GE | C2Y366SELSS | Use and Care Manual | GE C2Y366SELSS Use and Care Manual

GE C2Y366SELSS Use and Care Manual
RANGES
Professional Dual Fuel Gas
SAFETY INFORMATION
.......... 3
USING THE RANGE
Features of Your Range . . . . . . . . . . . . . . . . . 8
Cooktop Controls . . . . . . . . . . . . . . . . . . . . . . . 9
Surface Cooking . . . . . . . . . . . . . . . . . . . . . . . .10
Features of Your Oven . . . . . . . . . . . . . . . . . . 12
Oven Control . . . . . . . . . . . . . . . . . . . . . . . . . . .13
Baking Tips . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . .15
Baking . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .16
Broiling . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17
Convection Baking or Roasting . . . . . . . . . . .19
Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Proofing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Self-Cleaning Oven . . . . . . . . . . . . . . . . . . . . 23
Special Features . . . . . . . . . . . . . . . . . . . . . . . 25
OWNER’S MANUAL
CAFÉ
30”, 36” and 48”
ENGLISH/FRANÇAIS/ESPAÑOL
CARE AND CLEANING
Control Panel and Knobs . . . . . . . . . . . . . . . 26
Oven Burners . . . . . . . . . . . . . . . . . . . . . . . . . 26
Broiler Pan, Grid and Roasting Rack . . . . . . 26
Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
Low Profile Oven Rack . . . . . . . . . . . . . . . . . 27
Lift-off Oven Door . . . . . . . . . . . . . . . . . . . . . 28
Probe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28
Oven Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
Surfaces . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
Dual-flame Stacked Burners . . . . . . . . . . . . . .31
Spark Igniter and Electrodes . . . . . . . . . . . . 32
Burner Grates . . . . . . . . . . . . . . . . . . . . . . . . . 32
Grease Troughs. . . . . . . . . . . . . . . . . . . . . . . . 33
Griddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33
Cutting Board . . . . . . . . . . . . . . . . . . . . . . . . . 33
TROUBLESHOOTING TIPS. . . . . . . 34
WARRANTY . . . . . . . . . . . . . . . . . . . . . . .
38
ACCESSORIES . . . . . . . . . . . . . . . . . . . .
39
CONSUMER SUPPORT . . . . . . . . . . . 40
Write the model and serial numbers here:
Model # ___________________________
Serial # ___________________________
You’ll find them on a label located behind
the left burner knob or below the control
panel which is visible when the oven
door is opened.
GE is a trademark of the General Electric Company. Manufactured under trademark license.
49-85244 10-17 GEA
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.
2
49-85244
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING Read all safety instructions before using the product. Failure to follow these instructions may
result in fire, electrical shock, serious injury or death.
WARNING If the information in this manual is not followed exactly, a fire or
explosion may result, causing property damage, personal injury or death.
- Do not store or use gasoline or other flammable vapors and liquids in the vicinity of
this or any other appliance.
- WHAT TO DO IF YOU SMELL GAS
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ 'RQRWWU\WROLJKWDQ\DSSOLDQFH
Ŷ 'RQRWWRXFKDQ\HOHFWULFDOVZLWFKGRQRWXVHDQ\SKRQHLQ\RXUEXLOGLQJ
Ŷ ,PPHGLDWHO\FDOO\RXUJDVVXSSOLHUIURPDQHLJKERU¶VSKRQH)ROORZWKHJDV
VXSSOLHU¶VLQVWUXFWLRQV
Ŷ ,I\RXFDQQRWUHDFK\RXUJDVVXSSOLHUFDOOWKHILUHGHSDUWPHQW
- Installation and service must be performed by a qualified installer, service agency or
the gas supplier.
ANTI-TIP DEVICE
WARNING
Tip-Over Hazard
• A child or adult can tip the range and be killed.
• Install the anti-tip bracket to the wall or floor.
• Engage the range to the anti-tip bracket by sliding the
range back such that the foot is engaged.
• Re-engage the anti-tip bracket if the range is moved.
• Failure to do so can result in death or serious burns
to children or adults.
To reduce the risk of tipping the range,
the range must be secured by a properly
installed anti-tip bracket. See installation
instructions shipped with the bracket for
complete details before attempting to install.
For Professional All-Gas Ranges
To check if the bracket is installed and
engaged properly, look underneath the
range to see that the rear leveling leg is
engaged in the bracket. On some models,
the storage drawer or kick panel can be removed for easy inspection.
Anti-Tip Bracket
If visual inspection is not possible, slide the range forward, confirm
Kit Included
the anti-tip bracket is securely attached to the floor or wall, and slide
the range back so the rear leveling leg is under the anti-tip bracket.
If the range is pulled from the wall for any reason, always repeat
this procedure to verify the range is properly secured by the anti-tip
bracket.
Never completely remove the leveling legs or the range will not be
secured to the anti-tip device properly.
Rear View
READ AND SAVE THESE INSTRUCTIONS
49-85244
3
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS
WARNING NEVER use this appliance
as a space heater to heat or warm the room.
Doing so may result in carbon monoxide
poisoning and overheating of the oven.
Ŷ 8VHWKLVDSSOLDQFHIRULWVLQWHQGHGSXUSRVHDV
described in this owner’s manual.
Ŷ +
DYH\RXUUDQJHLQVWDOOHGDQGSURSHUO\JURXQGHGE\
a qualified installer in accordance with the provided
installation instructions.
Ŷ $
Q\DGMXVWPHQWDQGVHUYLFHVKRXOGEHSHUIRUPHG
only by a qualified gas range installer or service
technician. Do not attempt to repair or replace
any part of your range unless it is specifically
recommended in this manual.
Ŷ <
RXUUDQJHLVVKLSSHGIURPWKHIDFWRU\VHWIRUXVH
with natural gas or propane (LP) gas. It can be
converted for use with either. If required, these
adjustments must be made by a qualified technician
in accordance with the installation instructions
and local codes. The agency performing this work
assumes responsibility for the conversion.
Ŷ +
DYHWKHLQVWDOOHUVKRZ\RXWKHORFDWLRQRIWKH
range gas shut-off valve and how to turn it off if
necessary.
Ŷ %
HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKHUDQJH
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
Ŷ %
HVXUHDOOSDFNLQJPDWHULDOVDUHUHPRYHGIURPWKH
range before operating to prevent ignition of these
materials.
Ŷ '
XDO)XHO,IWKHKHDWLQJHOHPHQWLQWKHRYHQ
develops a glowing spot or shows other signs
of damage, do not use that area of the range. A
glowing spot indicates the element may fail and
present a potential burn, fire, or shock hazard. Turn
the heating element off immediately and have it
replaced by a qualified service technician.
Ŷ $
YRLGVFUDWFKLQJRULPSDFWLQJJODVVGLVSOD\V'RLQJ
so may lead to glass breakage. Do not cook on a
product with broken glass. Shock, fire, or cuts may
occur.
Ŷ '
RQRWOHDYHFKLOGUHQDORQHRUXQDWWHQGHGLQDQ
area where an appliance is in use. They should
never be allowed to climb, sit or stand on any part
of the appliance.
Ŷ
CAUTION Do not store items of interest
to children in cabinets above an oven - children
climbing on the oven to reach items could be
seriously injured.
Ŷ 1
HYHUEORFNWKHYHQWV DLURSHQLQJV RIWKHUDQJH
They provide the air inlets and outlets that are
necessary for the range to operate properly with
correct combustion. Air openings are located at the
rear of the cooktop, at the top and bottom of the
oven door, and at the bottom of the range.
Ŷ 8
VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch surface burners,
burner grate, or oven heating element. Do not use a
towel or other bulky cloth in place of pot holders.
Ŷ '
RQRWWRXFKWKHKHDWLQJHOHPHQWVRUWKHLQWHULRU
surface of the oven. These surfaces may be hot
enough to burn even though they are dark in color.
During and after use, do not touch, or let clothing
or other flammable materials contact any interior
area of the oven; allow sufficient time for cooling
first. Other surfaces of the appliance may become
hot enough to cause burns. Potentially hot surfaces
include the burners, grates, oven vent opening,
surfaces near the opening, crevices around the
oven door, metal trim parts above the door, any
backguard, or high shelf surface.
Ŷ '
RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH
could build up and the container could burst,
causing an injury.
READ AND SAVE THESE INSTRUCTIONS
4
49-85244
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS (cont.)
Ŷ &
RRNIRRGWKRURXJKO\WRKHOSSURWHFWDJDLQVW
foodborne illness. Minimum safe food temperature
recommendations can be found at
ZZZ,V,W'RQH<HWJRYDQGZZZIVLVXVGDJRY8VH
a food thermometer to take food temperatures and
check several locations.
Ŷ .
HHSWKHYHQWLODWRUKRRGDQGJUHDVHILOWHUVFOHDQ
to maintain good venting and to avoid grease fires.
Turn the ventilator OFF in case of a fire or when
intentionally "flaming" liquor or other spirits on the
cooktop. The blower if in operation, could spread
the flames.
Ŷ '
RQRWDOORZDQ\RQHWRFOLPEVWDQGRUKDQJRQWKH
oven door, drawer or cooktop. They could damage
the range or tip it over causing severe injury or death.
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE RANGE
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Failure to do so may result in fire or personal injury.
Ŷ 'RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQDQRYHQ
or near the cooktop, including paper, plastic, pot
holders, linens, wall coverings, curtains, drapes and
gasoline or other flammable vapors and liquids.
Ŷ 1HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH
using the appliance. These garments may ignite if
they contact hot surfaces causing severe burns.
Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH
materials accumulate in or near the range. Grease
in the oven or on the cooktop may ignite.
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
Ŷ 'RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXS
a flaming pan. Turn the controls off. Smother a
flaming pan on a surface unit by covering the pan
completely with a well-fitting lid, cookie sheet or flat
WUD\8VHDPXOWLSXUSRVHGU\FKHPLFDORUIRDPW\SH
fire extinguisher.
Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJVHOIFOHDQWXUQ
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at selfclean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJVPRWKHU
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
READ AND SAVE THESE INSTRUCTIONS
49-85244
5
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING COOKTOP SAFETY INSTRUCTIONS
Ŷ 1HYHUOHDYHWKHVXUIDFHEXUQHUVXQDWWHQGHGDW
medium or high heat settings. Foods, especially oily
foods, may ignite resulting in fire that could spread
to surrounding cabinets.
Ŷ 1
HYHUOHDYHRLOXQDWWHQGHGZKLOHIU\LQJ,IDOORZHG
to heat beyond its smoking point, oil may ignite
resulting in fire that may spread to surrounding
FDELQHWV8VHDGHHSIDWWKHUPRPHWHUZKHQHYHU
possible to monitor oil temperature.
Ŷ 7
RDYRLGRLOVSLOORYHUDQGILUHXVHWKHPLQLPXP
amount of oil when using a shallow pan-frying
and avoid cooking frozen foods with excessive
amounts of ice.
Ŷ 8
VHSURSHUSDQVL]HDQGDYRLGSDQVWKDWDUH
unstable or easily tipped. Select cookware that is
matched to the size of the burner. Burner flames
should be adjusted so that they do not extend
beyond the bottom of the pan. Excessive flame may
be hazardous.
Ŷ $
OZD\VXVHWKH/,7(SRVLWLRQZKHQLJQLWLQJWKHWRS
burners and make sure the burners have ignited.
Ŷ :
KHQXVLQJJODVVFHUDPLFFRRNZDUHPDNHVXUHLW
is suitable for cooktop service; others may break
because of sudden change in temperature.
Ŷ 7
RPLQLPL]HWKHSRVVLELOLW\RIEXUQVLJQLWLRQRI
flammable materials and spillage, the handle of a
container should be turned toward the center of the
range without extending over nearby burners.
Ŷ '
RQRWXVHDZRNZLWKDURXQGPHWDOVXSSRUWULQJ
The ring may trap heat and block air to the burner
resulting in a carbon monoxide hazard.
Ŷ '
RQRWDWWHPSWWROLIWWKHFRRNWRS'RLQJVRPD\
damage the gas tubing to the surface burners
resulting in a gas leak and risk of fire.
Ŷ :
KHQGLVDEOLQJ/RFN&RQWURO RQVRPHPRGHOV make sure the surface controls are set to the OFF
position. This will prevent unintended gas flow from
the burners.
Ŷ '
RQRWXVHDOXPLQXPIRLOWRFRYHUWKHJUDWHVRU
line any part of the cooktop. Doing so may result
in carbon monoxide poisoning, overheating of the
cooktop surfaces, or a potential fire hazard.
WARNING OVEN SAFETY INSTRUCTIONS
WARNING NEVER cover any slots,
holes, or passages in the oven bottom or
cover an entire rack with materials such as
aluminum foil or oven liners. Doing so blocks
air flow through the oven and may cause
carbon monoxide poisoning. Never place foil
or oven liners on the oven bottom. They can
trap heat causing risk of smoke or fire.
Ŷ 6WDQGDZD\IURPWKHUDQJHZKHQRSHQLQJWKHRYHQ
door. Hot air or steam which escapes can cause
EXUQVWRKDQGVIDFHDQGRUH\HV
Ŷ 3ODFHRYHQUDFNVLQGHVLUHGORFDWLRQZKLOHRYHQLV
cool. If rack must be moved while oven is hot, be
careful to avoid touching hot surfaces.
Ŷ 'RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJXWHQVLOV
or food in the oven when not in use. Items stored in
an oven can ignite.
Ŷ 'RQRWOHDYHLWHPVRQWKHFRRNWRSQHDUWKHRYHQ
vent. Items may overheat resulting in a risk of fire or
burns.
Ŷ 1HYHUEURLOZLWKGRRURSHQ2SHQGRRUEURLOLQJLV
not permitted due to overheating of control knobs.
Ŷ 1HYHUSODFHFRRNLQJXWHQVLOVSL]]DRUEDNLQJVWRQHV
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
READ AND SAVE THESE INSTRUCTIONS
6
49-85244
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
Ŷ 'RQRWWRXFKRYHQVXUIDFHVGXULQJVHOIFOHDQ
operation. Keep children away from the oven during
self-cleaning. Failure to follow these instructions
may cause burns.
Ŷ %
HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHUHPRYHSDQV
shiny metal oven racks, and other utensils from the
oven. Only porcelain-coated oven racks may be left
in the oven.
Ŷ %
HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHJUHDVH
and food soils from the oven. Excessive amount of
grease may ignite leading to smoke damage to your
home.
Ŷ ,IWKHVHOIFOHDQLQJPRGHPDOIXQFWLRQVWXUQWKH
oven off and disconnect the power supply. Have it
serviced by a qualified technician.
Ŷ '
RQRWXVHRYHQFOHDQHUV1RFRPPHUFLDORYHQ
cleaner or oven liner protective coating of any kind
should be used in or around any part of the oven.
Ŷ '
RQRWFOHDQWKHGRRUJDVNHW7KHGRRUJDVNHWLV
essential for a good seal. Care should be taken not
to rub, damage or move the gasket.
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ IMPORTANT: The health of some birds is
extremely sensitive to the fumes given off during
the self-cleaning cycle of any range. Move birds to
another well-ventilated room.
STATE OF CALIFORNIA PROPOSITION 65 WARNINGS
WARNING This product contains one or more chemicals known to the State of California to cause cancer,
and birth defects or other reproductive harm.
6HOIFOHDQHOHFWULFRYHQV6HOIFOHDQRYHQVFDQFDXVHORZOHYHOH[SRVXUHWRVRPHRIWKH3URSRVLWLRQ
substances, including carbon monoxide, during the cleaning cycle. Exposure to these substances can be
minimized by opening a window or using a ventilation fan or hood.
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
READ AND SAVE THESE INSTRUCTIONS
49-85244
7
USING THE RANGE: Features of Your Range
Features of Your Range
Design information
NOTE: Not all features are on all models. Appearance may vary.
3
6
7
4
6 burners and griddle
8
9
6 gas burners
10
5
Double oven model shown includes a small oven.
Feature Index
Page
1
Oven Vents
14
2
Griddle
11
3
Cooktop Burner Grates
4
Burner Control Knob
5
Oven Display
6
Mini-Knob
(to select PROBE, TIMER or Special Features)
7
Oven Mode Selector
13
8
Oven Temperature Knob
13
9
Kitchen Timer
10
Leveling System (4)
1
32
9, 26
13
13, 26
13, 24
²
2
Bamboo Cutting Board
3
Toekick
Optional Accessories
8
2
1
Griddle Cover
Page
1
Bamboo Cutting Board (on some models)
33
2
Toekick
²
3
Griddle Cover (on some models)
²
49-85244
Electronic Ignition and Automatic Reignition
The range is equipped with electronic ignition which
eliminates the need for a standing
pilot light.
The burners on this range will automatically relight if the
flame goes out.
In case of a power outage, you can light the surface
burners on your cooktop with a match. Hold a lighted
match to the burner, then turn the knob to the LOW
position. Use extreme caution when lighting burners
this way.
All surface burner igniters will spark and make clicking
sounds when any burner is turned on. Do not touch any
of the burners when igniters are clicking.
Do not attempt to light the griddle during a power outage.
The gas to these burners will automatically shut off
during a power outage.
Occasionally the burners may spark if excess wind or a
draft blows the flame away from the burner’s flame sensor.
To Light a Surface Burner
Push the control knob in and turn it counterclockwise to
the LITE position.
After the burner ignites, turn the knob to adjust the
flame size.
To turn a burner off, turn the knob clockwise, as far as
it will go, to the OFF position.
Ŷ Do not operate a burner for an extended period of time
without cookware on the grate. The finish on the grate
may chip without cookware to absorb the heat.
USING THE RANGE: Cooktop Controls
Cooktop Controls
WARNING Burners should be operated only
when covered by cookware. Burner flames not
covered by cookware present a risk of fire or
clothing ignition. Never let flames extend beyond the
sides of the cookware. Failure to comply may result
in serious injury.
Dual-flame Stacked Burners
All surface burners on your range have two sets of flames
stacked one on top of the other; the dual-flame burners
have a lower (simmer) flame and a upper (main) flame.
When a burner is turned on, the lower flame will always
light and stay on.
Simmering:
The stacked burner design provides a wide range of
heat settings with which to simmer. Depending on the
type and quantity of food, and pan size, the flame can
be adjusted to suit your specific need. The lowest setting
uses only the lower flame and can maintain delicate
foods at a safe 140°F.
Cooking:
Settings from LO to X-HI will use both upper and lower
IODPHV8VHLO to HIIRUDOOSXUSRVHFRRNLQJ8VHHI or
X-HI (highest setting) with larger diameter cookware.
X-HI and HI are very high heat settings and are intended
to sear foods quickly and boil large quantities of water.
Lower
Flame
8SSHU)ODPH
Lower Flame
49-85244
9
USING THE RANGE: Surface Cooking
10
Surface Cooking
How to Select Flame Size
Watch the flame, not the knob, as you increase or
reduce heat.
The flame size on a gas burner should match the
cookware you are using.
FOR SAFE HANDLING OF COOKWARE, NEVER
/(77+()/$0((;7(1'837+(6,'(62)7+(
COOKWARE. Any flame larger than the bottom of the
cookware will not result in faster heating and could be
hazardous.
For surface stability, 6” minimum diameter cookware is
UHFRPPHQGHG8VHODUJHUGLDPHWHUFRRNZDUHIRUKHDW
settings between HI and X-HI.
Wok Cooking
The burner grates are uniquely designed to cook on
either side. The flat side accommodates flat bottom
cookware (stockpots, sauce pans, frying pans and flat
bottom woks), while the wok side is designed to hold a
wide variety of round bottom woks without the need for a
separate ring.
Wok Side
Flat Side
For easy access, a front burner location is
recommended for wok cooking.
The front center burner is recommended for wok cooking
RQEXUQHUƎDQGƎUDQJHV
Do not use a wok support ring. Placing the ring over the
burner or grate may cause the burner to work improperly,
resulting in carbon monoxide levels above allowable
standards. This could be hazardous to your health.
49-85244
Griddle Safety Precautions, Leveling (on some models)
WARNING Fire Hazard
Ŷ 8VHFDUHZKHQFRRNLQJJUHDV\IRRGV6SLOOHGJUHDVHPD\UHVXOWLQILUH
Ŷ 1HYHUSODFHDQ\LWHPVRQWKHJULGGOHZKHQLWLVQRWLQXVH+HDWIURPVXUURXQGLQJEXUQHUVFDQKHDW
the griddle and may result in fire.
Ŷ 3ODFHDQGUHPRYHWKHJULGGOHRQO\ZKHQJULGGOHLVFRRODQGDOOVXUIDFHEXUQHUVDUHWXUQHG2))
Remove the metal cover and the cutting board before
turning the griddle on.
Griddle flue cover
The griddle assembly should not be removed for
cleaning.
Once the unit is in position, the griddle can be leveled.
Remove the flue cover by lifting it straight up. Be careful
not to scratch the surrounding stainless steel surfaces
during removal of the flue cover.
Leveling screws
The two inner screws are clamping screws for securing
the griddle in place. Loosen these two screws before
leveling. Do not remove these two screws.
The two outer screws are leveling screws. Do not
remove these two screws. They can be turned to level
the griddle or to provide a forward slope to help grease
and oils to drain away from the food being cooked. After
the first few uses, you will be able to judge the slope
best suited for the foods you are cooking and personal
preference.
Clamping
screws
After leveling the griddle, tighten the clamping screws to
secure griddle in place. +DQGWLJKWHQVFUHZVGRQRW
over-tighten.
USING THE RANGE: Surface Cooking
Surface Cooking (Cont.)
Using the Griddle
Clean the griddle thoroughly with hot soapy water before
first use and after subsequent uses. The griddle surface
is made of durable, highly polished Type 304 stainless
steel backed by an aluminum plate for even heat
distribution. Apply a light coating of cooking oil to the
griddle surface to help prevent food from sticking.
To heat the griddle, push in and turn the control knob
to the desired temperature setting. The light on the
bezel will glow to indicate that the thermostat control is
working. The griddle is thermostatically controlled and
can be set to maintain any temperature from 200ºF
to 450ºF. Permit the griddle to preheat for 10 minutes
before placing food on it.
NOTE:8QOLNHWKHVXUIDFHEXUQHUVZKLFKXVHVSDUN
igniters, the griddle uses a Glo-Bar for ignition. Gas flows
to the griddle burner and ignition occurs approximately
45 seconds after the control knob is turned to a set
temperature.
49-85244
Food Item
Temperature Setting
Pancakes
375ºF
Hamburgers
400ºF
Bacon*
400ºF
Grilled Cheese
350ºF
Eggs
275ºF
*NOTE: Place bacon on a cold griddle. Do not preheat.
11
USING THE RANGE: Features of Your Oven
Features of Your Oven
Design information
NOTE: Not all features are on all models.
7
1
2
11
8
3
Full Extension Oven Rack
4
9
5
12
6
10
Temperature Probe
Feature Index
Page
1
Automatic Oven Door Latch
²
2
Broil Elements (2)
26
3
Halogen Oven Lights
4
Oven Rack Supports
²SRVLWLRQVLQODUJHRYHQ
²SRVLWLRQVLQVPDOORYHQ
5
Bake Element (1) (under oven floor)
26
6
Oven Door Seal
30
7
Oven Frame Seal
30
8
Temperature Probe Outlet
²ULJKWVLGHLQODUJHRYHQ
²OHIWVLGHLQVPDOORYHQ
21
9
Convection Fan
19, 20
10
Oven Door
28, 30
11
Full Extension Oven Rack(s)
²LQODUJHRYHQ
²LQVPDOORYHQ
12
Temperature Probe
29
16, 20
15, 16, 20, 27
21, 28
NOTE: On models equipped with 2 ovens, both ovens have same features.
2
1
Broiler Pan and Grid
12
Roasting Rack
Optional Accessories
Page
1
Broiler Pan and Grid
19, 26
2
Roasting Rack
19, 26
49-85244
Features of Your Oven Control and Timer
5
4
3
1
2
1 Oven Mode Selector – 7XUQRXWHUULQJWRVHOHFW
PROOF – Maintains a warm environment useful for
rising yeast-leavened products.
The Oven Mode Selector (1) AND the Temperature
Knob (2) must be set together in one of the following
YDOLGSDLULQJV
BAKE – Select for traditional baking.
Oven Mode Selector
CONV BAKE –8VHIRUFRQYHFWLRQEDNLQJ
BAKE
175º to 550°F
CONV ROAST –8VHIRUFRQYHFWLRQURDVWLQJ
CONV BAKE
175º to 550°F
BROIL – Select for broiling.
CLEAN – Select for the self-cleaning function. See
the Self-Cleaning Oven section.
2 Temperature Knob –7XUQWRVHOHFW
Temperatures from 175°F to 550°F.
LOW BROIL – A lower broiling temperature is
automatically set.
Temperature Knob
&219(&7,2152$67
175º to 550°F
&219(&7,21%52,/
HIGH or LOW BROIL
BROIL
HIGH or LOW BROIL
CLEAN
CLEAN
PROOF
²
USING THE RANGE: Oven Control
Oven Control
To cancel a feature, turn either the Oven Mode
Selector or the Temperature knob to OFF.
To cancel PROOF, turn the Oven Mode Selector to OFF.
HIGH BROIL – A higher broiling temperature is
automatically set.
CLEAN – The self-clean temperature is automatically
set.
3 Mini-Knob – Turn to select and push to enter
PROBE or TIMER settings. Also to adjust CLEAN
cycle time.
4 Timer Button – Push to select the kitchen timer
function. The timer does not control oven operations.
5 Oven Display – Displays oven functions such as
oven and probe temperatures and kitchen timer.
49-85244
13
USING THE RANGE: Baking Tips
Baking Tips
Rear Oven Vents
An internal cooling fan operates during all oven modes.
The warm air from the oven is exhausted through vents
located at the rear of the cooktop.
Do not block
rear vents
Do not allow the airflow from the rear vents to be
obstructed by cookware or towels.
Aluminum Foil and Oven Liners
CAUTION Do not use any type of foil or oven liner
to cover the oven bottom. These items can trap heat or
melt, resulting in damage to the product and risk of shock,
smoke or fire. Damage from improper use of these items
is not covered by the product warranty.
Foil may be used to catch spills by placing a sheet on
a lower rack, several inches below the food. Do not use
more foil than necessary and never entirely cover an
RYHQUDFNZLWKDOXPLQXPIRLO.HHSIRLODWOHDVW´
from oven walls to prevent poor heat circulation.
Aluminum
foil to catch
spillovers
NOTE: “NO FOIL ON OVEN BOTTOM” note is
enameled on the bottom of the oven cavity and is
designed to withstand self-cleaning temperatures. Do not
attempt to peal or scrape off.
Pan Placement
For even cooking and proper browning, there must be enough room for air circulation in the oven. Baking results
will be better if baking pans are centered as much as possible rather than being placed to the front or to the back
of the oven.
Baking Pans/Sheets
8VHWKHSURSHUEDNLQJSDQ7KHW\SHRIILQLVKRQWKHSDQHIIHFWVWKHDPRXQWRIEURZQLQJWKDWZLOORFFXU
Ŷ Dark, rough or dull pans absorb heat resulting in a
EURZQHUFULVSHUFUXVW8VHWKLVW\SHIRUSLHV
Ŷ Shiny, bright and smooth pans reflect heat, resulting in
a lighter, more delicate browning. Cakes and cookies
require this type of pan or sheet.
Ŷ Glass baking dishes also absorb heat. When baking in
glass baking dishes, the temperature may need to be
reduced by 25°F.
Preheating
Allow the oven to preheat before placing food in the
oven. Preheating is necessary for good results when
baking cakes, cookies, pastry and breads.
14
NOTE: Condensation or fogging on the inside of the
oven door glass is normal during the preheating of
the oven and will evaporate usually by the end of the
preheating cycle.
49-85244
Full Extension Oven Racks
CAUTION To avoid possible burns, place the
racks in the correct position before turning on the oven.
The correct rack position depends on the kind of food
and the browning desired.
The racks have a frame that locks into the rack supports
on both sides. Once the frame is locked into place,
always pull the rack out, by its upper front rail, to its
full extension stop position, when placing or removing
cookware.
Remove and Replace Oven Racks
To remove a rack:
To replace a rack:
1. Make sure the rack is pushed all the way into the
oven.
1. Place the rear rack locks over and onto the rack
supports (five rack positions are available including
the top position).
2. Grasp the rack by both its upper front rail and its lower
front rail and lift straight up to unlock the front rack
locks from the rack supports.
Lift to unlock front
rack locks from the
rack support
8SSHU
front
rail
Front rack lock
Lower
front
rail
3. Firmly holding onto both the upper and lower front rack
rails, pull the rack forward and remove it from the oven.
8SSHU
front
rail
Lower
front
rail
USING THE RANGE: Oven Racks
Oven Racks
2. Slide the rack all the way in until the rear rack locks
are secure on the rear rack supports and press the
front rack locks onto the front rack supports.
Slide the rack all the way
in and push down to lock
the front rack locks onto
the front rack supports
Front
rack
lock
3. Pull the rack all the way out to check that it is properly
engaged.
49-85244
15
USING THE RANGE: Baking
Baking
How to Set the Oven for Baking
Oven Mode
Selector
(Outer)
Oven
Temperature
Knob (Inner)
1. Turn the Oven Mode Selector to BAKE.
8VLQJWKH7HPSHUDWXUHNQREVHWWKHGHVLUHG
temperature, in 25°F increments, from 175°F to
550°F.
E
D
The oven will now begin to preheat. The temperature
display will begin at 100ºF and remain there until the
oven exceeds that temperature. From that point, the
display will show the actual temperature.
The interior lights will turn on and stay on until the
oven is turned off. The convection oven fan will turn
on temporarily during preheat. The control will beep
when the oven is preheated and food can now be
placed inside the oven.
3. Turn the Oven Mode Selector and the Temperature
knob to OFF when baking is finished.
NOTE: A cooling fan will turn on to cool internal parts.
This is normal, and the fan may continue to run even after
the oven is turned off.
8VHWKHWHPSHUDWXUHSUREHZKHQDSUHFLVHLQWHUQDO
WHPSHUDWXUHLVLPSRUWDQW6HH8VLQJWKHSUREH
C
B
A
Or, place four pans on one shelf using the center
SRVLWLRQ&3ODFHWKHSDQVVRHDFKKDVDWOHDVWƎDLU
space around it.
The oven has 5 rack positions. See the Full extension
oven racks section for how to use, remove and replace
the racks.
The double oven range has a small oven with 4 rack
positions. Rack position C is not in the small oven.
Type of Food
E
D
C
B
When baking four cake layers at the same time, use
racks B and D. Stagger the pans so that one pan is not
directly above another.
Small Oven
Rack Position
Angel food cake
A
A
Biscuits or muffins
C
A or B
Cookies
C
B
Brownies
B
B
2 Layer cakes
B
B
4 Layer cakes
C
²
B or C
B
Sheet cakes or 9 x 13 cakes
A
Large Oven
Rack Position
Quick breads
C
B
Bundt or pound cakes
C
B
Scratch Pies or pie shells
B
A
Frozen pies
B or C
²
Casseroles
B or C
B
C
B
Pizza
Suggested shelf positions are intended as general guidelines. Experiment
with these positions for specific foods and personal preference.
16
49-85244
Introduction to Broiling
7KHUHDUHGLIIHUHQWEURLOPRGHV%URLODQG&RQYHFWLRQ
Broil. Choose HI or LO setting in either mode.
Ŷ The HI setting can be used to seal in juices or provide
intense browning or charring when needed for foods
such as hamburgers, roasted vegetables, whole
peppers, eggplant, corn, assorted cut vegetables,
kabobs and very thin meats such as smoked pork
chops, London broil and chicken.
Ŷ The LO setting can be used for foods that need
adequate browning and also need to be thoroughly
cooked, like fish fillets, pork tenderloin and beef roast.
Convection Broil:
8VHVWKHFRQYHFWLRQIDQIRUDGGHGHYHQQHVV
How to Set the Oven for Broiling
Oven Mode
Selector
(Outer)
USING THE RANGE: Broiling
Broiling
Oven
Temperature
Knob
(Inner)
1. Turn the Oven Mode Selector to BROIL or CONV
BROIL.
2. Turn the Oven Temperature Knob to LO BROIL or HI
BROIL. LO or HI will appear in the display.
NOTE: Always broil with the door closed. If the door is
left open, the display will scroll “CLOSE door” and the
elements will not turn on until the door is shut.
Open door broiling
is not permitted.
The oven interior lights will turn on and stay on until the
oven is turned off.
The convection fan will turn on when CONV BROIL is
selected.
3. When broiling is finished, turn the Oven Mode
Selector and the Temperature knob to OFF.
NOTE: Broil will not work if the temperature probe is
plugged in. Never leave your probe inside the oven
during a broil cycle.
NOTE: A cooling fan will turn on to cool internal parts.
This is normal, and the fan may continue to run even after
the oven is turned off.
The broiler does not need to be preheated for most
broiling. However, foods that cook quickly, such as thin
strips of meat or fish may require a short preheating
period of approximately 5 minutes to allow the food to
brown. Turn the food only once during broiling.
49-85244
17
USING THE RANGE: Broiling
Broiling (Cont.)
Broiling Guide
Due to the variety of of meats and cuts available, you
may select alternate rack positions based on personal
preferences of doneness and external searing. For
optimal searing, preheat oven for 5-10 minutes.
D
The size, weight, thickness, starting temperature and
your preference of doneness will affect broiling times.
This guide is based on meats at refrigerator temperature.
B
E
C
NOTE: In general, higher rack positions yield darker external searing
and lower positions yield more doneness.
Food
Rack Position
Heat Setting
Preheat
Broil
Ground Beef
D
HI
²
Chicken (Bone-in Breasts)
B
HI or LO
²
Bakery Products
Bread (toast)
D
HI or LO
²
Fish
OEILOOHWVWRƎWKLFN
D
LO
5 Minutes
Kabobs (5 skewers)
D
LO
5 Minutes
Sliced Vegetables
D
LO
5 Minutes
Convection Broiling
7KH86'HSDUWPHQWRI$JULFXOWXUHVD\V³5DUHEHHILVSRSXODUEXW\RXVKRXOGNQRZWKDWFRRNLQJLW
WRRQO\ƒ)PHDQVVRPHIRRGSRLVRQLQJRUJDQLVPVPD\VXUYLYH´ 6RXUFH6DIH)RRG%RRN<RXU
.LWFKHQ*XLGH86'$5HY-XQH
Aluminum Foil
You can use aluminum foil to line the broiler pan and
broiler grid. However, you must mold the foil tightly to the
grid and cut slits in it just like the grid.
18
49-85244
Introduction to Convection Cooking
The reverse-air convection system fan periodically
pauses, then changes direction to best distribute hot air
throughout the oven. As a result, foods are evenly cooked
DQGEURZQHG²RIWHQLQOHVVWLPHZLWKFRQYHFWLRQKHDW
NOTE: The convection fan shuts off when the oven door
is opened.
Cookware for Convection Cooking
Before using your convection oven, check to see if your
cookware leaves room for air circulation in the oven. If
you are baking with several pans, leave space between
them. Also, be sure the pans do not touch each other or
the walls of the oven.
It is recommended that when baking cookies, the best
results are attained with a flat cookie sheet instead of a
pan with sides. For recipes like oven-baked chicken, use
a pan with low sides. Hot air cannot circulate well around
food in a pan with high sides.
Cookware used in standard BAKE will also work in
CONV BAKE. See Baking Tips section.
Adapting Recipes
You can use your favorite recipes in the convection oven.
When convection baking, it may be necessary to reduce
the baking temperature by 25°F or to adjust the cooking
time. No temperature adjustment is necessary when
using CONV ROAST.
Some package instructions for frozen casseroles or
main dishes have been developed using commercial
convection ovens. For best results in this oven, preheat
the oven and use the temperature on the package.
Convection Roasting Tips
8VHWKHEURLOHUSDQJULGDQGWKHURDVWLQJUDFNIRUEHVW
UHVXOWV8VHRIWKHUDFNZLOOUHVXOWLQLPSURYHGEURZQLQJ
on the underside of meat or poultry.
Optional Accessories
Roasting Rack
1. Place the oven rack on a low rack position (A).
USING THE RANGE: Convection Baking or Roasting
Convection Baking or Roasting
2. Place the grid on the broiler pan and put the roasting
rack over them.
3. Place meat on the roasting rack.
Grid
Broiler pan
49-85244
19
USING THE RANGE: Convection Baking or Roasting
Convection Baking or Roasting (Cont.)
How to Set the Oven for Convection Baking or Roasting
Oven Mode
Selector
(Outer)
Oven
Temperature
Knob (Inner)
Convection Baking is ideal for evenly browned baked foods
cooked on single or multiple racks. Select Convection
Roast to roast large, tender cuts of meat uncovered.
When set on CONV BAKE or CONV ROAST, the rear
convection elements and the fan operate when the oven
is heating.
1. Turn the Oven Mode Selector to CONV BAKE or
CONV ROAST.
8VLQJWKH7HPSHUDWXUHNQREVHWWKHGHVLUHG
temperature, in 25°F increments, from 175°F to 550°F.
The oven will now begin to preheat. The temperature
display will begin at 100°F and remain there until the
oven exceeds that temperature. From that point, the
display will show the actual temperature.
Type of Food
Muffins and Cupcakes
(multiple racks)
Cookies
(multiple racks)
Large Oven Rack
Position
Small Oven Rack
Position
B&D
B&D
A, C & E
B&D
Frozen Appetizer
C
²]
Frozen Appetizer
(multiple racks)
A, C & E
²
Roasting
(large cuts of meat)
A
B
Turkey or
Whole Chicken
A
B
The interior lights will turn on and stay on until the
oven is turned off. The convection oven fan will turn on
during preheat. The control will beep when the oven is
preheated and food can be placed inside the oven.
3. Turn the Oven Mode Selector and the Temperature
knob to OFF when convection cooking is finished.
NOTE: A cooling fan will turn on to cool internal parts.
This is normal, and the fan may continue to run even
after the oven is turned off.
8VHWKHWHPSHUDWXUHSUREHZKHQDSUHFLVHLQWHUQDO
WHPSHUDWXUHLVLPSRUWDQW6HH8VLQJWKHSUREH
E
D
C
B
A
The oven has 5 rack positions. See the Full extension
oven racks section for how to use, remove and replace
the racks.
The double-oven range has a small oven with 4 rack
positions. Rack position C is not in the small oven.
Suggested shelf positions are intended as general guidelines. Experiment
with these positions for specific foods and personal preference.
20
49-85244
How to Use the Probe with Bake, Convection Bake and Convection Roast
WARNING Consuming undercooked food can result in foodborne illness. Use probe according to
the following instructions to ensure all portions of the food reach minimum safe cooking temperatures.
Recommendations for minimum safe food temperatures can be found at www.foodsafety.gov or
www.IsItDoneYet.gov.
CAUTION 8VHRYHQPLWWVZKHQLQVHUWLQJRU
removing the probe from the hot oven. Areas around the
probe inlet can be very hot.
For many foods, especially roasts and poultry, internal
food temperature is the best test for doneness. The
temperature probe takes the guesswork out of cooking
foods to the exact doneness you want.
Probe
Outlet
The probe can be used with the BAKE, CONV BAKE
and CONV ROAST.
USING THE RANGE: Probe
Probe
1. Push the tip of the probe into the thickest part of the
meat.
2. Place the rack in the desired rack position.
3. Set the oven controls. Turn the Oven Mode Selector
to CONV BAKE, CONV ROAST or BAKE. Turn the
Temperature Knob to desired oven temperature in
25°F increments, from 175°F to 550°F. Allow the oven
to preheat if necessary.
The oven and oven lights will turn on immediately and
stay on until the oven is turned off.
8VHRYHQPLWWVWRSODFHWKHIRRGLQWKHKRWRYHQ
Insert the plug into the outlet. Make sure it is pushed
all the way in. Close the oven door.
5. Turn the Mini-Knob to find the desired internal food
temperature. Push the Mini-Knob to select that
temperature.
The word PROBE and SET, will flash in the display
until a temperature is selected. If no temperature is
set, the probe will default to 100°F. If the oven was not
preheated, the display will show LO.
The internal food temperature can be set from a
minimum of 100°F and up to 200°F maximum.
When food reaches the set internal temperature, the
display will beep. To stop the reminder beep, turn the
Oven Mode Selector and the Temperature Knob to OFF.
8VHRYHQPLWWVWRUHPRYHWKHSUREHIURPWKHRYHQRXWOHW
To change the set internal temperature anytime in the
cooking process, push the Mini-Knob and turn to adjust
the temperature. Press the Mini-Knob to select.
Using the Probe
8VHRQO\WKHSUREHSURYLGHGZLWKWKHUDQJH
8VHWKHKDQGOHVRIWKHSUREHDQGSOXJZKHQLQVHUWLQJ
and removing them from the meat and oven outlet.
Cable
Plug
Ŷ To avoid damaging the probe, do not use tongs to pull
on the cable when removing it.
Ŷ To avoid breaking the probe, make sure food is
completely defrosted before inserting.
Ŷ To prevent possible burns, always wear an oven mitt
when removing the plug; internal oven surfaces may
be hot.
Probe
Handles
The temperature probe has a skewer-like probe at
one end and a plug at the other end that goes into
the outlet in the oven.
Ŷ Never leave the probe inside the oven during a broil or
self-cleaning cycle.
Ŷ Do not store the probe in the oven.
49-85244
21
USING THE RANGE:3UREH3URRILQJ
Probe (Cont.)
Proper placement of the probe
Ŷ Measure the distance to the center of a roast by laying
WKHWHPSHUDWXUHSUREHRQWRSRIWKHPHDW8VH\RXU
thumb and forefinger to mark where the edge of the
meat will come on the probe.
Ŷ Insert the probe up to the point marked with your
finger. The tip of the probe should be in the center of
the meat.
Proofing
How to Set the Oven for Proofing
The proofing feature maintains a warm environment
which is useful for rising yeast-leavened dough.
1. Turn the Oven Mode Selector to PROOF. The display
will show “PrF”. PROOF mode will not operate when
oven is above 125°F. The display will scroll “too hot”.
Allow the oven time to cool.
For best results, cover the dough with a cloth or with
greased plastic wrap.
8VHUDFNSRVLWLRQ%RU&LQWKHODUJHRYHQ8VHUDFN
position B in the small oven.
The proofing feature automatically provides the optimum
temperature for the proofing process; therefore the
Temperature knob does not affect the proof temperature.
The oven interior lights cycle on and off as necessary
to maintain optimum proof temperature until the Oven
Mode Selector has been turned to OFF.
CAUTION Do not use the proofing mode for
warming food or keeping food hot. The proofing oven
temperature is not hot enough to hold foods at safe
temperatures.
Ŷ To avoid lowering the oven temperature and
lengthening proofing time, do not open the oven door
unnecessarily.
Ŷ Check bread products early to avoid over-proofing.
2. When proofing is finished, turn the Oven Mode
Selector to OFF.
22
49-85244
Self-cleaning Safety Precautions
The self-clean oven feature is designed to make
cleaning the inside of the oven easy by using very high
temperatures to burn away food spills.
WARNING Wipe up excess grease and other food
spills with a damp cloth. Excessive food soils can ignite
leading to smoke and heat damage.
Ŷ Do not clean the oven seals, damage can occur.
Ŷ Remove cookware, broiler pan, grid, probe and any
aluminum foil from the oven.
Ŷ Make sure the oven light lens and lens frame are in place.
Ŷ Do not use commercial oven cleaners, abrasives or
oven protectors in or near the self-cleaning oven.
Ŷ We recommend venting your kitchen with an open
ZLQGRZRUXVLQJDYHQWLODWLRQIDQKRRGGXULQJWKHVHOI
clean cycle.
Ŷ The oven racks may be left in the oven during the selfclean cycle.
IMPORTANT: The health of some birds is extremely
sensitive to the fumes given off during the selfcleaning cycle of any oven. Move birds to another wellventilated room.
NOTE: Self-Clean will not work if the temperature probe
is plugged in or if the Sabbath mode is set.
On double oven models, you can set a clean cycle in
both ovens at the same time. The last oven set will
automatically delay its start until the end of the first
oven’s clean cycle.
On double oven models, you can bake in one oven and
self-clean in the other at the same time. However, you
cannot use the PROOF mode setting in one oven while
the other oven is self-cleaning.
Ŷ Clean soil from around the frame and from around the
oven door, outside the oven seals. These areas must
be cleaned by hand.
How to Set the Oven for Cleaning
USING THE RANGE: Self-Cleaning Oven
Self-Cleaning Oven
Mini-Knob
Turn to adjust
Push to select
1. Turn off all surface burners. (The CLEAN cycle will not
start until all surface burners have been turned off.)
2. Turn the Oven Mode Selector to CLEAN.
3. Turn the Temperature knob to CLEAN.
The control automatically defaults to the
recommended clean cycle time of 5 hours. The clean
time may be adjusted to any time between 3 and 5
hours using the Mini-Knob. The display will show the
actual time remaining.
4. Push the Mini-Knob to start the CLEAN cycle.
If “CLOSE door” scrolls in the display, the self-clean
cycle has been selected but the door is not closed.
Close the oven door.
49-85244
The
symbol will flash as the oven door is locked. It
will not be possible to open the oven door during the
clean cycle.
5. After the clean cycle is complete and the oven has
cooled, “End” will show in the display and the
will turn off. Turn the Oven Mode Selector and the
Temperature knob to OFF.
To interrupt a clean cycle, turn the Oven Mode
Selector and the Temperature knob to OFF. When the
oven has cooled to a safe temperature, the
symbol
will turn off indicating the door may be opened.
An interrupted clean cycle cannot be restarted until
after the oven is cool enough for the door to unlock.
23
USING THE RANGE: Self-Cleaning Oven
Self-Cleaning Oven (Cont.)
After a Clean Cycle
You may notice some white ash in the oven. Wipe it up
with a damp cloth after the oven cools.
If the oven is not clean after one clean cycle, repeat the
cycle.
If white spots remain, remove them with warm sudsy
water and rinse thoroughly with a vinegar and water
mixture. These deposits are usually a salt residue that
cannot be removed by the clean cycle.
Timer
NOTE: The timer is independent of all the other functions
and does not control the oven.
To set the timer:
1. Push the TIMER button.
2. Turn the Mini-Knob to adjust any length of time up to
12 hours and push to select it.
On double oven models, each oven control has its own
timer function. Each timer can be set independently.
The control will beep with 1 minute remaining and the
display will show seconds until the timer counts down to
:KHQWKHWLPHUUHDFKHVWKHFRQWUROZLOOEHHS
3 times followed by one beep every 6 seconds until the
Mini-Knob is pushed.
Mini-Knob
Turn to adjust
Push to select
NOTE: The timer cannot be used while the oven is selfcleaning. (On double oven models, the timer for the oven
that is not in the self-cleaning mode may be used.)
To cancel the timer:
1. Push the TIMER button.
2. Turn the Mini-KnobWRDQGSXVKWRVHOHFW
To adjust the timer after start:
1. Push the TIMER button.
2. Turn the Mini-Knob to a new desired time and push
to select.
24
49-85244
Oven Thermostat Adjustment
You may find that your new oven cooks differently than
WKHRQHLWUHSODFHG8VH\RXUQHZRYHQIRUDIHZZHHNV
to become more familiar with it. If you still think your new
oven is too hot or too cold, you can adjust the thermostat
yourself.
Mini-Knob
Turn to adjust
Push to select
On double oven models, use the large oven controls to
enter the mode and to select the adjustment.
To adjust the oven thermostat:
1. Push and hold the TIMER button and Mini-Knob at
the same time for 4 seconds until the display shows
“SF” (Special Features).
2. Turn the Mini-Knob counterclockwise until the display
scrolls “OFFSEt”. Push the Mini-Knob to select the
offset mode.
3. Turn the Mini-Knob to adjust the oven thermostat up
to 35°F hotter or (-) 35°F cooler in 1°F increments.
3A. On double oven models, you can adjust
the thermostat of the small oven by turning the
Mini-KnobDERYHWKHVPDOORYHQ8VHWKHODUJH
oven Mini-Knob to select that adjustment.
4. Push the Mini-Knob to select your choice and exit the
mode. If you do not wish to save changes, push the
TIMER button to exit at any time.
NOTE: This adjustment will only affect Bake, Convection
Bake and Convection Roast temperatures; it does
not affect broiling or self-cleaning temperatures. The
adjustment will be retained in memory after a power
failure.
Do not use thermometers, such as those found in
grocery stores, to check the temperature setting of your
oven. These thermometers may vary 20–40 degrees.
Sabbath Mode
USING THE RANGE: Special Features
Special Features
To set the Sabbath mode:
7KH6DEEDWKPRGHLVGHVLJQHGIRUXVHRQWKH-HZLVK
6DEEDWKDQGRWKHU-HZLVKKROLGD\V
It can be used for baking only. It cannot be used for any
other cooking mode.
Mini-Knob
Turn to adjust
Push to select
When the Sabbath feature is set, the oven light and
all audible beeps will be disabled. The feature will also
provide a random delay period, of approximately 30
seconds to 1 minute, before the oven will turn on once it
is set to BAKE.
To Cancel the Sabbath Mode:
1. Push and hold the TIMER button and Mini-Knob at
the same time for 4 seconds until the display shows
“SF” (Special Features).
The oven temperature may be adjusted at any time by
turning the temperature knob. There is a random delay
before the oven elements respond.
Repeat steps 1, 2 and 3. The display will scroll
“SAbbAtH OFF”.
2. Turn the Mini-Knob clockwise until the display scrolls
“SAbbAtH.” Push the Mini-Knob to select the Sabbath
mode.
3. Once “SAbbAtH” is selected, the display will scroll
“SAbbAtH ON”.
Certified Sabbath Mode
The Sabbath setting will control both ovens. The
symbol will appear in both oven display windows.
For double oven models, use the large oven control to
set the Sabbath feature for both ovens.
49-85244
25
CARE AND CLEANING:&RQWURO3DQHODQG.QREV2YHQ%XUQHUV%URLOHU3DQ*ULGDQG5RDVWLQJ5DFN
26
Control Panel and Knobs
Be sure all controls are off and all surfaces are cool before cleaning any part of the range.
WARNING If your range is removed for cleaning, servicing or any reason, be sure the
anti-tip device is reengaged properly when the range is replaced. Failure to
take this precaution could result in tipping of the range and can result in death
or serious burns to children or adults.
Clean up spatters with a damp cloth. Remove heavier
soil with warm, soapy water.
Do not use abrasives of any kind on the control panel or
knobs.
The control knobs may be removed for easier cleaning.
To remove a knob, pull it straight off the control panel.
Wash the knobs in hot soapy water, but do not soak.
NOTE: The Mini-Knob is not removable.
Mini-Knob
Oven Burners
Do not attempt to clean the broil elements. Any soil will
burn off when the burner is heated.
The bake and convection elements are not exposed.
Broiler Pan, Grid and Roasting Rack
The broiler pan, grid and roasting rack are all dishwasher
safe. However, baked on foods may require washing
by hand with a commercial oven cleaner or abrasive
detergent.
Optional Accessories
Roasting Rack
Do not store a soiled broiler pan or grid anywhere in the
oven. Always properly dispose of excess grease.
CAUTION Do not clean the broiler pan, grid or
Grid
roasting rack in a self-cleaning oven.
Broiler pan
49-85244
The racks may remain in the oven during the selfcleaning cycle without being damaged.
Periodically, after several self-clean cycles, the oven
racks may need to be lubricated using the Graphite
Lubrication shipped with your range. To order additional
Graphite Lubrication, call our National Parts Center at
800.626.2002 and reference WB02T10303.
Right side
Rack rightside-up
1. Remove rack from the oven. See the Full extension
oven racks section.
2. Fully extend the rack on a table or countertop.
Newspaper may be placed underneath the rack for
easy cleanup.
5. Repeat for the right slide mechanism of the rack.
Left side
3. If there is debris in the slide tracks, wipe it away using
a paper towel. NOTE: Any graphite lubricant wiped
away must be replaced.
Rack right-side-up
6. Open and close the rack several times to distribute the
lubricant.
7. Replace the cap on the lubricant and shake it again.
Turn the rack over and repeat steps 3, 4, 5 and 6.
CARE AND CLEANING: Oven Racks
Oven Racks
8. Close the rack, turn rack right-side-up and place in the
oven. See the Full extension oven racks section.
9. Repeat above steps for each rack.
NOTE: Do not use a cooking spray or other lubricant
sprays on the slides.
4. Shake the graphite lubricant before opening it. Starting
with left slide mechanism of the rack, place four (4)
small drops of lubricant on the two (2) bottom tracks of
the slide close to the bearing carriers.
49-85244
27
CARE AND CLEANING:/LIWRII2YHQ'RRU3UREH
Lift-off Oven Door
The door is very heavy. Be careful when removing and lifting the door.
Do not lift the door by the handle.
Slot
To remove the door:
1. Fully open the door.
2. Pull the hinge locks down toward the door frame, to
the unlocked position. A tool, such as a small flatblade screwdriver, may be required.
3. Firmly grasp both sides of the door at the top.
Hinge lock
Pull hinge locks down to unlock
4. Close door to the door removal position,
(approximately 15 degrees from closed) and lift it up
and out until the hinge arm is clear of the slot.
To replace the door:
1. Firmly grasp both sides of the door at the top.
2. With the door at the same angle as the removal
position, seat the indentation of the hinge arm into the
bottom edge of the hinge slot. The notch in the hinge
arm must be fully seated into the bottom of the slot.
Removal
position
3. Fully open the door. If the door will not fully open, the
indentation is not seated correctly in the bottom edge
of the slot.
4. Push the hinge locks up against the front frame of the
oven cavity, to the locked position.
Replacement
position
5. Close the oven door.
Bottom
edge
of slot
Hinge arm
Indentation
Hinge
arm
Hinge
lock
Push hinge locks up to lock
Probe
Allow the temperature probe to cool before cleaning.
The probe should be cleaned with soap and water by
hand.
Do not immerse the temperature probe in water.
Do not store the temperature probe in the oven.
Do not clean the temperature probe in the self-cleaning
oven.
28
49-85244
WARNING SHOCK OR BURN HAZARD: Before
replacing oven light bulb, disconnect the electrical power
to the range at the main fuse or circuit breaker panel.
Failure to do so may result in electric shock or burn.
CAUTION BURN HAZARD: The glass cover and
bulb should be removed when cool. Touching hot glass
with bare hands or a damp cloth can cause burns.
Each oven is equipped with halogen light columns
located on the side walls of the oven. The lights come
on when the door is opened or when the oven is in a
cooking cycle.
Each light assembly consists of a removable light cover
with two locking clips and a light compartment with three
halogen bulbs.
Be sure to let the light cover and bulb cool completely.
For your safety, do not touch a hot bulb with bare hands
or a damp cloth.
To remove:
1. Remove the racks from the oven. See the Full
extension oven racks section.
8VLQJDƎQXWGULYHUUHPRYHWKHIRXUQXWVKROGLQJ
the rack supports to the oven wall.
To replace:
8VHDQHZYROW+DORJHQEXOEZLWK*
pins, not to exceed 25 watts.
Replacement bulbs may be purchased by calling
800.626.2002. Order Part Number WB25T10064.
NOTE: Higher wattage bulbs will damage your oven.
8VLQJJORYHVRUDGU\FORWKUHPRYHWKHEXOEIURPLWV
packaging. Do not touch the bulb with bare fingers.
Oil from bare fingers may cause hot spots on the glass
surface and lead to premature failure of the bulb. If
you do touch the glass, clean it with alcohol prior to
installation.
1. Push the bulb straight into the receptacle all the way.
2. Replace the light cover, by placing its front edge under
the front two tabs in the light compartment. Roll the
back edge into place, making sure that it is firmly
seated.
NOTE: If the locking clips fell from the glass lens
cover, hold them on the cover, in the correct position,
while replacing the cover on the light compartment.
Locking
clips
3. Remove the glass light cover by pulling its back edge
out and rolling it toward you. Do not remove any
screws.
CARE AND CLEANING: Oven Lights
Oven Lights
Place front
edge of lens
cover under
front two tabs
Press the light cover into place
The light cover must be in place when using the
oven.
3. Reinstall the rack support. Be sure to orient the
support so that the top tabs for the nuts are closest to
the top of the oven. Lightly secure with the four nuts
removed earlier, but do not over-tighten or the enamel
could be chipped.
8VLQJJORYHVRUDGU\FORWKUHPRYHWKHEXUQHGRXW
light bulb by pulling it straight out.
4. Replace the racks. See the Full extension oven racks
section.
5. Reconnect electrical power to the oven.
49-85244
29
CARE AND CLEANING: Surfaces
30
Surfaces
Oven Door
The oven frame and door, outside the oven seals,
should be cleaned by hand. Enameled surfaces should
be cleaned with hot soapy water. See Stainless Steel
Surfaces section for all Stainless Steel areas.
'RQRWUXERUFOHDQWKHGRRUVHDO²WKHILEHUJODVV
material of the seal has an extremely low resistance to
abrasion. An intact and well-fitting oven seal is essential
for energy-efficient operation and good baking results. If
the seal becomes worn, frayed, damaged or displaced it
must be replaced by a qualified technician.
Stainless Steel Surfaces
Do not use a steel-wool pad; it will permanently scratch
the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner. Always wipe the
surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
To inquire about purchasing stainless steel appliance
cleaner, please call our toll-free number, 800.626.2002
or visit GEAppliances.com.
Oven bottom
The oven bottom has a porcelain enamel finish. To make
cleaning easier, protect the oven bottom from excessive
spillovers. A smaller sheet of foil or sheet tray may
be used to catch a spillover by placing it on the rack
below the rack you are cooking on. This is particularly
important when baking a fruit pie or other foods that
are highly acidic. Hot fruit fillings or other foods that are
highly acidic (such as tomatoes, sauerkraut and sauces
with vinegar or lemon juice) may cause pitting and
damage to the porcelain enamel surface and should be
wiped up immediately.
Never fully cover a rack with aluminum foil. This will
disturb the heat circulation and result in poor baking.
To clean up spillovers, use soap and water, an abrasive
cleaner or soap-filled scouring pad. Rinse well to remove
soap before self-cleaning.
49-85244
7KHEXUQHUFRQVLVWVRIWKUHHSDUWVWKHEXUQHUEDVH
burner head, and burner cap. The burner head and
burner cap can be lifted off, making them easy to clean.
CAUTION '212723(5$7(7+(%851(5
:,7+287$//%851(53$576,13/$&(
Surface burners should be cleaned routinely, especially
after bad spillovers, which could clog the slots and holes
in the burner heads.
The electrode is located at the rear of each burner. Do
not attempt to disassemble or clean around any burner
while another burner is on. An electric shock may result.
Cleaning
Lift off burner parts only when cool. Wash in hot, soapy
water. You may use a plastic scouring pad to remove
burned-on food particles.
To remove burned-on food, soak the burner heads in
a solution of mild liquid detergent and hot water for
20–30 minutes. For more stubborn stains, use a plastic
scouring pad or toothbrush.
If the spill goes inside the burner head assembly, wash it
under running water and shake to remove excess water.
After Cleaning
Before replacing the burner parts, shake out excess
water and then dry them thoroughly.
Burner Cap
Burner
Head
Burner
Base
Electrode
To replace the burner parts:
Make sure that the burner parts are replaced in the
correct location.
1. Replace the burner head on top of the burner base,
making sure that the hole in the burner head is
properly aligned with the electrode in the burner base.
A small gap between the base and head is normal.
2. Place the burner cap on top of the burner head. Make
sure that the burner cap is properly seated on the
burner head.
To remove the burner parts:
1. Turn all controls OFF before removing any burner
parts.
Burner cap properly seated
2. When cool, you may lift off the burner grates, burner
caps and burner heads for easier cleaning. Do not
remove the burner bases.
NOTE: The ZGP304 model has 2 different size burners.
Be sure to replace the burners in the same location.
49-85244
Burner cap not properly seated
CARE AND CLEANING: Dual-flame Stacked Burners
Dual-flame Stacked Burners
31
CARE AND CLEANING:6SDUN,JQLWHUDQG(OHFWURGHV%XUQHU*UDWHV
32
Spark Igniter and Electrodes
The electrode of the electronic ignition system is
positioned at the rear of the burner base. When cleaning
the cooktop, be careful not to snag the igniter with your
cleaning cloth. Damage to the igniter could occur.
Clean this metal part
with an emery board.
Be careful not to push in a control knob while cleaning. It
could cause the igniter to spark.
Make sure that the white ceramic igniters on the cooktop
are dry and clean. Clean the metal portion of the
electrode with a soft cloth or emery board.
Do not attempt to remove the electrode from the
cooktop.
Do not clean this white
ceramic part with an
emery board.
Burner Grates
The enameled cast-iron burner grates should be cleaned
regularly.
You must put the grates on the self-clean oven rack
during the self-clean cycle. DO NOT put the grate on
the oven floor during a self-clean cycle. DO NOT put the
frame inside the oven during a self-clean cycle. Only the
grate can withstand the heat of the self-clean cycle. The
frames may be cleaned by hand or in the dishwasher.
Wash them in hot soapy water, rinse, and dry thoroughly.
Although they are durable, the grates will gradually lose
their shine, regardless of the best care you can give
them. This is due to their continual exposure to high
temperatures.
Grates
Frame
Pads
For stability, the frames have rubber pads on each
corner. During cleaning and use, be careful not to
damage or snag rubber pads.
Do not operate a burner for an extended period of time
without cookware on the grate. The finish on the grate
may chip without cookware to absorb the heat.
49-85244
Grease from the griddle will drain into the enameled
cast-iron grease troughs at the front of the range. Once
the troughs have cooled, they may be lifted out for easier
cleaning.
Grease troughs
To remove the cool grease trough from the griddle, slide
it toward the front and lift up.
Do not allow grease to accumulate in the grease
troughs as it can be a fire hazard. Clean the grease
troughs as soon as they are cool. The grease troughs
can be cleaned by hand with hot soapy water or in the
dishwasher. Wipe any spillage in the trough basin with a
soft cloth.
For stability, the troughs have rubber pads at the front.
Be careful not to damage the pads when removing for
cleaning.
Griddle (on some models)
Thoroughly clean the griddle of grease and food particles,
using a square-edged metal spatula, while it is still hot.
NOTE: It is normal for the stainless steel griddle to
discolor to a yellow-brown color after use.
Wipe the griddle with a dry, heavy, coarse cloth to
remove any remaining residue and food particles. If the
griddle is cleaned with anything other than a dry, heavy,
coarse cloth, it will need to be reseasoned.
Never flood the hot griddle with cold water. This could
cause the griddle to crack or warp.
Cutting Board (on some models)
Wash the bamboo cutting board with warm water and a
mild soap. Occasionally, wipe it with mineral oil.
Do not clean the cutting board in the dishwasher.
49-85244
Optional Accessories
CARE AND CLEANING:*UHDVH7URXJKV*ULGGOH&XWWLQJ%RDUG
Grease Troughs (on some models)
33
TROUBLESHOOTING TIPS
34
Troubleshooting tips ... Before you call for service
Save time and money! Review the charts on the following pages first and you may not need to call for service. If an
error occurs in the control operation, a fault code will flash in the display. Record the error code and call for service.
Problem
Possible Cause
Oven Will Not Work
A fuse in your home may be blown or the circuit breaker tripped.
The oven controls are not properly set.
The oven controls are set for cleaning. If necessary, allow the oven to cool; then open the door.
Make sure the Oven Mode Selector is set to BAKE and the Temperature knob is set to a temperature.
Oven Light(S) Do
Not Work
The light bulb is defective. Replace the bulb.
The oven is self-cleaning or the Sabbath feature is set. The oven lights do not come on during selfcleaning or if the Sabbath feature is set.
The oven is set for Proof mode. The lights cycle on and off as necessary to maintain Proof temperature.
Food Does Not
Bake Or Roast
Properly
The oven controls are improperly set. See the Baking or Roasting section.
Oven not preheated for a long enough time; wait for the oven to signal preheat.
Incorrect cookware or cookware of improper size being used. See Baking Tips.
Racks in the wrong position. See the Baking or Roasting section.
8VHDIRLOWHQWWRVORZGRZQEURZQLQJGXULQJURDVWLQJ
Oven thermostat needs adjustment. See the Oven thermostat adjustment section.
Food Does Not
Broil Properly
This model is designed for closed door broiling only. Close the door. Always broil with the door closed.
The oven controls are not set at BROIL. See the Broiling section.
The probe is plugged into the outlet in the oven. Remove the probe from the oven.
Improper rack position being used.
&RRNZDUHLVQRWVXLWHGIRUEURLOLQJ8VHWKHEURLOLQJSDQDQGJULGWKDWFDPHZLWK\RXURYHQ
Aluminum foil used on the broiling pan and grid has not been fitted properly and slit as recommended.
Oven Will Not Self
Clean
The oven temperature is too high to set a self-clean operation.
Allow the oven to cool below the locking temperature and reset the controls.
The controls are not properly set. See the Self-Cleaning Oven section.
Cracking Or
Popping Sound
During Cleaning
This is normal. This is the sound of the metal heating and cooling during both the cooking and cleaning
functions.
Excessive Smoking
Occurs During
Cleaning
The oven is heavily soiled. Turn the Oven Mode Selector and the Temperature knobs to OFF. Open the
windows to rid the room of smoke. Wait until the locked door indicator light goes off. Wipe up excess
soil and reset the clean cycle.
Oven Not Clean
After A Clean Cycle
The oven was heavily soiled. Clean up heavy spillovers before starting the clean cycle. Heavily soiled
ovens may need to self-clean again.
Oven is connected to a 208V electrical supply. Set your cleaning time for 5 hours.
The oven controls are not properly set. See the Self-Cleaning Oven section.
Oven Racks Are
Difficult To Slide
The racks were cleaned in the self-clean cycle and now need periodic lubrication.
Do not spray with a cooking spray or other lubricant sprays. See Full extension oven racks in the Care
and Cleaning section.
49-85244
Problem
Possible Cause
Timer Does Not Work
The timer cannot be used while the oven is self-cleaning.
Oven Temperature
Too Hot Or Too Cold
Oven thermostat needs adjustment. See the Oven thermostat adjustment section.
Oven Door Will Not
Open After A Clean
Cycle
The oven is too hot. Allow the oven to cool below locking temperature.
“Close Door” Scrolls
In The Display
The self-clean cycle has been selected but the door is not closed.
Close the oven door. The
symbol will appear in the display
Is On When You
Want To Cook
The oven door is locked because the temperature inside the oven has not dropped below the
unlocking temperature. Turn the Oven Mode Selector and the Temperature knobs to OFF. Allow the
oven to cool.
F- And A Number
Flash In The Display
The oven has a function error code. Turn the Oven Mode Selector and the Temperature knobs to
OFF. Allow the oven to cool for one hour. Put the oven back into operation.
Disconnect all power to the oven for 30 seconds and then reconnect power. If the function error code
repeats, call for service.
Display Goes Blank
TROUBLESHOOTING TIPS
Troubleshooting tips ... Before you call for service
The display is blank when the oven or timer is not in use.
A fuse in your home may be blown or the circuit breaker tripped. Replace the fuse or reset the circuit
breaker.
Unable To Get The
Display To Show “Sf”
The TIMER and the MINI-KNOB buttons must be pushed at the same time and held for 4 seconds.
“Probe” Appears In
The Display
This is reminding you to enter a probe temperature after plugging in the probe. Enter a probe
temperature
Shows In Display
The Sabbath mode has been selected.
Power Outage
If the oven was in use during a power outage or surge, the oven must be reset. Turn the Temperature
knob and the Oven Mode Selector to OFF. Reset the controls to begin again.
Steam From The Vent
When using the convection mode, it is normal to see steam coming out of the oven vent. As the
number of racks or amount of food being cooked increases, the amount of visible steam will increase.
Burning Or Oily Odor
Emitting From The
Vent
This is normal in a new oven and will disappear in time.
Strong Odor
This is temporary. An odor from the insulation around the inside of the oven is normal for the first few
times the oven is used.
Fan Noise
A cooling fan or a convection fan (depending on the function you are using) may turn on. This is
normal. The cooling fan will turn on to cool internal parts. It may run after the oven is turned off. The
convection fan may cycle on and off until the function is over or the door is opened.
49-85244
35
TROUBLESHOOTING TIPS
Troubleshooting tips ... Before you call for service
Problem
Possible Cause
Convection Fan Not
On All The Time
The convection fan (depending on the function you are using) may cycle on and off until the function
is over or the door is opened for optimized performance. This is normal. In addition, the convection
fan may cycle in the clockwise and counter clockwise direction until the function is over or the door is
opened.
Burners Do Not
Light Or Spark
Randomly
Electrical plug is not plugged into a live power outlet.
Gas supply not turned on.
Burner parts not replaced correctly.
Holes in the simmer rings or slits in the burner rings are clogged.
Clogged orifice, or wet burners or electrodes.
Cooktop Lockout feature is activated.
A fuse in your home may be blown or circuit breaker tripped.
Burners Have
Yellow Or YellowTipped Flames
Burner parts not replaced correctly.
A. Yellow flames: Call
for service.
B. Yellow tips on outer
cones: Normal for
propane (LP) gas.
C. Soft blue flames:
Normal for natural gas.
If burner flames look like (A), call for service. Normal burner flames should look like (B) or (C),
depending on the type of gas.
36
Burner Flames Very
Large Or Yellow
The range may be connected to the wrong fuel type. Contact the person who installed your range or
made the conversion
Burner Control
Knob Will Not Turn
When the knob is at the OFF position, it must be pushed in before it can be turned, and it can only be
turned in a counterclockwise direction. When the knob is at any other position, it can be turned in either
direction without being pushed inwards.
Condensation Or
Fogging On The
Inner Door Glass
Burner Flames
contain Flickers of
Orange
Condensation or fogging on the inside of the oven door glass is normal during the preheating of the
oven and will evaporate usually by the end of the preheating cycle.
Airborne dust; cool-mist humidifier; debris on or inside burner.
49-85244
Notes
49-85244
37
WARRANTY
GE Appliances Gas Range Warranty
GEAppliances.com
All warranty service is provided by our Factory Service Centers, or an authorized Customer Care® technician. To schedule
service online, visit us at www.geappliances.com/service_and_support/, or call GE Appliances at 800.GE.CARES
(800.432.2737). Please have your serial number and your model number available when calling for service.
Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory
service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its
products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be
sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service.
For the period of
GE Appliances will replace
One year
From the date of the
original purchase
Any part of the cooktop which fails due to a defect in materials or workmanship. During
this limited one-year warranty, GE Appliances will provide, free of charge, all labor and
in-home service to replace the defective part.
What GE Appliances will not cover:
Staple your receipt here. Proof of the original purchase
date is needed to obtain service under the warranty.
Ŷ Service trips to your home to teach you how to use
the product.
Ŷ 'LVFRORUDWLRQRIWKHJULGGOHSODWHRURYHQUDFNV
Ŷ &KLSSLQJRISRUFHODLQHQDPHOJUDWHVRURYHQUDFNV
Ŷ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
breakers.
Ŷ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
possible defects with this appliance.
Ŷ 'DPDJHDIWHUGHOLYHU\
Ŷ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH
floods or acts of God.
Ŷ 3URGXFWGDPDJHRUIDLOXUHRIWKHSURGXFWLILWLV
abused, misused, used for other than the intended
purpose, or used commercially.
Ŷ ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
If you have an installation problem, contact your
dealer or installer. You are responsible for providing
adequate electrical, gas, exhausting and other
connecting facilities as described in the Installation
Instructions provided with the product.
Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
EXCLUSION OF IMPLIED WARRANTIES
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
This warranty is extended to the original purchaser and any succeeding owner for products purchased for home use
ZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($SSOLDQFHV$XWKRUL]HG6HUYLFHULVQRWDYDLODEOH
you may be responsible for a trip charge or you may be required to bring the product to an Authorized GE Appliances
Service location for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives you
specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights
are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances, a Haier company
Warrantor in Canada: MC Commercial, Burlington, ON, L7R 5B6
Extended Warranties: Purchase a GE Appliances extended warranty and learn about special discounts that are
available while your warranty is still in effect. You can purchase it online anytime at
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
or call 800.626.2224 during normal business hours. GE Appliances Service will still be there after your warranty expires.
38
49-85244
Looking For Something More?
GE Appliances offers a variety of accessories to
improve your cooking and maintenance experiences!
Refer to the Consumer Support page for phone numbers
and website information.
7KHIROORZLQJSURGXFWVDQGPRUHDUHDYDLODEOH
Parts
Bamboo Cutting Board (on some models)
ACCESSORIES
Accessories
Toekick
Griddle Covers (on some models)
Full Extension Oven Rack(s)
Low Profile Oven Rack
Broiler Pan and Grid
Temperature Probe
Roasting Rack
6 Gas Burners
6 Gas Burner with Griddle
49-85244
39
CONSUMER SUPPORT
Consumer Support
GE Appliances Website
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
VHUYLFHVGHVLJQHGIRU\RXUFRQYHQLHQFH,QWKH86GEAppliances.com ,Q&DQDGDGEAppliances.ca
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
the pre-printed registration card included in the packing material.
,QWKH86GEAppliances.com/register
,Q&DQDGDProdsupport.mabe.ca/crm/Products/ProductRegistration.aspx
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
\RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU,QWKH86GEAppliances.com/ge/service-and-support/service.htm
or call 800.432.2737 during normal business hours.
,Q&DQDGDGEAppliances.ca/en/support/service-request or call 800.561.3344
Extended Warranties
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
ZDUUDQW\H[SLUHV,QWKH86GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm
or call 800.626.2224 during normal business hours.
,Q&DQDGDGEAppliances.ca/en/support/purchase-extended-warranty or call 800.290.9029
Remote Connectivity
For assistance with wireless network connectivity (for models with remote enable),
visit our website at GEAppliances.com/ge/connected-appliances/RUFDOOLQWKH86RQO\
Parts and Accessories
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
(VISA, MasterCard and Discover cards are accepted). Order on-line today 24 hours every day.
,QWKH86GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Customers in Canada should consult the yellow pages for the nearest MC Commercial service center, visit our
website at GEAppliances.ca/en/products/parts-filters-accessories or call 800.661.1616.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
GHWDLOVLQFOXGLQJ\RXUSKRQHQXPEHURUZULWHWR
,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/ge/service-and-support/contact.htm
,Q&DQDGD'LUHFWRU&RQVXPHU5HODWLRQV0&&RPPHUFLDO,QF_6XLWH)DFWRU\/DQH_0RQFWRQ1%(&0
GEAppliances.ca/en/contact-us
40
Printed in Mexico
49-85244
Cuisinières mixtes professionnelles
CUISINIÈRES
CONSIGNES DE SÉCURITÉ . . . . . . . . . . 3
UTILISATION DE LA CUISINIÈRE
Fonctions de Votre Cuisinière . . . . . . . . . . . . . . . 8
Commandes de la Table de Cuisson . . . . . . . . . .9
Cuisson en Surface . . . . . . . . . . . . . . . . . . . . . . . . 10
Fonctions et Caractéristiques
de Votre Four . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Commande du Four . . . . . . . . . . . . . . . . . . . . . . . 13
Conseils Pour Cuisson . . . . . . . . . . . . . . . . . . . . . 14
Grilles du Four . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Cuisson . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
Cuisson au Grill . . . . . . . . . . . . . . . . . . . . . . . . . . . 17
Cuisson ou Rôtissage par Convection . . . . . . . 19
Sonde . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Levée . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22
Four Autonettoyant . . . . . . . . . . . . . . . . . . . . . . .23
Fonctions Spéciales . . . . . . . . . . . . . . . . . . . . . . .25
MANUEL DU
PROPRIÉTAIRE
CAFÉ
76 cm (30 po), 91 cm (36 po)
et 121 cm (48 po)
ENTRETIEN ET NETTOYAGE
Panneau de Commande et Boutons . . . . . . . . .26
Brûleurs du Four . . . . . . . . . . . . . . . . . . . . . . . . . .26
Moule à Cuisson, Grille et Grille
de Rôtissage . . . . . . . . . . . . . . . . . . . . . . . . . . .26
Grilles de Four . . . . . . . . . . . . . . . . . . . . . . . . . . .27
Soulever la Porte du Four . . . . . . . . . . . . . . . . . .28
Sonde . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28
Lampes du Four . . . . . . . . . . . . . . . . . . . . . . . . . .29
Surfaces . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
Brûleurs Double Flamme Superposés . . . . . . . . 31
Déclencheur d’étincelles et Électrodes . . . . . .32
Grilles de Brûleur . . . . . . . . . . . . . . . . . . . . . . . . .32
Lèchefrites . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .33
Plaque Chauffante . . . . . . . . . . . . . . . . . . . . . . . .33
Planche à Trancher. . . . . . . . . . . . . . . . . . . . . . . .33
CONSEILS DE DÉPANNAGE . . . . . . . .34
GARANTIE. . . . . . . . . . . . . . . . . . . . . . . . . . . .38
ACCESSOIRES . . . . . . . . . . . . . . . . . . . . . . .39
SOUTIEN AU CONSOMMATEUR . .
40
Inscrivez ci-dessous les numéros de modèle et de série
N° de modèle ________________________________
N° de série __________________________________
Vous les trouverez sur une étiquette placée derrière le
bouton du brûleur gauche ou sous le panneau de commande,
dans la partie visible lorsque la porte du four est ouverte.
GE est une marque déposée de General Electric Company. Fabriqué sous licence de marque.
49-85244 10-17 GEA
NOUS VOUS REMERCIONS D’ACCUEILLIR GE APPLIANCES CHEZ VOUS
Que vous ayez grandi avec GE Appliances ou qu’il s’agisse de votre première acquisition, nous
sommes heureux de vous accueillir dans notre famille.
Nous sommes fiers du savoir-faire, de l’innovation et de l’esthétique qui composent chaque appareil
GE Appliances, et nous pensons que vous le serez aussi. Dans cette optique, nous vous rappelons
que l’enregistrement de votre électroménager vous assure la communication de renseignements
importants sur le produit et la garantie lorsque vous en avez besoin.
Enregistrez votre électroménager GE en ligne dès maintenant. Des sites Web et des numéros de
téléphone utiles figurent dans la section Soutien au consommateur de ce manuel d’utilisation.
Vous pouvez aussi poster la fiche de garantie pré-imprimée incluse dans l’emballage.
2
49-85244
VEUILLEZ LIRE TOUTES LES CONSIGNES AVANT D’UTILISER L’APPAREIL
AVERTISSEMENT
Veuillez lire toutes les consignes avant d’utiliser ce produit. Le non-respect de ces instructions
pourrait entraîner un incendie, un choc électrique, une blessure grave voire la mort.
AVERTISSEMENT
Si les consignes du manuel ne sont pas respectées, il y a un
risque d’incendie ou d’explosion et des dommages matériels, physiques et la mort.
- Ne stockez ou n’utilisez pas d’essence ou d’autres vapeurs ou liquides inflammables
à proximité de la cuisinière ou de tout autre appareil.
- QUE FAIRE SI JE DÉTECTE UNE ODEUR DE GAZ
Ŷ 1¶DOOXPH]SDVO¶DSSDUHLO
Ŷ 1HWRXFKH]DXFXQLQWHUUXSWHXUQ¶XWLOLVH]SDVGHWpOpSKRQH
CONSIGNES DE SÉCURITÉ
CONSIGNES DE SÉCURITÉ IMPORTANTES
Ŷ $SSHOH]LPPpGLDWHPHQWYRWUHIRXUQLVVHXUGHJD]DYHFOHWpOpSKRQHGXYRLVLQ
Suivez les instructions du fournisseur.
Ŷ 6LYRXVQHSDUYHQH]SDVjMRLQGUHOHIRXUQLVVHXUGHJD]DSSHOH]OHVSRPSLHUV
- L’installation et l’entretien doivent être effectués par un installateur qualifié, un centre
de réparation ou le fournisseur de gaz.
DISPOSITIF ANTIBASCULEMENT
AVERTISSEMENT
Risque de basculement
• Un enfant ou un adulte peut faire basculer la cuisinière
et ainsi perdre la vie.
• Posez la ferrure antibasculement sur le mur ou le plancher.
• Remettez la cuisinière en place en la glissant de façon que
son pied s’insère dans la ferrure antibasculement.
• Insérez le pied de nouveau si vous déplacez la cuisinière.
• L’omission d’observer ces consignes peut occasionner
la mort ou des brûlures graves aux enfants ou aux adultes.
modèles, on peut enlever le tiroir de rangement ou le coup-de-pied pour
faciliter l’inspection. Si l’inspection visuelle n’est pas possible, glissez la
cuisinière vers l’avant, assurez-vous que la ferrure antibasculement est
solidement fixée au plancher ou au mur, puis repoussez la cuisinière de
façon à engager le pied de nivellement sous la ferrure antibasculement.
Afin de réduire le risque de basculement,
la cuisinière doit être correctement fixée
par une ferrure antibasculement. Consultez
les instructions d’installation livrées avec la
ferrure pour l’information détaillée avant de
tenter l’installation.
Cuisinières au gaz professionnelles
Pour vérifier si la ferrure est installée et
engagée correctement, regardez sous la
cuisinière pour voir si le pied de nivellement
arrière est engagé dans la ferrure. Sur certains
Trousse de ferrure
antibasculement incluse
Si la cuisinière est éloignée du mur pour une raison quelconque, répétez
toujours cette procédure pour vérifier que la cuisinière est correctement
fixée par la ferrure antibasculement.
N’enlevez jamais totalement les pieds de nivellement sinon la cuisinière
ne sera pas fixée par la ferrure antibasculement correctement.
Vue arrière
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
49-85244
3
CONSIGNES DE SÉCURITÉ
CONSIGNES DE SÉCURITÉ IMPORTANTES
VEUILLEZ LIRE TOUTES LES CONSIGNES AVANT D’UTILISER L’APPAREIL
AVERTISSEMENT
CONSIGNES GÉNÉRALES DE SÉCURITÉ
AVERTISSEMENT
N’utilisez JAMAIS cet
électroménager comme appareil de chauffage
pour réchauffer la pièce. Cela pourrait causer un
empoisonnement au monoxyde de carbone et la
surchauffe du four.
Ŷ 8WLOLVH]FHWpOHFWURPpQDJHUXQLTXHPHQWDX[ILQV
auxquelles il est fait mention dans ce manuel du
propriétaire.
Ŷ /¶LQVWDOODWLRQHWODPLVHjODWHUUHGRLYHQWrWUHUpDOLVpHV
par un installateur qualifié en conformité avec les
instructions d’installation fournies.
Ŷ 7RXWUpJODJHHWWRXWHUpSDUDWLRQGHYUDLHQWrWUHUpDOLVpV
par un installateur de cuisinière au gaz ou un technicien
en réparation qualifiés. Ne tentez pas de réparer ou de
remplacer une pièce de cette cuisinière à moins que cela
soit spécifiquement recommandé dans ce manuel.
Ŷ 9RWUHFXLVLQLqUHHVWH[SpGLpHGHO¶XVLQHSUrWHSRXUXQH
alimentation au gaz naturel ou au propane (LP). Elle
peut être convertie pour l’un ou l’autre de ces gaz. Si
nécessaire, ces conversions doivent être réalisées par
un technicien qualifié conformément aux instructions
d’installation et aux codes locaux. L’intermédiaire
qui réalise ce travail assume la responsabilité de la
conversion
Ŷ 'HPDQGH]jO¶LQVWDOODWHXUGHYRXVPRQWUHUO¶HPSODFHPHQW
du robinet de sectionnement du gaz de la cuisinière et
comment le fermer si nécessaire.
Ŷ $YDQWWRXWHUpSDUDWLRQGpEUDQFKH]ODFXLVLQLqUH
ou coupez l’alimentation électrique au panneau de
distribution domestique en retirant le fusible ou en
désarmant le disjoncteur.
Ŷ $VVXUH]YRXVGHUHWLUHUWRXWOHPDWpULHOG¶HPEDOODJHGH
la cuisinière avant d’allumer celle-ci afin de prévenir
l’inflammation de ce matériel.
Ŷ *D]HWpOHFWULFLWp1¶XWLOLVH]SDVODSDUWLHG¶XQHFXLVLQLqUH
sur laquelle l’élément chauffant développe un point
LQFDQGHVFHQWRXGpPRQWUHGHVVLJQHVGHEULV8QSRLQW
incandescent de l’élément indique que l’élément peut être
défectueux et représente un risque possible de brûlures,
d’incendie et d’électrocution. Éteignez immédiatement
l’élément chauffant et faites-le remplacer par un
technicien réparateur qualifié.
Ŷ eYLWH]GHUD\HUOHVVXUIDFHVGHYHUUH&HODSRXUUDLW
causer le bris du verre. Ne cuisez pas d’aliments sur
du verre brisé. Cela pourrait occasionner une décharge
électrique, un incendie ou des blessures.
Ŷ 1HODLVVH]SDVG¶HQIDQWVVHXOVRXVDQVVXUYHLOODQFHGDQV
la zone où l’électroménager est en cours d’utilisation. On
ne devrait jamais leur permettre de grimper, s’asseoir ou
se tenir sur quelque partie de l’électroménager que ce
soit.
Ŷ
ATTENTION
Ne rangez pas les articles qui attirent
les enfants dans des armoires au-dessus d’une cuisinière,
un enfant qui grimpe sur la cuisinière pour atteindre un
article peut se blesser gravement.
Ŷ 1¶REVWUXH]MDPDLVOHVRULILFHVG¶DLUGHODFXLVLQLqUH,OV
procurent les entrées et les sorties d’air nécessaires pour
un fonctionnement avec une combustion correcte. Les
orifices d’air sont situés à l’arrière de la table de cuisson,
dans le haut et le bas de la porte du four, et dans le bas
de la cuisinière.
Ŷ 8WLOLVH]VHXOHPHQWGHVSRLJQpHVRXPLWDLQHVVqFKHVFDU
des brûlures de vapeur peuvent survenir au contact des
surfaces chaudes si elles sont humides. Ne laissez pas
les poignées ou mitaines toucher les brûleurs de surface,
les grilles de brûleurs ou les éléments chauffants.
N’utilisez pas une serviette ou autre linge de grande taille
à la place d’une poignée ou de mitaines.
Ŷ 1HWRXFKH]SDVDX[pOpPHQWVFKDXIIDQWVRXjODVXUIDFH
intérieure du four. Ces surfaces peuvent s’avérer
suffisamment chaudes pour brûler même si elles sont
d’une couleur foncée. Pendant et après l’utilisation, ne
touchez pas à l’intérieur du four et ne laissez pas des
vêtements ou d’autres matières inflammables entrer en
contact avec celui-ci; laissez d’abord le four se refroidir
suffisamment. D’autres surfaces de l’électroménager
peuvent devenir suffisamment chaudes pour causer des
brûlures. Parmi les surfaces potentiellement chaudes,
mentionnons les brûleurs, les grilles, les orifices d’air du
four, les surfaces près des orifices, les fissures autour
de la porte du four, les pièces de garniture métalliques
au-dessus de la porte, les dosserets et les surfaces des
tablettes en hauteur.
Ŷ 1HFKDXIIH]SDVGHFRQWHQDQWVG¶DOLPHQWVQRQRXYHUWV
L’augmentation de la pression peut faire éclater le
contenant et causer des blessures.
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
4
49-85244
VEUILLEZ LIRE TOUTES LES CONSIGNES AVANT D’UTILISER L’APPAREIL
AVERTISSEMENT
CONSIGNES GÉNÉRALES DE SÉCURITÉ (suite)
Ŷ &
XLVH]OHVDOLPHQWVjIRQGSRXUYRXVSUpPXQLUFRQWUHOHV
maladies d’origine alimentaire. Des recommandations
relatives aux températures de cuisson minimales sûres
VRQWDFFHVVLEOHVVXUOHVVLWHVZZZ,V,W'RQH<HWJRYHW
ZZZIVLVXVGDJRY8WLOLVH]XQWKHUPRPqWUHSRXUDOLPHQWV
et vérifiez à plusieurs endroits.
Ŷ 1
HODLVVH]SHUVRQQHJULPSHUVHWHQLURXV¶DFFURFKHUj
la porte du four, sur le tiroir ou la table de cuisson. Cela
pourrait endommager la cuisinière ou la faire basculer et
causer des blessures graves ou la mort.
AVERTISSEMENT
Ŷ *
DUGH]ODKRWWHGXYHQWLODWHXUHWOHVILOWUHVjJUDLVVH
propres afin de maintenir une bonne ventilation et
prévenir les feux de graisse. Mettez le ventilateur en
arrêt (OFF) dans l’éventualité d’un incendie ou lors de
l’inflammation intentionnelle d’un spiritueux sur la table
de cuisson. La soufflante en marche peut propager les
flammes.
GARDEZ LES MATIÈRES INFLAMMABLES À DISTANCE DE LA
CUISINIÈRE
L’omission de prendre cette précaution peut causer un incendie ou une blessure corporelle.
Ŷ 1HUDQJH]QLQ¶XWLOLVH]GHVPDWLqUHVLQIODPPDEOHV
dans un four ou près de la table de cuisson, y
compris du papier, du plastique, des poignées ou
mitaines, du linge de maison, du revêtement mural,
des rideaux, des draperies, de l’essence ou d’autres
vapeurs ou liquides inflammables.
Ŷ 1HODLVVH]SDVODJUDLVVHGHFXLVVRQQLG¶DXWUHV
matières inflammables s’accumuler dans ou à
proximité de la cuisinière. La graisse dans le four
ou sur la table de cuisson peut prendre feu.
CONSIGNES DE SÉCURITÉ
CONSIGNES DE SÉCURITÉ IMPORTANTES
Ŷ 1HSRUWH]MDPDLVGHYrWHPHQWVDPSOHVRX
pendants lors de l’utilisation de l’électroménager.
Ces vêtements peuvent prendre feu au contact de
surfaces chaudes et causer des brûlures graves.
AVERTISSEMENT DANS L’ÉVENTUALITÉ D’UN INCENDIE, PRENEZ LES MESURES
SUIVANTES AFIN DE PRÉVENIR LES BLESSURES ET LA PROPAGATION
DU FEU
Ŷ 1HYHUVH]SDVG¶HDXVXUXQIHXGHJUDLVVH1HSUHQH]
jamais une casserole en flammes. Mettez les commandes
à la position d’arrêt (OFF). Étouffez une casserole en
flammes sur un élément de surface en recouvrant la
casserole complètement avec un couvercle bien adapté,
XQHW{OHjELVFXLWRXXQSODWHDXELHQSODW8WLOLVH]XQ
extincteur à poudre sèche ou à mousse.
Ŷ 6LXQIHXVHGpFODUHGDQVOHIRXUSHQGDQWO¶DXWRQHWWR\DJH
mettez le four à la position d’arrêt (OFF) et attendez
que le feu cesse. Ne forcez pas l’ouverture de la
porte. L’introduction d’air frais à des températures
d’autonettoyage peut provoquer un jaillissement de
flammes dans le four. L’omission d’observer cette mise
en garde peut causer des brûlures graves.
Ŷ 6LXQIHXVHGpFODUHGDQVOHIRXUSHQGDQWODFXLVVRQ
étouffez-le en fermant la porte du four et en mettant
le four à la position d’arrêt (OFF) ou en utilisant un
extincteur à poudre sèche ou à mousse.
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
49-85244
5
CONSIGNES DE SÉCURITÉ
CONSIGNES DE SÉCURITÉ IMPORTANTES
VEUILLEZ LIRE TOUTES LES CONSIGNES AVANT D’UTILISER L’APPAREIL
AVERTISSEMENT
CONSIGNES DE SÉCURITÉ RELATIVES À LA TABLE DE CUISSON
Ŷ 1HODLVVH]MDPDLVGHVEU€OHXUVGHVXUIDFHVDQV
surveillance à des réglages de chaleur modérés ou
élevés. Les aliments, en particulier les aliments huileux,
peuvent s’enflammer et déclencher un feu pouvant se
propager aux armoires environnantes.
Ŷ 1HODLVVH]MDPDLVGHO¶KXLOHHQFRXUVGHIULWXUHVDQV
surveillance. Au-delà de son point de fumée, l’huile peut
s’enflammer et causer un incendie pouvant se propager
DX[DUPRLUHVHQYLURQQDQWHV8WLOLVH]XQWKHUPRPqWUHj
bain de friture lorsque c’est possible afin de surveiller la
température de l’huile.
Ŷ 3RXUSUpYHQLUOHGpERUGHPHQWG¶KXLOHHWO¶LQFHQGLH
consécutif, utilisez une quantité d’huile minimale lorsque
vous utilisez une casserole peu profonde et évitez de
cuire des aliments congelés qui comportent trop de glace.
Ŷ 8WLOLVH]XQHFDVVHUROHG¶XQHWDLOOHDSSURSULpHHWpYLWH]
celles qui sont instables ou qui basculent facilement.
Réglez les flammes du brûleur de façon qu’elles ne
dépassent pas le fond de la casserole. Des flammes trop
intenses présentent un risque.
Ŷ 8WLOLVH]WRXMRXUVODSRVLWLRQ/,7( DOOXPDJH ORUVTXHYRXV
allumez les brûleurs supérieurs et assurez-vous qu’ils
sont bien allumés.
AVERTISSEMENT
Ŷ /RUVTXHYRXVXWLOLVH]XQHEDWWHULHGHFXLVLQHHQYHUUHRX
céramique, assurez-vous qu’elle convient à la chaleur
d’une table de cuisson; certaines peuvent éclater en
raison du brusque changement de température.
Ŷ 3RXUPLQLPLVHUODSRVVLELOLWpGHEU€OXUHG¶DOOXPDJHGH
matières inflammables ou de débordement, la poignée
du récipient doit être orientée vers le centre de la table
de cuisson sans se trouver au-dessus des brûleurs
environnants.
Ŷ 1¶XWLOLVH]SDVXQZRNGRWpG¶XQDQQHDXGHVXSSRUW
métallique. L’anneau peut emprisonner la chaleur,
bloquer l’air au brûleur et présenter un risque
d’intoxication au monoxyde de carbone.
Ŷ 1HWHQWH]SDVGHVRXOHYHUODWDEOHGHFXLVVRQ&HOD
peut endommager la tuyauterie de gaz aux brûleurs
occasionnant une fuite de gaz et un risque d’incendie.
Ŷ /RUVGHODGpVDFWLYDWLRQGHODIRQFWLRQ/RFN&RQWURO
(verrouillage de gaz, certains modèles), assurez-vous que
les commandes de surface sont réglées à la position d’arrêt
(OFF). Cela préviendra l’afflux de gaz imprévu aux brûleurs.
Ŷ 1¶XWLOLVH]SDVGHSDSLHUDOXPLQLXPSRXUUHFRXYULUOHVJULOOHV
ou une partie de la table de cuisson. Cela peut mener à
une intoxication au monoxyde de carbone, à la surchauffe
des surfaces de la table de cuisson ou à un incendie.
CONSIGNES DE SÉCURITÉ RELATIVES AU FOUR
AVERTISSEMENT
Ne recouvrez JAMAIS les
fentes, les trous ou les passages dans le bas du
four, ni une grille en entier, avec une matière telle
que du papier d’aluminium ou une doublure de
four. Un tel recouvrement bloque la circulation d’air
dans le four et peut causer un empoisonnement
DXPRQR[\GHGHFDUERQH1HSODFH]MDPDLVGX
papier d’aluminium ou une doublure de four dans le
bas du four. Ces matières peuvent emprisonner la
chaleur et poser un risque de fumée ou d’incendie.
Ŷ 7HQH]YRXVjO¶pFDUWGHODFXLVLQLqUHORUVTXHYRXVRXYUH]
la porte du four. La vapeur ou l’air chauds qui s’échappent
peuvent brûler les mains, la figure et/ou les yeux.
Ŷ $WWHQGH]TXHOHIRXUVRLWUHIURLGLSRXUSODFHUOHVJULOOHV
du four aux emplacements désirés. Si la grille doit être
déplacée alors que le four est chaud, évitez de toucher
aux surfaces chaudes.
Ŷ 1HODLVVH]GHVDUWLFOHVWHOVTXHGXSDSLHUGHVXVWHQVLOHV
ou des aliments dans le four lorsqu’il n’est pas utilisé. Les
articles rangés dans le four peuvent s’enflammer.
Ŷ 1HODLVVH]SDVGHVDUWLFOHVVXUODWDEOHGHFXLVVRQSUqV
de l’orifice de ventilation du four. Les articles peuvent
surchauffer et poser un risque d’incendie ou de brûlure.
Ŷ 1¶XWLOLVH]MDPDLVODIRQFWLRQGHJULOODYHFODSRUWHRXYHUWH
La cuisson au grill avec la porte ouverte n’est pas
autorisée en raison du risque de surchauffe des boutons
de commande.
Ŷ 1HSODFH]MDPDLVG¶XVWHQVLOHVGHSLHUUHVjSL]]DRXGH
cuisson, ni tout type de papier ou de doublure sur le fond
du four. Ces articles peuvent emprisonner la chaleur ou
fondre, endommageant le produit et causant un risque de
décharge électrique, d’enfumage ou d’incendie.
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
6
49-85244
VEUILLEZ LIRE TOUTES LES CONSIGNES AVANT D’UTILISER L’APPAREIL
AVERTISSEMENT
CONSIGNES DE SÉCURITÉ RELATIVES AU FOUR AUTONETTOYANT
La fonction d’autonettoyage élève la température du four à des degrés suffisants pour brûler complètement les souillures
alimentaires dans le four. Suivez les instructions suivantes pour un fonctionnement sûr.
Ŷ 1HWRXFKH]SDVOHVVXUIDFHVSHQGDQWOHSURFHVVXV
d’autonettoyage. Gardez les enfants à l’écart du four
pendant l’autonettoyage. L’omission d’observer ces
instructions peut occasionner des brûlures.
Ŷ $YDQWGHODQFHUOHF\FOHG¶DXWRQHWWR\DJHUHWLUH]OHV
casseroles, les grilles métalliques luisantes et tous les
autres ustensiles du four. Seules les grilles recouvertes
de porcelaine peuvent être laissées dans le four.
Ŷ $YDQWGHODQFHUOHF\FOHG¶DXWRQHWWR\DJHHVVX\H]OD
JUDLVVHHWOHVVRXLOOXUHVDOLPHQWDLUHVGDQVOHIRXU8QH
quantité excessive de graisse peut s’enflammer et causer
des dommages par la fumée.
Ŷ 6LOHPRGHG¶DXWRQHWWR\DJHQHIRQFWLRQQHSDVELHQ
éteignez le four (OFF) et coupez l’alimentation électrique.
Faites réparer l’appareil par un technicien qualifié.
Ŷ 1¶XWLOLVH]SDVGHQHWWR\DQWVSRXUOHIRXU,OIDXW
absolument s’abstenir d’utiliser quelque nettoyant ou
enduit de protection pour four du commerce, que ce soit
dans le four ou autour de n’importe quelle partie de celuici.
Ŷ 1HQHWWR\H]SDVOHMRLQWG¶pWDQFKpLWpGHODSRUWH&HMRLQW
G¶pWDQFKpLWpHVWHVVHQWLHOSRXUJDUDQWLUO¶pWDQFKpLWp,OIDXW
veiller à ne pas frotter, endommager ni déplacer le joint
d’étanchéité.
Ŷ IMPORTANT : Certains oiseaux sont extrêmement
sensibles aux vapeurs dégagées durant le cycle
d’autonettoyage de n’importe quelle cuisinière. Placez les
oiseaux dans une autre pièce, bien ventilée.
CONSIGNES DE SÉCURITÉ
CONSIGNES DE SÉCURITÉ IMPORTANTES
AVERTISSEMENTS DE LA PROPOSITION 65 DE L’ÉTAT DE LA CALIFORNIE
AVERTISSEMENT
Ce produit contient une ou plusieurs substances chimiques reconnues par l’État de Californie pour
causer le cancer, et des anomalies congénitales ou d’autres problèmes liés à la reproduction.
)RXUVpOHFWULTXHVDXWRQHWWR\DQWV/HVIRXUVDXWRQHWWR\DQWVSHXYHQWFDXVHUXQHH[SRVLWLRQGHIDLEOHLQWHQVLWpjFHUWDLQHVGHV
substances de la Proposition 65, y compris au monoxyde de carbone, durant le cycle d’autonettoyage. L’exposition à ces
substances peut être réduite en ouvrant une fenêtre ou en utilisant un ventilateur soufflant ou une hotte.
Comment Retirer le Film Protecteur d’expédition et le Ruban Adhésif d’emballage
Saisissez délicatement un coin du film protecteur d’expédition
avec vos doigts et le décoller lentement de la surface de
l’appareil. N’utilisez pas d’objets pointus pour retirer le film.
Retirez complètement le film avant d’utiliser l’appareil pour la
première fois.
Pour assurer ne pas endommager la finition du produit, la
façon la plus sûre pour enlever le ruban adhésif de l’emballage
sur les nouveaux appareils consiste à appliquer un détergent à
vaisselle liquide à l’aide d’un chiffon doux et à laisser tremper.
REMARQUE : Le ruban adhésif doit être retiré de toutes les
SLqFHV,OQHSRXUUDSDVrWUHUHWLUpDSUqVFXLVVRQ
LISEZ CES INSTRUCTIONS ET RANGEZ-LES SOIGNEUSEMENT
49-85244
7
UTILISATION DE LA CUISINIÈRE : Fonctions de Votre Cuisinière
Fonctions de Votre Cuisinière
Caractéristiques de l’appareil
REMARQUE : Toutes les fonctions ne sont pas présentes sur tous les modèles. L’apparence peut varier d’un modèle à l’autre.
3
6
7
4
6 brûleurs et plaque chauffante
8
9
6 brûleurs au gaz
10
5
Le modèle double four illustré est doté d’un petit four.
Index des fonctions
Page
1
Évents de grill
2
Plaque chauffante
11
3
Grilles de brûleur de table de cuisson
32
4
Bouton de commande d’allumeur
5
Écran de four
6
Mini Bouton
(pour sélectionner les fonctions spéciales PROBE (Sonde),
7,0(5 0LQXWHXU
7
Bouton de sélection de mode
8
Bouton Température du four
9
Minuteur
10
Système d’équilibrage (4)
1
14
9, 26
13
13, 26
13
13
13, 24
—
2
Planche à trancher
en bambou
3
Plinthe
Accessoires optionnels
8
2
1
Protecteur de plaque chauffante
Page
1
Planche à trancher en bambou (sur certains modèles)
33
2
Plinthe
—
3
Protecteur de plaque chauffante (sur certains modèles)
—
49-85244
Allumage Électronique et Rallumage Automatique
La cuisinière est équipée d’un allumeur électronique intégré qui
se substitue à toute flamme de veille.
Les brûleurs de cette cuisinière se rallumeront
automatiquement si la flamme venait à s’éteindre.
Tous les allumeurs émettent une étincelle et produisent un
cliquetis lorsque l’un des brûleurs est activé. Ne touchez aucun
des brûleurs lorsque les allumeurs émettent le cliquetis.
,OVHSHXWTXHOHVEU€OHXUVpPHWWHQWSDUIRLVXQHpWLQFHOOH
lorsqu’un coup de vent ou un courant d’air déplace la flamme
en l’éloignant du capteur de flamme du brûleur.
En cas de coupure de courant, vous pouvez allumer les
brûleurs de votre table de cuisson à l’aide d’une allumette.
Approchez une allumette allumée au brûleur puis tournez le
bouton en le positionnant sur LOW (Feu doux). Soyez très
prudent lorsque vous allumez les brûleurs en utilisant
cette méthode.
Ne tentez pas de faire chauffer la plaque chauffante pendant
une panne de courant. L’arrivée de gaz de ces brûleurs sera
automatiquement coupée pendant une coupure de courant.
Allumage du Brûleur
Appuyez sur le bouton de réglage puis tournez-le dans le
sens inverse des aiguilles d’une montre pour le positionner
sur LITE (Allumage).
Après avoir allumé le brûleur, tournez le bouton pour régler
la taille de la flamme.
Pour éteindre un brûleur, tournez à fond le bouton, dans
le sens des aiguilles d’une montre jusqu’à le positionner sur
OFF (Arrêt).
Ŷ Ne laissez pas un brûleur allumé pendant trop longtemps si
aucun ustensile n’est placé sur la grille. Les finitions
de la grille pourraient s’effriter si aucun ustensile n’absorbe
la chaleur.
AVERTISSEMENT
Il faut utiliser les brûleurs
uniquement lorsqu’ils sont recouverts d’un récipient
(casserole, poêlon, etc.) de cuisson. Les flammes de
brûleur non recouvertes par un ustensile de cuisson
présentent un risque d’incendie ou d’inflammation de
YrWHPHQW1HODLVVH]MDPDLVOHVIODPPHVGpSDVVHUGHV
côtés du récipient de cuisson. L’omission d’observer cette
directive peut occasionner des blessures graves.
Brûleurs Double Flamme Superposés
Tous les brûleurs de votre cuisinière possèdent deux rangées
de flammes superposées, les brûleurs double flamme
disposent d’une flamme réduite (feu doux) et d’une flamme
plus importante (feu principal).
Lorsqu’un brûleur est activé, la flamme (feu doux) se maintient
toujours allumée.
)HXGRX[RXPLMRWDJH
Le brûleur à deux rangées de flammes a été conçu pour fournir
un éventail de réglages de puissance qui inclut le feu doux
ou mijotage. Selon le type et la quantité de nourriture et de la
taille de la casserole, la flamme peut être réglée pour s’ajuster
à vos besoins spécifiques. Le réglage le plus bas n’utilise que
la flamme réduite et peut maintenir les aliments délicats à une
température sûre de 140°F (60°C).
Cuisson :
Les réglages allant de LO (0) à X-HI (max) utilisent les
IODPPHVUpGXLWHVDLQVLTXHOHVIODPPHVSULQFLSDOHV8WLOLVH]
les réglages LO (0) et HI (Fort) pour tous types de cuisson.
8WLOLVH]+,RX;+, 5pJODJHOHSOXVpOHYp ORUVTXHYRXVXWLOLVH]
un ustensile d’un diamètre plus important.
X-HI et HI sont des paramètres de cuisson à haute
température et servent à frire les aliments rapidement et à
bouillir de grandes quantités d’eau.
Feu doux
UTILISATION DE LA CUISINIÈRE : Commandes de la Table de Cuisson
Commandes de la Table de Cuisson
Feu principal
Feu doux
49-85244
9
UTILISATION DE LA CUISINIÈRE : Cuisson en Surface
10
Cuisson en Surface
Comment Sélectionner la Taille de la Flamme
Observez la flamme et non pas le bouton lorsque vous
augmentez ou réduisez la puissance.
La taille de la flamme sur un brûleur à gaz doit correspondre à
l’ustensile que vous utilisez.
32850$1,38/(5(17287(6e&85,7e/¶867(16,/(
1(/$,66(=-$0$,6/$)/$00('e3$66(5/(6%25'6
'(/¶867(16,/(/HVIODPPHVGpSDVVDQWOHVERUGVGH
l’ustensile ne réchaufferont pas vos aliments plus rapidement
et peuvent être dangereuses.
Pour davantage de stabilité, il est recommandé d’utiliser des
ustensiles dont le diamètre minimum est de 15 cm (6 po). Pour
les paramètres HI et X-HI, utilisez un diamètre plus important.
Cuisiner au Wok
Les grilles des brûleurs ont été spécialement conçues pour être
utilisées sur deux faces. La face plate convient aux ustensiles
jIRQGSODW PDUPLWHVFDVVHUROHVSRrOHVjIULUHHWZRNVjIRQG
SODW DORUVTXHOHF{WpZRNHVWFRQoXSRXUPDLQWHQLUWRXWHXQH
YDULpWpGHZRNVjIRQGERPEpVDQVDYRLUjXWLOLVHUXQVXSSRUW
en anneau.
Pour plus de commodité, il est recommandé d’utiliser un
brûleur frontal lorsque vous cuisinez à l’aide d’un wok.
)DFHGXZRN
Face plate
Le brûleur frontal situé au centre est recommandé pour
FXLVLQHUjO¶DLGHG¶XQZRNVXUOHVFXLVLQLqUHVjEU€OHXUVGH
po (91 cm) et de 48 po (121 cm).
1¶XWLOLVH]SDVXQDQQHDXGHVXSSRUWGHZRN3ODFHUXQWHO
anneau au-dessus d’un brûleur ou d’une grille peut nuire au
bon fonctionnement du brûleur, ce qui augmentera le niveau
de monoxyde de carbone au-dessus des valeurs admissibles.
Cela peut présenter un risque pour votre santé.
49-85244
Précautions de Sécurité de la Palaque Chauffante, Réglage de la Hauteur
(sur certains modèles)
AVERTISSEMENT
Risque d’incendie
Ŷ 8
VH]GHSUXGHQFHORUVGHODFXLVVRQG¶DOLPHQWVJUDLVVHX[/¶pFRXOHPHQWGHJUDLVVHSHXWSURYRTXHUXQLQFHQGLH
Ŷ 1HSODFH]MDPDLVXQDUWLFOHTXHOFRQTXHVXUODSODTXHFKDXIIDQWHORUVTXHFHOOHFLQ¶HVWSDVXWLOLVpH/DFKDOHXUGHV
brûleurs environnants peut chauffer la plaque chauffante et provoquer un incendie.
Ŷ 3
ODFH]HWHQOHYH]ODSODTXHFKDXIIDQWHVHXOHPHQWORUVTX¶HOOHHVWUHIURLGLHHWTXHWRXVOHVEU€OHXUVGHVXUIDFHVRQW
éteints (OFF).
Retirez le couvercle en métal et la planche à trancher avant
d’allumer la plaque chauffante.
Conduit
d’aération
de la plaque
Les éléments de la plaque chauffante ne doivent pas être
retirés lors de son entretien.
8QHIRLVTXHOHGLVSRVLWLIHVWSUrWYRXVSRXYH]UpJOHUOD
hauteur. Retirez le conduit d’aération en le tirant dessus à
l’horizontale. Veillez à ne pas rayer les surfaces en acier
inoxydable alentour lorsque vous retirez le couvercle du
conduit d’aération.
Les deux vis intérieures sont des vis à crampons qui servent à
maintenir la plaque en place. Desserrez ces deux vis avant de
procéder au réglage de la hauteur de la plaque. Ne retirez pas
ces deux vis.
Les deux vis extérieures sont des vis de réglage de hauteur.
Ne retirez pas ces deux vis. Vous pouvez les desserrer pour
régler la plaque ou bien pour créer une légère inclinaison par
laquelle s’écouleront les huiles et les graisses lorsque vous
serez en train de cuisiner. Après les premières utilisations, vous
serez en mesure de déterminer l’inclinaison la plus adéquate
selon les aliments que vous préparez ou selon vos préférences.
Vis de réglage
Vis à crampons
Après avoir réglé la hauteur de la plaque, resserrez les vis
à crampons pour fixer la plaque dans sa position de départ.
Serrez les vis à la main, ne pas serrer excessivement.
Utiliser la Plaque Chauffante
Nettoyez la plaque chauffante soigneusement avec de
l’eau savonneuse avant la première utilisation et après les
utilisations subséquentes. La surface de la plaque chauffante
est fabriquée avec de l’acier inoxydable de type 304 résistant,
à polissage de haute précision, doublé d’une plaque en
aluminium pour distribuer la chaleur uniformément. Appliquez
un léger film d’huile de cuisson sur la surface de la plaque
chauffante afin d’empêcher les aliments de coller.
Pour chauffer la plaque chauffante, poussez et tournez le bouton
de commande jusqu’au réglage de température désiré. La lampe
du cadran va s’allumer pour indiquer que la commande du
thermostat fonctionne. La plaque chauffante est commandée par
thermostat et peut se régler à n’importe quelle température entre
200 ºF et 450 ºF (93 ºC à 232 ºC). Laissez la grille se réchauffer
durant 10 minutes avant d’y placer des aliments.
REMARQUE : Contrairement aux brûleurs de surface qui
utilisent des allumeurs à étincelle, la plaque chauffante utilise
XQGLVSRVLWLI*OR%DUSRXUO¶DOOXPDJH8QHIRLVOHERXWRQGH
commande tourné à la température choisie, il faut environ 45
secondes pour que le gaz alimente l’allumeur et le brûleur de
la plaque chauffante.
49-85244
Aliment
Température
Crêpes
375ºF (190°C)
%LIWHFNVKDFKpV
400ºF (204°C)
Bacon*
400ºF (204°C)
Fromage fondu
350ºF (176°C)
Œufs
275ºF (135°C°)
UTILISATION DE LA CUISINIÈRE : Cuisson en Surface
Cuisson en Surface (Suite)
*REMARQUE : Disposez le bacon sur une plaque froide.
Ne pas préchauffer.
11
UTILISATION DE LA CUISINIÈRE : Fonctions et Caractéristiques de Votre Four
12
Fonctions et Caractéristiques de Votre Four
Caractéristiques de l’appareil
REMARQUE : Toutes les fonctions ne sont pas présentes sur tous les modèles.
7
1
2
11
8
3
Grille de four extensible
4
9
5
12
6
10
Sonde de température
Index des fonctions
Page
1
Loquet de porte de four automatique
—
2
Éléments du grill (2)
26
3
Lampes halogènes du four
29
4
Supports de grille de four
— 5 positions dans le grand four
— 4 positions dans le petit four
5
Élément de cuisson (1) (sous le fond du four)
26
6
-RLQWGHSRUWHGHIRXU
30
16, 20
7
-RLQWGHFDGUHGXIRXU
30
8
Prise de sonde de température
— côté droit dans le grand four
— côté gauche dans le petit four
21
9
Ventilateur de convection
10
Porte de four
11
Grille(s) de four extensible(s)
— 1 dans le grand four
— 2 dans le petit four
12
Sonde de température
19, 20
28, 30
15, 16, 20, 27
21, 28
REMARQUE : Les modèles équipés d’un petit four possèdent les mêmes fonctions que
le grand four.
2
1
Barquette et grille
Grille de rôtissage
Accessoires optionnels
Page
1
Barquette et grille
19, 26
2
Grille de rôtissage
19, 26
49-85244
Fonctions du Panneau de Commande et du Minuteur
5
4
3
1
2
1 Bouton de sélection de mode du four –
7RXUQH]OHFHUFOHH[WpULHXUSRXUVpOHFWLRQQHU PROOF (Levée) – Maintient un environnement chaud utile
pour les aliments à base de levure.
BAKE (Cuisson) – Sélectionnez pour la cuisson classique.
CONV BAKE (Cuisson par convection) ±8WLOLVH]SRXUOD
cuisson par convection.
CONV ROAST (Rôtissage par convection) ±8WLOLVH]SRXU
le rôtissage par convection.
BROIL (Cuisson au grill – Sélectionnez pour griller
CLEAN (Nettoyage) – Sélectionnez pour le nettoyage
automatique. Voir la section Four en mode nettoyage
automatique.
2 Bouton Température –7RXUQH]SRXUVpOHFWLRQQHU Le bouton de sélection de mode du four (1) ET le bouton
Température (2) doivent être réglés simultanément sur l’une
GHVFRPELQDLVRQVYDOLGHVFLGHVVRXV Bouton de sélection de mode
Bouton Température
BAKE (Cuisson)
175º–550°F (80°–290°C)
CONV BAKE (Par convection)
175º–550°F (80°–290°C)
&219(&7,2152$67
(Convect./rôtissage)
175º–550°F (80°–290°C)
&219(&7,21%52,/
(Convect./Grill)
+,*+RX/2:%52,/
%52,// *ULOO
+,*+RX/2:%52,/
CLEAN (Nettoyage)
PROOF (Levée)
CLEAN
—
Températures de 175°F (80°C) à 550°F (290°C).
Pour désactiver une fonction, tournez le bouton de sélection
de mode du four ou le bouton Température sur OFF.
LOW BROIL (Cuisson au grill légère)±8QHWHPSpUDWXUH
de cuisson au grill inférieure est automatiquement réglée.
Pour annuler PROOF (Levée), tournez le bouton de sélection
de mode sur OFF.
HIGH BROIL (Cuisson au grill forte)±8QHWHPSpUDWXUH
de cuisson au grill supérieure est automatiquement réglée.
CLEAN (Nettoyage) – La température
de nettoyage automatique est automatiquement réglée.
UTILISATION DE LA CUISINIÈRE : Commande du Four
Commande du Four
3 Mini Bouton – Tournez pour sélectionner et appuyez
dessus pour saisir les paramètres PROBE (Sonde) ou
7,0(5 0LQXWHXU 3RXUDMXVWHUpJDOHPHQWODGXUpHGH
CLEAN (Nettoyage).
4 Bouton Minuteur – Appuyez dessus pour
sélectionner la fonction minuteur de cuisson. Le minuteur ne
commande pas les opérations du four.
5 Écran du four –,ODIILFKHOHVSDUDPqWUHVGXIRXUWHOOHV
que les températures du four et de la sonde et le minuteur
de cuisson.
49-85244
13
UTILISATION DE LA CUISINIÈRE : Conseils Pour Cuisson
Conseils Pour Cuisson
Évents de Four Arrière
8QHYHQWLODWHXULQWHUQHGHUHIURLGLVVHPHQWV¶HQFOHQFKH
quelque soit le mode du four. L’air chaud du four est évacué à
travers les évents situés à l’arrière de la table de cuisson.
Ne bloquez pas
les évents arrière
Veillez à ce que le flux d’air des évents arrière ne soit pas
obstrué par les ustensiles de cuisson ou des serviettes.
Papier d’aluminium et Doublures de Four
ATTENTION
Abstenez-vous d’utiliser tout type de papier
ou de doublure dans le fond du four. Ces articles peuvent
emprisonner la chaleur ou fondre, endommageant le produit
et causant un risque de décharge électrique, d’enfumage ou
d’incendie. Les dommages résultant de l’usage inapproprié de
ces articles ne sont pas couverts par la garantie du produit.
Pour protéger des débordements, une feuille d’aluminium peut
être placée sur une grille inférieure se trouvant à plusieurs
centimètres en dessous des aliments. N’utilisez pas plus de
papier d’aluminium que nécessaire et ne recouvrez jamais la
totalité d’une grille avec le papier. Laissez une distance d’au
moins 3,8 cm (1 1/2 po) entre le papier et les parois du four
pour permettre une bonne distribution de chaleur.
Feuille d’aluminium
pour recueillir les gouttes
REMARQUE :/¶LQVFULSWLRQ³12)2,/2129(1%27720´
(Pas de feuille d’aluminium dans le fond du four) est
émaillée dans le bas de la cavité du four et elle résistera aux
températures élevées de l’autonettoyage. Ne tentez pas de
peler ou gratter cette inscription.
Placer le Moule
Pour une cuisson homogène et un dorage réussi, vous devez prévoir un espace suffisant pour la circulation de l’air dans le
four. La cuisson sera plus réussie si les plateaux de cuisson sont placés le plus au centre possible plutôt que sur l’avant ou
l’arrière du four.
Plateaux ou Feuilles de Cuisson
8WLOLVH]OHVERQVSODWHDX[GHFXLVVRQ/HW\SHGHILQLWLRQGXSODWHDXDJLWVXUO¶LQWHQVLWpGXGRUDJH
Ŷ Des plateaux foncés, ternes, rigides absorbent la chaleur,
permettant d’obtenir une croûte plus dorée, plus croustillante.
8WLOLVH]FHW\SHGHSODWHDXSRXUOHVWDUWHV
Ŷ Les plats de cuisson en verre absorbent également la
chaleur. Lorsque vous utilisez ce type de plat, vous devrez
baisser la température de 25°F (4 °C).
Ŷ Des moules lisses, lumineux et clairs renvoient la chaleur,
SRXUXQGRUDJHSOXVOpJHUHWSOXVUDIILQp8WLOLVH]FHW\SHGH
moule ou de feuille pour les gâteaux et les biscuits.
Préchauffage
Laissez le four préchauffer avant de placer les plats à l’intérieur
du four. Le préchauffage est essentiel pour une bonne cuisson
des gâteaux, des biscuits, des pâtisseries et du pain.
14
REMARQUE : La présence de condensation ou de brouillard
sur l’intérieur de la vitre de la porte du four est normale durant
le préchauffage du four et elle disparaît habituellement à la fin
du cycle de préchauffage.
49-85244
Grilles de Cuisson Extensibles
ATTENTION
Afin déviter les brûlures éventuelles, placez
les grilles dans la bonne position avant d’allumer le four.
La position de la grille dépendra du type d’aliment et du dorage
souhaité.
Les grilles diposent d’un cadre qui s’emboîte dans les supports
GHVGHX[F{WpV8QHIRLVOHFDGUHHQFDVWUpIDLWHVWRXMRXUV
glisser la grille par son rail supérieur, sur la position de butée
de son extension pour placer ou retirer les plats.
Retirer et Replacer les Grilles du Four
Pour retirer une grille :
Pour replacer une grille :
1. Veillez à ce que la grille soit introduite jusqu’à atteindre le
fond du four.
1. Placez les verrous de la grille arrière sur les supports
(cinq positions de cuisson sont disponibles, position
supérieure comprise).
2. Saisissez la grille par son rail avant supérieur et par le rail
arrière inférieur et soulevez-la pour débloquer les verrous
avant de ses supports.
Soulevez pour
débloquer les
verrous du support
Rail avant
supérieur
Rail
avant
inférieur
Verrou de grille avant
3. En tenant fermement les rails avant supérieur et inférieur,
tirez la grille vers vous et retirez-la du four.
Rail avant
supérieur
Rail avant
inférieur
2. Faites glisser complètement la grille jusqu’à ce que le verrous
de la grille arrière avant soient fixés sur les supports, et
appuyez sur les verrous de la plaque avant sur les supports.
Faites coulisser la grille au
maximum et poussez pour
verrouiller les verrous de grille
avant sur les supports avant
UTILISATION DE LA CUISINIÈRE : Grilles du Four
Grilles du Four
Verrou
de grille
avant
3. Faites glisser la grille vers vous afin de vérifier si elle a été
correctement introduite.
49-85244
15
UTILISATION DE LA CUISINIÈRE : Cuisson
Cuisson
Comment Régler le Four Pour la Cuisson
Bouton de sélection
de mode du four
(Extérieur)
Bouton température
GXIRXU ,QWpULHXU
1. Tournez le bouton de sélection de mode du four sur BAKE
(Cuisson).
E
2. Avec le bouton Température, réglez la température
souhaitée, en incréments de 25 °F (4 °C), de 175 °F (80 °C)
à 550 °F (290 °C).
D
C
Le four commencera alors à préchauffer. L’affichage
de la température commencera à 100ºF (37°C), cette
température reste affichée jusqu’à ce que le four dépasse
cette température. À partir de là, l’écran affichera la
température réelle.
Les lampes internes s’allumeront et resteront allumées jusqu’à
ce que le four soit éteint. Le ventilateur de convection du four
s’enclenchera provisoirement pendant le préchauffage. La
commande émettra un bip lorsque le four est préchauffé et le plat
peut alors être placé dans le four.
3. Tournez le bouton de sélection de mode du four et le bouton
Température sur OFF (arrêt) une fois la cuisson terminée.
REMARQUE :8QYHQWLODWHXUGHUHIURLGLVVHPHQWV¶HQFOHQFKHUD
pour refroidir les composants internes. C’est normal, et le
ventilateur continuera probablement de fonctionner même lorsque
le four est éteint.
8WLOLVH]ODVRQGHGHWHPSpUDWXUHORUVTX¶LOHVWLPSRUWDQWGH
GLVSRVHUG¶XQWHPSpUDWXUHLQWHUQHSUpFLVH9RLU8WLOLVHUODVRQGH
E
D
C
B
A
B
A
Ou, placez quatre moules sur une grille en utilisant la position
centrale C. Placez les moules en laissant un espace minimal de
3,8 cm (1-1/2 po) autour d’eux.
Le four possède 5 positions de grille de cuisson. Voir la
section Grilles de cuisson extensibles pour en savoir plus sur
l’utilisation, la réinstallation et la désinstallation des grilles.
La cuisinière double four est équipée d’un petit four doté de 4
positions de grille. La position de grille C n’est pas valable pour
le petit four.
Type d’aliment
Position de grille
(petit four)
Gâteau des anges
A
A
Biscuits ou muffins
C
A ou B
&RRNLHV
C
B
Carrés au chocolat
B
B
Gâteau à 2 couches
B
B
Gâteau à 4 couches
C
—
Galettes ou gâteaux 9 x 13
B ou C
B
Pains rapides
C
B
Gâteau cuit ou quatre-quarts
C
B
Tourtes ou pâtes à tarte
Lors de la cuisson simultanée de gâteaux à 4 étages,
utilisez les grilles B et D. Ne placez pas un moule à gâteau
directement au-dessus d’un autre au moment de la disposition.
Position de grille
(grand four)
B
A
Tartes surgelées
B ou C
—
Casseroles
B ou C
B
C
B
Pizza
Les positions de grille de cuisson suggérées ne sont fournies qu’à titre indicatif.
Essayez ces positions pour des aliments spécifiques ou vos préférences personnelles.
16
49-85244
Introduction à la Cuisson au Grill
,OH[LVWHPRGHVGHFXLVVRQDXJULOO &XLVVRQDXJULOORX
Cuisson au grill par convection Sélectionnez HI (Fort) ou LO
(Léger), quelque soit le mode.
Ŷ Le paramètre LO peut être utilisé pour dorer certains
aliments et pour les cuire avec parcimonie, à savoir les filets
de poisson, le filet de porc et le rôti de bœuf.
Ŷ Le paramètre HI peut être utilisé pour contenir les jus ou
appliquer si nécessaire une cuisson ou une carbonisation
LQWHQVHSRXUOHVELIWHFNVKDFKpVOHVOpJXPHVU{WLVOHV
poivrons, les aubergines, le maïs, les légumes découpés,
NHEDEVHWOHVYLDQGHVWUqVILQHVWHOOHVTXHOHVF{WHOHWWHVGH
SRUFIXPpOHELIWHFNGHIODQFURXOpHWOHSRXOHW
Cuisson au grill par convection :
8WLOLVH]OHYHQWLODWHXUGHFRQYHFWLRQSRXUXQHFXLVVRQSOXV
homogène.
Comment Régler le Four Pour la Cuisson au Grill
Bouton de sélection
de mode du four
(Extérieur)
Bouton
température
du four
,QWpULHXU
1. Tournez le bouton de sélection de mode du four sur BROIL
(Cuisson au grill) ou CONV BROIL (Cuisson au grill par
convection).
2. Tournez le bouton Température sur LO BROIL (Cuisson au
grill légère) ou HI BROIL (Cuisson au grill forte). LO ou HI
apparaîtra sur l’écran.
REMARQUE : Lancez la cuisson au grill avec la porte fermée.
Si la porte est ouverte, l’écran va faire défiler « CLOSE door »
)(50(=ODSRUWH HWOHVpOpPHQWVV¶DOOXPHURQWMXVTX¶jFHTXH
la porte soit fermée.
Les lampes internes du four s’allumeront et resteront allumées
jusqu’à ce que le four soit éteint.
Le ventilateur de convection s’allumera lorsque CONV BROIL
(Cuisson au grill par convection) a été sélectionné.
La cuisson au grill
avec la porte ouverte
est interdite.
UTILISATION DE LA CUISINIÈRE : Cuisson au Grill
Cuisson au Grill
REMARQUE : La cuisson au grill ne fonctionnera pas si la
sonde de température est branchée. Ne laissez jamais la sonde
à l’intérieur du four pendant un programme de cuisson au grill.
8QHIRLVODFXLVVRQWHUPLQpHWRXUQH]OHERXWRQGHVpOHFWLRQ
de mode de four et le bouton Température sur OFF.
REMARQUE :8QYHQWLODWHXUGHUHIURLGLVVHPHQWV¶HQFOHQFKHUD
pour refroidir les composants internes. C’est normal, et le
ventilateur continuera de fonctionner même après que le four
a été éteint.
La rôtissoire ne doit pas être préchauffée pour la plupart des
cuissons au grill. Toutefois, les aliments dont la cuisson est
rapide, tels que les filets fins de viande ou de poisson doivent
probablement être préchauffés pendant environ 5 minutes pour
laisser dorer les aliments. Ne retournez la viande qu’une fois
pendant la cuisson au grill.
49-85244
17
UTILISATION DE LA CUISINIÈRE : Cuisson au Grill
18
Cuisson au Grill (Suite)
Guide de Cuisson au Grill
Les positions de grille de cuisson suggérées ne sont fournies
qu’à titre indicatif. Procédez à des essais avec ces positions
pour des aliments spécifiques et vos préférence personnelle.
E
D
La taille, le poids, l’épaisseur, la température de début de
cuisson et le degré de cuisson de votre choix auront une
incidence sur la durée de cuisson au grill. Ce guide prend des
viandes à température de réfrigérateur comme exemples.
C
B
REMARQUE : En général, des positions de grilles hautes procurent
un grillage externe plus foncé et les positions basses, un degré de
cuisson plus élevé.
Aliment
Position de grille
Paramètre de cuisson
Préchauffage
Grill
Boeuf haché
D
+,
—
Poulet (poitrine non dessossée)
B
+,RX/2
—
Boulangerie Pain (pain grillé)
D
+,RX/2
—
Poisson Filets (1 livre) Épaisseur
2,5–1,2 cm (1/4–1/2 po)
D
LO
5 Minutes
Kebabs (5 broches)
D
LO
5 Minutes
Légumes émincés
D
LO
5 Minutes
Grill Par Convection
Le ministère américain à l’Agriculture déclare « Le boeuf saignant est populaire, mais vous devriez savoir que si vous
UpJOH]VDFXLVVRQVXUƒ)OHVRUJDQLVPHVQRFLIVSRXUOHVDOLPHQWVULVTXHQWGHVXUYLYUHjODFXLVVRQ ª6RXUFH 6DIH)RRG%RRN<RXU.LWFKHQ*XLGH86'$5HY-XLQ
Feuille d’aluminium
Vous pouvez utiliser une feuille d’aluminium pour aligner la
barquette sur la grille de cuisson. Vous devez toutefois mouler
la barquette sur la grille et faire des incisions qui épousent les
fentes de la grille.
49-85244
Introduction à la Cuisson par Convection
Le ventilateur bidirectionnel du système de convection fait une
pause périodiquement, puis change de direction pour mieux
distribuer l’air chaud dans l’ensemble du four. Par conséquent,
les aliments sont cuits et dorés de façon homogène, souvent
en moins de temps que pour la cuisson par convection.
REMARQUE : Le ventilateur de convection s’éteint lorsque la
porte du four est ouverte.
Ustensiles pour Cuisson par Convection
Avant d’utiliser le four à convection, veillez à ce que les ustensiles
laissent circuler l’air dans le four. Si vous utilisez plusieurs moules
veillez à les espacer suffisamment. Veillez à ce qu’elles ne se
touchent pas ou qu’elles ne touchent pas les parois du four.
Les ustensiles utilisés dans la BAKE (Cuisson) standard
fonctionneront également en mode CONV BAKE (Cuisson par
convection). Voir la section consacrée aux Conseils pour cuisson.
,OHVWUHFRPPDQGpORUVTXHYRXVFXLVH]DXIRXUGHVELVFXLWV
d’utiliser une feuille à biscuit plate plutôt que des moules à
rebord. Pour les plats tels que le poulet au four, utilisez un
moule à rebords bas. L’air chaud ne peut circuler correctement
autour des aliments avec
un moule à rebords hauts.
Adapter les Recettes
Vous pouvez utiliser vos recettes préférées dans le four à
convection.
Lors de la cuisson par convection, il peut s’avérer nécessaire
de baisser la température de 25°F (4°C) ou d’ajuster le temps
GHFXLVVRQ,OQ¶HVWSDVQpFHVVDLUHGHUpJOHUODWHPSpUDWXUHHQ
mode CONV ROAST.
Des instructions figurant sur l’emballage pour les casseroles
surgelées ou les plats principaux ont été conçues pour les
fours commerciaux à convection. Pour des résultats optimaux,
préchauffez le four et utilisez la température mentionnée sur
l’emballage.
Conseils pour Rôtissage par Convection
8WLOLVH]OHPRXOHjFXLVVRQODJULOOHHWODJULOOHGHU{WLVVDJHSRXU
de meilleurs résultats. Si vous utilisez la grille, le dorage sur la
partie inférieure de la viande et de la volaille sera plus réussi.
Accessoires optionnels
Grille de rôtissage
1. Placez le grille du four sur une position basse (A).
2. Placez la grille sur le moule/plat et placez la grille de
rôtissage dessus.
3. Placez la viande sur la grille de rôtissage.
Grille
Moule à cuisson
49-85244
UTILISATION DE LA CUISINIÈRE : Cuisson ou Rôtissage par Convection
Cuisson ou Rôtissage par Convection
19
UTILISATION DE LA CUISINIÈRE : Cuisson ou Rôtissage par Convection
20
Cuisson ou Rôtissage par Convection (Suite)
Comment Régler le Four Sur la Cuisson ou le Rôtissage par Convection
Bouton de sélection
de mode du four
(extérieur)
Bouton Température
du four (intérieur)
La cuisson par convection s’avère idéale pour dorer les
plats cuits au four sur une ou plusieurs grilles. Sélectionnez
Convection Roast (Rôti par convection) pour rôtir de grands et
tendres morceaux de viande découverts.
Si configuré sur CONV BAKE ou CONV ROAST, les éléments
arrière de convection et le ventilateur fonctionnent lorsque le
four chauffe.
1. Tournez le bouton de sélection de mode du four sur CONV
BAKE ou CONV ROAST.
8WLOLVH]OHERXWRQ7HPSpUDWXUHSRXUVpOHFWLRQQHUOD
température souhaitée, en incréments de 25°F (4°C), de
175°F (80°C) à 550°F (290°C).
Le four commencera alors à préchauffer. L’affichage de la
température commencera à 100°F et ne changera pas tant
que le four ne dépasse pas cette température. A partir de là,
l’écran affichera la température réelle.
Type de plats
Muffins et quatre-quarts
(plusieurs grilles)
Biscuits (plusieurs grilles)
Position de grille
(grand four)
Position de grille
(petit four)
B et D
B et D
A, C et E
B et D
+RUVG¶RHXYUHVXUJHOp
C
—
+RUVG¶RHXYUHVXUJHOp
(plusieurs grilles)
A, C et E
—
Rôtis (gros morceaux de viande)
A
B
Dinde ou poulet entier
A
B
Les lampes internes s’allumeront et resteront allumées
jusqu’à ce le four soit éteint. Le four à convection s’allumera
pendant le préchauffage. La commande émettra un bip pour
signaler que le four est préchauffé et que les plats peuvent
être placés dans le four.
3. Tournez le bouton de sélection de mode et le bouton
Température sur OFF une fois la cuisson par convection
terminée.
REMARQUE :8QYHQWLODWHXUV¶HQFOHQFKHUDSRXUUHIURLGLUOHV
composants internes. C’est normal, le ventilateur continuera à
fonctionner même si le four est éteint.
8WLOLVH]ODVRQGHjWHPSpUDWXUHORUVTXHODWHPSpUDWXUHLQWHUQH
HVWpOHYpH9RLU8WLOLVHUODVRQGH
E
D
C
B
A
Les positions de grille de cuisson suggérées ne sont fournies qu’à titre
indicatif. Essayez ces positions pour des aliments spécifiques ou selon
vos préférences personnelles.
Le four possède 5 positions de cuisson. Voir la section Grille
de four extensible pour en savoir plus sur la manière d’utiliser,
de retirer et de replacer les grilles.
La cuisinière double four est équipé d’un petit four doté de 4
positions de cuisson. La position C ne correspond pas à la
position du petit four.
49-85244
Comment Utiliser la Sonde Avec la Cuisson, la Cuisson par Convection et le Rôtissage par
Convection
AVERTISSEMENT
La consommation d’aliments insuffisamment cuits pose un risque de maladies d’origine
alimentaire. Utilisez la sonde selon les instructions suivantes pour faire en sorte que toutes les parties des
aliments atteignent les températures sécuritaires de cuisson minimales. On peut trouver des recommandations de
températures sécuritaires de cuisson minimales sur les sites www.foodsafety.gov ou www.IsItDoneYet.gov.
ATTENTION
Le terme PROBE (Sonde) et SET (Régler) clignoteront sur
8WLOLVH]GHVJDQWVSRXULQWURGXLUHRXUHWLUHU
la sonde du four chaud. Les zones autour de l’entrée de la
sonde peuvent être brûlantes.
Pour de nombreux plats, notamment la volaille et les rôtis,
la température interne des aliments est le meilleur test pour
le degré de cuisson. La sonde de température détecte la
température des aliments cuits pour ajuster le degré de
cuisson.
Prise
de la sonde
La sonde peut être utilisée avec BAKE (Cuisson), CONV BAKE
(Cuisson par convection) et CONV ROAST (Rôtissage par
convection).
,QWURGXLVH]ODSRLQWHGHODVRQGHGDQVODSDUWLHODSOXV
épaisse de la viande.
2. Placez le plateau sur la position souhaitée.
3. Réglez les commandes du four. Tournez le bouton de
selection sur CONV BAKE (Cuisson par convection),
CONV ROAST (Rôtissage par convection) ou BAKE
(Cuisson). Tournez le bouton Température sur la
température souhaitée en incréments de 25°F (4°C), de
175°F (80°C) à 550°F (290°C). Faites au besoin préchauffer
le four.
l’écran jusqu’à ce que la température ait été sélectionnée. Si
aucune température n’est préréglée, la sonde fonctionnera
sur 100°F (38°C) par défaut. Si le four n’a pas été préchauffé,
l’écran affichera LO.
La température interne des aliments peut être réglée sur un
minimum de 100°F (38°C) et jusqu’à un maximum de 200°F
(76°C) .
Le four et les lampes du four s’allumeront et resteront
allumées jusqu’à ce que le four soit éteint.
Lorsque les aliments atteignent la température interne définie,
l’écran émettra un bip. Pour arrêter le bip de rappel, tournez
le bouton de sélection de mode et le bouton Température sur
2))8WLOLVH]OHVSRLJQpHVSRXUUHWLUHUODVRQGHGHODSULVHGH
sortie du four.
8
WLOLVH]GHVSRLJQpHVSRXUSODFHUOHVSODWVGDQVOHIRXU
FKDXG,QVpUH]ODILFKHGDQVODSULVHHWDVVXUH]YRXVGH
l’avoir introduite entièrement. Fermez la porte du four.
Pour changer la température interne à tout instant pendant la
cuisson, appuyez sur le mini bouton et tournez pour ajuster la
température. Appuyez sur le mini bouton pour faire votre choix.
UTILISATION DE LA CUISINIÈRE : Sonde
Sonde
5. Tournez le mini bouton pour trouver la température interne
des aliments. Appuyez sur le mini bouton pour sélectionner
cette température.
Utiliser la Sonde
N’utilisez que la sonde bleue livrée avec l’appareil.
8WLOLVH]OHVSRLJQpHVGHODVRQGHHWGHODILFKHSRXUOHVLQVpUHU
et les retirer de la viande et de la prise de sortie du four.
Câble
Fiche
Ŷ Pour ne pas endommager la sonde, n’utilisez pas de pinces
pour retirer le câble.
Ŷ Afin de ne pas casser la sonde, veillez à ce que les aliments
aient été décongelés avant d’introduire la sonde.
Ŷ Afin d’éviter les brûlures, enfilez un gant pour retirer la fiche;
les surfaces internes du four sont brûlantes.
Ŷ Ne laissez jamais la sonde dans le four pendant la cuisson
au grill ou un cycle d’autonettoyage.
Sonde
Poignées
La sonde de température est dotée d’une sonde en
forme de brochette sur une extrémité et une prise sur
l’autre qui s’introduit dans la prise de sortie du four.
Ŷ Ne rangez pas la sonde dans le four.
49-85244
21
UTILISATION DE LA CUISINIÈRE : Sonde / Levée
Sonde (Suite)
Insertion Adequate de la Sonde
Ŷ Mesurez la distance par rapport au centre d’un rôti en posant
la sonde de température sur la viande. A l’aide de votre doigt
et de l’index, marquez l’emplacement de contact entre la
viande et la sonde.
Ŷ,QVpUH]ODVRQGHMXVTX¶DXSRLQWPDUTXpGHYRWUHGRLJW/D
pointe de la sonde doit être placée au coeur de la viande.
Levée
Comment Régler le Four Sur la Levée
La fonction test maintient un environnement chaud utile pour la
pâte levée à la levure.
1. Tournez le bouton de sélection de mode sur PROOF.
L’écran affichera le message « PrF ». Le mode PROOF
(Levée) ne fonctionnera pas lorsque la temperature du four
est supérieure à 125°F (51°C). Le message « too hot »
(trop chaud) défilera sur l’écran. Laissez le four refroidir.
Pour des résultats optimaux, placez un chiffon ou un film
cellophane lubrifié sur la pâte.
8WLOLVH]ODSRVLWLRQGHFXLVVRQ%RX&GDQVOHJUDQGIRXU
8WLOLVH]ODSRVLWLRQ%GDQVOHSHWLW
La fonction test fournit automatiquement la température
optimale pour le processus de test,
le bouton Température n’affecte pas la température de test.
Les lampes du four s’éteignent et se rallument successivement
afin de maintenir la température de test optimale jusqu’à ce
que le bouton de sélection de mode soit placé sur OFF.
ATTENTION
N’utilisez pas le mode levée pour réchauffer
des plats ou les maintenir au chaud. La température de levée
n’est pas suffisamment élevée pour garder les plats au chaud.
Ŷ Afin de ne pas baisser la température de test et de prolonger
la durée de test, n’ouvrez pas la porte si cela ne s’avère pas
nécessaire.
Ŷ Vérifiez les aliments à base de pain suffisamment tôt pour
éviter une levée excessive.
8QHIRLVODIHUPHQWDWLRQWHUPLQpHWRXUQH]OHERXWRQGH
sélection de mode sur OFF.
22
49-85244
Consignes de Sécurité Pour l’autonettoyage
La fonction d’autonettoyage du four a été conçue pour faciliter
le nettoyage de l’intérieur du four en utilisant des températures
très élevées pour brûler les résidus de nourriture.
AVERTISSEMENT
Essuyez l’excès de graisse et les
autres résidus d’aliments à l’aide d’un chiffon humide. Les
résidus de nourriture risquent prendre feu, au risque de
provoquer des dommages liés à la fumée et à la chaleur.
Ŷ Ne nettoyez pas les joints du four au risque de provoquer
des dommages.
Ŷ Retirez les ustensiles, la lèchefrite, la grille, la sonde et toute
feuille d’aluminium du four.
Ŷ Assurez-vous que la lentille de la lumière du four et le cadre
de la lentille soient bien à leur place.
Ŷ N’utilisez pas de nettoyants pour four, d’abrasifs ou
de protecteurs à proximité ou dans le four en cours de
nettoyage.
Ŷ Nous recommandons d’aérer votre cuisine en ouvrant une
fenêtre ou via une hotte de ventilation ou un ventilateur
pendant le nettoyage.
Ŷ Nettoyez les résidus du cadre et autour dela porte du four,
à l’extérieur des joints du four. Ces zones doivent être
nettoyées à la main.
Ŷ Les plateaux du four doivent être laissés à l’intérieur pendant
le nettoyage.
IMPORTANT : Certains oiseaux sont très sensibles aux
émanations résultant du cycle de nettoyage automatique
G¶XQIRXU,QVWDOOH]OHVRLVHDX[GDQVXQHDXWUHSLqFH
parfaitement ventilée.
REMARQUE : Le nettoyage automatique ne fonctionnera pas
si la sonde de température est insérée ou si le mode Sabbath
est réglé.
Sur les modèles à four double, vous pouvez régler un
programme de nettoyage dans les deux fours en même temps.
Le dernier four réglé différera automatiquement son démarrage
jusqu’à la fin du programme de nettoyage du premier four.
Sur les modèles à four double, vous pouvez cuire dans un four
et lancer le nettoyage automatique dans l’autre simultanément.
Vous ne pouvez toutefois pas utiliser le mode PROOF (Levée)
dans un four tandis que l’autre four est automatiquement nettoyé.
Comment Régler le Four Sur le Nettoyage
Mini bouton
Tournez pour ajuster
Appuyez dessus
pour sélectionner
1. Éteignez tous les brûleurs de surface. (Le cycle CLEAN
(Nettoyage) ne démarrera que lorsque tous les brûleurs de
surface auront été éteints.)
2. Tournez le bouton de sélection de mode sur CLEAN
(Nettoyage).
3. Tournez le bouton Température sur CLEAN (Nettoyage).
La commande est réglée automatiquement sur la durée de
nettoyage recommandée (5 heures). La durée de nettoyage
peut être ajustée sur 3 à 5 heures à l’aide du mini bouton.
L’écran affichera le temps restant.
4. Enfoncez le mini bouton pour démarrer le cycle CLEAN
(Nettoyage).
Si le message « CLOSE door » (Fermez la porte) défile
sur l’écran, le programme de nettoyage automatique a été
sélectionné mais la porte du four n’est pas fermée. Fermez-la.
49-85244
Le symbole
clignotera lorsque la porte du four est
EORTXpH,OQHVHUDSDVSRVVLEOHG¶RXYULUODSRUWHSHQGDQWOH
nettoyage.
8QHIRLVOHSURJUDPPHGHQHWWR\DJHWHUPLQpHWOHIRXU
refroidi, le message « End » (Fin) s’affichera et le
s’éteindra. Tournez le bouton de sélection de mode et le
bouton Température sur OFF.
Pour interrompre un programme, tournez le bouton de
sélection de mode et le bouton Température sur OFF.
Lorsque le four a suffisamment refroidi pour ne plus
présenter de risque, le symbole
s’éteindra indiquant que
la porte est peut-être ouverte.
8QSURJUDPPHLQWHUURPSXQHSHXWSDVrWUHUHGpPDUUpDYDQW
que le four ne soit suffisamment froid de sorte que la porte
se débloque.
UTILISATION DE LA CUISINIÈRE : Four Autonettoyant
Four Autonettoyant
23
UTILISATION DE LA CUISINIÈRE : Four Autonettoyant
24
Four Autonettoyant (Suite)
Après un Programme de Nettoyage
Vous remarquerez la présence de cendre blanche à l’intérieur
du four. Essuyez-la à l’aide d’un chiffon humide après
refroidissement du four.
Si le four est encore sale après un programme, répétez le
programme.
Si les traces blanches persistent, retirez-les à l’eau chaude
savonneuse et rincez-les avec un mélange de vinaigre et
d’eau. Ces dépôts sont en général des restes de sel que le
programme de nettoyage automatique ne peut éliminer.
Feuille d’aluminium
REMARQUE : Le minuteur est indépendant des autres
fonctions et ne permet pas de commander le four.
Pour régler le minuteur :
1. Appuyez sur le bouton TIMER (Minuteur).
2. Tournez le Mini Bouton pour régler la durée jusqu’à 12
heures et appuyez pour sélectionner.
Sur les modèles double four, chaque commande est dotée de
sa propre fonction minuteur. Chaque minuteur peut être réglé
de façon autonome.
La commande émettra un bip pendant 1 minute et l’écran
affichera les secondes jusqu’à ce que le minuteur compte
MXVTX¶j/RUVTXHOHPLQXWHXUDWWHLQWODFRPPDQGH
émettra 3 bips, suivis d’un bip toutes les 6 secondes jusqu’à ce
que le Mini Bouton soit enfoncé.
Mini Bouton
Tournez pour régler
Appuyez pour sélectionner
REMARQUE : Vous ne pouvez pas utiliser le minuteur en
mode d’autonettoyage. (Sur les modèles à four double, il est
possible d’utiliser le minuteur du four qui n’est pas en mode
d’autonettoyage.)
Pour annuler le minuteur :
1. Appuyez sur le bouton TIMER (Minuteur).
2. Tournez le Mini BoutonVXUHWDSSX\H]SRXU
sélectionner.
Pour régler le minuteur après démarrage :
1. Appuyez sur le bouton TIMER (Minuteur).
2. Tournez le Mini Bouton sur le délai souhaité
et appuyez pour sélectionner.
49-85244
Réglage Thermostat du Four
Vous remarquerez peut-être que le nouveau four cuit
GLIIpUHPPHQWTXHYRWUHDQFLHQIRXU8WLOLVH]OHQRXYHDXIRXU
pendant quelques semaines afin de vous exercer. Si vous
estimez que votre nouveau four est trop froid ou trop chaud,
réglez le thermostat.
Sur les modèles double four, utilisez les commandes du grand
four pour sélectionner un mode et le réglage.
Mini Bouton
Tournez pour ajuster Appuyez
dessus pour sélectionner
Pour régler le thermostat du four :
1. Appuyez et maintenez enfoncé le bouton TIMER (Minuteur)
et le Mini Bouton simultanément pendant 4 secondes
jusqu’à ce que l’écran affiche « SF » (Fonctions spéciales).
2. Tournez le Mini Bouton dans le sens inverse des aiguilles
d’une montre jusqu’à ce que le message « OFFSEt » défile
sur l’écran. Appuyez sur le Mini Bouton pour passer en
mode offset (compensation).
3. Tournez le Mini Bouton pour ajuster le thermostat
jusqu’à 35°F plus chaud ou (-) 35°F (1,6 °C) plus froid, en
incréments de 1°F (-17°C).
3A. Sur les modèles à four double, vous pouvez régler
thermostat du petit four en tournant le Mini Bouton
DXGHVVXVGXJUDQGIRXU8WLOLVH]OHMini Bouton du
grand four pour sélectionner le réglage.
4. Appuyez sur Mini Bouton pour faire votre sélection et
quitter le mode. Si vous ne souhaitez pas enregistrer les
FKDQJHPHQWVDSSX\H]VXUOHERXWRQ7,0(5 0LQXWHXU j
tout moment.
REMARQUE : Ce réglage n’aura pas d’incidence sur les
WHPSpUDWXUHVGH%DNH &XLVVRQ &RQYHFWLRQ%DNH &XLVVRQ
par convection) et Convection Roast (Rôtissage par
convection), ni les températures de nettoyage et de cuisson au
grill. Ce réglage sera mémorisé après une coupure de courant.
N’utilisez pas de thermomètres tels que ceux que l’on trouve
dans les épiceries pour vérifier la température de votre four.
Ces thermomètres ont une marge d’erreur de 20 (-6°C)–40
(4,4°C) degrés F.
Mode Sabbath
Pour passer en mode Sabbath :
Le mode Sabbath est conçu pour être utilisé les jours de
Sabbath et les autres fêtes religieuses du judaïsme.
,OQHSHXWrWUHXWLOLVpTXHSRXUODFXLVVRQ,OQHSHXWSDVrWUH
utilisé pour tout mode de cuisson.
Lorsque le mode Sabbath est sélectionné, la lampe du four et
tous les bips sonores seront désactivés. La fonction permet
également un délai aléatoire d’environ 30 secondes à 1 minute,
avant l’allumage du four réglé sur BAKE (Cuisson).
$SSX\H]VXUOHERXWRQ7,0(5HWOHMini Bouton et
maintenez-les enfoncés simultanément pendant 4 secondes
jusqu’à ce que l’écran affiche « SF » (Fonctions spéciales).
2. Tournez le Mini Bouton dans le sens des aiguilles d’une
PRQWUHMXVTX¶jFHTXHOHPHVVDJH© 6$EE$W+ ªGpILOHVXU
l’écran. Enfoncez le Mini Bouton pour passer en mode
Sabbath.
8QHIRLV© 6$EE$W+ ªVpOHFWLRQQpOHPHVVDJH© 6$EE$W+
ON » défilera sur l’écran.
Le mode Sabbath commandera les deux fours. Le symbole
s’affichera sur les deux écrans des fours.
Mini Bouton
Tournez pour ajuster
Enfoncez pour sélectionner
Pour désactiver le mode Sabbath :
5pSpWH]OHVpWDSHVHW/HPHVVDJH© 6$EE$W+2)) ª
défilera sur l’écran.
La température du four peut être à tout moment ajustée en
WRXUQDQWOHERXWRQSUpYXjFHWHIIHW,O\DXQGpODLDOpDWRLUH
avant que les éléments du four ne répondent.
UTILISATION DE LA CUISINIÈRE : Fonctions Spéciales
Fonctions Spéciales
Mode Sabbath homologué
Pour les modèles à four double, utilisez la commande du grand
four pour régler le mode Sabbath pour les deux fours.
49-85244
25
ENTRETIEN ET NETTOYAGE: Panneau de Commande et Boutons / Brûleurs du Four / Moule à Cuisson, Grille et Grille de Rôtissage
26
Panneau de Commande et Boutons
Assurez-vous que toutes les commandes sont à la position d’arrêt (OFF) et que toutes les surfaces sont refroidies avant de
nettoyer une partie quelconque de la cuisinière.
AVERTISSEMENT
Si vous déplacez votre cuisinière pour le nettoyage, une réparation
ou une autre raison, assurez-vous de bien engager la cuisinière dans
la ferrure antibasculement lors de sa remise en place. L’omission de
prendre cette précaution pose un risque de basculement de la cuisinière
pouvantcauser des brûlures graves ou la mort des enfants ou des adultes.
Nettoyez les projections à l’aide d’un chiffon doux. Retirez les
taches les plus coriaces à l’eau chaude et au savon.
N’utilisez pas d’abrasifs sur le panneau de commande ou les
boutons.
,OHVWSRVVLEOHGHGpPRQWHUOHVERXWRQVGHFRPPDQGHSRXU
faciliter le nettoyage. Pour ce faire, vous n’avez qu’à l’extraire
du panneau de commande. Lavez les boutons à l’eau chaude
et savonneuse, mais n’épongez pas.
REMARQUE : Le Mini Bouton n’est pas démontable.
Mini Bouton
Brûleurs du Four
Ne tentez pas de nettoyer les éléments du grill. Toute souillure
sera brûlée pendant le fonctionnement du brûleur.
Les éléments de cuisson et de cuisson par convection ne sont
pas exposés.
Moule à Cuisson, Grille et Grille de Rôtissage
Le moule à cuisson, la grille et la grille de rôtissage sont
lavables au lave-vaisselle. Toutefois, les plats cuits doivent
être lavés à la main à l’aide d’un nettoyant de four ou d’un
détergent abrasif.
Accessoires optionnels
Grille de rôtissage
Ne rangez pas moule à cuisson ou de grille sale dans le four.
Éliminez toujours tout excès de graisse.
ATTENTION
Ne nettoyez pas le moule, la grille
ou la grille de rôtissage dans un four en mode nettoyage
automatique.
Grille
Moule à cuisson
49-85244
Les grilles peuvent être placées dans le four en mode
nettoyage automatique sans risquer de dommages.
Après plusieurs cycles de nettoyage, les grilles doivent être
lubrifiées avec la graisse Graphite livrée avec l’appareil. Pour
commander une graisse Graphite supplémentaire, appelez
notre centre de pièces au 800.561.3344 et mentionnez la
référence WB02T10303.
Côté gauche
Grille avec côté
droit vers le haut
1. Retirez la grille du four. Voir la section Grilles de four
extensibles.
2. Dépliez totalement la grille sur la table ou le plan de travail.
Nous vous recommandons de placer du papier journal sous
la grille pour faciliter le nettoyage.
5. Faites de même pour le mécanisme coulissant droit.
Côté gauche
3. Si vous constatez la présence de résidus sur les barres
coulissantes, éliminez-les à l’aide d’une serviette en papier.
REMARQUE : Tout lubrifiant graphite essuyé doit être
réappliqué.
Grille avec côté
droit vers le haut
6. Ouvrez et fermez la grille plusieurs fois pour étaler le
lubrifiant.
7. Replacez le bouchon du lubrifiant et secouez-le à nouveau.
Retournez la grille et répétez les étapes 3, 4, 5 et 6.
8. Fermez la grille, placez la grille avec le côté droit à la
verticale et introduisez-la dans le four. Voir la section Grilles
de cuisson extensibles.
9. Répétez les étapes ci-dessus pour chaque grille.
4. Secouez le lubrifiant graphite avant de l’ouvrir. En
commençant par le mécanisme coulissant gauche de la
grille, appliquez quatre (4) goutelettes de lubrifiant sur les
deux (2) chenilles du mécanisme coulissant à proximité des
porte-roulements.
49-85244
REMARQUE : N’utilisez pas pulvérisateur pour huiles de
cuisson ou tout autre aérosol de lubrifiant sur les glissières.
ENTRETIEN ET NETTOYAGE: Grilles de Four
Grilles de Four
27
ENTRETIEN ET NETTOYAGE: Soulever la Porte du Four / Sonde
Soulever la Porte du Four
La porte est très lourde. Retirez-la et soulevez-la avec précaution.
Rainure
Ne la soulevez pas par la poignée.
Pour retirer la porte :
1. Ouvrez la porte complètement.
2. Appuyez sur les butées de charnière vers le cadre de la
SRUWHVXUODSRVLWLRQGpYHUURXLOOpH,OYRXVIDXGUDSHXWrWUH
un tournevis à tête plate.
3. Saisissez fermement les deux extrémités de la porte sur la
partie supérieure.
Verrou de charnière
Rabattez les verrous pour débloquer
4. Fermez la porte sur la position de désinstallation de porte,
(15 degrés environ par rapport à la position fermée) et
soulevez-la jusqu’à ce que le bras de la charnière sorte de
la rainure.
Pour réinstaller la porte :
Position
désinstallée
1. Saisissez fermement les deux extrémités de la porte sur la
partie supérieure.
2. Avec la porte sur le même angle que la position
désinstallée, positionnez le retrait du bras de charnière dans
le bord inférieur de la rainure de charnière. L’entaille sur le
bras de charnière doit être entièrement positionnée dans le
bas de la rainure.
3. Ouvrez la porte en grand. Si la porte ne s’ouvre pas
complètement, le retrait n’est pas correctement positionné
dans le bord inférieur de la rainure.
Position
réinstallée
4. Enfoncez les butées de charnière contre le cadre avant de
la cavité du four, sur la position verrouillée.
5. Fermez la porte du four.
Bord inférieur
de la rainure
Bras de charnière
Retrait
Bras de
charnière
Verrou de
charnière
Remonter les verrous pour les enclencher
Sonde
Laissez la sonde de température refroidir avant de procéder au
nettoyage.
,OHVWUHFRPPDQGpGHQHWWR\HUODVRQGHDXVDYRQHWjO¶HDXj
la main.
Ne plongez pas la sonde de température dans l’eau.
Ne rangez pas la sonde de température dans le four.
Ne nettoyez pas la sonde de température dans le four en cours
de nettoyage automatique.
28
49-85244
AVERTISSEMENT
RISQUE DE DÉCHARGE
ÉLECTRIQUE OU DE BRÛLURE : Avant de replacer
l’ampoule de la lampe du four, coupez l’alimentation électrique
de la cuisinière au fusible principal ou au panneau des
disjoncteurs. L’omission de prendre cette précaution peut
occasionner une décharge électrique ou une brûlure.
ATTENTION
RISQUE DE BRÛLURE : Attendez que le
couvercle de verre et l’ampoule soient refroidis avant de les
retirer. Toucher du verre chaud avec les mains nues ou un
linge humide peut causer des brûlures.
Chaque four est équipé de colonnes lumineuses halogènes
situées sur les parois latérales du four. Les lampes s’allument
lorsque la porte est ouverte ou si le four est en mode cuisson.
Chaque lumière se compose d’un couvercle de lampe amovible
avec deux clips de fixation et d’un compartiment lumineux de
trois ampoules halogènes.
Veillez à laisser l’ampoule et le couvercle refroidir
complètement. Pour votre sécurité, ne touchez pas une
ampoule brûlante avec vos mains ou un chiffon doux.
Pour retirer :
1. Retirez les grilles du four. Voir la section Grilles de four
extensibles.
2. A l’aide d’un tournevis à douille 7/16 po, retirez les quatre
écrous qui fixent les supports de la grille à la paroi du four.
3. Retirez la protection de verre de la lampe en sortant son
extrémité arrière et en l’enroulant vers vous. Ne retirez pas
les vis.
Pour procéder au remplacement :
8WLOLVH]XQHDPSRXOHKDORJqQH9QHXYH
avec des broches G8, non supérieure à
25 watts.
Vous pouvez commander des ampoules de rechange par
téléphone au 800.561.3344. Numéro de pièce pour la
commande WB25T10064.
REMARQUE : Les ampoules de puissance supérieure
endommageront votre four.
A l’aide de gants ou d’un chiffon doux, retirez l’ampoule de
son emballage. Ne touchez pas l’ampoule avec vos mains.
L’huile émanant de la peau de vos mains risque de laisser
des traces sur la surface en verre et provoquer la défaillance
prématurée de l’ampoule. Si vous touchez le verre, nettoyez-le
à l’alcool avant installation.
,QVpUHUO¶DPSRXOHDXIRQGGHODGRXLOOH
2. Replacez la protection de lampe, en plaçant son extrémité
avant sous les deux languettes avant dans le compartiment
à lampe. Enroulez l’extrémité arrière en veillant à ce qu’elle
soit correctement insérée.
REMARQUE : Si les clips de fixation se détachent de
la protection de la lentille de verre, maintenez-les sur la
protection dans la bonne position, tout en replaçant la
protection sur le compartiment.
Clips de
fixation
Placez l’extrémité
avant de la protection
de la lentille
sous les deux
languettes avant
ENTRETIEN ET NETTOYAGE: Lampes du Four
Lampes du Four
Enfoncez la protection de la lampe
4. A l’aide de gants ou d’un chiffon doux, retirez l’ampoule
grillée en tirant dessus.
La protection de lampe doit être installée lorsque vous
utilisez le four.
3. Réinstallez le support de la grille. Veillez à l’orienterde
sorte que les languettes supérieures des écrous soient le
plus proches possible du dessus du four. Fixez à l’aide des
quatre écrous dévissés récemment, mais ne serrez pas trop
ou vous risqueriez de briser l’émail.
4. Replacez les grilles. Voir la section Grilles de four
extensibles.
5. Remettez le four sous tension.
49-85244
29
ENTRETIEN ET NETTOYAGE: Surfaces
30
Surfaces
Pour Nettoyer la Porte
Le cadre et la porte du four, à l’extérior des joints d’étanchéité
du four, doivent être nettoyés à la main. Les surfaces émaillées
doivent être nettoyées à l’eau chaude savonneuse. Voir la
section Surfaces en acier inoxydable pour toutes les surfaces
de ce type.
Ne frottez ou ne nettoyez pas le joint de la porte car le
matériau en fibre de verre du joint se caractérise par une
UpVLVWDQFHH[WUrPHPHQWIDLEOHjO¶DEUDVLRQ8QMRLQWGHIRXU
intact et correctement inséré est essentiel pour une bonne
efficacité énergétique et de bonnes performances de cuisson.
Si le joint est usé, effiloché, abîmé ou déplacé, il doit être
remplacé par un technicien qualifié.
Surfaces en Acier Inoxydable
N’utilisez pas d’éponge en laine d’acier, vous risquez de laisser
des rayures indélébiles sur la surface.
Pour nettoyer la surface en acier inoxydable, faites-le à l’eau
chaude savonneuse ou à l’aide d’un nettoyant pour acier
inoxydable. Essuyez toujours la surface dans le sens du grain.
Suivez les instructions du nettoyant pour nettoyer la surface en
acier inoxydable.
Pour en savoir sur plus l’achat d’un nettoyant pour appareil
en acier inoxydable, veuillez appeler notre numéro gratuit, le
800.561.3344 ou allez sur GEAppliances.com.
Base du Four
La base du four est recouverte d’un émail vitrifié. Pour faciliter
le nettoyage, protégez la base du four contre les débordements
H[FHVVLIV8QHSHWLWHIHXLOOHG¶DOXPLQLXPRXXQHSODTXHSHXW
servir à recueillir les débordements si elle est placée sous
la grille où s’effectue la cuisson. Cela est particulièrement
important lors de la cuisson d’une tarte aux fruits ou d’autres
aliments très acides. Les garnitures de fruits ou d’autres
aliments chauds très acides (p.ex. tomates, choucroute et
sauces comportant du vinaigre ou du jus de citron) peuvent
causer de la corrosion et endommager la surface en émail
vitrifié, de sorte qu’il importe de les essuyer immédiatement.
8QHIHXLOOHG¶DOXPLQLXPQHGRLWMDPDLVUHFRXYULUWRWDOHPHQWXQH
grille. La circulation de la chaleur sera gênée et la cuisson sera
déficiente.
Pour nettoyer les débordements, utilisez de l’eau et du savon,
un nettoyant abrasif ou un tampon à récurer imbibé de savon.
Rincez à fond pour enlever le savon avant l’autonettoyage.
49-85244
/HEU€OHXUVHFRPSRVHGHWURLVpOpPHQWV ODEDVHGXEU€OHXU
la tête du brûleur et le chapeau du brûleur. La tête du brûleur et
le chapeau peuvent être démontés pour faciliter leur nettoyage.
ATTENTION
1¶87,/,6(=3$6/(%5Ó/(856,7286
/(6&20326$176'8%5Ó/(851(62173$6,167$//e6
Les brûleurs de surface doivent être nettoyés régulièrement,
surtout après des éclaboussures nocive susceptibles de
boucher les orifices et les rainures des têtes du brûleur.
L’électrode est située à l’arrière de chaque brûleur. N’essayez
pas démonter ou de nettoyer la zone autour du brûleur si
un autre brûleur est utilisé. Vous risqueriez de prendre une
décharge électrique.
Chapeau de
brûleur
Nettoyage
Démontez les composants du brûleur que lorsqu’ils sont froids.
Lavez à l’eau chaude et savonneuse. Vous pouvez utiliser un
tampon à récurer en plastique pour retirer les particules de
nourriture carbonisée.
Pour la nourriture carbonisée, imbibez les têtes de brûleur
dans une solution à base de détergent liquide doux et d’eau
chaude pendant 20–30 minutes. Pour les taches les plus
coriaces, utilisez un tampon à récurer en plastique ou une
brosse à dents.
Si l’éclaboussure s’infiltre dans le tête du brûleur, lavez-la à
l’eau et secouez-la pour retirer l’excès d’eau.
Après nettoyage
Avant de replacer les composants du brûleur, secouez l’excès
d’eau et séchez soigneusement.
Pour replacer les composants du brûleur :
Veillez à réinstaller les composants du brûleur au même endroit.
Tête du
brûleur
1. Replacez la tête du brûleur sur la base du brûleur, en
veillant à ce que l’orifice de la tête soit correctement alignée
sur l’électrode dans la base. C’est normal de trouver un petit
espace entre la base et la tête.
Base du
brûleur
2. Placez le chapeau du brûleur sur la tête. Veillez à ce que le
chapeau soit encastré sur la tête du brûleur.
Électrode
Pour retirer les composants du brûleur :
1. Tournez les commandes sur OFF avant de démonter les
composants du brûleur.
Chapeau de brûleur correctement encastré
8QHIRLVIURLGYRXVSRXYH]VRXOHYHUOHVJULOOHVGXEU€OHXU
les chapeaux et les têtes pour faciliter le nettoyage. Ne
retirez pas les bases.
REMARQUE : /HPRGqOH='3SRVVqGHGHX[WDLOOHVGH
brûleur. Veillez à replacer les brûleurs l’endroit prévu à cet effet.
49-85244
Chapeau de brûleur incorrectement installé
ENTRETIEN ET NETTOYAGE: Brûleurs Double Flamme Superposés
Brûleurs Double Flamme Superposés
31
ENTRETIEN ET NETTOYAGE: Déclencheur d’étincelles et Électrodes / Grilles de Brûleur
32
Déclencheur d’étincelles et Électrodes
L’électrode du système d’allumage électronique est placé à
l’arrière de la base du brûleur. Lorsque vous nettoyez la table
de cuisson, prenez soin de ne pas accrocher l’allumeur avec
un chiffon doux. Vous risqueriez de l’abîmer.
Nettoyez la partie métallique à
l’aide d’une lime à ongles.
Veillez à ne pas appuyer sur un bouton de commande pendant
le nettoyage. L’allumeur pourrait dégager des étincelles.
Veillez à ce que les allumeurs en céramique blanche de la table
de cuisson soient secs et propres. Nettoyez la partie métallique
de l’électrode à l’aide d’un chiffon doux ou une lime à ongles.
N’essayez pad de retirer l’électrode de la table de cuisson.
Ne nettoyez pas la partie
en céramique blanche
avec la lime à ongles.
Grilles de Brûleur
Nettoyez régulièrement les grilles de brûleur en fonte émaillée.
Les grilles peuvent être nettoyés à l’intérieur du four en mode
nettoyage automatique ou dans le lave-vaisselle. Les cadres
doivent nettoyés à la main ou dans le lave-vaisselle.
Grilles
Lavez-les à l’eau chaude et savonneuse, rincez et séchez
soigneusement.
Malgré leur robustesse, les grilles perdront progressivement
de leur éclat, indépendamment de l’entretien. Ceci est dû à
l’exposition permanente aux hautes températures.
Ne mettez pas un brûleur en marche pendant une période
prolongée sans ustensiles sur la grille. La finition de la grille
risque de s’effriter sans ustensiles pour absorber la chaleur.
Cadre
Cales
Pour davantage de stabilité, les cadres possèdent des cales
en caoutchouc sur chaque extrémité. Pendant le nettoyage et
l’utilisation, prenez soin de ne pas abîmer ou d’accrocher les
cales en caoutchouc.
49-85244
La graisse de la plaque chauffante s'égouttera par le canal
HQIRQWHpPDLOOpHVLWXpHjO DYDQWGHODFXLVLQLqUH8QHIRLV
les lèchefrites refroidies, vous pouvez les démonter pour les
nettoyer plus facilement.
Lèchefrites
Pour démonter le lèchefrite froide de la plaque chauffante, faitesle glisser vers l’avant et soulevez-le.
Ne laissez pas la graisse s’accumuler dans les lèchefrites afin
d’éviter tout risque d’incendie. Nettoyez les lèchefrites dès
qu’ils sont froids. Les lèchefrites peuvent être nettoyées à la
main à l’eau savonneuse et chaude ou dans le lave-vaisselle.
Essuyez tout déversement dans la cuve de la lèchefrite l’aide
d’un chiffon doux.
Pour davantage de stabilité, les lèchefrites possèdent des cales
en caoutchouc sur l’avant. Pendant le nettoyage et l’utilisation,
prenez soin de ne pas abîmer ou d’accrocher les cales.
Plaque Chauffante (sur certains modèles)
Eliminez soigneusement la graisse et les particules de
nourriture de la plaque chauffante, avec une spatule en métal à
bords carrés pendant qu’elle est encore chaude.
REMARQUE :,OHVWQRUPDOTXHOHJULOG¶DFLHULQR[\GDEOHVH
décolore et prenne une teinte jaune-brun après l’utilisation.
Essuyez la plaque à l’aide d’un chiffon sec, lourd, épais pour
retirer les résidus restants et les particules de nourriture.
Si la plaque est nettoyée avec autre chose, elle devra être
reconditionnée.
N’aspergez d’eau froide pas la plaque chauffante. La plaque
risquerait de se déformer ou se fissurer.
Planche à Trancher (sur certains modèles)
Lavez la planche à trancher en bambou à l’eau chaude et au
savon doux. Lavez-la parfois à l’huile minérale.
Ne lavez pas la planche à trancher dans le lave-vaisselle.
49-85244
Accessoires optionnels
ENTRETIEN ET NETTOYAGE: Lèchefrites / Plaque Chauffante / Planche à Trancher
Lèchefrites (sur certains modèles)
33
TRUCS DE DÉPANNAGE
34
Trucs de dépannage ... Avant d’appeler le service à la clientèle
Économisez du temps et de l’argent! Consultez les tableaux des pages suivantes, et vous n’aurez peut-être pas à appeler le
service à la clientèle. Si une erreur se produit dans l’utilisation des commandes, un code de défaillance s’affichera. Notez le code
d’erreur et contactez le service.
Problème
Cause Possible
Le Four Ne Fonctionne
Pas
8QIXVLEOHGHYRWUHPDLVRQSHXWrWUHJULOOpRXOHGLVMRQFWHXUGpFOHQFKp
Les commandes du four ne sont pas correctement réglées.
Les commandes du four sont réglées pour le nettoyage. Laissez le four refroidir si nécessaire, puis ouvrez la porte.
Veillez à ce que le bouton de sélection de mode du four est sur BAKE (Cuisson) et que le bouton température soit
placé sur une température.
Les Lampes Du Four Ne
Fonctionnent Pas
L’ampoule est défectueuse. Remplacez l’ampoule.
Le four est en autonettoyage ou le mode Sabbath est réglé. Les lampes du four ne s’allument pas en mode
nettoyage automatique ou si le mode Sabbath est activé
Le four est en mode Proof (Levée). Les lampes s’allument et s’éteignent successivement pour maintenir la
température de levée.
Le Plat Ne Cuit Pas
Ou Ne Rôtit Pas
Correctement
/HVFRPPDQGHVGXIRXUVRQWPDOUpJOpHV9RLUODVHFWLRQ%DNLQJ &XLVVRQ RX5RDVWLQJ 5{WLVVDJH
Four non préchauffé pendant une durée suffisante, attendez que le four signale la fin du préchauffage.
8VWHQVLOHVGHFXLVVRQLQDSSURSULpVRXXVWHQVLOHVG¶XQHWDLOOHLQDSSURSULpH9RLUOHVFRQVHLOVSRXUODFXLVVRQ
*ULOOHVGDQVODPDXYDLVHSRVLWLRQ9RLUODVHFWLRQ%DNLQJ &XLVVRQ RX5RDVWLQJ 5{WLVVDJH 8WLOLVH]XQHIHXLOOHG¶DOXPLQLXPSRXUUDOHQWLUOHGRUDJHSHQGDQWOHU{WLVVDJH
Le thermostat du four doit être ajusté. Voir la section Réglage du thermostat du four.
Le Plat Ne Grille Pas
Correctement
Ce modèle est conçu pour griller en porte fermée uniquement. Fermez la porte. Grillez avec la porte fermée.
/HIRXUQ¶HVWSDVUpJOpVXU%52,/ *ULOOHU 9RLUODVHFWLRQ%URLOLQJ &XLVVRQDXJULOO La sonde est branchée à la prise du four. Retirez la sonde du four.
La position de cuisson n’est pas la bonne.
/HVXVWHQVLOHVQHVRQWDGDSWpVSRXUJULOOHU8WLOLVH]OHPRXOHSODWHWODJULOOHIRXUQLVDYHFYRWUHIRXU
Le papier aluminium utilisé dans le plat et la grille n’a pas été placé correctement et coupé selon les
recommandations.
Le Four Ne Se Met Pas
En Autonettoyage
La température du four est trop élevée pour fonctionner en mode d’autonettoyage.
Laissez le four refroidir en dessous de la température .de fermeture et réglez les commandes à nouveau.
Les boutons sont mal réglés. Voir la section Four en mode nettoyage automatique.
Bruit Sec Ou Un
Crépitement Pendant
Le Nettoyage
&¶HVWQRUPDO,OV¶DJLWGXEUXLWGXPpWDOTXLFKDXIIHHWTXLUHIURLGLWSHQGDQWODFXLVVRQHWOHQHWWR\DJH
Une Fumée Excessive
S’échappe Pendant Le
Nettoyage
Le four est extrêmement sale. Tournez le bouton de sélection de mode du four et le bouton Température sur
OFF. Ouvrez les fenêtres pour évacuer la fumée. Patientez jusqu’à ce que le voyant témoin d’ouverture de porte
s’éteigne. Essuyez la saleté et redémarrez le programme de nettoyage.
Le Four Est Sale Après
Un Programme De
Nettoyage
Le four est extrêmement sale. Nettoyez les éclaboussures coriaces avant démarrer le nettoyage. Les fours
extrêmement sales devront probablement êtr à nouveau nettoyés.
Le four est branché sur une alimentation 208 V. Réglez le temps de nettoyage sur 5 heures.
Les boutons sont mal réglés. Voir la section Four en mode nettoyage automatique.
Les Grilles Du Four
Sont Difficiles À
Coulisser
Les grilles doivent être nettoyées dans le programme d’autonettoyage et régulièrement lubrifiées. Ne pulvérisez
pas de produit pour cuisine ou autres lubrifiants. Voir Grilles de four extensibles dans la section Entretien et
nettoyage.
49-85244
Problème
Cause Possible
Le Minuteur Ne Marche
Pas
Vous ne pouvez pas utiliser le minuteur si le four est en mode nettoyage automatique.
La Température Du
Four Est Trop Faible
Ou Trop Forte
Le thermostat du four doit être réglé. Voir la section Réglage du thermostat du four.
Le Message “Err Turn
Surface Burners Off”
Défile À L’écran.
L’autonettoyage est en cours et la fonction de verrouillage de la table de cuisson est activée. Aucune cuisson de
surface n’est autorisée durant l’autonettoyage. Attendez que cette opération soit terminée.
Le Message « Close
Door (Fermez La
Porte) Défile Sur
L’écran
Le programme de nettoyage automatique a été sélectionné mais la porte n’est pas fermée. Fermez la porte du
Est Enclenché
Lorsque Vous
Souhaitez Lancer La
Cuisson
four. Le
symbole apparaîtra sur l’écran.
La porte du four est verrouillée car la température du four n’a pas baissé sous la température de fermeture.
Tournez le bouton de sélection de mode du four et le bouton Température sur OFF. Laissez le four refroidir.
F- Et Un Numéro
Fclignotent Sur L’écran
Le four a un code d’erreur de fonctionnement. Tournez le bouton de sélection de mode du four et le bouton
Température sur OFF. Laissez le four refroidir pendant une heure. Remettez le four en route.
Coupez l’alimentation du four pendant 30 secondes et rebranchez l’alimentation. Si le code d’erreur se répète,
appelez un réparateur.
L’écran Est Noir
L’écran est noir lorsque le four ou le minuteur n’est pas utilisé.
8QIXVLEOHGHYRWUHPDLVRQSHXWrWUHJULOOpRXOHGLVMRQFWHXUGpFOHQFKp5HPSODFH]OHIXVLEOHRXUpHQFOHQFKH]OH
disjoncteur.
L’écran Ne Peut Pas
Afficher « Sf »
Les boutons TIMER (Minuteur) et MINI-KNOB (Mini bouton) doivent être enfoncés en même temps et maintenus
pendant 4 secondes.
Le Message « Probe »
(Sonde) S’affiche Sur
L’écran
&HFLDSRXUEXWGHYRXVUDSSHOHUG¶LQWURGXLUHODVRQGHGHWHPSpUDWXUHDSUqVO¶DYRLUEUDQFKp,QWURGXLVH]XQHVRQGH
de température.
Le Message
Sur L’écran
S’affiche
Le mode Sabbath a été sélectionné.
Coupure De Courant
Si vous avez utilisé le four pendant une coupure de courant ou une surtension, redémarrez le four. Tournez
le bouton de sélection de mode du four et le bouton Température sur OFF. Réglez à nouveau les boutons de
commande pour redémarrer.
Vapeur Provenant De
L’évent
Si vous l’utilisez en mode convection, il est normal de voir de la fumée s’échapper de l’évent du four. Le nombre
de positions de cuissons ou la quantité d’aliments en cours de cuisson augmentant, la quantité de vapeur
augmentera.
Odeur D’huile Ou De
Brûlé Provenant De
L’évent
C’est normal dans un four neuf, l’odeur disparaîtra.
Un Odeur Forte
&¶HVWSURYLVRLUH,OHVWIUpTXHQWTX¶XQHRGHXUSURYHQDQWGHO¶LVRODWLRQTXLHQWRXUHO¶LQWpULHXUGXIRXUVHGpJDJHORUV
des premières mises en route.
Bruit Du Ventilateur
8QYHQWLODWHXUGHFRQYHFWLRQRXGHUHIURLGLVVHPHQW VHORQODIRQFWLRQTXHYRXVXWLOLVH] SHXWV¶DOOXPHU&¶HVW
QRUPDO/HYHQWLODWHXUGHUHIURLGLVVHPHQWV¶DOOXPHUDSRXUUHIURLGLUOHVFRPSRVDQWVLQWHUQHV,OIRQFWLRQQHUD
probablement après l’extinction du four. Le ventilateur de convection peut s’allumer et s’éteindre jusqu’à ce que la
fonction soit terminée ou que la porte s’ouvre.
49-85244
TRUCS DE DÉPANNAGE
Trucs de dépannage ... Avant d’appeler le service à la clientèle
35
TRUCS DE DÉPANNAGE
Trucs de dépannage ... Avant d’appeler le service à la clientèle
Problème
Cause Possible
Le Ventilateur De
Convection N’est Pas
7RXMRXUV(Q0DUFKH
Pour optimiser le rendement, le ventilateur de convection (selon la fonction que vous utilisez) peut passer par des
cycles marche-arrêt jusqu’à ce que la fonction soit terminée ou que la porte soit ouverte. Cela est normal. De plus, le
ventilateur peut tourner en alternance dans le sens horaire et antihoraire jusqu’à ce que la fonction soit terminée ou
que la porte soit ouverte.
Les Brûleurs Ne
S’allument Pas Ou De
Manière Aléatoire
La fiche électrique n’est pas branchée dans une prise d’alimentation qui marche.
Le gaz est coupé.
Les éléments du brûleur ne sont pas correctement installés.
Les trous des plaques d’ébullition ou des orifices des disques du brûleur sont bouchés
Orifice bouché, ou brûleurs ou électrodes.
La fonction de verrouillage de la table de cuisson est activée.
8QIXVLEOHGHYRWUHGRPLFLOHSHXWDYRLUVDXWpRXOHGLVMRQFWHXUDpWpGpFOHQFKp
Flammes De Brûleur
Jaunes Ou Grandes
Les éléments du brûleur ne sont pas correctement installés.
$)ODPPHVMDXQHVAppelez
un réparateur.
%([WUpPLWpVMDXQHVNormal
pour du gaz propane (LP).
C. Flammes bleu claire :
Normal pour du gaz naturel.
Si les flammes du brûleur ressemblent à (A), appelez un réparateur. L’aspect normal des flammes devrait être (B) ou
(C), selon le gaz.
36
Flammes De Brûleur
Jaunes Ou Grandes
Le four est probablement branché sur un carburant inapproprié. Contactez la personne qui a installé votre four ou
qui a effectué la conversion.
Le Bouton De
Commande Du Brûleur
Est Bloqué
Lorsque le bouton est sur la position OFF, vous devez appuyer dessus avant de le tourner, et vous ne pouvez le
tourner que dans le sens des aiguilles d’une montre. Si le bouton est placé sur une autre position, vous pouvez le
tourner sans avoir à appuyer dessus.
De La Condensation
Ou Du Brouillard
Embue L’intérieur De
La Vitre De Porte.
La présence de condensation ou de brouillard sur l’intérieur de la vitre de la porte du four est normale durant le
préchauffage du four et elle disparaît habituellement à la fin du cycle de préchauffage.
Les flammes du
brûleur présentent des
vacillements orange
Poussières en suspension; humidificateur à vapeur froide; débris sur ou à l’intérieur du brûleur.
49-85244
Notes
49-85244
37
GARANTIE
Garantie de la cuisinière à gaz GE Appliances
GEAppliances.com
Tout entretien ou réparation en vertu de la garantie est fourni par nos Centres d’entretien et de réparation de l’usine
ou par un technicien autorisé de Customer Care®. Pour fixer un rendez-vous en ligne, consultez notre site
www.geappliances.com/service_and_support/, ou téléphonez GE Appliances à 800.GE.CARES (800.432.2737).
Veuillez avoir vos numéros de série et de modèle à portée de main lors de l’appel.
L’entretien de votre appareil pourrait nécessiter l’utilisation d’un accès aux données embarquées pour le diagnostic.
Cela permet au technicien de l’atelier de réparation GE Appliances de diagnostiquer rapidement toute défaillance
de votre électroménager et à GE Appliances d’améliorer la qualité de ses produits. Si vous ne souhaitez pas
transmettre les données de votre appareil à GE Appliances, veuillez aviser votre technicien de s’en abstenir au
moment de la visite de service.
Durant une période de GE Appliances remplacera
Un an
depuis la date d’achat
d’origine
Toute pièce défectueuse en raison d'un vice de matière ou de fabrication. Durant cette
garantie limitée d’un an, GE Appliances assumera tous les frais de main-d'œuvre et
de service à domicile afférents au remplacement de la pièce défectueuse.
$JUDIH]LFLYRWUHUHoX8QHSUHXYHGHO¶DFKDWRULJLQDOHVWUHTXLVH
pour l’accès à l‘entretien et aux réparations en vertu de la garantie.
What GE Appliances will not cover:
Ŷ /
HVGpSODFHPHQWVGHVWHFKQLFLHQVjYRWUHGRPLFLOHSRXU
vous apprendre à utiliser l’appareil.
Ŷ 'pFRORUDWLRQGHODSODTXHFKDXIIDQWHRXGHVJULOOHVGXIRXU
Ŷ &DVVXUHGHVJULOOHVSRUFHODLQHpPDLOOpHRXGHVJULOOHVGXIRXU
Ŷ 5HPSODFHPHQWGHVIXVLEOHVRXUpHQFOHQFKHPHQWGHV
disjoncteurs.
Ŷ 'RPPDJHVLQGLUHFWVOLpVDX[pYHQWXHOVG\VIRQFWLRQQHPHQWV
de cet appareil.
Ŷ 'RPPDJHVOLpVDXWUDQVSRUW
Ŷ 'RPPDJHVOLpVjXQDFFLGHQWLQFHQGLHLQRQGDWLRQV
catastrophes naturelles.
Ŷ 'pIDLOODQFHRXGRPPDJHGXSURGXLWV¶LOHVWPDOWUDLWpPDO
utilisé, utilisé à d’autres fins que l’usage prévu, ou utilisé
commercialement.
Ŷ ,QVWDOODWLRQOLYUDLVRQHWHQWUHWLHQLQDSSURSULpV
Si vous rencontrez une problème d’installation, contactez
YRWUHUHYHQGHXURXLQVWDOODWHXU,OYRXVLQFRPEHGHIRXUQLU
une alimentation de gaz, électrique, une ventilation
adéquats et autres raccordements comme indiqué dans les
consignes d’installation fournies avec l’appareil.
Ŷ /¶DSSDUHLOQ¶HVWSDVDFFHVVLEOHSRXUIRXUQLUOHVHUYLFHUHTXLV
EXCLUSION DES GARANTIES IMPLICITES
Votre seul et unique recours est la réparation du produit selon les dispositions de la présente garantie limitée.
Toutes garanties implicites, y compris les garanties implicites de qualité marchande et d’adéquation à un usage
spécifique, sont limitées à un an ou à la plus courte période permise par la loi.
&HWWHJDUDQWLHHVWRIIHUWHjO¶DFKHWHXULQLWLDOHWjWRXWSURSULpWDLUHVXEVpTXHQWG¶XQSURGXLWDFKHWpDX[eWDWV8QLVjGHV
fins d’usage domestique. Si le produit est situé dans une localité où un réparateur autorisé GE n’est pas disponible, vous
pourriez encourir des frais de déplacement ou devoir acheminer le produit à un réparateur autorisé GE pour faire réparer
O¶DSSDUHLO(Q$ODVNDFHWWHJDUDQWLHH[FOXWOHVIUDLVG¶H[SpGLWLRQHWOHVYLVLWHVGHVHUYLFHjYRWUHGRPLFLOH
Certains États ou provinces ne permettent pas l’exclusion ou la restriction des dommages accessoires ou indirects.
Certains droits particuliers vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres
droits qui varient selon votre lieu de résidence. Pour connaître la nature exacte de vos droits, consultez l’organisme de
protection du consommateur de votre région, ou encore le bureau du procureur général de l’État.
Garant : GE Appliances a Haier company
Garant au Canada : MC Commercial, Burlington, ON, L7R 5B6
Prolongation de garantie : Achetez un contrat d’entretien GE Appliances et informez-vous des rabais spéciaux en
vigueur pendant toute la durée de votre garantie. Vous pouvez vous le procurer en tout temps sur
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
ou en composant le 800.626.2224 durant les heures normales de bureau. Le service après-vente GE Appliances sera
toujours disponible après l’expiration de votre garantie.
38
49-85244
Vous êtes à la recherche d’autres articles?
GE Appliances propose une variété d’accessoires
afin d’améliorer votre expérience de cuisson et
d’entretien!
Reportez-vous à la page du Soutien au consommateur
pour des renseignements sur l’accessibilité téléphonique
et en ligne.
/HVSURGXLWVVXLYDQWVHWG¶DXWUHVHQFRUHVRQWRIIHUWV
Pièces
ACCESSOIRES
Accessoires
Planche à trancher en bambou (sur certains modèles)
Plinthe
Protecteur de plaque chauffante (sur certains modèles)
Grille(s) de four extensible(s)
Barquette et grille
Grille de four profil bas
Sonde de température
Grille de Rôtissage
6 Brûleurs à Gaz
6 Brûleurs à Gaz Avec Plaque Chauffante
49-85244
39
SOUTIEN AU CONSOMMATEUR
Soutien au consommateur
Site Web de GE Appliances
Vous avez une question ou vous avez besoin d’aide pour votre appareil électroménager? Visitez le site Web de GE
Appliances 24 heures par jour, tous les jours de l’année! Vous pouvez aussi y trouver d’autres formidables produits
*($SSOLDQFHVHWWLUHUDYDQWDJHGHWRXVQRVVHUYLFHVG¶DVVLVWDQFHHQOLJQH$X[eWDWV8QLVGEAppliances.com
$X&DQDGDGEAppliances.ca
Enregistrez votre électroménager
Enregistrez votre nouvel appareil en ligne au moment qui vous convient le mieux! L’enregistrement de votre produit
dans les délais prescrits permet une meilleure communication et un service rapide, selon les modalités de votre
garantie, si besoin est. Vous pouvez également envoyer par courrier la carte d’enregistrement pré-imprimée qui se
trouve dans l’emballage de votre appareil.
$X[eWDWV8QLVGEAppliances.com/register
$X&DQDGDProdsupport.mabe.ca/crm/Products/ProductRegistration.aspx
Service de réparation
8QVHUYLFHGHUpSDUDWLRQH[SHUW*($SSOLDQFHVVHWURXYHjTXHOTXHVSDVGHFKH]YRXV5HQGH]YRXVVXUQRWUHVLWH
et programmez, à votre convenance, une visite de réparation à n’importe quel jour de l’année.
$X[eWDWV8QLVGEAppliances.com/ge/service-and-support/service.htm ou composez le 800.432.2737 durant
les heures normales de bureau.
$X&DQDGDGEAppliances.ca/en/support/service-request ou composez le 800.561.3344
Prolongation de garantie
Procurez-vous une prolongation de garantie GE Appliances et informez-vous des rabais spéciaux en vigueur
pendant la durée de votre garantie. Vous pouvez vous la procurer en ligne en tout temps. Les services GE
$SSOLDQFHVVHURQWWRXMRXUVGLVSRQLEOHVDSUqVO¶H[SLUDWLRQGHODJDUDQWLH$X[eWDWV8QLV
GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm ou composez le 800.626.2224
durant les heures normales de bureau.
$X&DQDGD GEAppliances.ca/en/support/purchase-extended-warranty ou composez le 800.290.9029
Connectivité à distance
Pour de l’assistance concernant la connectivité au réseau sans fil (pour les modèles équipés de cette fonction),
visitez notre site Web au GEAppliances.com/ge/connected-appliances/ ou composez le 800.220.6899 aux États8QLVVHXOHPHQW
Pièces et accessoires
Les personnes ayant les compétences requises pour réparer elles-mêmes leurs appareils peuvent recevoir
GLUHFWHPHQWjODPDLVRQGHVSLqFHVRXDFFHVVRLUHV OHVFDUWHV9,6$0DVWHU&DUGHW'LVFRYHUVRQWDFFHSWpHV Commandez en ligne 24 heures par jour.
$X[eWDWV8QLVGEApplianceparts.com ou par téléphone au 877.959.8688 durant les heures normales de bureau.
Les instructions contenues dans le présent manuel comportent des procédures que tout utilisateur peut
effectuer. Les autres types de réparation doivent généralement être confiés à un technicien qualifié. Usez de
prudence : une réparation ou un entretien mal effectués peuvent rendre l’utilisation de l’appareil dangereuse.
Les consommateurs au Canada doivent consulter les pages jaunes pour connaître le centre de service
MC Commercial le plus proche, visiter notre site Web au GEAppliances.ca/en/products/parts-filters-accessories
ou composer le 1.800.661.1616.
Communiquez avec nous
Si vous n’êtes pas satisfait du service après-vente de GE Appliances, communiquez avec nous depuis notre site Web
HQIRXUQLVVDQWWRXVOHVGpWDLOVGRQWYRWUHQXPpURGHWpOpSKRQHRXpFULYH]j
$X[eWDWV8QLV*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/ge/service-and-support/contact.htm
$X&DQDGD'LUHFWRU&RQVXPHU5HODWLRQV0&&RPPHUFLDO,QF_6XLWH)DFWRU\/DQH_0RQFWRQ1%(&0
GEAppliances.ca/en/contact-us
40
,PSULPpDX0H[LTXH
49-85244
Cocinas Profesionales con Dos Tipos de Combustibles
COCINAS
INFORMACIÓN DE SEGURIDAD . . . . . 3
USO DE LA COCINA
Características de su Cocina . . . . . . . . . . . . . . . . . . 8
Controles de la Estufa . . . . . . . . . . . . . . . . . . . . . . . . 9
Cocción Sobre Superficie . . . . . . . . . . . . . . . . . . . . 10
Características de su Horno . . . . . . . . . . . . . . . . . . 12
Control del Horno. . . . . . . . . . . . . . . . . . . . . . . . . . . 13
Consejos de Horneado . . . . . . . . . . . . . . . . . . . . . . 14
Antes de Comenzar . . . . . . . . . . . . . . . . . . . . . . . . . 15
Horneado . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16
Asado . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17
Horneado o Asado por Convección . . . . . . . . . . . 19
Sonda . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Leudado . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Horno Auto-limpiante . . . . . . . . . . . . . . . . . . . . . . . 23
Características Especiales. . . . . . . . . . . . . . . . . . . .25
MANUAL DEL
PROPIETARIO
CAFÉ
30”, 36” y 48”
CUIDADO Y LIMPIEZA
Panel de Control y Perillas . . . . . . . . . . . . . . . . . . .26
Quemadores del Horno . . . . . . . . . . . . . . . . . . . . . .26
Asadera, Rejilla y Parrilla de Rostizado . . . . . . . .26
Bandejas del Horno . . . . . . . . . . . . . . . . . . . . . . . . . 27
Puerta del Horno Desmontable . . . . . . . . . . . . . . .28
Sonda . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28
Luces del Horno . . . . . . . . . . . . . . . . . . . . . . . . . . . .29
Superficies . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .30
Quemadores Apilados de Llama Dual . . . . . . . . . 31
Encendedor por Chispa y Electrodos . . . . . . . . . . 32
Rejillas del Quemador . . . . . . . . . . . . . . . . . . . . . . . 32
Canaletas Para Grasa . . . . . . . . . . . . . . . . . . . . . . . .33
Plancha . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .33
Tabla Para Cortar . . . . . . . . . . . . . . . . . . . . . . . . . . .33
CONSEJOS PARA LA
SOLUCIÓN DE PROBLEMAS
. . . . . . . .34
GARANTÍA . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38
ACCESORIOS . . . . . . . . . . . . . . . . . . . . . . . . . .39
SOPORTE PARA
EL CONSUMIDOR . . . . . . . . . . . . . . . . . . . .
40
Escriba el modelo y los números de serie
a continuación:
Modelo No: _______________________
Serial No: _________________________
Los encontrará en una etiqueta ubicada
detrás de la perilla del quemador izquierdo
o en la parte inferior de la estufa.
GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca.
49-85244 10-17 GEA
GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR.
Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace
tenerlo en la familia.
Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de
GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico
asegura que podamos entregarle información importante del producto y detalles de la garantía
cuando los necesite.
Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles
están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con
el material embalado.
2
49-85244
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA
Lea todas las instrucciones de seguridad antes de utilizar este producto. No seguir estas
instrucciones puede generar un incendio, una descarga eléctrica, lesiones corporales o la muerte.
ADVERTENCIA Si la información de este manual no se sigue al pie de la letra,
puede ocasionarse un incendio o una explosión, generando daños a la propiedad,
lesiones personales o la muerte.
- No almacene o use gasolina u otros vapores o líquidos inflamables cerca de este o
cualquier otro aparato.
- QUÉ HACER SI HUELE GAS
Ŷ 1RWUDWHGHHQFHQGHUQLQJ~QDSDUDWR
Ŷ 1RWRTXHQLQJ~QLQWHUUXSWRUHOpFWULFRQRXWLOLFHQLQJ~QWHOpIRQRHQVXHGLILFLR
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
Ŷ ,QPHGLDWDPHQWHOODPHDVXSURYHHGRUGHJDVGHVGHHOWHOpIRQRGHXQYHFLQR6LJD
las instrucciones del proveedor de gas.
Ŷ 6LQRSXHGHFRPXQLFDUVHFRQHOSURYHHGRUGHJDVOODPHDOGHSDUWDPHQWRGH
bomberos.
/DLQVWDODFLyQ\VHUYLFLRWpFQLFRGHEHQUHDOL]DUORVXQLQVWDODGRUFDOLILFDGRXQD
agencia de servicio o el proveedor de gas.
DISPOSITIVO ANTI-VOLCADURAS
ADVERTENCIA
Riesgo de Caída
• Un niño o adulto pueden volcar la cocina y morir.
• Instale el soporte anti-volcaduras sobre la pared o el piso.
• Asegúrese la estufa al soporte anti-volcaduras deslizando
la unidad hacia atras de tal manera que la pata niveladora
sea enganchada.
• Vuelva a adherir el soporte anti-volcaduras si la estufa
se mueve de lugar.
• Si esto no se hace, se podrá producir la muerte o
quemaduras graves en niños o adultos.
cajón de almacenamiento o el panel de protección se pueden retirar
para una fácil inspección. Si no es posible realizar una inspección visual,
deslice la cocina hacia adelante, confirme que el soporte anti-volcaduras
esté ajustado de forma segura al piso o la pared, y deslice la cocina
hacia atrás de modo que la pata niveladora trasera se encuentre debajo
del soporte anti-volcaduras.
Para reducir el riesgo de volcar la cocina,
ésta debe sujetarse mediante un soporte antivolcaduras con una adecuada instalación. Ver
las instrucciones de instalación enviadas con el
soporte para obtener detalles completos antes
de iniciar la instalación.
Para Cocinas a Gas Profesionales
Para controlar si el soporte es instalado y
ajustado de forma apropiada, mire que debajo
de la cocina la pata niveladora trasera esté
ajustada al soporte. En algunos modelos, el
Kit de soporte
anti-volcaduras incluido
Si la cocina es expulsada de la pared por alguna razón, siempre repita
este procedimiento a fin de verificar que esté asegurado de forma
correcta con un soporte anti volcaduras.
Nunca quite las patas de nivelación por completo ya que la cocina no
quedará bien sujeta al dispositivo anti-volcaduras.
Vista Trasera
LEA Y GUARDE ESTAS INSTRUCCIONES
49-85244
3
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD
ADVERTENCIA
NUNCA use este
HOHFWURGRPpVWLFRSDUDFDOHQWDUHODPELHQWH
Como consecuencia de esto, se podrá producir
envenenamiento con monóxido de carbono y el
sobrecalentamiento del horno.
Ŷ 8VHHVWHHOHFWURGRPpVWLFRVyORSDUDVXSURSyVLWRRULJLQDO
como se describe en el manual del propietario.
Ŷ 6
ROLFLWHTXHXQLQVWDODGRUFDOLILFDGRLQVWDOHVXFRFLQD\
que esté correctamente conectada a tierra, de acuerdo
con las instrucciones de instalación provistas.
Ŷ &
XDOTXLHUDMXVWH\WUDEDMRGHVHUYLFLRWpFQLFRGHEHUi
ser realizado únicamente por instaladores calificados de
cocinas a gas o técnicos del servicio. No intente reparar o
reemplazar ninguna parte de la cocina, a menos que esto
se recomiende específicamente en este manual.
Ŷ 6
XFRFLQDHVHQYLDGDGHVGHODIiEULFDFRQILJXUDGDSDUD
uso con gas natural o con gas propano (LP). Puede ser
convertida para uso con cualquiera de los dos. Si se
requieren, estos ajustes deben ser realizados por un
técnico calificado de acuerdo con las instrucciones de
instalación y códigos locales. La agencia que realiza este
trabajo asume la responsabilidad de la conversión.
Ŷ 6
ROLFLWHTXHHOLQVWDODGRUOHPXHVWUHODXELFDFLyQGHOD
válvula de cierre de la cocina a gas y cómo apagarla en
caso de ser necesario.
Ŷ $
QWHVGHUHDOL]DUFXDOTXLHUVHUYLFLRWpFQLFRGHVHQFKXIH
la cocina o desconecte el suministro de corriente desde
el panel de distribución del hogar, retirando el fusible o
desconectando el disyuntor.
Ŷ $
VHJ~UHVHGHTXHWRGRVORVPDWHULDOHVGHHPEDODMHVHDQ
retirados de la cocina antes de su uso, a fin de evitar que
estos materiales se incendien.
Ŷ '
REOH$OLPHQWDFLyQ6LHOHOHPHQWRGHFDOHQWDPLHQWR
del horno desarrolla un punto brillante y muestra otras
VHxDOHVGHGDxRQRXVHGLFKDiUHDGHODFRFLQD8Q
punto brillante indica que el elemento puede fallar y
generar una posible quemadura, incendio o descarga
eléctrica. Apague el elemento de calentamiento de
inmediato y solicite a un técnico calificado del servicio
que reemplace el mismo.
Ŷ (
YLWHUD\DURLPSDFWDUODVSDQWDOODVGHYLGULR+DFHU
esto podrá producir la rotura de vidrios. No cocine un
producto con un vidrio roto. Es posible que se produzcan
descargas, incendio o cortes.
Ŷ 1
RGHMHDORVQLxRVVRORVRIXHUDGHVXUDGLRGHDWHQFLyQ
en el área donde el electrodoméstico se encuentre en
uso. Nunca se les deberá permitir trepar, sentarse o
pararse sobre ninguna parte del electrodoméstico.
Ŷ
PRECAUCIÓN
No coloque artículos de interés
para los niños sobre los gabinetes que están sobre un
horno – si los niños se trepan sobre el horno para llegar
a estos artículos podrían sufrir lesiones graves.
Ŷ 1
XQFDEORTXHHODVYHQWLODFLRQHV DEHUWXUDVGHDLUH GHOD
cocina. Las mismas brindan las entradas y salidas de aire
que son necesarias para que la cocina opere de forma
correcta con la combustión adecuada. Las aberturas de
aire están ubicadas en la parte trasera de la cocina, en
la parte superior e inferior de la puerta del horno, y en la
parte inferior de la cocina.
Ŷ 8
VHVyORVRVWHQHGRUHVGHROODVVHFRV±ORVVRVWHQHGRUHV
húmedos sobre superficies calientes pueden producir
quemaduras debido al vapor. No permita que los
sostenedores de ollas tengan contacto con los
quemadores superficiales, la parrilla de los quemadores,
o el elemento de calefacción del horno. No use una toalla
u otra tela voluminosa para reemplazar el mango de las
cacerolas.
Ŷ 1
RWRTXHHOHOHPHQWRFDOHQWDGRUQLODVXSHUILFLHLQWHULRU
del horno. Es posible que estas superficies estén
demasiado calientes como para quemar, aunque su
FRORUVHDRVFXUR'XUDQWH\GHVSXpVGHOXVRQRWRTXH
ni permita que telas u otros materiales inflamables
toquen cualquier área interior del horno; espere a
que haya pasado un tiempo suficiente para que se
enfríen. Otras superficies del electrodoméstico se
podrán calentar lo suficiente como para ocasionar
lesiones. Las superficies potencialmente calientes
incluyen quemadores, rejillas, abertura de la ventilación
del horno, superficies cercanas a la abertura, grietas
alrededor de la puerta del horno, piezas con bordes
metálicos sobre la puerta, cualquier protección trasera,
o superficie de estante alto.
Ŷ 1
RFDOLHQWHHQYDVHVGHFRPLGDTXHQRKD\DQVLGR
abiertos. Se podría acumular presión y el envase podría
explotar, ocasionando una lesión.
LEA Y GUARDE ESTAS INSTRUCCIONES
4
49-85244
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD (cont.)
Ŷ &
RFLQHODFRPLGDFRPSOHWDPHQWHSDUDHYLWDUTXHVH
produzcan enfermedades a partir de la comida. Puede
encontrar recomendaciones de seguridad mínima sobre
ODWHPSHUDWXUDGHODFRPLGDHQZZZ,V,W'RQH<HWJRY\
ZZZIVLVXVGDJRY8WLOLFHXQWHUPyPHWURSDUDWRPDUOD
temperatura de la comida y haga controles en diferentes
ubicaciones.
Ŷ 0
DQWHQJDOLPSLDODFDPSDQDGHOYHQWLODGRU\ORVILOWURV
de grasa, a fin de mantener una buena ventilación y de
evitar incendios con grasa. Apague el ventilador en caso
de incendio o al “encender” intencionalmente licor u otras
bebidas alcohólicas de alta graduación en la superficie de
cocción. Si el extractor se encuentra en funcionamiento,
podrá esparcir las llamas.
Ŷ 1
RSHUPLWDTXHQDGLHVHWUHSHSDUHRFXHOJXHGHOD
puerta del horno, del cajón o la cocina. Se podrá dañar la
cocina o provocar su caída, ocasionando lesiones graves
o la muerte.
ADVERTENCIA MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA COCINA
Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios.
Ŷ 1RJXDUGHQLXVHPDWHULDOHVLQIODPDEOHVHQXQKRUQR
o cerca de la parte superior de la cocina, incluyendo
papel, plástico, sostenedores de ollas, trapos, cobertores
de pared, cortinas, paños y gasolina u otros vapores y
líquidos inflamables.
Ŷ 1RSHUPLWDTXHODJUDVDGHODFRFFLyQXRWURVPDWHULDOHV
inflamables se acumulen en o cerca de la cocina. La
grasa del horno o sobre la cocina se podrá incendiar.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
Ŷ 1XQFDXVHSUHQGDVKROJDGDVRTXHFXHOJXHQPLHQWUDV
usa el electrodoméstico. Evite acumular artículos
comúnmente usados en gabinetes sobre la cocina, y
tenga cuidado al extender la mano sobre la cocina.
La ropa que se encuentre cerca de los quemadores o
superficies calientes se podrá encender, ocasionando
quemaduras graves.
ADVERTENCIA EN CASO DE INCENDIO, SIGA LOS SIGUIENTES PASOS
PARA EVITAR LA PROPAGACIÓN DEL FUEGO
Ŷ 1RXVHDJXDVREUHHOIXHJRGHODJUDVD1XQFDWRPH
una olla que se esté incendiando. Apague los controles.
Extinga la olla que se esté incendiando sobre un
quemador superficial, cubriendo la olla completamente
con su tapa correspondiente, una hoja metálica de
galletas o una bandeja plana. Si es necesario, use un
químico seco multiuso o un extintor de chorro de espuma.
Ŷ (QFDVRGHTXHKD\DIXHJRHQHOKRUQRGXUDQWHHOSHUtRGR
de auto limpieza, apague el horno y espere a que el fuego
se extinga. No fuerce la puerta para abrirla. La entrada de
aire fresco sobre las temperaturas de auto limpieza podrá
conducir a la producción de llamas en el horno.
Ŷ 6LKD\XQLQFHQGLRHQHOKRUQRGXUDQWHHOKRUQHDGR
ahogue el fuego cerrando la puerta del horno y apagando
el mismo o usando un químico seco multipropósito o un
extintor de incendio con espuma.
LEA Y GUARDE ESTAS INSTRUCCIONES
49-85244
5
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DE LA PARTE
SUPERIOR DE LA COCINA
Ŷ 1XQFDSLHUGDGHYLVWDORVTXHPDGRUHVFXDQGRVH
encuentren en las configuraciones de calor media o alta.
Las comidas, especialmente las que se preparan con
aceite, se pueden incendiar, lo cual puede ocasionar un
incendio que se propague a los gabinetes próximos.
Ŷ 1XQFDSLHUGDGHYLVWDHODFHLWHFXDQGRHVWpIULHQGR6L
se calienta más allá de su punto de cocción, el aceite
se puede quemar y provocar un incendio que se puede
SURSDJDUDORVJDELQHWHVSUy[LPRV8VHXQWHUPyPHWUR
para grasas profundas siempre que sea posible, a fin de
monitorear la temperatura del aceite.
Ŷ 3DUDHYLWDUGHUUDPHVHLQFHQGLRVXVHXQDFDQWLGDG
mínima de aceite al usar una sartén poco profunda y
evite la cocción de comidas congeladas con cantidades
excesivas de hielo.
Ŷ 8VHHOWDPDxRGHROODDGHFXDGRSDUDHYLWDUTXHVHDQ
inestables o que sufran caídas fácilmente. Seleccione
utensilios que coincidan con el tamaño del quemador.
Las llamas del quemador se deberán ajustar de modo
que no se extiendan más allá de la parte inferior de la
ROOD8QDFDQWLGDGH[FHVLYDGHOODPDSXHGHUHSUHVHQWDU
un riesgo.
Ŷ 6LHPSUHXVHODSRVLFLyQ/,7(DOHQFHQGHUORV
quemadores superiores y asegúrese de que estos se
hayan encendido.
Ŷ $OXVDUXWHQVLOLRVGHYLGULRFHUiPLFDDVHJ~UHVHGH
que sean adecuados para el servicio de cocina; otros
se podrán romper debido a un cambio repentino de
temperatura.
Ŷ $ILQGHPLQLPL]DUSRVLEOHVTXHPDGXUDVLQFHQGLRGH
materiales inflamables y derrames, la manija de un
envase deberá ser inclinada hacia el centro de la cocina
sin que se extienda sobre los quemadores cercanos.
Ŷ 1RXVHXQZRNFRQXQDQLOORFRQVRSRUWHGHPHWDO
redondo. El anillo podrá atrapar calor y bloquear el aire
hacia el quemador, produciendo el riesgo de emisión de
monóxido de carbono.
Ŷ 1RLQWHQWHHOHYDUODFRFLQD+DFHUHVWRSRGUtDGDxDU
la tubería de gas hasta los quemadores superficiales,
ocasionando una pérdida de gas y riesgo de incendio.
Ŷ $OLQKDELOLWDUHO%ORTXHRGHO&RQWUROGH*DV HQDOJXQRV
modelos), asegúrese de que los controles de superficie
se encuentren en la posición OFF (Apagado). Esto
evitará que haya un flujo de gas no intencional desde los
quemadores.
Ŷ 1RXVHSDSHOGHDOXPLQLRSDUDFXEULUUHMLOODVFXDOTXLHU
parte de la cocina. Si se hace esto se podrá
producir envenenamiento con monóxido de carbono,
sobrecalentamiento de las superficies de la cocina o un
posible riesgo de incendio.
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD
ADVERTENCIA
NUNCA cubra ninguna
ranura, agujeros o pasajes en el fondo del horno ni
cubra un estante entero con materiales tales como
papel de aluminio o cobertores de horno. Hacer esto
EORTXHDHOIOXMRGHDLUHDWUDYpVGHOKRUQR\SXHGH
ocasionar envenenamiento con monóxido de carbono.
Nunca coloque papel de aluminio o cobertores de
horno en el fondo del horno. Podrán atrapar el calor,
ocasionando riesgos de humo o incendio.
Ŷ 0DQWpQJDVHDOHMDGRGHODFRFLQDDODEULUODSXHUWDGHO
horno. El aire caliente o el vapor que sale puede causar
TXHPDGXUDVHQODVPDQRVURVWUR\XRMRV
Ŷ &RORTXHORVHVWDQWHVGHOKRUQRHQODXELFDFLyQ
correspondiente mientras éste se encuentra frío. Si
es necesario retirar el estante mientras el horno se
encuentra caliente, evite tocar las superficies calientes.
Ŷ 1RGHMHSURGXFWRVWDOHVFRPRSDSHOXWHQVLOLRVGHFRFLQD
ni comida en el horno cuando no esté en uso. Los
artículos guardados en el horno se pueden incendiar.
Ŷ 1RGHMHQLQJ~QSURGXFWRVREUHODVXSHUILFLHGHFRFFLyQ
cerca de la ventilación del horno. Los artículos se pueden
sobrecalentar, y existe riesgo de incendio o quemaduras.
Ŷ 1XQFDDVHFRQODSXHUWDDELHUWD6HSURKtEHDVDUFRQ
la puerta abierta debido al sobrecalentamiento de las
perillas de control.
Ŷ 1XQFDFRORTXHORVXWHQVLOLRVGHFRFLQDSLHGUDVSDUD
pizza u horneado o cualquier otro tipo de aluminio
o cobertor en la base del horno. Este ítems pueden
atrapar el calor o derretirse, ocasionando daños sobre el
producto y el riesgo de descargas, humo o incendios.
LEA Y GUARDE ESTAS INSTRUCCIONES
6
49-85244
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ESTE ELECTRODOMÉSTICO
ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO CON FUNCIÓN
DE AUTO LIMPIEZ
La función de auto limpieza usa el horno en temperaturas lo suficientemente altas como para consumir restos de comida
que haya dentro del mismo. Para un funcionamiento seguro, siga estas instrucciones.
Ŷ 1RWRTXHODVVXSHUILFLHVGHOKRUQRGXUDQWHHOFLFORGH
limpieza automática. Mantenga a los niños alejados del
horno durante la limpieza automática. Si no se siguen
estas instrucciones, se podrán producir quemaduras.
Ŷ $QWHVGHXWLOL]DUHOFLFORGHDXWROLPSLH]DUHWLUHODVROODV
estantes de metal brillante del horno y otros utensilios
que haya dentro del mismo. Sólo se pueden dejar dentro
del horno los estantes para horno con recubrimiento de
porcelana.
Ŷ $QWHVGHXWLOL]DUHOFLFORGHDXWROLPSLH]DOLPSLHODJUDVD
\UHVWRVGHFRPLGDTXHKD\DHQHOKRUQR8QDFDQWLGDG
excesiva de grasa se puede incendiar, lo cual puede
producir daños con humo en su hogar.
Ŷ 6LHOPRGRGHDXWROLPSLH]DIXQFLRQDGHIRUPDLQFRUUHFWD
apague el horno y desconecte el suministro de corriente.
Solicite el servicio de un técnico calificado.
Ŷ 1RXVHOLPSLDGRUHVSDUDKRUQR1RVHGHEHUiXVDU
limpiador para hornos comerciales ni revestimientos de
protección para hornos de ningún tipo en o alrededor de
cualquier parte del horno.
Ŷ 1ROLPSLHODMXQWDGHODSXHUWD/DMXQWDGHODSXHUWDHV
esencial para un buen sellado. Se debe tener cuidado de
no frotar, dañar ni mover la junta.
Ŷ IMPORTANTE: La salud de algunas aves es
extremadamente sensible a los humos emitidos durante
el ciclo de limpieza automática de cualquier cocina.
Coloque las aves en otra habitación bien ventilada.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
ADVERTENCIA DE LA PROPOSICIÓN 65 DEL ESTADO DE CALIFORNIA
ADVERTENCIA
Este producto contiene uno o más químicos que el Estado de California entiende que producen
cáncer, y defectos en el nacimiento u otros daños reproductivos.
Los hornos con limpieza automática pueden ocasionar exposiciones de bajo nivel a algunas de las sustancias de la
Proposición 65, incluyendo monóxido de carbono, durante el ciclo de limpieza. La exposición a sustancias puede ser
minimizada abriendo una ventana o usando un extractor o campana.
Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje
Con cuidado tome un extremo de la película protectora
de envío con los dedos y lentamente retire la misma de la
superficie del electrodoméstico. No utilice ningún producto
filoso para retirar la película. Retire toda la película antes de
usar el electrodoméstico por primera vez.
Para asegurar que no haya daños sobre el acabado del
producto, la forma más segura de retirar el adhesivo de la cinta
de embalaje en electrodomésticos nuevos es aplicando un
detergente líquido hogareño para lavar platos. Aplique con una
tela suave y deje que se seque.
NOTA: El adhesivo deberá ser eliminado de todas las partes.
No se puede retirar si se hornea con éste dentro.
LEA Y GUARDE ESTAS INSTRUCCIONES
49-85244
7
USO DE LA COCINA: Características de su Cocina
Características de su Cocina
Información de Diseño
NOTA: No todas las características se encuentran en todos los modelos. La apariencia puede cambiar.
3
6
7
4
6 quemadores y plancha
8
9
6 quemadores a gas
10
5
El modelo de horno doble ilustrado incluye un horno pequeño.
Índice de Características
Página
1
Ventilaciones del horno
2
Plancha
11
3
Rejillas de los quemadores de la estufa
32
4
Perilla de Control del Quemador
5
Pantalla del horno
6
Mini perilla
SDUDVHOHFFLRQDU352%( VRQGD 7,0(5 WHPSRUL]DGRU R
Special Features (características especiales)
7
Selector de modo horno
8
Perilla de temperatura del horno
9
Temporizador de cocina
10
Sistema nivelador (4)
1
14
9, 26
13
13, 26
13
13
13, 24
—
2
Tabla para cortar
de bambú
3
Placa de protección
Accesorios Opcionales
8
2
1
Tapa de la Plancha
Página
1
Tabla para cortar de bambú (en algunos modelos)
33
2
Placa de protección
—
3
Tapa de la Plancha (en algunos modelos)
—
49-85244
Encendido Electrónico y Reencendido Automático
La cocina se encuentra equipada con un encendido electrónico
que elimina la necesidad de una luz piloto fija.
Los quemadores de esta cocina vuelven a encenderse
automáticamente si la llamas e apaga.
Todos los encendedores de quemadores de superficie
chispearán y harán chasquidos cuando cualquier quemador
se enciende. No toque ningún quemador cuando los
encendedores se encuentran chasqueando.
Si ocurriera un corte de energía, usted puede encender los
quemadores de superficie con un cerillo. Sostenga un cerillo
encendido cerca d el quemador, luego gire la perilla a la
posición LOW (baja). Tenga mucho cuidado al encender los
quemadores de esta manera.
No intente iluminar la plancha durante un corte de
corriente. El gas que alimenta estos quemadores se cerrará
automáticamente durante un corte de energía.
Ocasionalmente los quemadores pueden chasquear si un
viento o corriente fuertes alejan la llama del sensor de llama
del quemador.
Cómo Encender un Quemador de Superficie
Presione la perilla de control hacia adentro y gírela en sentido
contrario a las agujas del reloj a la posición LITE (encender).
'HVSXpVGHTXHVHHQFLHQGDHOTXHPDGRU gire la perilla
para ajustar el tamaño de la llama.
Para apagar el quemador, gire la perilla en sentido de las
agujas del reloj, hasta el máximo, a la posición OFF.
Ŷ No haga funcionar el quemador durante un período
prolongado sin recipientes de cocción sobre la rejilla. El
acabado de la rejilla puede saltarse sin un recipiente que
absorba el calor.
ADVERTENCIA
Los quemadores sólo deben ser
XVDGRVFXDQGRHVWpQFXELHUWRVSRUORVXWHQVLOLRV/DV
OODPDVGHORVTXHPDGRUHVTXHQRHVWpQFXELHUWDVSRUHO
utensilio presentan un riesgo de incendio o incendio de
telas. Nunca permita que las llamas se extiendan más allá
de los costados del utensilio. Si esto no se cumple, se
podrán producir lesiones graves.
USO DE LA COCINA: Controles de la Estufa
Controles de la Estufa
Quemadores Apilados de Llama Dual
Todos los quemadores de superficie de su cocina cuentan
con dos equipos de llamas apilados uno encima del otro; los
quemadores de llama dual tienen una llama inferior (fuego
lento) y una llama superior (principal).
Cuando se enciende un quemador, la llama inferior siempre se
encenderá y quedará prendida.
Fuego lento:
El diseño de quemadores apilados ofrece una amplia gama
de configuraciones de calor para poder cocinar a fuego lento.
'HSHQGLHQGRGHOWLSR\FDQWLGDGGHDOLPHQWRV\GHOWDPDxR
del recipiente, la llama puede ajustarse a sus necesidades
específicas. La configuración más baja utiliza sólo la llama más
baja y puede mantener alimentos delicados a una temperatura
segura de 140°F.
Cocción:
Las configuraciones desde LO (baja) a X-HI (extra alta)
XWLOL]DQODVOODPDVDOWDV\EDMDV8WLOLFHGHLO (baja) a HI (alta)
SDUDFRFFLyQJHQHUDO8WLOLFHHI (alta) o X-HI (extra alta) para
recipientes de un diámetro mayor
X-HI (extra alta) y HI (alta) son configuraciones muy altas y se
utilizan para dorar alimentos rápidamente y para hervir grandes
cantidades de agua.
Llama inferior
Llama superior
Llama inferior
49-85244
9
USO DE LA COCINA: Cocción Sobre Superficie
10
Cocción Sobre Superficie
Cómo Elegir el Tamaño de la Llama
Mire la llama, no la perilla, mientras reduzca o incremente el
calor.
El tamaño de la llama del quemador a gas debe ajustarse al
recipiente que esté usando.
3$5$810$1(-26(*852'(/265(&,3,(17(6'(
&2&&,Ï1181&$'(-(48(/$6//$0$66((;7,(1'$1
0È6$//È'(/26/$'26'(/265(&,3,(17(68WLOL]DU
llamas de un tamaño mayor a la base de los recipientes no los
calentará más rápido y podría resultar peligroso.
Para lograr estabilidad de la superficie, se recomienda un
UHFLSLHQWHGHFRFFLyQGHXQGLiPHWURPtQLPRGH´8WLOLFH
recipientes de una diámetro mayor en configuraciones de calor
entre HI (alta) y X-HI (extra alta).
Cocción en Wok
Las rejillas de los quemadores cuentan con un diseño único
para poder cocinar en ambos lados. El lado plano se utiliza
con recipientes de base plana (ollas grandes, cacerolas,
VDUWHQHV\ZRNVGHEDVHSODQD PLHQWUDVTXHHOODGRGHOZRN
VHHQFXHQWUDGLVHxDGRSDUDVRVWHQHUXQDYDULHGDGGHZRNVGH
base redonda sin la necesidad de un anillo separado.
Para un acceso sencillo, se recomienda el uso de un
quemador frontal para la cocción con wok.
/DGRSDUDZRN
Lado plano
Se recomienda el quemador frontal central para la cocción con
ZRNHQFRFLQDVGHTXHPDGRUHVGH´\´
1RXVHXQDQLOORGHVRSRUWHSDUDZRN&RORFDUHODQLOORVREUH
el quemador o parrilla podrá hacer que el quemador funcione
de forma inadecuada, produciendo niveles de monóxido de
carbono que superan los estándares permitidos. Esto puede
ser peligroso para su salud.
49-85244
Precauciones de seguridad y nivelación de la plancha (en algunos modelos)
ADVERTENCIA
Riesgo de Incendio
Ŷ 7HQJDFXLGDGRDOFRFLQDUFRPLGDVFRQJUDVD/DJUDVDHVSDUFLGDSXHGHSURYRFDUXQLQFHQGLR
Ŷ 1
XQFDFRORTXHQLJXDUGHXQDUWtFXORHQODSODQFKDLQFOXVRFXDQGRQRHVWpHQXVR(OFDORUGHORVGHPiV
quemadores puede calentar la plancha y provocar un incendio.
Ŷ &
RORTXH\UHWLUHODSODQFKDVyORFXDQGRWRGDVODVSDUULOODV\ODSODQFKDHVWpQIUtDV\WRGDVODVXQLGDGHV
VXSHUILFLDOHVHVWpQHQ2)) $SDJDGR Quite la tapa de metal y la tabla para cortar antes de encender
la plancha.
La ensambladura de la plancha no debe quitarse para la
OLPSLH]D
Tapa de
ventilación de la
plancha
8QDYH]TXHODXQLGDGVHHQFXHQWUDHQVXSRVLFLyQODSODQFKD
puede nivelarse. Quite la tapa de ventilación levantándola
hacia arriba. Asegúrese de no rayar las superficies de acero
inoxidable cercanas mientras quita la tapa de ventilación.
Los dos tornillos internos son tornillos de apriete para asegurar
la plancha en su lugar. Afloje los dos tornillos antes de nivelar.
No quite estos dos tornillos.
Los dos tornillos exteriores son tornillos de nivelación. No
quite estos dos tornillos. Pueden girarse para nivelar la
plancha o para brindar una inclinación hacia adelante para que
las grasas y aceites se escurran de los alimentos que se están
FRFLQDQGR'HVSXpVGHORVSULPHURVXVRVXVWHGSRGUiMX]JDU
la inclinación que mejor se ajuste a los alimentos que está
cocinando y a su preferencia personal.
Tornillos
de nivelación
Tornillos
de apriete
'HVSXpVGHQLYHODUODSODQFKDDMXVWHORVWRUQLOORVGHDSULHWH
para asegurar la plancha en su lugar. Ajuste los tornillos a
PDQRQRDMXVWHGHPiV
Cómo Usar la Plancha
USO DE LA COCINA: Cocción Sobre Superficie
Cocción Sobre Superficie (Cont.)
Limpie la plancha completamente con agua caliente y jabón
antes del primer uso y luego de usos subsiguientes. La
superficie de la plancha es de acero inoxidable Tipo 304
altamente pulido y duradero, reforzado con una placa de
aluminio para una distribución pareja del calor. Aplique una
capa fina de aceite de cocina sobre la superficie de la plancha,
a fin de evitar que la comida se pegue.
Para calendar la plancha, presione y gire la perilla de control
hasta la configuración de temperatura deseada. La luz del
engaste brillará para indicar que el control del termostato se
encuentra en funcionamiento. La plancha es controlada por
termostato y puede ser configurada para mantener cualquier
temperatura entre 200ºF y 450ºF. Espere hasta que la plancha
se precaliente durante 10 minutos antes de colocar comida en
la misma.
NOTA: A diferencia de los quemadores de la superficie, los
cuales usan encendido a chispa, la plancha usa un encendido
SRULQFDQGHVFHQFLD *OR%DU (OJDVIOX\HKDVWDHOTXHPDGRU
de la plancha y el encendido se produce aproximadamente 45
segundos después de que la perilla de control es girada hasta
la temperatura configurada.
49-85244
Alimento
Panqueques
Configuración de
temperatura
375ºF
+DPEXUJXHVDV
400ºF
Tocino*
400ºF
Queso asado
350ºF
+XHYRV
275ºF
*NOTA: Coloque el tocino sobre una plancha fría. No la
precaliente.
11
USO DE LA COCINA:&DUDFWHUtVWLFDVGHVX+RUQR
Características de su Horno
Información de Diseño
NOTA: No todas las características se encuentran en todos los modelos.
7
1
2
11
8
3
%DQGHMDGHOKRUQR
de extensión total
4
9
5
12
6
10
Índice de Características
Sonda de temperatura
Página
1
Traba automática de la puerta del horno
—
2
Elementos para Asar (2)
26
3
Luces halógenas del horno
29
4
Soportes de la bandeja del horno
— 5 posiciones en un horno grande
— 4 posiciones en un horno pequeño
16, 20
5
(OHPHQWRSDUD+RUQHDU GHEDMRGHOSLVRGHOKRUQR
26
6
-XQWDGHODSXHUWDGHOKRUQR
30
7
-XQWDGHODUPD]yQGHOKRUQR
30
8
Salida de la sonda de temperatura
— lado derecho en un horno grande
— lado izquierdo en un horno pequeño
21
9
Ventilador de Convección
10
Puerta del horno
11
%DQGHMD V GHOKRUQRGHH[WHQVLyQWRWDO
— 1 en un horno grande
— 2 en un horno pequeño
12
Sonda de temperatura
19, 20
28, 30
15, 16, 20, 27
21, 28
NOTA: Los modelos con horno pequeño tienen las mismas características de un
horno grande.
2
1
Asadera y rejilla
de la asadera
12
%DQGHMDGHURVWL]DGR
Accesorios Opcionales
Página
1
Asadera y rejilla de la asadera
19, 26
2
%DQGHMDGHURVWL]DGR
19, 26
49-85244
&DUDFWHUtVWLFDVGHO&RQWUROGHO+RUQR\GHO7HPSRUL]DGRU
5
4
3
1
2
1 Selector de modo del horno – Gire el anillo
H[WHULRUSDUDHOHJLU
PROOF (leudado) – Mantiene un medio tibio útil para
leudar productos con levadura.
El selector de modo del horno (1) Y la perilla de temperatura
(2) deben configurarse juntos en uno de los siguientes pares
YiOLGRV
Selector de modo del horno
Perilla de temperatura
BAKE (horneado) – Seleccione para horneado tradicional.
%$.( KRUQHDGR
175º to 550°F
CONV BAKE (horneado por convección) –8WLOLFHSDUD
horneado por convección.
&219%$.( KRUQHDGRSRUFRQYHFFLyQ
175º to 550°F
&219(&7,2152$67 FRQYHFFLyQURVWL]DGR
175º to 550°F
&21952$67 URVWL]DGRSRUFRQYHFFLyQ ±8WLOLFHSDUD
rostizar por convección.
&219(&7,21%52,/ FRQYHFFLyQDVDGR
+,*+ DOWD R
/2:%52,/ DVDGREDMD
%52,/ DVDGR
+,*+ DOWD R
/2:%52,/ DVDGREDMD
BROIL (asado) – Seleccione para asar.
&/($1 OLPSLH]D ±Seleccione para la función de autoOLPSLH]D9HUODVHFFLyQ+RUQRDXWROLPSLDQWH
2 Perilla de temperatura –*LUHSDUDVHOHFFLRQDU
CLEAN (limpieza)
CLEAN (limpieza)
PROOF (leudado)
—
Temperaturas de 175°F a 550°F.
Para cancelar una característica, gire la perilla de selector
de modo del horno o la perilla de temperatura a OFF.
LOW BROIL (asado baja) – Se configura automáticamente
una temperatura de asado menor.
Para cancelar PROOF (leudado), gire el selector de modo del
horno a OFF.
USO DE LA COCINA:&RQWUROGHO+RUQR
Control del Horno
HIGH BROIL (asado alta) – Se configura automáticamente
una temperatura de asado mayor.
&/($1 OLPSLH]D ± Se configura automáticamente la
temperatura de auto-limpieza.
3 Mini-perilla – Gírela para seleccionar y presione para
LQJUHVDUODVFRQILJXUDFLRQHV352%( VRQGD R7,0(5
(temporizador). También para ajustar el tiempo del ciclo
CLEAN (limpieza).
%RWyQGHOWHPSRUL]DGRU – Presione para elegir
la función del temporizador de cocina. El temporizador no
controla las operaciones del horno.
5 Pantalla del horno – Muestra las funciones del
horno tales como las temperaturas del horno y de la sonda
y el temporizador de cocina.
49-85244
13
USO DE LA COCINA:&RQVHMRVGH+RUQHDGR
Consejos de Horneado
Ventilaciones Traseras del Horno
'XUDQWHWRGRVORVPRGRVGHOKRUQRIXQFLRQDXQYHQWLODGRU
interno de enfriamiento. El aire caliente del horno se libera a
través de ventilaciones ubicadas en la parte trasera de la estufa.
No bloquee las
ventilaciones traseras
No permita que el flujo de aire proveniente de las ventilaciones
traseras quede obstruido por recipientes de cocción o toallas.
Papel de Aluminio y Cobertores del Horno
PRECAUCIÓN
No use ningún tipo de aluminio o
cobertor de horno para cubrir el fondo del horno. Estos ítems
pueden atrapar el calor o derretirse, ocasionando daños sobre
el producto y el riesgo de descargas, humo o incendios. Los
daños por uso inadecuado de estos ítems no están cubiertos
por la garantía del producto.
Se podrá usar aluminio para evitar derrames, colocando una
hoja sobre un estante inferior varias pulgadas debajo de la
comida. No use más aluminio que el necesario y nunca cubra
totalmente el estante de un horno con papel de aluminio.
0DQWHQJDHODOXPLQLRDSRUORPHQRV´GHODVSDUHGHVGHO
horno, para evitar una circulación deficiente del calor.
Papel de aluminio para
retener derrames
NOTA: La nota que indica que no se coloque papel aluminio
en el fondo del horno está esmaltada en la base de la cavidad
del horno y está diseñada para resistir temperaturas de autolimpieza. No intente quitarla o rasparla.
Ubicación de Moldes
Para una cocción uniforme y un dorado adecuado, tiene que haber suficiente espacio para la circulación de aire en el horno. Los
resultados del horneado serán mejores si los moldes de horneado se hallan lo más cerca posible del centro del horno, en lugar
de en el frente o en la parte trasera.
Moldes/Bandejas de Horneado
8WLOLFHHOPROGHGHKRUQHDGRDGHFXDGR(OWLSRGHDFDEDGRGHOPROGHDIHFWDHOGRUDGRGHODSUHSDUDFLyQ
Ŷ Los moldes oscuros, ásperos o sin brillo absorben el calor,
ORTXHFUHDXQDFRUWH]DPiVGRUDGD\FUXMLHQWH8WLOLFHHVWD
clase para tartas.
Ŷ Los recipientes de vidrio para hornear también absorben el
calor. Cuando hornee en recipientes de vidrio, puede tener
que reducir la temperatura en 25°F.
Ŷ Los moldes brillantes, claros y lisos reflejan el calor, lo
que crea una dorado más claro y delicado. Los pasteles y
galletas requieren esta clase de molde o bandeja.
Precalentamiento
Permita que el horno se precaliente antes de colocar alimentos
en el horno. El precalentamiento es necesario para obtener
buenos resultados cuando hornee pasteles, galletas, pastelitos
y panes.
14
NOTA: La condensación o neblina al interior del vidrio de la
puerta del horno es normal durante el pre-calentamiento del
horno y por lo general se evaporará hacia el final del ciclo de
pre-calentamiento.
49-85244
Bandejas del Horno de Extensión Total
PRECAUCIÓN
Para evitar posibles quemaduras,
coloque las bandejas en la posición correcta antes de
encender el horno. La posición correcta de la bandeja depende
de la clase de alimento y del nivel de dorado deseado.
Las bandejas cuentan con un armazón que bloquea los
VRSRUWHVVREUHDPERVODGRV8QDYH]TXHHODUPD]yQVH
encuentra bloqueado en su lugar, siempre tire de la bandeja
hacia fuera, de su riel frontal superior, hasta su posición de
extensión total, cuando coloque o quite recipientes de cocción.
Cómo Colocar y Quitar Bandejas del Horno
Para quitar una bandeja:
3DUDUHHPSOD]DUXQDEDQGHMD
1. Asegúrese de empujar la bandeja hasta el fondo del horno.
1. Coloque las trabas traseras de la bandeja sobre y dentro de
los soportes de la parrilla (hay cinco posiciones de parrilla
incluyendo la posición superior).
2. Tome la bandeja desde el riel frontal superior y su riel frontal
inferior y levántela hacia arriba para desbloquear las trabas
de los soportes de la parrilla.
Levante para desbloquear las
trabas de la bandeja frontal
del soporte de la parrilla
Riel frontal
superior
Riel
frontal
inferior
Traba frontal de la bandeja
3. Sosteniendo firmemente los rieles de las bandejas frontales
superior e inferior, tire de la parrilla hacia adelante y quítela
del horno.
Riel frontal
superior
'HVOLFHODEDQGHMDKDFLDHOIRQGRKDVWDTXHODVWUDEDV
traseras de la parrilla se encuentren en los soportes de la
parrilla y presione las trabas frontales de la parrilla dentro de
los soportes frontales de la parrilla.
Riel frontal
inferior
'HVOLFHODEDQGHMDKDVWDHOIRQGR
y presione hacia abajo para
bloquear las trabas frontales
dentro de los soportes frontales
USO DE LA COCINA: Antes de Comenzar
$QWHVGH&RPHQ]DU
Traba
frontal
de la
bandeja
3. Tire la bandeja hacia afuera por completo para verificar que
se halle bien enganchada.
49-85244
15
USO DE LA COCINA:+RUQHDGR
Horneado
Cómo Configurar el Horno Para Hornear
Selector de modo
del horno (exterior)
Perilla de temperatura
del horno (interior)
1. Gire el selector del modo del horno a BAKE (hornear).
8
WLOL]DQGRODSHULOODGHWHPSHUDWXUDFRQILJXUHOD
temperatura deseada, incrementando la temperatura en
unidades de 25°F, de 175°F a 550°F.
E
'
El horno comenzará a precalentarse. La pantalla de
temperatura comenzará en 100ºF y seguirá allí hasta que
HOKRUQRVXSHUHGLFKDWHPSHUDWXUD'HVGHHVHSXQWROD
pantalla mostrará la temperatura actual.
Las luces internas se encenderán y continuarán encendidas
hasta que se apague el horno. El ventilador del horno
por convección se encenderá temporalmente durante
el precalentamiento. El control emitirá un pitido cuando
el horno ya haya precalentado y los alimentos pueden
colocarse dentro del horno.
3. Cuando el horneado haya finalizado, gire el selector de modo
del horno y la perilla de temperatura a OFF (apagado).
NOTA: Se encenderá un ventilador de refrigeración para enfriar
las piezas internas. Esto es normal, y el ventilador puede
continuar funcionando aún después de apagado el horno.
8WLOLFHODVRQGDGHWHPSHUDWXUDFXDQGRUHVXOWHLPSRUWDQWHXQD
temperatura interna precisa. Ver Cómo usar la sonda.
E
'
C
%
A
C
%
A
O coloque cuatro cacerolas en una repisa usando la posición
central C. Coloque las cacerolas de modo que cada una posea
XQHVSDFLRGHDLUHGHSRUORPHQRV´DOUHGHGRUGHOD
misma.
El horno tiene 5 posiciones de bandejas. Ver la sección
%DQGHMDVGHOKRUQRGHH[WHQVLyQWRWDOSDUDFRQVXOWDUFyPR
usar, quitar y reemplazar las bandejas.
La cocina de horno doble cuenta con un horno pequeño con 4
posiciones de bandejas. La posición de bandeja C no existe en
el horno pequeño.
Tipo de alimento
Horno pequeño
Posición de las
bandejas
Pastel “Angel food”
A
A
Galletas o muffins
C
$R%
%L]FRFKRV
C
%
%URZQLHV
%
%
Pasteles de 2 capas
%
%
Pasteles de 4 capas
C
—
%R&
%
Pasteles simples o de 9 x 13
Al hornear cuatro capas de torta al mismo tiempo, use los
HVWDQWHV%\'(VFDORQHODVFDFHURODVGHPRGRTXHQRTXHGH
una directamente sobre la otra.
Horno grande
Posición de las
bandejas
Panes rápidos
C
%
3DVWHOHV%XQGWRGHOLEUD
C
%
Pasteles caseros o bases de masa
para pasteles
%
A
Pasteles congelados
%R&
—
Estofados
%R&
%
C
%
Pizza
Las posiciones de estantes sugeridas deben utilizarse como una guía general.
Experimente con estas posiciones mediante alimentos específicos y
preferencia personal.
16
49-85244
Introducción al Asado
Existen 2 modos diferentes para asar. Elija la configuración HI (alta) o LO (baja).
Ŷ La configuración HI (alta) puede utilizarse para sellar los
jugos o dorar intensamente o carbonizar, cuando sea
necesario, alimentos tales como hamburguesas, vegetales
rostizados, pimientos enteros, berenjenas, maíz, variedad
GHYHJHWDOHVFRUWDGRVNDEREV\FDUQHVPX\ILQDVFRPR
chuletas de cerdo ahumadas, “London broil” y pollo.
Ŷ La configuración LO (baja) puede utilizarse para alimentos
que necesitan un dorado adecuado y también deben
cocinarse por completo, como filetes de pescado, lomo de
cerdo y asado de carne vacuna.
Cómo Configurar el Horno Para Asar
Selector de modo
del horno (exterior)
Perilla de
temperatura
del horno
(interior)
USO DE LA COCINA: Asado
Asado
1. Gire el selector de modo del horno a BROIL (asado).
2. Gire la perilla de temperatura del horno a LO BROIL (asado
baja) o HI BROIL (asado alta). Aparecerán en la pantalla
LO (baja) o HI (alta).
NOTA: Siempre ase con la puerta cerrada. Si la puerta se
deja abierta, en la pantalla aparecerá “CLOSE door” (cerrar la
puerta) y los elementos no se encenderán hasta que se cierre
la puerta.
Las luces internas del horno se encenderán y continuarán
encendidas hasta que se apague el horno.
No está permitido
asar con la puerta
abierta
3. Cuando haya terminado de asar, gire el selector de modo
del horno y la perilla de temperatura a OFF.
NOTA: Se encenderá un ventilador de refrigeración para enfriar
las piezas internas. Esto es normal, y el ventilador puede
continuar funcionando aún después de apagado el horno.
NOTA: El asado no funcionará si la sonda de temperatura se
encuentra enchufada. Nunca deje la sonda dentro del horno
durante un ciclo de asado.
49-85244
17
USO DE LA COCINA: Asado
Asado (Cont.)
Guía de Asado
Las posiciones de estantes sugeridas deben utilizarse como
una guía general. Experimente con estas posiciones con
alimentos específicos y preferencia personal.
E
'
El tamaño, peso, grosor, temperatura inicial y el punto de
cocción preferido afectarán los tiempos de asado. Esta guía
está basada en carnes con temperatura de refrigerador.
C
%
NOTA: En general, las posiciones más altas de la bandeja dan como
resultado un sellamiento externo de los alimentos mientras que las
posiciones más bajas dan como resultado en un nivel de cocción
más completo.
Alimento
Posición de las bandejas
Configuración de calor
Precalentamiento
Asado
Carne picada
'
+, DOWD
—
Pollo (Pechugas con hueso)
%
+, DOWD R/2 EDMD
—
Productos de Panadería
Pan (tostado)
'
+, DOWD R/2 EDMD
—
Pescado Filetes
GHOLEUDDƎDQFKR
'
LO (baja)
5 Minutos
Kabobs (5 pinchos)
'
LO (baja)
5 Minutos
Vegetales en rodajas
'
LO (baja)
5 Minutos
Asado Por Convección
(O0LQLVWHULRGH$JULFXOWXUDGHORV((88DILUPDTXH³ODFDUQHYDFXQDMXJRVDHVPX\SRSXODUSHURGHEHVDEHUVHTXH
DOFRFLQDUODDVyORƒ)DOJXQRVRUJDQLVPRVTXHSURYRFDQLQWR[LFDFLyQSXHGHQVREUHYLYLU´ )XHQWH6DIH)RRG%RRN
<RXU.LWFKHQ*XLGH86'$5HY-XQLR Papel de Aluminio
8VWHGSXHGHXVDUSDSHOGHDOXPLQLRSDUDFXEULUODDVDGHUD\OD
rejilla. Sin embargo, debe ajustarse bien el papel de aluminio a
la rejilla, y efectuarse cortes siguiendo la forma de la misma.
18
49-85244
Introducción a la Cocción por Convección
El ventilador con sistema de convección por aire inverso de se
pausa periódicamente, luego cambia de dirección a fin de generar
una mejor distribución de aire caliente a través del horno. Como
resultado, los alimentos se cocinan y doran en forma pareja, a
menudo en menos tiempo que con el calor normal.
NOTA: El ventilador por convección se apaga cuando se abre
la puerta de horno.
Recipientes Para la Cocción por Convección
Antes de utilizar el horno por convección, verifique que sus
elementos de cocción dejen espacio para la circulación de aire
en el horno. Si va a hornear con varios recipientes, deje un
espacio entre ellos. Además, asegúrese de que los recipientes
no se toquen entre sí o toquen las paredes del horno.
Al hornear galletas, los mejores resultados se logran con una
bandeja para galletas plana en lugar de una bandeja con
lados. Para recetas como pollo al horno, utilice una bandeja
con lados bajos. El aire caliente no puede circular bien
alrededor de los alimentos en una bandeja con lados altos.
/RVUHFLSLHQWHVGHFRFFLyQXWLOL]DGRVHQ%$.( KRUQHDGR FRP~QWDPELpQSXHGHQXVDUVHHQ&219%$.( KRUQHDGRSRU
convección). Ver la sección Consejos de horneado.
Cómo Adaptar Recetas
8VWHGSXHGHXWLOL]DUVXVUHFHWDVIDYRULWDVHQHOKRUQRSRU
convección.
Cuando hornee por convección, puede resultar necesario
reducir la temperatura de horneado en 25°F o ajustar el tiempo
de cocción. No hace falta ajustar la temperatura cuando se usa
CONV ROAST (rostizado por convección).
Algunas instrucciones en paquetes de estofados congelados o
platos principales han sido desarrollados utilizando hornos por
convección comerciales. Para mejores resultados, precaliente
el horno y utilice la temperatura para horneado común indicada
en el paquete.
&RQVHMRVGH5RVWL]DGRSRU&RQYHFFLyQ
8WLOLFHODDVDGHUDODUHMLOOD\ODSDUULOODGHURVWL]DGRSDUD
mejores resultados. Mediante el uso de la parrilla, la parte
inferior de la carne vacuna o de ave se dorará mejor.
Accesorios Opcionales
Parrilla de rostizado
1. Coloque la bandeja del horno en una posición baja (A).
2. Coloque la rejilla sobre la asadera y deposite la parrilla de
rostizado por encima.
3. Coloque la carne sobre la parrilla de rostizado.
USO DE LA COCINA:+RUQHDGRR$VDGRSRU&RQYHFFLyQ
Horneado o Asado por Convección
Rejilla
Asadera
49-85244
19
USO DE LA COCINA:+RUQHDGRR$VDGRSRU&RQYHFFLyQ
Horneado o Asado por Convección (Cont.)
&yPR&RQILJXUDUHO+RUQR3DUD+RUQHDGRR5RVWL]DGRSRU&RQYHFFLyQ
Selector de modo
del horno (exterior))
Perilla de temperatura
del horno (interior)
El horneado por convección es ideal para lograr alimentos con
un dorado parejo cocinados en bandejas únicas o múltiples.
Seleccione rostizado por convección para cocinar cortes de
carne grandes y tiernos sin cubrir.
Cuando se configuran en CONV BAKE (horneado por
convección) o &21952$67 URVWL]DGRSRUFRQYHFFLyQ ,
los elementos por convección traseros y el ventilador funcionan
cuando el horno se encuentra calentando.
3. Cuando la cocción por convección haya finalizado, gire el
selector de modo del horno y la perilla de temperatura a
OFF (apagado).
1. Gire el selector de modo del horno a CONV BAKE
(horneado por convección) o &21952$67 URVWL]DGR
por convección).
NOTA: Se encenderá un ventilador de refrigeración para enfriar
las piezas internas. Esto es normal, y el ventilador puede
continuar funcionando aún después de apagado el horno.
8WLOL]DQGRODSHULOODGHWHPSHUDWXUDFRQILJXUHODWHPSHUDWXUD
deseada, incrementando la temperatura en unidades de
25°F, de 175°F a 550°F.
8WLOLFHODVRQGDGHWHPSHUDWXUDFXDQGRUHVXOWHLPSRUWDQWHXQD
temperatura interna precisa. Ver Cómo usar la sonda.
El horno comenzará a precalentarse. La pantalla de
temperatura comenzará en 100ºF y seguirá allí hasta que
HOKRUQRVXSHUHGLFKDWHPSHUDWXUD'HVGHHVHSXQWROD
pantalla mostrará la temperatura actual.
Horno grande Posición
de las bandejas
Horno pequeño Posición
de las bandejas
Muffins y magdalenas
(bandejas múltiples)
% '
% '
Galletas
(bandejas múltiples)
$& (
% '
Aperitivo congelado
C
—
Aperitivo congelado
(bandejas múltiples)
$& (
—
Rostizado (cortes de
carne grandes)
A
%
Pavo o pollo entero
A
%
Tipo de alimento
Las posiciones de estantes sugeridas deben utilizarse como una guía
general. Experimente con estas posiciones para alimentos específicos
y preferencia personal.
20
Las luces internas se encenderán y continuarán encendidas
hasta que se apague el horno. El ventilador del horno por
convección se encenderá durante el precalentamiento. El
control emitirá un pitido cuando el horno ya haya precalentado
y los alimentos pueden colocarse dentro del horno.
E
'
C
%
A
El horno tiene 5 posiciones de bandejas. Ver la sección
%DQGHMDVGHOKRUQRGHH[WHQVLyQWRWDOSDUDFRQVXOWDUFyPR
usar, quitar y reemplazar las bandejas.
La cocina de horno doble cuenta con un horno pequeño con 4
posiciones de bandejas. La posición de bandeja C no existe en
el horno pequeño.
49-85244
&yPRXVDUOD6RQGDFRQ+RUQHDGR+RUQHDGRSRU&RQYHFFLyQ\5RVWL]DGRSRU&RQYHFFLyQ
ADVERTENCIA
El consumo de comida semicruda puede hacer que se contraigan enfermedades producidas
por la comida. Use la sonda de acuerdo con las siguientes instrucciones, a fin de asegurar que todas las partes
de la comida alcancen temperaturas de cocción mínimamente seguras. Puede encontrar recomendaciones de
temperaturas de cocción mínimamente seguras en www.foodsafety.gov o en www.IsItDoneYet.gov.
PRECAUCIÓN
8WLOLFHDJDUUDGHUDVFXDQGR
introduzca o quite la sonda del horno caliente. Las áreas que
rodean la entrada de la sonda pueden estar muy calientes.
En muchos alimentos, especialmente asados y carnes de ave,
la temperatura interna de los alimentos es la mejor prueba
para verificar el grado de cocción. Mediante la sonda de
temperatura se evita tener que adivinar el estado de cocción y
se logra el punto de cocción exacto.
Salida
de la sonda
/DVRQGDSXHGHXVDUVHFRQ%$.( KRUQHDGR &219%$.(
(horneado por convección) y CONV ROAST (rostizado por
convección).
1. Introduzca la punta de la sonda dentro de la parte más
gruesa de la carne.
2. Coloque la bandeja en la posición deseada.
3. Configure los controles del horno. Gire el selector de modo
del horno a CONV BAKE (horneado por convección),
&21952$67 URVWL]DGRSRUFRQYHFFLyQ o BAKE
(horneado). Gire la perilla de temperatura a la temperatura
de horno deseada, incrementando la temperatura en
XQLGDGHVGHƒ)GHƒ)Dƒ)'HMHTXHHOKRUQR
se precaliente si fuese necesario. El horno y las luces
del horno se encenderán inmediatamente y continuarán
encendidas hasta que se apague el horno.
8
WLOLFHDJDUUDGHUDVSDUDFRORFDUODFRPLGDHQHOKRUQR
caliente. Introduzca el enchufe en la salida. Verifique que
esté introducida hasta el fondo. Cierre la puerta del horno.
5. Gire la mini-perilla para encontrar la temperatura interna
deseada de los alimentos. Presione la mini-perilla para
seleccionar dicha temperatura.
USO DE LA COCINA: Sonda
Sonda
/DVSDODEUDV352%( VRQGD \6(7 FRQILJXUDU GHVWHOODUiQHQ
la pantalla hasta que se seleccione una temperatura. Si no se
configura una temperatura, la sonda utilizará una temperatura
predeterminada de 100°F. Si el horno no se precalentó, la
pantalla mostrará LO (baja).
La temperatura interna de los alimentos puede configurarse
desde un mínimo de 100°F hasta un máximo de 200°F.
Cuando los alimentos alcanzan la temperatura interna
configurada, la pantalla emitirá un pitido. Para detener el pitido,
gire el selector de modo del horno y la perilla de temperatura
D2))8VHDJDUUDGHUDVSDUDTXLWDUODVRQGDGHODVDOLGDGHO
horno.
Para cambiar la temperatura interna configurada en cualquier
momento del proceso de cocción, presione la mini-perilla y
gírela para ajustar la temperatura. Presione la mini-perilla para
seleccionar.
Cómo Usar la Sonda
8WLOLFHVyORODVRQGDD]XOSURYLVWDFRQODFRFLQD
8WLOLFHODVPDQLMDVGHODVRQGD\HOHQFKXIHFXDQGRORV
introduzca y quite de la carne y de la salida del horno.
Cable
Enchufe
Ŷ Para no dañar la sonda, no utilice pinzas para tirar del cable
cuando lo quite.
Ŷ Para no romper la sonda, verifique que los alimentos estén
totalmente descongelados antes de introducirla.
Ŷ Para evitar posibles quemaduras, siempre use una
agarradera cuando quite el enchufe; las superficies internas
del horno pueden estar calientes.
Ŷ Nunca deja la sonda dentro del horno durante un ciclo de
asado o de auto-limpieza.
Sonda
Manijas
La sonda de temperatura cuenta con una sonda similar a
un pincho en un extremo y un enchufe en el otro extremo
que se introduce en la salida del horno.
Ŷ No almacene la sonda en el horno.
49-85244
21
USO DE LA COCINA:6RQGD/HXGDGR
Sonda (Cont.)
Colocación Adecuada de la Sonda
Ŷ Mida la distancia hasta el centro del trozo de carne colocando
ODVRQGDGHWHPSHUDWXUDVREUHODFDUQH8WLOLFHVXSXOJDUR
dedo índice para marcar dónde quedará el extremo de la
carne en la sonda.
Ŷ Introduzca la sonda hasta el punto marcado con su dedo. La
punta de la sonda debe hallarse en el centro de la carne.
Cómo Configurar el Horno Para Leudar
La característica de leudado mantiene un medio tibio que
resulta útil para leudar masas con levadura.
1. Gire el selector de modo del horno a PROOF (leudado). En
la pantalla podrá verse “PrF”. El modo PROOF no funciona
cuando el horno se encuentra por encima de los 125°F. La
SDQWDOODLQGLFDUi³WRRKRW´ GHPDVLDGRFDOLHQWH 'HMHHQIULDU
el horno.
Para mejores resultados, cubra la masa con un paño o con un
envoltorio plástico engrasado.
8WLOLFHODSRVLFLyQGHEDQGHMD%R&GHOKRUQRJUDQGH8WLOLFHOD
SRVLFLyQGHEDQGHMD%HQHOKRUQRSHTXHxR
La característica de leudado brinda automáticamente la
temperatura óptima para el proceso de leudado; por lo tanto, la
perilla de temperatura no afecta la temperatura de leudado.
Las luces internas del horno se encienden y apagan según sea
necesario para mantener una temperatura de leudado óptima
hasta que el selector de modo del horno se haya apagado
(OFF).
PRECAUCIÓN
No utilice el modo de leudado
para calentar alimentos o para mantenerlos calientes. La
temperatura de leudado del horno no es lo suficientemente
caliente para conservar alimentos a temperaturas seguras.
Ŷ Para evitar bajar la temperatura del horno y prolongar
el tiempo de leudado, no abra la puerta del horno
innecesariamente.
Ŷ Verifique que los panes no leuden de más.
2. Cuando el leudado haya finalizado, gire el selector de modo
del horno a OFF.
22
49-85244
3UHFDXFLRQHVGH6HJXULGDGGHOD$XWROLPSLH]D
La característica de auto-limpieza del horno se encuentra
diseñada para facilitar la limpieza de la parte interna del horno
utilizando temperaturas muy elevadas para quemar y eliminar
derrames de alimentos.
ADVERTENCIA
Limpie la grasa excesiva y otros
derrames de alimentos con un paño húmedo. La suciedad
excesiva de alimentos puede prenderse fuego, lo que provoca
humo y daños por calor.
Ŷ No limpie las juntas del horno porque pueden provocarse
daños.
Ŷ Quite los elementos de cocción, asadera, rejilla, sonda y
cualquier trozo de papel de aluminio del horno.
Ŷ Verifique que la lente de la luz del horno y el marco de la
lente se encuentren en su lugar.
Ŷ No utilice limpiadores de horno comerciales, abrasivos o
protectores de horno en o cerca de un horno auto-limpiante.
Ŷ Recomendamos ventilar su cocina con una ventana abierta
RXWLOL]DQGRXQYHQWLODGRUFDPSDQDGXUDQWHHOFLFORGHDXWR
limpieza.
Ŷ Limpie la suciedad ubicada alrededor del armazón o
alrededor de la puerta del horno, en la parte exterior de las
juntas del horno. Estas áreas deben limpiarse a mano.
Ŷ Las bandejas del horno pueden dejarse en el horno durante
el ciclo de auto-limpieza.
IMPORTANTE: Las emanaciones producidas durante el
ciclo de auto-limpieza de cualquier horno afectan la salud de
algunas aves de manera notoria. Procure llevar a sus aves a
otra habitación bien ventilada.
NOTA: El modo de auto-limpieza no funciona si la sonda de
temperatura se encuentra enchufada o si se halla configurado
el modo Sabbat.
En los modelos de horno doble, puede configurarse el ciclo de
limpieza en ambos hornos al mismo tiempo. El último horno
en configurarse automáticamente retardará su inicio hasta la
finalización del ciclo de limpieza del primer horno.
En los modelos de horno doble, se puede hornear en un horno
y efectuar la auto-limpieza en el otro al mismo tiempo.
Sin embargo, no puede usarse la configuración de modo
PROOF (leudado) en un horno mientras el otro se halla
realizando la auto-limpieza.
&yPR&RQILJXUDUHO+RUQR3DUDOD/LPSLH]D
Mini-perilla
Gire para ajustar
Presione para
seleccionar
1. Apague todos los quemadores de la superficie. (El ciclo de
OLPSLH]D no empieza hasta que todos los quemadores de la
superficie se hayan apagado).
2. Gire el selector de modo del horno a &/($1 OLPSLH]D .
3. Gire la perilla de temperatura a la posición CLEAN
OLPSLH]D .
El control automáticamente utiliza el tiempo predeterminado
de ciclo de limpieza recomendado de 5 horas. El ciclo
de limpieza puede ajustarse a cualquier tiempo entre 3 y
5 horas utilizando la mini-perilla. La pantalla mostrará el
tiempo restante.
4. Presione la mini-perilla para iniciar el ciclo CLEAN
OLPSLH]D .
Si en la pantalla aparece “CLOSE door” (cerrar la puerta),
se ha seleccionado el ciclo de auto-limpieza pero no se ha
cerrado la puerta. Cierre la puerta del horno.
49-85244
USO DE LA COCINA:+RUQR$XWROLPSLDQWH
Horno Auto-limpiante
El símbolo
destellará hasta que se bloquee la puerta del
horno. No podrá abrirse la puerta del horno durante el ciclo
de limpieza.
'
HVSXpVGHTXHHOFLFORGHOLPSLH]DKD\DILQDOL]DGR\HO
horno se haya enfriado, aparecerá “End” en la pantalla y el
se apagará. Gire el selector de modo del horno y la
perilla de temperatura a OFF (apagado).
Para interrumpir el ciclo de limpieza, gire el selector de
modo del horno y la perilla de temperatura a OFF. Cuando
la temperatura del horno haya bajado a un nivel seguro, el
símbolo
se apagará indicando que puede abrirse la
puerta.
8QFLFORGHOLPSLH]DTXHVHLQWHUUXPSHQRSXHGHUHLQLFLDUVH
hasta que el horno se enfríe lo suficiente para que la puerta
se destrabe.
23
USO DE LA COCINA:+RUQR$XWROLPSLDQWH
Horno Auto-limpiante (Cont.)
'HVSXpVGHXQFLFORGHOLPSLH]D
Pueden quedar cenizas blancas en el horno. Límpielas con un
paño húmedo después de que se enfríe el horno.
Si el horno no queda limpio después de un ciclo de limpieza,
repítalo.
Si quedan unas manchas blancas, quítelas con agua jabonosa
tibia y enjuague bien con una mezcla de vinagre y agua. En
general, estos depósitos son restos de sal que no pueden
eliminarse durante el ciclo de limpieza.
7HPSRUL]DGRU
NOTA: El temporizador es independiente de todas las otras
funciones y no controla el horno.
3DUDFRQILJXUDUHOWHPSRUL]DGRU
1. Presione el botón 7,0(5 WHPSRUL]DGRU .
2. Gire la mini-perilla para ajustar cualquier período de tiempo
de hasta 12 horas y presiónela para seleccionarlo.
En los modelos de horno doble, cada control del horno cuenta
con su propia función de temporizador. Cada temporizador
puede configurarse en forma independiente.
El control emitirá un pitido cuando quede 1 minuto de tiempo
restante y la pantalla mostrará los segundos hasta que el
WHPSRUL]DGRUKDJDODFXHQWDUHJUHVLYDKDVWD&XDQGR
HOWHPSRUL]DGRUDOFDQFHHOFRQWUROHPLWLUiSLWLGRV
seguidos de 1 pitido cada 6 segundos hasta que se presione
la mini-perilla.
Mini-perilla
Gire para ajustar
Presione para seleccionar
NOTA: El temporizador no puede utilizarse mientras el horno
está efectuando la auto-limpieza. (En los modelos de horno
doble, puede utilizarse el temporizador del horno que no se
encuentra en el modo de auto-limpieza).
3DUDFDQFHODUHOWHPSRUL]DGRU
1. Presione el botón 7,0(5 WHPSRUL]DGRU .
2. Gire la mini-perillaD\SUHVLRQHSDUDVHOHFFLRQDU
3DUDDMXVWDUHOWHPSRUL]DGRUGHVSXpVGHOLQLFLR
1. Presione el botón 7,0(5 WHPSRUL]DGRU .
2. Gire la mini-perilla hasta alcanzar un nuevo tiempo
deseado y presione para seleccionar.
24
49-85244
Ajuste del termostato del horno
Es posible que su nuevo horno cocine de manera diferente
DODTXHXVWHGVHHQFXHQWUDDFRVWXPEUDGR8WLOtFHORGXUDQWH
algunas semanas para familiarizarse con sus funciones. Si
luego de este período considera que la temperatura del horno
es demasiado baja o demasiado alta, usted puede regular el
termostato.
En los modelos de horno doble, utilice los controles del horno
grande para ingresar el modo y para seleccionar el ajuste.
Para ajustar el termostato del horno:
1. Presione y sostenga el botón 7,0(5 WHPSRUL]DGRU
y la mini-perilla al mismo tiempo durante 4 segundos
hasta que en la pantalla aparezca “SF” (Special Features,
características especiales).
2. Gire la mini-perilla en sentido contrario a las agujas
del reloj hasta que en la pantalla aparezca “OFFSEt”
(desplazamiento). Presione la mini-perilla para seleccionar
el modo desplazamiento.
3. Gire la mini-perilla para ajustar el termostato del horno
hasta 35°F más o 35°F menos, incrementándose en
unidades de 1°F.
3A. En modelos de horno doble, el termostato del horno
pequeño puede ajustarse girando la mini-perilla
XELFDGDVREUHHOKRUQRSHTXHxR8WLOLFHODmini-perilla
del horno grande para seleccionar dicho ajuste.
Mini-perilla
Gire para ajustar
Presione para seleccionar
4. Presione la mini-perilla para seleccionar su elección y
para salir de dicho modo. Si no desea guardar los cambios,
presione el botón TIMER (temporizador) para salir en
cualquier momento.
NOTA: Este ajuste sólo afecta las temperaturas de horneado,
horneado por convección y rostizado por convección; no
afecta las temperaturas de asado o de auto-limpieza. El ajuste
se conservará en la memoria aún después de un corte de
energía.
No utilice termómetros, como los que se venden en las
tiendas, para verificar la configuración de temperatura del
horno. Esos termómetros pueden variar entre 20-40 grados.
Modo Sabbat
Para configurar el modo Sabbat:
El modo Sabbat se encuentra diseñado para utilizar en el
Sabbat judío y en otras festividades judías.
Sólo puede ser utilizado para hornear. No puede utilizarse para
otros modos de cocción.
Cuando se configura la característica de Sabbat, se
desactivan la luz del horno y todos los pitidos audibles. La
característica también ofrece un período de retardo aleatorio,
de aproximadamente 30 segundos a 1 minuto, antes de
que el horno se encienda una vez que se ha configurado en
%$.( KRUQHDU 1. Presione y sostenga el botón TIMER (temporizador) y la
mini-perilla al mismo tiempo durante 4 segundos hasta
que en la pantalla aparezca “SF” (Special Features,
características especiales).
2. Gire la mini-perilla en sentido de las agujas del reloj hasta
TXHHQODSDQWDOODDSDUH]FD³6$EE$W+´ 6DEEDW 3UHVLRQH
la mini-perilla para seleccionar el modo Sabbat.
Mini-perilla
Gire para ajustar
Presione para seleccionar
USO DE LA COCINA: Características Especiales
Características Especiales
La configuración de Sabbat controla ambos hornos. El símbolo
aparecerá en las dos ventanas de visualización de los hornos.
Para modelos de horno doble, utilice el control del horno grande
para configurar la característica Sabbat en ambos hornos.
Para cancelar el modo Sabbat:
5HSLWDORVSDVRV\3RGUiYHUVH³6$EE$W+2))´ 6DEEDW
apagado) en la pantalla.
La temperatura del horno puede ajustarse en cualquier
momento girando la perilla de temperatura. Antes de que
respondan los elementos del horno existe un retardo aleatorio.
8QDYH]TXHVHKD\DVHOHFFLRQDGR³6$EE$W+´ODSDQWDOOD
PRVWUDUi³6$EE$W+21´ 6DEEDWHQFHQGLGR Modo Sabbat certificado
49-85244
25
CUIDADO Y LIMPIEZA:3DQHOGH&RQWURO\3HULOODV4XHPDGRUHVGHO+RUQR$VDGHUD5HMLOOD\3DUULOODGH5RVWL]DGR
26
Panel de Control y Perillas
Asegúrese de que todos los controles estén apagados y que las superficies estén frías antes de limpiar cualquier parte de la cocina.
Si se quita la cocina para efectuar una limpieza, reparaciones o cualquier
ADVERTENCIA otra razón, verifique que el dispositivo anti-volcaduras se coloque de
manera adecuada cuando vuelva a instalarse la cocina. Si no toma esta
precaución, la cocina puede volcarse y provocar lesiones.
Limpie los derrames con un paño húmedo. Quite suciedades
más rebeldes con agua tibia jabonosa.
No utilice abrasivos de ninguna clase sobre el panel de control
y las perillas.
Para una limpieza más sencilla, las perillas de control pueden
quitarse. Para quitar una perilla, tire de la misma directamente
del panel de control. Lave las perillas en agua caliente
jabonosa, pero no las deje sumergidas.
NOTA: La mini-perilla no puede quitarse.
0LQL%RXWRQ
Quemadores del Horno
No intente limpiar los elementos para asar. Cualquier suciedad
se quemará cuando el quemador se caliente.
Los elementos para hornear y de convección no están expuestos.
$VDGHUD5HMLOOD\3DUULOODGH5RVWL]DGR
La asadera, rejilla y parrilla de rostizado son todas aptas para
lavaplatos. Sin embargo, los elementos pegados durante el
horneado pueden necesitar limpieza a mano con un limpiador
de horno comercial o un detergente abrasivo.
Accesorios Opcionales
Parrilla de rostizado
No guarde una asadera o rejillas sucias dentro del horno.
Siempre elimine los restos de grasa.
PRECAUCIÓN
No limpie la asadera, la rejilla o la
parrilla de rostizado en el horno auto-limpiante.
Rejilla
Asadera
49-85244
Las bandejas pueden permanecer en el horno durante el ciclo
de auto-limpieza sin sufrir daños.
Periódicamente, después de varios ciclos de auto-limpieza,
las bandejas del horno pueden necesitar el uso del lubricante
de grafito enviado con su cocina. Para solicitar lubricante de
grafito adicional, llame a nuestro centro nacional de repuestos
DOFRQODUHIHUHQFLD:%7
Lado derecho
Guía lado
derecho arriba
4
XLWHODEDQGHMDGHOKRUQR9HUODVHFFLyQ%DQGHMDVGHO
horno de extensión total.
2. Extienda por completo la bandeja sobre una mesa o
mostrador de encimera. Puede colocarse papel de diario
debajo de la bandeja para una limpieza sencilla.
5. Repita en el mecanismo del lado derecho de la guía.
Lado izquierdo
3. Si hay residuos en las guías de deslizamiento, límpielas con
una toalla de papel. NOTA: Todo el lubricante de grafito
que se haya eliminado durante la limpieza debe volver a
colocarse.
Guía lado
derecho arriba
6. Abra y cierre la guía varias veces para distribuir el
lubricante.
5
HHPSODFHODWDSDGHOOXEULFDQWH\DJtWHODQXHYDPHQWH'p
vuelta la bandeja y repita los pasos 3, 4, 5 y 6.
8. Cierre la bandeja, gire la bandeja dejando el lado derecho
hacia arriba y colóquela en el horno. Ver la sección
%DQGHMDVGHOKRUQRGHH[WHQVLyQWRWDO
9. Repita los pasos anteriores para cada bandeja.
4. Agite el lubricante de grafito antes de abrirlo. Comenzando
con el mecanismo de deslizamiento izquierdo de la guía,
coloque cuatro (4) gotas de lubricante sobre las dos (2)
guías traseras cercanas a los cojinetes de apoyo.
49-85244
NOTA: No utilice un pulverizador de cocción u otros
pulverizadores lubricantes sobre los deslizadores.
CUIDADO Y LIMPIEZA:%DQGHMDVGHO+RUQR
Bandejas del Horno
27
CUIDADO Y LIMPIEZA:3XHUWDGHO+RUQR'HVPRQWDEOH6RQGD
Puerta del Horno Desmontable
La puerta es muy pesada. Tenga cuidado al quitar y levantar la puerta.
Ranura
No levante la puerta de la manija.
Para quitar la puerta:
1. Abra la puerta por completo.
2. Presione las trabas de la bisagra hacia abajo en dirección
del armazón de la puerta hasta destrabarlas. Puede
necesitarse una herramienta, como un destornillador plano.
3. Tome con firmeza ambos lados de la puerta de la parte
superior.
Traba de la bisagra
Tire las trabas de la bisagra hacia abajo para destrabar
4. Cierre la puerta hasta su posición de remoción
(aproximadamente 15 grados desde la posición cerrada)
y levántela hacia arriba y afuera hasta que el brazo de la
bisagra quede liberado de la ranura.
3DUDUHHPSOD]DUODSXHUWD
1. Tome con firmeza ambos lados de la puerta de la parte
superior.
Posición de
remoción
2. Con la puerta en el mismo ángulo de la posición de
remoción, introduzca la muesca del brazo de la bisagra
dentro del extremo inferior de la ranura de la bisagra. La
ranura del brazo de la bisagra debe estar bien colocada en
la parte inferior de la ranura.
3. Abra la puerta por completo. Si la puerta no se abre por
completo, la muesca no está bien colocada en el extremo
inferior de la ranura.
4. Presione las trabas de la bisagra hacia arriba contra el
armazón frontal de la cavidad del horno, hasta alcanzar la
posición de trabado.
5. Cierre la puerta del horno.
Posición de
reemplazo
Extremo inferior
de la ranura
%UD]RGHODELVDJUD
Muesca
%UD]RGH
la bisagra
Traba de la
bisagra
Presione las trabas de la bisagra hacia arriba para trabar
Sonda
Permita que la sonda de temperatura se enfríe antes de
limpiarla.
La sonda debe limpiarse a mano con agua y jabón.
No sumerja la sonda de temperatura en agua.
No almacene la sonda de temperatura en el horno.
No limpie la sonda de temperatura en el horno auto-limpiante.
28
49-85244
ADVERTENCIA
PELIGRO DE DESCARGA
ELÉCTRICA O QUEMADURAS: Antes de reemplazar la
bombilla del horno, desconecte la alimentación de energía al
horno desde el panel principal de fusibles o del interruptor de
circuitos. No hacerlo puede provocar una descarga eléctrica o
una quemadura.
PRECAUCIÓN
RIESGO DE INCENDIO: La tapa de
vidrio y la lámpara de luz se deberán retirar cuando estén frías.
Tocar el vidrio caliente sin protección en las manos o con un
trapo húmedo puede ocasionar quemaduras.
Los hornos están equipados con columnas de luces halógenas
ubicadas en la paredes laterales del horno. Las luces se
encienden cuando se abre la puerta o cuando el horno se
encuentra en un ciclo de cocción.
3DUDUHHPSOD]DU
8WLOLFHXQIRFRKDOyJHQRQXHYRGHYROWLRV
con clavijas G8, que no supere los 25 vatios.
Pueden adquirirse focos de repuesto llamando al
6ROLFLWHHOQ~PHURGHSLH]D:%7
NOTA: El uso de focos de un vataje mayor puede dañar su
horno.
Retire el foco de su envoltorio utilizando guantes o un trapo
seco. No toque el foco con las manos desnudas. El aceite de
las manos desnudas puede provocar puntos calientes en la
superficie de vidrio y causar una falla prematura del foco. Si
toca el vidrio, límpielo con alcohol antes de la instalación.
1. Empuje por completo el foco en línea recta dentro del
receptáculo.
Cada ensambladura de luz está compuesta por una tapa
de luz desmontable con dos ganchos de trabado y un
compartimento de luz con tres focos halógenos.
Verifique que la tapa de la lámpara y el foco se hayan enfriado
por completo. Para mayor seguridad, no toque el foco con las
manos desnudas o con un trapo húmedo.
Para quitar:
4XLWHODVEDQGHMDVGHOKRUQR9HUODVHFFLyQ%DQGHMDVGHO
horno de extensión total.
8WLOL]DQGRXQDOODYHGHWXHUFDVGH´TXLWHODVFXDWUR
tuercas que sostienen los soportes de la bandeja a la pared
del horno.
2. Reemplace la tapa de la luz, colocando el extremo frontal
bajo las dos lengüetas frontales del compartimento de luz.
Coloque el extremo trasero en su lugar, verificando que esté
bien firme.
NOTA: Si los ganchos de trabado se cayeron de la tapa de
la lente de vidrio, sosténgalos sobre la tapa, en la posición
correcta, mientras reemplaza la tapa del compartimento de
la luz.
Ganchos de
trabado
3. Quite la tapa de luz de vidrio tirando su extremo trasero
hacia afuera y acercándolo hacia usted. No quite ningún
tornillo.
CUIDADO Y LIMPIEZA:/XFHVGHO+RUQR
Luces del Horno
Coloque el extremo
frontal de la tapa de
la lente bajo las dos
lengüetas frontales
Presione la tapa de la luz en su lugar
/DWDSDGHODOX]GHEHHVWDUHQVXOXJDUFXDQGRXWLOLFHHO
horno.
3. Reinstale el soporte de la bandeja. Asegúrese de orientar
el soporte de modo que las lengüetas superiores para las
tuercas se encuentren lo más cerca posible de la parte
superior del horno. Asegure suavemente con las cuatro
tuercas quitadas con anterioridad, pero no ajuste de más
porque el esmalte puede saltarse.
8WLOL]DQGRJXDQWHVRXQWUDSRVHFRUHWLUHHOIRFRGHOX]
quemado tirando en línea recta hacia fuera.
5HHPSODFHODVEDQGHMDV9HUODVHFFLyQ%DQGHMDVGHOKRUQR
de extensión total.
5. Reconecte la energía eléctrica al horno.
49-85244
29
CUIDADO Y LIMPIEZA: Superficies
30
Superficies
Para Limpiar la Puerta
El armazón y la puerta del horno, fuera de las juntas del horno,
deben limpiarse a mano. Las superficies esmaltadas deben
limpiarse con agua caliente jabonosa. Ver la sección Superficies
de acero inoxidable para todas las áreas de acero inoxidable.
No frote o limpie la junta de la puerta, dado que el material
de fibra de vidrio de la junta tiene un resistencia muy baja
DODDEUDVLyQ8QDMXQWDGHOKRUQRLQWDFWD\ELHQDMXVWDGD
resulta esencial para una operación con buen rendimiento
de la energía y buenos resultados de horneado. Si la junta
se desgasta, rompe o daña o cambia de lugar, un técnico
calificado debe cambiarla de inmediato.
Superficies de Acero Inoxidable
No utilice almohadillas de acero ya que rayan la superficie en
forma permanente.
Para limpiar la superficie de acero inoxidable, utilice agua tibia
jabonosa o un limpiador de acero inoxidable. Siempre limpie
la superficie en dirección de la veta. Siga las instrucciones del
producto para limpiar la superficie de acero inoxidable.
Para consultar sobre la compra de limpiadores de acero
inoxidable, llame en forma gratuita al 800.626.2002 o visite
GEAppliances.com.
Base del Horno
La base del horno tiene un acabado de esmalte de porcelana.
Para hacer la limpieza más fácil, proteja la base del horno de
GHUUDPHVH[FHVLYRV8QDOiPLQDGHDOXPLQLRPiVSHTXHxDR
una lata se puede usar para recoger los derrames colocándola
en la bandeja debajo de la bandeja en la cual usted está
cocinando. Esto es particularmente importante al hornear un
pastel de frutas u otros alimentos que son altamente ácidos.
Los rellenos de fruta caliente u otros alimentos que tienen alto
QLYHOGHiFLGR FRPRORVWRPDWHVHOVDXHUNUDXW\ODVVDOVDV
con vinagre o jugo de limón) pueden causar que el esmalte de
la porcelana se pele y se dañe, por lo que se debe limpiar de
inmediato.
Nunca cubra completamente una bandeja con papel aluminio.
Esto impedirá la circulación del calor y resultará en un
horneado deficiente.
Para limpiar los derrames use agua y jabón, un limpiador
abrasivo o esponjilla de restregar con jabón. Enjuague bien
para eliminar el jabón antes de hacer la auto-limpieza.
49-85244
(OTXHPDGRUFRQVWDGHWUHVSDUWHV/DEDVHGHOTXHPDGRUHO
cabezal del quemador y la tapa del quemador. El cabezal y la
tapa del quemador pueden quitarse a fin de facilitar la limpieza.
PRECAUCIÓN
1287,/,&((/48(0$'256,1
72'$6/$63,(=$6(168/8*$5
Los quemadores de superficie debe limpiarse regularmente, en
especial después de sufrir derrames, lo que podría obstruir las
ranuras y orificios de los cabezales de los quemadores.
El electrodo se encuentra en la parte trasera de cada
quemador. No intente desarmar o limpiar un quemador
mientras otro se encuentre encendido. Puede provocarse una
descarga eléctrica.
/LPSLH]D
Quite todas las piezas del quemador sólo cuando estén
frías. Lávelas en agua caliente jabonosa. Puede utilizarse
una almohadilla plástica para quitar las partículas de comida
quemada y pegada.
Para remover alimentos quemados y pegados, deje en
remojo los cabezales de los quemadores en una solución
de detergente líquido suave y agua caliente durante 20-30
minutos. Para manchas más rebeldes, utilice una almohadilla
plástica o un cepillo de dientes.
Si el derrame ingresa a la ensambladura del cabezal del
quemador, lávela bajo agua corriente y agítela para remover el
exceso de agua.
'HVSXpVGHODOLPSLH]D
Tapa del
quemador
'HVSXpVGHUHHPSOD]DUODVSLH]DVGHOTXHPDGRUDJtWHODVSDUD
quitar el exceso de agua y luego séquelas bien.
3DUDUHHPSOD]DUODVSLH]DVGHOTXHPDGRU
Cabezal del
quemador
Asegúrese de que las piezas de los quemadores se coloquen
en los lugares correctos.
%DVHGHO
quemador
1. Reemplace el cabezal del quemador sobre la base del
quemador, verificando que el orificio del cabezal se
HQFXHQWUHELHQDOLQHDGRFRQHOHOHFWURGRGHODEDVH8Q
espacio pequeño entre la base y el cabezal resulta normal.
Electrodo
2. Coloque la tapa del quemador sobre el cabezal del
quemador. Verifique que la tapa del quemador esté bien
colocada sobre el cabezal del quemador.
3DUDTXLWDUODVSLH]DVGHOTXHPDGRU
1. Gire todos los controles a OFF (apagado) antes de quitar
piezas de los quemadores.
2. Cuando se enfríen, usted puede levantar las rejillas,
las tapas y los cabezales del quemador para efectuar
una limpieza más sencilla. No quite las bases de los
quemadores.
NOTA:(OPRGHOR=*3FXHQWDFRQWDPDxRVGLIHUHQWHVGH
quemadores. Asegúrese de reemplazar los quemadores en la
misma ubicación.
49-85244
Tapa del quemador bien colocada
Tapa del quemador mal colocada
CUIDADO Y LIMPIEZA:4XHPDGRUHV$SLODGRVGH/ODPD'XDO
Quemadores Apilados de Llama Dual
31
CUIDADO Y LIMPIEZA:(QFHQGHGRUSRU&KLVSD\(OHFWURGRV5HMLOODVGHO4XHPDGRU
32
Encendedor por Chispa y Electrodos
El electrodo del sistema de encendido electrónico se encuentra
ubicado en la parte trasera de la base del quemador. Cuando
limpie la estufa, tenga cuidado de no enganchar el encendedor
con el paño de limpieza. El encendedor podría dañarse.
Limpie esta parte de
metal con una lija.
Tenga cuidado de no empujar la perilla de control hacia
adentro mientras realiza la limpieza. Podría provocar el
accionamiento del encendedor por chispa.
Asegúrese de que los encendedores de cerámica blancos
ubicados sobre la estufa estén secos y limpios. Limpie la
porción de metal del electrodo con un paño suave o una lija.
No trate que quitar el electrodo de la estufa.
No limpie esta parte
de cerámica blanca
con una lija.
Rejillas del Quemador
Las rejillas del quemador de hierro fundido esmaltado deben
limpiarse regularmente.
Las rejillas pueden limpiarse dentro del horno durante el ciclo
de auto-limpieza, o en el lavaplatos. Los armazones deben
limpiarse a mano o en el lavaplatos.
Rejillas
Lávelos en agua caliente jabonosa, enjuague y seque bien.
A pesar de ser resistentes, las rejillas gradualmente irán
perdiendo el brillo, aunque les brinde el mayor cuidado. Esto
se debe a su exposición continua a altas temperaturas.
No haga funcionar el quemador durante un período prolongado
sin recipientes de cocción sobre la rejilla. El acabado de la
rejilla puede saltarse sin un recipiente que absorba el calor.
Armazón
Almohadillas
Para estabilidad, los armazones cuentan con almohadillas de
JRPDHQFDGDHVTXLQD'XUDQWHODOLPSLH]D\HOXVRWHQJD
cuidado de no dañar o enganchar las almohadillas de goma.
49-85244
La grasa de la plancha será drenada a la canaleta para grasa
GHKLHUURIXQGLGRXELFDGDHQHOIUHQWHGHODFRFLQD8QDYH]
que las canaletas se hayan enfriado, pueden quitarse para
efectuar una limpieza más cómoda.
Canaletas para grasa
Para quitar la canaleta para grasa fría de la plancha, deslícela
hacia el frente y levántela.
No permita la acumulación de grasa en las canaletas porque
pueden generar un peligro de incendio. Limpie las canaletas
para grasa tan pronto como se enfríen. Las canaletas para
grasa pueden limpiarse a mano con agua caliente jabonosa
o en el lavaplatos. Limpie cualquier derrame del tazón de la
canaleta con un paño suave.
Para lograr estabilidad, las canaletas cuentan con almohadillas
de goma en la parte frontal. Tenga cuidado de no dañar las
almohadillas cuando las quite para la limpieza.
Plancha (en algunos modelos)
Quite bien la grasa y las partículas de comida de la plancha
utilizando una espátula de metal de lados rectos, mientras
todavía esté caliente.
NOTA: Es normal que la plancha en acero inoxidable se ponga
de color amarillo-café después del uso.
Limpie la plancha con un paño seco, resistente y grueso para
eliminar los residuos restantes y partículas de alimentos. Si la
plancha se limpia con otro elemento que no sea un paño seco,
resistente y grueso, ésta tendrá que volver a curarse.
Nunca llene la plancha caliente con agua fría. Esto podría
quebrar o torcer la plancha.
Tabla Para Cortar (en algunos modelos)
Limpie la tabla para cortar de bambú con agua tibia y jabón
VXDYH'HYH]HQFXDQGROtPSLHODFRQDFHLWHPLQHUDO
No lave la tabla para cortar en el lavaplatos.
49-85244
Accesorios Opcionales
CUIDADO Y LIMPIEZA:&DQDOHWDV3DUD*UDVD3ODQFKD7DEOD3DUD&RUWDU
Canaletas Para Grasa (en algunos modelos)
33
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
34
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite solicitar
reparaciones. Si se produce un error en el funcionamiento del control, un código de falla titilará en la pantalla. Registre el código
de error y llame al servicio técnico.
Problema
Causa Posible
El Horno No Funciona
El fusible puede haberse quemado o el interruptor de circuitos puede haber saltado.
Los controles del horno no están bien configurados.
Los controles del horno están configurados para limpieza. Si fuera necesario, deje enfriar el horno; luego abra la
puerta.
9HULILTXHTXHHOVHOHFWRUGHPRGRGHOKRUQRHVWpFRQILJXUDGRHQ%$.( KRUQHDU \TXHODSHULOODGHWHPSHUDWXUD
esté configurada en una temperatura.
Las Luces Del Horno
No Funcionan
El foco de luz no funciona. Cambie el foco.
El horno se encuentra en el modo de auto-limpieza o la característica Sabbat se halla configurada. Las luces del
horno no se encienden durante la auto-limpieza o si la característica Sabbat se encuentra configurada.
El horno está configurado en el modo Proof (leudado). Las luces se encienden y apagan según sea necesario para
mantener la temperatura de leudado.
Los Alimentos No
Or Se Hornean O
5RVWL]DQ'H0DQHUD
Adecuada
/RVFRQWUROHVGHOKRUQRQRHVWiQELHQFRQILJXUDGRV9HUODVHFFLyQ+RUQHDGRR5RVWL]DGR
El horno no se precalentó el tiempo suficiente; espere a que el horno dé la señal de precalentamiento.
Se están utilizando recipientes de cocción incorrectos o de tamaño inapropiado. Ver los Consejos de horneado.
/DVEDQGHMDVQRHVWiQHQODSRVLFLyQFRUUHFWD9HUODVHFFLyQ+RUQHDGRR5RVWL]DGR
8WLOLFHSDSHOGHDOXPLQLRSDUDUHWDUGDUHOGRUDGRGXUDQWHHOURVWL]DGR
El termostato del horno debe ajustarse. Ver la sección Ajuste del termostato del horno.
Los Alimentos No
Se Asan De Manera
Adecuada
Este modelo está diseñado sólo para asado con la puerta cerrada Cierre la puerta. Siempre ase con la puerta
cerrada.
/RVFRQWUROHVGHOKRUQRHVWiQFRQILJXUDGRVHQ%52,/ DVDU 9HUODVHFFLyQ$VDGR
a sonda está enchufada dentro de la salida del horno. Quite la sonda del horno.
Se está usando una posición de bandeja inadecuada.
/RVUHFLSLHQWHVQRVRQDGHFXDGRVSDUDDVDU8VHODEDQGHMDSDUDDVDU\UHMLOODTXHYLQLHURQFRQVXFRFLQD
El papel metálico usado en la asadera y la rejilla no se ha colocado de manera correcta y no se han realizado los
cortes recomendados.
(O+RUQR1R5HDOL]D
/D$XWR/LPSLH]D
/DWHPSHUDWXUDGHOKRUQRHVWiPX\HOHYDGDSDUDFRQILJXUDUODIXQFLyQGHDXWROLPSLH]D'HMHTXHHOKRUQRVHHQIUtH
por debajo de la temperatura de bloqueo y reconfigure los controles.
/RVFRQWUROHVQRHVWiQELHQFRQILJXUDGRV9HUODVHFFLyQ+RUQRDXWROLPSLDQWH
Ruidos De Crujidos O
Chasquidos Durante
/D/LPSLH]D
Esto es normal. Es el sonido del metal calentándose y enfriándose durante las funciones de cocción y limpieza.
Humo Excesivo
'XUDQWH/D/LPSLH]D
El horno está muy sucio. Gire el selector de modo del horno y las perillas de temperatura a OFF (apagado). Abra
las ventanas para que salga el humo Espere hasta que se apague la luz indicadora de bloqueo de la puerta. Limpie
el exceso de suciedad y reconfigure el ciclo de limpieza.
El Horno No Queda
/LPSLR'HVSXpV8Q
&LFOR'H/LPSLH]D
El horno estaba muy sucio. Limpie los derrames más rebeldes antes de iniciar el ciclo de limpieza. Los hornos muy
sucios pueden necesitar un nuevo ciclo de auto-limpieza.
El horno se encuentra conectado a un suministro eléctrico de 208V. Configure el tiempo de limpieza a 5 horas.
/RVFRQWUROHVGHOKRUQRQRHVWiQELHQFRQILJXUDGRV9HUODVHFFLyQ+RUQRDXWROLPSLDQWH
5HVXOWD'LItFLO'HVOL]DU
Las Bandejas Del
Horno
Las bandejas se limpiaron en el ciclo de auto-limpieza y ahora necesitan lubricación periódica. No rocíe con
SXOYHUL]DGRUSDUDFRFLQDUXRWURVOXEULFDQWHVHQVSUD\9HU%DQGHMDVGHOKRUQRGHH[WHQVLyQWRWDOHQODVHFFLyQ
Cuidado y Limpieza.
49-85244
Problema
Causa Posible
(O7HPSRUL]DGRU1R
Funciona
El temporizador no puede utilizarse mientras el horno está efectuando la auto-limpieza.
La Temperatura Del
Horno Es Muy Elevada
O Muy Baja
El termostato del horno debe ajustarse. Ver la sección Ajuste del termostato del horno.
La Puerta Del Horno
1R6H$EUH'HVSXpV
De Un Ciclo De
/LPSLH]D
(OKRUQRHVWiPX\FDOLHQWH'HMHTXHHOKRUQRVHHQIUtHSRUGHEDMRGHODWHPSHUDWXUDGHEORTXHR
En La Pantalla
Aparece “Close Door”
(Cerrar Puerta)
Se ha seleccionado el ciclo de auto-limpieza pero la puerta no está cerrada. Cierre la puerta del horno. El símbolo
Aparece
Activado
Cuando Usted Desea
Cocinar
aparecerá en la pantalla.
La puerta del horno está bloqueada porque la temperatura dentro del horno no ha descendido por debajo de la
WHPSHUDWXUDGHEORTXHR*LUHHOVHOHFWRUGHPRGRGHOKRUQR\ODVSHULOODVGHWHPSHUDWXUDD2)) DSDJDGR 'HMH
enfriar el horno.
)<8Q1~PHUR
Destellan En La
Pantalla
El horno tiene un código de error de función. Gire el selector de modo del horno y las perillas de temperatura a OFF
(apagado). Permita que el horno se enfríe durante una hora. Vuelva a encender el horno.
'HVFRQHFWHODHQHUJtDKDFLDHOKRUQRSRUVHJXQGRV\OXHJRYXHOYDDFRQHFWDUODHQHUJtD6LHOFyGLJRGHHUURU
de función se repite, llame al servicio técnico.
La Pantalla Queda En
Blanco
La pantalla queda en blanco cuando el horno o el temporizador no se encuentran en uso.
8QIXVLEOHSXHGHKDEHUVHTXHPDGRRHOLQWHUUXSWRUGHFLUFXLWRVSXHGHKDEHUVDOWDGR&DPELHHOIXVLEOHR
reconfigure el interruptor de circuito.
La Pantalla No
Muestra “Sf”
Los botones 7,0(5 WHPSRUL]DGRU y MINI-KNOB (mini-perilla) deben presionarse al mismo tiempo y sostenerse
durante 4 segundos.
Aparece “Probe”
(Sonda) En La Pantalla
Esto le recuerda de ingresar una temperatura de sonda después de enchufarla. Ingrese una temperatura de sonda.
Aparece En La
Pantalla
Se ha seleccionado el modo Sabbat.
Corte De Energía
Si el horno se encontraba en uso durante un corte de energía o subida de tensión, el horno debe reconfigurarse.
Gire la perilla de temperatura y el selector de modo del horno a OFF (apagado). Reconfigure los controles para
comenzar de nuevo.
Sale Vapor De La
Ventilación
Cuando se utiliza el modo por convección, es normal ver vapor saliendo de la ventilación del horno. A medida que
el número de bandejas o la cantidad de alimentos a cocinar se incrementa, la cantidad de vapor visible se elevará
Sale Olor A Quemado
O A Aceite Desde La
Ventilación
Esto es normal en un horno nuevo y desaparece con el tiempo.
Olor Penetrante
Esto es temporal. Las primeras veces que se utiliza el horno es normal sentir un olor proveniente del aislante que
recubre la parte interna del horno.
Se Oye Un Ventilador
8QYHQWLODGRUGHHQIULDPLHQWRRXQYHQWLODGRUSRUFRQYHFFLyQ VHJ~QODIXQFLyQTXHVHHVWpXWLOL]DQGR SXHGH
encenderse. Esto es normal. Se encenderá un ventilador de refrigeración para enfriar las piezas internas. Puede
funcionar aún después de que el horno se haya apagado. El ventilador por convección puede encenderse y
apagarse hasta que termine la función o se abra la puerta.
49-85244
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
35
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
36
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
Problema
Causa Posible
El Ventilador De
Convección No Está
Encendido En Todo
Momento
El ventilador de convección (dependiendo de la función que esté usando) puede tener un ciclo de encendido y apagado
hasta que la función termine y la puerta se abra para un mejor desempeño. Esto es normal. Además, el ventilador de
convección puede realizar un ciclo en el sentido del reloj y en sentido contrario hasta que la función termine y la puerta
se abra.
Los Quemadores
No Se Enciende O
Chispean En Forma
Aleatoria
El enchufe eléctrico no se encuentra enchufado a un tomacorriente cargado.
El gas no está encendido.
Las piezas de los quemadores no se volvieron a colocar correctamente.
Los orificios de los anillos de fuego lento o las ranuras de los anillos del quemador se encuentran obstruidos.
Orificio obstruido o quemadores o electrodos húmedos.
/DIXQFLyQ&RRNWRS/RFNRXW %ORTXHRGHOD6XSHUILFLHGH&RFFLyQ HVWiDFWLYDGD
Es posible que haya un fusible quemado en su hogar o que se haya desactivado el disyuntor.
Las Llamas De Los
Quemadores Son
Amarillas O Tienen
Puntas Amarillas
Las piezas de los quemadores no se volvieron a colocar correctamente.
A. Llamas amarillas: Llame al
servicio técnico.
B. Puntas amarillas en los
conos externos: Normal
para gas propano (LP).
&/ODPDVGHD]XOFODUR
Normal para gas natural.
Si las llamas del quemador se parecen a (A), llame al servicio técnico. Las llamas normales de los quemadores
GHEHQVHUFRPR % R & GHSHQGLHQGRGHOWLSRGHJDV
Las Llamas De Los
Quemadores Son Muy
Grandes O Amarillas
La cocina puede estar conectada a un tipo de combustible incorrecto. Comuníquese con la persona que instaló su
cocina o que realizó la conversión.
La Perilla De Control
Del Quemador No Gira
Cuando la perilla se encuentra en la posición OFF, debe presionarse hacia adentro antes de que pueda girarse,
y sólo puede girarse en sentido contrario a las agujas del reloj. Cuando la perilla se encuentra en cualquier otra
posición, ésta puede girarse en cualquier dirección sin presionarse hacia adentro.
Condensación O
Neblina En El Vidrio
Interior De La Puerta
La condensación o neblina en el interior del vidrio de la puerta del horno es normal durante el precalentamiento del
horno y por lo general se evaporará antes del final del ciclo de precalentamiento.
Las Llamas del
Quemador poseen
Parpadeos de Color
Anaranjado
Polvo en el aire, humidificador de vapor frío, desechos en o dentro del quemador.
49-85244
Notas
49-85244
37
GARANTÍA
Garantía de la Cocina a Gas de GE Appliances
GEAppliances.com
Todo el servicio de garantía es provisto por nuestros Centros de Servicio de Fabricación, o un técnico autorizado de Customer Care®.
Para programar una visita del servicio técnico a través de Internet, visítenos en www.geappliances.com/service_and_support/, o
llame a GE Appliances al 800.GE.CARES. Cuando llame para solicitar el servicio, tenga los números de serie y modelo disponibles.
Para realizar el servicio técnico de su electrodoméstico, se podrá requerir el uso de datos del puerto de abordaje para su diagnóstico.
Esto da al técnico del servicio de fábrica de GE Appliances la habilidad de diagnosticar de forma rápida cualquier problema con
su electrodoméstico, y de ayudar a GE Appliances a mejorar sus productos al brindarle a GE Appliances la información sobre su
electrodoméstico. Si no desea que los datos de su electrodoméstico sean enviados a GE Appliances, solicitamos que le indique a su
técnico no entregar los datos a GE Appliances en el momento del servicio.
Por el Período de
*($SSOLDQFHVUHHPSOD]DUi
Un Año
Cualquier parteGHODHVWXIDTXHIDOOHGHELGRDXQGHIHFWRHQORVPDWHULDOHVRODIDEULFDFLyQ'XUDQWH
'HVGHODIHFKDGHOD esta garantía limitada de un año, GE Appliances también proveerá, sin costo, todo el trabajo y el
compra original
servicio en el hogar para reemplazar la parte que presente defectos.
4XpQRFXEULUi*($SSOLDQFHV
Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con
la garantía deberá contar con la prueba de la fecha original de compra.
Ŷ 9LVLWDVDVXKRJDUSDUDHQVHxDUOHDXVDUHOSURGXFWR
Ŷ 'HFRORUDFLyQGHODSODFDGHODSODQFKDRGHODVEDQGHMDV
del horno.
Ŷ 6DOWDGRGHODVUHMLOODVGHHVPDOWHGHSRUFHODQDRGHODV
bandejas del horno.
Ŷ 5HHPSOD]RGHIXVLEOHVGRPpVWLFRVRODUHFRQILJXUDFLyQGHORV
interruptores de circuito.
Ŷ 'DxRVLQFLGHQWDOHVRUHVXOWDQWHVSURYRFDGRVSRUSRVLEOHV
defectos de este aparato.
Ŷ 'DxRVSURYRFDGRVGHVSXpVGHODHQWUHJD
Ŷ 'DxRVDOSURGXFWRSURYRFDGRVSRUDFFLGHQWHVLQFHQGLRV
inundaciones o fuerza mayor.
Ŷ )DOODVGHOSURGXFWRVLVHXWLOL]DSDUDXQREMHWLYRGLIHUHQWHGHO
previsto o si se usa en forma comercial.
Ŷ ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV
Si tiene un problema con la instalación, comuníquese con su
YHQGHGRURLQVWDODGRU8VWHGHVUHVSRQVDEOHGHVXPLQLVWUDU
adecuadas instalaciones eléctricas, de gas, de salida y
otras conexiones como se describe en las Instrucciones de
Instalación incluidas con el producto.
Ŷ 3URGXFWRQRDFFHVLEOHSDUDSUHVWDUHOVHUYLFLRWpFQLFR
solicitado.
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS
Su única y exclusiva alternativa es la reparación del producto, como se indica en la Garantía Limitada. Las
garantías implícitas, incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito
particular, se limitan a un año o al período más corto permitido por la ley.
Esta garantía se extiende al comprador original y a cualquier dueño subsiguiente de productos comprados para
XVRKRJDUHxRGHQWURGH((886LHOSURGXFWRHVWiHQXQiUHDGRQGHQRVHHQFXHQWUDGLVSRQLEOHXQ3URYHHGRU
Autorizado del Servicio Técnico de GE Appliances, usted será responsable por el costo de un viaje o se podrá
requerir que traiga el producto a una ubicación del Servicio Técnico de GE Appliances autorizado para recibir el
VHUYLFLR(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRDVXKRJDU$OJXQRVHVWDGRV
no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía le da derechos legales
específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer cuáles son
sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado.
Garante: GE Appliances, a Haier company
Garante en Canadá: MC Commercial, Burlington, ON, L7R 5B6
Garantías Extendidas: Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que
están disponibles mientras su garantía aún está vigente. Puede acceder a la misma a través de Internet en cualquier
momento en
www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm
o llamando al 800.626.2224 durante el horario comercial. Los Servicios para los GE Appliances aún estarán
disponibles cuando su garantía caduque.
38
49-85244
¿Busca Algo Más?
¡GE Appliances ofrece una variedad de accesorios para
mejorar sus experiencias de cocción y mantenimiento!
Para acceder a números telefónicos e información de sitios
Web, consulte la página de Soporte para el Consumidor.
(VWRV\RWURVSURGXFWRVHVWiQGLVSRQLEOHV
3LH]DV
Tabla para cortar de bambú (en algunos modelos)
ACCESORIOS
Accesorios
Placa de protección
Tapa de la Plancha (en algunos modelos)
%DQGHMD V GHOKRUQRGHH[WHQVLyQWRWDO
%DQGHMDGHOKRUQRGHEDMRSHUILO
Asadera y rejilla de la asadera
Sonda de temperatura
%DQGHMDGHURVWL]DGR
6 Quemadores a Gas
6 Quemadores a Gas con Plancha
49-85244
39
SOPORTE PARA EL CONSUMIDOR
Soporte para el Consumidor
Sitio Web de GE Appliances
¢'HVHDUHDOL]DUXQDFRQVXOWDRQHFHVLWDD\XGDFRQVXHOHFWURGRPpVWLFR"£,QWHQWHDWUDYpVGHO6LWLR:HEGH*($SSOLDQFHVODV
KRUDVGHOGtDFXDOTXLHUGtDGHODxR8VWHGWDPELpQSXHGHFRPSUDUPiVHOHFWURGRPpVWLFRVPDUDYLOORVRVGH*($SSOLDQFHV\
aprovechar todos nuestros servicios de soporte a través de Internet, diseñados para su conveniencia.
(Q((88GEAppliances.com (Q&DQDGi GEAppliances.ca
5HJLVWUHVX(OHFWURGRPpVWLFR
£5HJLVWUHVXHOHFWURGRPpVWLFRQXHYRDWUDYpVGH,QWHUQHWVHJ~QVXFRQYHQLHQFLD8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUi
una mejor comunicación y un servicio más puntual de acuerdo con los términos de su garantía, en caso de surgir la necesidad.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado.
(Q((88GEAppliances.com/register
(Q&DQDGi Prodsupport.mabe.ca/crm/Products/ProductRegistration.aspx
Servicio Programado
El servicio de reparación de expertos de GE Appliances está a sólo un paso de su puerta. Conéctese a través de Internet y programe
VXVHUYLFLRDVXFRQYHQLHQFLDFXDOTXLHUGtDGHODxR(Q((88GEAppliances.com/ge/service-and-support/service.htm
o comuníquese al 800.432.2737 durante el horario de atención comercial.
(Q&DQDGi GEAppliances.ca/en/support/service-request o llame al 800.561.3344
Garantías Extendidas
Adquiera una garantía extendida de GE Appliances y conozca los descuentos especiales que están disponibles mientras su
garantía aún está vigente. La puede adquirir en cualquier momento a través de Internet. Los servicios de GE Appliances aún
estarán allí cuando su garantía caduque.
(Q((88GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm
o comuníquese al 800.626.2224 durante el horario de atención comercial.
(Q&DQDGiGEAppliances.ca/en/support/purchase-extended-warranty o llame al 800.290.9029
Conectividad Remota
Para solicitar asistencia para la conectividad de red inalámbrica (para modelos con acceso remoto),
visite nuestro sitio web en GEAppliances.com/ge/connected-appliances/RFRPXQtTXHVHDOHQ((88~QLFDPHQWH
3LH]DV\$FFHVRULRV
Aquellos individuos calificados para realizar el servicio técnico de sus propios electrodomésticos podrán solicitar el envío de
SLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHV VHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU 2UGHQHKR\DWUDYpVGH
,QWHUQHWGXUDQWHODVKRUDVWRGRVORVGtDV(Q((88GEApplianceparts.com o de forma telefónica al 877.959.8688 durante
el horario de atención comercial.
/DVLQVWUXFFLRQHVTXHILJXUDQHQHVWHPDQXDOFXEUHQORVSURFHGLPLHQWRVTXHVHUiQUHDOL]DGRVSRUFXDOTXLHUXVXDULR
2WURVVHUYLFLRVWpFQLFRVJHQHUDOPHQWHGHEHQVHUGHULYDGRVDSHUVRQDOFDOLILFDGRGHOVHUYLFLR6HGHEHUiWHQHUFXLGDGR
ya que una reparación indebida podrá hacer que el funcionamiento no sea seguro.
Los clientes de Canadá deberán consultar en las páginas amarillas el centro de servicios de MC Commercial más cercano; visite
nuestro sitio web en GEAppliances.ca/en/products/parts-filters-accessories o comuníquese al 800.661.1616.
Contáctenos
Si no se encuentra satisfecho con el servicio que recibió de GE Appliances, comuníquese con nosotros a través de nuestro sitio
:HEFRQWRGRVORVGHWDOOHVLQFOX\HQGRVXQ~PHURWHOHIyQLFRRHVFULEDD
(Q((88*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/ge/service-and-support/contact.htm
(Q&DQDGi'LUHFWRU&RQVXPHU5HODWLRQV0&&RPPHUFLDO,QF_6XLWH)DFWRU\/DQH_0RQFWRQ1%(&0
GEAppliances.ca/en/contact-us
40
Impreso en México
49-85244
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising