GE | PSB9240EFES | Use and Care Manual | GE PSB9240SFSS Use and Care Manual

GE PSB9240SFSS Use and Care Manual
ADVANTIUM OVEN
®
SAFETY INFORMATION
. . . . . . . . .3
ADVANTIUM
Getting to Know Advantium?. . . . . . . . . . . .8
Features . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9
Controls . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
OWNER’S MANUAL
PSB9240
SPEEDCOOKING
Power Level. . . . . . . . . . . . . . . . . . . . . . . . . . 11
Cookware. . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Custom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Menu Guide . . . . . . . . . . . . . . . . . . . . . . . . . . 13
Recipe Features . . . . . . . . . . . . . . . . . . . . . . 15
Things That Are Normal . . . . . . . . . . . . . . . 14
CONVECTION BAKING
. . . . . . . . . 17
BROILING AND TOASTING . . . . . 18
WARMING AND PROOFING . . . . 19
MICROWAVING . . . . . . . . . . . . . . . . .
20
Cookware. . . . . . . . . . . . . . . . . . . . . . . . . . . 20
Pre-Set Selections . . . . . . . . . . . . . . . . . . . 20
Cook By Time . . . . . . . . . . . . . . . . . . . . . . . . 21
Power Levels . . . . . . . . . . . . . . . . . . . . . . . . . 21
Cooking Tips . . . . . . . . . . . . . . . . . . . . . . . . . 21
Defrost . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .22
Sensor Cooking . . . . . . . . . . . . . . . . . . . . . .23
Things That Are Normal . . . . . . . . . . . . . . 24
OTHER FEATURES
. . . . . . . . . . . . . .25
CARE AND CLEANING
Inside of Oven and Accessory Storage
Drawer (with some models) . . . . . . . . . . . .27
Removable Turntable . . . . . . . . . . . . . . . . .27
Cooking Trays and Wire Oven Rack . . . . .28
Halogen Lamp Cover and Mica Sheet . . . .28
Outside of Oven and Accessory Storage
Drawer (with some models) . . . . . . . . . . . .28
TROUBLESHOOTING . . . . . . . . . . .
30
WARRANTY . . . . . . . . . . . . . . . . . . . . . . 31
CONSUMER SUPPORT . . . . . . . . . .32
ESPAÑOL
Write the model and serial
numbers here:
Model # _________________
Para consultar una version en
español de este manual de
instrucciones, visite nuestro sitio de
internet GEAppliances.com.
Serial # _________________
Find these numbers on a label
inside the oven.
GE is a trademark of the General Electric Company. Manufactured under trademark license.
http://geadvantium.com
49-40686-4
12-16 GEA
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.
2
49-40686-4
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING To reduce the risk of burns, electric shock, fire, injury to persons, or exposure to
excessive microwave energy:
When using electrical appliances, basic safety precautions should be followed, including the following:
Ŷ 5HDGDOOLQVWUXFWLRQVEHIRUHXVLQJWKLVDSSOLDQFH
Ŷ 5HDGDQGIROORZWKHVSHFLILFSUHFDXWLRQVLQWKH
PRECAUTIONS TO AVOID POSSIBLE EXPOSURE
TO EXCESSIVE MICROWAVE ENERGY section on
page 7.
Ŷ 8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGXVHDV
described in this manual. Do not use corrosive
chemicals or vapors in this appliance. This oven is
specifically designed to heat, dry or cook food, and is
not intended for laboratory or industrial use.
Ŷ 7KLVDSSOLDQFHPXVWRQO\EHVHUYLFHGE\TXDOLILHG
service personnel. Contact nearest authorized service
facility for examination, repair or adjustment.
INSTALLATION
Ŷ ,QVWDOORUORFDWHWKLVDSSOLDQFHRQO\LQDFFRUGDQFHZLWK
the provided installation instructions.
Ŷ This appliance must be grounded. Connect only
to properly grounded outlet. See “GROUNDING
INSTRUCTIONS” found on page 7.
Ŷ 7KLVPLFURZDYHLV8/OLVWHGIRUVWDQGDUGZDOO
installation. See installation instructions for approved
appliances to mount over and under the microwave.
Ŷ 'RQRWRSHUDWHWKLVDSSOLDQFHLILWKDVDGDPDJHG
power cord or plug, if it is not working properly, or if it
has been damaged or dropped.
Ŷ .HHSFRUGDZD\IURPKHDWHGVXUIDFHV
TO REDUCE THE RISK OF FIRE IN THE CAVITY:
Ŷ 'RQRWRYHUFRRNIRRG&DUHIXOO\DWWHQGDSSOLDQFH
when paper, plastic or other combustible materials
are placed inside the oven to facilitate cooking.
Ŷ 5HPRYHZLUHWZLVWWLHVDQGPHWDOKDQGOHVIURPSDSHU
or plastic containers before placing them in the oven.
Ŷ ,IPDWHULDOVLQVLGHWKHRYHQLJQLWHNHHSWKHRYHQGRRU
closed, turn the oven off and disconnect the power
cord or shut off power at the fuse or circuit breaker
panel.
Ŷ 'RQRWVWRUHDQ\PDWHULDOVLQWKLVRYHQZKHQQRWLQ
use. Do not leave paper products, cooking utensils or
food in the cavity when not in use. All racks should be
removed from oven when not in use.
Ŷ '
RQRWRSHUDWHWKHPLFURZDYHIHDWXUHZLWKRXWIRRGLQ
the oven.
Ŷ '
RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQVXFFHVVLRQ
on the same food portion. If food is undercooked
DIWHUWKHILUVWFRXQWGRZQXVH&22.%<7,0(IRU
additional cooking time.
Ŷ 7
KHZLUHRYHQUDFNVKRXOGQRWEHXVHGIRU
speedcook or microwave cooking to prevent arcing.
TO REDUCE THE RISK OF BURNS:
Ŷ %HFDUHIXOZKHQRSHQLQJFRQWDLQHUVRIKRWIRRG8VH
pot holders and direct steam away from face and
hands.
Ŷ 'RQRWOHWFRUGKDQJRYHUWKHHGJHRIWKHWDEOHRU
counter
Ŷ 9
HQWSLHUFHRUVOLWFRQWDLQHUVSRXFKHVRUSODVWLF
bags to prevent build-up of pressure.
Ŷ 'RQRWLPPHUVHFRUGRUSOXJLQZDWHU
Ŷ %
HFDUHIXOZKHQWRXFKLQJWKHWXUQWDEOHGRRUUDFNV
or walls of the oven which may become hot during
use.
Ŷ 'RQRWFRYHURUEORFNDQ\RSHQLQJVRQWKHDSSOLDQFH
Ŷ 'RQRWVWRUHWKLVDSSOLDQFHRXWGRRUV'RQRWXVHWKLV
product near water—for example, in a wet basement,
near a swimming pool, near a sink or in similar
locations.
Ŷ 'RQRWPRXQWWKLVDSSOLDQFHRYHUDVLQN
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ /
LTXLGVDQGFHUWDLQIRRGVKHDWHGLQWKHPLFURZDYH
oven can present a risk of burn when removing
them from the microwave. The potential for a burn is
greater in young children, who should not be allowed
to remove hot items from the microwave.
READ AND SAVE THESE INSTRUCTIONS
49-40686-4
3
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING Continued
OPERATING
Ŷ $
VZLWKDQ\DSSOLDQFHFORVHVXSHUYLVLRQLV
necessary when used by children.
Ŷ '
RQRWRSHUDWHWKHRYHQZLWKRXWWKHWXUQWDEOHLQ
place. The turntable must be unrestricted so it can
turn.
Ŷ '
RQRWVWRUHDQ\WKLQJGLUHFWO\RQWRSRIWKH
microwave oven surface when the microwave oven
is in operation.
Ŷ 2
YHUVL]HGIRRGVRURYHUVL]HGPHWDOXWHQVLOVVKRXOG
not be inserted in a microwave/convection oven as
they may create a fire or risk of electric shock.
Ŷ D
o not use paper products in oven when
appliance is operating in any cooking mode except
microwave.
Ŷ 6
RPHSURGXFWVVXFKDVZKROHHJJVDQGVHDOHG
containers—for example, closed jars—are able to
explode and should not be heated in this oven.
CLEANING
Ŷ .HHSWKHRYHQIUHHIURPJUHDVHEXLOGXS
Ŷ '
RQRWFOHDQZLWKPHWDOVFRXULQJSDGV3LHFHVFDQ
burn off the pad and touch electrical parts involving
a risk of electric shock.
Ŷ :
KHQFOHDQLQJVXUIDFHVRIGRRUDQGRYHQWKDW
comes together on closing the door, use only mild,
nonabrasive soaps, or detergents applied with a
clean sponge or soft cloth. Rinse well.
SUPER HEATED WATER
Ŷ /LTXLGVVXFKDVZDWHUFRIIHHRUWHDDUHDEOHWR
be overheated beyond the boiling point without
appearing to be boiling. Visible bubbling or boiling
when the container is removed from the microwave
oven is not always present. THIS COULD RESULT
IN VERY HOT LIQUIDS SUDDENLY BOILING
OVER WHEN THE CONTAINER IS DISTURBED
OR A SPOON OR OTHER UTENSIL IS INSERTED
INTO THE LIQUID.
Ŷ '
RQRWRYHUFRRNSRWDWRHV7KH\FRXOGGHK\GUDWH
and catch fire, causing damage to your oven.
Ŷ 7RUHGXFHWKHULVNRILQMXU\WRSHUVRQV
Ŷ '
RQRWFRYHUUDFNVRUDQ\RWKHUSDUWRIWKHRYHQ
with meal foi. This will cause overheating of the
oven.
6WLUWKHOLTXLGERWKEHIRUHDQGKDOIZD\WKURXJK
heating it.
Ŷ &
RRNPHDWDQGSRXOWU\WKRURXJKO\²
meat to at least an INTERNAL temperature
RIƒ)DQGSRXOWU\WRDWOHDVWDQ
,17(51$/WHPSHUDWXUHRIƒ)&RRNLQJWRWKHVH
temperatures usually protects against foodborne
illness.
Ŷ 7KLVRYHQLVQRWDSSURYHGRUWHVWHGIRUPDULQHXVH
'RQRWRYHUKHDWWKHOLTXLG
- Do not use straight-sided containers with narrow
necks.
- After heating, allow the container to stand in the
microwave oven for a short time before removing
the container.
- Use extreme care when inserting a spoon or other
utensil into the container.
WARNING Arcing can occur during both speedcooking and microwave cooking. If you see arcing,
press the CANCEL/OFF pad and correct the problem.
Arcing is the microwave term for sparks in the oven.
Ŷ 0
HWDOFRRNZDUHXVHGGXULQJHLWKHUVSHHGFRRNRU
Arcing is caused by:
PLFURZDYHFRRNLQJ H[FHSWIRUWKHSDQVSURYLGHG
with the oven).
Ŷ 0HWDORUIRLOWRXFKLQJWKHVLGHRIWKHRYHQ
Ŷ
0HWDOVXFKDVWZLVWWLHVSRXOWU\SLQVRU
Ŷ )
RLOQRWPROGHGWRIRRG XSWXUQHGHGJHVDFWOLNH
gold-rimmed dishes, in the oven.
antennas).
Ŷ 5HF\FOHGSDSHUWRZHOVFRQWDLQLQJVPDOOPHWDO
Ŷ 8VHIRLORQO\DVUHFRPPHQGHGLQWKLVPDQXDO
pieces being used in the oven.
READ AND SAVE THESE INSTRUCTIONS
4
49-40686-4
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING SPEEDCOOK OVEN-SAFE COOKWARE
Ŷ 7KHRYHQDQGGRRUZLOOJHWYHU\KRWZKHQ
speedcooking.
Ŷ &RRNZDUHZLOOEHFRPHKRW2YHQPLWWVZLOOEH
needed to handle the cookware.
Ŷ 'RQRWXVHFRYHULQJVFRQWDLQHUVRUFRRNLQJ
roasting bags made of foil, plastic, wax or paper
when speedcooking.
Ŷ 'RQRWFRYHUWKHWXUQWDEOHPHWDOWUD\VRUDQ\SDUW
of the oven with metal foil. This will cause arcing in
the oven.
Ŷ 8VHWKHPHWDOWUD\LQWKHVDPHZD\
you would use a shallow baking pan or baking tray.
Ŷ 'RQRWXVHWKHZLUHRYHQUDFNIRUVSHHGFRRN
Ŷ 3ODFHIRRGGLUHFWO\RQWKHPHWDOWUD\VZKHQFRRNLQJ
unless prompted by the oven to do otherwise.
Ŷ $Q\QRQPHWDORYHQVDIHGLVKFDQEHXVHGLQ\RXU
oven. Recipes in the Advantium Cookbook were
tested in Pyrex® glass cookware and Corningware®
ceramic casseroles. Cook times and results may
vary when using other types of oven-safe dishes.
Place them directly on the trays.
Ŷ 8VHRIWKHFOHDUJODVVWUD\ZKHQVSHHGFRRNLQJZLOO
result in inferior cooking performance and possible
cracking of the glass tray.
Ŷ 8VHRQO\WKHPHWDOWUD\VVSHFLILHGIRUXVHZLWKWKLV
oven. Other metal trays are not designed for use
with this oven and will result in inferior cooking
performance.
The turntable must always
be in place when using the
oven.
Put food directly on
the metal grill tray to
speedcook.
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Put food directly on the metal
tray to convection bake, warm
or toast.
WARNING OVEN-SAFE COOKWARE FOR BAKING, BROILING, WARMING,
PROOFING & TOASTING
Ŷ 7KHRYHQDQGGRRUZLOOJHWYHU\KRWZKHQ
convection baking, broiling, warming or toasting.
Ŷ 3ODFHIRRGGLUHFWO\RQWKHPHWDOWUD\VZKHQFRRNLQJ
XQOHVVWKHUHFLSHUHTXLUHVDGLVK
Ŷ &RRNZDUHZLOOEHFRPHKRW2YHQPLWWVZLOOEH
needed to handle the cookware.
Ŷ $Q\RYHQVDIHGLVKFDQEHXVHGLQ\RXURYHQ
Recipes in the Advantium Cookbook were tested in
Pyrex® glass cookware and Corningware® ceramic
casseroles. Cook times and results may vary when
using other types of oven-safe dishes. Place them
directly on the trays.
Ŷ 'RQRWFRYHUGLVKHVRUXVHSODVWLFFRQWDLQHUV
plastic cooking/roasting bags, plastic wrap, wax
paper or paper when broiling or toasting.
Ŷ 8VHWKHPHWDOWUD\LQWKHVDPHZD\\RXZRXOGXVH
a shallow baking pan or baking tray.
Ŷ 8VHWKHZLUHRYHQUDFNZKHQFRQYHFWLRQEDNLQJRU
warming on two levels.
The turntable must always
be in place when using the
oven.
Put food directly on
the metal grill tray to
speedcook.
Ŷ 8VHRIWKHFOHDUJODVVWUD\ZKHQFRQYHFWLRQEDNLQJ
broiling, warming or toasting will result in inferior
cooking performance.
Put food directly on the metal
tray to convection bake, warm
or toast.
Put food directly on the wire rack or
in the appropriate dish and place on
the rack when baking or warming on
multiple levels.
READ AND SAVE THESE INSTRUCTIONS
49-40686-4
5
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING MICROWAVE-SAFE COOKWARE
Make sure to use suitable cookware during microwave
cooking. Most glass casseroles, cooking dishes,
measuring cups, custard cups, pottery or china
dinnerware which does not have metallic trim or glaze
with a metallic sheen can be used. Some cookware is
labeled “suitable for microwaving.”
Ŷ 3ODFHIRRGRUPLFURZDYDEOHFRQWDLQHUGLUHFWO\RQWKH
clear glass tray to cook your food.
Ŷ 8VHRIDPHWDOWUD\GXULQJPLFURZDYHFRRNLQJZLOO
result in inferior cooking performance.
Ŷ &RRNZDUHPD\EHFRPHKRWEHFDXVHRIKHDW
transferred from the heated food. Oven mitts may be
needed to handle the cookware.
Ŷ 'RQRWXVHUHF\FOHGSDSHUSURGXFWV5HF\FOHG
paper towels, napkins and waxed paper can contain
metal flecks which may cause arcing or ignite.Paper
products containing nylon or nylon filaments should
be avoided, as they may also ignite.
Ŷ 8VHIRLORQO\DVGLUHFWHGLQWKLVPDQXDO:KHQXVLQJ
foil in the oven, keep the foil at least 1” away from
the sides of the oven.
Ŷ ,I\RXXVHDPHDWWKHUPRPHWHUZKLOHFRRNLQJPDNH
sure it is safe for use in microwave ovens.
Ŷ 6RPHIRDPWUD\V OLNHWKRVHWKDWPHDWLVSDFNDJHG
on) have a thin strip of metal embedded in the
bottom. When microwaved, the metal can burn the
floor of the oven or ignite a paper towel.
Ŷ 3DSHUWRZHOVZD[HGSDSHUDQGSODVWLFZUDSFDQEH
used to cover dishes in order to retain moisture and
prevent spattering. Be sure to vent plastic wrap so
steam can escape.
Ŷ ³%RLODEOH´FRRNLQJSRXFKHVDQGWLJKWO\FORVHGSODVWLF
bags should be slit, pierced or vented as directed by
package instructions. If they are not, plastic could
burst during or immediately after cooking, possibly
resulting in injury. Also, plastic storage containers
should be at least partially uncovered because they
form a tight seal. When cooking with containers
tightly covered with plastic wrap, remove covering
carefully and direct steam away from hands and
face.
Ŷ 3
ODVWLFFRRNZDUH²3ODVWLFFRRNZDUHGHVLJQHGIRU
microwave cooking is very useful, but should be
used carefully. Even microwave-safe plastic may not
be as tolerant of overcooking conditions as are glass
or ceramic materials. Plastic may soften or char if
subjected to short periods of overcooking. In longer
exposures to overcooking, the food and cookware
could ignite.
Ŷ 'RQRWXVHWKHZLUHRYHQUDFNIRUPLFURZDYLQJ
)ROORZWKHVHJXLGHOLQHV
1. Use microwave-safe plastics only, and use them in
strict compliance with the cookware manufacturer’s
recommendations.
2. Do not microwave empty containers.
3. Do not permit children to use plastic cookware
without adult supervision.
The turntable must
always be in place when
using the oven.
The clear glass tray
should always be in place
when microwaving.
Ŷ 1RWDOOSODVWLFZUDSLVVXLWDEOHIRUXVHLQPLFURZDYH
ovens. Check the package for proper use.
READ AND SAVE THESE INSTRUCTIONS
6
49-40686-4
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
PRECAUTIONS TO AVOID POSSIBLE EXPOSURE
TO EXCESSIVE MICROWAVE ENERGY
(a) Do Not Attempt to operate this oven with the
door open since open-door operation can result
in harmful exposure to microwave energy. It is
important not to defeat or tamper with the safety
interlocks.
(b) Do Not Place any object between the oven front
face and the door or allow soil or cleaner residue to
accumulate on sealing surfaces.
(c) Do Not Operate the oven if it is damaged.
It is particularly important that the oven door close
properly and that there is no damage to the:
GRRU EHQW K
LQJHVDQGODWFKHV EURNHQRUORRVHQHG GRRUVHDOVDQGVHDOLQJVXUIDFHV
(d) The Oven Should Not be adjusted or repaired by
DQ\RQHH[FHSWSURSHUO\TXDOLILHGVHUYLFHSHUVRQQHO
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
GROUNDING INSTRUCTIONS
WARNING Improper grounding can result in a risk of electric shock.
7KLVDSSOLDQFHPXVWEHFRQQHFWHGWRDJURXQGHGPHWDOOLFSHUPDQHQWZLULQJV\VWHPRUDQHTXLSPHQWJURXQGLQJ
FRQGXFWRUVKRXOGEHUXQZLWKWKHFLUFXLWFRQGXFWRUVDQGFRQQHFWHGWRWKHHTXLSPHQWJURXQGLQJWHUPLQDORUOHDG
on the appliance.
NOTICE: PACEMAKERS
Most pacemakers are shielded from interference from electronic products, including microwaves. However,
patients with pacemakers may wish to consult their physicians if they have concerns.
STATE OF CALIFORNIA PROPOSITION 65 WARNINGS
WARNING This product contains one or more chemicals known to the State of California to cause cancer,
and birth defects or other reproductive harm.
READ AND SAVE THESE INSTRUCTIONS
49-40686-4
7
ADVANTIUM: *HWWLQJWR.QRZ$GYDQWLXP
Getting to Know Advantium
What is Advantium?
The new Advantium oven uses breakthrough Speedcook
technology to harness the power of light. The Advantium
oven cooks the outside of foods much like conventional
radiant heat, while also penetrating the surface so the
inside cooks simultaneously. While halogen light is the
primary source of power, a “microwave boost” is added
ZLWKFHUWDLQIRRGV)RRGVFRRNHYHQO\DQGIDVWUHWDLQLQJ
their natural moisture.
The Advantium oven is capable of speedcooking,
convection baking, broiling, toasting, warming, proofing
and microwaving. The Speedcook feature is the biggest
benefit of the Advantium oven.
1RSUHKHDWLQJLVUHTXLUHGWRVSHHGFRRN3ODFHWKHIRRG
in the oven and start cooking immediately. You see
timesaving because there is no preheat and because
speedcook cooks faster.
Advantium Quick Start
Set the Clock
To change the time:
When you first plug in the oven or after a power outage:
1. Press the OPTIONS pad.
1. Turn the selector dial to set the hour. Press the
dial to enter.
2. Turn the dial to SET&/2&.3UHVVWKHGLDOWRHQWHU
and follow the display directions to set.
2. Turn the dial to set the minute. Press the dial to enter.
The clock is designed to turn off when unit is idle for
30 seconds to minimize the standby power usage.
The clock will turn on when unit is in use or the door is
opened. There is not an override option available based
RQWKH'2(HQHUJ\UHTXLUHPHQWV
3. Turn the dial to select AM or PM. Press the
dial to enter.
Microwaving with Express
Press EXPRESS repeatedly for 30-second increments of
microwave cooking time.
The oven starts immediately.
The turntable must
always be in place when
using the oven.
The clear glass tray
should always be in place
when microwaving.
Speedcooking
3UHVVWKH63(('&22.SDG
7XUQWKHGLDOWR)22'0(183UHVVWKHGLDOWRHQWHU
3. Turn the dial to select the type of food category you
want. Press the dial to enter.
4. Turn the dial to select the specific food. Press the dial
to enter.
5. Turn the dial to select the amount, size, and/or
GRQHQHVV LIUHTXLUHGWKHRYHQZLOOSURPSW\RX Press the dial after each selection.
8
6. Once the display shows ADJUST TIME OR START,
either press the dial or start pad to start cooking.
ŶPress CANCEL/OFF at any time to top cooking.
The turntable must always be
in place when using the oven.
Put food directly on the non-stick
metal tray to speedcook.
49-40686-4
Throughout this manual, features and appearance may vary from your model.
3
1
4
2
10
5
ADVANTIUM: )HDWXUHV
Features
11
9
6
8
7
1. Turntable
The turntable must always be in place, on the oven
floor, for all cooking. Be sure the turntable is seated
securely over the spindle in the center of the oven.
2. Metal Tray or Metal Grill Tray
Put food directly on the metal tray or metal grill tray
and place on the turntable when using the speedcook,
broil, toast, warm and convection bake features.
3. Wire Oven Rack
Put food directly on the metal tray or in an oven-safe
dish on the wire oven rack only when convection
baking on two levels.
4. Clear Glass Tray
Place on the turntable when using the microwave
features. Place food or microwave-safe cookware
directly on the tray.
5. Upper Halogen Lamp
Two 1200W halogen lamps cook food from above in
speedcook, broil and toast.
49-40686-4
6. Window
Allows cooking to be viewed while keeping
microwaves confined in the oven.
7. Door Handle
Pull to open the door.
8. Door Latches
The door must be securely latched for the oven to
operate.
9. Lower Ceramic Heater
One 500W ceramic heater cooks food from the bottom
in speedcook, broil and toast.
10. Control Panel
The pads used to operate the oven are located on
the control panel.
11. Rear Convection System
One 1500W heating element cooks food with a
convection fan circulating the hot air throughout the
cavity in speedcook, broil, convection bake, toast
and warm.
9
ADVANTIUM: Controls
Controls
With your Advantium oven, you can cook with high-intensity halogen lights, ceramic heaters and
convection heating element, and/or conventional microwave energy.
1
2
3
5
4
7
6
9
8
10
11
1. SPEEDCOOK/Repeat Last
Press this pad to access the pre-set speedcook
menu. Press and hold for 3 seconds to repeat the
last cooking selection.
12
13
15
16
14
17
18
11. DISPLAY
Shows and instructs the use of all features on the
oven.
3. CUSTOM SPEEDCOOK
Press this pad to set your own speedcook program.
12. Selector Dial–Turn to select, Press to enter
)LUVWWXUQWKHQSUHVVWKHGLDOWRPDNHRSWLRQIRRG
power level or temperature selections. Also use the
GLDOWRLQFUHDVH WXUQFORFNZLVH RUGHFUHDVH WXUQ
counterclockwise) cooking times.
4. WARM/PROOF
Select WARM to keep hot, cooked foods at serving
temperature.
13. START/PAUSE
Press this pad to start or pause any cooking
function.
14. CANCEL/OFF
Press this pad to cancel ALL oven programs except
the clock and timer.
2. CONVECTION BAKE/BROIL
Press this pad to bake, broil or toast.
HOHFW3522)WRVHWIRUDZDUPHQYLURQPHQWXVHIXO
6
for rising yeast-leavened products.
5. COOK (Microwave)
Press this pad to microwave food that is not in the
)$925,7(5(&,3(VHFWLRQ
6. EXPRESS (Microwave)
Press for 30 seconds of microwave cooking time.
Each time the pad is pressed adds an additional 30
seconds to the remaining cooking time. The oven
starts immediately.
7. DEFROST (Microwave)/OVEN LIGHT
Press this pad to defrost, soften or melt frozen foods.
While cooking, press this pad to light the cavity for 4
seconds.
8. REHEAT (Microwave)
Press this pad to reheat servings of previously
cooked foods or a plate of leftovers.
9. FAVORITE RECIPE
3UHVVWKLVSDGWRDGGHGLW FKDQJH RUUHPRYHD
recipe from the memory.
15. BACK
Press this pad to step back one or more levels in the
program process.
16. HELP
Press this pad to find out more about your oven’s
features.
17. POWER/TEMP
During cooking, press this pad and turn/press the
selector dial to change the microwave power level,
the convection bake temperature or the speedcook
power levels.
18. OPTIONS
Press this pad to set the Clock and access the
Beeper Volume, Auto Recipe Convert, Display
Scroll Speed, Delay Start and Reminder features.
10. TIMER
Press this pad to set the minute timer.
10
49-40686-4
WARNING When using speedcook programs, remember that the oven, door and dishes will
be very hot!
ADVERTENCIA
Cuando utilice los programas de cocción rápida, recuerde que el horno,
compuerta y los platos se ¡encontrarán muy calientes!
Prior to the first use of your oven, the clock must be set. See the Advantium Quick Start section.
Before you begin, make sure the turntable is in place. Use the non-stick metal tray and your own glass or ceramic
cookware, if needed.
SPEEDCOOKING
Speedcooking
Speedcook Power Level
The Advantium uses power from high intensity halogen
lamps, a ceramic heater, a convection system and
microwaves to cook food from the top, bottom and
interior simultaneously to seal in moisture and flavor.
4. Turn the dial to change the lower power level. Press
the dial to enter.
When using the pre-set menu foods, the power levels
are already selected for you. However, power levels can
be adjusted when using pre-set menu foods and Custom
Speedcook.
6. Turn the dial to change the convection power level.
Press the dial to enter.
Each power level gives you halogen lamp or ceramic
heater power and microwave energy for a certain
percentage of the time or provides heating from the
convection system.
)RUH[DPSOH
U–07 Upper halogen lamp on 70% of the time.
L–07 Lower ceramic heater on 70% of the time.
&± &RQYHFWLRQHOHPHQWKHDWVRYHQWRž)
M–05 Microwave on 50% of the time.
NOTE: Be careful when adjusting power levels so that
you do not over- or undercook food.
3
UHVVWKH63(('&22.SDGDQGVHOHFW\RXUIRRG
IROORZLQVWUXFWLRQVIURP8VLQJWKHSUHVHWVSHHGFRRN
menu).
2. When display shows ADJUST TIME or START, press
the POWER LEVEL pad.
If you do not want to change one of the settings, just
press the dial to move to the next selection.
3. Turn the dial clockwise to increase or
counterclockwise to decrease the upper power level.
Press the dial to enter.
49-40686-4
5. Turn the dial to change the microwave power level.
Press the dial to enter.
7. Press the START/PAUSE pad or the selector dial to
start cooking.
Follow these general guidelines when selecting the
best U=, L=, M= and C= settings for your favorite
recipe:
8 6HOHFWDKLJKHUVHWWLQJIRUWKLQIRRGVUHTXLULQJ
DJROGHQEURZQWRS H[DPSOHILVKILOOHWVWRDVW
boneless chicken breasts). Select
a lower setting for thicker foods and foods with
KLJKVXJDURUIDWFRQWHQW H[DPSOHPXIILQVURDVWV
FDVVHUROHV RUWKDWUHTXLUHDORQJHUFRRNWLPH
L = Select a higher setting for thick or dense foods that
PD\QRWFRRNTXLFNO\LQWKHFHQWHU H[DPSOHVWHDNV
casseroles). Select a lower setting for thin foods
H[DPSOHFRRNLHV M = Select a higher setting to shorten cooking time for
GHQVHRUKHDY\IRRGV H[DPSOHFDVVHUROHVZKROH
chicken). Select a lower setting for delicate foods
H[DPSOHEUHDGV RUIRRGVUHTXLULQJORQJHUFRRN
WLPHVIRUWHQGHUUHVXOWV H[DPSOHVWHZSRWURDVW C = Select a lower setting for more delicate foods that
cook at lower temperatures. Select a higher setting
RUDERYH IRUPRUHUREXVWIRRGVRUIRRGVWKDW
FRRNDWWHPSHUDWXUHVDERYHž)
11
SPEEDCOOKING
Speedcooking
Using Speedcook Features
Ŷ,IWKHGRRULVRSHQHGGXULQJFRRNLQJWKHRYHQZLOOVWRS
and PAUSE will appear in the display. Close the door
and press the START/PAUSE pad to resume cooking.
Ŷ$WDQ\WLPHGXULQJFRRNLQJ\RXFDQWXUQWKHVHOHFWRU
dial to change the cooking time. You can change power
levels by pressing POWER/TEMP.
Ŷ7RFRRNIRUDGGLWLRQDOWLPHDIWHUDFRRNLQJF\FOHKDV
been completed, use the Resume feature as instructed
on the display.
The turntable must always be in
place when using the oven.
Ŷ6SHHGFRRNLQJPHDWVLQWKHRYHQPD\SURGXFHVPRNH
Put food directly on the metal tray or metal grill
tray to speedcook.
Cooking Tips
To ensure consistent and even browning when cooking
foods directly on the non-stick metal tray, arrange food
as shown below.
Foods can touch but should not overlap.
Circular pattern
([DPSOHELVFXLWVFRRNLHV
Side by side pattern
([DPSOHPHDWVDQGSRXOWU\
)UHVKPHDWFKLFNHQILVKRUVHDIRRGWKDWKDVEHHQIUR]HQ
VKRXOGEHWKDZHGEHIRUHFRRNLQJ WKHPLFURZDYHGHIURVW
IHDWXUHFDQEHXVHG )RURWKHUIUR]HQSUHSDFNDJHG
foods, follow package directions.
Spoke pattern
([DPSOHFUHVFHQW
rolls, breadsticks)
Single layer
([DPSOHDSSHWL]HUV
Speedcook Cookware
Ŷ )
ROORZFRRNZDUHVXJJHVWLRQVRQWKHRYHQGLVSOD\RU
in the Cookbook or Cooking guide.
Ŷ &RRNZDUHZLOOEHFRPH2YHQPLWWVZLOOEHQHHGHGWR
handle the cookware.
Ŷ 3ODFHIRRGGLUHFWO\RQWKHPHWDOWUD\RUPHWDOJULOOWUD\
when cooking, unless prompted by the oven to do
otherwise.
Ŷ 8VHWKHPHWDOWUD\LQWKHVDPHZD\\RXZRXOGXVHD
shallow baking pan or baking tray.
Ŷ ,QDGGLWLRQWRWKHFRRNZDUHSURYLGHG\RXFDQXVH
non-metal casserole dishes, pie plates and other
heat-safe cookware. Place them directly on the
turntable.
Ŷ %
HVXUHWRVHOHFWDVL]HWKDWZLOOURWDWHHDVLO\
Ŷ 3ODFHWKHPHWDOWUD\RUPHWDOJULOOWUD\RQWKH
turntable. Place glass or ceramic cookware on the
tray.
Ŷ 'RQRWXVHFRRNZDUHRUFRYHULQJVPDGHRISDSHU
plastic, or foil when cooking during a speedcook
cycle.
Custom Speedcook
Advantium gives you the flexibility to cook your favorite dishes.
4. Turn the dial to select the lower power level. Press the
If you want to cook a food item that is not among the
dial to enter.
pre-set selections, use custom speedcook.
3UHVVWKH&8672063(('&22.SDG
5. Turn the dial to select the microwave power level.
Press the dial to enter.
If no entries are made within 15 seconds, the display will
return to blank.
6. Turn the dial to set the convection power level. Press
the dial to enter.
2. Turn the selector dial to select the cooking time. Press
the dial to enter.
7. Press the START/PAUSE pad or press the selector
dial to start cooking.
The display will prompt you to select the power
OHYHO V )RUSRZHUOHYHODQGFRRNLQJWLPHVXJJHVWLRQVXVH\RXU
cooking guide, cookbook and the pre-set speedcook
3. Turn the dial to select the upper power level. Turn
menu selections.
the dial clockwise to increase or counterclockwise
to decrease the upper power level. Press the dial to
enter.
12
49-40686-4
Repeat Last
Resume
Use this time saving feature for cooking repetitive items
like cookies or appetizers.
1. If your food needs to cook a bit longer, you can
restart the oven by pressing the START/PAUSE pad
or selector dial.
NOTE: The last program used is stored for two hours.
3
UHVVDQGKROGWKH63(('&22.SDGIRUVHFRQGV
2. The last pre-set food will be displayed.
3. Press the START/PAUSE pad or the selector dial to
start cooking.
5(680(&22.,1*ZLOOEHGLVSOD\HGDQGWKHRYHQ
will restart immediately at 10% of the original time.
The program stays in memory for 10 minutes. After that
you will need to begin the program again. See To use a
pre-set speedcook menu.
SPEEDCOOKING
Speedcooking
Pre-set Speedcook Menu
SPEEDCOOK PRE-SET FOOD SELECTIONS:
Ŷ$SSHWL]HUV
Ŷ'HVVHUWV
Ŷ3L]]D
Ŷ6DQGZLFK
Ŷ%UHDGV
Ŷ(QWUHHV
Ŷ3RWDWRHV
Ŷ6HDIRRG
Ŷ%UHDNIDVW
Ŷ0HDWV
Ŷ3RXOWU\
Ŷ6LGH'LVK
Advantium is already pre-set to cook over 175 popular dishes.
3
UHVVWKH63(('&22.SDG
If no selection is made within 15 seconds, the display
will return to blank.
2. Turn the selector dial to select the type of food
category you want. Press the dial to enter.
3. Turn the selector dial to select the specific food
PHQXVHOHFWLRQ 3UHVVWKHGLDOWRHQWHU
4. Turn the selector dial to select amount, size, and/
RUGRQHQHVV LIUHTXLUHGWKHRYHQZLOOSURPSW\RX Press the dial after each selection.
Turn the food over when the oven signals
7851)22'29(5 IRUFHUWDLQIRRGV :KHQWKHRYHQVLJQDOV&+(&.IRU'21(1(66FKHFN
WRVHHLI\RXUIRRGLVGRQHWR\RXUOLNLQJ IRUFHUWDLQ
foods).
To review settings during cooking, press the selector dial.
If you enter an undesired selection at any time, simply
SUHVVWKH%$&.SDGDQGUHHQWHUWKHGHVLUHGVHOHFWLRQV
Speedcooking meats in the oven may produce smoke.
5. Once the display shows ADJUST TIME or START,
press start or the selector dial to start cooking.
49-40686-4
13
SPEEDCOOKING
Speedcooking
Pre-Set Speedcook Menu Selections
Ŷ $
IWHUDFRRNLQJF\FOHKDVEHHQFRPSOHWHGXVHWKH
Resume feature to cook for additional time.
Food Category
Menu Selection
Food Category
Menu Selection
Food Category
Menu Selection
Appetizers
Bagel Bites
Cheese Sticks
(JJ5ROOV )UR]HQ
+RW'LS ±&XSV
Jalapeno Poppers
0HDW%DOOV )UR]HQ
Nachos
Nuts Roasted
Onion Rings
Pizza Rolls
6RIW3UHW]HOV )UR]HQ
(QWUHH
%XUULWRV IUR]HQ
Chimichanga
Casserole
(JJ5ROOV IUR]HQ
(QFKLODGD IUHVK
Lasagna
0HDWORDI [
4XHVLGLOODV IUHVK
6WXIIHG3HSSHUV 6HDIRRG
&RG)LOOHWV
)LVK6WLFNV IUR]HQ
)UR]HQ%UHDGHG
Lobster Tails
2UDQJH5RXJK\)LOOHW
Salmon
Sea Bass
Shellfish
Swordfish Steak
Tilapia
Tuna Steaks
Whitefish
%UHDGV
%UHDNIDVW
Desserts
%DJHOV IUR]HQ
Biscuits
Bread Sticks
Cheese Bread
Crescent Rolls
Dinner Rolls
Garlic Bread
4XLFN%UHDG [
Sweet Rolls/Danish
7DFR6KHOOV ER[HG
Texas Toast
%DJHOV IUR]HQ
Belgian Waffles
Breakfast Pizza
&DVVHUROH HJJ[
Coffee Cake
)UHQFK7RDVW
3DQFDNHV IUR]HQ
Hashbrown Patties
5ROOV UHIULJHUDWHG
Sausage Biscuit
Sausage
6WUXGHO IUR]HQ
Sweet Rolls/Danish
Turnovers
:DIIOHV IUR]HQ
Brownies
&DNHV PL[[
&REEOHU IUHVK[
Coffee Cake
Cookies
3LH IUHVKIUXLW
5ROOV UHIULJHUDWHG
Turnovers
0HDWV
3L]]D
Potatoes
Poultry
6DQGZLFK
14
Ŷ 7
RUHYLHZVHWWLQJVGXULQJFRRNLQJSUHVVWKH
selector dial.
)LOHW0LJQRQ
Hamburger
Lamb Chops
Pork Chops
Roast – Pork
Roast – Beef
Ribeye Steak
Sirloin Steak
Strip Steak
T-Bone Steak
Tenderloin
'HOL)UHVK
Use Precooked Crust
)UR]HQ3L]]D
6LGH'LVK
5HIULHG%HDQV R]
Roasted Asparagus
Roasted Bell Pepper
5RDVWHG&KLOLV Roasted Corn
Roasted Garlic
Roasted Mixed Vegetables
6WXIILQJ PL[
Stuffed Mushrooms
Stuffed Tomatoes
Baked Potato
Hashbrown Patties
)UR]HQ)ULHV
)UR]HQ1XJJHW
Sweet Potato/Yam
Chicken, Bone-In
Chicken, Boneless
&KLFNHQ)LOOHW IUR]HQ
&KLFNHQ)LQJHU IUR]HQ
&KLFNHQ)ULHG IUR]HQ
&KLFNHQ1XJJHW IUR]HQ
&KLFNHQ3DWW\ IUR]HQ
&KLFNHQ7HQGHU IUR]HQ
&KLFNHQ:LQJV IUR]HQ
Chicken, Whole
Turkey
&RUQ'RJ IUR]HQ
Crescent Roll Hot Dog
Grilled Sandwich
Hot Dog in a Bun
Pocket Sandwich
7DTXLWRV IUR]HQ
49-40686-4
Favorite Recipe
To Enter and Save
Add and save up to 30 of your own Speedcook or
microwave recipes, or pre-set Speedcook menu recipes
DVDIDYRULWHUHFLSH2QFHLW¶VGRQH\RXFDQTXLFNO\
recall your favorite so that your food cooks just the way
you want it every time!
3
UHVVWKH)$925,7(5(&,3(RUWKH63(('&22.
pad.
7
XUQWKHGLDOXQWLO)$925,7(5(&,3(DSSHDUV
3UHVVWKHGLDOWRHQWHU 6NLSWKLVVWHSLIWKH
)$925,7(5(&,3(SDGZDVSUHVVHGLQVWHS 3. Turn the dial until ADD RECIPE appears. Press the
dial to enter.
4. Turn the dial to COPY SPEED RECIPE or to ADD
NEW RECIPE. Press the dial to enter.
If COPY SPEED RECIPE was selected, turn dial to
IRRGW\SH V DQGSUHVVWKH)$925,7(5(&,3(SDG
to enter and save the recipe.
If ADD NEW RECIPE was selected, turn the dial to
VHOHFW63(('&22.RU0,&52:$D9(UHFLSH3UHVV
the dial to enter and continue with these steps.
6(/(&7&22.7,0(DSSHDUV7XUQWKHGLDOWRVHOHFW
the cooking time. Press the dial to enter.
7KHGLVSOD\ZLOOSURPSW\RXWRVHOHFWWKHSRZHUOHYHO V 6. Turn the dial clockwise to increase or
FRXQWHUFORFNZLVHWRGHFUHDVHWKHSRZHUOHYHO V Press the dial to enter.
)RUSRZHUOHYHODQGFRRNLQJWLPHVXJJHVWLRQVXVH\RXU
cooking guide or cook book.
63(//7+()22'1$0(DSSHDUV7XUQWKHGLDOWR
the first letter of your food description and press the
dial to enter. Continue this process to spell the rest of
the food name. Press the START/PAUSE pad to save
the recipe and its name.
SPEEDCOOKING
Speedcooking
To Find and Use
To find and use stored favorite recipes:
3
UHVVWKH)$925,7(5(&,3(RUWKH63(('&22.
pad.
7
XUQWKHGLDOXQWLO)$925,7(5(&,3(DSSHDUV
3UHVVWKHGLDOWRHQWHU 6NLSWKLVVWHSLIWKH
)$925,7(5(&,3(SDGZDVSUHVVHGLQ6WHS
7XUQGLDOWR86()$925,7(5(&,3(DQGSUHVVWR
enter.
4. The recipe names you entered will appear.
5. Turn dial until the recipe you want is displayed and
press the dial to enter.
6. Press the START/PAUSE pad or press the selector
dial to start cooking.
To Adjust or Change
To adjust or change stored custom speedcook recipes:
3
UHVVWKH)$925,7(5(&,3(RUWKH63(('&22.
pad.
7
XUQWKHGLDOXQWLO)$925,7(5(&,3(DSSHDUV
3UHVVWKHGLDOWRHQWHU 6NLSWKLVVWHSLIWKH
)$925,7(5(&,3(SDGZDVSUHVVHGLQ6WHS
3. Turn the dial until EDIT RECIPE appears. Press the
dial to enter.
4. Turn the dial to the recipe you want to change. Press
the dial to enter. Current settings appear.
5. Press the dial to edit.
6. The display will prompt you to select the power
OHYHO V DQGHGLWWKHQDPH7XUQWKHGLDODQGSUHVVWR
enter the appropriate settings.
)RUSRZHUOHYHODQGFRRNLQJWLPHVXJJHVWLRQVXVH\RXU
cooking guide or cook book.
To Delete
To delete stored custom speedcook recipes:
3
UHVVWKH)$925,7(5(&,3(RUWKH63(('&22.
pad.
7
XUQWKHGLDOXQWLO)$925,7(5(&,3(DSSHDUV
3UHVVWKHGLDOWRHQWHU 6NLSWKLVVWHSLIWKH
)$925,7(5(&,3(SDGZDVSUHVVHGLQ6WHS
49-40686-4
3. Turn the dial until DELETE RECIPE appears and
press the dial to enter.
4. Turn dial to the recipe you want to delete and press
the dial to enter.
15
SPEEDCOOKING
Speedcooking
Things that are Normal
Cooking Times
Oven Heat
Ŷ :
KHQVSHHGFRRNLQJSUHSURJUDPPHGIRRGV\RXPD\
VHH237,0,=,1*&22.7,0(LQWKHGLVSOD\VHYHUDO
seconds after you press START/PAUSE. The oven
automatically senses the electrical voltage level in
your home and adjusts the cooking time up or down
for proper cooking.
Ŷ 1
RSUHKHDWLQJWLPHLVUHTXLUHGGXULQJ6SHHGFRRN
cycles. The oven begins cooking immediately.
Ŷ 7KHGRRUDQGLQVLGHRIWKHRYHQZLOOEHYHU\KRW8VH
caution when opening the door and removing food.
Be cautious of steam or vapor that may escape from
around the door.
Ŷ 'RQRWXVHFRRNZDUHRUFRYHULQJVPDGHRISDSHU
plastic, or foil when cooking during a speedcook
cycle.
Cooling Fans
Ŷ 7
KHIDQZLOOEHRQGXULQJFRRNLQJ$WWKHHQGRI
cooking, the automatic fan may continue to run for a
short time, and the display will read Oven is Cooling.
The fan will automatically shut off when the internal
parts of the oven have cooled.
Ŷ 7KHRYHQYHQWZLOOHPLWZDUPDLUZKLOHWKHRYHQLVRQ
Sounds
Lights
Ŷ &
OLFNVDQGDIDQEORZLQJDUHQRUPDOVRXQGVGXULQJ
cooking. The relay board is turning components on
and off.
Ŷ :
KHQWKHRYHQLVRQOLJKWPD\EHYLVLEOHDURXQGWKH
door or outer case.
Ŷ 7KHKDORJHQOLJKWVZLOOGLPDQGF\FOHRQDQGRII
during a speedcook cycle, sometimes even at full
power levels. This is normal. The oven senses the
heat level and adjusts automatically.
16
Ŷ :
KHQFRRNLQJIRUDQH[WHQGHGSHULRGRIWLPHWKH
oven may automatically reduce the power levels to
maintain the appropriate level of oven heat.
Interference
Ŷ79UDGLRLQWHUIHUHQFHPLJKWEHQRWLFHGZKLOHXVLQJ
the microwave, similar to the interference caused by
other small appliances. It does not indicate a problem
with the microwave. Move the radio or TV as far away
from the microwave as possible, or check the position
of the TV/radio antenna.
49-40686-4
WARNING When baking, remember that the oven, door and dishes will be very hot!
Convection baking allows you to cook foods the same
way as a conventional oven, using a heating element
to raise the temperature of the air inside the oven. Any
RYHQWHPSHUDWXUHIURPƒ)WRƒ)PD\EHVHW
A fan gently circulates heated air throughout the oven,
over and around the food. Because the heated air is kept
constantly moving, not permitting a layer of cooler air to
develop around the food, some foods cook slightly faster
than in regular oven cooking.
Before you begin, make sure the turntable is in place.
Use the metal tray at all times when single or two-level
baking.
The turntable must always
be in place when using the
oven.
Put food directly on
the metal grill tray to
speedcook.
Put food directly on the metal tray or in the
appropriate dish and place on wire oven rack
when baking or warming on two levels.
CONVECTION BAKING
Convection Baking
How to Convection Bake
3
UHVV&219(&7,21%$.(%52,/SDG
3UHVVWKHGLDOWRVHOHFW&219%$.(
3. Turn the dial to set the oven temperature and press
to enter.
To bypass preheating:
1. When the prompt shows PREHEAT THE OVEN? turn
the dial to NO. Press the dial to enter.
2. Place food in oven, turn the dial to set the cook time
and press to enter.
3. Press the dial or press START/PAUSE to start
cooking. When cooking is complete, the oven will
signal and turn off.
To preheat:
1. When the prompt shows PREHEAT THE OVEN?
turn the dial to YES. Press the dial or press START/
PAUSE to begin preheating.
The oven starts preheating immediately. Do not place
IRRGLQRYHQ <RXZLOOEHSURPSWHGWRHQWHUDFRRN
time, after oven is preheated.)
2. When the oven is finished preheating, it will signal. If
you do not open the door within 1 hour, the oven will
turn off automatically. Open the oven door and, using
caution, place the food in the oven.
3. Close the oven door. Turn the dial to set the cook
time and press to enter.
4. Press the dial or press START/PAUSE to start
cooking. When cooking is complete, the oven will
signal and turn off.
You may change the oven temperature during preheating
by pressing the POWER/TEMP pad and turning the dial
to select the new temperature. Press the dial to enter.
If the oven door is opened during cooking, PAUSE will
appear in the display. Close the door and press start/
pause.
Cook times are shown in minutes and can be set to a
maximum of 179 minutes. Time can be changed during
cooking by turning the dial.
Cooking Tips for Convection Baking
Ŷ:KHQFRRNLQJLWHPVWKDWJRGLUHFWO\RQWRWKHPHWDO
tray, do not place the tray into the oven during preheat.
Place the food directly onto the tray, and place the
metal tray with food onto the turntable after the oven is
finished preheating.
Ŷ:KHQFRRNLQJLWHPVLQDGLVKWREHSODFHGRQWKH
metal tray, place the metal tray in the oven during
preheat for optimum cooking performance.
49-40686-4
Ŷ)RUWZROHYHOEDNLQJLQVWDOOWKHZLUHUDFNRQWKHUDFN
supports and a metal tray
on the turntable. Baking
dishes can be placed
directly onto the wire rack
and the turntable.
Ŷ,IEDNLQJWUD\VDUHUHTXLUHGIRUFRRNLQJIRRGVOLNH
cookies or biscuits, use the metal trays supplied with
the oven to place on the wire rack and on the turntable
for best performance.
17
BROILING AND TOASTING
Broiling and Toasting
WARNING When broiling or toasting, remember that the oven, door and dishes will
be very hot!
Broil and toast use the upper lamps, lower heater and
convection system to broil or toast food similar to a
conventional oven.
Before you begin, make sure the turntable is in place.
Use the metal tray when toasting and the metal tray or
metal grill tray when broiling.
The turntable must
always be in place when
using the oven.
Put food directly on the metal
tray or the metal grill tray.
How to Broil or Toast
3UHVVWKH&219%$.(%52,/SDG
2. Turn the dial to BROIL or TOAST and press to enter.
To bypass preheating:
1. When the prompt shows PREHEAT THE OVEN? turn
the dial to NO. Press the dial to enter.
2. Place the food in the oven, turn the dial to set the
cook time and press to enter.
Press the dial or START/PAUSE to start cooking.
When cooking is complete, the oven will signal and
turn off.
To preheat:
1. When the prompt shows PREHEAT THE OVEN?
turn the dial to YES. Press the dial or press START/
PAUSE to begin preheating.
The oven starts preheating immediately. Do not place
WKHIRRGLQWKHRYHQ <RXZLOOEHSURPSWHGWRHQWHU
the cook time, after the oven is preheated.)
2. When the oven is finished preheating, it will signal. If
you do not open the door within 1 hour, the oven will
turn off automatically. Open the oven door and, using
caution, place the food in the oven.
3. Close the oven door. Turn the dial to set the cook
time and press the dial or START/PAUSE pad to
begin cooking. When cooking is complete, the oven
will signal and turn off.
If the oven door is opened during cooking, PAUSE will
appear in the display. Close the door and press start/
pause.
Cooking Tips for Broiling
Ŷ%URLOLQJWLPHVPD\EHVKRUWHULQWKH$GYDQWLXPRYHQ
because of the use of halogen lamps. Make sure to
monitor food closely to get the desired results.
Ŷ)RUEHVWUHVXOWVZKHQEURLOLQJSODFHIRRGGLUHFWO\RQ
the metal grill tray.
Ŷ,ISUHKHDWLQJWKHRYHQWREURLOPHDWSUHKHDWZLWKWKH
metal grill tray in the oven and place food on the hot
metal tray for best searing of meat.
Ŷ%URLOLQJPHDWVLQWKHRYHQPD\SURGXFHVPRNH
Ŷ0RVWIRRGVVKRXOGEHWXUQHGKDOIZD\WKURXJKEURLOLQJ
time. Dense foods such as meaty, bone-in chicken
pieces should be turned about 3/4 of the way through
broiling time.
Ŷ5HPRYHWKLQQHUSLHFHVDVQHHGHGWRSUHYHQW
overcooking and drying.
Cooking Tips for Toasting
Ŷ)RUEHVWUHVXOWVZKHQWRDVWLQJXVHWKHPHWDOWUD\
Ŷ0RVWIRRGVVKRXOGEHWXUQHGRYHURIWKHZD\
through toasting time when not preheating.
Ŷ:KHQXVLQJWKHSUHKHDWRSWLRQWXUQIRRGKDOIZD\
through the cooking time.
18
Ŷ7RFULVSH[WHULRUEXWPDLQWDLQPRLVWQHVVLQVLGHIRRGV
preheat the oven.
Ŷ7RFULVSH[WHULRUDQGFULVSWKHLQVLGHWRRGRQRW
preheat the oven.
Ŷ7RDVWWKLFNHUSLHFHVDORQJHUWLPHWKLQQHUSLHFHVD
shorter time.
49-40686-4
Warming
The WARM feature will keep hot, cooked foods at
serving temperature. Always start with hot food. Use
cookware and utensils that can withstand temperatures
XSWRÛ)
3UHVVWKH:$503522)SDG
7
XUQWKHGLDOWRVHOHFW+2/')22':$503UHVV
the dial to enter.
3. Turn the dial to select the oven temperature. See the
chart and tips. Press the dial to enter.
/2:
0(',80
+,*+
Tips for Crisp Foods.
Ŷ /HDYHIRRGXQFRYHUHG
Ŷ 'RQRWXVHSODVWLFFRQWDLQHUVRUSODVWLFZUDS
Ŷ 3UHKHDWLQJLVQRWQHFHVVDU\H[FHSWIRUFULVSLQJVWDOH
LWHPV 6HH7R&ULVS6WDOH,WHPV
Tips for Moist Foods:
Ŷ &RYHUIRRGZLWKOLGRUDOXPLQXPIRLO
Ŷ 'RQRWXVHSODVWLFFRQWDLQHUVRUSODVWLFZUDS
Ŷ 3UHKHDWLQJLVQRWQHFHVVDU\
Temperature and Moisture Selection Chart
±ƒ)
±ƒ)
±ƒ)
)RRG7\SH
4. Turn the dial to select the level of moisture you want.
See the chart and tips below. Press the dial to enter.
If the oven door is opened during warming, PAUSE will
appear in the display. Close the door and press START/
PAUSE.
Control
Setting
Moisture
Setting
Bread, hard rolls
MEDIUM
CRISP
Bread, soft rolls
MEDIUM
MOIST
Casseroles
MEDIUM
MOIST
)ULHGIRRGV
HIGH
CRISP
MEDIUM
CRISP
To Crisp Stale Items:
Meats* and fish
Ŷ 3ODFHIRRGRUGLVKHVGLUHFWO\RQWKHEODFNPHWDOWUD\
Pancakes, waffles
HIGH
CRISP
Pizza
HIGH
CRISP
Ŷ 3UHKHDWRQ/2:VHWWLQJDQGVHOHFW&5,63
Ŷ &
KHFNFULVSQHVVDIWHUPLQXWHV$GGWLPHDV
needed.
Potatoes, baked
HIGH
CRISP
MEDIUM
MOIST
Poultry
HIGH
MOIST
Tortilla Chips
LOW
CRISP
MEDIUM
MOIST
Potatoes, mashed
Vegetables
The turntable must always be in
place when using the oven.
Put food directly on the
metal tray to warm.
WARMING AND PROOFING
Warming and Proofing
86'$)6,6UHFRPPHQGVDQLQWHUQDOWHPSHUDWXUHRIƒ)
as the minimum doneness for beef.
Use a portable meat thermometer to check internal
temperatures.
Proofing
The proofing feature automatically provides the optimum
temperature for the proofing process, and therefore does
not have a temperature adjustment.
3
UHVVWKH:$503522)SDG
NOTES:
Ŷ 'RQRWXVHWKHSURRILQJPRGHIRUZDUPLQJIRRGRU
keeping food hot. The proofing oven temperature is
not hot enough to hold foods at safe temperatures.
Use the WARM feature to keep food warm.
7
XUQWKHGLDOWRVHOHFW3522)%5($'3UHVVWKHGLDO
Ŷ 3URRILQJZLOOQRWRSHUDWHLIWKHRYHQLVWRRKRW$OORZ
to enter. The oven starts proofing immediately and
the oven to cool before proofing.
shows the amount of proofing time completed.
Ŷ 7
RDYRLGORZHULQJWKHRYHQWHPSHUDWXUHDQG
lengthening proofing time, do not open the oven door
unnecessarily.
Ŷ &KHFNEUHDGSURGXFWVHDUO\WRDYRLGRYHUSURRILQJ
49-40686-4
The turntable must always be in
place when using the oven.
Put bread dough in a bowl/bread
pan and place on the metal tray
to proof.
19
MICROWAVING
Microwaving
Make sure the turntable is in place with the side marked
“TOP” facing up. Use the clear glass tray.
Place food or microwavable container directly on the
clear glass tray to cook your food.
The turntable must always
be in place when using the oven.
The clear glass tray should always
be in place when microwaving.
Cookware
Ŷ0DNHVXUHWKDWFRRNZDUHLVVXLWDEOHIRUPLFURZDYLQJ
Ŷ3ODFHIRRGRUPLFURZDYDEOHFRQWDLQHUGLUHFWO\RQWKH
clear glass tray to cook your food.
Microwave Pre-Set Selections
Ŷ Cook
ŶDefrost
ŶReheat
±%\)RRG7\SH
–By Time
–By Time 1 & 2
–Delay Start
–Heat/Reheat
Beverage
–Melt
–Slow Cook
–Soften
–1.0 lb Quick
–By Time
±%\)RRG7\SH
–By Weight
–Delay Start
–Melt
–Soften
–Beverage
–Casserole
–Chicken
–Pasta
–Pizza
±3ODWHRI)RRG
–Rice
–Soup
–Steaks/Chops
–Vegetables
3
UHVVWKHPLFURZDYH&22.'()5267RU5(+($7
pad. If no selection is made within 15 seconds, the
display will return to blank.
2. Turn the dial to find the food you want to cook, defrost or reheat. Press the dial to enter.
3. Turn the selector dial to select the type, amount,
weight and/or size as prompted by the oven. Press
the dial after each selection.
To review settings during cooking, press the selector dial.
If the door is opened during cooking, the oven will stop
and PAUSE will appear in the display. Close the door and
press START/ PAUSE to resume cooking.
If you enter an undesired selection at any time, simply
SUHVVWKH%$&.SDGDQGUHHQWHUWKHGHVLUHGVHOHFWLRQV
4. Press the dial or the START/ PAUSE pad to start
cooking.
20
49-40686-4
Cook By Time / Cook By Time 1 & 2
8VH&22.%<7,0(DQG&22.%<7,0( WR
microwave food that is not in the recipe section and at
WKHWLPH V \RXVHW
3
UHVVWKH&22.SDG
7
XUQWKHGLDOWRVHOHFW&22.%<7,0(RU&22.%<
TIME 1 & 2 and press the dial to enter.
3. Turn the dial to set the cook time and press the dial
to enter.
,I\RXVHOHFWHG&22.%<7,0( WXUQWKHGLDOWRVHW
the second cook time and press the dial to enter.
The power level is automatically set at high, but you can
change it for more flexibility.
To change the power level if you don’t want full power,
press the POWER/TEMP pad before entering the
WLPH V 7XUQWKHGLDOWRVHOHFWDQGSUHVVWKHGLDOWR
enter.
4. Press the dial or the START/ PAUSE pad to start
cooking.
<RXPD\RSHQWKHGRRUGXULQJ&22.%<7,0(DQG
&22.%<7,0( WRFKHFNWKHIRRG&ORVHWKHGRRU
and press START/PAUSE to resume cooking.
MICROWAVING
Microwaving
Express
Press EXPRESS repeatedly for 30 second increments of
microwave cooking time. Oven starts immediately.
Ŷ 7
KHSRZHUOHYHOLVDXWRPDWLFDOO\VHWDWKLJKEXW\RX
FDQFKDQJHLWIRUPRUHIOH[LELOLW\ 6HH0LFURZDYH
power levels for instructions.)
Microwave Power Level(s)
)
LUVWIROORZGLUHFWLRQVIRU&22.%<7,0(&22.%<
7,0( (;35(66RU'()5267%<7,0(
2. Press the POWER/TEMP pad.
3. Turn the dial clockwise to increase and
counterclockwise to decrease the power level. Press
the dial to enter.
4. Press the dial or the START/ PAUSE pad to start
cooking.
Ŷ<RXFDQFKDQJHWKHSRZHUOHYHOEHIRUHRUGXULQJD
cooking program.
Here are some examples of uses for various power
levels:
High 10: )LVKEDFRQYHJHWDEOHVERLOLQJOLTXLGV
Med-High 7: Gentle cooking of meat and poultry;
baking casseroles and reheating.
Medium 5: Slow cooking and tenderizing for stews and
less tender cuts of meat.
Low 2 or 3: Defrosting; simmering; delicate sauces.
Warm 1: .HHSLQJIRRGZDUPVRIWHQLQJEXWWHU
Favorite Recipe
6HHWKH)DYRULWHUHFLSHVHFWLRQVLQWKH6SHHGFRRN
section of this book for instructions on how to save, use,
change or delete a favorite recipe.
Cooking Tips
Ŷ:KHQFRRNLQJEDFRQOD\HUVWULSVRQDSODWH&RYHU
each layer with a paper towel.
Ŷ )
RUIUR]HQYHJHWDEOHVIROORZWKHSDFNDJHLQVWUXFWLRQV
for adding water.
Ŷ:KHQFRRNLQJYHJHWDEOHVXVHDPLFURZDYHVDIH
casserole or bowl. Cover with a microwave-safe lid or
vented plastic wrap.
Ŷ )
RUIUHVKYHJHWDEOHVDGGWDEOHVSRRQVRIZDWHUIRU
each serving.
49-40686-4
21
MICROWAVING
Microwaving
Defrost By Food Type
Auto Defrost automatically sets the defrosting times and
power levels to give even defrosting results for meats,
poultry and fish weighing up to 6 pounds.
Ŷ 5
HPRYHGHIURVWHGPHDWRUVKLHOGZDUPDUHDVZLWK
small pieces of foil for even defrosting.
1. Remove food from the package and place it on a
microwave-safe dish.
Ŷ $
IWHUGHIURVWLQJPRVWPHDWVQHHGWRVWDQGPLQXWHV
to complete defrosting. Large roasts should stand for
about 30 minutes.
3UHVVWKH'()5267SDG
Conversion Guide
7
XUQWKHGLDOWR'()5267%<)22'7<3(3UHVV
the dial to enter.
If the weight of food is stated in pounds and ounces, the
RXQFHVPXVWEHFRQYHUWHGWRWHQWKV RIDSRXQG
4. Turn the dial to select food type. Press the dial to
enter.
5. Turn the dial to the food weight, using the Conversion
*XLGHDWULJKW)RUH[DPSOHGLDOIRUSRXQGV
SRXQGR] 3UHVVWKHGLDOWRHQWHU
6. Press the dial or START/PAUSE pad to start
defrosting.
7. Turn the food over when the oven signals TURN
)22'29(5
Weight of Food
in Ounces
1-2
3
4-5
6-7
8
9-10
11
12-13
14-15
Enter Food Weight
(tenths of a pound)
.1
.2
.3
.4
.5
.6
.7
.8
.9
Defrost By Time
Use Time Defrost to defrost for a selected length of time.
3UHVVWKH'()5267SDG
7
XUQWKHVHOHFWRUGLDOWR'()5267%<7,0(3UHVV
the dial to enter.
3. Turn the dial to select the time you want. Press the
dial to enter.
4. Press the dial or START/PAUSE pad to start
defrosting.
Ŷ3RZHUOHYHOLVDXWRPDWLFDOO\VHWDWEXWFDQEH
changed. To change the power levels, see the
0LFURZDYH3RZHU/HYHO V VHFWLRQ
<RXFDQGHIURVWVPDOOLWHPVTXLFNO\E\UDLVLQJWKHSRZHU
level after entering the time. Power level 7 cuts the total
defrosting time in about half; power level 10 cuts the total
time to about 1/3. When defrosting at high power levels,
IRRGZLOOQHHGPRUHIUHTXHQWDWWHQWLRQWKDQXVXDO
5. Turn the food over when the oven signals TURN
)22'29(5
Defrosting Tips
8VH'()5267%<)22'7<3(IRUPHDWSRXOWU\DQG
ILVK8VH'()5267%<7,0(IRUPRVWRWKHUIUR]HQ
foods.
Ŷ)RRGVWKDWVSRLOHDVLO\VKRXOGQRWEHDOORZHGWRVLW
out for more than one hour after defrosting. Room
temperature promotes the growth of harmful bacteria.
Ŷ)RRGVIUR]HQLQSDSHURUSODVWLFFDQEHGHIURVWHGLQ
WKHSDFNDJHZKHQXVLQJ'()5267%<7,0()RRGV
should be taken out of the package when using
'()5267%<)22'7<3(&ORVHGSDFNDJHVVKRXOG
be slit, pierced or vented after food has partially
defrosted. Plastic storage containers should be
partially uncovered.
Ŷ)RUPRUHHYHQGHIURVWLQJRIODUJHUIRRGVVXFKDV
URDVWVXVH'()5267%<7,0(%HVXUHODUJHPHDWV
are completely defrosted before cooking.
Ŷ)DPLO\VL]HSUHSDFNDJHGIUR]HQGLQQHUVFDQEH
defrosted and microwaved. If the food is in a foil
container, transfer it to a microwave-safe dish.
22
Ŷ:KHQGHIURVWHGIRRGVKRXOGEHFRROEXWVRIWHQHGLQ
all areas. If still slightly icy, return to the microwave
very briefly, or let it stand a few minutes.
Ŷ:KHQGHIURVWLQJRUPRUHSRXQGVRIJURXQGRUFXEHG
meat, remove defrosted portions at the turn signals.
49-40686-4
Sensor Cooking
The Advantium’s microwave mode features sensor
cooking. The oven automatically senses when food
is done and shuts itself off—eliminating the need to
program cook times and power levels.
MICROWAVE SENSOR PROGRAMS:
Ŷ*URXQG0HDW
Ŷ3RSFRUQ±3UHSDFNDJHGPLFURZDYHSRSFRUQ
R]WRR]
Ŷ6RXS
Ŷ5LFH
Ŷ9HJHWDEOHV &DQQHG)UHVK)UR]HQ
Ŷ&KLFNHQ5HKHDW
Ŷ3DVWD5HKHDW
Ŷ3ODWHRI)RRG5HKHDW
Ŷ6RXS5HKHDW
Ŷ9HJHWDEOH5HKHDW
NOTE: Do not use the sensor features twice in
succession on the same food portion—it may result in
severely overcooked or burnt food. If the food is not
done enough at the end of the sensor cook time, use
Cook BY Time in the microwave selector to cook for
more time.
Ŷ ,I\RXKDYHEHHQFRRNLQJDQGWKHRYHQLVKRWLWPD\
indicate that it is too hot for sensor cooking. In that
case, the oven will automatically change to time
cooking and may prompt for weights or amounts of
food.
Ŷ 7
RVKRUWHQRUOHQJWKHQWKHFRRNWLPHZDLWXQWLOWKH
time countdown shows in the display. Then turn the
dial to add or subtract time.
Ŷ ,I\RXRSHQWKHGRRUZKLOHVHQVRUFRRNLQJ6(1625
ERROR will appear. Close the door, press START/
PAUSE to begin again.
Notes About the Reheat Program:
Reheated foods may have wide variations in
temperature. Some areas may be extremely hot.
3
UHVVWKH&22.SDGDQGWXUQWKHGLDOWR&22.%<
)22'7<3(3UHVVWKHGLDOWRHQWHU2USUHVVWKH
REHEAT pad.
,WLVEHVWWRXVH&22.%<7,0(DQGQRW5(+($7IRU
these foods:
2. Turn the dial to select the food you want. Press the
dial to enter.
Ŷ )RRGWKDWPXVWEHUHKHDWHGXQFRYHUHG
3. Press the dial or press the START/ PAUSE pad to
start cooking.
Do not open the oven door until time is counting down
in the display. If the door is opened, close it and press
START/PAUSE immediately. If the food is not done
HQRXJKXVH&22.%<7,0(LQWKHPLFURZDYHVHOHFWRU
to cook for more time.
MICROWAVING
Microwaving
Ŷ %UHDGSURGXFWV
Ŷ )RRGVWKDWQHHGWREHVWLUUHGRUWXUQHG
Ŷ )
RRGVFDOOLQJIRUDGU\ORRNRUFULVSVXUIDFHDIWHU
reheating.
Sensor Cooking Cookware
The proper containers and covers are essential for best
sensor cooking.
Ŷ$OZD\VXVHPLFURZDYHVDIHFRQWDLQHUVDQGFRYHUWKHP
with lids or vented plastic wrap. Never use tight sealing
plastic containers—they can prevent steam from
escaping and cause food to overcook.
Ŷ%HVXUHWKHRXWVLGHRIWKHFRRNLQJFRQWDLQHUVDQG
the inside of the oven are dry before placing food in
the oven. Beads of moisture turning into steam can
mislead the sensor.
Ŷ%HYHUDJHVDUHEHVWKHDWHGXQFRYHUHG
49-40686-4
Covered
Vented
Dry off dishes so they
don’t mislead the sensor.
23
MICROWAVING
Microwaving
Things that are Normal
Interference
Oven Heat
Ŷ79UDGLRLQWHUIHUHQFHPLJKWEHQRWLFHGZKLOHXVLQJ
the microwave. Similar to the interference caused by
other small appliances, it does not indicate a problem
with the microwave. Move the radio or TV as far away
from the microwave as possible, or check the position
of the TV/radio antenna.
Ŷ&RRNZDUHPD\EHFRPHKRWEHFDXVHRIKHDW
transferred from the heated food. Oven mitts may be
needed to handle the cookware.
Ŷ6WHDPRUYDSRUPD\HVFDSHIURPDURXQGWKHGRRU
Lights
Ŷ7KHRYHQFDYLW\OLJKWZLOOQRWFRPHRQ
during any cooking cycle. To view food in the oven,
SUHVVWKH'()5267SDGZKLOHFRRNLQJWROLJKWWKH
cavity for 4 seconds.
24
49-40686-4
Cook Time Completed
To remind you that you have food in the oven, the oven
ZLOOGLVSOD\&22.7,0(&203/(7('DQGEHHSRQFHD
minute until you either open the oven door or press the
&$1&(/2))SDG
Options
Clock:
Beeper Volume:
The clock must be set before you can use your oven for
the first time. When setting the clock time for the first
time go directly to Step 2.
Use this feature to adjust the volume of the beeper. You
can even turn it off. Press the OPTIONS pad, turn the
dial to select BEEPER VOLUME, press the dial to enter,
and follow the display directions.
1. To change the clock time, press the OPTIONS pad
DQGWXUQWKHGLDOWR&/2&.3UHVVWKHGLDOWRHQWHU
2. Turn the dial to set hours. Press the dial to enter.
3. Turn the dial to set minutes. Press the dial to enter.
4. Turn the dial to select AM or PM. Press the dial to
enter.
The clock is designed to turn off when unit is idle for
30 seconds to minimize the standby power usage. The
clock will turn on when unit is in use or door is opened.
There is not an override option available based on the
'2(HQHUJ\UHTXLUHPHQWV
Auto Recipe Convert:
Auto recipe conversion reduces the convection baking
WHPSHUDWXUHDXWRPDWLFDOO\E\ž)ZKHQWXUQHG21
You still input the recipe temperature and the oven
control does the rest. To change the setting, press
the OPTIONS pad and turn the dial to AUTO RECIPE
CONVERT. Press the dial to enter. Turn the dial to
FKDQJHWKHVHWWLQJWR21RU2))3UHVVWKHGLDOWRHQWHU
OTHER FEATURES
Other Features
Scroll Speed:
Is the message scroll too slow or too fast? Change it!
Press the OPTIONS pad, turn the dial to select DISPLAY
SCROLL SPEED, press the dial to enter, and follow the
display directions.
Reminder:
Use this feature to set an alarm beep to sound at a
specific the time of day. Press the OPTIONS pad, turn
the dial to SET/CLEAR REMINDER and press the dial to
enter. Turn the dial to select the hour and press to enter.
Turn the dial to select the minute and press to enter.
Turn the dial to select AM or PM and press to enter.
To review the setting, turn the dial to SET/CLEAR
REMINDER and press the dial to enter. Turn the dial to
REVIEW and press to enter.
To cancel the setting, turn the dial to SET/CLEAR
REMINDER and press the dial to enter. Turn the dial to
CLEAR and press to enter.
Delay Start:
Delay Start allows you to set the oven to delay cooking
up to 24 hours. Press the OPTIONS pad, turn the dial to
VHOHFW'(/$<67$57DQGSUHVVWKHGLDOWRHQWHU)ROORZ
the display directions to set the Delay Start time and
feature you wish to delay.
Review
Use this feature to review the current cooking selections
you have set.
Press the selector dial during speedcooking or
microwave cooking.
49-40686-4
25
OTHER FEATURES
Other Features
Help
Use this feature to find out more about your oven and its
features.
The display will show a description for the program you
have chosen.
1. Press the HELP pad.
2. Turn the dial to select the feature name. Press the
dial to enter.
Features found in the HELP function.
Adding time
Back
Bake
Beverage Heat
Broil
Child Lockout
Cancel/Off
Cook
Cook by Time
&RRNE\)RRG7\SH
Custom Speed Cook
Defrost
'HIURVWE\)RRG7\SH
Defrost by Time
Defrost by Weight
Delay Start
Express Cook
)DYRULWH5HFLSH
Help
+ROG)RRG:DUP
Options
Power/Temp
Proof Bread
Reheat
Repeat Last
Resume
Review
Sensor Cooking
Set Beeper Volume
Set Clock
Set Display Speed
Set/Clear Reminder
Slow Cook
Soften/Melt
Speed Cook
Start/Pause
Time Cook 1 & 2
Timer On/Off
Toast
Warm/Proof
Child Lock-Out
You may lock the control panel to prevent the oven from
being accidentally started or used by children.
3UHVVDQGKROG&$1&(/2))IRUVHFRQGVWRORFNDQG
unlock.
When the control panel is locked, CONTROL IS
/2&.('ZLOOEHGLVSOD\HGEULHIO\DQ\WLPHDSDGRUGLDOLV
pressed.
Timer
Use this feature anytime you need a general purpose
timer. It can even be used while cooking in the oven.
3. Turn the dial to select the minutes. Press the dial to
enter.
1. Press the TIMER pad.
To cancel, press TIMER.
2. Turn the dial to select the hours. Press the dial to
enter.
Cooling Fans
7ZRFRROLQJIDQVDXWRPDWLFDOO\WXUQRQDVUHTXLUHGWR
keep the internal oven components and control from
overheating.
The fans will automatically turn off when the internal
parts are cool. One or both may stay on for 30 minutes
or more after the oven control is turned off.
Accessory Storage Drawer (with some models)
The accessory storage drawer is designed to hold the
cooking trays and wire oven rack provided with the oven.
The accessory storage drawer is not intended for storing
cloth, wood, paper or other combustible products.
26
Contents in the drawer can become hot to the touch
while the oven is in use and while the oven is cooling.
Use caution when removing items at these times.
49-40686-4
Inside of Oven and Accessory Storage Drawer (with some models)
Be certain the oven control is turned off and the oven is
warm or cool to the touch before cleaning any part of this
oven.
Clean the inside of the oven often for proper heating
performance.
Do not clean the inside of the oven or the accessory
storage drawer with metal scouring pads. Pieces can
break off the pad inside the oven, causing electrical
shock as well as damaging the inside surface finish of
the oven or the accessory storage drawer..
Some spatters can be removed with a paper towel,
RWKHUVPD\UHTXLUHDZDUPVRDS\FORWK5HPRYHJUHDV\
spatters with a sudsy cloth, then rinse with a damp cloth.
If the dirt and spatter do not come off easily with a warm
sudsy cloth, place a medium sized bowl full of water in
the unit on the metal tray and Custom Speedcook for 10
minutes at U=10, L=10, M=7, C=10. This should loosen
the dirt in the oven so that it can be removed with a
warm sudsy cloth.
CARE AND CLEANING
Care and Cleaning
If you notice yellowing on the metal inside the oven
that cannot be removed with a warm sudsy cloth, use a
stainless steel cleaner that removes heat discoloration
and/or tarnishing. You can then clean the inside of the
oven as you normally do.
Do not use abrasive cleaners or sharp utensils on oven
walls or the accessory storage drawer.
Never use a commercial oven cleaner on any part of
your oven or the accessory storage drawer.
Removable Turntable
The area underneath the turntable should be cleaned
IUHTXHQWO\WRDYRLGRGRUVDQGVPRNLQJGXULQJDFRRNLQJ
cycle.
The turntable can be broken if dropped. Wash carefully
in warm, sudsy water. Dry completely and replace.
To replace the turntable, place its center over the
spindle in the center of the oven and turn it until it seats
LQWRSODFH 0DNHVXUHWKHVPRRWKVLGHRIWKHWXUQWDEOH
is facing up and that its center seats securely on the
spindle.)
49-40686-4
Turntable
Do not use the oven without the
turntable in place.
27
CARE AND CLEANING
Care and Cleaning
Cooking Trays and Wire Oven Rack
To prevent breakage, allow the trays to cool completely
before cleaning. Wash carefully in hot, sudsy water or in
the dishwasher.
Wire oven rack
Do not use abrasives to clean the glass tray or wire oven
rack, as they may damage the finish.
A soap-filled scouring pad may be used to clean the
metal trays.
Clear glass tray
Metal tray
Metal grill tray
Halogen Lamp Cover and Mica Sheet
Do not remove the halogen lamp glass cover or the mica
sheet.
The upper halogen lamp cover must be kept free
of grease and food spatterings in order to operate
effectively.
Clean the lamp glass cover and mica sheet often to
avoid excess smoking and decreased cooking power.
Upper halogen
lamp cover
Mica sheet
To clean the upper lamp cover: Allow the oven and
glass cover to cool completely. Wipe clean with a warm
soapy cloth or plastic scrubbie.
)RUKHDY\EXUQHGRQVRLODFOHDQLQJVFUDSHUPD\EH
used to clean the halogen lamp cover. Wearing an oven
mitt, hold the cleaning scraper at a 30° angle. Scrape the
glass clean and wipe up excess soil.
To clean the mica sheet: Allow the oven to cool
completely. Wipe clean with a warm soapy cloth.
)RUKHDY\RUEXUQHGRQVRLO
Outside of Oven and Accessory Storage Drawer (with some models)
We recommend against using cleaners with ammonia
or alcohol, as they can damage the appearance of the
oven or the accessory storage drawer. If you choose to
use a common household cleaner, first apply the cleaner
directly to a clean cloth, then wipe the soiled area.
Glass Control Panel, Door and Drawer
Wipe with a clean damp sponge. Dry thoroughly. Do
not use cleaning sprays, large amounts of soap and
water, abrasives or sharp objects on the panel—they can
damage it.
Stainless Steel (on some models)
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always
ZLSHWKHVXUIDFHLQWKHGLUHFWLRQRIWKHJUDLQ)ROORZ
the cleaner instructions for cleaning the stainless steel
surface.
7RLQTXLUHDERXWSXUFKDVLQJVWDLQOHVVVWHHODSSOLDQFH
cleaner or polish, or to find the location of a dealer
nearest you, please call our toll-free number,
800.626.2005 or visit GEAppliances.com.
Door Seal
It’s important to keep the area clean where the door
seals against the oven. Use only mild, non-abrasive
detergents applied with a clean sponge or soft cloth.
Rinse well.
28
49-40686-4
FEDERAL COMMUNICATIONS COMMISSION RADIO FREQUENCY
INTERFERENCE STATEMENT (U.S.A. ONLY)
7KLVHTXLSPHQWJHQHUDWHVDQGXVHV,60IUHTXHQF\
energy and if not installed and used properly, that is in
strict accordance with the manufacturer’s instructions,
may cause interference to radio and television
reception. It has been type tested and found to comply
ZLWKOLPLWVIRU,60(TXLSPHQWSXUVXDQWWRSDUWRI
)&&5XOHVZKLFKDUHGHVLJQHGWRSDUWRI)&&
Rules, which are designed to provide residential
installation.
Ŷ5HRULHQWWKHUHFHLYLQJDQWHQQDRIWKHUDGLRRU
television.
However, there is no guarantee that interference will not
RFFXULQDSDUWLFXODULQVWDOODWLRQ,IWKLVHTXLSPHQWGRHV
cause interference to radio or television reception, which
FDQEHGHWHUPLQHGE\WXUQLQJWKHHTXLSPHQWRIIDQGRQ
the user is encouraged to try to correct the interference
by one or more of the following:
The manufacturer is not responsible for any radio of TV
interference caused by unauthorized modification to this
microwave oven. It is the responsibility of the user to
correct such interference.
49-40686-4
Ŷ5HORFDWHWKH0LFURZDYH2YHQZLWKUHVSHFWWRWKH
receiver.
Ŷ0RYHWKHPLFURZDYHRYHQDZD\IURPWKHUHFHLYHU
Ŷ3OXJWKHPLFURZDYHRYHQLQWRDGLIIHUHQWRXWOHWVRWKDW
the microwave oven and the receiver are on different
branch codes.
CARE AND CLEANING
Care and Cleaning
29
TROUBLESHOOTING TIPS
Troubleshooting Tips... Before you call for service
Save time and money! Review the charts on the following pages first and you may not need to call for service.
Problem
Possible Cause
What To Do
Light during a speedcook cycle
dims and cycles on and off, even
at full power levels
This is normal. Power level has been
automatically reduced because the
oven is hot.
This is normal. The oven senses the heat
level and adjusts automatically.
Light visible around the door and
outer case while speedcooking
This is normal.
When the oven is on, light may be visible
around the door and outer case.
Fan continues to run after
cooking stops
The oven is cooling.
The fans will automatically shut off when the
internal parts of the oven have cooled.
Oven vent emits warm air while
oven is on
This is normal.
Fan comes on automatically
when using the microwave
This is normal.
LIGHTS
COOLING FANS
COOKING
The oven makes unusual sounds
while cooking
Clicks are normal. The control is
turning components on and off.
These sounds are normal.
Fan noise is normal. Fans
are required to keep the oven
components and controls cool.
These sounds are normal.
Smoke comes out of the oven
when I open the door
Food is high in fat content. Aerosol
spray used on the pans.
Smoke is normal when cooking high-fat
foods.
Food is not fully cooked or
browned at the end of a cooking
program
Programmed times may not match
WKHVL]HRUDPRXQWRIIRRG\RXDUH
cooking.
Adjust time for doneness or adjust the upper
or lower lamps for browning and doneness.
SENSOR ERROR displayed
along with an oven signal
Food amount or type placed in the
oven does not match the program
that was set.
3UHVVWKH&$1&(/2))SDG6HWWKHRYHQ
SURJUDPWRPDWFKWKHIRRGRUOLTXLGWREH
cooked or heated.
Steam was not sensed by the oven
because plastic wrap was not vented,
a lid too tight was on the dish or a
liquid was covered.
Vent plastic wrap, use a looser lid or
XQFRYHUOLTXLGVZKHQFRRNLQJRUKHDWLQJ
DISPLAY
The display is blank
The clock is designed to turn off when unit is
idle for 30 seconds to minimize the standby
SRZHUXVDJH 6HH&ORFNVHFWLRQ
“Control is LOCKED” appears in
display
The control has been locked.
3UHVVDQGKROG&$1&(/2))IRUVHFRQGV
to unlock the control.
Control display is lit yet oven will
not start
Clock is not set.
Set the clock.
Door not securely closed.
Open the door and close securely.
START/PAUSE pad not pressed after
entering cooking selection.
Press START/PAUSE.
Another selection already entered
in oven and CANCEL/OFF pad not
pressed to cancel it.
3UHVV&$1&(/2))
6L]HTXDQWLW\RUFRRNLQJWLPHQRW
entered after final selection.
Make sure you have entered cooking time
after selecting.
CANCEL/OFF was pressed
accidentally.
Reset cooking program and press START/
PAUSE.
The door and inside of the oven
feels hot
The heat lamps produce intense heat
when ready.
This is normal. Use oven mitts to remove
food when in a small space.
Oven will not start
A fuse in your home may be blown or
the circuit breaker tripped.
Replace fuse or reset circuit breaker.
OTHER PROBLEMS
30
49-40686-4
GEAppliances.com
$OOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH® technician. To schedule
service online, visit us at www.geappliances.com/service_and_support/, or call GE Appliances at 800.GE.CARES
3OHDVHKDYH\RXUVHULDOQXPEHUDQG\RXUPRGHOQXPEHUDYDLODEOHZKHQFDOOLQJIRUVHUYLFH
For the period of
GE Appliances will replace
One year
)URPWKHGDWH
of the original
purchase
Any part of the oven which fails due to a defect in materials or workmanship. During this
limited one-year warranty, GE Appliances will also provide, free of charge, all labor and
related service costs to replace the defective part.
Five years
)URPWKHGDWH
of the original
purchase
The magnetron tube, if the magnetron tube fails due to a defect in materials or workmanship.
During this five-year limited warranty, you will be responsible for any labor or in-home
service costs.
WARRANTY
Advantium Oven Warranty
What GE Appliances will not cover:
Ŷ6HUYLFHWULSVWR\RXUKRPHWRWHDFK\RXKRZWRXVHWKH
product.
Ŷ5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJ
of circuit breakers.
Ŷ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
Ŷ5HSODFHPHQWRIWKHFRRNWRSOLJKWEXOEV
Ŷ3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
Ŷ'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUHIORRGV
or acts of God.
Ŷ)DLOXUHRIWKHSURGXFWRUGDPDJHWRWKHSURGXFWLILWLV
DEXVHGPLVXVHG IRUH[DPSOHFDYLW\DUFLQJIURPZLUH
rack or metal/foil), or used for other than the intended
purpose or used commercially.
Ŷ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
possible defects with this appliance.
Ŷ'DPDJHFDXVHGDIWHUGHOLYHU\
EXCLUSION OF IMPLIED WARRANTIES
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\JLYHV\RX
specific legal rights, and you may also have other rights which vary from state to state. To know what your legal rights
are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances
49-40686-4
Staple your receipt here. Proof of the original purchase
date is needed to obtain service under the warranty.
This warranty is extended to the original purchaser and any succeeding owner for products purchased for home use
within the USA. If the product is located in an area where service by a GE Appliances Authorized Servicer is not available,
\RXPD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG*($SSOLDQFHV
Service location for service. In Alaska, the warranty excludes the cost of shipping or service calls to your home.
31
CONSUMER SUPPORT
Consumer Support
GE Appliances Website
+DYHDTXHVWLRQRUQHHGDVVLVWDQFHZLWK\RXUDSSOLDQFH"7U\WKH*($SSOLDQFHV:HEVLWHKRXUVDGD\DQ\GD\
of the year! You can also shop for more great GE Appliances products and take advantage of all our on-line support
services designed for your convenience. In the US: GEAppliances.com
Register Your Appliance
Register your new appliance on-line at your convenience! Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
the pre-printed registration card included in the packing material. In the US: GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
your convenience any day of the year. In the US: GEAppliances.com/ge/service-and-support/service.htm
or call 800.432.2737 during normal business hours.
Extended Warranties
Purchase a GE Appliances extended warranty and learn about special discounts that are available while your
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
warranty expires. In the US: GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm
or call 800.626.2224 during normal business hours.
Remote Connectivity
)RUDVVLVWDQFHZLWKZLUHOHVVQHWZRUNFRQQHFWLYLW\ IRUPRGHOVZLWKUHPRWHHQDEOH visit our website at GEAppliances.com/ge/connected-appliances/ or call 800.220.6899 in the US.
Parts and Accessories
,QGLYLGXDOVTXDOLILHGWRVHUYLFHWKHLURZQDSSOLDQFHVFDQKDYHSDUWVRUDFFHVVRULHVVHQWGLUHFWO\WRWKHLUKRPHV
9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG 2UGHURQOLQHWRGD\KRXUVHYHU\GD\
In the US: GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/ge/service-and-support/contact.htm
32
3ULQWHGLQWKH.RUHD
49-40686-4
HORNO ADVANTIUM®
INFORMACIÓN DE SEGURIDAD
. . . .3
ADVANTIUM
Familiarícese con Advantium . . . . . . . . . . . . . . . . 8
Funciones . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9
Controles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
MANUAL DEL USUARIO
PSB9240
COCCIÓN RÁPIDA
Nivel de potencia . . . . . . . . . . . . . . . . . . . . . . . . . 11
Recipientes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Cocción rápida personalizada . . . . . . . . . . . . . . 12
Menú de preestablecido . . . . . . . . . . . . . . . . . . . 13
Receta . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
Cosas que son normales . . . . . . . . . . . . . . . . . . . 16
HORNEAR CON CONVECCIÓN
. . . . 17
ASAR Y TOSTAR . . . . . . . . . . . . . . . . . . . . . 18
CALENTAR Y FERMENTAR . . . . . . . . . . 19
COCCIÓN POR MICROONDAS
Recipientes de cocina . . . . . . . . . . . . . . . . . . . . 20
Selecciones de Microondas Preprogramadas . . 20
Cocinar por tiempo . . . . . . . . . . . . . . . . . . . . . . . 21
Nivel(es) de potencia del horno
microondas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Consejos de cocina . . . . . . . . . . . . . . . . . . . . . . . 21
Descongelación . . . . . . . . . . . . . . . . . . . . . . . . . .22
Cocción por sensor . . . . . . . . . . . . . . . . . . . . . . .23
Cosas que son normales . . . . . . . . . . . . . . . . . . .24
OTRAS FUNCIONES . . . . . . . . . . . . . . . .
25
MANTENIMIENTO Y LIMPIEZA
Dentro del Horno y del Cajón de Almacenamiento
de Accesorios (en algunos modelos) . . . . . . . 27
Plato giratorio removible . . . . . . . . . . . . . . . . . 27
Bandejas de Cocimiento y Parrilla
de Alambre del Horno . . . . . . . . . . . . . . . . . . . . 28
Lámpara Halógena y Lámina de Mica . . . . . . . 28
Fuera del Horno y del Cajón de Almacenamiento
de Accesorios (en algunos modelos) . . . . . . 28
CONSEJOS PARA LA SOLUCIÓN
DE PROBLEMAS . . . . . . . . . . . . . . . . . . . .
GARANTÍA
30
. . . . . . . . . . . . . . . . . . . . . . . . . . . 31
SOPORTE PARA EL CONSUMIDOR .
32
Anote aquí los números de modelo
y de serie:
Modelo número __________
Número de serie__________
Los encontrará en una etiqueta
dentro del horno.
GE es una marca registrada de General Electric Company. Fabricado bajo licencia de marca.
http://geadvantium.com
49-40686-4
12-16 GEA
GRACIAS POR HACER QUE GE APPLIANCES SEA PARTE DE SU HOGAR.
Ya sea que haya crecido usando GE Appliances, o que ésta es su primera vez, nos complace
tenerlo en la familia.
Sentimos orgullo por el nivel de arte, innovación y diseño de cada uno de los electrodomésticos de
GE Appliances, y creemos que usted también. Entre otras cosas, el registro de su electrodoméstico
asegura que podamos entregarle información importante del producto y detalles de la garantía
cuando los necesite.
Registre su electrodoméstico GE ahora a través de Internet. Sitios Web y números telefónicos útiles
están disponibles en la sección de Soporte para el Consumidor de este Manual del Propietario.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con
el material embalado.
2
49-40686-4
ADVERTENCIA Para reducir el riesgo de quemaduras, descargas eléctricas, incendio, lesiones o
exposición a energía de microondas excesiva:
Cuando utilice aparatos eléctricos, se deben seguir las precauciones de seguridad básicas, entre las que se incluyen las
siguientes:
Ŷ /HDWRGDVODVLQVWUXFFLRQHVDQWHVGHXWLOL]DUHVWHDSDUDWR
PARA REDUCIR EL RIESGO DE INCENDIO DENTRO DEL
HORNO:
Ŷ /HD\VLJDODVSUHFDXFLRQHVHVSHFtILFDVGHVFULWDVHQOD
Ŷ 1RFRFLQHH[FHVLYDPHQWHORVDOLPHQWRV9LJLOH
VHFFLyQ35(&$8&,21(63$5$(9,7$5/$326,%/(
cuidadosamente el aparato cuandose coloque papel,
EXPOSICIÓN A ENERGÍA DE MICROONDAS EXCESIVA
plástico u otros materiales combustibles dentro del
de la página 7.
microondas para facilitar la cocción.
Ŷ 8WLOLFHHVWHDSDUDWRVRODPHQWHSDUDHOILQSUHYLVWR
Ŷ
4XLWHODVWLULWDVGHVHJXULGDG WZLVWWLHV \DVDVPHWiOLFDV
como se describe en este manual. No utilice químicos
de los recipientes de papel o plástico antes de colocarlos
ni vapores corrosivos en este aparato. Este horno está
dentro del microondas.
específicamente diseñado para calentar, secar o cocinar
alimentos y bebidas y no está diseñado para usarse en n
Ŷ 6LORVPDWHULDOHVTXHVHHQFXHQWUDQGHQWURGHOKRUQR
laboratorio ni para uso industrial.
prenden fuego, mantenga cerrada la puerta del horno,
apáguelo y desconecte el cable eléctrico, o corte la
Ŷ 6yORSHUVRQDOFXDOLILFDGRGHEHUHSDUDUHVWHDSDUDWR
energía desde el panel de fusibles o del interruptor de
Póngase en contacto con el centro de mantenimiento
circuitos.
autorizado más cercano en caso de necesitar revisión,
Ŷ
1RXWLOLFHHOKRUQRSDUDDOPDFHQDUHOHPHQWRV1RGHMH
reparación o ajuste.
productos de papel, utensilios de cocina o alimentos en
INSTALLATION
el horno cuando no lo esté usando. Todos los estantes
Ŷ ,QVWDOHRXELTXHHVWHDSDUDWR~QLFDPHQWHGHDFXHUGRDODV
deberán ser retirados del horno cuando no se encuentren
instrucciones de instalación suministradas.
en uso.
Ŷ (VWHDSDUDWRGHEHFRQWDUFRQXQDFRQH[LyQDWLHUUD
Ŷ 1RRSHUHHOKRUQRVLQDOLPHQWRVDGHQWUR
&RQHFWHVyORDXQWRPDFRUULHQWHFRQDGHFXDGDFRQH[LyQD
WLHUUD9HUODVHFFLyQ,QVWUXFFLRQHVGHFRQH[LyQDWLHUUDGH Ŷ 1RXWLOLFHODVIXQFLRQHVGHOVHQVRUGRVYHFHV
sucesivamente en la misma porción de alimento. Si el
la página 7.
alimento no se cocina completamente después del primer
Ŷ (VWHKRUQRHVWiOLVWDGRSRU8/SDUDDLQVWDODFLyQGHSDUHG
FRQWHRUHJUHVLYRXWLOLFHODIXQFLyQ&22.%<7,0(
estándar. Consulte las instrucciones de instalación para
&2&,1$53257,(032 SDUDSHUPLWLUWLHPSRGHFRFFLyQ
que electrodomésticos aprobados se puedan montar sobre
adicional.
y debajo del microondas.
Ŷ Para evitar chispas no se debe utilizar la parrilla de
Ŷ 1RXWLOLFHHVWHDSDUDWRVLWLHQHHOFDEOHHOpFWULFRRHO
alambre del horno para el cocimiento rápido o cocimiento
enchufe dañados, si no funciona bien o si ha sufrido una
con microonda.
avería o una caída.
A
FIN
DE REDUCIR RIESGOS DE QUEMADURAS:
Ŷ 0DQWHQJDHOFDEOHDOHMDGRGHVXSHUILFLHVFDOLHQWHV
Ŷ 7HQJDFXLGDGRDODEULUHQYDVHVFRQFRPLGDFDOLHQWH8VH
Ŷ 1RSHUPLWDTXHHOFDEOHHOpFWULFRFXHOJXHVREUHHOERUGH
manijas y aleje el vapor del rostro y las manos.
de la mesa o del mostrador de encimera.
Ŷ 9HQWLOHSHUIRUHRFRUWHHQYDVHVEROVDVREROVDV
Ŷ 1RVXPHUMDHOFDEOHHOpFWULFRRHOHQFKXIHHQDJXD
plásticas para evitar la acumulación de presión.
Ŷ 7HQJDFXLGDGRDOWRFDUHOSODWRJLUDWRULRODSXHUWD
Ŷ 1RFXEUDQLEORTXHHQLQJXQDDSHUWXUDGHHVWHDSDUDWR
estantes o paredes del horno, los cuales se podrán
Ŷ 1RDOPDFHQHHVWHDSDUDWRDODLUHOLEUH1RXWLOLFHHVWH
calentar durante el uso.
producto cerca del agua; por ejemplo, en un sótano
Ŷ
/
RVOtTXLGRV\FLHUWDVFRPLGDVFDOHQWDGDVHQHOKRUQR
húmedo, cerca de una piscina, cerca de un lavabo o
microondas pueden presentar riesgos de quemaduras,
lugares similares.
DOVHUUHWLUDGRVGHOKRUQRPLFURRQGDV/DSRVLELOLGDGGH
Ŷ 1RPRQWHHVWHDSDUDWRVREUHHOIUHJDGHUR
quemaduras es mayor en niños pequeños, a los cuales
no se les deberá permitir retirar ítems calientes del horno
microondas.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
LEA Y GUARDE ESTAS INSTRUCCIONES
49-40686-4
3
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA Continuado
USO
Ŷ &RPRFRQFXDOTXLHUDSDUDWRFXDQGRVHDXWLOL]DGRSRU
niños es necesaria una estrecha vigilancia.
Ŷ 1RKDJDIXQFLRQDUHOKRUQRVLQWHQHUFRORFDGDHQVXOXJDU
ODEDVHJLUDWRULD/DEDVHJLUDWRULDGHEHHVWDUOLEUHGH
bloqueos para poder girar.
Ŷ 1RDOPDFHQHQLQJ~QHOHPHQWRGLUHFWDPHQWHVREUHOD
superficie del horno de microondas cuando éste se
encuentre en funcionamiento.
Ŷ /DVFRPLGDVRXWHQVLOLRVPHWiOLFRVGHWDPDxRH[FHVLYR
no deberán ser insertados en un horno microondas/
convección, ya que podrán generar un incendio o riesgos
de descargas eléctricas.
Ŷ 1RXWLOLFHSURGXFWRVGHSDSHOFXDQGRHODSDUDWRVHXWLOL]D
en modos diferentes al microondas.
Ŷ $OJXQRVSURGXFWRVWDOHVFRPRKXHYRVHQWHURV\
FRQWHQHGRUHVVHOODGRV SRUHMHPSORIUDVFRVVHOODGRV VRQ
SURSHQVRVDH[SORWDU\QRGHEHQFDOHQWDUVHHQHVWHKRUQR
Tal uso del horno puede resultar en lesiones personales.
Ŷ 1RFRFLQHODVSDSDVH[FHVLYDPHQWH3XHGHQ
deshidratarse y provocar fuego, causando daños al horno
Ŷ 1RFXEUDODVSDUULOODVXRWUDSDUWHGHOKRUQRFRQSDSHO
metálico. Esto puede sobrecalentar el horno.
Ŷ &RFLQHDIRQGRODFDUQHGHUHVRDYHODFDUQHGHUHVDSRU
los menos una temperatura INTERNA de 160° F y carne
de ave a por lo menos una temperatura INTERNA de 180°
F. Cocinar a estas temperaturas generalmente protege
contra enfermedades causadas por los alimentos.
Ŷ (VWHKRUQRQRKDVLGRDSUREDGRQLSUREDGRSDUDXWLOL]DFLyQ
marina.
LIMPIEZA
Ŷ 0
DQWHQJDHOKRUQROLEUHGHDFXPXODFLyQGHJUDVD
Ŷ 1
ROLPSLHFRQHVSRQMLOODVGHPHWDO3XHGHQGHVSUHQGHUVH
pedazos de la esponjilla y tocar partes eléctricas,
provocando un riesgo de descarga eléctrica.
Ŷ $OOLPSLDUVXSHUILFLHVGHSXHUWDV\KRUQRTXHVHXQHQDO
cerrar la puerta, sólo use detergentes suaves no abrasivos
aplicados con una esponja limpia o un paño suave.
Enjuague bien.
AGUA SOBRECALENTADA
Ŷ /tTXLGRVWDOHVFRPRDJXDFDIpRWpVRQFDSDFHV
de sobrecalentarse más allá del punto de ebullición
sin parecer que estén hirviendo. No siempre hay
burbujeo o hervor visible cuando se saca el recipiente
GHOKRUQRPLFURRQGDV(67238('(5(68/7$5(1
/$(%8//,&,Ï15(3(17,1$'(/Ë48,'2608<
&$/,(17(6&8$1'26(08(9((/5(&,3,(17(26(
,16(57$81$&8&+$5$8275287(16,/,2'(1752
'(//Ë48,'2
Ŷ 3
DUDUHGXFLUHOULHVJRGHOHVLyQItVLFD
1RVREUHFDOLHQWHHOOtTXLGR
5HYXHOYDHOOtTXLGRDQWHV\DODPLWDGGHOWLHPSRGH
calentamiento.
1RXWLOLFHUHFLSLHQWHVFRQFRVWDGRVUHFWRV\FXHOORV
angostos.
'HVSXpVGHFDOHQWDUHOUHFLSLHQWHGpMHORHQHOKRUQR
microondas por un período corto de tiempo antes de
sacarlo.
7HQJDH[WUHPDSUHFDXFLyQFXDQGRLQWURGX]FDXQD
cuchara u otro utensilio en el recipiente.
El arqueo voltaico puede ocurrir tanto durante la cocción rápida (speedcooking) y de
microondas. Si nota que ocurre arqueo voltaico, apriete el botón táctil CANCEL/OFF
(BORRAR/APAGAR) y corrija el problema.
Ŷ 8WHQVLOLRVGHFRFLQDGHPHWDOXWLOL]DGRVGXUDQWHODFRFFLyQ
El arqueo voltaico es el término técnico que define las
chispas en el horno. El arqueo voltaico es causado por:
UiSLGDRGHPLFURRQGDV H[FHSWRROODVVXPLQLVWUDGDVFRQ
HOKRUQR Ŷ 0HWDOROiPLQDGHPHWDOHQFRQWDFWRFRQHOFRVWDGRGHO
horno.
Ŷ 0
HWDOWDOFRPRWLULWDVPHWiOLFDVGHVHJXULGDGVXMHWDGRUHV
para carne de ave o platos con borde de oro en el horno.
Ŷ /iPLQDGHPHWDOPROGHDGDDODOLPHQWR ORVERUGHV
GREODGRVKDFLDDUULEDDFW~DQFRPRDQWHQDV Ŷ 7
RDOODVGHSDSHOUHFLFODGRTXHFRQWHQJDQSHGD]RVGH
metal pequeños que se utilizan en el horno.
Ŷ 8WLOLFHODOiPLQDGHPHWDOVHJ~QODVUHFRPHQGDFLRQHVGH
este manual.
ADVERTENCIA
LEA Y GUARDE ESTAS INSTRUCCIONES
4
49-40686-4
ADVERTENCIA UTENSILIOS PARA COCCIÓN RÁPIDA SEGUROS PARA MICROONDAS
Ŷ El horno y la compuerta se tornarán muy calientes
cuando se utiliza la función de cocción rápida.
Ŷ Los utensilios de cocina se tornarán muy calientes
debido a la transferencia de calor proveniente de los
alimentos calentados. Se requerirán guantes de cocina
protectores para manipular los recipientes de cocina.
Ŷ 1RXWLOLFHWDSDVUHFLSLHQWHVREROVDVGHFRFFLyQDVDGR
fabricadas de láminas de metal, plástico, cera o papel
cuando cocine con la función de cocción rápida.
Ŷ 1RFXEUDODEDVHJLUDWRULDSDUULOODGHDODPEUHEDQGHMDV
ni ninguna pieza del horno con lámina de metal. Esto
provocará arqueo voltaico en el horno.
Ŷ 8WLOLFHODEDQGHMDGHPHWDODQWLDGKHUHQWHHODPLVPD
forma que utilizaría una bandeja o charola para hornear
plana.
Ŷ No use la rejilla de acero del horno para la cocción rápida
Cuando utilice el hornoel
plato giratoriosiempre debe
estarcolocado en su lugar.
Ŷ &RORTXHORVDOLPHQWRVGLUHFWDPHQWHHQODVEDQGHMDV
cuando cocine, a menos que el horno le indique otra
cosa.
Ŷ 3XHGHXWLOL]DUHQHOKRUQRFXDOTXLHUSODWRGLVHxDGRSDUD
PLFURRQGDV/DVUHFHWDVGHO/LEURGHFRFLQD$GYDQWLXP
VHSUREDURQHQUHFLSLHQWHVGHFRFLQDGHYLGULR3\UH[®
\FDFHURODVGHFHUiPLFD&RUQLQJZDUH®/RVWLHPSRV\
resultados de cocción pueden variar cuando se utilizan
otros tipos de recipientes diseñados para hornos
microondas. Colóquelos directamente en las bandejas.
Ŷ (OXVRGHODEDQGHMDGHYLGULRFODURDOFRFLQDUHQ
velocidad resultará en un rendimiento inferior de la
cocción y posibles fisuras sobre la bandeja de vidrio.
Ŷ 8VHVROREDQGHMDVPHWiOLFDVHVSHFLILFDGDVSDUDXVR
con este horno. Otras bandejas metálicas no fueron
diseñadas para uso con este horno y resultarán en un
rendimiento inferior de la cocción.
Para cocimiento rápido
coloque la comida
directamente en la bandeja de
metal para asar.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
Para cocinar rápido,convección,
hornear, calentar o tostar
coloquela comida directamenteen
la bandeja de metal.
RECIPIENTES DE COCINA SEGUROS DISEÑADOS PARA HORNEAR, ASAR,
ADVERTENCIA CALENTAR, ACTIVAR Y TOSTAR
Ŷ El horno y la compuerta se tornarán muy calientes
cuando se hornea, asa, calienta, activa o tuesta algo.
Ŷ Los recipientes de cocina se tornarán muy calientes.
Se requerirán guantes de cocina protectores para
manipular los recipientes de cocina.
Ŷ 1RXWLOLFHWDSDVUHFLSLHQWHVQLEROVDVGHFRFFLyQDVDGR
fabricadas de láminas de metal, plástico, cera o papel
cuando cocine con la función de cocción rápida.
Ŷ 8WLOLFHODEDQGHMDPHWiOLFDDQWLDGKHUHQWHGHODPLVPD
forma que utilizaría una bandeja o charola para hornear
plana.
Ŷ Use la bandeja con rejilla del horno para hornear por
convección o calentar en dos niveles.
Cuando utilice el hornoel plato
giratorio siempre debe estar
colocado en su lugar.
Para asar coloque la comida
directamente en la bandeja de
metal para asar.
Ŷ &RORTXHORVDOLPHQWRVGLUHFWDPHQWHHQODVEDQGHMDV
cuando cocine, a menos que el horno le indique hacer
otra cosa.
Ŷ 3XHGHXWLOL]DUHQHOKRUQRFXDOTXLHUSODWRGLVHxDGRSDUD
PLFURRQGDV/DVUHFHWDVGHO/LEURGHFRFLQD$GYDQWLXP
VHSUREDURQHQUHFLSLHQWHVGHFRFLQDGHYLGULR3\UH[®
\FDFHURODVGHFHUiPLFD&RUQLQJZDUH®/RVWLHPSRV\
resultados de cocción pueden variar cuando se utilizan
otros tipos de recipientes diseñados para hornos
microondas. Colóquelos directamente en las bandejas.
Ŷ 8WLOL]DUODEDQGHMDGHYLGULRWUDQVSDUHQWHFXDQGRKRUQHD
asa, calienta, activa o tuesta puede producir resultados
insatisfactorios.
Para hornear con convección,
calentar o tostar coloquela
comida directamenteen la
bandeja de metal.
Coloque la comida directamente sobre
el estante con rejilla o en el plato
adecuado y coloque el mismo sobre
el estante al hornear o calentar en
múltiples niveles.
LEA Y GUARDE ESTAS INSTRUCCIONES
49-40686-4
5
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
ADVERTENCIA RECIPIENTES DE COCINA SEGUROS DISEÑADOS PARA
MICROONDAS
Asegúrese de utilizar recipientes de cocina adecuados durante
la cocción a microondas. Se pueden utilizar la mayoría de
las cacerolas, platos para cocinar, tazas de medir, tazas
normales, cerámica o loza que no tengan bordes metálicos o
vidriados con un recubrimiento metálico. Algunos recipientes
de cocina se encuentran marcados como adecuados para
microondas.
Ŷ &RORTXHORVDOLPHQWRVRUHFLSLHQWHSDUDPLFURRQGDV
directamente en la bandeja de vidrio transparente para
cocinar sus alimentos.
Ŷ /DXWLOL]DFLyQGHODEDQGHMDPHWiOLFDDQWLDGKHUHQWH
durante la cocción en microondas puede producir
resultados insatisfactorios.
Ŷ /RVXWHQVLOLRVGHFRFLQDSXHGHQWRUQDUVHPX\FDOLHQWHV
debido a la transferencia de calor proveniente de los
alimentos calentados. Podrían requerirse guantes de
cocina para manipular los recipientes de cocina.
Ŷ 1RXWLOLFHSURGXFWRVGHSDSHOUHFLFODGR/DVWRDOODV
servilletas y papel encerado fabricados de material
reciclado pueden contener partículas metálicas que
pueden causar arqueo voltaico o prender fuego. Se deben
evitar los productos de papel que contienen nylon o
filamentos de nylon, ya que también pueden incendiarse.
Ŷ 8WLOLFHODVOiPLQDVPHWiOLFDV~QLFDPHQWHFRPRVHLQGLFD
en este manual. Cuando utilice la lámina de metal en el
KRUQRPDQWHQJDODOiPLQDSRUORPHQRVƎDOHMDGDGHORV
costados del horno.
Ŷ 6LXWLOL]DXQWHUPyPHWURGHFDUQHPLHQWUDVFRFLQD
asegúrese que sea seguro para utilizarse en hornos
microondas.
Ŷ $OJXQDVEDQGHMDVGHHVSXPD FRPRDTXHOODVHQODVTXH
VHHPSDFDODFDUQH WLHQHQXQDWLULWDGHPHWDOGHOJDGD
empotrada en la parte inferior. Cuando se cocinan con
microondas, el metal puede quemar el fondo del horno o
hacer que arda una toalla de papel.
Ŷ 6HSXHGHXWLOL]DUWRDOODVGHSDSHOSDSHOHQFHUDGR\ODV
envolturas plásticas para cubrir los platos con el propósito
de mantener la humedad y prevenir los salpicones.
Asegúrese de ventilar cortando la envoltura plástica para
que pueda escapar el vapor.
Ŷ 1RWRGDVODVFXELHUWDVSOiVWLFDVVRQDGHFXDGDVSDUD
KRUQRVPLFURRQGDV/HDHQODFDMDODVLQVWUXFFLRQHV
correspondientes.
Ŷ 6HGHEHQFRUWDUSHUIRUDURYHQWLODUFRPRVHLQGLFDHQOD
caja las bolsas de cocina “hervibles” y bolsas plásticas
cerradas herméticamente. De lo contrario, el plástico
puede reventarse durante o inmediatamente después de
la cocción, resultando en una posible lesión. También,
los recipientes de almacenamiento plásticos deben al
menos estar parcialmente descubiertos debido a que
forman un sello muy ajustado. Al cocinar con recipientes
cubiertos con envoltura plástica de manera muy ajustada,
quite cuidadosamente la cubierta y dirija el vapor fuera y
alejado de manos y rostro.
Ŷ 5HFLSLHQWHVGHFRFLQDSOiVWLFRV²/RVUHFLSLHQWHVGH
cocina diseñados para microondas son muy útiles, pero
deben utilizarse con cuidado. Incluso el plástico diseñado
para microondas podría no tolerar condiciones de sobre
cocción, así como los materiales de vidrio o cerámica
\SRGUtDQVXDYL]DUVHRFDUERQL]DUVHVLVHH[SRQHQD
SHUtRGRVFRUWRVGHVREUHFRFFLyQ(QH[SRVLFLRQHV
más prolongadas a la sobrecocción, los alimentos y los
recipientes de cocina podrían coger fuego.
Ŷ 1
RXWLOLFHODSDUULOODGHDODPEUHGHOKRUQRSDUDFRFLQDUFRQ
microonda.
Siga las siguientes pautas:
1. Utilice plásticos seguros para microondas únicamente y
utilícelos estrictamente según las especificaciones del
fabricante.
2. No cocine en el microondas recipientes vacíos.
3. No permita que los niños utilicen recipientes de plástico
sin vigilarlos bien.
/Dbase giratoria siempre
debe estar colocada en su
lugar cuando se utiliza el
horno.
/D bandeja de cristal
transparente siempre
deberá estar en su lugar
cuando se cocina con
microondas.
LEA Y GUARDE ESTAS INSTRUCCIONES
6
49-40686-4
PRECAUCIONES PARA EVITAR LA POSIBLE
EXPOSICIÓN A ENERGÍA DE MICROONDAS EXCESIVA
(a) No intente hacer funcionar el horno con
la compuerta abierta ya que ésto puede provocar
H[SRVLFLyQSHOLJURVDDODHQHUJtDGHPLFURRQGDV(V
importante no forzar ni dañar los seguros.
(b) No coloque ningún objeto entre la parte frontal del horno
y la compuerta, ni permita que se acumulen residuos de
producto limpiador o detergente, suciedad o polvo en las
superficies de sellado.
(c) No haga funcionar el horno si se encuentra dañado. Es
particularmente importante cerrar bien la compuerta
ODFRPSXHUWD GREODGDRFXUYDGD ODVELVDJUDV\SHVWLOORV URWRVRIORMRV V HOORVGHODFRPSXHUWD\VXSHUILFLHVGHVHOODGR
(d) El horno no debe ser ajustado o reparado por ninguna
SHUVRQDH[FHSWRSRUSHUVRQDOGHPDQWHQLPLHQWR
calificado.
INSTRUCCIONES DE CONEXIÓN A TIERRA
ADVERTENCIA
El uso inadecuado del enchufe de conexión a tierra puede provocar un riesgo de descarga
eléctrica.
(VWHHOHFWURGRPpVWLFRGHEHHVWDUFRQHFWDGRDXQVLVWHPDGHFDEOHDGRGHPHWDOSHUPDQHQWHFRQFRQH[LyQDWLHUUDRVHGHEH
WHQGHUXQFRQGXFWRSDUDODFRQH[LyQDWLHUUDGHOHTXLSRFRQORVFRQGXFWRUHVGHOFLUFXLWR\FRQHFWDGRDOWHUPLQDOGHWLHUUDGHO
equipo o al conductor de suministro del electrodoméstico.
INFORMACIÓN DE SEGURIDAD
INFORMACIÓN IMPORTANTE DE SEGURIDAD
LEA TODAS LAS INSTRUCCIONES ANTES DE USAR
AVISO: MARCAPASOS
/DPD\RUtDGHORVPDUFDSDVRVVHHQFXHQWUDQSURWHJLGRVFRQWUDODLQWHUIHUHQFLDGHSURGXFWRVHOHFWUyQLFRVLQFOX\HQGRORV
microondas. Sin embargo, los pacientes que tengan marcapasos deberían consultar a sus médicos si tienen alguna duda.
ADVERTENCIAS DE LA PROPOSICIÓN 65 DEL ESTADO DE CALIFORNIA:
ADVERTENCIA Este producto contiene uno o más químicos que el Estado de California entiende que
producen cáncer, y defectos en el nacimiento u otros daños reproductivos.
49-40686-4
7
ADVANTIUM: Familiarícese con Advantium
Familiarícese con Advantium
¿Qué es Advantium?
El horno Advantium utiliza tecnologíaavanzada de Cocimiento
rápido paraaprovechar la energía de la luz. Elhorno Advantium
FRFLQDHOH[WHULRUGHORVDOLPHQWRVPX\SDUHFLGRDOFDORU
radiante convencional, al mismo tiempoen que penetra la
VXSHUILFLHSDUDFRFLQDUHOLQWHULRUVLPXOWiQHDPHQWH/DOX]
halógena es la fuente primariade energía, un sistema de
conveccióny un calentador de cerámica ayudan alcocimiento,
con un “refuerzo de microonda” agregado en algunos
DOJRULWPRVGHFRFLPLHQWR/RVDOLPHQWRVVHFRFLQDQSDUHMRV\
rápido, al mismo tiempoen que retienen su humedad natural.
El horno Advantium es capaz de cocinar rápido, hornear con
convección, asar, tostar, calentar, fermentar y cocinar con
PLFURRQGD/DIXQFLyQGHFRFLPLHQWRUiSLGRHVHOPD\RU
beneficio del horno Advantium.
Para cocinar rápido no se requiere precalentar. Coloque los
alimentos en elhorno y comience a cocinar inmediatamente.
Se ahorra tiempo ya que noprecalienta y debido a que éste
cocinamás rápido.
Inicio Rápido de Advantion
Configure el reloj
Para cambiar la hora:
Cuando enchufe el horno por primera vez o luego de un corte
de corriente:
3
UHVLRQHODWHFOD237,216 2SFLRQHV 1. Gire el dial para configurar la hora. Presione el dial para
ingresar.
2. Gire el dial para seleccionar los minutos. Presione el dial
para ingresar.
3. Gire el dial para seleccionar AM o PM. Presione el dial para
ingresar.
*
LUHHOGLDOD6(7&/2&. &RQILJXUDU5HORM 3UHVLRQHHO
dial para ingresar y seguir las instrucciones de configuración
que aparecen en pantalla.
El reloj fue diseñado para apagar la unidad cuando quede
inactiva durante 30 segundos, a fin de minimizar el uso de
la energía en suspensión. El reloj se encenderá cuando la
unidad se encuentre en uso, la puerta sea abierta, la tecla
&$1&(/2)) &DQFHODU$SDJDU VHDSUHVLRQDGDRHOGLDOVHD
presionado. No hay una opción de anulación disponible basada
en los requisitos de energía DOE.
Uso del microondas con la función EXPRESS (RÁPIDA)
Presione EXPRESS de forma repetida por incrementos de 30
segundos de tiempo de cocción en el microondas.
El horno se inicia de inmediato.
El plato giratorio debe
estar en la ubicación
correcta al usar el horno.
/DEDQGHMDGHYLGULR
transparente siempre debe
estar en su lugar al cocinar
en el microondas.
Inicio de cocción rápida
3UHVLRQHODWHFOD63(('&22. &RFFLyQ5iSLGD *LUHHOGLDOSDUDVHOHFFLRQDU)22'0(18 0HQ~GH
&RPLGDV 3UHVLRQHHOGLDOSDUDLQJUHVDU
3. Gire el dial para seleccionar la categoría de comida que
desee. Presione el dial para ingresar la misma.
4. Gire el dial para seleccionar la comida específica. Presione
el dial para ingresar.
5. Gire el dial para seleccionar la cantidad, tamaño y/o
ILQDOL]DFLyQ VLHVQHFHVDULRHOKRUQRGDUiXQDYLVR Presione el dial luego de cada selección.
8
6. Una vez que la pantalla muestre ADJUST TIME OR START
$MXVWHGH7LHPSRR,QLFLR SUHVLRQHODWHFODGLDORLQLFLR
para iniciar la cocción.
Ŷ Presione CANCEL/OFF (Borrar/ Apagar) en cualquier
momento para detener la cocción.
El plato giratorio debe estar en
la ubicación correcta al usar el
horno.
Coloque la comida directamente
en la bandeja de metal
antiadherente para una cocción
rápida.
49-40686-4
A través de este manual, las características y apariencia pueden variar de las de su modelo.
3
1
4
2
10
5
11
9
6
8
7
1. Plato Giratorio
Para todos los tipos de cocimiento el plato giratorio siempre
debe estar en su lugar, en el piso del horno. Asegúresede
que esté colocado seguro sobre eleje en el centro del horno
con el lado que posee la marca mirando hacia arriba.
6. Ventana
Permite ver el cocmiento, al mismo tiempo en que mantiene
confinadas las microondas adentro del horno.
2. Bandeja de Metal o Bandeja de Metal para Asar
Al cocinar rápido, asar y tostar coloque los alimentos
directamente en la bandeja de metal o bandeja de metal
para asar y coloque el plato giratorio.
8. Aldabas de la Puerta
Para que el horno funcione la puerta debe estar cerrada con
la aldaba.
3. Parrilla de Alambre del Horno
Al hornear con convección o en dos niveles coloque los
alimentos directamente en la bandeja de metal o plato
seguro para elhorno sobre la parilla de alambre del horno.
4. Bandeja de Vidrio Claro
Coloque el plato giratorio cuando utilice las funciones de
microonda. Coloque los alimentos o el recipiente seguro
paramicroondas directamente en la bandeja.
5. Lámparas Halógenas Superiores
Al cocinar rápido, asar y tostar, dos lámparas halógenas de
1200” cocinan losalimentos.
49-40686-4
ADVANTIUM: Funciones del Horno
Funciones del horno
7. Manilleta de la Puerta
Hale para abrir la puerta.
9. Calentador de Cerámica Inferior
Un calentador de cerámica de 500W cocina los alimentos
por la parte deabajo, al cocinar rápido, asar otostar.
10. Panel de Control
/DVWHFODVXWLOL]DGDVSDUDRSHUDUHOKRUQRHVWiQXELFDGDV
en el panel decontrol.
11. Sistema de Convección
Un elemento de calentamiento de 1500W cocina los
alimentos con unventilador de convección haciendocircular
el aire caliente a través dela cavidad para cocinar rápido,
asar,hornear con convección, tostar y calentar.
9
ADVANTIUM: Controles
Controles
Con su horno advantium usted podrá cocinar con luces halógenas de altaintensidad, calentadores de cerámica,
elemento de calentamiento de convección y/o con energía de microonda convencional.
1
2
3
1.
5
4
7
6
9
8
10
SPEEDCOOK/Repeat Last (cocimiento rápido/Repita el
Último Paso)
Presione este botón para acceder al menú predeterminado
de cocción rápida. Mantenga el mismo presionado durante
3 segundos para repetir la última selección de cocción.
2.
CONVECTION BAKE/BROIL
(hornear con convección o asar)
Presione esta tecla para hornear, asar o tostarcon
convección.
3.
COCCIÓN COMÚN CON SPEEDCOOK
Presione esta tecla para configurar su propia
SURJUDPDFLyQGHVSHHGFRRN FRFFLyQUiSLGD 4.
5.
6.
7.
11
CALENTAR/ LEUDAR
6HOHFFLRQHODIXQFLyQ:$50 FDOHQWDU SDUDPDQWHQHU
las comidas calientes y cocinadas en la temperatura para
servir.
HOHFFLRQH3522) /HXGDU SDUDFUHDUXQDPELHQWH
6
cálido que sea útil para la elevación de productos
fermentados a base de levadura.
COCINAR (Microondas)
Presione esta tecla para cocinar en el microondas.
EXPRESS (Microondas)
Presione esta tecla durante 30 segundos de tiempo de
cocción en el microondas. Cada vez que se presiona
esta tecla, se suman 30 segundos al tiempo de cocción
restante. El horno se inicia de inmediato.
DESCONGELAR (Microondas) / LUZ DEL HORNO
Presione esta tecla para descongelar, ablandar o derretir
comidas. Mientras cocina, presione esta tecla para
iluminar la cavidad durante 4 segundos.
8.
RECALENTAR (Microondas)
Presione esta tecla para recalentar comidas cocinadas
previamente, un plato con restos de comida o bebidas.
9.
RECETAS FAVORITA
3UHVLRQHHVWDWHFODSDUDDJUHJDUHGLWDU FDPELDU RUHWLUDU
una receta de la memoria.
12
13
15
16
14
17
18
11. DISPLAY (pantalla)
Muestra y da instrucciones sobre el uso de todas las
funciones del horno.
12. SELECTOR DIAL (dial selector) –Turn to select, Gire
para seleccionar, presione para ingresar Primero. Gire,
luego presione el dial para elegir opciones, comidas,
nivel de potencia o temperatura. También use el dial para
LQFUHPHQWDU JLUHHQGLUHFFLyQGHODVDJXMDVGHOUHORM R
UHGXFLU JLUHHQFRQWUDGHODVDJXMDVGHOUHORM ORVWLHPSRV
de cocción.
13. START/PAUSE (inicio/pausa)
Presione esta tecla para iniciar o detener cualquier función
de cocimiento.
14. CANCEL/OFF
Presione esta tecla para cancelar TODAS las operaciones
GHOKRUQRH[FHSWRHOEORTXHRGHOFRQWUROHOUHORM\HO
temporizador.
15. BACK (regreso)
Presione este botón para retroceder uno o más niveles del
proceso de programación.
16. HELP (ayuda)
Presione este botón para averiguar más sobre las
funciones del horno.
17. ENCENDIDO/ TEMPERATURA
Durante la cocción, presione esta tecla y gire/ presione
el dial de selección para cambiar el nivel de potencia del
microondas, la temperatura de horneado por convección o
ORVQLYHOHVGHSRWHQFLDGHVSHHGFRRN FRFFLyQUiSLGD 18. OPCIONES
3UHVLRQHHVWDWHFODSDUDFRQILJXUDU&ORFN UHORM \DFFHGHU
D%HHSHU9ROXPH YROXPHQGHSLWLGR $XWR5HFLSH
&RQYHUW FRQYHUVLyQGHDXWRUHFHWD DSDJDGD 'LVSOD\
6FUROO6SHHG YHORFLGDGGHGHVSOD]DPLHQWRGHSDQWDOOD 'HOD\6WDUW LQLFLRUHWUDVDGR \IXQFLRQHVGH5HPLQGHU
UHFRUGDWRULRV 10. TIMER (cronómetro)
Presione esta tecla para configurar el temporizador por
minutos.
10
49-40686-4
ADVERTENCIA
Cuando utilice los programas de cocción rápida, recuerde que el horno,
compuerta y los platos se ¡encontrarán muy calientes!
Antes de utilizar su horno por primera vez, se debe programar el reloj. Consulte la sección de Inicio rápido de
Advantium.
Antes de empezar, asegúrese que se encuentre colocada la base giratoria. Si es necesario, utilice la bandeja de
metal antiadherente y sus propios recipientes de cocina de cerámica o vidrio.
Nivel de potencia de la función de cocción rápida
El Advantium utiliza energía de las lámparas halógenas
de alta intensidad, delcalentador de cerámica, del sistema
deconvección y de microondas para cocinar simultáneamente
los alimentos porarriba, abajo y en el interior, y sellar
lahumedad y el sabor.
Cuando utilice el menú predeterminado dealimentos, los
niveles de potencia yaestán seleccionados para usted.
Sin embargo, estos se pueden ajustar al utilizar el menú
predeterminado de alimentosy COCCIÓN COMÚN CON
SPEEDCOOK.
Cada nivel de potencia le ofrece energíade la lámpara
halógena o del calentadorde cerámica y de microonda durante
cierto porcentaje de tiempo o le ofrece calentamiento para el
sistema de convección.
Por ejemplo:
8± /iPSDUDKDOyJHQDVXSHULRUHQFHQGLGDHOGHO
tiempo.
/± &DOHQWDGRUGHFHUiPLFDLQIHULRUHQFHQGLGRHOGHO
tiempo.
C–06 Elemento de convección calienta el horno a 350ºF.
0± 0LFURRQGDHQFHQGLGRHOGHOWLHPSR
NOTA: Tenga cuidado al ajustar los niveles de potencia de
manera que no cocinelos alimentos demasiado o muy poco.
1. Presione la tecla SPEEDCOOK y seleccione su comida
VLJDODVLQVWUXFFLRQHVGHXVRGHOPHQ~SUHGHWHUPLQDGRGH
FRFLPLHQWRUiSLGR &
XDQGRODSDQWDOODPXHVWUH$'-8677,0( $MXVWHGH
7LHPSR R67$57 ,QLFLDU SUHVLRQHODWHFOD32:(5
/(9(/ 1LYHOGH3RWHQFLD Si no desea cambiar ninguno de losajustes, simplemente
presione eldial y pase a la siguiente selección.
COCCIÓN RÁPIDA
Cocción rápida
Presione el dial para seleccionar.
5. Gire el dial para cambiar el nivel depotencia de microonda.
Presioneel dial para seleccionar.
6. Gire el dial para cambiar el nivel depotencia de convección.
Presioneel dial para seleccionar.
7. Presione la tecla START/PAUSEo el dial selector para
comenzara cocinar.
Siga estas guías generales cuando seleccione los mejores
DMXVWHVGH8 / 0 \& SDUDVXV5HFHWDV)DYRULWD
U = Seleccione un ajuste más alto paraalimentos delgados
TXHUHTXLHUHQXQFDIpGRUDGRHQODSDUWHGHDUULED SRUHMHPSOR
ILOHWHVGHSHVFDGRWRVWDGDVSHFKXJDVGHSROORGHVKXHVDGDV Seleccione un ajuste más bajopara alimentos gruesos o con
PXFKRFRQWHQLGRGHD]~FDURJUDVD SRUHMHPSORPXIILQV
URVWL]DGRVFDFHURODV RTXHUHTXLHUDQXQWLHPSRGHFRFLPLHQWR
más largo.
/ 6HOHFFLRQHXQDMXVWHPiVDOWRSDUDDOLPHQWRVJUXHVRVR
densos que norequieren un cocimiento rápido en elcentro
SRUHMHPSORVWHDNVFDFHURODV 6HOHFFLRQHXQDMXVWHPiV
EDMRSDUDDOLPHQWRVGHOJDGRV SRUHMHPSORJDOOHWDV M = Seleccione un ajuste más alto paraacortar el tiempo de
FRFLPLHQWRSDUDDOLPHQWRVGHQVRVRSHVDGRV SRUHMHPSOR
FDFHURODVSROORVHQWHURV 6HOHFFLRQHXQDMXVWHPiVEDMR
SDUDDOLPHQWRVGHOLFDGRV SRUHMHPSORSDQHV RDOLPHQWRV
que requierenun período de cocimiento más largopara
REWHQHUUHVXOWDGRVVXDYHV SRUHMHPSORVWHDNVFDUQH
SDUDDVDU C = Seleccione un ajuste más bajo paraalimentos más
delicados que se cocinan a temperaturas más bajas.
6HOHFFLRQHXQDMXVWHPiVDOWR RPD\RU SDUDDOLPHQWRV
robustos o quese cocinan a temperaturas arriba de350ºF.
3. Gire el dial en dirección de las manecillas de reloj para
aumentar o al contrario para disminuir el nivelde potencia
superior. Presione eldial para seleccionar.
4. Gire el dial para cambiar el nivel depotencia inferior.
49-40686-4
11
COCCIÓN RÁPIDA
Cocción rápida
Uso de lasfunciones de cocimiento rápido
Ŷ(OKRUQRVHGHWHQGUiVLDEUHODSXHUWDGXUDQWHHOFRFLPLHQWR\
aparecerá PAUSE enla pantalla. Para reanudar el cocimiento
cierre la puerte y presione START/PAUSE.
ŶPara cocinar un tiempo adicional después deque terminó el
ciclo de cocimiento, utilice lafunción para Reanudar, como se
le indica enla pantalla.
ŶSeleccione EDIT para cambiar el tiempo olos niveles de po
tencia en cualquier momento durante el cocimiento.
El plato giratorio debe estar colocadoen
su lugar siempre que utiliza el horno.
ŶSe produce humo al cocinar rápido carnes en el horno.
Para cocinar ràpido coloque los alimentos directamente en la
bandeja de metal o en la bandeja de metal para asar.
Consejos de cocción
Para asegurar un dorado uniforme y constante cuando cocine
los alimentos directamente en la bandeja de metal, coloque los
alimentos como se indica a continuación.
Los alimentos pueden tocarse pero no deben estar montados unos sobre otros.
Patrón circular
(MHPSORELVFRFKRVJDOOHWDV
Patrón de lado a lado
(MHPSORFDUQHV\DYHV
/DFDUQHSROORSHVFDGRRPDULVFRVIUHVFRVTXHHVWiQFRQJH
ODGRVGHEHQGHVFRQJHODUVHDQWHVGHFRFLQDUORV 3XHGHXWLOL]DU
ODIXQFLyQGHGHVFRQJHODFLyQGHOPLFURRQGD 6LJDODVLQVWUXF
cionesdel paquete para otros alimentos congelados empaca
dos.
Patrón radial
(MHPSORUROOLWRVGH
PHGLDOXQD>FUHVFHQW@
Capa sencilla
(MHPSORDSHULWLYRV
Recipientos para cocimiento rápido
Ŷ 6
LJDODVVXJHUHQFLDVSDUDXWHQVLOLRVGHFRFLQDHQOD
SDQWDOODGHOKRUQRRHQHO/LEURGH&RFFLyQROD*XtDGH
Cocción.
Ŷ /RVUHFLSLHQWVVHFDOHQWDUiQ1HFHVLWDUiJXDQWHVSDUD
manipular los recipientes.
Ŷ &XDQGRFRFLQHFRORTXHORVDOLPHQWRVGLUHFWDPHQWHHQOD
bandeja de metal o en la bandeja de metal para asar, a
menos de que el horno le indique lo contrario.
Ŷ 8WLOLFHODEDQGHMDGHPHWDOGHODPLVPDPDQHUDHQTXH
utilizaría una pan para hornear baja o una bandeja para
hornear.
Ŷ $GHPDVGHORVXWHQVLOLRVVXPLQLVWUDGRVXVWHGSXHGHXWLOL]DU
platos de cacerolasque no sean de metal, platos para
tartasy otros recipientes seguros para el calor.Colóquelos
directamente en la bandejade metal.
Ŷ $VHJ~UHVHGHVHOHFFLRQDUXQWDPDxRTXHURWHIiFLOPHQWH
Ŷ &RORTXHODEDQGHMDGHPHWDORODEDQGHMDGHPHWDOSDUD
asar en el plato giratorio. Coloque el recipiente de vidrio o
cerámicaen la bandeja.
Ŷ &XDQGRFRFLQHUiSLGRQRXWLOLFHUHFLSLHQWHVQLFXELHUWDV
hechas de papel, plástico o aluminio.
Cocción rápida personalizada
(O$GYDQWLXPOHRIUHFHIOH[LELOLGDGDOFRFLQDUVXVSODWRV
favoritos.
Si desea cocinar una comida que nose encuentra entre
nuestras selecciones predeterminada, utilice cocimiento rápido.
3UHVLRQHODWHFOD63(('&22. &RFFLyQ5iSLGD Si no se realiza ninguna entrada durante 15 segundos, la
pantalla volverá a quedar en blanco.
2. Gire el dial selector para seleccionar el tiempo de
cocimiento. Presione el dial para seleccionar.
/DSDQWDOODOHLQGLFDUiTXHGHEHVHOHFFLRQDUHOQLYHOR
niveles de potencia.
3. Gire el dial para seleccionar el nivelde potencia superior.
Gire el dial en dirección de las manecillas del relojpara
aumentar o en dirección contrariapara disminuir el nivel de
potencia superior. Presione el dial para seleccionar.
12
4.
Gire el dial para seleccionar el nivel depotencia inferior.
Presione para seleccionar.
5. Gire el dial para seleccionar el nivel depotencia de
microonda. Presione paraseleccionar.
6. Gire el dial para seleccionar el nivel depotencia de
convección. Presione paraseleccionar.
7. Presione la tecla START/PAUSE o presione el dial
selector para comenzara cocinar.
Para sugerencias sobre el nivel de potencia o tiempo de
cocimiento, utilice la guíade cocimiento, libro de recetas o las
selecciones del menú predeterminado de cocimiento rápido.
49-40686-4
Repeat Last (Repetir último)
Continuar función
Utilice esta función de ahorro de tiempo para cocinar alimentos
repetitivos como galletas o entradas.
NOTA: El último programa utilizado se almacena durante dos
horas.
1. Apretar y mantener apretado el botón SPEEDCOOK
&2&&,Ï15È3,'$ GXUDQWHVHJXQGRV
2. Se mostrará el último alimento preprogramado.
$SULHWHHOERWyQ67$573$86( ,1,&,$53$86$5 RHOGLDO
selector para iniciar la cocción.
1. Si sus alimentos necesitan cocinarse por un poco más de
tiempo, puede reiniciar el horno apretando el botón START/
3$86( ,1,&,$53$86$5 RHOGLDOVHOHFWRU
(OPHQVDMH5(680(&22.,1* &217,18$5
&2&,1$1'2 VHPRVWUDUi\HOKRUQRUHLQLFLDUi
LQPHGLDWDPHQWHDOGHOWLHPSRRULJLQDO
El programa se mantiene en la memoria durante 10 minutos.
Después de ello necesitará iniciar el programa nuevamente.
Consulte el menú de Cómo utilizar el menú de cocción rápida
preprogramado.
COCCIÓN RÁPIDA
Cocción rápida
Menú de cocción rápida preestablecido
SPEEDCOOK PRE-SET FOOD SELECTIONS:
Ŷ$SSHWL]HUV
Ŷ'HVVHUWV
Ŷ3L]]D
Ŷ6DQGZLFK
Ŷ%UHDGV
Ŷ(QWUHHV
Ŷ3RWDWRHV
Ŷ6HDIRRG
Ŷ%UHDNIDVW
Ŷ0HDWV
Ŷ3RXOWU\
Ŷ6LGH'LVK
$GYDQWLXPLVDOUHDG\SUHVHWWRFRRNRYHUSRSXODUGLVKHV
1. Press the SPEEDCOOK pad.
,IQRVHOHFWLRQLVPDGHZLWKLQVHFRQGVWKHGLVSOD\ZLOO
return to blank.
2. Turn the selector dial to select the type of food category
\RXZDQW3UHVVWKHGLDOWRHQWHU
7
XUQWKHVHOHFWRUGLDOWRVHOHFWWKHVSHFLILFIRRG PHQX
VHOHFWLRQ 3UHVVWKHGLDOWRHQWHU
4. Turn the selector dial to select amount, size, and/or
GRQHQHVV LIUHTXLUHGWKHRYHQZLOOSURPSW\RX 3UHVVWKH
dial after each selection.
7XUQWKHIRRGRYHUZKHQWKHRYHQVLJQDOV7851)22'29(5
IRUFHUWDLQIRRGV When the oven signals CHECK for DONENESS, check to see
LI\RXUIRRGLVGRQHWR\RXUOLNLQJ IRUFHUWDLQIRRGV 7RUHYLHZVHWWLQJVGXULQJFRRNLQJSUHVVWKHVHOHFWRUGLDO
If you enter an undesired selection at any time, simply press
WKH%$&.SDGDQGUHHQWHUWKHGHVLUHGVHOHFWLRQV
Speedcooking meats in the oven may produce smoke.
2
QFHWKHGLVSOD\VKRZV$'-8677,0(RU67$57SUHVV
start or the selector dial to start cooking.
49-40686-4
13
COCCIÓN RÁPIDA
Cocción rápida
Selecciones del menú predeterminado de cocimiento rápido
Ŷ '
HVSXpVTXHVHKDFRPSOHWDGRXQFLFORGHFRFFLyQXWLOLFH
ODIXQFLyQ5HVXPH &RQWLQXDU SDUDFRFLQDUSRUWLHPSR
adicional.
Categoría
de alimentos
$SHULWLYRV
&DUQHV
&DUQHGHDYH
'HVD\XQR
14
Selección de menú
$OEyQGLJDV 0HDW%DOOV &RQJHODGDV Anillos de cebolla
%HVRVGHMDODSHxR
-DODSHxR3RSSHUV
%ROORV %DJHO%LWHV
Nachos
Nueces tostadas
Palitos de queso
&KHHVH6WLFNV Pretzels suaves
&RQJHODGRV
Rollitos de huevo
(JJ5ROOV &RQJHODGRV Rollitos de pizza
6DOVDFDOLHQWH +RW'LS 7D]DV %LVWHFGHOFXDUWRWUDVHUR
GHUHV 6LUORLQ
%LVWHFWLSRULEH\H
%LVWHFWLSR6WULS
%LVWHFWLSR7%RQH
Carne asada
Chuletas de cordero
Chuletas de puerco
Filet Mignon
Hamburguesa
/RPR
Puerco asado
$OLWDVGHSROOR FRQJHODGDV )LOHWHGHSROOR FRQJHODGR Nugget de pollo
FRQJHODGR Pastelito de pollo
FRQJHODGR Pavo
Pollo, con hueso
Pollo entero
3ROORIULWR FRQJHODGR Pollo, sin hueso
7LUDGHSROOR FRQJHODGD Tiritas de pollo
FRQJHODGDV %LVFRFKRGHVDOFKLFKD
6DXVDJH%LVFXLW %RFDGLWRV 7XUQRYHUV
%ROORV %DJHOV &RQJHODGRV
Categoría
de alimentos
Desayuno
(PSDUHGDGR
Guarniciones
3DQHV
Ŷ 3DUDUHYLVDUORVDMXVWHVGXUDQWHODFRFFLyQSUHVLRQHHOGLDO
de selección.
Selección de menú
Chorizo
*XLVDGR KXHYR[
3DQTXHTXHV &RQJHODGRV Pan tostado a la francesa
Pastel de café
Pastel de hoja relleno
FRQJHODGR Pastelitos de patata
+DVKEURZQ3DWWLHV Pizza de desayuno
5ROOLWRV UHIULJHUDGRV
Rollitos dulces/Pan danés
:DIIOHV FRQJHODGRV
Wafles belgas
&RUQ'RJ FRQJHODGR Emparedado asado
a la parrilla
Emparedado de bolsillo
SRFNHW Hot Dog con rollito
GHPHGLDOXQD &UHVFHQW Hot Dog en bollo
7DTXLWRV FRQJHODGRV
Ajo asado
Champiñones rellenos
&KLOHVDVDGRV Espárragos asados
)ULMROHVUHIULWRV R]
Maíz asado
Pimiento asado
5HOOHQR PH]FOD
Tomates rellenos
9HUGXUDVPL[WDVDVDGDV
%ROORV %DJHOV &RQJHODGRV %ROORVGHFHQD
'LQQHU5ROOV
Palitos de pan
%UHDG6WLFNV
Pan de ajo
Pan de queso
&KHHVH%UHDG 3DQUiSLGR [
3DQHFLOORV %LVFXLWV
Rollitos de media luna
&UHVFHQW5ROOV Rollitos dulces/Pan danés
7DFRV HQFDMD
Categoría
de alimentos
Selección de menú
Panes
3DSDV
Tostada tejana
7H[DV7RDVW
&DPRWH²DPH
Nugget congelado
Papa al horno
Papas fritas congeladas
Pastelitos de patata
+DVKEURZQ3DWWLHV Pescado
Colas de langosta
y mariscos
Congeladas empanizadas
Filetes de atún
Filetes de bacalao
Filete de pez espada
Filete Orange Roughy
/XELQD
Mariscos
Pescado blanco
Salmón
Tilapia
Tiritas de pescado
FRQJHODGDV Pizza
Deli/Fresca
Pizza congelada
Utilizar masa precocida
3ODWRVIXHUWHV %XUULWRV FRQJHODGRV &KLOHVUHOOHQRV Chimichanga
(QFKLODGD IUHVFD Guisado
/DVDxD
Pastel de carne
0HDWORDI [
4XHVLGLOODV IUHVFDV
Rollitos de huevo
FRQJHODGRV 3RVWUHV
%RFDGLWRV 7XUQRYHUV
%URZQLHV
Galletas
3DVWHO IUHVFR[
Pastel de café
3DVWHOHV PH]FOD[
5ROOLWRV UHIULJHUDGRV
7DUWD IUXWDIUHVFD
49-40686-4
Receta favorita
Para ingresar y almacenar
Agregue y almacene hasta 30 de sus propias recetas de
microondas o de cocción rápida como sus recetas favoritas.
¡Una vez que lo haya hecho, podrá acceder a su receta
favorita rápidamente de modo que sus comidas se cocinen
justo de la manera que le gusta todo el tiempo!
3
UHVLRQHODVWHFODV)$925,7(5(&,3( 5HFHWDV)DYRULWD R63(('&22. &RFFLyQ5iSLGD 2. Gire el dial hasta que aparezca FAVORITE RECIPE
5HFHWDV)DYRULWD 3UHVLRQHHOGLDOSDUDLQJUHVDU 6DOWHH
HVWHSDVRVLODWHFOD)$925,7(5(&,3( 5HFHWDV
)DYRULWD IXHSUHVLRQDGDHQHOSDVR *
LUHHOGLDOKDVWDTXHDSDUH]FD$''5(&,3( $JUHJDU
5HFHWD 3UHVLRQHHOGLDOSDUDLQJUHVDU
*
LUHHOGLDOD&23<63(('5(&,3( &RSLDU5HFHWD
5iSLGD RD$''1(:5(&,3( $JUHJDU1XHYD5HFHWD Presione el dial para ingresar.
6LODRSFLyQ&23<63(('5(&,3( &RSLDU5HFHWD
5iSLGD IXHVHOHFFLRQDGDJLUHHOGLDODWLSR V GHFRPLGD
\SUHVLRQHODWHFOD)$925,7(5(&,3( 5HFHWDV)DYRULWD para ingresar y guardar la receta.
Mi Receta encontrar y utilizar
Para encontrar y utilizar las recetas favoritas almacenadas:
$SULHWHHOERWyQ)$925,7(5(&,3( 5(&(7$6
)$925,7$ R63(('&22. &2&&,Ï15È3,'$ 2. Gire el dial hasta que aparezca FAVORITE RECIPE
5(&(7$6)$925,7$ $SULHWHHOGLDOSDUDLQJUHVDU
*LUHHOGLDOKDVWDYHU86()$925,7(5(&,3( 87,/,=$5
/$5(&(7$)$925,7$ \DSULHWHSDUDLQJUHVDU
4. Aparecerán los nombres de las recetas que ingresó.
6LODRSFLyQ$''1(:5(&,3( $JUHJDU1XHYD5HFHWD fue seleccionada, gire el dial para seleccionar la receta
63(('&22. &RFFLyQ5iSLGD R0,&52:$9( +RUQHDU
HQHO0LFURRQGDV 3UHVLRQHHOGLDOSDUDLQJUHVDU\
continuar con estos pasos.
$SDUHFH6(/(&7&22.7,0( 6HOHFFLRQHHO7LHPSRGH
&RFFLyQ 3UHVLRQHHOGLDOSDUDVHOHFFLRQDUHOWLHPSRGH
cocción. Presione el dial para ingresar.
DSDQWDOODOHVXJHULUiVHOHFFLRQDUHOQLYHO HV GHSRWHQFLD
/
6. Gire el dial en dirección de las manecillas de reloj para
aumentar o al contrario para disminuir el nivel de potencia
superior. Presione el dial para seleccionar.
Utilice la guía de cocimiento o libro de recetas para ver
sugerencias del nivel de potencia y del tiempo de cocimiento.
$SDUHFHUi63(//7+()22'1$0( GHOHWUHHHO
QRPEUHGHODFRPLGD *LUHHOGLDOKDVWDODSULPHUDOHWUD
dela descripción de su comida y presioneel dial para
seleccionar. Continúeeste proceso hasta deletrear el
restodel nombre. Presione la tecla START/PAUSE para
guardar la receta y sunombre.
COCCIÓN RÁPIDA
Cocción rápida
5. Gire el dial hasta que se muestre la receta que desea y
apriete el dial para ingresar.
$
SULHWHHOERWyQ67$573$86( ,1,&,$53$86$5 RHO
dial selector para iniciar la cocción.
Para ajustar o cambiar
Para ajustar o cambiar las recetas de cocción rápida personalizadas almacenadas:
$
SULHWHHOERWyQ)$925,7(5(&,3(6 5(&(7$6
actuales.
)$925,7$ R63(('&22. &2&&,Ï15È3,'$ 5. Apriete el dial para ingresar.
2. Gire el dial hasta que aparezca FAVORITE RECIPE
/DSDQWDOODOHSHGLUiTXHVHOHFFLRQHHOQLYHOGHSRWHQFLD
5(&(7$6)$925,7$ $SULHWHHOGLDOSDUDLQJUHVDU
y edite el nombre. Gire el dial y apriételo para ingresar los
*
LUHHOGLDOKDVWDTXHDSDUH]FD(',75(&,3( (',7$5
ajustes correspondientes.
5(&(7$ $SULHWHHOGLDOSDUDLQJUHVDU
Para obtener sugerencias sobre el nivel y tiempo de cocción,
4. Gire el dial para escoger la receta que desea cambiar.
utilice su guía o libro de cocina.
Apriete el dial para ingresar. Aparecerán los ajustes
Para borarlas
Para borrar las recetas de cocción rápida personalizadas
almacenadas:
$
SULHWHHOERWyQ)$925,7(5(&,3(6 5(&(7$6
)$925,7$ R63(('&22. &2&&,Ï15È3,'$ 2. Gire el dial hasta que aparezca FAVORITE RECIPE
5(&(7$6)$925,7$ $SULHWHHOGLDOSDUDLQJUHVDU
49-40686-4
*LUHHOGLDOKDVWDTXHDSDUH]FD'(/(7(5(&,3(
%255$55(&(7$ \DSULHWHHOGLDOSDUDLQJUHVDU
4. Gire el dial para escoger la receta que desea y apriete el
dial para ingresar.
15
COCCIÓN RÁPIDA
Cocción rápida
Lo que es normal
Tiempos de cocimiento
Calor del Horno
Ŷ $
OFRFLQDUUiSLGRFRQHOPHQ~SUHGHWHUPLQDGRGHDOLPHQWRV
SRGUiYHUHQODSDQWDOOD237,0,=,1*&22.7,0(
RSWLPL]DQGRHOWLHPSRGHFRFLPLHQWR YDULRVVHJXQGRV
después de presionar START/PAUSE. El horno detecta
automáticamente el nivel del voltaje eléctrico de su casa y
ajusta el tiempo de cocimiento hacia arriba o hacia abajo
para un cocimiento adecuado.
Ŷ /
RVFLFORVGHFRFLPLHQWRUiSLGRQRUHTXLHUHQXQWLHPSR
de precalentamiento. El horno comienzaa cocinar
inmediatamente.
Ventiladores de Enfriamiento
Ŷ &
XDQGRFRFLQHUiSLGRQRXWLOLFHUHFLSLHQWHVQLFXELHUWDV
hechas de papel, plástico o aluminio.
Ŷ /RVYHQWLODGRUHVVHHQFHQGHUiQGXUDQWHHOFRFLPLHQWR$O
final, éstos continuarán durante un tiempo corto para enfriar
ORVFRPSRQHQWHVLQWHUQRV/RVYHQWLODGRUHVVHDSDJDUiQ
automáticamente cuando las piezas internas del horno
HVWpQIUtDV/DSDQWDOODPRVWUDUi
Ŷ 0LHQWUDVHOKRUQRHVWpHQFHQGLGRHOUHVSLUDGRUHPLWLUiXQ
aire caliente.
Luces
Ŷ &XDQGRHOKRUQRHVWiHQFHQGLGRODOX]HVWDUiYLVLEOH
DOUHGHGRUGHODSXHUWDRGHODFDMDH[WHULRU
Ŷ /DVOXFHVKDOyJHQDVVHRSDFDUiQ\VHHQFHQGHUiQ\
apagarán durante el ciclo de cocimiento rápido, algunas
veces a niveles de potencia completa. Esto es normal. El
hornodetecta el nivel de calor y se ajusta automáticamente.
16
Ŷ /
DSXHUWD\HOLQWHULRUGHOKRUQRHVWDUiQPX\FDOLHQWHV
Tenga cuidado al abrir la puerta y retirarlos alimentos.
Tenga cuidado del vapor quese puede salir alrededor de la
puerta.
Ŷ &
XDQGRFRFLQHSRUXQSHUtGRODUJRGHWLHPSRHOKRUQR
puede reducir automáticamente los niveles de potencia
para mantener el nivelapropiado de calor en el horno.
Sonidos
Ŷ (
VQRUPDOHVFXFKDUGXUDQWHHOFRFLPLHQWRFKDVTXLGRV\HO
soplador del ventilador. El controlelectrónico enciende y
apaga los componentes.
Interferencia
Ŷ6HSXHGHREVHUYDULQWHUIHUHQFLDGH79UDGLRFXDQGRXWLOL]D
el microonda, similar a la interferencia causada por otros
aparatos pequeños.Esto no indica un problema con el
microonda.Mueva el radio o la TV lo más lejos posible
delmicroonda o revise la posición de la antena dela TV/radio.
49-40686-4
ADVERTENCIA ¡ Cuando hornee, recuerde que el horno, la puerta y losplatos están
muy calientes.
Hornear con convección le permite cocinar los alimentos de la
misma manera que un horno convencional, utiliza un elemento
para calentar el aire adentro del horno. Se puede programar
cualquier temperatura entre 250ºF a 450ºF.
El ventilador circula suavemente el aire caliente a través del
horno, sobre y alrededor de los alimentos. Debido a que el
aire caliente se mantiene en constante movimiento, algunos
alimentos se cocinan un poco más rápido, a diferencia de los
hornos de cocimiento regular.
Antes de comenzar, asegúrese que la parrilla de metal esté en
su lugar. Se pueden utilizar ambas parrillas en los dos niveles
de cocimiento.
Cuando utilice el horno el
plato giratorio debeestar
siempre ensu lugar.
Coloque los alimentos
directamente en la bandeja
de metal o en la bandeja de
metal para asar.
Cuando hornee o caliente en los dos niveles
coloque el alimento en la bandeja de metal
o en elplato apropiado y colóquelo sobre la
parrilla dealambre del horno.
Cómo se Hornea con Convección
3UHVLRQHODWHFOD&219(&7,21%$.(%52,/ +RUQHDU
$VDUSRU&RQYHFFLyQ 3UHVLRQHHOGLDOSDUDVHOHFFLRQDU&219%$.( +RUQHDUSRU
&RQYHFFLyQ 3. Gire el dial para configurar la temperatura del horno y
presione el dial para ingresar.
Para evitar el precalentamiento:
&XDQGRVHVXJLHUD35(+($77+(29(1" ¢3UHFDOHQWDU
HO+RUQR" JLUHHOGLDOD123UHVLRQHHOGLDOSDUDLQJUHVDU
2. Coloque la comida en el horno, gire el dial para configurar
el tiempo de cocción y presione el dial para ingresar.
3
UHVLRQHHOGLDORHOERWyQ67$573$86( ,QLFLDU3DXVDU para iniciar la cocción. Una vez completada la cocción, el
horno emitirá una señal y se apagará.
Para precalentar:
1. Cuando la sugerencia muestre PREHEAT THE OVEN?
¢3UHFDOHQWDUHO+RUQR" JLUHHOGLDOD<(6 6t 3UHVLRQH
HOGLDORHOERWyQ67$573$86( ,QLFLDU3DXVDU SDUD
iniciar el precalentamiento.
HORNEAR CON CONVECCIÓN
Hornear con Convección
El horno comienza a precalentarse de inmediato. No
FRORTXHFRPLGDHQHOKRUQR /HVHUiVXJHULGRLQJUHVDU
un tiempo de cocción, una vez que el horno se haya
SUHFDOHQWDGR 2. Una vez que el horno esté precalentado, emitirá una señal.
Si no abre la puerta dentro de la hora, el horno se apagará
de forma automática. Abra la puerta del horno y, con
cuidado, coloque la comida en el mismo.
3. Cierre la puerta del horno. Gire el dial para configurar la
temperatura del horno y presione el dial para ingresar.
3UHVLRQHHOGLDORHOERWyQ67$573$86( ,QLFLDU3DXVDU para iniciar la cocción. Una vez completada la cocción, el
horno emitirá una señal y se apagará.
Podrá cambiar la temperatura del horno durante el
precalentamiento, presionando la tecla POWER/ TEMP
3RWHQFLD7HPSHUDWXUD \JLUDQGRHOGLDOSDUDVHOHFFLRQDUOD
nueva temperatura. Presione el dial para ingresar.
Si la puerta del horno es abierta durante la cocción, PAUSE
3DXVD DSDUHFHUiHQODSDQWDOOD&LHUUHODSXHUWD\SUHVLRQH
67$573$86( ,QLFLDU3DXVDU /RVWLHPSRVGHFRFFLyQDSDUHFHQHQPLQXWRV\VHSXHGH
FRQILJXUDUKDVWDXQPi[LPRGHPLQXWRV(OWLHPSRSRGUi
ser modificado durante la cocción girando el dial.
Consejos de Cocimiento para Hornear con Convección
Ŷ$OFRFLQDUSURGXFWRVTXHHQWUDQGLUHFWDPHQWHVREUHXQD
bandeja metálica, no coloque la bandeja en el horno
mientras el horno se está precalentando. Coloque la comida
directamente sobre la bandeja, y coloque la bandeja metálica
con comida en el plato giratorio una vez que el horno se
haya precalentado.
Ŷ$OFRFLQDUSURGXFWRVVREUHXQSODWRTXHVHDSR\DUiHQXQD
bandeja metálica, coloque esta última en el horno durante el
precalentamiento para un rendimiento óptimo de la cocción.
49-40686-4
Ŷ3DUDXQKRUQHDGRHQGRVQLYHOHVLQVWDOHXQDUHMLOODHQORV
soportes para 4 estantes y
una bandeja metálica en el
SODWRJLUDWRULR/RVSODWRV
de horneado pueden ser
colocados directamente en la
rejilla y en el plato giratorio.
Ŷ6LVHUHTXLHUHQEDQGHMDVGHKRUQHDGRSDUDFRFLQDUFRPLGDV
tales como galletas o galletitas, use las bandejas metálicas
suministradas con el horno para ser colocadas sobre la rejilla
o el plato giratorio para un mejor rendimiento.
17
ASAR Y TOSTAR
Asar y Tostar
ADVERTENCIA ¡ Al asar o tostar, recuerde que el horno, la puerta y los platos estarán
muy calientes.
Asar y tostar utilizan las lámparas superiores, el calentador
inferior y el sistema de convección, para asar o tostar los
alimentos similar al horno convencional.
Antes de comenzar asegúrese que el plato giratorio esté en su
lugar. Al tostar utilice la bandeja de metal y al asar utilice la
bandeja de metal o la bandejade metal para asar.
Cuando utilice el horno el
plato giratorio debeestar
siempre ensu lugar.
Coloque los alimentos
directamente en la bandeja de
metal o en la bandeja de metal
para asar.
Cómo Asar o Tostar
3UHVLRQHODWHFOD&219(&7,21%$.(%52,/ +RUQHDU
$VDUSRU&RQYHFFLyQ *LUHHOGLDOD%52,/ $VDU R72$67 7RVWDU \SUHVLRQHOD
misma para ingresar.
Para evitar el precalentamiento:
&XDQGRVHVXJLHUD35(+($77+(29(1" 3UHFDOHQWDUHO
+RUQR JLUHHOGLDOD123UHVLRQHHOGLDOSDUDLQJUHVDU
2. Coloque la comida en el horno, gire el dial para configurar
el tiempo de cocción y presione el dial para ingresar.
3UHVLRQHHOGLDORHOERWyQ67$573$86( ,QLFLDU3DXVDU para iniciar la cocción. Una vez completada la cocción, el
horno emitirá una señal y se apagará.
Para precalentar:
1. Cuando la sugerencia muestre PREHEAT THE OVEN?
¢3UHFDOHQWDUHO+RUQR" JLUHHOGLDOD<(6 6t 3UHVLRQH
HOGLDORHOERWyQ67$573$86( ,QLFLDU3DXVDU SDUD
iniciar el precalentamiento.
El horno inicia el precalentamiento de inmediato. No
FRORTXHODFRPLGDHQGHOKRUQR /HVHUiVXJHULGRLQJUHVDU
un tiempo de cocción, una vez que el horno se haya
SUHFDOHQWDGR 2. Una vez que el horno esté precalentado, emitirá una señal.
Si no abre la puerta dentro de la hora, el horno se apagará
de forma automática. Abra la puerta del horno y, con
cuidado, coloque la comida en el mismo.
3. Cierre la puerta del horno. Gire el dial para configurar el
WLHPSRGHFRFFLyQ\SUHVLRQH67$573$86( ,QLFLDU
3DXVDU SDUDLQLFLDUODFRFFLyQ8QDYH]FRPSOHWDGDOD
cocción, el horno emitirá una señal y se apagará.
Si la puerta del horno es abierta durante la cocción, PAUSE
3DXVD DSDUHFHUiHQODSDQWDOOD&LHUUHODSXHUWD\SUHVLRQH
67$573$86( ,QLFLDU3DXVDU Consejos de cocimiento para asar
Ŷ/RVWLHPSRVGHDVDUSXHGHQVHUPiVFRUWRVHQHOKRUQR
Advantium ya queutiliza lámparas halógenas. Asegúrese
de monitorear de cerca los alimentos para obtener los
resultados deseados.
Ŷ3DUDPHMRUHVUHVXOWDGRVDODVDUFRORTXHORVDOLPHQWRV
directamente en la bandeja de metal para asar.
Ŷ6HSURGXFHKXPRDODVDUFDUQHHQHOKRUQR
Ŷ6LSUHFDOLHQWDHOKRUQRSDUDDVDUFDUQHSUHFDOLHQWHFRQOD
bandeja de metal para asar en el horno y para una mejor
brasa en la carne colóquela sobre la bandeja caliente.
Ŷ/DPD\RUtDGHODVFRPLGDVVHGHEHUtDQGDUYXHOWDHQOD
PLWDGGHOWLHPSRDODVDUODVPLVPDV/DVFRPLGDVGHQVDV
con mucha carne o trozos de pollo con huesos se deberían
dar vuelta a los ¾ de tiempo durante el tiempo de asado.
Ŷ5HWLUHODVSLH]DVPiVILQDVSDUDHYLWDUTXHVHFRFLQHQ
demasiado y que se sequen.
Consejos de cocimiento para tostar
Ŷ8WLOLFHODEDQGHMDGHPHWDOSDUDPHMRUHVUHVXOWDGRVDOWRVWDU
Ŷ/DPD\RUtDGHODVFRPLGDVVHGHEHUtDQGDUYXHOWDDORV
2/3 del tiempo de cocción al asar cuando no se esté
precalentando.
Ŷ$OXVDUODRSFLyQGHSUHFDOHQWDPLHQWRGpYXHOWDODFRPLGDD
la mitad del tiempo de cocción.
18
Ŷ3DUDTXHHOH[WHULRUTXHGHFURFDQWH\TXHVHPDQWHQJDOD
humedad interior de las comidas, precaliente el horno.
Ŷ7RFULVSH[WHULRUDQGFULVSWKHLQVLGHWRRGRQRWSUHKHDWWKH
oven.
Ŷ7XHVWHODVSLH]DVPiVJUXHVDVSRUPiVWLHPSRODVSLH]DV
delgadas menos tiempo.
49-40686-4
Calentar
/DIXQFLyQ:$50PDQWHQGUiFDOLHQWHODVFRPLGDVFRFLQDGDV
a temperaturas de servicio. Siempre comience con la comida
caliente. Utilice recipientes y utensilios que puedan soportar
temperaturas hasta 230ºF.
3UHVLRQHODRSFLyQ:$503522) FDOHQWDUOHXGDU *LUHHOGLDOSDUDVHOHFFLRQDU+2/')22':$50
PDQWHQHUODFRPLGDFDOLHQWH 3UHVLRQHHOGLDOSDUD
seleccionar.
3. Gire el dial para seleccionar la temperatura del horno. Vea
el cuadro y consejos a continuación.Presione el dial para
seleccionar.
/2:ƒ)
0(',80ƒ)
+,*+ƒ)
4. Gire el dial para seleccionar el nivel de humedad que
desee. Consulte el cuadro y los consejos a continuación.
Presione el dial para ingresar.
Si la puerta del horno se abre durante el calentamiento,
³3DXVH´ SDXVD DSDUHFHUiHQODSDQWDOOD&LHUUHODSXHUWD\
SUHVLRQHHOERWyQ67$573$86( LQLFLDUSDXVD Para hacer crujiente los alimentos viejos:
Ŷ 6HOHFFLRQHHODMXVWHGH&5,633UHFDOLHQWHHOKRUQR
durante 10 minutos.
NOTA: Sólo precaliente cuando desee hacer crujiente los
alimentos viejos.
Ŷ 6HOHFFLRQHODVFRQILJXUDFLRQHV/2: %DMD \&5,63
&URFDQWH 3UHFDOLHQWHHOKRUQRGXUDQWHPLQXWRV
Ŷ 5HYLVHSDUDYHUVLHVWiFUXMLHQWHGHVSXpVGHPLQXWRV
Si es necesario, agregue más tiempo.
Consejos para alimentos crujientes:
Ŷ 1RFXEUDORVDOLPHQWRV
Ŷ 1RXWLOLFHUHFLSLHQWHVSOiVWLFRVQLHQYROWRULRVSOiVWLFRV
Ŷ 1RHVQHFHVDULRSUHFDOHQWDUDPHQRVTXHGHVHHKDFHU
FUXMLHQWHDOLPHQWRVYLHMRV 9HD+DFHUFUXMLHQWHORV
DOLPHQWRVYLHMRV
Consejos para alimentos húmedos:
Ŷ &XEUDORVDOLPHQWRVFRQXQDWDSDRFRQSDSHOGHDOXPLQLR
Ŷ 1RXWLOLFHUHFLSLHQWHVSOiVWLFRVQLHQYROWRULRVSOiVWLFRV
Ŷ 1RHVQHFHVDULRSUHFDOHQWDU
Cuadro de Selección de Temperatura y Humedad
Tipo de Comida
Configuración
del Control
Ajuste de
Humedad
Pan, panes
crocantes
MEDIA
Crujiente
Pan, panes blandos
MEDIA
Húmedo
Cacerolas
MEDIA
Húmedo
$/7$
Crujiente
MEDIA
Crujiente
Panqueques,
ZDIIOHV
$/7$
Crujiente
Pizza
$/7$
Crujiente
Papas, horneadas
$/7$
Crujiente
Comidas fritas
Carnes* y pescado
Papas, pisadas
MEDIA
Húmedo
Ave
$/7$
Húmedo
Tortilla de Papas
%$-$
Crujiente
MEDIA
Húmedo
Verduras
Cuando utilice el horno el plato
giratorio debe estar siempre en
su lugar.
Para calentar coloque los
alimentos o el recipiente seguro
para el horno directamente en la
bandeja de metal.
CALENTAR Y FERMENTAR
Calentar y Fermentar
6'$)6,6UHFRPLHQGDXQDWHPSHUDWXUDLQWHULRUGHž) ž& 8
como mínimo para un bife. Use un termómetro portátil para carne a
fin de controlar las temperaturas interiores.
Fermentar
/DIXQFLyQSDUDIHUPHQWDUVXPLQLVWUDDXWRPiWLFDPHQWHOD
temperatura apropiada para el proceso de fermentación,por lo
tanto, no necesita ajustar la temperatura.
3UHVLRQHODWHFOD:$513522) &DOHQWDU/HXGDU *LUHHOGLDOSDUDVHOHFFLRQDU3522)%5($' /HXGDU
HO3DQ 3UHVLRQHHOGLDOSDUDLQJUHVDU(OKRUQRLQLFLD
el leudado de forma inmediata y muestra la cantidad de
tiempo de leudado completada
Ŷ 3DUDHYLWDUEDMDUODWHPSHUDWXUDGHOKRUQR\SURORQJDUHO
tiempo de fermentación, no abra la puerta del horno sin
necesidad.
Ŷ 5HYLVHORVSURGXFWRVGHSDQDQWHVSDUDHYLWDU
sobrefermentarlos.
49-40686-4
NOTAS:
Ŷ 1RXWLOLFHHOPRGRGHIHUPHQWDFLyQSDUDFDOHQWDUDOLPHQWRV
RSDUDPDQWHQHUFDOLHQWHODFRPLGD/DWHPSHUDWXUD
de fermentación no es lo suficientemente caliente para
mantener la comida a temperaturas seguras. Utilice la
función WARM para mantener la comida caliente.
Ŷ /DIXQFLyQGHIHUPHQWDFLyQQRRSHUDUiVLHOKRUQRHVWi
demasiado caliente. Permita que el horno se enfríe antes
de fermentar.
Cuando utilice el horno el plato
giratorio debe estar siempre en
su lugar.
Para fermentar coloque la masa
en un tazón/pana para pan y
colóquela en la bandeja de metal.
19
COCCIÓN POR MICROONDAS
Cocción por microondas
Asegúrese de que el plato giratorio esté en su lugar con el lado
TXHSRVHHODPDUFD³723´ 3DUWH6XSHULRU KDFLDDUULED
Utilice la bandeja de vidrio claro.Coloque los alimentos o
el recipiente para microondas directamente en la bandeja
devidrio claro, para cocinar los alimentos.
Cuando utilice el horno el plato
giratorio debe estar siempre en
su lugar.
Recipientes de cocimiento
Ŷ$VHJ~UHVHTXHWRGRVORVUHFLSLHQWHVVHDQDGHFXDGRVSDUD
cocinar en microondas.
Ŷ&RORTXHODFRPLGDRHOHQYDVHSDUDFRFFLyQFRQ
el microondas directamente en la bandeja de vidrio
transparente para cocinar su comida.
SELECCIONES PREDETERMINADAS PARA EL MICROONDAS
Ŷ Cocimiento
ŶDescongelación
–Por tipo de comida –1.0 lb rápido
–Por tiempo
–Por tiempo
–Por tiempo 1 y 2
–Por tipo de comida
–Retrasar Inicio
–Por peso
–Calentar/ Recalentar
–Retrasar Inicio
%HELGD
–Derretir
–Derretir
–Ablandar
±&RFFLyQ/HQWD
–Ablandar
ŶRecalentar
±%HELGDV
–Cacerolas
–Pollo
–Pasta
–Pizza
–Plato de comida
–Arroz
–Sopa
–Filetes/Chuletas
–Vegetales
$SUHWDUHOERWyQ&22. &2&,1$5 '()5267
'(6&21*(/$5 R5(+($7 5(&$/(17$5 GHO
microondas.
Si no se realiza ninguna entrada durante 15 segundos, la
pantalla volverá a quedar en blanco.
2. Gire el dial para encontrar los alimentos que desea cocinar,
descongelar o recalentar. Apriete el dial para ingresar.
3. Gire el dial para seleccionar el tipo, cantidad, peso y/o
WDPDxR (OKRUQROHFRQVXOWDUiHQODPHGLGDTXHVHD
QHFHVDULR $SULHWHHOGLDOGHVSXpVGHFDGDVHOHFFLyQ
$SULHWHHOGLDORDSULHWH67$573$86( ,1,&,$53$86$5 para iniciar la cocción.
20
Cuando cocine en el microondas
la bandejade vidrio claro siempre
debe estaren su lugar.
Para revisar los ajustes durante la cocción, apriete el dial
selector.
Si se abre la compuerta durante la cocción, el horno se
GHWHQGUi\VHPRVWUDUi3$86( 3$86$ HQODSDQWDOOD&LHUUH
ODFRPSXHUWD\DSULHWHHOERWyQ67$573$86( ,1,&,$5
3$86$5 SDUDFRQWLQXDUFRFLQDQGR
Si ingresa una selección no deseada en cualquier momento,
VLPSOHPHQWHDSULHWHHOERWyQ%$&. 5(*5(6$5 \UHLQJUHVH
las selecciones deseadas.
49-40686-4
Cocimiento con tiempo y Cocimiento con tiempo 1 y 2
8WLOLFHODVIXQFLRQHVGH&22.%<7,0( &RFLQDUSRU7LHPSR \&22.%<7,0( &RFLQDUSRU7LHPSR\ SDUD
cocinar en el microondas comida que no esté en la sección de
UHFHWDV\HQHOPRPHQWR V TXHFRQILJXUy
3UHVLRQHODWHFOD&22. &RFLQDU *LUHHOGLDOSDUDVHOHFFLRQDU&22.%<7,0( &RFLQDUSRU
7LHPSR R&22.%<7,0( &RFLQDUSRU7LHPSR\
\SUHVLRQHHOGLDOSDUDLQJUHVDU
3. Gire el dial para configurar el tiempo de cocción y presione
el dial para ingresar.
6LVHOHFFLRQy&22.%<7,0( &RFLQDUSRU7LHPSR\
JLUHHOGLDOSDUDFRQILJXUDUHOVHJXQGRWLHPSRGHFRFFLyQ\
presione el dial para ingresar.
El nivel de potencia se configura de forma automática en alto,
SHURORSXHGHPRGLILFDUSDUDXQDPD\RUIOH[LELOLGDG
Para cambiar el nivel de potencia en caso de no desear la
SRWHQFLDPi[LPDSUHVLRQHODWHFOD32:(57(03 3RWHQFLD
7HPSHUDWXUD DQWHVGHLQJUHVDUHOWLHPSR*LUHHOGLDOSDUD
seleccionar y presione el dial para ingresar.
3UHVLRQHHOGLDORHOERWyQ67$573$86( LQLFLRSDXVD para iniciar la cocción.
8VWHGSXHGHDEULUODSXHUWDGXUDQWH&22.%<7,0( &RFLQDU
SRU7LHPSR \&22.%<7,0( &RFLQDUSRU7LHPSR\
SDUDFRQWURODUODFRPLGD&LHUUHODSXHUWD\SUHVLRQH67$57
3$86( ,QLFLDU3DXVDU SDUDUHDQXGDUODFRFFLyQ
Express
Presione EXPRESS de forma repetida por incrementos de 30
segundos de tiempo de cocción en el microondas. El horno se
inicia de inmediato.
Ŷ (OQLYHOGHSRWHQFLDVHFRQILJXUDGHIRUPDDXWRPiWLFDHQ
DOWRSHURORSXHGHPRGLILFDUSDUDXQDPD\RUIOH[LELOLGDG
3DUDDFFHGHUDLQVWUXFFLRQHVFRQVXOWHODVHFFLyQ1LYHOHV
GHSRWHQFLDGHOPLFURRQGDV COCCIÓN POR MICROONDAS
Cocción por microondas
Niveles de potencia de microonda
3ULPHURVLJDODVLQVWUXFFLRQHVSDUD&22.%<7,0(
FRFLQDUSRUWLHPSR &22.%<7,0( FRFLQDUSRU
WLHPSR 0,&52 PLFUR \'()5267%<7,0(
GHVFRQJHODUSRUWLHPSR 3UHVLRQHODWHFOD32:(57(03 3RWHQFLD7HPSHUDWXUD 3. Gire el dial en dirección de las agujas del reloj para
incrementar el nivel de potencia y en contra de las agujas
del reloj para reducir el mismo. Presione el dial para
ingresar.
3UHVLRQHHOGLDORHOERWyQ67$573$86( LQLFLRSDXVD para iniciar la cocción.
Ŷ 8VWHGSXHGHPRGLILFDUHOQLYHOGHSRWHQFLDDQWHVRGXUDQWH
un programa de cocción..
/RVVLJXLHQWHVVRQDOJXQRVHMHPSORVGHGLIHUHQWHVQLYHOHVGH
energía
+LJK DOWR 3HVFDGRWRFLQRYHJHWDOHVOtTXLGRVHQKHUYRU
0HG+LJK PHGDOWR &RFFLyQVXDYHGHFDUQHGHUHV\GHDYH
horneado de estofados y recalentamiento.
0HGLXP PHGLR 3DUDFRFFLyQOHQWD\SDUDWLHUQL]DU
estofados y cortes de carne menos tiernos.
/RZ DEDMR y'HVFRQJHODUKHUYLUDIXHJROHQWRVDOVDV
delicadas.
:DUP WLELR 0DQWHQHUDOLPHQWRVFDOLHQWHVDEODQGDU
mantequilla.
Recetas Favorita
Consulte las secciones de Recetas Favorita en la sección
6SHHGFRRN &RFFLyQ5iSLGD GHHVWHOLEURDILQGHDFFHGHUD
instrucciones sobre cómo guardar, usar, modificar o borrar una
receta favorita.
Consejos de cocimiento
Ŷ&XDQGRFRFLQHWRFLQRFRORTXHODWLUDVHQFDSDVVREUHHO
plato. Cubra cada capa con papel toalla.
Ŷ3DUDYHJHWDOHVFRQJHODGRVDJUHJXHDJXDGHDFXHUGRFRQ
las instrucciones del paquete
Ŷ&XDQGRFRFLQHYHJHWDOHVXWLOLFHXQDFDFHURODRWD]yQ
seguro para el microondas. Cúbralos con una tapa seguro
para el microondas o con un envoltorio plástico ventilado.
Ŷ3DUDYHJHWDOHVIUHVFRVDJUpJXHOHFXFKDUDGDVGHDJXDD
cada porción
49-40686-4
21
COCCIÓN POR MICROONDAS
Cocción por microondas
Descongelación por tipo de alimento
/DIXQFLyQ$XWR'HIURVW 'HVFRQJHODFLyQDXWRPiWLFD DMXVWD
los tiempos de descongelación y los niveles de potencia para
ofrecer resultados de descongelación uniformes para carnes
de res, pollo y pescado de hasta 6 libras de peso.
1. Saque los alimentos de la caja y colóquelos en un plato
adecuado para microondas.
$SULHWHHOERWyQ'()5267 '(6&21*(/$5 *LUHHOGLDOSDUDVHOHFFLRQDU'()5267%<)22'7<3(
'(6&21*(/$53257,32'(&20,'$ $SULHWHHOGLDO
para ingresar.
4. Gire el dial para seleccionar el tipo de comida. Apriete el
dial para ingresar.
5. Gire el dial para seleccionar el peso de los alimentos,
utilizando la Guía de conversión de la derecha. Por
HMHPSORVHOHFFLRQHSDUDOLEUDV OLEUDRQ]DV Apriete el dial para ingresar.
$SULHWHHOGLDORHOERWyQ67$573$86( ,1,&,$5
3$86$5 SDUDFRPHQ]DUDGHVFRQJHODU
7. Gire los alimentos cuando el horno le indique TURN FOOD
29(5 '$598(/7$$/26$/,0(1726 Ŷ 6DTXHODFDUQHGHVFRQJHODGDRFXEUDODViUHDVFDOLHQWHV
con pedazos pequeños de lámina de aluminio para lograr
una descongelación uniforme.
Ŷ 'HVSXpVGHGHVFRQJHODUODPD\RUtDGHODVFDUQHV
necesitan dejarse en reposo durante 5 minutos para
completar la descongelación. Asados de mayor tamaño
deben permanecer en reposo por cerca de 30 minutos.
Guía de conversión
Si se indica el peso de los alimentos en libras y onzas, se
GHEHQFRQYHUWLUODVRQ]DVDGpFLPRV GHOLEUD
Peso de la Comida
en Onzas
3
8
11
Ingrese el Peso de la Comida
(décimas de una libra)
.1
.2
.3
.4
.5
.6
.7
.8
.9
Descongelar por tiempo
8WLOLFHODVIXQFLRQHVGH'()5267%<7,0( 'HVFRQJHODU
SRU7LHPSR SDUDGHVFRQJHODUGXUDQWHXQSHUtRGRGHWLHPSR
seleccionado.
3UHVLRQHODWHFOD'()5267 'HVFRQJHODU *LUHHOGLDOGHVHOHFFLyQD'()5267%<7,0(
'HVFRQJHODUSRU7LHPSR 3UHVLRQHHOGLDOSDUDLQJUHVDU
3. Gire el dial para seleccionar el tiempo que desee. Presione
el dial para ingresar.
3UHVLRQHHOGLDORHOERWyQ67$573$86( ,QLFLDU3DXVDU para iniciar la descongelación.
5. Dé vuelta la comida si el horno da la señal TURN FOOD
29(5 'p9XHOWDOD&RPLGD Ŷ(OQLYHOGHSRWHQFLDVHFRQILJXUDGHIRUPDDXWRPiWLFDHQ
3, pero se puede cambiar. Para acceder a instrucciones
sobre cambio en los niveles de potencia, consulte la sección
Niveles de potencia del microondas.
Puede descongelar productos pequeños de forma rápida,
incrementando el nivel de potencia luego de ingresar el
WLHPSR3RZHUOHYHO 1LYHOGHSRWHQFLD UHGXFHHOWLHPSR
GHGHVFRQJHODFLyQWRWDODSUR[LPDGDPHQWHDODPLWDGSRZHU
OHYHO QLYHOGHSRWHQFLD UHGXFHHOWLHPSRWRWDOD
DSUR[LPDGDPHQWH$OGHVFRQJHODUHQQLYHOHVGHSRWHQFLD
altos, será necesario prestar mayor atención a la comida que
lo usual.
Consejos para la descongelación
8WLOLFHODVIXQFLRQHVGH'()5267%<)22'7<3(
'HVFRQJHODUSRU7LSRGH&RPLGD SDUDFDUQHVDYHV\
SHVFDGR8VH'()5267%<7,0( 'HVFRQJHODFLyQSRU
7LHPSR SDUDODPD\RUtDGHODVGHPiVFRPLGDVFRQJHODGDV
Ŷ/DVFRPLGDVFRQJHODGDVHQSDSHORSOiVWLFRVHSRGUiQ
GHVFRQJHODUHQHOSDTXHWHDOXVDU'()5267%<7,0(
'HVFRQJHODUSRU7LHPSR /DVFRPLGDVVHGHEHUiQUHWLUDU
HOSDTXHWHDOXVDU'()5267%<)22'7<3( 'HVFRQJHODU
SRU7LSRGH&RPLGD /RVSDTXHWHVFHUUDGRVVHGHEHUiQ
cortar, perforar o ventilar luego de que la comida se haya
GHVFRQJHODGRSDUFLDOPHQWH/RVHQYDVHVGHSOiVWLFRVH
deberán descubrir en forma parcial.
Ŷ/DVFRPLGDVGHWDPDxRIDPLOLDUSUHHPSDTXHWDGDVVH
podrán descongelar y cocinar en el horno microondas. Si
la comida se encuentra en el envase de papel de aluminio,
traslade la misma a un plato para uso seguro en el horno
microondas.
22
Ŷ/DVFRPLGDVTXHVHHFKDQDSHUGHUFRQIDFLOLGDGQRVH
deberán dejar reposar por más de una hora luego de la
GHVFRQJHODFLyQ/DWHPSHUDWXUDDPELHQWHHVWLPXODHO
desarrollo de bacterias nocivas.
Ŷ3DUDXQDGHVFRQJHODFLyQPiVSDUHMDGHFRPLGDVPiV
JUDQGHVWDOHVFRPRFRPLGDVGRUDGDVXVH'()5267%<
7,0( 'HVFRQJHODUSRU7LHPSR $VHJ~UHVHGHTXHODV
carnes queden totalmente descongeladas antes de cocinar.
Ŷ8QDYH]GHVFRQJHODGDODFRPLGDGHEHUtDHVWDUIUtD
pero ablandada en todas las áreas. Si aún está un poco
congelada, vuelva a colocarla en el horno microondas
muy brevemente, o deje reposar la misma por unos pocos
minutos.
Ŷ$OGHVFRQJHODURPiVOLEUDVGHFDUQHSLFDGDRHQFXERV
retire las partes descongeladas al escuchar las señales
intermitentes.
49-40686-4
Cocción por sensor
/DPRGDOLGDGGHPLFURRQGDV$YDQWLXPWLHQHODIXQFLyQ
de cocción por sensor. El horno detecta automáticamente
cuándo están cocinados los alimentos y se apaga solo,
eliminando la necesidad de programar tiempos de cocción
y niveles de potencia. El horno ajusta el tiempo de cocción
automáticamente a los diferentes tipos y cantidades de
comida.
PROGRAMAS DE SENSOR PARA COCCIÓN POR
MICROONDAS:
Ŷ&DUQHPROLGD
Ŷ3DORPLWDVGHPDt]±3DORPLWDVGHPDt]SDUD
microondas preempacadas, de 3,0 onzas. a
3,5 onzas.
Ŷ6RSD
Ŷ$UUR]
Ŷ9HUGXUDV HQODWDGDVIUHVFDVFRQJHODGDV
Ŷ5HFDOHQWDPLHQWRGHSROOR
Ŷ5HFDOHQWDPLHQWRGHSDVWD
Ŷ3ODWRGHUHFDOHQWDPLHQWRGHFRPLGD
Ŷ5HFDOHQWDPLHQWRGHVRSD
Ŷ5HFDOHQWDPLHQWRGHYHUGXUDV
$
SULHWHHOERWyQ&22. &2&,1$5 \JLUHHOGLDOD&22.
%<)22'7<3( &2&&,Ï13257,32'($/,0(172 Apriete el dial para ingresar. O apriete el botón REHEAT
5(&$/(17$5 2. Gire el dial para seleccionar los alimentos que desea.
Apriete el dial para ingresar.
$SULHWHHOGLDORDSULHWH67$573$86( ,1,&,$53$86$5 para iniciar la cocción.
No abra la compuerta del horno hasta que el tiempo se
encuentre en conteo regresivo en la pantalla. Si la compuerta
se encuentra abierta, ciérrela y apriete START/PAUSE
,1,&,$53$86$5 LQPHGLDWDPHQWH6LORVDOLPHQWRVD~QQR
se encuentran lo suficientemente cocinados, utilice la función
&RRN%<7LPH &2&&,Ï13257,(032 HQHOVHOHFWRUGH
microondas para cocinar por más tiempo.
NOTA: No utilice las funciones de sensor dos veces en
sucesión en la misma porción de comida ya que puede
dar como resultado comida severamente sobrecocinada o
quemada. Si el alimento no se cocina completamente después
GHOSULPHUFRQWHRUHJUHVLYRXWLOLFHODIXQFLyQGH&22.%<
7,0( &2&,1$53257,(032 SDUDSHUPLWLUWLHPSRGH
cocción adicional.
Ŷ 6LKDHVWDGRXWLOL]DQGRODIXQFLyQGHFRFFLyQUiSLGD\HO
horno se encuentra caliente, esto puede ser una indicación
de que está demasiado caliente como para cocinar por
sensor. Por supuesto, siempre puede proceder a cocinar
FRQODIXQFLyQ&22.%<7,0( &2&&,Ï13257,(032 o Cocción rápida.
NOTA: Si el horno se encuentra demasiado caliente, cambiará
automáticamente a cocción por tiempo.
Ŷ 3DUDGLVPLQXLURDXPHQWDUHOWLHPSRGHFRFFLyQHVSHUH
hasta que se muestre el conteo de tiempo regresivo en la
SDQWDOOD/XHJRJLUHHOGLDOSDUDDxDGLURUHVWDUWLHPSR
Ŷ 6LDEUHODFRPSXHUWDPLHQWUDVVHHQFXHQWUDXWLOL]DQGR
ODIXQFLyQ6(1625&RRNLQJ &RFFLyQSRU6(1625 DSDUHFHUiHOPHQVDMH6(1625(5525 (5525'(
6(1625 &LHUUHODFRPSXHUWD\DSULHWHHOERWyQ67$57
3$86( ,1,&,$53$86$5 SDUDFRPHQ]DUQXHYDPHQWH
COCCIÓN POR MICROONDAS
Cocción por microondas
Notas sobre el programa de Recalentamiento:
/RVDOLPHQWRVUHFDOHQWDGRVSRGUtDQWHQHUDPSOLDVYDULDFLRQHV
de temperatura. Algunas áreas se pueden encontrar
H[WUHPDGDPHQWHFDOLHQWHV
(VPHMRUXWLOL]DUODIXQFLyQ&RRN%<7LPH &RFFLyQSRUWLHPSR y no Recalentar estos alimentos:
Ŷ 3URGXFWRVGHSDQ
Ŷ /RVDOLPHQWRVTXHGHEHQUHFDOHQWDUVHFXELHUWRV
Ŷ /RVDOLPHQWRVTXHQHFHVLWDQUHYROYHUVHRYROWHDUVH
Ŷ /
RVDOLPHQWRVTXHQHFHVLWDQWHQHUXQDVSHFWRVHFRR
superficie crujiente después del recalentamiento.
Cocción de microondas por sensor
/RVUHFLSLHQWHV\WDSDVRFXELHUWDVDSURSLDGDVVRQHVHQFLDOHV
para obtener los mejores resultados con la cocción por sensor.
Ŷ8WLOLFHVLHPSUHUHFLSLHQWHVDGHFXDGRVSDUDPLFURRQGDV\
cúbralos con tapas o envoltura plástica ventilada. Nunca
utilice recipientes de plástico con sellado ajustado ya que
pueden prevenir que el vapor escape ocasionando que se
sobrecocinen los alimentos.
Ŷ$VHJ~UHVHGHTXHHOH[WHULRUGHORVUHFLSLHQWHVGHFRFLQD\
el interior del horno se encuentren secos antes de colocar
ORVDOLPHQWRVHQHOKRUQR/DVJRWDVGHKXPHGDGTXHVH
convierten en vapor pueden dar lecturas incorrectas al
sensor.
Ŷ/DVEHELGDVVHFDOLHQWDQPHMRUGHVFXELHUWDV
49-40686-4
Cubiertas
Ventiladas
Seque los platos de modo
que no den lecturas
incorrectas al sensor.
23
COCCIÓN POR MICROONDAS
24
Cocción por microondas
Cosas que son normales
Interferencia
Ŷ6HSXHGHREVHUYDULQWHUIHUHQFLDGH79UDGLRFXDQGRXWLOL]D
el microonda, similar a la interferencia causada por otros
aparatos pequeños. Esto no indica un problema con el
microonda. Mueva el radio o la TV lo más lejos posible del
microonda o revise la posición de la antena de la TV/radio.
Luces
Ŷ/DOX]GHODFDYLGDGGHOKRUQRQRVHHQFHQGHUiGXUDQWH
ningún ciclo de cocción. Para ver la comida en el horno,
SUHVLRQHODWHFOD'()5267 'HVFRQJHODU PLHQWUDVFRFLQD
a fin de iluminar la cavidad durante 4 segundos.
Calor del Horno
Ŷ/RVUHFLSLHQWHVVHSXHGHQFDOHQWDUGHELGRDODWUDQVIHUHQFLD
de calor de los alimentoscalientes. Utilice guantes para
manipularlos.
Ŷ(OYDSRUVHSXHGHVDOLUDOUHGHGRUGHODSXHUWD
49-40686-4
“COOK TIME COMPLETED” (Tiempo de cocción completo)
Para recordarle que tiene comida en el horno, el horno
LQGLFDUiHOPHQVDMH&22.7,0(&203/(7(' 7,(032'(
&2&&,Ï1&203/(72 \SLWDUiXQDYH]SRUPLQXWRKDVWDTXH
DEUDODFRPSXHUWDGHOKRUQRRDSULHWHHOERWyQ&$1&(/2))
%255$5$3$*$5 OPCIONES
Reloj:
Debe programar el reloj antes de utilizar elhorno por
primera vez. Cuando programe elreloj por primera vez vaya
directamente alpaso dos..
1. To change the clock time, press the OPTIONS pad and
WXUQWKHGLDOWR&/2&.3UHVVWKHGLDOWRHQWHU
2. Gire el dial para ajustar la hora. Presiónelopara
seleccionar.
3. Gire el dial para ajustar los minutos. Presione el dial para
seleccionar.
4. Gire el dial para seleccionar AM o PM. Presione el dial
para ingresar.
El reloj fue diseñado para apagar la unidad cuando quede
inactiva durante 30 segundos, a fin de minimizar el uso de
la energía en suspensión. El reloj se encenderá cuando la
unidad se encuentre en uso, la puerta sea abierta, la tecla
&$1&(/2)) &DQFHODU$SDJDU VHDSUHVLRQDGDRHOGLDOVHD
presionado. No hay una opción de anulación disponible basada
en los requisitos de energía DOE.
Conversión de Auto Receta:
/DFRQYHUVLyQGHDXWRUHFHWDUHGXFHODWHPSHUDWXUD
de horneado por convección de forma automática a
DSUR[LPDGDPHQWHž)FXDQGRVHHQFLHQGH6LHPSUHGHEH
introducir la temperatura de la receta y el horno hará el resto
Para cambiar la configuración, presione la tecla OPTIONS
2SFLRQHV \JLUHHOGLDOD$8725(&,3(&219(57
&RQYHUVLyQD$XWR5HFHWD 3UHVLRQHHOGLDOSDUDLQJUHVDU
*LUHHOGLDOSDUDFDPELDUODFRQILJXUDFLyQD21 (QFHQGHU X
2)) $SDJDU 3UHVLRQHHOGLDOSDUDLQJUHVDU
Retrasar Inicio:
'HOD\6WDUW 5HWUDVDU,QLFLR OHSHUPLWHFRQILJXUDUHOKRUQRSDUD
retrasar la cocción hasta durante 24 horas. Presione la tecla
237,216 2SFLRQHV JLUHHOGLDOSDUDVHOHFFLRQDU'(/$<
67$57 5HWUDVDU,QLFLR \SUHVLRQHHOGLDOSDUDLQJUHVDU6LJD
las instrucciones en pantalla para configurar el tiempo y la
IXQFLyQGH'HOD\6WDUW 5HWUDVDU,QLFLR TXHGHVHHUHWUDVDU
OTRAS FUNCIONES
Otras funciones
Voumen Del Pito:
Utilice esta característica para ajustar el volumen del pitido.
Usted también puede desactivarla. Presione la tecla OPTIONS
2SFLRQHV JLUHHOGLDOSDUDVHOHFFLRQDU%((3(592/80(
9ROXPHQGHO3LWLGR SUHVLRQHHOGLDOSDUDLQJUHVDU\VLJDODV
instrucciones en pantalla.
Velocidad de Desplazamiento:
¢6HGHVSOD]DHOPHQVDMHGHPDVLDGRGHVSDFLRRGHPDVLDGR
UiSLGR"£&iPELHOR3UHVLRQHODWHFOD237,216 2SFLRQHV JLUHHOGLDOSDUDVHOHFFLRQDU',63/$<6&52//63(('
9HORFLGDGGH'HVSOD]DPLHQWRHQ3DQWDOOD SUHVLRQHHOGLDO
para ingresar, y siga las instrucciones en pantalla.
Recordatorio:
Use esta función para configurar un pitido de la alarma a fin
de que suene en un momento específico del día. Presione
ODWHFOD237,216 2SFLRQHV JLUHHOGLDOSDUDVHOHFFLRQDU
6(7&/($55(0,1'(5 &RQILJXUDU%RUUDU5HFRUGDWRULR y presione el dial para ingresar. Gire el dial para seleccionar
la hora y presione el mismo para ingresar. Gire el dial para
seleccionar los minutos y presione el mismo para ingresar.
Gire el dial para seleccionar AM o PM y presione el mismo
para ingresar.
3DUDUHYLVDUODFRQILJXUDFLyQSUHVLRQHODWHFOD6(7&/($5
5(0,1'(5 &RQILJXUDU%RUUDU5HFRUGDWRULR \SUHVLRQHHOGLDO
SDUDLQJUHVDU*LUHHOGLDOD5(9,(: 5HYLVDU \SUHVLRQHHO
mismo para ingresar.
3DUDFDQFHODUODFRQILJXUDFLyQSUHVLRQHODWHFOD6(7&/($5
5(0,1'(5 &RQILJXUDU%RUUDU5HFRUGDWRULR \SUHVLRQHHO
GLDOSDUDLQJUHVDU*LUHHOGLDOD&/($5 %RUUDU \SUHVLRQHHO
mismo para ingresar.
Revisión
Use esta función para revisar las selecciones actuales de
cocción que usted configuró.
Presione el dial de selección durante la cocción rápida o la
cocción con microondas.
49-40686-4
25
OTRAS FUNCIONES
Otras funciones
Help (ayuda)
Utilice esta función para saber más acerca de su horno y sus
funciones.
3UHVLRQHODWHFOD+(/3
2. Gire el dial para escoger el nombrede la función. Presione
el dial paraseleccionar.
/DSDQWDOODOHPRVWUDUiXQDGHVFULSFLyQGHOSURJUDPDTXH
seleccionó.
Características que encontrará en la función HELP (ayuda).
$GGLQJWLPH $xDGLUWLHPSR
'HIURVWE\:HLJKW 'HVFRQJHODFLyQSRUSHVR
6HW%HHSHU9ROXPH $MXVWDUHOYROXPHQGHO
LQGLFDGRUVRQRUR
%DFN 5HJUHVDU
'HOD\6WDUW ,QLFLRGHPRUDGR
6HW&ORFN 3RQHUHOUHORM
%DNH +RUQHDU
([SUHVV&RRN &RFFLyQ([SUHVV
6HW'LVSOD\6SHHG $MXVWDUYHORFLGDGGH
SDQWDOOD
%HYHUDJH+HDW &DOHQWDPLHQWRGHEHELGDV
)DYRULWH5HFLSH 5HFHWDVIDYRULWD
Set/Clear Reminder $MXVWDUERUUDU
UHFRUGDWRULR
%URLO $VDU
+HOS $\XGD
6ORZ&RRN &RFFLyQOHQWD
Seguro contra niños
+ROG)RRG:DUP 0DQWHQHUFDOLHQWHOD
FRPLGD
6RIWHQ0HOW 6XDYL]DU'HUUHWLU
&DQFHO2II %RUUDU$SDJDU
2SWLRQV 2SFLRQHV
6SHHG&RRN &RFFLyQUiSLGD
&RRN &RFLQDU
3RZHU7HPS 3RWHQFLD7HPSHUDWXUD
6WDUW3DXVH ,QLFLDU3DXVDU
&RRNE\WLPH &RFFLyQSRUWLHPSR
3URRI%UHDG $FWLYDUSDQ
7LPH&RRN 7LHPSRGHFRFFLyQ\
&RRNE\)RRG7\SH &RFLQDUSRUWLSRGH
DOLPHQWR
5HKHDW 5HFDOHQWDU
7LPHU2Q2II &URQyPHWUR(QFHQGLGR
$SDJDGR
&XVWRP6SHHG&RRN &RFFLyQUiSLGD
SHUVRQDOL]DGD
5HSHDWODVW 5HSHWLU~OWLPR
7RDVW 7RVWDU
'HIURVW 'HVFRQJHODU
5HVXPH 5HDQXGDU
:DUP3URRI &DOHQWDU$FWLYDU
'HIURVWE\)RRG7\SH 'HVFRQJHODFLyQSRUWLSR
GHDOLPHQWR
5HYLHZ 5HYLVDU
'HIURVWE\7LPH 'HVFRQJHODFLyQSRUWLHPSR
6HQVRU&RRNLQJ &RFFLyQSRUVHQVRU
Seguro contra niños
Puede bloquear el panel de control para prevenir que los niños
inicien accidentalmente o utilicen el horno.
$SULHWH\PDQWHQJDDSUHWDGR&$1&(/2)) %255$5
$3$*$5 GXUDQWHVHJXQGRVSDUDEORTXHDU\GHVEORTXHDU
las funciones.
Cuando el panel de control se encuentra bloqueado, se
PRVWUDUiHOPHQVDMH&21752/,6/2&.(' (OFRQWUROVH
HQFXHQWUDEORTXHDGR EUHYHPHQWHHQFXDOTXLHUPRPHQWRTXH
un botón o el dial es apretado o tocado.
Timer (cronómetro)
Utilice esta función cada vez que necesite un cronómetro.
/DSXHGHXWLOL]DUPLHQWUDVFRFLQDHQHOKRUQR
1. Presione la tecla TIMER.
2. Gire el dial para escoger los minutos. Presiónelo para
seleccionar.
3. Gire el dial para escoger los segundos. Presiónelo para
seleccionar.
Ventiladores de refrigeración
Dos ventiladores para enfriar se encienden de forma
automática, de acuerdo con lo requerido para evitar el
sobrecalentamiento del control y los componentes internos del
horno.
/RVYHQWLODGRUHVVHDSDJDUiQDXWRPiWLFDPHQWHFXDQGRVH
enfríen las piezasinternas. Uno o más pueden permanecer
encendidos durante 30 minutos o más, después de que el
control del horno se haya apagado.
Cajón de Almacenamiento de Accesorios (en algunos modelos)
El cajón de almacenamiento de accesorios está diseñado
para sostener las bandejas de cocción y el estante rejilla para
horno, provisto con el horno. El cajón de almacenamiento de
accesorios no debe ser usado para guardar ropa, madera,
papel u otros productos combustibles.
26
/RVFRQWHQLGRVGHOFDMyQVHSRGUiQFDOHQWDUFRQHOWDFWR
mientras el horno esté en uso y mientras el mismo se esté
enfriando. Tenga cuidado al retirar objetos en estos momentos.
49-40686-4
Dentro del Horno y del Cajón de Almacenamiento de Accesorios (en algunos modelos)
Antes de limpiar cualquier parte delhorno asegúrese que el
control del horno esté apagado y que esté frío o tibio al tacto.
/LPSLHHOLQWHULRUGHOKRUQRIUHFXHQWHPHQWHSDUDTXHSXHGD
calentar adecuadamente.
Algunas salpicaduras pueden ser removidas con papel
toalla, otras requieren un paño tibio jabonoso.Remueva las
salpicaduras de grasacon un paño jabonoso, luego enjuague
con un paño húmedo.
,IWKHGLUWDQGVSDWWHUGRQRWFRPHRIIHDVLO\ZLWKDZDUPVXGV\
cloth, place
DPHGLXPVL]HGERZOIXOORIZDWHULQ
the unit on the metal tray and CUSTOM SPEEDCOOK for 10
PLQXWHVDW8 / 0 & (VWRGHEHDIORMDUHOVXFLR
adentro del horno demanera que lo pueda remover conun
paño tibio jabonoso.
Si observa un amarillentamiento enel metal adentro del horno
que no puede ser removido con un pañotibio jabonoso, utilice
XQOLPSLDGRUSDUDDFHURLQR[LGDEOHTXHUHPXHYHODGHFRORUDFLyQ
por calor y/o manchas.Puede limpiar el interior del horno como
lo haría normalmente.
No utilice limpiadores abrasivos niutensilios filosos en las
paredes delhorno o el cajón de almacenamiento de accesorios.
Nunca utilice limpiadores comerciales para hornos en
ninguna parte de su horno o el cajón de almacenamiento de
accesorios.
No limpie el interior del horno o el cajón de almacenamiento
de accesorios con estropajos de metal. Se pueden quebrar
pedazos del estropajo adentro del horno,causando un toque
eléctrico, así comodaño al acabado de la superficie interiordel
horno o el cajón de almacenamiento de accesorios.
CUIDADO Y LIMPIEZA
Cuidado y Limpieza
Plato giratorio removible
El área debajo del plato giratorio debe limpiarse
frecuentemente para evitar oloros y humo durante el
ciclo de cocimiento.
El plato giratorio se puede quebrar si lodeja caer.
/iYHORFRQFXLGDGRHQDJXDWLELD\MDERQRVD6pTXHOR
bien y colóquelo en su lugar.
Para colocar el plato giratorio, coloque elcentro sobre
el eje en el centro del hornoy gírelo hasta que esté
FRORFDGRHQVXOXJDU $VHJ~UHVHGHTXHHOODGRSODQR
GHOSODWRJLUDWRULRFRQODPDUFD³723´ 3DUWH6XSHULRU esté mirando hacia arriba y que su centro se apoye
VREUHHOSHUQR
49-40686-4
Plato giratorio
No utilice el horno sin el platogiratorio
en su lugar.
27
CUIDADO Y LIMPIEZA
Cuidado y Limpieza
Bandejas de cocimiento y parrilla de alambre del horno
Para evitar que se quiebren, permitaque las bandejas se
HQIUtHQFRPSOHWDPHQWHDQWHVGHOLPSLDUODV/DYHFRQFXLGDGR
en agua caliente jabonosa oen la lavadora de platos.
No utilice abrasivos para limpiar la bandeja de vidrio ni la
parrilla de alambre delhorno, ya que se puede dañar el
acabado.
Se debe utilizar un estropajo plástico paralimpiar las bandejas
de metal.
Parrilla de alambre del horno
%DQGHMDGH
vidrio claro
%DQGHMDGHPHWDO
%DQGHMDGHPHWDOSDUDDVDU
Cubierta de la lámpara halógena y lámina de mica
No retire la cubierta de vidrio de la lámpara halógena ni la
lámina de mica.
/DFXELHUWDGHODOiPSDUDKDOyJHQDVXSHULRUGHEHHVWDUOLEUH
de grasa o desalpicaduras de alimentos, para quepueda
funcionar efectivamente.
/LPSLHODFXELHUWDGHYLGULRGHODOiPSDUD\ODODPLQDGHPLFD
IUHFXHQWHPHQWDSDUDHYLWDUHOH[FHVRGHKXPR\ODGLVPLQXFLyQ
de la potencia de cocimiento.
Para limpiar la cubierta de la lámparasuperior: Permita
que el horno y lacubierta de vidrio se enfríen completamente.
/tPSLHODFRQXQSDxRWLELSMDERQRVRRFRQXQHVWURSDMR
plástico.
Para sucio quemado, puede utilizar un raspador para limpiar
la cubierta de lalámpara halógena. Sostenga el raspador a un
iQJXORGHž5DVSHHOYLGULRSDUDOLPSLDUOR\OLPSLHHOH[FHVR
desucio.
Para limpiar la lámina de mica: Permitaque el horno se
HQIUtHFRPSOHWDPHQWH/LPSLHFRQXQSDxRWLELRMDERQRVR
Cubierta de la lámpara
halógena superior
/iPLQDGH0LFD
Para suciedad pesada o quemada
Fuera del Horno y del Cajón de Almacenamiento de Accesorios (en algunos modelos)
No recomendamos el uso de limpiadores con amoníaco o
alcohol, ya que pueden dañar la apariencia del horno or el
cajón de almacenamiento de accesorios. Si escoge utilizar
un limpiador casero común, aplique primero el limpiador
directamente en el pañode limpieza, luego limpie el área sucia.
Panel de Control, Puerta y Cajón de Vidrio
/LPSLHFRQXQDHVSRQMDOLPSLD\K~PHGD6HTXHWRWDOPHQWH
No use espráis limpiadores, grandes cantidades de agua y
jabón, objetos abrasivos o puntiagudos sobre el panel, ya que
lo pueden dañar.
Acero Inoxidable (en algunos modelos)
3DUDOLPSLDUODVXSHUILFLHGHDFHURLQR[LGDEOHXVHDJXDWLELD
FRQMDEyQRXQOLPSLDGRURSXOLGRUSDUDDFHURLQR[LGDEOH
Siempre limpie la superficie en la dirección del veteado. Siga
las instrucciones del limpiador para limpiar la superficie de
DFHURLQR[LGDEOH
Para consultar sobre la compra de limpiadores o pulidores para
HODUWHIDFWRGHDFHURLQR[LGDEOHRSDUDEXVFDUODXELFDFLyQGHO
vendedor minorista más cercano a su hogar, comuníquese al
número gratuito: 800.626.2005 o visite GEAppliances.com.
Sello de la Puerta
Es importante mantener limpia el área donde sella la puerta
con el horno. Utilice detergentes suaves, noabrasivos
aplicados con un paño o esponja. Enjuague bien.
28
49-40686-4
DECLARACIÓN DE INTERFERENCIA POR RADIOFRECUENCIA DE LA
FEDERAL COMMUNICATIONS COMMISSION (COMISIÓON FEDERAL DE
COMUNICACIONES) (EE.UU. ÚNICAMENTE)
Este equipamiento genera y utiliza energía de
frecuencia ISM y si no es instalado y usado de forma
adecuada, estando en estricto cumplimiento con las
instrucciones del fabricante, podrá generar interferencia
en la recepción de radio y televisión. Fue evaluado de
forma específica y se comprobó que cumple con los
límites de Equipamientos ISM, de acuerdo con la parte
18 de las Reglas de la FCC, que fueron diseñadas para
brindar una instalación residencial.
Ŷ5HRULHQWHODDQWHQDUHFHSWRUDGHODUDGLRRHO
televisor.
Sin embargo, no se garantiza que no se presenten
interferencias en una instalación en particular. Si este
equipamiento genera interferencias en la recepción
de radio o televisión, lo que se puede comprobar
encendiendo y apagando el equipo, se aconseja al
usuario que intente corregir la interferencia a través de
una de las siguientes medidas:
El fabricante no es responsable por ninguna
interferencia de radio o TV generada por modificaciones
no autorizadas sobre este horno microondas. Es
responsabilidad del usuario corregir tales interferencias.
49-40686-4
Ŷ5HXELTXHHO+RUQR0LFURRQGDVHQUHODFLyQDO
receptor.
Ŷ$OHMHHOKRUQRPLFURRQGDVGHODSRVLFLyQGHOUHFHSWRU
Ŷ(QFKXIHHOKRUQRPLFURRQGDVHQXQWRPDFRUULHQWH
diferente, de modo que el horno microondas y el
receptor estén en diferentes recepciones de códigos.
CUIDADO Y LIMPIEZA
Cuidado y Limpieza
29
CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS
Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico
¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite solicitar reparaciones.
Problema
Causas posibles
Qué hacer/Explicación
Se opaca la luz durante un circlo de
cocimiento rapido y se enciende y
apaga, aún en niveles de potencio
completa.
Esto es normal. El nivel de potencia ha
sido reducido automáticamente ya que el
horno está caliente.
Esto es normal. El horno detecta el nivel de calor y
se ajusta automáticamente.
Luz visible alrededor de la puerta y
de la caja exterior al cocinar ráppido.
Esto es normal.
Cuando el horno está encendido, hay una luz visible
DOUHGHGRUGHODSXHUWD\GHODFDMDH[WHULRU
El ventilador continúa funcionando
despué de terminar de cocinar.
El horno se está enfriando.
El ventilador se apagará automáticamente cuando
las piezas internos del horno se hayan enfriado.
El respirador del horno emite un
aire caliente mientras el horno está
encendido.
Esto es normal.
El ventilador del respirador se
enciende automáticamente cuando
el horno no está en uso.
Esto es normal.
LUCES
VENTILADORES PARA ENFRIAR
COCIMIENTO
El horno emite sonidos atípicos
mientras se está cocinando
Los sonidos de clic son normales. El
control está encendiendo y apagando los
componentes.
Estos sonidos son normales.
El sonido del ventilador es normal. La
función de los ventiladores es mantener
fríos los componentes y controles del
horno.
Estos sonidos son normales.
Sale humo del horno cuando se abre
la puerta.
La comida tiene alto contenido de grasa.
Se utilizó espray en las panas.
El humo es normal al cocinar comidas con mucha
grasa. Utilice aceite vegetal o de oliva en la carne,
en lugar de cubrir toda la pana.
Al final del programa de cocimento
la comida no está completamente
cocida ni dorada.
Los tiempos programados no cocnierdan
con el tamaño ni la cantidad de comida que
va a cocinar.
Ajuste el tiempo de finalización o ajuste las
lámparas superior e inferior para dorar y finalizar la
cocción.
Aparece SENSOR ERROR (Error
del Sensor) junto con una señal del
horno
La cantidad o el tipo de comida colocado
en el horno no coinciden con el programa
que fue configurado.
3UHVLRQHODWHFOD&$1&(/2)) %RUUDU$SDJDU Configure el programa del horno para igualar la
comida y el líquido que se cocinarán o calentarán.
El sensor del horno no detectó el vapor
debido a que el envoltorio plástico no
estaba ventilado, una tapa del plato estaba
demasiado ajustada o un líquido estaba
cubierto.
Ventile los envoltorios plásticos, use una tapa floja o
destape los líquidos al cocinar o calentar.
PANTALLA
(VWRHVQRUPDO/DSDQWDOODHVWiSURJUDPDGDSDUD
apagarse durante el modo de espera. 9HUOD
La pantalla está en blanco.
VHFFLyQGHOUHORM
Aparece en la pantalla
El control está bloqueado.
3UHVLRQH\VRVWHQJD&$1&(/2))³&RQWUROGXUDQWH
3 segundos para desbloquear Funciones.
La pantalla de control está iluminada
pero el horno no se inicia
El reloj no está programado.
Siga las instrucciones para programar el reloj.
La puerta no está cerrada.
Abra la puerta y ciérrela segura.
No se presionó la tecla START/PAUSE
después de seleccionar el cocimiento.
3UHVLRQH67$573$86( ,QLFLR3DXVD Otra selección ya fue ingresada en el horno
y no se presionó la tecla CANCEL/ OFF
(Borrar/ Apagar) para cancelar la misma.
3UHVLRQH&$1&(/2)) %RUUDU$SDJDU El tamaño, la cantidad o el tiempo de
cocción no fueron ingresados luego de la
selección final.
Asegúrese de haber ingresado el tiempo de cocción
luego de realizar la selección.
Se presionó accidentalmente CANCEL/OFF
Reajuste el programa de cocimiento y presione
START/PAUSE.
La puerta y el interior del horno se
sienten caliente.
Las lámparas de calentamiento producen
un calor intenso en un espacio pequeño.
Esto es normal.
Cuando la comida esté lista, utilice guantes para
retirarla.
El horno no arranca
Se pudo haber quemado un fusible o
disparado el interruptor automático de su
casa.
Cambie el fusible o reajuste el interruptor automático.
OTROS PROBLEMAS
30
49-40686-4
GEAppliances.com
Todo el servicio de garantía es provisto por nuestros Centros de Servicio de Fabricación, o un técnico autorizado de Customer Care®.
Para programar una visita del servicio técnico a través de Internet, visítenos enZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUW, o
OODPHDO*(&$5(6 &XDQGROODPHSDUDVROLFLWDUHOVHUYLFLRWHQJDORVQ~PHURVGHVHULH\PRGHORGLVSRQLEOHV
Por el período de
GE Appliances Reemplazará:
Un año
Desde la fecha de
compra original
Cualquier parte del horno que falle debido a un defecto en los materiales o mano de obra.
Durante esta garantía limitada de un año, GE Appliances también proveerá, gratis, toda la
mano de obra y servicio relacionado para reemplazar la pieza defectuosa.
Un año
Desde la fecha de
compra original
El tubo magnetrón, si el tubo magnetrón falla debido a un defecto de materiales o mano de
obra. Durante esta garantía limitada de un año, usted será responsable de toda mano de
obra o costos de la reparación a domicilio.
GARANTÍA
Garantía del horno Advantium
Lo que GE Appliances no cubrirá:
Ŷ9LVLWDVGHVHUYLFLRDGRPLFLOLRSDUDHQVHxDUOHDXWLOL]DUHVWH
producto.
Ŷ5HHPSOD]RGHIXVLEOHVGHOKRJDURUHLQLFLDOL]DFLyQGH
interruptores de circuitos.
Ŷ,QVWDODFLyQHQWUHJDRPDQWHQLPLHQWRLQDGHFXDGRV
Ŷ5HHPSOD]RGHERPELOODVGHODOX]GHODHVWXID
Ŷ3URGXFWRQRDFFHVLEOHSDUDIDFLOLWDUHOVHUYLFLRUHTXHULGR
Ŷ'DxRVRFDVLRQDGRVDOSURGXFWRSRUPRWLYRGHDFFLGHQWH
incendio, inundaciones o actos fortuitos.
Ŷ)DOORVGHOSURGXFWRVLKD\DEXVRPDOXVR SRUHMHPSOR
chispas dentro de horno microondas del estante metálico/
SDSHOGHDOXPLQLR RXVRSDUDRWURVSURSyVLWRVTXHORV
propuestos, o si se usa con fines comerciales.
Ŷ'DxRVLQFLGHQWDOHVRLQGLUHFWRVFDXVDGRVSRUSRVLEOHV
defectos de este aparato.
Ŷ'DxRVFDXVDGRVGHVSXpVGHODHQWUHJD
EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS
6X~QLFD\H[FOXVLYDDOWHUQDWLYDHVODUHSDUDFLyQGHOSURGXFWRFRPRVHLQGLFDHQOD*DUDQWtD/LPLWDGD/DVJDUDQWtDV
implícitas, incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito particular, se limitan a un
año o al período más corto permitido por la ley.
$OJXQRVHVWDGRVQRSHUPLWHQODH[FOXVLyQROLPLWDFLyQGHGDxRVIRUWXLWRVRFRQVHFXHQWHV(VWDJDUDQWtDOHGDGHUHFKRVOHJDOHV
específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer cuáles son sus derechos
legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado.
Garante: GE Appliances
49-40686-4
Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con
la garantía deberá contar con la prueba de la fecha original de compra.
(VWDJDUDQWtDVHH[WLHQGHDOFRPSUDGRURULJLQDO\DFXDOTXLHUGXHxRVXEVLJXLHQWHGHSURGXFWRVFRPSUDGRVSDUDXVRKRJDUHxRGHQWUR
de EE.UU. Si el producto está en un área donde no se encuentra disponible un Proveedor Autorizado del Servicio Técnico de GE
Appliances, usted será responsable por el costo de un viaje o se podrá requerir que traiga el producto a una ubicación del Servicio
7pFQLFRGH*($SSOLDQFHVDXWRUL]DGRSDUDUHFLELUHOVHUYLFLR(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRD
su hogar.
31
SOPORTE PARA EL CONSUMIDOR
Soporte para el Consumidor
Sitio Web de GE Appliances
¢'HVHDUHDOL]DUXQDFRQVXOWDRQHFHVLWDD\XGDFRQVXHOHFWURGRPpVWLFR"£,QWHQWHDWUDYpVGHO6LWLR:HEGH*($SSOLDQFHVODV
24 horas del día, cualquier día del año! Usted también puede comprar más electrodomésticos maravillosos de GE Appliances y
aprovechar todos nuestros servicios de soporte a través de Internet, diseñados para su conveniencia.
En EE.UU.: GEAppliances.com
Registre su Electrodoméstico
¡Registre su electrodoméstico nuevo a través de Internet, según su conveniencia! Un registro puntual de su producto permitirá
una mejor comunicación y un servicio más puntual de acuerdo con los términos de su garantía, en caso de surgir la necesidad.
También puede enviar una carta en la tarjeta de inscripción preimpresa que se incluye con el material embalado.
En EE.UU.: GEAppliances.com/register
Servicio Programado
(OVHUYLFLRGHUHSDUDFLyQGHH[SHUWRVGH*($SSOLDQFHVHVWiDVyORXQSDVRGHVXSXHUWD&RQpFWHVHDWUDYpVGH,QWHUQHW\SURJUDPH
su servicio a su conveniencia cualquier día del año. En EE.UU.: GEAppliances.com/ge/service-and-support/service.htm
o comuníquese al 800.432.2737 durante el horario de atención comercial.
Garantías Extendidas
$GTXLHUDXQDJDUDQWtDH[WHQGLGDGH*($SSOLDQFHV\FRQR]FDORVGHVFXHQWRVHVSHFLDOHVTXHHVWiQGLVSRQLEOHVPLHQWUDVVX
JDUDQWtDD~QHVWiYLJHQWH/DSXHGHDGTXLULUHQFXDOTXLHUPRPHQWRDWUDYpVGH,QWHUQHW/RVVHUYLFLRVGH*($SSOLDQFHVD~Q
estarán allí cuando su garantía caduque.
En EE.UU.: GEAppliances.com/ge/service-and-support/shop-for-extended-service-plans.htm
o comuníquese al 800.626.2224 durante el horario de atención comercial.
Conectividad Remota
3DUDVROLFLWDUDVLVWHQFLDSDUDODFRQHFWLYLGDGGHUHGLQDOiPEULFD SDUDPRGHORVFRQDFFHVRUHPRWR YLVLWHQXHVWURVLWLRZHEHQGEAppliances.com/ge/connected-appliances/ o comuníquese al 800.220.6899 en EE.UU.
Piezas y Accesorios
Aquellos individuos calificados para realizar el servicio técnico de sus propios electrodomésticos podrán solicitar el envío de
SLH]DVRDFFHVRULRVGLUHFWDPHQWHDVXVKRJDUHV VHDFHSWDQODVWDUMHWDV9,6$0DVWHU&DUG\'LVFRYHU 2UGHQHKR\DWUDYpVGH
Internet durante las 24 horas, todos los días. En EE.UU.: GEApplianceparts.com o de forma telefónica al 877.959.8688 durante
el horario de atención comercial.
Las instrucciones que figuran en este manual cubren los procedimientos que serán realizados por cualquier usuario.
Otros servicios técnicos generalmente deben ser derivados a personal calificado del servicio. Se deberá tener cuidado,
ya que una reparación indebida podrá hacer que el funcionamiento no sea seguro.
Contáctenos
Si no se encuentra satisfecho con el servicio que recibió de GE Appliances, comuníquese con nosotros a través de nuestro sitio
Web con todos los detalles, incluyendo su número telefónico, o escriba a:
(Q((88*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/ge/service-and-support/contact.htm
32
Impreso en Corea
49-40686-4
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising