GE | PHC06LY | Use and Care Manual | GE PHC08LY Use and Care Manual

GE PHC08LY Use and Care Manual
AIR CONDITIONER
ROOM
SAFETY INFORMATION
. . . . . . . . .3
OWNER’S MANUAL
USING THE AIR CONDITIONER
PHC06
PHC08
Controls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
CARE AND CLEANING . . . . . . . . . . .8
INSTALLATION INSTRUCTIONS
Before you begin . . . . . . . . . . . . . . . . . . . . . .9
Electrical Requirements . . . . . . . . . . . . . . . .9
Parts Included . . . . . . . . . . . . . . . . . . . . . . . . 10
Window Requirements . . . . . . . . . . . . . . . . 11
Prepare the Air Conditioner . . . . . . . . . . . . 11
Install the Air Conditioner. . . . . . . . . . . . . . 12
TROUBLESHOOTING TIPS. . . . . . 14
Normal Operating Sounds . . . . . . . . . . . . . 15
WiFi SETUP
. . . . . . . . . . . . . . . . . . . . . . 15
CONSUMER SUPPORT
Limited Warranty . . . . . . . . . . . . . . . . . . . . . 17
Consumer Support . . . . . . . . . . . . . . . . . . . . 18
Write the model and serial
numbers here:
Model # _________________
Serial # _________________
You can find the rating label on the
side of the air conditioner.
GE is a trademark of the General Electric Company. Manufactured under trademark license.
49-5000295 Rev. 1 02-19 GEA
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.
2
49-5000295 Rev. 1
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING For your safety, the information in this manual must be followed to minimize the risk of
fire, electric shock or personal injury.
Ŷ8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGSXUSRVHDV
described in this Owner’s Manual.
ŶThis air conditioner must be properly installed in
accordance with the Installation Instructions before it is
used.
ŶNever unplug your air conditioner by pulling on the
power cord. Always grip plug firmly and pull straight
out from the receptacle.
ŶReplace immediately all electric service cords that
have become frayed or otherwise damaged. A
damaged power supply cord must be replaced with a
new power supply cord obtained from the manufacturer
WARNING
and not repaired. Do not use a cord that shows cracks
or abrasion damage along its length or at either the
plug or connector end.
ŶTurn the unit OFF and unplug your air conditioner
before cleaning.
ŶFor your safety…do not store or use combustible
materials, gasoline or other flammable vapors or
liquids in the vicinity of this or any other appliance.
ŶIf the receptacle does not match the plug, the
receptacle must be changed out by a qualified
electrician.
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Risk of Fire or Explosion. This unit contains flammable refrigerant.
Additional safety precautions must be followed.
Ŷ'RQRWXVHPHDQVWRDFFHOHUDWHWKHGHIURVWLQJSURFHVV
or to clean, other than those recommended by the
manufacturer.
ŶThe appliance shall be stored in a room without
continuously operating ignition sources (for example:
open flames, an operating gas appliance or an
operating electric heater.
ŶDo not pierce or burn refrigerant tubing. Be aware that
refrigerants may not contain an odor.
ŶKeep ventilation openings clear of obstruction.
ŶWhen handling, installing, and operating the appliance,
care should be taken to avoid damage to the
refrigerant tubing.
ŶDo not drill holes in the unit.
ŶMaintenance, cleaning, and service should only be
performed by technicians properly trained and qualified
in the use of flammable refrigerants.
ŶGE Appliances does not support any servicing of the
air conditioner.
ŶDispose of air conditioner in accordance with Federal
and Local Regulations. Flammable refrigerants require
special disposal procedures. Contact your local
authorities for the environmentally safe disposal of your
air conditioner.
WARNING USE OF EXTENSION CORDS
RISK OF FIRE. Could cause serious injury or death.
Ŷ'2127XVHDQH[WHQVLRQFRUGZLWKWKLV:LQGRZ$LU
Conditioner.
HOW TO CONNECT ELECTRICITY
Do not, under any circumstances, cut or remove the third
(ground) prong from the power cord. For personal safety,
this appliance must be properly grounded.
DO NOT use an adapter plug with this appliance.
The power cord of this appliance is equipped with a
3-prong (grounding) plug which mates with a standard
3-prong (grounding) wall outlet to minimize the possibility
of electric shock hazard from this appliance.
Power cord includes a current interrupter device. A test
and reset button is provided on the plug case. The device
should be tested on a periodic basis by first pressing the
TEST button and then the RESET button while plugged
into the outlet. If the TEST button does not trip or if the
RESET button will not stay engaged, discontinue use of the
air conditioner and contact a qualified service technician.
Ŷ'2127XVHVXUJHSURWHFWRUVRUPXOWLRXWOHWDGDSWRUV
with this Window Air Conditioner.
Have the wall outlet and circuit checked by a qualified
electrician to make sure the outlet is properly grounded.
Where a 2-prong wall outlet is encountered, it is your
personal responsibility and obligation to have it replaced
with a properly grounded 3-prong wall outlet.
The air conditioner should always be plugged into its
own individual electrical outlet which has a voltage rating
that matches the rating plate.
This provides the best performance and also prevents
overloading house wiring circuits which could cause a
fire hazard from overheated wires.
See the Installation Instructions, Electrical
Requirements section for specific electrical connection
requirements.
READ AND SAVE THESE INSTRUCTIONS
49-5000295 Rev. 1
3
USING THE AIR CONDITIONER
Controls
Features and appearance will vary.
Auto High
Power
Delay
Med
Quiet
Cool
Fan E-Save Dehum
Fan
Mode
Filter
Wi¿
2
1
5
6
Temp | Time
3
4
Solid light indicates WiFi connected.
Blinking light indicates connecting
See WiFi Setup section in this manual (pg. 15)
This section explains how to operate this air conditioner.
IMPORTANT:
When you turn off the air conditioner, either at the control
panel or with the remote control, wait at least 3 minutes
before turning it back on. This prevents the compressor
from overloading. This 3 minute delay also applies when
switching from cool mode to fan and back.
NOTE: There is a built in 3 minute delay. You may notice
the compressor might not start right away. This was
designated to protect the unit.
Do not operate your air conditioner in the Cool Mode when
the outside temperature is below 61° F (16° C). This inside
evaporator coil will freeze up, and the air conditioner will not
operate properly.
Controls
1. MODE
1. Press MODE until you see the indicator light come on
next to the desired setting.
2. Choose Fan, Cool, Energy save (E-Save), or Dehum.
Fan - Only the fan runs. Press FAN SPEED to select
High, Med or Quiet fan speed. The display shows the
current room temperature.
NOTE: in fan mode, the temperature cannot be set.
NOTE: When the air conditioner is first plugged in, the
LED display will show “88” for 3 seconds. After the air
conditioner is turned on for the first time, the display will
show the temperature 72° F and the fan will automatically
set the Quiet speed and the Mode indicator will show
ENERGY SAVE.
NOTE: To switch the temperature display between
Fahrenheit (°F) and Celsius (°C), the air conditioner must
be plugged in and turned on. On the control panel on the
IURQWRIWKHDLUFRQGLWLRQHUSUHVVWKH83DQG'2:1EXWWRQ
at the same time and hold for 3 seconds. Press F/C button
on remote control to switch between Fahrenheit (°F) and
Celsius (°C).
NOTE: Each time this ENERGY STAR qualified air
conditioner is turned on, it will operate in energy save mode
per the EPA requirements. You can select any other mode
to satisfy your needs.
2. FAN SPEED
1. Press FAN SPEED until you see the indicator light
come on next to the desired setting.
2. Choose High, Med, Quiet, or Auto.
HIGH – For maximum cooling.
MED – For normal cooling.
48,(7±)RUPLQLPXPFRROLQJDQGQRLVH
$872±$GMXVWVWKHIDQVSHHGDXWRPDWLFDOO\WRSURYLGH
ideal cooling based on the room temperature.
E-Save - In this this mode the fan runs only when
cooling is needed. The fan will run for 3 minutes after
the compressor shuts off. The fan then cycles on for 2
minutes at 10 minute intervals until the temperature in
the room is above the set temperature. The compressor
then turns back on.
Cool - Cools the room. Press FAN SPEED to select
High, Med, Quiet or Auto Cool fan speed. Press
the TEMP/TIME + or – arrow button to adjust the
temperature. The fan will run continuously in cool mode.
Dehum - Aids in removing humidity from the room.
Dehum mode cannot be used to cool room.
NOTE: In Dehum mode, when the set temperature is
close to ambient temperature, the compressor may stop
and the fan will run in Quiet speed only.
4
49-5000295 Rev. 1
3. Delay
Delay ON—When the air conditioner is off, it can be
set to automatically come on in 1 to 24 hours at its
previous mode and fan settings.
Delay OFF—When the air conditioner is on,
it can be set to automatically turn off in 1 to
24 hours.
How to set:
Press the Delay 1–24hr pad on the unit or the remote
control. Each touch of the Increase + / Decrease –
pads on the unit or the remote control will set the timer
in 1-hour intervals.
4. TEMP/TIME
1. Press the TEMP/TIME + button to raise the
temperature. Each time you press the TEMP/TIME
+ button, the temperature will go up by 1° F until it
reaches 86° F (30° C).
2. Press the TEMP/TIME – button to lower the
temperature. Each time you press the TEMP/TIME
– button, the temperature will go down by 1° F until it
reaches 61° F (16° C).
NOTE8QGHU)DQPRGHWKHGLVSOD\ZLOOVKRZWKH
FXUUHQWWHPSHUDWXUH8QGHU(QHUJ\6DYH&RRORU
Dehum mode, the display will show the set temperature.
To review the remaining time on the Delay 1–24hr
timer, press the Delay 1–24hr pad on the unit or the
UHPRWHFRQWURO8VHWKH Increase + / Decrease –
pads on the unit or on the remote control to set a new
time if desired.
5. FILTER RESET
This feature automatically notifies you that the air filter
must be cleaned. The indicator light will come on after
240 hours of operation. Clean the air filter (refer to Care
and Cleaning section), place it back in the front panel,
and press the Filter Reset button. The light will turn off.
To cancel the timer, press Decrease – pad on the
unit or the remote control until the set time is zero.
After 3 seconds the light on the Delay 1-24 hour pad
goes off.
6. WiFi Connect
Enables connection of the air conditioner to hte home
WiFi. Download App for details at:
GEAppliances.com/connect.
49-5000295 Rev. 1
USING THE AIR CONDITIONER
Controls
5
USING THE AIR CONDITIONER
Controls
Using the Remote Control
Remote Control may differ in appearance from the image
show.
1. Press TIMER ON/OFF button on the remote control to
select the time off function.
3UHVVWKH7,0(583RU7,0(5'2:1DUURZEXWWRQ
to change the delay time from 1 hour to 24 hours.
Timer OFF indicator light on the air conditioner panel
will illuminate.
QUIET
HIGH
MED
AUTO
TEMP UP
FAN
COOL
ENERGY
SAVE
TEMP DOWN
TIMER
UP
TIMER
ON/OFF
TIMER
DOWN
DEHUM
F/C
SLEEP
LOCK
LIGHT
RESET
NOTE: Please remove the back of the controller and insert
two AAA batteries. Replace batteries after 6 months of use
or when remote control starts to lose power.
NOTE: DO NOT mix old and new batteries.
1. POWER
Press the power button to turn on the air conditioner.
When you first press the power button, the air conditioner
will operate in Energy Save mode, Quiet fan speed and
temperature of 72°F. You can select any other mode to
satisfy your needs .
2. SPEED
High - Press HIGH button to choose high fan speed.
Med - Press MED button to choose medium fan speed.
Quiet3UHVV48,(7EXWWRQWRFKRRVHTXLHWIDQVSHHG
Auto Cool 3UHVV$872EXWWRQWRFKRRVHDXWRFRROIDQ
speed.
3. MODE
Fan- Press the FAN button to activate fan mode.
Cool - Press the COOL button to activate cool mode.
E-Save Press the ENERGY SAVE button to activate
mode.
Dehum -3UHVVWKH'(+80EXWWRQWRDFWLYDWHGHKXP
mode.
6
4. TIMER
To set the air conditioner to turn off after a set
amount of time between 1 hour and 24 hours (unit
must be ON):
3. The buzzer beeps twice after 5 seconds, then Timer
OFF countdown will initiate.
To clear TIMER Program:
NOTE: Air conditioner can be either on or off.
Press TIMER ON/OFF button until Timer indicator light
turns off.
5. TEMP UP/TEMP DOWN
‡3UHVVWKH7(0383EXWWRQWRUDLVHWKHWHPSHUDWXUH
(DFKWLPH\RXSUHVVWKH7(0383EXWWRQWKH
temperature will go up 1° F until it reaches 86°F (30°C).
• Press the TEMP DOWN button to lower the
temperature. Each time you press the TEMP DOWN
button, the temperature will go down 1° F until it
reaches 61°F (16°C).
6. SLEEP
1. Press SLEEP button on the remote control to choose
Sleep mode. This display will show (08) and the
indicator light will turn on.
2. The temperature will increase by 2° F one hour after
the mode is chosen. The temperature then increases
another 2° F after one hour. The until will hold this
temperature for six hours then stop.
3. To turn off Sleep mode, press the SLEEP button until
the indicator light is off.
7. FAHRENHEIT/CELSIUS
• Press the F/C button to choose between Fahrenheit
and Celsius.
8. LOCK
• Press the LOCK button on the remote control to
disable button functionality. Press the LOCK button
again to activate the remote control functionality.
9. LIGHT
• When you press the LIGHT button, the display on the
unit will turn off, but the unit is still operating normally.
When you press the LIGHT button again or press
any button on the remote control, the display will be
illuminated again.
10. RESET
• Press the RESET button to reset the unit to factory
settings.
49-5000295 Rev. 1
Air Direction
COOL MIN:
COOL MAX:
To reduce cooling capacity, point air directional louvers
up.
To maximize cooling capacity, point air directional
louvers down.
Changing the Air Direction
2-Way Air Flow: The air directional louvers let you
control the direction of the airflow. The airflow can be
directed up to down.
49-5000295 Rev. 1
USING THE AIR CONDITIONER
Controls
7
CARE AND CLEANING
Care and Cleaning
Cleaning the Air Filter
The air filter is removable for easy cleaning. A clean air filter
helps remove dust, lint and particles from the air for optimal
cooling operating efficiency. The Filter Reset light will turn
on to notify you that the air filter must be cleaned. The light
goes on after the air conditioner has been operating for 240
hours.
1. Turn off the air conditioner and unplug the power supply
cord from the outlet.
2. Remove the air filter by opening the front panel.
8VHDYDFXXPFOHDQHUZLWKWKHKRVHDWWDFKPHQWWRFOHDQ
the air filter. If the air filter is very dirty, wash it in warm
water with mild detergent. Do not wash the air filter in
a dishwasher or clothes washer, or use any chemical
cleaners. Do not use a cloth dryer or microwave oven
to dry it. Air dry the air filter completely before placing it
back in the unit.
4. Place the air filter back in the air conditioner. The bottom
of the black filter should nest behind three white tabs in
the base of the front panel.
To do this, gently grip the front panel by the two openings
on the side, and slide towards you.
The front panel will slide ~ 2 inches and stop. The front
panel does not remove from the unit. You will see the
black filter tilt forward for removal.
Tabs
5. Close the front panel.
6. Plug the power supply cord into the outlet, turn on the air
conditioner and press the filter reset button to turn off the
indicator light.
NOTE: Do not operate the air conditioner without the filter
in place.
Cleaning the Front Panel
3. Air-dry the front panel completely.
1. Turn off the air conditioner and unplug the power supply
cord from the outlet.
4. Plug the power supply cord in the outlet and turn on the
air conditioner.
2. Clean the front panel with a soft cloth. Do not use
chemical cleaners, especially spray cleaners, sharp
instruments, or flammable fluids. These products can
damage the surface of your air conditioner.
8
49-5000295 Rev. 1
Questions? Call 800.GE.CARES (800.432.2737) or Visit our Website at: GEAppliances.com
BEFORE YOU BEGIN
Read these instructions completely and carefully.
•
IMPORTANT – Save these
instructions for local inspector’s use.
•
IMPORTANT – Observe all
governing codes and ordinances.
• Note to Installer – Be sure to leave these
instructions with the Consumer.
• Note to Consumer – Keep these instructions for
future reference.
• Skill level – Installation of this appliance requires
basic mechanical skills.
• Completion time – Approximately 1 hour
• We recommend that two people install
this product.
• Proper installation is the responsibility
of the installer.
• Product failure due to improper installation is not
covered under the Warranty.
‡ <RX0867XVHDOOVXSSOLHGSDUWVDQGXVHSURSHU
installation procedures as described in these
instructions when installing this air conditioner.
ELECTRICAL
REQUIREMENTS
These models require a 115/120-volt AC,
60-Hz grounded outlet protected with a
15-amp time-delay fuse or circuit breaker.
The 3-prong grounding plug minimizes the possibility
of electric shock hazard. If the wall outlet you plan to
use is only a 2-prong outlet, it is your responsibility to
have it replaced with a properly grounded 3-prong wall
outlet.
UNPACKING THE AIR
CONDITIONER
WARNING
EXCESSIVE WEIGHT HAZARD - When moving or
lifting the air conditioner, use two or more people.
Wear gloves when handling the air conditioner to
protect against possible sharp edges and metal fins.
Remove Packaging Materials
• Remove packaging materials. Save the carton
and the foam packaging for storing the unit when
not in use.
NOTE: There is NO internal packing material
inside the air conditioner to remove - DO NOT
open the cabinet.
• Handle the air conditioner gently.
• Keep the air conditioner upright and level. Do not
set the air conditioner on its side, front, back or
upside down.
• The air conditioner must be standing upright for 2
hours prior to installation and operation.
INSTALLATION INSTRUCTIONS
Installation Instructions
TOOLS YOU WILL NEED
Phillips head screwdriver
CAUTION
Drill and 1/8” drill bit
Do not, under any circumstances, cut or remove the
third (ground) prong from the power cord.
Do not change the plug on the power cord of this air
conditioner.
Aluminum house wiring may present special
problems—consult a qualified electrician.
Power cord includes a current interrupter device. A
test and reset button is provided on the plug case. The
device should be tested on a periodic basis by first
pressing the TEST button and then the RESET button
while plugged into the outlet. If the TEST button does
not trip or if the RESET button will not stay engaged,
discontinue use of the air conditioner and contact a
qualified service technician.
49-5000295 Rev. 1
Pencil
Ruler or tape measure
Level
Scissors or knife
9
INSTALLATION INSTRUCTIONS
Installation Instructions
PARTS INCLUDED
(Appearance may vary)
Side Curtain
Frame
Weather Seal (3)
Top mounting rail
Left
Right
Side
Curtain (2)
Air
conditioner
Remote Control
Side Curtain
Foam (2)
Foam
Seal
QUIET
HIGH
MED
AUTO
TEMP UP
FAN
COOL
ENERGY
SAVE
TEMP DOWN
Type A (4)
3/8” selftapping screw
10
Type B (9)
1” wood screw
Side Brackets (2)
TIMER
UP
TIMER
ON/OFF
TIMER
DOWN
DEHUM
F/C
SLEEP
LOCK
LIGHT
RESET
Window locking
bracket (1)
49-5000295 Rev. 1
1. WINDOW REQUIREMENTS
3. PREPARE THE AIR CONDITIONER
• These instructions are for a standard double-hung
window. You will need to modify them for other
types of windows.
• The air conditioner can be installed without the
side curtain panels if needed to fit in a narrow
window. See the window opening dimensions.
• All supporting parts must be secured to firm
wood, masonry or metal.
• The electrical outlet must be within reach of the
power cord.
• Follow the dimensions in the table and
illustration for your model.
A. Install the top mounting rail with 4 Type A screws
Top Mounting rail
B. Slide the side curtain panels into the side panel
rails.
13 3/8”
26-1/16”- 39-1/4”
(With side curtain panels)
2. STORM WINDOW REQUIREMENTS
A storm window frame will not allow the air
conditioner to tilt toward the outside, and will keep
it from draining properly. To adjust for this, attach
a piece of wood to the sill.
WOOD PIECES
WIDTH: 2Ǝ
LENGTH: Long enough to fit inside the window
frame.
THICKNESS: To determine the thickness, place
DSLHFHRIZRRGRQWKHVLOOWRPDNHLWƎKLJKHU
than the top of the storm window frame or the
vinyl frame.
Attach securely with nails or screws provided by
the installer.
ƎKLJKHU
than vinyl frame
(on some windows)
ƎKLJKHU
than storm
window
frame
Storm window
frame
49-5000295 Rev. 1
INSTALLATION INSTRUCTIONS
Installation Instructions
C. For model AHD06, cut and apply a weather
strip to side of the curtain frame (one each side).
D. Slide left and right side curtain frames into top
and bottom rails. Make sure that side curtains
snap into side of the frames.
Wood
Sill
CLICK
Vinyl frame
11
INSTALLATION INSTRUCTIONS
Installation Instructions
4. INSTALL THE AIR CONDITIONER
IN THE WINDOW
A. Measure the width of the window opening and
mark the center line on the inside window sill.
4. INSTALL THE AIR CONDITIONER
IN THE WINDOW (continues)
C. Install the side bracket into the unit and into the
window sill using two 1” wood screws provided.
Repeat on other side.
Width of window open
ing
Center line
Cut and apply weather
strip to front and
bottom edge of window
frame.
D. Extend the curtain panels until they fill the
window.
Cut and apply weather
strip to back edge of
the window sill
Place the unit in the window. Lower the window
sash to hold unit in place.
B. Set the air conditioner in the window so that is
centered. Place the air conditioner so that front
edge of the bottom mounting rail is against the
back edge of the sill.
Make sure that the air conditioner is level or tilting
slightly to the outside.
Top Rail
Sill
12
Mark the location of the holes in each corner of
WKHFXUWDLQ8VHWKHGULOODQG´GULOOELWWRGULOO
SLORWKROHV8VHW\SH%VFUHZVWRVHFXUHWKH
side panels in place.
Lower
Window
Sash
Bottom Rail
49-5000295 Rev. 1
5. INSTALL WINDOW LOCKING
BRACKET AND FOAM TOP
WINDOW GASKET
.
A.
8VH7\SH%6FUHZWRLQVWDOOWKHZLQGRZORFN
bracket on top of the bottom window.
CAUTION
To prevent broken glass or
damage to windows, on vinyl
or other similarly constructed
windows, attach the window
locking bracket to the
window side jamb with one
Type B screw.
5. INSTALL WINDOW LOCKING
BRACKET AND FOAM TOP
WINDOW GASKET (continues)
D. For additional energy savings, on AHD06 only,
measure and cut the adhesive backed foam
sheets, and apply over the side curtains and
frames to seal air leakage.
Vinyl
Side Curtain
Foam
Wood
Weather
Seals
INSTALLATION INSTRUCTIONS
Installation Instructions
B. Cut the foam top window gasket to the window
width.
C. Stuff the foam between the glass and the window
to prevent air and insects from getting into the
room.
NOTE: If the gasket supplied does not fit your
window, obtain appropriate material locally to
provide a proper installation seal.
49-5000295 Rev. 1
13
TROUBLESHOOTING TIPS
14
Troubleshooting Tips... Before you call for service
Save time and money! Review the charts on the following pages first and you may not need to call for service.
Problem
Possible Cause
What To Do
Air conditioner does not
start.
The unit is unplugged.
Make sure the air conditioner plug is pushed completely
into the outlet.
The fuse is blown/circuit breaker
is tripped.
Check the house fuse/circuit breaker box and replace
the fuse or reset the breaker.
Power Failure.
The unit will automatically restart in the setting last
used after the power is restored.
There is a protective time delay (approximately
3 minutes) to prevent tripping of the compressor
overload. For this reason, the unit may not start normal
cooling for 3 minutes after it is turned back on.
The current interrupter device is
tripped.
Press RESET button located on the power cord plug.
Remote control is not
working
Batteries are dead.
Replace the batteries.
Batteries inserted wrong.
Make sure batteries are inserted in the correct position.
Air conditioner does not
cool as it should.
Indoor airflow is restricted.
Make sure there are not curtains, blinds or furniture
blocking the front of the air conditioner.
The temp control may not be set
properly.
Turn the temperature control to a higher number.
The air filter is dirty.
Clean the filter at least every 30 days. See Care and
Cleaning section.
The room may have been hot.
When the air conditioner is first turned on, you need to
allow time for the room to cool down.
Cold air is escaping.
Check for open furnace registers and cold air returns.
Cooling coils have iced up.
See “Air conditioner freezing up” below.
Air conditioner freezing up
Ice blocks the air flow and stops
the air conditioner from cooling
the room.
On models with control knobs, set the mode control at
High Fan or High Cool with the Temp at 1 or 2.
Water drips outside
Hot, humid weather.
This is normal.
Water drips inside
The air conditioner is not tilted to
the outside.
For proper disposal, make sure the air conditioner
slants slightly from the case front to the rear.
Water collects in base pan
Moisture removed from air and
drain into base pan.
This is normal for a short period in areas with little
humidity; normal for a longer period in very humid
areas.
If the RESET button will not stay engaged, discontinue
use of the air conditioner and contact a qualified
service technician.
49-5000295 Rev. 1
Ŷ<RXPD\KHDUDSLQJLQJQRLVHFDXVHGE\ZDWHUEHLQJSLFNHGXSDQGWKURZQDJDLQVWWKHFRQGHQVHURQUDLQ\GD\V
or when the humidity is high. This design feature helps remove moisture and improve efficiency.
Ŷ<RXPD\KHDUWKHWKHUPRVWDWFOLFNZKHQWKHFRPSUHVVRUF\FOHVRQDQGRII
Ŷ:DWHUZLOOFROOHFWLQWKHEDVHSDQGXULQJKLJKKXPLGLW\RURQUDLQ\GD\V7KHZDWHUPD\RYHUIORZDQGGULSIURPWKH
outdoor side of the unit.
Ŷ7KHIDQPD\UXQHYHQZKHQWKHFRPSUHVVRUGRHVQRW
Ŷ:DWHUGURSOHWVEHLQJWKURZQDJDLQVWWKHRXWVLGH
coils can make a pinging noise. This helps cool
the condenser. You can reduce this noise by
removing the subbase water plug.
Removing this plug will lower the Energy Efficiency
of your until.
Subbase Water Plug
NOTE: Do not drill hole in the base pan.
TROUBLESHOOTING TIPS
Normal Operating Sounds
WiFi Setup
GE Appliances WiFi Connect (for customers in the United States)
GE Appliances WiFi Connect Enabled*. If your Air Conditioner (AC) has a Connected Appliance Information
label located on the outside as shown below, your AC is GE Appliances WiFi Connect Enabled. A WiFi
communication card is built into the product allowing it to communicate with your smart phone for remote monitoring,
control and notifications. Please visit www.GEAppliances.com/connect to learn more about connected appliance
features, and to learn what connected appliance apps will work with your smart phone.
Network: GE_MODULE_XXXX
PASSWORD: XXXXXXXX
MAC ID: XX-XX-XX-XX-XX-XX
CONTAINS FCCID: 2ALD3-MKQTWIFI11
CONTAINS IC: 22987-MKQTWIFI11
123-45-678
How it Works
Download the GE Appliances App
8VHWKHDSSWRFRQQHFW\RXUURRPDLU
conditioner to WiFi
Once connected, use the app to turn
down your air conditioner as you
leave work.
CHANGE TEMP
TO 65
WiFi Connectivity: For assistance with the appliance or the ConnectPlus network connectivity (for models that are WiFi
enabled or WiFi optional), please call 1-800-220-6899.
49-5000295 Rev. 1
15
WIFI SETUP
WiFi Setup
Getting Started
To connect your room air conditioner, you’ll need the
GE Appliances App. The app will walk you through the
connection process. Download the app from iTunes or
Google Play.
All connected appliace data is held in strict accordance
with the GE Appliances Connected Data Privacy Policy.
Visit geappliances.com/privacy/privacy_policy_
connected to view this policy.
Questions about WiFi Connect
Get answers you need about setting up WiFi appliances
and connecting to your home network in our support
articles.
Visit products.geappliances.com/appliance/geasupport-search-content to view wifi connect room air
conditioner support articles.
REGULATORY INFORMATION
• Reorient or relocate the receiving antenna.
FCC/IC Compliance Statement:
• Increase the separation between the equipment and
receiver.
This device complies with Part 15 of the FCC Rules.
Operation is subject to the following two conditions:
• Connect the equipment into an outlet on a circuit
different from that to which the receiver is connected.
1. This device may not cause harmful interference.
• Consult the dealer or an experienced radio/television
technician for help.
2. This device must accept any interference received,
including interference that may cause undesired
operation.
This equipment has been tested and found to comply
with the limits for a Class B digital device, pursuant to
Part 15 of the FCC Rules. These limits are designed
to provide reasonable protection against harmful
interference in a residential installation. This equipment
generates uses and can radiate radio frequency energy
and, if not installed and used in accordance with the
instructions, may cause harmful interference to radio
communications. However, there is no guarantee that
interference will not occur in a particular installation. If
this equipment does cause harmful interference to radio
or television reception, which can be determined by
turning the equipment off and on, the user is encouraged
to try to correct the interference by one or more of the
following measures:
Labelling: Changes or modifications to this unit not
expressly approved by the manufacturer could void the
user’s authority to operate the equipment.
*Select Models Only
This product has Wi-Fi capability and requires
Internet connectivity and a wireless router to enable
interconnection with an Energy Management System,
and/or with other external devices, systems or
applications.
8VHRIWKH:RUNVZLWK$SSOH+RPH.LWŒORJRPHDQV
that an electronic accessory has been designed to
connect specifically to iPod touch®, iPhone®, or iPad®,
respectively, and has been certified by the developer
to meet Apple® performance standards. Apple is
not responsible for the operation of this device or its
compliance with safety and regulatory standards.
Demand Response
This product has Demand Response capability that allows the product to participate in load reduction events initiated by
XWLOLWLHV7KHVHHYHQWVZLOOWHPSRUDULO\WXUQWKH$LU&RQGLWLRQHURIIWRPDNHVOLJKWDGMXVWPHQWVLQWHPSHUDWXUH8VHUVFDQ
actively override these events by pressing and holding the Mode button for 3 seconds. The unit will return to the same
status that was set prior to receiving the demand response signal.
Prior to use, download the latest GE Appliances Comfort App and update your connected software if prompted.
This product has Wi-Fi capability and requires Internet connectivity and a wireless router to enable interconnection with
an Energy Management System, and/or with other external devices, systems or applications.
16
49-5000295 Rev. 1
Staple your receipt here.
Proof of the original purchase date is needed to make a warranty claim.
For The Period Of: GE Appliances Will Replace:
One Year
From the date of the
original purchase
Replacement, repair, or refund of the original retail price for any product which fails due
to a defect in materials or workmanship. If the unit is exchanged, the replacement unit
is warranted for the remainder of your product’s original one-year warranty period. GE
Appliances will, at its sole discretion, replace the product with a product of the same or
comparable functionality and quality or refund the original retail price.
,Q2UGHUWR0DNHD:DUUDQW\&ODLP'XULQJ<RXU5HWDLOHU¶V$OORZDEOH5HWXUQ3HULRG
Ŷ Properly pack your unit. We recommend using the
original carton and packing materials.
Ŷ5HWXUQWKHSURGXFWWRWKHUHWDLOORFDWLRQZKHUHLWZDV
purchased.
Ŷ Include in the package a copy of the sales receipt
or other evidence of date of original purchase. Also
print your name and address and a description of the
defect.
LIMITED WARRANTY
GE Appliances Air Conditioner Limited Warranty
In Order to Make a Warranty Claim During the Remainder of the One-Year Warranty:
Ŷ/RFDWH\RXURULJLQDOVDOHVUHFHLSWDQGPDNHDQRWHRI
your model and serial number.
Ŷ&DOO800.GE.CARES (800.432.2737) LQWKH8QLWHG
States) to initiate the product replacement process.
Ŷ<RXZLOOEHDVNHGWRSURYLGH\RXUQDPHDGGUHVV
date of purchase, model and serial number.
Ŷ*($SSOLDQFHVZLOODUUDQJHIRUDFDUWRQWREHVHQWWR
your home to recover the product.
Ŷ Please return all requested materials (postage pre-paid)
in the carton provided. Please include a description of the
defect.
Ŷ<RXVKRXOGUHFHLYH\RXUUHSODFHPHQWSURGXFWRU
refund within 7 to 10 business days after your
package is received.
What Will Not Cover:
Ŷ&XVWRPHULQVWUXFWLRQ7KLVRZQHU¶VPDQXDOSURYLGHV
information regarding operating instructions and
user controls.
Ŷ,PSURSHULQVWDOODWLRQ,I\RXKDYHDQLQVWDOODWLRQ
problem, or if the air conditioner is of improper
capacity, contact your dealer or installer. You
are responsible for providing adequate electrical
connecting facilities.
Ŷ)DLOXUHRIWKHSURGXFWUHVXOWLQJIURPPRGLILFDWLRQV
to the product or due to unreasonable use including
failure to provide reasonable and necessary
maintenance.
Ŷ5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
breakers.
Ŷ)DLOXUHGXHWRFRUURVLRQRQPRGHOVQRWFRUURVLRQ
protected.
Ŷ'DPDJHWRWKHSURGXFWFDXVHGE\LPSURSHUSRZHU
supply voltage, accident, fire, floods or acts of God.
Ŷ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
possible defects with this air conditioner.
Ŷ'DPDJHFDXVHGDIWHUGHOLYHU\
EXCLUSION OF IMPLIED WARRANTIES - Your sole and exclusive remedy is product repair as provided in this
Limited Warranty. Any implied warranties, including the implied warranties of merchantability or fitness for a
particular purpose, are limited to one year or the shortest period allowed by law.
For US Customers: This limited warranty is extended to the original purchaser and any succeeding owner for
SURGXFWVSXUFKDVHGIRUKRPHXVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*(
Appliances Authorized Servicer is not available, you may be responsible for a trip charge or you may be required to
bring the product to an Authorized GE Appliances Service location for service. In Alaska, the limited warranty excludes
the cost of shipping or service calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty
gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor US:
GE Appliances, a Haier company
Louisville, KY 40225
49-5000295 Rev. 1
17
CONSUMER SUPPORT
Consumer Support
GE Appliances Website
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
VHUYLFHVGHVLJQHGIRU\RXUFRQYHQLHQFH,QWKH86GEAppliances.com
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
WKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO,QWKH86GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
\RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU,QWKH86GEAppliances.com/service or call 800.432.2737 during normal
business hours.
Extended Warranties
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
ZDUUDQW\H[SLUHV,QWKH86GEAppliances.com/extended-warranty or call 800.626.2224 during normal
business hours.
Remote Connectivity
For assistance with wireless network connectivity (for models with remote enable),visit our website at
GEAppliances.com/connectRUFDOOLQWKH86
Parts and Accessories
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
(VISA, MasterCard and Discover cards are accepted). Order on-line today 24 hours every day.
,QWKH86GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/contact
18
Printed in China
49-5000295 Rev. 1
PARA SALA
ACCONDICIONADORES DE AIRE
INFORMACIÓN DE SEGURIDAD . . .3
USO DEL ACONDICIONADOR DE
AIRE
Controles . . . . . . . . . . . . . . . . . . . . . . . . . . . . .4
CUIDADO Y LIMPIEZA . . . . . . . . . . . . .8
MANUAL DEL
PROPIETARIO
PHC06
PHC08
INSTRUCCIONES DE INSTALACIÓN
Antes de comenzar . . . . . . . . . . . . . . . . . . . .9
Requisitos Eléctricos . . . . . . . . . . . . . . . . . .9
Piezas Incluidas . . . . . . . . . . . . . . . . . . . . . . 10
Requisitos de la Ventana . . . . . . . . . . . . . . 11
Preparación del Acondicionador de Aire 11
Instalación del Acondicionador de Aire . 12
CONSEJOS PARA LA SOLUCIÓN
DE PROBLEMAS . . . . . . . . . . . . . . . . . 14
Sonidos de Funcionamiento Normal . . . . 15
CONFIGURACIÓN WIFI . . . . . . . . . . . 15
SOPORTE AL CLIENTE
Garantía Limitada . . . . . . . . . . . . . . . . . . . . . 17
Soporte al Cliente . . . . . . . . . . . . . . . . . . . . 18
Escriba los números de modelo y de
serie aquí:
Nº de Modelo ____________
Nº de Serie ______________
Estos números se encuentran en una
etiqueta al costado del acondicionador
de aire.
GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca.
49-5000295 Rev. 1 02-19 GEA
GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR.
Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace
tenerlo en la familia.
Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de
GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico
asegura que podamos entregarle información importante del producto y detalles de la garantía
cuando los necesite.
Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles
están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con
el material embalado.
2
49-5000295 Rev. 1
ADVERTENCIA
Para su seguridad, siga las instrucciones de este manual a fin de minimizar riesgos de
incendio, descargas eléctricas o heridas personales.
Ŷ8VHHVWHHOHFWURGRPpVWLFRVyORSDUDVXSURSyVLWRRULJLQDOFRPRVH
describe en el Manual del Propietario.
Ŷ(VWHDFRQGLFLRQDGRUGHDLUHVHGHEHLQVWDODUGHIRUPDDSURSLDGDGH
acuerdo con las Instrucciones de Instalación antes de ser usado.
Ŷ1XQFDGHVHQFKXIHVXDFRQGLFLRQDGRUGHDLUHHPSXMDQGRHOFDEOH
de corriente. Siempre tome su enchufe de manera firme y empuje el
mismo hacia afuera del receptáculo.
Ŷ5HHPSODFHGHLQPHGLDWRWRGRVORVFDEOHVGHOVHUYLFLRGHHOHFWULFLGDG
SHODGRVRFRQFXDOTXLHUWLSRGHGDxR8QFDEOHGHOVHUYLFLRGH
corriente que esté dañado deberá ser reemplazado por uno nuevo
SURYLVWRSRUHOIDEULFDQWH\QRGHEHUiVHUUHSDUDGR1RXVHXQFDEOH
con cortaduras o abrasión sobre su extensión o en cualquiera de sus
enchufes o extremos.
Ŷ&RORTXHODXQLGDGHQ2)) $SDJDGR \GHVHQFKXIHHO
acondicionador de aire antes de usar el mismo.
Ŷ3DUDVXVHJXULGDGQRDFXPXOHQLXVHPDWHULDOHVFRPEXVWLEOHV
gasolina u otros vapores o líquidos inflamables cerca de éste u otro
electrodoméstico.
Ŷ6LHOUHFHSWiFXORQRFRLQFLGHFRQHOHQFKXIHHOFDPELRGHOPLVPR
deberá ser realizado por un electricista calificado.
ADVERTENCIA Riesgo de Incendio o Explosión. Esta unidad contiene refrigerante inflamable.
Se deben seguir las precauciones adicionales de seguridad.
Ŷ$ILQGHDFHOHUDUHOSURFHVRGHGHVFRQJHODFLyQRSDUDOLPSLDUQRXVH
ningún método que no sea el recomendado por el fabricante.
Ŷ(VWHHOHFWURGRPpVWLFRGHEHUiVHUJXDUGDGRHQXQDVDODGRQGHQR
KD\DIXHQWHVGHHQFHQGLGRFRQWLQXDV SRUHMHPSOROODPDVDELHUWDV
un electrodoméstico que funcione a gas o un calefactor que funcione
DHOHFWULFLGDG Ŷ1RSHUIRUHQLTXHPHHOWXERUHIULJHUDQWH7HQJDSUHVHQWHTXHORV
refrigerantes no deben tener olor.
Ŷ0DQWHQJDODVDEHUWXUDVGHODYHQWLODFLyQOLEUHVGHREVWUXFFLRQHV
Ŷ$OPRYHULQVWDODU\RSHUDUHOHOHFWURGRPpVWLFRVHGHEHUiWHQHU
cuidado para evitar dañar la tubería del refrigerante.
Ŷ1RUHDOLFHSHUIRUDFLRQHVHQODXQLGDG
Ŷ(OPDQWHQLPLHQWRODOLPSLH]D\HOVHUYLFLRWpFQLFRVyORGHEHUiQVHU
realizados por técnicos adecuadamente entrenados y calificados en
el uso de refrigerantes inflamables.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
Ŷ*(QRVXPLQLVWUDVHUYLFLRWpFQLFRSDUDHODFRQGLFLRQDGRUGHDLUH
Ŷ'HVFDUWHHOHOHFWURGRPpVWLFRGHDFXHUGRFRQODV5HJXODFLRQHV
Federales y Locales. Los refrigerantes inflamables requieren
procedimientos de descarte específicos. A fin de descartar
su acondicionador de aire de forma ambientalmente segura,
comuníquese con las autoridades locales.
ADVERTENCIA USO DE PROLONGADORES
RIESGO DE INCENDIO. Podría
ocasionar lesiones graves o la muerte.
Ŷ12XVHXQSURORQJDGRUFRQHVWH$FRQGLFLRQDGRUGH$LUHGH
Ventana.
Ŷ12XVHSURWHFWRUHVFRQWUDSLFRVGHFRUULHQWHQL
adaptadores para múltiples tomacorrientes con este
Acondicionador de Aire de Ventana.
CÓMO CONECTAR LA ELECTRICIDAD
1XQFDEDMRQLQJXQDFLUFXQVWDQFLDFRUWHRHOLPLQHHOWHUFHUFDEOH
WLHUUD GHOFDEOHGHFRUULHQWH3DUDVXVHJXULGDGSHUVRQDOHVWH
electrodoméstico debe estar adecuadamente conectado a tierra.
Contrate a un electricista calificado para que controle el
tomacorriente y el circuito eléctrico para asegurar que el
enchufe esté correctamente conectado a tierra.
NO use un enchufe adaptador con este electrodoméstico.
En caso de contar con un tomacorriente de pared de 2
cables, es su responsabilidad y obligación reemplazarlo
por un tomacorriente de pared de 3 cables correctamente
conectado a tierra.
El cable de corriente de este electrodoméstico contiene un
HQFKXIHGHFDEOHV FRQH[LyQDWLHUUD TXHVHFRQHFWDDXQ
WRPDFRUULHQWHGHSDUHGHVWiQGDUGHFDEOHV FRQH[LyQD
WLHUUD SDUDPLQLPL]DUODSRVLELOLGDGGHULHVJRVGHGHVFDUJDV
eléctricas por parte del mismo.
El cable de corriente incluye un interruptor de corriente. Se brinda
un botón de evaluación y reinicio en la caja del enchufe. El
dispositivo deberá ser evaluado en forma periódica, presionando
primero el botón TEST (YDOXDU \OXHJRRESET 5HLQLFLR mientras se encuentre enchufado al tomacorriente. Si el botón
TEST (YDOXDU QRVHDFWLYDRHOERWyQRESET 5HLQLFLR QR
permanece en su posición, deje de usar el acondicionador de
aire y comuníquese con un técnico calificado del servicio.
49-5000295 Rev. 1
El acondicionador de aire debería estar siempre conectado a
un enchufe específico con un índice de voltaje equivalente al
que figura en su etiqueta de características técnicas.
Esto garantiza el mejor funcionamiento y además previene la
sobrecarga de los circuitos del hogar, lo cual podría ocasionar
riesgos de incendio debido al recalentamiento de cables.
Para conocer los requisitos específicos de la conexión
eléctrica, consulte las Instrucciones de Instalación,
Requisitos Eléctricos.
LEA Y GUARDE ESTAS INSTRUCCIONES
3
USO DEL ACONDICIONADOR DE AIRE
Controles
Las funciones y la apariencia podrán variar.
Auto High
Power
Delay
Med
Quiet
Cool
Fan E-Save Dehum
Fan
Mode
Filter
Wi¿
2
1
5
6
Temp | Time
3
4
/DOX]VyOLGDLQGLFDTXHHO:L)LHVWiFRQHFWDGR
La luz parpadeante indica que se está conectando.
Consulte la sección de Configuración de WiFi en
HVWHPDQXDO SiJ
Esta sección explica cómo hacer funcionar este aire
acondicionado.
IMPORTANTE:
C uando apague el aire acondicionado, ya sea desde
el tablero de control o con el control remoto, espere por
lo menos 3 minutos antes de volver a encenderlo. Esto
evita que el compresor se sobrecargue. Esta espera de 3
minutos también se aplica cuando se cambia del modo de
espera al de ventilación y a la inversa.
NOTA: Hay un retardo integrado de 3 minutos. Puede
notar que el compresor no enciende inmediatamente. Esto
se diseñó así para proteger la unidad.
1RSRQJDHQIXQFLRQDPLHQWRHODLUHDFRQGLFLRQDGRHQHO
modo de enfriamiento cuandola temperatura exterior sea
PHQRUDORVƒ) ƒ& (OVHUSHQWtQGHOHYDSRUDGRU
interiorse congelará y el aire acondicionado no funcionará
correctamente.
NOTA: Cuando el aire acondicionado se conecte por
SULPHUDYH]ODSDQWDOOD/('PRVWUDUi³´GXUDQWH
VHJXQGRV'HVSXpVGHHQFHQGHUHODLUHDFRQGLFLRQDGRSRU
primera vez, la pantalla mostrará la temperatura de 72 °F
ƒ& HOYHQWLODGRUVHHVWDEOHFHUiDXWRPiWLFDPHQWHHQ
4XLHWVSHHG YHORFLGDGVLOHQFLRVD \HOLQGLFDGRUGHPRGR
PRVWUDUi(1(5*<6$9( DKRUURGHHQHUJtD NOTA: Para cambiar la temperatura entre grados
)DKUHQKHLW ) \&HOVLXV & HQODSDQWDOODGHEHFRQHFWDUHO
aire acondicionado y encenderlo. En el tablero de control,
en la parte frontal del aire acondicionado, oprima los
ERWRQHV83 DUULED \'2:1 DEDMR DOPLVPRWLHPSR\
manténgalos oprimidos durante 3 segundos. Pulse el botón
)&HQHOFRQWUROUHPRWRSDUDFDPELDUHQWUH)DKUHQKHLW ) \&HOVLXV & NOTA: Cada vez que se enciende un aire acondicionado
FDOLILFDGRGH(1(5*<67$5pVWHRSHUDUiHQHOPRGRGH
ahorro de energía de acuerdo con los requerimientos de
EPA. Puede seleccionar
cualquier otro modo que se ajuste a sus necesidades.
Controles
1. MODO
2SULPD02'(KDVWDTXHYHDTXHODOX]LQGLFDGRUD
pasa a la siguiente configuración deseada.
(OLMD)DQ YHQWLODFLyQ &RRO HQIULDPLHQWR (QHUJ\6DYH (6DYH DKRUURGHHQHUJtD R'HKXP
GHVKXPLGLILFDU Fan -6RORIXQFLRQDHOYHQWLODGRU2SULPD)$163(('
SDUDVHOHFFLRQDUODYHORFLGDGGHOYHQWLODGRU+LJK0HG
R4XLHW DOWDEDMDRVLOHQFLRVD /DSDQWDOODPXHVWUDOD
temperatura actual de la habitación. NOTA: En el modo
Fan, la temperatura no puede ajustarse.
E-Save - En este modo el ventilador funciona
únicamente cuando se requiere el enfriamiento. El
ventilador funcionará durante 3 minutos después de que
el compresor se apague. Posteriormente el ventilador se
encenderá en ciclos de 2 minutos, en intervalos de 10
minutos, hasta que la temperatura en la habitación esté
SRUDUULEDGHODWHPSHUDWXUDHVWDEOHFLGD'HVSXpVHO
compresor se enciende de nuevo.
Cool (QIUtDODKDELWDFLyQ2SULPD)$163(('SDUD
VHOHFFLRQDUODYHORFLGDGGHOYHQWLODGRU+LJK DOWD 0HG
PHGLD 4XLHW VLOHQFLRVD R$XWR DXWRPiWLFD 2SULPDHO
4
botón TEMP/TIME + o – el botón de flecha para ajustar
la temperatura. El ventilador operará continuamente en
modo de enfriamiento.
'HKXP$\XGDDHOLPLQDUODKXPHGDGGHODKDELWDFLyQ
(OPRGR'HKXPQRGHEHXWLOL]DUVHSDUDHQIULDUOD
habitación.
NOTA: (QPRGR'HKXPFXDQGRODWHPSHUDWXUD
establecida esté cerca de la temperatura ambiente,
el compresor puede detenerse y el ventilador operará
solamente en la velocidad Quiet.only.
2. VELOCIDAD (FAN SPEED)
3UHVLRQH)$163((' YHORFLGDG KDVWDTXHYHD
que la luz indicadora pasa a la siguiente configuración
deseada.
(OLMDHOHQIULDPLHQWR+LJK DOWR 0HG PHGLR 4XLHW
VLOHQFLRVR R$XWR DXWRPiWLFR HIGH—Para un máximo enfriamiento
0('²3DUDXQHQIULDPLHQWRQRUPDO
48,(7²3DUDXQHQIULDPLHQWR\UXLGRPtQLPRV
$872±$MXVWDDXWRPiWLFDPHQWHODYHORFLGDGGHO
ventilador para ofrecer un enfriamiento
óptimo con base en la temperatura de la habitación.
49-5000295 Rev. 1
6. RETRASO
Delay ON (Retraso Encendido)—Cuando el
acondicionador de aire se encuentre apagado, se podrá
configurar para que se encienda automáticamente
en un período de entre 1 y 24 horas en el modo y
configuraciones del ventilador previas.
4. TIEMPO/TEMPERATURA
2SULPDHOERWyQ7(037,0(SDUDVXELUOD
temperatura. Cada vez que oprima el botón TEMP/TIME
ODWHPSHUDWXUDDXPHQWDUiƒ) ƒ& KDVWD que
OOHJXHDORVƒ) ƒ& Delay OFF (Retraso del Apagado)—Cuando el
acondicionador de aire se encuentre encendido, se
podrá configurar automáticamente para que se apague
en un período de entre 1 y 24 horas.
2SULPDHOERWyQ7(037,0(±SDUDEDMDUOD
temperatura. Cada vez que oprima el botón TEMP/TIME
±ODWHPSHUDWXUDGLVPLQXLUiƒ) ƒ& KDVWDTXH
OOHJXHDORVƒ) ƒ& Cómo configurar:
Presione la tecla Delay 1–24hr 5HWUDVRHQWUH\
KUV HQODXQLGDGRHQHOFRQWUROUHPRWR&DGDYH]TXH
presione las teclas Increase (Incrementar) +/ Decrease
(Reducir) – de la unidad del control remoto se ajustará
el temporizador por intervalos de 1 hora.
NOTA(QHOPRGRGHYHQWLODGRUODSDQWDOODPRVWUDUi
la temperatura actual. En el modo de ahorro de
energía, enfriar o deshumidificar, la pantalla mostrará la
temperatura establecida.
Para revisar el tiempo restante en el temporizador de
Delay 1–24hr (Retraso entre 1 y 24 hrs), presione la
tecla Delay 1–24hr (Retraso entre 1 y 24 hrs.) de la
XQLGDGRGHOFRQWUROUHPRWR8VHODVWHFODV Increase
(Incrementar) + / Decrease (Reducir) – de la unidad
del control remoto para configurar un tiempo nuevo si
así lo desea.
Para cancelar el temporizador, presione la tecla
reducir – en la unidad o en el control remoto, hasta que
el tiempo configurado sea cero. Luego de 3 segundos,
la luz de la tecla Delay 1-24 hour (Retraso de 1 a 24
horas) se apaga.
49-5000295 Rev. 1
5. RESTABLECIMIENTO DEL FILTRO
Esta característica le notifica de manera automática
que el filtro de aire debe limpiarse. La luz indicadora se
encenderá después de 240 horas de funcionamiento.
/LPSLHHOILOWURGHDLUH FRQVXOWHODVHFFLyQ&XLGDGR\
OLPSLH]D FROyTXHORGHQXHYRHQHOWDEOHURIURQWDO\
SUHVLRQHHOERWyQ)LOWHU5HVHW UHVWDEOHFLPLHQWRGHOILOWUR La luz se apagará.
5. WiFi Connect
Enables connection of the air conditioner to hte home
:L)L'RZQORDG$SSIRUGHWDLOVDW
GEAppliances.com/connect.
USO DEL ACONDICIONADOR DE AIRE
Controles
5
USO DEL ACONDICIONADOR DE AIRE
Controles
USO DEL CONTROL REMOTO
24 (la unidad debe estar encendida):
El control remoto puede tener una apariencia diferente al de
la imagen mostrada.
2SULPDHOERWyQ7,0(212)) (QFHQGLGR$SDJDGRGHO
WHPSRUL]DGRU HQHOFRQWUROUHPRWRSDUDVHOHFFLRQDUOD
función de apagado del temporizador.
2SULPDHOERWyQGHIOHFKD7,0(583 DXPHQWDU
WHPSRUL]DGRU R7,0(5'2:1 GLVPLQXLUWHPSRUL]DGRU para cambiar el tiempo de demora de 1 a 24 horas.La
OX]LQGLFDGRUD7LPHU2))GHOSDQHOGHFRQWUROGHODLUH
acondicionado se encenderá.
QUIET
HIGH
MED
AUTO
TEMP UP
FAN
COOL
ENERGY
SAVE
TEMP DOWN
TIMER
UP
TIMER
ON/OFF
TIMER
DOWN
DEHUM
F/C
SLEEP
LOCK
LIGHT
RESET
NOTA: Retire la parte trasera del control e inserte dos baterías
AAA. Reemplace las baterías después de 6 meses de uso, o bien,
cuando el control remoto comience a perder energía.
NOTA: 12FRPELQHEDWHUtDVYLHMDV\QXHYDV
1. ENCENDIDO
2SULPDHOHQFHQGLGRERWyQSDUDHQFHQGHUHODLUH
acondicionado. Cuando presione por primera vez el encendido
botón, el aire acondicionado operará en modo de ahorro de
energía, con la velocidad del ventilador establecida en Quiet
VLOHQFLRVR \XQDWHPSHUDWXUDGHƒ) ƒ& 8VWHGSXHGH
seleccionar otro modo que se ajuste a sus necesidades.
2. Velocidad
High3UHVV+,*+EXWWRQWRFKRRVHKLJKIDQVSHHG
Me Alta - 2SULPDHOERWyQ+LJKSDUDHOHJLUODYHORFLGDGDOWDGHO
ventilador.
Media - 2SULPDHOERWyQ0HGSDUDHOHJLUODYHORFLGDGPHGLD
del ventilador.
Quiet -2SULPDHOERWyQ4XLHWSDUDHOHJLUODYHORFLGDG
VLOHQFLRVD PtQLPD GHOYHQWLODGRU
Auto Cool -2SULPDHOERWyQ$XWR&RROSDUDHOHJLUODYHORFLGDG
del ventilador con enfriamiento automático. d 3UHVV0('
button to choose medium fan speed.
Quiet3UHVV48,(7EXWWRQWRFKRRVHTXLHWIDQVSHHG
Auto Cool 3UHVV$872EXWWRQWRFKRRVHDXWRFRROIDQ
speed.
3. MODO
FAN - 2SULPDHOERWyQ)DQSDUDDFWLYDUHOPRGRGHYHQWLODGRU
COOL - 2SULPDHOERWyQ&RROSDUDDFWLYDUHOPRGRGH
enfriamiento.
ENERGY SAVE (E-Save) -2SULPDHOERWyQ(QHUJ\6DYHSDUD
activar el modo de energía.
DEHUM - 2SULPDHOERWyQ'HKXPSDUDDFWLYDUHOPRGRGH
deshumidificación.
3. El timbre suena dos veces después de 5 segundos, luego
7LPHU2))FXHQWDDWUiVLQLFLDUi
PARA BORRAR LA PROGRAMACIÓN DE DEMORA DEL
TEMPORIZADOR:
NOTA: El aire acondicionado puede estar encendido o
DSDJDGR2SULPDHOERWyQ7,0(5212))KDVWDTXHODOX]
indicadora del temporizador se apague.
5. AUMENTAR/DISMINUIR TEMPERATURA
‡2SULPDHOERWyQ7(0383SDUDDXPHQWDUODWHPSHUDWXUD
&DGDYH]TXHRSULPDHOERWyQ7(0383ODWHPSHUDWXUD
DXPHQWDUiƒ) ƒ& KDVWDOOHJDUDORVƒ) ƒ& ‡2SULPDHOERWyQ7(03'2:1SDUDGLVPLQXLUOD
WHPSHUDWXUD&DGDYH]TXHRSULPDHOERWyQ7(03'2:1OD
WHPSHUDWXUDGLVPLQXLUiƒ) ƒ& KDVWDOOHJDUDORVƒ)
ƒ& 6. DORMIR
2SULPDHOERWyQ6/((3SDUDHOHJLUHOPRGRGHDSDJDGR
DXWRPiWLFR/DSDQWDOODPRVWUDUi \VHHQFHQGHUiODOX]
del indicador.
/DWHPSHUDWXUDDXPHQWDUiƒ) ƒ& KRUDGHVSXpVGH
haber seleccionado el modo.Posteriormente la temperatura
DXPHQWDUiRWURVƒ) ƒ& GHVSXpVGHKRUD/DXQLGDG
mantendrá esta temperatura durante 6 horas y después se
detendrá.
3. Par a apagar el modo de apagado automático, presione el
botón SLEEP hasta que la luz del indicador se apague.
7. FAHRENHEIT/CELSIUS
‡2SULPDHOERWyQ)&SDUDHOHJLUHQWUH)DKUHQKHLW\&HOVLXV
8. BLOQUEO
‡2SULPDHOERWyQ/2&. EORTXHDU HQHOFRQWUROUHPRWRSDUD
GHVKDELOLWDUODIXQFLRQDOLGDGGHOERWyQ2SULPDHOERWyQ/RFN
nuevamente para activar la funcionalidad del control remoto.
9. LUZ
‡&XDQGRSUHVLRQHHOERWyQ/,*+7 OX] ODSDQWDOODGHOD
unidad se apagará, pero la unidad continuará operando
normalmente. Cuando presione nuevamente el botón LIGHT
o cualquier botón del control remoto, la pantalla se volverá a
iluminar.
10. RESTABLECER
‡2SULPDHOERWyQ5HVHWSDUDUHVWDEOHFHUODXQLGDGDOD
configuración de fábrica.
4. TEMPORIZADOR
Para ajustar el aire acondicionado para que se apague
después de una cantidad determinada de horas, entre 1 y
6
49-5000295 Rev. 1
DIRECCIÓN DEL AIRE
Enfriamiento mínimo:
Enfriamiento máximo:
Para reducir la capacidad de enfriamiento, apunte para
arriba las rejillas que dan dirección al aire.
Para maximizar la capacidad de enfriamiento, apunte
para abajo las rejillas que dan dirección al aire..
CAMBIO DE LA DIRECCIÓN DEL AIRE
)OXMRGHDLUHGHGLUHFFLRQHV/DVUHMLOODVGLUHFFLRQDOHV
de aire le permiten controlar la dirección del flujo de
aire. El flujo de aire se puede dirigir hacia arriba o hacia
abajo.
49-5000295 Rev. 1
USO DEL ACONDICIONADOR DE AIRE
Controles
7
CUIDADO Y LIMPIEZA
Cuidado y limpieza
LIMPIEZA DEL FILTRO DE AIRE
3DUDIDFLOLWDUODOLPSLH]DVHSXHGHTXLWDUHOILOWURGHDLUH8Q
filtro de aire limpio ayuda a eliminar del aire el polvo, las
pelusas y las partículas para obtener un enfriamiento óptimo
y un funcionamiento eficaz.La luz Filter Reset se encenderá
para notificarle que el filtro de aire debe limpiarse. La luz se
enciende después de un funcionamiento de 240 horas del
aire acondicionado.
1. Encienda el aire acondicionado y desconecte el cable de
suministro eléctrico del tomacorriente.
2. Retire el filtro de aire abriendo el panel frontal.
Para hacer esto, tome de forma suave el panel frontal
desde la dos aberturas laterales y realice el deslizamiento
hacia usted.
8WLOLFHXQDDVSLUDGRUDFRQHODFFHVRULRGHPDQJXHUD
para limpiar el filtro de aire. Si el filtro de aire está muy
VXFLROiYHORFRQDJXDWLELD\GHWHUJHQWHVXDYH1RODYH
el filtro de aire en un lavavajillas, una lavadora, ni utilice
OLPSLDGRUHVTXtPLFRV1RXVHXQDVHFDGRUDQLXQKRUQR
GHPLFURRQGDVSDUDVHFDUOR'HMHTXHHOILOWURVHTXH
completamente al aire libre antes de colocarlo de nuevo
en la unidad.
4. Vuelva a colocar el filtro de aire en el acondicionador
de aire. La parte inferior del filtro negro se deberá poder
calzar detrás de tres lengüetas blancas en la base del
panel frontal.
El panel frontal se deslizará ~ 2 pulgadas y se detendrá.
No es posible retirar el panel frontal de la unidad.
2EVHUYDUiTXHHOILOWURQHJURVHLQFOLQDKDFLDDGHODQWH
para su retiro.
Tabs
5. Cierre el panel frontal.
6. Conecte el cable de suministro eléctrico en el
tomacorriente, encienda el aire acondicionado y presione
el botón de restablecimiento de filtro para apagar la luz
indicadora.
NOTA: 1RKDJDIXQFLRQDUHODLUHDFRQGLFLRQDGRVLQFRORFDU
el filtro en su lugar.
LIMPIEZA DEL PANEL FRONTAL
'HMHTXHHOSDQHOIURQWDOVHTXHFRPSOHWDPHQWHDODLUH
1. Encienda el aire acondicionado y desconecte el cable de
suministro eléctrico del tomacorriente.
4. Conecte el cable de suministro eléctrico en el
tomacorriente y encienda el aire acondicionado.
/LPSLHHOSDQHOIURQWDOFRQXQSDxRVXDYH1RXWLOLFH
limpiadores químicos, especialmente limpiadores en
aerosol, instrumentos filosos ni líquidos inflamables.
Estos productos pueden dañar la superficie del aire
acondicionado.
49-5000295 Rev. 1
¿Preguntas? Llame 800.GE.CARES (800.432.2737) o visite nuestra página en la red en:
GEAppliances.com
ANTES DE INICIAR
Lea estas instrucciones completa y
cuidadosamente.
•
IMPORTANTE – Guarde estas
instrucciones para uso del inspector local.
•
•
•
•
•
•
•
•
•
IMPORTANTE – 2EVHUYHWRGRV
los códigos y órdenes de ley.
Nota al instalador ±$VHJ~UHVHGHGHMDUHVWDV
instrucciones con el consumidor.
Nota al consumidor ±&RQVHUYHHVWDV
instrucciones para referencia futura..
Nivel de destreza±/DLQVWDODFLyQGHHVWHDSDUDWR
requiere de destrezas mecánicas básicas.
Tiempo de ejecución – Aprox. 1 hora
Recomendamos dos personas para
la instalación de este producto.
La instalación apropiada es la responsabilidad del
instalador.
La falla del producto debido a una instalación
inadecuada no está cubierta
por la garantía.
Cuando instale este acondicionador
GHDLUH'(%(XVDUWRGDVODVSLH]DVVXPLQLVWUDGDV
y usar procedimientos adecuados de instalación.
REQUISITOS ELÉCTRICOS(CONT)
El cable de alimentación incluye un dispositivo para
interrupción de corriente. Se incluye un botón de
prueba y de reinicio en el dispositivo. El dispositivo
GHEHSRQHUVHDSUXHEDSHULyGLFDPHQWHSULPHUR
se presiona el botón de TEST SUXHED \OXHJR
RESET UHLQLFLR PLHQWUDVVHHQFXHQWUDHQFKXIDGRDO
tomacorriente. Si el botón TEST no se dispara o si el
botón RESET no queda enganchado, deje de utilizar el
acondicionador de aire y comuníquese con un técnico
calificado.
HERRAMIENTAS QUE
NECESITARÁ
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de instalación
8QGHVWRUQLOODGRUGHHVWUHOOD
7DODGUR\EURFDGH´
REQUISITOS ELÉCTRICOS
Algunos modelos requieren tomacorrientes
de 115/120 voltios de corriente alterna y
60 Hz conectados a tierra, protegidos con
un fusible de dilatación de tiempo de 15
amperios o un cortacircuitos.
El enchufe de tres púas con conexión a tierra
minimiza la posibilidad de descargas eléctricas. Si
el tomacorriente de la pared que usted planea usar
solamente tiene 2 tomas, es su responsabilidad
hacer que un técnico lo reemplace por uno de tres
tomas con conexión a tierra.
Lápiz
8QDUHJODRFLQWDPpWULFD
1LYHO
Tijeras o cuchilla
PRECAUCIÓN
%DMRQLQJXQDFLUFXQVWDQFLDFRUWHRUHPXHYDOD
WHUFHUDS~D FRQH[LyQDWLHUUD GHOFDEOHHOpFWULFR
1RFDPELHHOHQFKXIHHQHOFDEOHHOpFWULFRGHHVWH
acondicionador de aire.
Los cables caseros de aluminio podrían presentar
problemas especiales. Consulte a un técnico
electricista calificado.
49-5000295 Rev. 1
9
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de instalación
PARTES INCLUIDAS
(La apariencia puede variar)
Riel de montaje superior
%XUOHWH Marcos de la
Cortina Lateral
dejado
derecho
Cortinas
Laterales
Acondicionador
de aire
Gomaespuma de
la Cortina Lateral
Cinta de espuma
QUIET
HIGH
MED
AUTO
TEMP UP
FAN
ENERGY
SAVE
COOL
TEMP DOWN
TIMER
UP
TIMER
ON/OFF
TIMER
DOWN
DEHUM
F/C
SLEEP
LOCK
LIGHT
RESET
Control remoto
7LSR$ Tornillos
autorroscantes
GH´
10
7LSR% Tornillo de madera
GH´
Soportes Laterales
Soporte de Cierre
GHOD9HQWDQD 49-5000295 Rev. 1
1. REQUISITOS PARA LA VENTANA
• Estas instrucciones son para una ventana estándar
GHGRVSOLHJXHV8VWHGQHFHVLWDUiPRGLILFDUHO
proceso para otros tipos de ventanas.
• El acondicionador de aire puede instalarse sin los
paneles de acordeón para ajustarse a una ventana
más estrecha. Ver las dimensiones de la abertura de
la ventana.
• Todas las partes de apoyo deben quedar totalmente
aseguradas a algún metal, mampostería o a la
madera.
• El tomacorriente eléctrico debe estar al alcance del
cable eléctrico del acondicionador de aire.
• Siga las dimensiones de la tabla y la ilustración
según su modelo.
3. PREPARE EL ACONDICIONADOR
DE AIRE
A. Instale el riel de montaje superior con tornillos Tipo A,
4 desde la parte exterior de la caja.
Riel de montaje superiorl
B.'HVOLFHORVSDQHOHVGHODFRUWLQDODWHUDOHQORVULHOHV
del panel lateral.
13 3/8”
26-1/16”- 39-1/4”
FRQSDQHOHVGHDFRUGHyQ
2. REQUISITOS DE UNA VENTANA
DE TORMENTAS
8QPDUFRGHYHQWDQDGHWRUPHQWDVQRSHUPLWLUiTXH
el acondicionador de aire se incline hacia el exterior
y evitará que drene apropiadamente. Para solucionar
este problema, adhiera un pedazo de madera a el
umbral.
PEDAZOS DE MADERA
$1&+2Ǝ
LONGITUD: Lo suficientemente largo como para
ajustar en el interior del marco de la ventana.
GRUESO: Para determinar el grueso, coloque un
SHGD]RGHPDGHUDHQHOXPEUDOSDUDKDFHUODƎPiV
alta que la parte superior del marco de la ventana de
tormentas o del marco vinilo.
Péguelo firmemente con clavos o con tornillos
proporcionados por el instalador.
ƎPiVDOWR
que el marco
de ventana de
tormentas
Marco de
ventana de
tormentas
49-5000295 Rev. 1
ƎPDVDOWRTXHHOPDUFR
YLQLOR HQDOJXQDVYHQWDQDV
Madera
8PEUDO
Marco vinilo
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de instalación
C. Para el modelo AHD06, corte y coloque un
burlete sobre el lateral del marco de la cortina
XQRHQFDGDODGR D. 'HVOLFHORVPDUFRVGHODVFRUWLQDVODWHUDOHVL]TXLHUGD
y derecha en el riel
de montaje superior
e inferior. Asegúrese
de que las cortinas
laterales coincidan
sobre los costados de
los marcos.
CLICK
11
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de instalación
4. INSTALL THE AIR CONDITIONER
IN THE WINDOW
4. INSTALL THE AIR CONDITIONER
IN THE WINDOW (continues)
A. Mida el ancho de la abertura de la ventana y
marque la línea central del alféizar interior de la
ventana.
C. Instale el soporte lateral en la unidad y en el
alféizar de la ventana, usando los dos tornillos
GHPDGHUDGH´SURYLVWRV5HSLWDHVWHSDVRGHO
otro lado.
Ancho de la abertura
de
la ventana
Línea central
Corte y coloque un
burlete en la parte
frontal y en el extremo
inferior del marco de la
ventana.
D. Extienda los paneles de la cortina hasta que
llenen la ventana.
Corte y coloque un
burlete en el extremo
trasero del alféizar de
la ventana.
&RORTXHODXQLGDGHQODYHQWDQD%DMHODPDUFR
de la ventana para mantener sostenida la unidad.
B. Coloque el acondicionador de aire en la ventana
de modo que se encuentre centrado. Coloque el
acondicionador de aire de modo que el extremo
frontal del riel de montaje inferior se encuentre
contra el extremo trasero del alféizar.
Asegúrese de que el acondicionador de aire esté
nivelado o apenas inclinado hacia el exterior.
Riel superior
Alféizar
12
Marque la ubicación de los agujeros en cada
HVTXLQD8VHHOWDODGUR\XQDEURFDGH´SDUD
WDODGUDUDJXMHURVSLORWR8VHWRUQLOORVWLSR%
para asegurar los paneles laterales en sus
lugares correspondientes.
Marco de la
ventana
Riel inferior
49-5000295 Rev. 1
5. INSTALE EL SOPORTE DE
LA TRABA DE LA VENTANA
Y LA JUNTA SUPERIOR DE
GOMAESPUMA DE LA VENTANA
8VHXQWRUQLOORWLSR%SDUDLQVWDODUHOVRSRUWHGH
bloqueo arriba de la parte
inferior de la ventana.
A.
PRECAUCIÓN
Para evitar la rotura de vidrios
o daños sobre las ventanas,
sobre vinilo o ventanas
construidas de manera similar,
adjunte el soporte de bloqueo
de la ventana a la jamba lateral
de la ventana con un tornillo
7LSR%
5. INSTALE EL SOPORTE DE
LA TRABA DE LA VENTANA
Y LA JUNTA SUPERIOR DE
GOMAESPUMA DE LA VENTANA
D. Para ahorros adicionales de energía, sólo en
$+'PLGD\FRUWHODVSODQFKDVDGKHVLYDVFRQ
base de gomaespuma, y coloque las mismas
sobre las cortinas laterales y marcos para sellar
el paso del aire.
Vinilo
Madera
Goma espuma
de la cortina
lateral
Sellos
herméticos
B. Corte la junta de gomaespuma superior de la ventana
del mismo ancho que la ventana.
INSTRUCCIONES DE INSTALACIÓN
Instrucciones de instalación
C. Coloque la gomaespuma entre el vidrio y la ventana
para evitar el ingreso de aire e insectos a la habitación.
NOTA: Si la junta provista no se ajusta a su ventana,
obtenga el material apropiado en forma local para
contar con un sellado correcto en la instalación.
49-5000295 Rev. 1
13
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
14
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no
necesite solicitar reparaciones.
Problema
Causas posibles
Qué hacer
El acondicionador de aire
no enciende
El acondicionador de aire está
desconectado.
Cerciórese de que el acondicionador de aire está
enchufado totalmente en el tomacorriente.
El fusible se disparó/ el
cortacircuitos se disparó.
Inspeccione los fusibles / caja de interruptores de
la casa y reemplace cualquier fusible o reajuste el
interruptor.
Interrupción en el suministro
eléctrico.
La unidad se reiniciará automáticamente con la
configuración utilizada por última vez luego de
reestablecer la electricidad.
([LVWHXQUHWUDVRGHWLHPSRSRUSURWHFFLyQ GH
DSUR[LPDGDPHQWHPLQXWRV SDUDHYLWDUOD
desconexión por sobrecarga del compresor.Por esta
razón, es posible que la unidad no comience a enfriar
de forma normal hasta transcurridos 3 minutos desde
que volvió a encenderse.
El dispositivo de interrupción de
corriente se ha activado.
Presione el botón RESET ubicado en el cable de
alimentación.
Si el botón RESET no se mantiene en su lugar, no
utilice más el acondicionador de aire y comuníquese
con un técnico calificado.
El acondicionador de aire
no enfría como debería
El flujo de aire está restringido.
Cerciórese de que no existe ninguna cortina, persiana
o mueble bloqueando el frente del acondicionador de
aire.
El control de temperatura no está
ajustado apropiadamente.
En los modelos con botones, gire la temperatura a un
número mayor.
El filtro de aire está sucio.
Limpie el filtro cada 30 días por lo menos. Ver la
sección de Cuidado y limpieza.
La habitación podría haber estado
caliente.
Cuando el acondicionador de aire se enciende, usted
necesita darle tiempo para que enfrié la habitación.
El aire frío se está escapando.
Cerciórese de que los registros de la calefacción no
están abiertos y se encuentran retornando el aire frío.
Las bobinas de enfriamiento se
congelaron.
9HU³$FRQGLFLRQDGRUGHDLUHFRQJHOiQGRVH´PiV
adelante.
El hielo bloquea el flujo de aire
hacia el acondicionador de
aire evitando que se enfríe la
habitación.
En modelos con los botones de control, coloque el
FRQWUROGHPRGRHQ+LJK)DQ 9HQWLODGRU$OWR y+LJK
&RRO )UtR$OWR FRQODWHPSHUDWXUDHQy
Hay agua goteando afuera
Tiempo húmedo y caliente.
Esto es normal.
Hay agua goteando en el
interior de la habitación
El acondicionador de aire no está
inclinado hacia afuera.
Para drenar el agua apropiadamente, cercíorese
de que el acondicionador de aire está inclinado
ligeramente desde el frente hacia atrás.
Se acumula agua en la
bandeja
La humedad removida del aire y
se drena hasta la bandeja.
Esto es normal por un corto período en áreas con
poca humedad; normal por un período de tiempo más
postergado en áreas más húmedas.
El acondicionador de aire
se está congelando
49-5000295 Rev. 1
Ŷ4XL]iVHVFXFKHXQVRQLGRPHWiOLFRFDXVDGRSRUHODJXDWRPDGD\WLUDGDFRQWUDHOFRQGHQVDGRUHQORVGtDVOOXYLRVRVRFXDQGR
la humedad es alta. Esta característica de diseño ayuda a remover la humedad y mejora la eficiencia.
Ŷ4XL]iVHVFXFKHTXHHOWHUPRVWDWRKDFHFOLFFXDQGRHOFRPSUHVRUKDFHFLFORHQWUHHQFHQGLGR\DSDJDGR
Ŷ(ODJXDVHDFXPXODHQODEDQGHMDGXUDQWHGtDVOOXYLRVRVRFRQPXFKDKXPHGDG(ODJXDSRGUtDGHUUDPDUVH\JRWHDUGHVGHHO
lado externo de
la unidad.
Ŷ(OYHQWLODGRUSRGUtDIXQFLRQDUDXQVLHOFRPSUHVRUQROR
hace.
Ŷ/DVJRWLWDVGHDJXDTXHFDHQFRQWUDODVERELQDVH[WHUQDV
SXHGHQKDFHUXQUXLGRGH³SLQJ´(VWRD\XGDDHQIULDU
el condensador. Puede reducir este ruido retirando el
HQFKXIHGHDJXDGHODVXEEDVH
Enchufe de Agua de la
6XEEDVH
El retiro del enchufe reducirá la Eficiencia
Energética de la unidad.
NOTA: 1RKDJDXQDJXMHURHQODROODGHODEDVH
Configuración WiFi
GE Appliances WiFi Connect (Conexión WiFi de GE Appliances)
(Para clientes en Estados Unidos)
GE Appliances WiFi Connected Habilitado* Si su acondicionador de aire posee una etiqueta de Información del
Electrodoméstico Conectado ubicada en la parte externa como se muestra a continuación, su acondicionador de aire cuenta con
*(:L)L&RQQHFW+DELOLWDGR8QDWDUMHWDGHFRPXQLFDFLyQGH:L)LHVWiLQFRUSRUDGDHQHOSURGXFWRSHUPLWLHQGRODFRPXQLFDFLyQ
del mismo con su teléfono inteligente para el monitoreo remoto, control y notificaciones. Para aprender más sobre las funciones
del electrodoméstico conectado, y para saber qué aplicaciones de electrodomésticos conectados funcionarán con su teléfono
LQWHOLJHQWHYLVLWHZZZ*($SSOLDQFHVFRPFRQQHFW
Network: GE_MODULE_XXXX
PASSWORD: XXXXXXXX
MAC ID: XX-XX-XX-XX-XX-XX
CONTAINS FCCID: 2ALD3-MKQTWIFI11
CONTAINS IC: 22987-MKQTWIFI11
123-45-678
Cómo Funciona
'HVFDUJXHOD$SOLFDFLyQGH*(
Appliances
8VHODDSOLFDFLyQSDUDFRQHFWDUVX
acondicionador de aire para sala al
WiFi
8QDYH]FRQHFWDGDXVHODDSOLFDFLyQ
para apagar su acondicionador de
aire al salir del trabajo.
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS / WIFI
Sonidos de operación normales
CHANGE TEMP
TO 65
&RQHFWLYLGDG:L)L3DUDVROLFLWDUDVLVWHQFLDHQUHODFLyQDVXHOHFWURGRPpVWLFRRVREUHODFRQHFWLYLGDGGHUHGConnectPlus SDUD
PRGHORVFRQ:L)LKDELOLWDGRR:L)LRSFLRQDO FRPXQtTXHVHDO1-800-220-6899.
49-5000295 Rev. 1
15
CONFIGURACIÓN WIFI
Configuración WiFi
Puesta en marcha
A fin de conectar su acondicionador de aire para sala,
necesitará la Aplicación de GE Appliances. La aplicación
ORJXLDUiDWUDYpVGHOSURFHVRGHFRQH[LyQ'HVFDUJXHOD
aplicación de iTunes o Google Play.
Los datos de todos los electrodomésticos
conectados son guardados en estricto cumplimiento
con la Política de Privacidad de Datos de Conexión
de GE Appliances. Para acceder a esta política, visite
geappliances.com/privacy/privacy_policy_connected.
Preguntas acerca de WiFi Connect
Acceda a respuestas necesarias sobre la configuración
de electrodomésticos con WiFi y la conexión a su red
hogareña a través de nuestros artículos de soporte.
3DUDDFFHGHUDORVDUWtFXORVGHVRSRUWHODFRQH[LyQZLIL
del acondicionador de aire para sala, visite products.
JHDSSOLDQFHVFRPDSSOLDQFHJHDVXSSRUWVHDUFKFRQWHQW
INFORMACIÓN REGULATORIA
Declaración de Cumplimiento con FCC/
IC:
1. Este dispositivo no podrá causar interferencias perjudiciales.
2. Este dispositivo debe aceptar cualquier interferencia
recibida, incluidas las interferencias que puedan provocar un
funcionamiento no deseado.
Este equipo fue probado y cumple con los límites establecidos
SDUDXQGLVSRVLWLYRGLJLWDOGHFODVH%VHJ~QODSDUWHGH
OD1RUPDWLYDGHOD)&&(VWRVOtPLWHVIXHURQGLVHxDGRVSDUD
brindar una protección razonable contra interferencias nocivas
en una instalación residencial. Este equipo genera, usa y
puede emitir energía de radiofrecuencia y, si no se instala
y utiliza de acuerdo con las instrucciones, puede ocasionar
interferencias perjudiciales sobre las comunicaciones
radiales. Sin embargo, no se garantiza que no se presenten
interferencias en una instalación en particular. Si este equipo
provoca interferencias perjudiciales para la recepción de radio
o televisión, lo que puede comprobar encendiendo y apagando
el equipo, se aconseja al usuario que intente corregir la
LQWHUIHUHQFLDDWUDYpVGHXQDRPiVGHODVVLJXLHQWHVPHGLGDV
• Reoriente o reubique la antena receptora.
• Aumente la separación entre el equipo y el receptor.
• Conecte el equipo a un tomacorriente de un circuito diferente
al tomacorriente al cual se encuentra conectado el receptor.
• Para solicitar ayuda, consulte al comerciante minorista o a un
técnico experimentado de radio/ televisión.
Etiqueta: Las modificaciones sobre esta unidad no aprobadas
expresamente por parte del fabricante podrían anular la
autoridad del usuario para utilizar el equipo.
*Modelos Selectos Únicamente
(VWHSURGXFWRWLHQHFDSDFLGDG:L)L\UHTXLHUHFRQHFWLYLGDGD,QWHUQHW
y un enrutador inalámbrico para permitir la interconexión con un
Sistema de administración de energía y / o con otros dispositivos,
sistemas o aplicaciones externos.
(OXVRGH:RUNVFRQHOORJRWLSRGH$SSOH+RPH.LWŒVLJQLILFD
que un accesorio electrónico se ha diseñado para conectarse
específicamente con iPod touch®, iPhone® o iPad®, respectivamente,
y el desarrollador ha certificado que cumple con los estándares de
rendimiento de Apple®. Apple no es responsable del funcionamiento
de este dispositivo ni de su cumplimiento de las normas de seguridad
y reglamentarias.
Respuesta a la Demanda
(VWHSURGXFWRFXHQWDFRQFDSDFLGDGGH5HVSXHVWDDOD'HPDQGDORFXDOSHUPLWHTXHSDUWLFLSHHQHYHQWRVGHUHGXFFLyQGHFDUJD
iniciados por las utilidades. Estos eventos apagarán de forma temporal el Acondicionador de Aire a fin de realizar leves ajustes de
WHPSHUDWXUD/RVXVXDULRVSRGUiQDQXODUGHIRUPDDFWLYDHVWRVHYHQWRVPDQWHQLHQGRSUHVLRQDGRHOERWyQ0RGH 0RGR GXUDQWH
segundos. La unidad regresará al mismo estado al cual fue configurada antes de recibir la señal de respuesta a la demanda.
$QWHVGHOXVRGHVFDUJXHOD$SOLFDFLyQ*($SSOLDQFHV&RPIRUW\DFWXDOLFHVXVRIWZDUHFRQHFWDGRVLDVtVHLQGLFD
(VWH SURGXFWR FXHQWD FRQ FDSDFLGDG :L)L \ UHTXLHUH GH FRQHFWLYLGDG D ,QWHUQHW \ XQ HQUXWDGRU LQDOiPEULFR D ILQ GH SHUPLWLU OD
interconexión con un Sistema de Manejo de Energía, y/o con otros dispositivos, sistemas o aplicaciones externas.t
16
49-5000295 Rev. 1
GARANTÍA LIMITADA
Garantía Limtada del Acondicionador de Aire GE Appliances
Grape aquí su recibo.
Se requiere facilitar prueba de la fecha de compra original para hacer un reclamo de garantía.
Por el Período de:
Reemplazaremos:
8Q$xR
'HVGHODIHFKDGHOD
compra original
Reemplazo, reparación o reembolso del costo minorista original de cualquier producto
que falle debido a un defecto en los materiales o la fabricación. Si la unidad es cambiada,
la unidad de reemplazo posee garantía por el resto del período de la garantía original
de un año sobre su producto. GE Appliances reemplazará, a su exclusivo criterio, el
producto por otro de la misma o de una funcionalidad y calidad comparable o hará un
reembolso por el precio minorista original.
A Fin de Realizar un Reclamo de la Garantía Durante el Período de Devolución Permitido por el Vendedor Minorista:
Ŷ Embale la unidad correctamente. Le recomendamos
usar la caja de cartón y los materiales de embalaje
originales.
Ŷ(QWUHJXHHOSURGXFWRHQODXELFDFLyQGHOYHQGHGRU
minorista donde fue adquirido.
Ŷ Incluya en el paquete una copia del receptor de la
venta u otro comprobante de la fecha de compra
original. También escriba su nombre y domicilio y una
descripción del defecto.
A Fin de Realizar un Reclamo sobre la Garantía Durante el Resto de la Garantía de un Año:
Ŷ8ELTXHVXUHFLERGHYHQWDRULJLQDO\KDJDXQDQRWDGH Ŷ*($SSOLDQFHVKDUiDUUHJORVSDUDTXHVHHQYtHXQD
su modelo y número de serie.
caja de cartón a su hogar para recuperar el producto.
Ŷ/ODPHDO*(&$5(6 HQ(VWDGRV
Ŷ3RUIDYRUHQWUHJXHWRGRVORVPDWHULDOHVVROLFLWDGRV HQYtR
8QLGRV para iniciar el proceso de reemplazo del
SRVWDOSUHSDJR HQODFDMDGHFDUWyQSURYLVWD3RUIDYRU
producto.
incluya una descripción del defecto.
Ŷ6HVROLFLWDUiVXQRPEUHGRPLFLOLRIHFKDGHFRPSUD
Ŷ'HEHUtDUHFLELUHOSURGXFWRGHUHHPSOD]RRXQ
y números de modelo y serie.
reembolso entre los 7 y 10 días hábiles una vez que
hayamos recibido su paquete.
Qué No Será Cubierto:
Ŷ,QVWUXFFLyQDOFOLHQWH(VWHPDQXDOGHOSURSLHWDULR
brinda información relacionada con instrucciones de
funcionamiento y controles del usuario.
Ŷ,QVWDODFLyQLQDGHFXDGD6LWLHQHXQSUREOHPDGH
instalación o el acondicionador de aire no posee
la capacidad adecuada, contacte a su vendedor
minorista o instalador. Usted es responsable
de brindar instalaciones de conexión eléctrica
adecuadas.
Ŷ)DOODGHOSURGXFWRFRPRUHVXOWDGRGHPRGLILFDFLRQHV
sobre el mismo o debido a un uso irrazonable,
incluyendo la falta de mantenimiento razonable o
necesario.
Ŷ5HHPSOD]RGHIXVLEOHVGHOKRJDURUHLQLFLRGH
disyuntores.
Ŷ)DOODVFRPRFRQVHFXHQFLDGHFRUURVLyQHQPRGHORV
sin protección contra ésta.
Ŷ'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUQLYHO
de suministro de voltaje inadecuado, accidente,
incendio, inundaciones o catástrofes naturales.
Ŷ'DxRVFRQVHFXHQWHVRLQFLGHQWDOHVFDXVDGRVSRU
posibles defectos del acondicionador de aire.
Ŷ'DxRFDXVDGRGHVSXpVGHODHQWUHJD
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS—Su única y exclusiva alternativa es la reparación del producto, como
se indica en la Garantía Limitada. Las garantías implícitas, incluyendo garantías implícitas de comerciabilidad o
conveniencia sobre un propósito particular, se limitan a un año o al período más corto permitido por la ley.
Para Clientes de EE.UU: Esta garantía limitada se extiende al comprador original y a cualquier dueño subsiguiente
GHSURGXFWRVFRPSUDGRVSDUDXVRKRJDUHxRGHQWURGH((886LHOSURGXFWRHVWiHQXQiUHDGRQGHQRVHHQFXHQWUD
disponible un Proveedor Autorizado del Servicio Técnico de GE Appliances, usted será responsable por el costo de un viaje
o se podrá requerir que traiga el producto a una ubicación del Servicio Técnico de GE Appliances Autorizado para recibir el
VHUYLFLR(Q$ODVNDODJDUDQWtDOLPLWDGDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRWpFQLFRDVXKRJDU
Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía limitada le da
derechos legales específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer
cuáles son sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado.
Garante en EE.UU:
GE Appliances, a Haier company
Louisville, KY 40225
49-5000295 Rev. 1
17
SOPORTE PARA EL CONSUMIDOR
Soporte al Cliente
GE Appliances Sitio Web
¢'HVHDUHDOL]DUXQDFRQVXOWDRQHFHVLWDD\XGDFRQVXHOHFWURGRPpVWLFR"£,QWHQWHDWUDYpVGHO6LWLR:HEGH(OHFWURGRPpVWLFRV
GH*($SSOLDQFHVODVKRUDVGHOGtDFXDOTXLHUGtDGHODxR8VWHGWDPELpQSXHGHFRPSUDUPiVJUDQGLRVRVSURGXFWRVGH*(
Appliances y sacar ventaja de todos nuestros servicios a través de Internet diseñados para su conveniencia.
(Q((88GEAppliances.com
Registre su Electrodoméstico
£5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUi
una mejor comunicación y un servicio más puntual de acuerdo con los términos de su garantía, en caso de surgir la necesidad.
7DPELpQSXHGHHQYLDUXQDFDUWDHQODWDUMHWDGHLQVFULSFLyQSUHLPSUHVDTXHVHLQFOX\HFRQHOPDWHULDOHPEDODGR
(Q((88GEAppliances.com/register
Servicio Programado
El servicio de reparación de expertos de GE Appliances está a sólo un paso de su puerta. ¡Conéctese a través de Internet y
SURJUDPHVXVHUYLFLRDVXFRQYHQLHQFLDFXDOTXLHUGtDGHODxR(Q((88GEAppliances.com/serviceROODPHDO
durante el horario comercial habitual.
Garantías Extendidas
Adquiera una garantía extendida de GE Appliances y aprenda sobre descuentos especiales que están disponibles mientras su
garantía aún está vigente. La puede adquirir en cualquier momento a través de Internet. Los Servicios de GE Appliances aún
HVWDUiQDOOtFXDQGRVXJDUDQWtDFDGXTXH(Q((88GEAppliances.com/extended-warrantyROODPHDOGXUDQWH
el horario comercial habitual.
Conectividad Remota
3DUDVROLFLWDUDVLVWHQFLDFRQODFRQHFWLYLGDGGHUHGLQDOiPEULFD SDUDPRGHORVFRQDFWLYDFLyQUHPRWD YLVLWHQXHVWURVLWLR:HEHQ
GEAppliances.com/connectROODPHDOHQ((88
Piezas y Accesorios
Individuos calificados para realizar el servicio técnico de sus propios electrodomésticos podrán solicitar el envío de piezas o
DFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHV VHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU 2UGHQHDWUDYpVGH,QWHUQHWKR\
GXUDQWHODVKRUDVGHOGtD(Q((88GEApplianceparts.comRSRUWHOpIRQRDOGXUDQWHHOKRUDULRFRPHUFLDO
habitual.
Las instrucciones que figuran en este manual cubren los procedimientos que serán realizados por cualquier usuario.
Otros servicios técnicos generalmente deberían ser derivados a personal calificado del servicio. Se deberá tener
cuidado, ya que una reparación indebida podrá ocasionar que el funcionamiento no sea seguro.
Contáctenos
Si no se encuentra satisfecho con el servicio que recibió de GE Appliances, comuníquese con nosotros a través de nuestro sitio
:HEFRQWRGRVORVGHWDOOHVLQFOX\HQGRVXQ~PHURWHOHIyQLFRRHVFULEDD
(Q((88*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/contact
Printed in China
49-5000295 Rev. 1
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising