inoxidable (en algunos modelos)
pueden ser limpiados con un limpiador para
acero inoxidable para usos comerciales. Los
limpiadores con ácido oxálico tales como Bar
Keepers Friend Soft Cleanser™ eliminarán
el óxido sobre la superficie, deslustres y
pequeñas manchas. Use sólo un limpiador
líquido libre de material abrasivo y frote en
la dirección de las líneas del cepillo con una
esponja suave y húmeda. No utilice cera para
electrodomésticos sobre el acero inoxidable.
No limpie el refrigerador con un paño sucio para
trastes ni con un paño húmedo. Estos podrían
dejar residuos que afecten a la pintura. No use
estropajos, limpiadores en polvo, blanqueadores
ni limpiadores que contengan blanqueador, ya
que estos productos podrían rayar y desprender
el terminado de pintura.
Mantenga limpio el terminado. Limpie con
un paño limpio ligeramente humedecido con
cera para aparatos de cocina o un detergente
suave y agua. Seque y pula con un paño limpio
y suave.
Limpiar el interior
Para evitar olores, deje una caja abierta de
bicarbonato de sodio en los compartimientos
del refrigerador y del congelador.
Desconecte el refrigerador antes de limpiarlo.
Si no fuera posible, exprima el exceso de
humedad de la esponja o del paño cuando
se limpie alrededor de botones, bombillas o
controles.
Use agua caliente y una solución de
ELFDUERQDWRGHVRGLR³DSUR[LPDGDPHQWHXQD
cucharada (15 ml) de bicarbonato de sodio
por cada cuarto (1 litro) de agua. Esta solución
limpia y neutraliza olores. Enjuague y seque.
Después de limpiar las juntas de las puertas,
aplique una capa delgada de vaselina del lado
de la bisagra. Esto ayuda a evitar que las juntas
se doblen o se peguen.
Orificio para drenaje en el compartimiento
del congelador. Durante la limpieza anual,
retire la cacerola inferior del congelador vierta
una solución de bicarbonato de soda: una
cucharadita (5 ml) en dos tasas (500 ml) de
agua caliente (que no esté hirviendo), en la línea
de drenaje con la ayuda de un desbastador
de carne. Esto ayudará a eliminar el olor y
reducirá la probabilidad de una obstrucción en
la línea de drenaje. Si el drenaje se obstruye,
utilice un desbastador de carne y una solución
de bicarbonato de soda para eliminar la
obstrucción en la línea de drenaje.
PRECAUCIÓN No limpie estantes de
vidrio ni tapas con agua caliente cuando
estén fríos. Los estantes de vidrio y las
tapas se pueden romper si son expuestos
a cambios de temperatura repentinos o
impactos tales como sacudones o caídas.
El vidrio templado está diseñado para
destruirse en pequeñas piezas en caso de
rotura.
No lave ninguna parte plástica del
refrigerador en la lavadora de platos.
9
Cuidado y limpieza del refrigerador.
Atrás del refrigerador
Se deberá tener cuidado al retirar el
refrigerador de la pared. Todos los tipos de
recubrimiento de pisos se pueden dañar, sobre
todo los recubrimientos acojinados y los que
tienen superficies repujadas.
Jale el refrigerador en forma recta y empuje
nuevamente para devolverlo a su posición.
Mover el refrigerador en dirección lateral puede
causar daños al recubrimiento del piso o al
refrigerador.
Al empujar el refrigerador a su lugar, asegúrese
de no pasar sobre el cable eléctrico ni sobre la
línea de alimentación del dispositivo para hacer
hielos (en algunos modelos).
Preparación para vacaciones
En el caso de vacaciones o ausencias
prolongadas, quite los alimentos y desenchufe
el refrigerador. Limpie el interior con solución
de bicarbonato de una cucharada (15 ml) de
bicarbonato por un cuarto (1 litro) de agua.
Deje abiertas las puertas.
Deslice el interruptor de alimentación eléctrica
del dispositivo automático para hacer hielo en
la posición OFF (apagado) y cierre el suministro
de agua al refrigerador.
En caso de mudanza
Asegure todos los elementos sueltos como
entrepaños y recipientes pegándolos con cinta
adhesiva en su lugar para evitar daños.
Asegúrese de que el refrigerador se coloque en
posición vertical durante la mudanza.
Reemplazo de bombillas
ADVERTENCIA
Antes de reemplazar una lámpara quemada, el refrigerador deberá ser
desenchufado a fin de evitar el contacto con el filamento de un cable con corriente. (Existe riesgo
de que una lámpara quemada se rompa durante su reemplazo).
Girar el control a la posición OFF no desconecta la corriente del circuito de la luz.
Desenchufe el refrigerador.
Retire el entrepaño justo por debajo
de la cubierta de luz.
10
Cambie la bombilla por una bombilla del
mismo tamaño y voltaje.
Vuelva a instalar el entrepaño y enchufe
el refrigerador de nuevo.
Instrucciones para
la instalación
Refrigerador
Modelos 20, 22 y 25
Si tiene preguntas, llame al 1.800.GE.CARES o bien visite nuestra página Web: GEAppliances.com
ANTES DE EMPEZAR
ESPACIOS LIBRES
Lea estas instrucciones completa y cuidadosamente.
Deje suficiente espacio para facilitar la instalación, la
circulación adecuada de aire y las conexiones de plomería y
eléctricas.
•
IMPORTANTE – Guarde estas
instrucciones para uso del inspector local.
•
IMPORTANTE – Observe todos los
•
1RWDDOLQVWDODGRU² Asegúrese de dejar estas
•
1RWDDOFRQVXPLGRU² Conserve estas
códigos y órdenes de ley.
•
•
•
•
instrucciones con el consumidor.
instrucciones para referencia futura.
1LYHOGHGHVWUH]D²/DLQVWDODFLyQGHHVWHDSDUDWR
requiere de destrezas mecánicas básicas.
7LHPSRGHHMHFXFLyQ²,QVWDODFLyQGHOUHIULJHUDGRU
(15 minutos)
La instalación apropiada es la responsabilidad del
instalador.
La falla del producto debido a una instalación
inadecuada no está cubierta por la garantía.
UBICACIÓN DEL REFRIGERADOR
• No instale el refrigerador donde las temperaturas
sean inferiores a 60ºF (16ºC), ya que no se
mantendrá en funcionamiento el tiempo suficiente
para conservar las temperaturas adecuadas.
• No instale el refrigerador donde la temperatura sea
superior a los 100ºF (37ºC), ya que no funcionará de
forma correcta.
• Lados 1/8” (4 mm)
• Parte superior 1” (25 mm)
• Parte posterior 1” (25 mm)
Un espacio de 3/4” (19 mm) se necesita para abrir la
puerta de 90° lo que le ofrece un mejor acceso al área
de almacenamiento de los alimentos.
RODILLOS
Los rodillos tienen 3 propósitos:
„Los rodillos se ajustan para hacer que la puerta
se cierre con facilidad cuando está abierta
aproximadamente en la mitad.
„Los rodillos se ajustan para que el refrigerador
sea firmemente posicionado en el piso y para
no tambalearse.
„Los rodillos permiten mover el refrigerador para retirarlo
de la pared para su limpieza.
Para ajustar los rodillos, retire la rejilla de la base
empujándola hacia abajo.
• No instale el refrigerador en una ubicación expuesta
al agua (lluvia, etc.) o en contacto directo con la luz
solar.
• Instale el refrigerador en un piso lo suficientemente
fuerte como para soportarlo completamente
cargado.
SUMINISTRO DE AGUA HACIA EL
DISPOSITIVO PARA HACER HIELO
(en algunos modelos)
Si el refrigerador tiene un dispositivo para hacer hielo,
tendrá que estar conectada a una línea de agua fría.
Un kit de suministro de agua (contiene tubería, válvula de
cierre, accesorios e instrucciones) está disponible con un
costo adicional a través de su proveedor, visitando nuestra
página Web GEAppliances.com o bien a través de Partes y
Accesorios, 800.626.2002.
Gire los tornillos de ajuste de los rodillos en el sentido de las
manecillas del reloj para levantar el refrigerador y en sentido
contrario a las manecillas del reloj para bajarlo. Use una
llave ajustable (tornillo de cabeza hexagonal de 3/8”) o unas
tenazas.
Para reemplazar la rejilla de la base, alinee los ganchos
en la parte posterior de la rejilla entre la barra y la parte
inferior del gabinete. Empuje hacia adelante hasta que
la rejilla haga un chasquido al quedar en su lugar.
11
Instrucciones para la instalación
ALINEACIÓN DE LAS PUERTAS
Después de nivelar, asegúrese de que las puertas estén al
mismo nivel en la parte superior.
Para emparejar las puertas, ajuste la puerta del refrigerador.
Usando una llave de cubo de 5/16”, gire el tornillo
de ajuste de la puerta hacia la derecha para elevar
la puerta; gírelo hacia la izquierda para hacerla
descender. (Un tapón de nylon está encajado
en la rosca del pin para impedir que el pin gire
a menos de que se use una llave.)
Después de una o dos vueltas con la llave, abra
y cierre la puerta del compartimiento del refrigerador y
luego controle la alineación superior de las puertas.
Llave de cubo
de 5/16”
Para remover la parrilla
base, abra las puertas
y entonces tire de la
parrilla directamente
hacia afuera.
12
Levantar
Instrucciones para la instalación
CÓMO INSTALAR LA TUBERÍA DEL AGUA
ANTES DE INICIAR
QUÉ NECESITA
Los kits de cobre recomendados para el suministro de agua
VRQ:;;:;;R:;;GHSHQGLHQGRGH
la cantidad de tubería necesaria. Las tuberías plásticas
aprobadas para el suministro de agua son las tuberías
para el refrigerador SmartConnect™GH*( :;;
:;;:;;\:;; Al conectar su refrigerador a un Sistema de Agua de
Ósmosis Inversa de GE Appliances, la única instalación
aprobada es con un kit de Ósmosis Inversa de GE
Appliances. Para otros sistemas de agua de ósmosis inversa,
siga las instrucciones del fabricante.
Si la alimentación de agua a su refrigerador proviene de
un sistema de filtración de agua de ósmosis inversa Y el
refrigerador también cuenta con un filtro de agua, use
el tapón de derivación del filtro del refrigerador. El uso
conjunto del cartucho de filtración de agua del refrigerador
con el filtro de RO (ósmosis inversa) pudiera resultar en la
producción de cubos de hielo huecos y en un caudal de
agua más lento del dispensador de agua.
• Kit de tubería de cobre para el refrigerador o
SmartConnect™ de GE, 1/4” de diámetro externo
para conectar el refrigerador al suministro de agua.
Si usa cobre, asegúrese de que ambos extremos
de la tubería se corten uniformemente.
Para determinar la cantidad de tubería que necesita: mida la
distancia desde la válvula del agua en la parte posterior del
refrigerador hasta el tubo de suministro de agua. Asegúrese
de que haya suficiente tubería adicional para permitir que
el refrigerador se pueda mover de la pared después de la
instalación.
Los kits de tubería para el refrigerador SmartConnect™
de GE están disponibles en las siguientes longitudes:
· P ²:;;
· P ²:;;
· P ²:;;
· P ²:;;
NOTA: La única tubería de plástico aprobada de GE
Appliances es la que viene provista con los kits de tubería
para el refrigerador SmartConnect™ de GE. No use ninguna
otra tubería plástica para el suministro del agua ya que
la tubería está bajo presión todo el tiempo. Ciertos tipos de
plástico se fracturarán o se romperán con el tiempo
y causarán daños en su casa debido al agua.
Esta instalación de la tubería del agua no está garantizada
por el fabricante del refrigerador o de la máquina de hielos.
Siga estas instrucciones cuidadosamente para minimizar el
riesgo de un daño costoso debido al agua.
El martilleo del agua (agua golpeando contra la tubería) en
la tubería de la casa puede causar daños a las partes del
refrigerador y conducir a un goteo o inundación por el agua.
Llame a un plomero calificado para corregir el martilleo del
agua antes de instalar la tubería del agua al refrigerador.
Para evitar quemaduras y daños con el producto, no
conecte la tubería del agua a la tubería del agua caliente.
Si usa el refrigerador antes de conectar la tubería, asegúrese
de que el interruptor de corriente de la
máquina de hielos esté en la posición OFF (apagado).
No instale la tubería de la máquina de hielos en lugares
donde la temperatura caiga por debajo del nivel de
congelamiento.
Todas las instalaciones deben apegarse a las normas
vigentes en materia de obras de plomería.
ADVERTENCIA
Conectar al suministro de agua
potable únicamente.
13
Instrucciones para la instalación
CÓMO INSTALAR LA TUBERÍA DEL AGUA (CONT.)
QUÉ NECESITA (CONT.)
• Un kit de suministro de agua de GE Appliances (contiene
tubería, válvula de cierre y accesorios enumerados abajo)
está disponible a un costo adicional en su tienda o por
medio de Partes y Accesorios, 877.959.8688.
• Un suministro de agua fría. La presión del agua debe estar
entre 20 y 120 p.s.i. (1.4-8.2 bar) en modelos sin filtro de
DJXD\HQWUH\SVL ²EDU HQPRGHORVFRQ
filtros de agua.
• Taladro eléctrico.
• Llave de 1/2” o ajustable.
• Destornillador plano y de estrella.
• Dos tuercas de compresión de 1/4” de diámetro
H[WHULRU\IpUXODV PDQJDV ³SDUDFRQHFWDUODWXEHUtD
de cobre a la válvula de cierre y la válvula del agua
del refrigerador.
O BIEN
• Si está usando un kit de tubería para el refrigerador
SmartConnect™ de GE, los accesorios necesarios ya
vienen preinstalados en la tubería.
• Si su tubería existente de cobre para el agua tiene
un accesorio con vuelo en el extremo, necesitará un
adaptador (disponible en las tiendas de suministros de
plomería) para conectar la línea del agua al refrigerador O
BIEN, podrá cortar el accesorio con vuelo con un cortador
de tubos y luego usar un accesorio de compresión. No
corte el extremo formado de la tubería para el refrigerador
SmartConnect™ de GE.
1 CIERRE EL SUMINISTRO PRINCIPAL
DE AGUA
2 SELECCIONE LA UBICACIÓN
DE LA VÁLVULA
Seleccione una ubicación para la válvula que sea
fácilmente accesible. Es mejor conectarla en el costado
de una tubería vertical de agua. Cuando sea necesario
conectarla en una tubería horizontal de agua, haga
la conexión en la parte superior o al lado, en vez de
hacerlo en la parte de abajo, para evitar retirar cualquier
sedimento de la tubería del agua.
Perfore un orificio de 1/4” en la tubería del agua (incluso
si está usando una válvula auto perforadora), usando
una broca afilada. Retire cualquier sobrante que resulte
de perforar el orificio en la tubería. Tenga cuidado de no
permitir que se filtre agua hacia el taladro. No perforar un
orificio de 1/4” puede resultar en menor producción de
hielo o cubos más pequeños.
3 INSTALE LA VÁLVULA DE CIERRE
Una la válvula de cierre a la tubería de agua fría
con la abrazadera para el tubo.
Apriete los tornillos de la abrazadera hasta que
la arandela sellante empiece a hincharse.
NOTA: No apriete demasiado la tubería ya que podría
romperse.
Arandela
• Válvula de cierre para conectar a la línea del agua fría.
La válvula de cierre deberá tener una entrada de agua
con un diámetro interno mínimo de 5/32” en el
punto de conexión a la TUBERÍA DEL AGUA FRÍA. Las
válvulas de apagado tipo silla vienen incluidas en muchos
kits de suministro de agua. Antes de comprar, asegúrese
de que una válvula tipo silla cumple con los códigos de
plomería en su localidad. Instale la válvula
de cierre en la tubería del agua de consumo más
frecuentemente utilizada.
14
Abrazadera
del tubo
Extremo de entrada
Tornillo de la
abrazadera
Válvula de
cierre tipo silla
Tubería vertical
de agua fría
NOTA: Se deberán seguir los Códigos 248CMR de
Plomería para el Estado de Massachusetts. Las válvulas
tipo silla son ilegales y su uso no está permitido en
Massachusetts. Consulte con un plomero licenciado.
Instrucciones para la instalación
4 DIRIJA LA TUBERÍA
7 CONECTE LA TUBERÍA
Dirija la tubería entre la línea del agua fría y el
refrigerador.
Dirija la tubería a través de un orificio perforado en
la pared o en el piso (detrás del refrigerador o del
gabinete de la base adyacente) lo más cerca posible
a la pared.
NOTA: Asegúrese de que haya suficiente tubería
adicional para permitir que el refrigerador se pueda
mover de la pared después de la instalación.
5 CONECTE LA TUBERÍA
A LA VÁLVULA
Coloque la tuerca de compresión y férula para la tubería
de cobre (manga) en el extremo de la tubería y conéctela
a la válvula de cierre.
Asegúrese de que la tubería esté complemente
insertada en la válvula. Apriete la tuerca de compresión
firmemente.
AL REFRIGERADOR
NOTAS:
• Antes de hacer la conexión al refrigerador, asegúrese
de que el cable de corriente del refrigerador no esté
conectado en el tomacorriente de la pared.
• Si su refrigerador no tiene filtro de agua,
recomandamos la instalación de uno si su suministro
de agua tiene arena o partículas que podrían obstruir
la malla de la válvula de agua del refrigerador. Instálelo
en la tubería del agua cerca al refrigerador. Si usa un
kit de tubería para el refrigerador SmartConnect™ de
*(QHFHVLWDUiXQWXERDGLFLRQDO :;; SDUD
conectar el filtro. No corte la tubería plástica para
instalar el filtro.
Algunos modelos tienen la conexión del refrigerador
al final de la tubería localizada en la parte exterior del
cobertor de acceso del compartimento del compresor. En
otros modelos, el cobertor de acceso del compartimento
del compresor debe ser removido para tener acceso a la
conexión del refrigerador a la válvula de agua.
Para tubería de plástico de un kit de tubería para
el refrigerador SmartConnect™ de GE, inserte el extremo
moldeado de la tubería en la válvula de cierre y apriete
la tuerca de compresión hasta que esté firmemente
apretada a mano, luego apriete otro giro con una llave.
Apretar demasiado puede causar fugas.
Válvula de
cierre tipo silla
Tuerca de
compresión
Tubería
SmartConnect™
En modelos que usan la conexión de la válvula de agua,
remove la tapa de plástico flexible.
Tuerca de
empaque
Válvula de salida
Férula (manga)
NOTA: Se deberán seguir los Códigos 248CMR de
Plomería para el Estado de Massachusetts. Las válvulas
tipo silla son ilegales y su uso no está permitido en
Massachusetts. Consulte con un plomero licenciado.
6 LAVE LA TUBERÍA
Abra el suministro principal de agua y lave la tubería
hasta que el agua esté limpia.
Coloque la tuerca de compresión y la férula (manga) en
el extremo de la tubería como se muestra. En el kit de
tubería para el refrigerador SmartConnect™ de GE, las
tuercas ya vienen armadas con la tubería.
15
Instrucciones para la instalación
CÓMO INSTALAR LA TUBERÍA DEL AGUA (CONT.)
7 CONECTE LA TUBERÍA
AL REFRIGERADOR (CONT.)
9 CONECTE EL REFRIGERADOR
Inserte el extremo de la tubería en la conexión del
refrigerador lo más que se pueda. Mientras sostiene
la tubería, apriete el accesorio.
Para tubería de plástico de un kit de tubería para el
refrigerador SmartConnect™ de GE, inserte el extremo
moldeado de la tubería en la conexión del refrigerador
y apriete la tuerca de compresión hasta que esté
firmemente apretada a mano, luego apriete otra vuelta
con una llave. Apretar demasiado puede causar fugas.
Una la tubería a la abrazadera provista para sostenerla
en una posición vertical. Quizás necesite apalancar la
abrazadera.
Una de las ilustraciones más abajo lucirá como la
conexión en su refrigerador.
Abrazadera
del tubo
Tubería
de 1/4”
Tuerca de
compresión
de 1/4”
Férula
(manga)
Tubería de
SmartConnect™
Conexión
al refrigerador
Abrazadera
del tubo
Tubería
de 1/4”
Tuerca de
compresión
de 1/4”
Férula
(manga)
Conexión al refrigerador
Tubería de
SmartConnect™
8 ABRA LA LLAVE DEL AGUA
EN LA VÁLVULA DE CIERRE
Apriete cualquier conexión que pueda presentar fugas.
Reemplace la cubierta de acceso.
16
Organice el cable de la tubería de manera que no vibre
contra la parte trasera del refrigerador o contra la pared.
Empuje el refrigerador hacia la pared.
10 INICIE LA MÁQUINA DE HIELOS
Deslice el interruptor de la máquina de hielos
en la posición ON (encendido). La máquina
de hielos no empezará a operar hasta que alcance
su temperatura de operación de 15°F (-9°C) o menor.
Luego, empezará a operar automáticamente
si el interruptor de la máquina de hielos está
en la posición ON (encendido).
Sonidos normales de operación.
GEAppliances.com
Los refrigeradores más nuevos producen sonidos diferentes
a los modelos más antiguos. Los refrigeradores modernos
tienen más funciones y usan tecnología más reciente.
¿Usted escucha lo que yo escucho? Estos sonidos son normales.
¡WHIR!
HMMMM...
WHOOSH....
„El nuevo compresor de alta eficiencia puede funcionar
más rápido y durar más que el de su refrigerador
anterior y puede escuchar un zumbido de tono alto o
un sonido pulsante mientras opera.
„A veces el refrigerador funciona por un período
prolongado, especialmente cuando las puertas se
abren continuamente. Esto significa que la función
Frost Guard ™ está en operación para impedir que el
congelador se queme y mejorar la preservación
de los alimentos.
„Puede escuchar un sonido de soplido cuando las
puertas se cierran. Esto se debe a que la presión se
está estabilizando dentro del refrigerador.
CHASQUIDOS, ESTALLIDOS,
CRUJIDO, GORJEOS
„Puede escuchar los ventiladores moviéndose a
gran velocidad. Esto pasa cuando el refrigerador se
conecta por primera vez, cuando las puertas se abren
frecuentemente o cuando se guarda gran cantidad de
alimentos en el refrigerador o en los compartimientos
del congelador. Los ventiladores están ayudando a
mantener las temperaturas correctas.
„Si cualquiera de las puertas permanece abierta por
más de 8 minutos, puede escuchar los ventiladores
para enfriar los focos de luz.
„Los ventiladores cambian la velocidad para suministrar
enfriamiento óptimo y ahorrar energía.
SONIDOS DE AGUA
„Puede escuchar sonidos como de crujido o
estallidos cuando el refrigerador se conecta por
primera vez. Esto pasa a medida que el refrigerador se
enfría hasta la temperatura correcta.
„Los reguladores electrónicos se abren y se cierran para
ofrecer un enfriamiento óptimo y ahorrar energía.
„El compresor puede causar un chasquido o un gorjeo
cuando intenta volver a arrancar (esto
puede tomar hasta 5 minutos).
„El tablero de control electrónico puede causar
un sonido de chasquido cuando se activa el relé
para controlar los componentes del refrigerador.
„Expansión y contracción de las bobinas durante
„El fluido del
refrigerante a través de las bobinas puede producir un
sonido de borboteo como de agua hirviendo.
„El agua que cae en el calentador de descongelación
puede causar un chisporroteo, estallido o zumbido
durante el ciclo de descongelación.
„Un ruido de agua cayendo se puede escuchar durante
el ciclo de descongelación a medida que
el hielo se derrite del evaporador y fluye hacia
la bandeja de drenaje.
„El cierre de las puertas puede producir un sonido
de gorgoteo debido a la estabilización de la presión.
o después del ciclo de descongelación puede
causar sonidos como de crujido o estallidos.
„En modelos con máquina de hielos, después de
completar un ciclo de hacer hielo, se pueden escuchar
los cubos de hielo cuando caen a la bandeja de hielos.
17
Antes de solicitar un servicio…
Solucionar problemas
¡Ahorre tiempo y dinero! Revise las tablas en las siguientes
páginas y tal vez no necesitará de solicitar un servicio.
Problema
Causas Posibles
Qué hacer
El refrigerador no
funciona
Refrigerador en ciclo de descongelar.
Espere 30 minutos para que la descongelación se
termine.
Controles de temperatura en posición 0
(apagado).
Mueva los controles de temperatura del congelador
hasta un ajuste inferior de temperatura.
El refrigerador esté desconectado.
Empuje la clavija completamente en el enchufe.
Fusible fundido/ interruptor de circuito roto.
Reemplace el fusible o reajuste el interruptor.
Vibraciones o
sacudidas (una
vibración ligera es
normal)
Los rodillos requieren un ajuste.
Vea Rodillos.
El motor opera durante
períodos prolongados
o se arranca y se
para con frecuencia.
(Refrigeradores
modernos con
más espacio de
almacenamiento y
un congelador más
grande requieren más
tiempo de operación.
Se arrancan y se paran
a para mantener
temperaturas
uniformes.)
Es normal cuando el refrigerador es recién
instalado en su casa.
Espere 24 horas para que el refrigerador se enfríe
completamente.
Ocurre cuando hay largas cantidades de
alimentos en el refrigerador.
Eso es normal.
Se dejó abierta la puerta.
Revise si un paquete mantiene la puerta abierta.
Clima caluroso o aperturas frecuentes de
la puerta.
Eso es normal.
Controles de temperatura ajustados al
punto más frío.
Vea Los controles.
Compartimiento de
alimentos frescos o
congelador demasiado
cálido
El control de temperatura no se fijó
bastante frío.
Vea Los controles.
Clima caluroso o aperturas frecuentes de
la puerta.
Fije el control de temperatura un paso más frío. Vea
Los controles.
Se dejó abierta la puerta.
Revise si hay un paquete que mantiene la puerta
abierta.
Escarcha o cristales
de hielo en alimentos
congelados (escarcha
en paquete es normal)
Se dejó abierta la puerta.
Revise si hay un paquete que mantiene la puerta
abierta.
El divisor entre el
compartimiento de
alimentos frescos y el
congelador se siente
tibio
Ahorro automático de energía circula
líquido tibio en la frente del congelador.
Eso ayuda prevenir la condensación en el exterior.
Dispositivo automático
para hacer hielo no
funciona (en algunos
modelos)
El interruptor de alimentación eléctrica del
dispositivo automático para hacer hielo
está en la posición OFF (apagado).
Deslice el interruptor de alimentación eléctrica a la
posición ON (encendido).
El agua está cerrada o no está conectada.
Vea Instalar la línea de agua.
El compartimiento del congelador es muy
cálido.
Espere 24 horas para que se enfríe el refrigerador.
Cubos apilados en el recipiente apaga el
dispositivo para hacer hielo.
Nivele los cubos con la mano.
Cubos de hielo atorados en dispositivo
para hacer hielo.
Apague el dispositivo de hielo, retire los cubos y
vuelva a poner el dispositivo en marcha.
18
La puerta se abre con frecuencia o por
mucho tiempo.
GEAppliances.com
Problema
Causas Posibles
Qué hacer
Los cubos tienen mal
olor/sabor
El recipiente para los cubos necesita
limpieza.
Vacíe y limpie el recipiente. Deseche los cubos.
Alimentos transmitiendo olor/sabor a los
cubos.
Envuelva bien los alimentos.
El interior del refrigerador requiere limpieza.
Vea Cuidado y limpieza.
Cubos pequeños o huecos
Filtro de agua tapado.
Reemplace el cartucho del filtro con uno nuevo o
con el tapón.
Formación lenta del hielo
Se dejó abierta la puerta.
Revise si hay un paquete que mantiene la puerta
abierta.
El control de temperatura no es bastante frío.
Vea Los controles.
La puerta no se cierre
correctamente
La junta en el lado de la bisagra está pegada
o doblada.
Aplique vaselina en la parte frontal de la junta.
Brillo anaranjado en el
congelador
Calefactor de descongelación encendido.
Eso es normal.
El dispensador de hielo
no funciona (en algunos
modelos)
Dispositivo de hielo apagado o el agua está
apagado.
Enciende el dispositivo de hielo o el agua.
Los cubos están pegados al brazo detector.
Remueve los cubos.
Bloques irregulares de hielo en el recipiente.
Rómpalos con los dedos y deseche los cubos
restantes.
El congelador puede ser muy caliente. Ajuste el
control a una posición más fría paso por paso
hasta que no se formen bloques.
El dispensador está BLOQUEADO (LOCKED).
Presione la tecla Lock (bloqueo) y manténgala
presionada durante tres segundos.
El agua tiene un sabor/
olor malo (en algunos
modelos)
El dispensador de agua no se uso por mucho
tiempo.
Dispense el agua hasta que todo el sistema del
agua se llene de nuevo.
El dispensador de agua
no funciona (en algunos
modelos)
Suministro de agua apagado o no
conectado.
Vea Instalar la línea de agua.
Filtro de agua tapado.
Reemplace el cartucho del filtro o remueve el filtro
y instale el tapón.
Aire atrapado en el sistema del agua.
Presione el brazo del dispensador por un par de
minutos.
El dispensador está BLOQUEADO (LOCKED).
Presione la tecla Lock (bloqueo) y manténgala
presionada durante tres segundos.
Eso es normal con un refrigerador recién
instalado.
Espere 24 horas para que se enfríe el refrigerador.
El dispensador de agua no se uso por mucho
tiempo.
Dispense el agua hasta que todo el sistema del
agua se llene de nuevo.
El sistema de agua se ha desaguado.
Espere algunas horas para que se enfríe el agua.
El agua chorrea del
dispensador
Cartucho del filtro recién instalado.
Deje correr el agua desde el dipensador por 3
minutos (aprox. 1-1/2 galóns).
No sale agua
El agua en el depósito está congelada.
Llame para servicio.
No sale agua y el
dispositivo para hacer
hielo no funciona
Está tapada la línea de agua o la llave de
paso.
Llame a un plomero
Filtro de agua tapado.
Reemplace el cartucho del filtro o remueve el filtro
y instale el tapón.
El dispensador está BLOQUEADO (LOCKED).
Presione la tecla Lock (bloqueo) y manténgala
presionada durante tres segundos.
El agua en el primer vaso
está tibia (en algunos
modelos)
19
Antes de solicitar un servicio…
Solucionar problemas
Problema
Causas Posibles
Qué hacer
El refrigerador huele
Alimentos transmitiendo olores al refrigerador.
Alimentos con olores fuertes deben estar tapados.
Guarde una caja de bicarbonato de sodio en el
refrigerador; cámbiela cada tres meses.
El interior requiere limpieza.
Vea Cuidado y limpieza.
Limpie el sistema de agua de descongelación.
Vea Cuidado y limpieza.
Humedad en
el exterior del
refrigerador
Normal en períodos con alto grado de
humedad.
Seque la superficie.
Humedad en el
interior (en clima
húmedo el aire
lleva la humedad
al interior del
refrigerador cuando
se abren las puertas)
Se abre la puerta con frecuencia o por mucho
tiempo.
No funciona la luz
interior
No hay corriente en el contacto.
Reemplace el fusible o reajuste el interruptor.
Bombilla fundida.
Vea Reemplazar las bombillas.
Agua en el piso de la
cocina o en el fondo
del congelador
El desagüe en el fondo del
Vea Cuidado y limpieza.
Cubos atrapados en el orificio.
Empuje los cubos en el vertedero con una cuchara
de madera.
Aire caliente a la
base del refrigerador
El aire fluye para enfriar el motor. En el proceso
de refrigeración es normal que salga calor de la
base del refrigerador. Algunos recubrimientos
de piso estan sensitivos y se descoloran a estas
temperaturas normales y seguras.
Se seleccionó Cubed
Ice (hielo en cubos)
pero se dispensó
Crushed Ice (hielo
picado) (en algunos
odelos)
La última selección fue Crushed Ice (hielo
picado).
Se quedaron unos cuantos cubos en el triturador de
la selección anterior. Esto es normal.
Frecuente sonido de
“murmullo”
El interruptor de corriente del dispositivo para
hacer hielo está en la posición ON (encendido)
pero no se ha conectado la tubería de
suministro de agua hacia el refrigerador.
Deslice el interruptor de corriente a la posición
OFF (apagado). Mantenerlo en la posición ON
(encendido) dañará la válvula del agua.
20
Garantía del Refrigerador.
Todo el servicio de garantía es provisto por nuestros Centros de
Servicio de Fabricación, o un técnico autorizado de Servicio al
Cliente (Customer Care®). Para programar una visita del servicio
técnico, visítenos en GEAppliances.com, o comuníquese al 800.
GE.CARES (800.432.2737). Cuando llame para solicitar el servicio,
tenga los números de serie y modelo disponibles.
Por el Período de:
GE Appliances Reemplazará
Un Año
Desde la fecha de la compra
original
Cualquier parte del refrigerador que falle debido a un defecto en los materiales o la fabricación.
Durante esta garantía limitada de un año, GE Appliances también proveerá, sin costo, todo el
trabajo y el servicio relacionado con el reemplazo de la parte que presente defectos.
Treinta Días
(Filtro de Agua, si está
incluido)
Desde la fecha de la compra
original del refrigerador
Cualquier parte del cartucho del filtro de Agua que falle debido a un defecto en los materiales o la
fabricación. Durante la garantía limitada por treinta días, GE Appliances también le brindará, sin
costo, el reemplazo de un cartucho del filtro de agua.
SÓLO MODELOS GE PROFILETM
Cinco Años
Desde la fecha de la compra
original
Cualquier parte del sistema de refrigeración sellado (el compresor, condensador, evaporador y
todas las tuberías de conexión) que falle debido a un defecto en los materiales o la fabricación.
Durante esta garantía de cinco años del sistema de refrigeración sellado, GE Appliances también
proveerá, sin costo, todo el trabajo y el servicio relacionado con el reemplazo de la parte que presente
defectos en el sistema de refrigeración sellado.
Qué No Cubrirá GE Appliances:
■ Viajes del técnico del servicio a su hogar para enseñarle sobre
cómo usar el producto.
■ Instalación, entrega o mantenimiento inadecuados.
■ Fallas del producto en caso de abuso, mal uso, o uso para
propósitos diferentes al original o uso comercial.
■ Pérdida de alimentos por mal estado.
■ Reemplazo de fusibles de la casa o reinicio de disyuntores.
■ Daño causado después de la entrega.
■ Reemplazo del cartucho del filtro de agua, si se incluye, debido a
la presión del agua que está fuera del rango de funcionamiento
específico o debido a exceso de sedimentos en el suministro de
agua.
■ Reemplazo de bombillas de luz, si se incluyen, o del cartucho
del filtro de agua, si se incluye, a diferencia de lo detallado
anteriormente.
■ Daños ocasionados sobre el producto por accidente, incendio,
inundaciones o catástrofes naturales.
■ Daños consecuentes o incidentales causados por posibles
defectos de este producto.
■ Producto no accesible para brindar el servicio requerido.
■ Daño ocasionado por un filtro de agua de una marca que no es GE
Appliances.
„ Cualquier daño sobre la terminación deberá ser
informado dentro de las 48 horas luego de la entrega del
electrodoméstico.
(;&/86,Ï1'(*$5$17Ë$6,03/Ë&,7$6³6X~QLFD\H[FOXVLYDDOWHUQDWLYDHVODUHSDUDFLyQGHOSURGXFWRFRPR
se indica en la Garantía Limitada. Las garantías implícitas, incluyendo garantías implícitas de comerciabilidad
o conveniencia sobre un propósito particular, se limitan a un año o al período más corto permitido por la ley.
Esta garantía se extiende al comprador original y a cualquier dueño subsiguiente de productos comprados para
uso hogareño dentro de EE.UU. Si el producto está en un área donde no se encuentra disponible un Proveedor
Autorizado del Servicio Técnico de GE Appliances, usted será responsable por el costo de un viaje o se podrá
requerir que traiga el producto a una ubicación del Servicio Técnico de GE Appliances Autorizado para recibir el
servicio. En Alaska, la garantía excluye el costo de envío o llamadas del servicio a su hogar.
Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía le da
derechos legales específicos y es posible que tenga otros derechos legales que varían entre un estado y otro.
Para conocer cuáles son sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o
al Fiscal de su estado.
Warrantor: General Electric Company. Louisville, KY 40225
21
Ficha Técnica de Funcionamiento
6LVWHPDGH)LOWUDFLyQ6PDUW:DWHUŒ³&DUWXFKR0:)
Información de los Datos de Rendimiento
Capacidad: 300 Galones (1,135 litros)
/DFRQFHQWUDFLyQGHORVFRQWDPLQDQWHVHYDOXDGRVHQHVWH¿OWURVREUHHODJXDTXHLQJUHVDDOVLVWHPD
fue reducida a la concentración menor que o igual al límite permisible para el agua que deja el sistema,
FRPRVHHVSHFL¿FDHQHO(VWiQGDU\HQHO(VWiQGDUGH16)$16,6LVWHPDHYDOXDGR\FHUWL¿FDGR
por NSF International contra el Estándar 42 y el Estándar 53 de NSF/ANSI.
Para acceder a un listado completo de los contaminantes evaluados y las cantidades reducidas, consulte
geappliances.com.
Los siguientes reclamos de reducción farmacéutica no fueron certificados por NSF International ni por el Estado de California.
Reclamos evaluados y verificados por un laboratorio independiente:
Reducción de
contaminantes
Atenolol
Fluoxetina
Ibuprofeno
Progesterona
Trimetoprima
Concentración
Promedio
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
Concentración Máxima
Especificada por NSF
N/A
N/A
N/A
N/A
N/A
Promedio de
% Promedio Concentración del
de Reducción Agua Procesada
99.5%
5.0 ng/L
99.4%
5.4 ng/L
94.1%
52.3 ng/L
99.5%
5.0 ng/L
99.5%
2.0 ng/L
Concentración Máxima Requisitos de
Reducción
Autorizada Aceptable
de Agua Procesada
de NSF
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
Informe
de Evaluación
de NSF
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Pautas de Aplicación/ Parámetros de Suministro de Agua
Flujo de Servicio
Suministro de Agua
0.5 gpm (21.9 lpm)
Agua Potable
Presión del Agua
Temperatura del agua
40-120 psi (2.8-8.2 bar)
ƒ)ƒ) ƒ&ƒ&
Es esencial que se cumpla con los requisitos de instalación, mantenimiento y reemplazo de filtros recomendados por el fabricante, a fin de que el producto funcione de acuerdo a
como fue promocionado. Para acceder a información sobre la Garantía, consulte el Manual de Instalación.
Nota: Observe que aunque la evaluación se realizó de acuerdo con condiciones
HVWiQGDUHVGHODERUDWRULRHOGHVHPSHxRSXHGHYDULDU&DUWXFKRGH5HHPSOD]R
0:)3DUDFRQRFHUFRVWRVHVWLPDGRVGHHOHPHQWRVGHUHHPSOD]RFRPXQtTXHVH
al 877.959.8688 o visite nuestro sitio web en geapplianceparts.com.
ADVERTENCIA
A fin de reducir el riesgo asociado con la ingestión de contaminantes:
• No se deben usar con agua que no sea microbiológicamente segura o de
calidad desconocida sin una desinfección adecuada, antes o después,
del sistema. Los sistemas certificados para la reducción de quistes se pueden
usar en aguas desinfectadas que puedan contener quistes filtrables.
(VWDEOHFLPLHQWRGH(3$1~PHUR01
3DUDFRQRFHUODVFRQGLFLRQHVGHXVRUHFODPRVPpGLFRVFHUWLILFDGRVSRUHO&DOLIRUQLD
'HSDUWPHQWRI3XEOLF+HDOWK 'HSDUWPHQWRGH6DOXG3~EOLFDGH&DOLIRUQLD FRQVXOWHO
DILFKDWpFQLFDGHUHQGLPLHQWR&HUWLILFDFLyQGHO&DOLIRUQLD'HSDUWPHQWRI3XEOLF+HDOWK
'HSDUWDPHQWRGH6DOXG3~EOLFDGH&DOLIRUQLD Qž/RVFRQWDPLQDQWHVXRWUDV
sustancias eliminadas o reducidas por este filtro de agua no están necesariamente en
el agua de todos los usuarios.
ELEMENTOS
DE REEMPLAZO
22
Sistema evaluado y certificado por NSF
International contra NSF/ANSI Estándar 42
y Estándar 53 en el modelo MWF para
la reducción de los reclamos especificados
en la ficha técnica de rendimiento.
AVISO
A fin de reducir el riesgo asociado con daños sobre la propiedad debido a pérdidas de agua:
•
• La instalación y uso DEBERÁN cumplir con todos los códigos de plomería estatales y locales.
• No se deberá instalar si la presión del agua supera los 120 psi (8.2 bar). Si la presión del agua
es superior a los 80 psi, se deberá instalar una válvula limitadora de presión. Si no está
seguro sobre cómo controlar la presión del agua, comuníquese con un plomero profesional.
• No instale cuando se puedan producir condiciones de golpe de ariete. Si existen
condiciones de golpe de ariete, deberá instalar un suspensor de golpes de ariete. Si no
está seguro sobre cómo controlar esta condición, comuníquese con un plomero profesional.
• No instale en líneas de suministro de agua caliente. La temperatura máxima
GHIXQFLRQDPLHQWRGHODJXDSDUDHVWHVLVWHPDGHILOWURHVGHƒ) ƒ& • Proteja el filtro de heladas. Drene el filtro cuando las temperaturas sean
LQIHULRUHVDž) ž& • El cartucho del filtro descartable deberá ser reemplazado cada 6 meses luego
de un uso normal, o antes si se produce una reducción notoria en el caudal.
Servicio al consumidor.
Página Web de GE Appliances
GEAppliances.com
¿Tiene alguna pregunta sobre su electrodoméstico? ¡Pruebe la página Web de GE Appliances 24 horas al día, cualquier
día del año! Para mayor conveniencia y servicio más rápido, ya puede descargar los Manuales de los Propietarios,
pedir piezas o incluso hacer una cita en línea para que vengan a realizar una reparación.
Solicite una reparació
GEAppliances.com
El servicio de expertos GE Appliances está a tan sólo un paso de su puerta. ¡Entre en línea y solicite su reparación
cuando le venga cualquier día del año! O llame al 800.GE.CARES (800.432.2737) durante horas normales de oficina.
Real Life Design Studio (Estudio de diseño para la vida real) GEAppliances.com
*($SSOLDQFHVDSR\DHOFRQFHSWRGH'LVHxR8QLYHUVDO³SURGXFWRVVHUYLFLRV\DPELHQWHVTXHSXHGHQXVDUJHQWHGH
todas las edades, tamaños y capacidades. Reconocemos la necesidad de diseñar para una gran gama de habilidades
y dificultades físicas y mentales. Para más detalles cobre las aplicaciones de GE Appliances Diseño Universal,
incluyendo ideas de diseño para la cocina para personas con discapacidades, mire nuestra página Web hoy mismo.
Para personas con dificultades auditivas, favor de llamar al 800.TDD.GEAC (800.833.4322).
Garantías ampliadas
GEAppliances.com
Compre una garantía ampliada y obtenga detalles sobre descuentos especiales disponibles mientras su garantía está
aún activa. Puede comprarla en línea en cualquier momento, o llamar al (800.626.2224) durante horas normales de
oficina. GE Appliances Consumer Home Services estará aún ahí cuando su garantía termine.
Piezas y accesorios
GEApplianceParts.com
Aquellos individuos con la calificación necesaria para reparar sus propios electrodomésticos pueden pedir que se les
manden las piezas o accesorios directamente a sus hogares (aceptamos las tarjetas VISA, MasterCard y Discover).
Haga su pedido en línea hoy, 24 horas cada día o llamar por teléfono al 877.959.8688 durante horas normales de
oficina.
Las instrucciones descritas en este manual cubren los procedimientos a seguir por cualquier usuario. Cualquier
otra reparación debería, por regla general, referirse a personal calificado autorizado. Debe ejercerse precaución
ya que las reparaciones incorrectas pueden causar condiciones de funcionamiento inseguras.
Póngase en contacto con nosotros
GEAppliances.com
Si no está satisfecho con el servicio que recibe de GE Appliances, póngase en contacto con nosotros en nuestra
página Web indicando todos los detalles así como su número de teléfono o escríbanos a:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
Registre su electrodoméstico
GEAppliances.com
£5HJLVWUHVXQXHYRHOHFWURGRPpVWLFRHQOtQHD³FXDQGRXVWHGSUHILHUD(OUHJLVWUDUVXSURGXFWRDWLHPSROH
proporcionará, si surgiera la necesidad, una mejor comunicación y un servicio más rápido bajo los términos de su
garantía. También puede enviar su tarjeta de registro pre-impresa que se incluye en el material de embalaje o recorte
y use el formulario de este Manual del Propietario.
23
Consumer Support.
GE Appliances Website
In the U.S.: GEAppliances.com
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day of
the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
services designed for your convenience. In Canada: GEAppliances.ca
Schedule Service
In the U.S.: GEAppliances.com
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
your convenience any day of the year! Or call 800.GE.CARES (800.432.2737) during normal business hours.
In Canada, call 1.800.561.3344
Real Life Design Studio
In the U.S.: GEAppliances.com
*($SSOLDQFHVVXSSRUWVWKH8QLYHUVDO'HVLJQFRQFHSW³SURGXFWVVHUYLFHVDQGHQYLURQPHQWVWKDWFDQEHXVHGE\
people of all ages, sizes and capabilities. We recognize the need to design for a wide range of physical and mental
abilities and impairments. For details of GE Appliances Universal Design applications, including kitchen design
ideas for people with disabilities, check out our Website today. For the hearing impaired, please call 800.TDD.GEAC
(800.833.4322).
In Canada, contact: Manager, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Extended Warranties
In the U.S.: GEAppliances.com
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your warranty
is still in effect. You can purchase it on-line anytime, or call 800.626.2224 during normal business hours.
GE Appliances Consumer Home Services will still be there after your warranty expires. In Canada, call 1.888.261.2133
Parts and Accessories
In the U.S.: GEApplianceParts.com
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes (VISA,
MasterCard and Discover cards are accepted). Order on-line today, 24 hours every day or by phone at
877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing generally
should be referred to qualified service personnel. Caution must be exercised, since improper servicing may cause
unsafe operation.
Customers in Canada should consult the yellow pages for the nearest Mabe service center, or call 1.800.661.1616.
Contact Us
In the U.S.: GEAppliances.com
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the details
including your phone number, or write to:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
In Canada: GEAppliances.ca, or write to:
Director, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Register Your Appliance
In the U.S.: GEAppliances.com
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQH³DW\RXUFRQYHQLHQFH7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRU
enhanced communication and prompt service under the terms of your warranty, should the need arise.
You may also mail in the pre-printed registration card included in the packing material, or detach and c
use the form in this Owner’s Manual. In Canada: GEAppliances.ca
Printed in the United States
Printed on Recycled Paper

advertisement

Was this manual useful for you? Yes No
Thank you for your participation!

* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project

Related manuals

advertisement