GE | JGRP20BEJBB | Use and Care Manual | GE JGRP20BEJBB Use and Care Manual

GE JGRP20BEJBB Use and Care Manual
WALL OVEN
Built-In Gas
SAFETY INFORMATION
. . . . . . . . . .3
OWNER’S MANUAL
USING THE OVEN
JGRP20
Single Wall Oven . . . . . . . . . . . . . . . . . . . . . . . 6
Double Wall Oven . . . . . . . . . . . . . . . . . . . . . . 7
Special Features . . . . . . . . . . . . . . . . . . . . . . . . 8
Oven Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Aluminum Foil and Oven Liners. . . . . . . . . . . 9
Cookware. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Cooking Modes . . . . . . . . . . . . . . . . . . . . . . . . 10
Cooking Guide . . . . . . . . . . . . . . . . . . . . . . . . 11
CARE AND CLEANING
Oven . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
Oven Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
Oven Door . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14
TROUBLESHOOTING TIPS. . . . . . . 15
LIMITED WARRANTY . . . . . . . . . . . . 18
ACCESSORIES . . . . . . . . . . . . . . . . . . . . 19
CONSUMER SUPPORT . . . . . . . . . . .20
Write the model and serial
numbers here:
Model # ____________________
Serial # ____________________
You can find them on a label on
the front of the oven behind the
door.
GE is a trademark of the General Electric Company. Manufactured under trademark license.
49-80713 Rev. 2 08-19 GEA
THANK YOU FOR MAKING GE APPLIANCES A PART OF YOUR HOME.
Whether you grew up with GE Appliances, or this is your first, we’re happy to have you in the family.
We take pride in the craftsmanship, innovation and design that goes into every GE Appliances
product, and we think you will too. Among other things, registration of your appliance ensures that we
can deliver important product information and warranty details when you need them.
Register your GE appliance now online. Helpful websites and phone numbers are available in the
Consumer Support section of this Owner’s Manual. You may also mail in the pre-printed registration
card included in the packing material.
2
49-80713 Rev. 2
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
WARNING If the information in this manual is not followed exactly, a fire or
explosion may result, causing property damage, personal injury or death.
- Do not store or use gasoline or other flammable vapors and liquids in the vicinity of
this or any other appliance.
- WHAT TO DO IF YOU SMELL GAS
Ŷ 'RQRWWU\WROLJKWDQ\DSSOLDQFH
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ 'RQRWWRXFKDQ\HOHFWULFDOVZLWFKGRQRWXVHDQ\SKRQHLQ\RXUEXLOGLQJ
Ŷ ,PPHGLDWHO\FDOO\RXUJDVVXSSOLHUIURPDQHLJKERU¶VSKRQH)ROORZWKHJDV
VXSSOLHU¶VLQVWUXFWLRQV
Ŷ ,I\RXFDQQRWUHDFK\RXUJDVVXSSOLHUFDOOWKHILUHGHSDUWPHQW
- Installation and service must be performed by a qualified installer, service agency or
the gas supplier.
WARNING Read all safety instructions before using the product. Failure to follow these instructions may result
in fire, electrical shock, serious injury or death.
WARNING GENERAL SAFETY INSTRUCTIONS
Ŷ 8VHWKLVDSSOLDQFHIRULWVLQWHQGHGSXUSRVHDV
described in this owner’s manual.
Ŷ +
DYH\RXUUDQJHLQVWDOOHGDQGSURSHUO\JURXQGHGE\
a qualified installer in accordance with the provided
installation instructions.
Ŷ $
Q\DGMXVWPHQWDQGVHUYLFHVKRXOGEHSHUIRUPHG
only by a qualified gas range installer or service
technician. Do not attempt to repair or replace
any part of your range unless it is specifically
recommended in this manual.
Ŷ <
RXUUDQJHLVVKLSSHGIURPWKHIDFWRU\VHWIRUXVH
with natural gas. It can be converted for use with
propane gas. If required, these adjustments must be
made by a qualified technician in accordance with
the installation instructions and local codes. The
agency performing this work assumes responsibility
for the conversion.
Ŷ +
DYHWKHLQVWDOOHUVKRZ\RXWKHORFDWLRQRIWKH
range gas shut-off valve and how to turn it off if
necessary.
Ŷ 3OXJ\RXUUDQJHLQWRDYROWJURXQGHGRXWOHW
only. Do not remove the round grounding prong
from the plug. If in doubt about the grounding of the
home electrical system, it is your responsibility and
obligation to have an ungrounded outlet replaced
with a properly grounded, three prong outlet in
accordance with the National Electrical Code. Do
not use an extension cord with this appliance.
Ŷ %
HIRUHSHUIRUPLQJDQ\VHUYLFHXQSOXJWKHUDQJH
or disconnect the power supply at the household
distribution panel by removing the fuse or switching
off the circuit breaker.
Ŷ %
HVXUHDOOSDFNLQJPDWHULDOVDUHUHPRYHGIURPWKH
range before operating to prevent ignition of these
materials.
Ŷ $
YRLGVFUDWFKLQJRULPSDFWLQJJODVVGRRUV
cooktops, or control panels. Doing so may lead
to glass breakage. Do not cook on a product with
broken glass. Shock, fire, or cuts may occur.
Ŷ '
RQRWOHDYHFKLOGUHQDORQHRUXQDWWHQGHGLQDQ
area where an appliance is in use. They should
never be allowed to climb, sit or stand on any part
of the appliance.
READ AND SAVE THESE INSTRUCTIONS
49-80713 Rev. 2
3
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING GENERAL SAFETY INSTRUCTIONS (Cont.)
Ŷ
CAUTION Do not store items of interest
to children in cabinets above an oven - children
climbing on the oven to reach items could be
seriously injured.
Ŷ '
RQRWDOORZDQ\RQHWRFOLPEVWDQGRUKDQJRQWKH
oven door ir drawer. They could damage the range or
tip it over causing severe injury or death.
Ŷ 1
HYHUEORFNWKHYHQWV DLURSHQLQJV RIWKHUDQJH
They provide the air inlets and outlets that are
necessary for the range to operate properly with
correct combustion. Air openings are located at the
top and bottom of the oven door, and at the bottom
of the range under lower oven drawer or panel.
Ŷ 8
VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW
holders on hot surfaces may result in burns from
steam. Do not let pot holders touch burner grate or
oven heating element. Do not use a towel or other
bulky cloth in place of pot holders.
Ŷ '
RQRWWRXFKWKHKHDWLQJHOHPHQWVRUWKHLQWHULRU
surface of the oven. These surfaces may be hot
enough to burn even though they are dark in color.
During and after use, do not touch, or let clothing
or other flammable materials contact any interior
area of the oven; allow sufficient time for cooling
first. Other surfaces of the appliance may become
KRWHQRXJKWRFDXVHEXUQV3RWHQWLDOO\KRWVXUIDFHV
include the oven vent opening, surfaces near the
opening and crevices around the oven door.
Ŷ '
RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH
could build up and the container could burst,
causing an injury.
Ŷ &
RRNIRRGWKRURXJKO\WRKHOSSURWHFWDJDLQVW
foodborne illness. Minimum safe food temperature
recommendations can be found at IsItDoneYet.gov
and fsis.usda.gov8VHDIRRGWKHUPRPHWHUWRWDNH
food temperatures and check several locations.
WARNING KEEP FLAMMABLE MATERIALS AWAY FROM THE OVEN
Failure to do so may result in fire or personal injury.
Ŷ '
RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQRUQHDU
an oven, including paper, plastic, pot holders,
linens, wall coverings, curtains, drapes and gasoline
or other flammable vapors and liquids.
Ŷ 1
HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH
using the appliance. These garments may ignite if
they contact hot surfaces, causing severe burns.
Ŷ '
RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH
materials accumulate in or near the oven. Grease in
the oven or near the oven may ignite.
WARNING IN THE EVENT OF A FIRE, TAKE THE FOLLOWING
STEPS TO PREVENT INJURY AND FIRE SPREADING
Ŷ '
RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXSD
flaming pan.
Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJVPRWKHU
the fire by closing the oven door and turning the
oven off or by using a multi-purpose dry chemical or
foam-type fire extinguisher.
Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJVHOIFOHDQWXUQ
the oven off and wait for the fire to go out. Do not
force the door open. Introduction of fresh air at
self-clean temperatures may lead to a burst of flame
from the oven. Failure to follow this instruction may
result in severe burns.
READ AND SAVE THESE INSTRUCTIONS
4
49-80713 Rev. 2
READ ALL INSTRUCTIONS BEFORE USING THE APPLIANCE
WARNING OVEN SAFETY INSTRUCTIONS
Ŷ 6
WDQGDZD\IURPWKHRYHQZKHQRSHQLQJWKHRYHQ
door. Hot air or steam which escapes can cause
burns to hands, face and/or eyes.
Ŷ '
RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJXWHQVLOV
or food in the oven when not in use. Items stored in
an oven can ignite.
Ŷ .HHSWKHRYHQYHQWXQREVWUXFWHG
Ŷ 1HYHUSODFHFRRNLQJXWHQVLOVSL]]DRUEDNLQJVWRQHV
or any type of foil or liner on the oven floor. These
items can trap heat or melt, resulting in damage to
the product and risk of shock, smoke or fire.
Ŷ .
HHSWKHRYHQIUHHIURPJUHDVHEXLOGXS*UHDVHLQ
the oven may ignite.
Ŷ 3
ODFHRYHQUDFNVLQGHVLUHGORFDWLRQZKLOHRYHQLV
cool. If rack must be moved while oven is hot, do not
let pot holder contact hot heating element in oven.
Ŷ 1HYHUEURLOZLWKGRRURSHQ2SHQGRRUEURLOLQJLVQRW
permitted due to overheating of controls.
Ŷ :
KHQXVLQJFRRNLQJRUURDVWLQJEDJVLQWKHRYHQ
follow the manufacturer’s directions.
SAFETY INFORMATION
IMPORTANT SAFETY INFORMATION
Ŷ 3
XOOWKHRYHQUDFNWRWKHVWRSORFNSRVLWLRQZKHQ
loading and unloading food from the oven. This
helps prevent burns from touching hot surfaces of
the door and oven walls.
WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS
The self-cleaning feature operates the oven at temperatures high enough to burn away food soils in the oven.
Follow these instructions for safe operation.
Ŷ '
RQRWWRXFKRYHQVXUIDFHVGXULQJVHOIFOHDQ
RSHUDWLRQ.HHSFKLOGUHQDZD\IURPWKHRYHQGXULQJ
self-cleaning. Failure to follow these instructions
may cause burns.
Ŷ %
HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHJUHDVH
and food soils from the oven. Excessive amount
of grease may ignite, leading to smoke damage to
your home.
Ŷ %
HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHUHPRYHSDQV
shiny metal oven racks and other utensils from the
oven. Only porcelain-coated oven racks may be left
in the oven. Do not use self-clean to clean other
parts, such as grates.
Ŷ ,IWKHVHOIFOHDQLQJPRGHPDOIXQFWLRQVWXUQWKH
oven off and disconnect the power supply. Have it
serviced by a qualified technician.
Ŷ '
RQRWXVHRYHQFOHDQHUV1RFRPPHUFLDORYHQ
cleaner or oven liner protective coating of any kind
should be used in or around any part of the oven.
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
READ AND SAVE THESE INSTRUCTIONS
49-80713 Rev. 2
5
USING THE OVEN: Oven Controls
Oven Controls
1. BAKE: Touch this pad to select the bake function.
Bake Light:)ODVKHVZKLOHLQHGLWPRGH²\RXFDQ
change the oven temperature at this point. Glows
when the oven is in bake mode.
2. BROIL HI/LO: Touch this pad to select the broil
function. See the Cooking Modes section for more
information.
Bake Light: )ODVKHVZKLOHLQHGLWPRGH²\RXFDQ
VZLWFKIURP+,WR/2%52,/DWWKLVSRLQW*ORZV
when the oven is in bake mode.
3. DISPLAY: Shows the operations you have
selected, the time of day and the cooking status.
4. COOKING TIME: Touch this pad and then
touch the + or – pad to set the amount of time you
want your food to cook. The oven will shut off when
the cooking time has run ou
8. START: Must be touched to start any cooking
function.
9. – Pad: Short taps to this pad will decrease the
time or temperature by small amounts. Touch and
hold the pad to decrease the time or temperature by
larger amounts.
10. + Pad: Short taps to this pad will increase the time
or temperature by small amounts. Touch and hold
the pad to increase the time or temperature by larger
amounts.
11. CLEAR/OFF: Touch this pad to cancel ALL oven
operations except the clock and timer.
12. SELF CLEAN: Touch this pad to select the selfFOHDQLQJIXQFWLRQ6HHWKH8VLQJWKHVHOIFOHDQLQJ
oven section.
5. DELAY START:8VHDORQJZLWKWKH&22.,1* 13. CLEAN LIGHT: )ODVKHVZKLOHLQHGLWPRGH²
TIME or SELF CLEAN pad to set the oven to start
and stop automatically at a time you set.
6. OVEN LIGHT ON/OFF: Touch this pad to
turn the oven light on or off.
7. TIMER/CLOCK: Touch this pad to select the
timer feature. Then touch + and – pads to adjust
time. To set the clock, touch this pad twice and hold
3 seconds and then touch the + and – pads. The
time of day will flash in the display when the oven is
first turned on.
6
you can change the length of time for the self-clean
cycle at this point. Glows when the oven is in the
self-clean cycle. After the self-clean cycle, the light
ZLOOWXUQRII8QODWFKWKHGRRU
If “F–” and a number or letter flash in the display and the
oven control signals, this indicates a function error code.
Touch the CLEAR/OFF pad. Allow the oven to cool for
RQHKRXU3XWWKHRYHQEDFNLQWRRSHUDWLRQ
If function error code repeats, disconnect power to the
oven and call for service.
49-80713 Rev. 2
Not all features are on all models.
To Set the Clock
The clock must be set to the correct time of day for the
automatic oven timing functions to work properly. The
time of day cannot be changed during a delayed cooking
or a delayed self-cleaning cycle.
7RXFKWKHTIMER/CLOCK pad twice.
3. Touch the START pad until the time of day shows in
the display. This enters the time and starts the clock.
To check the time of day when the display is showing
other information, simply touch the CLOCK pad. The
time of day shows until another pad is touched.
2. Touch the + or – pad.
If the + or – pad is not touched within one minute after
you touch the TIMER/CLOCK pad, the display reverts
to the original setting. If this happens, touch the TIMER/
CLOCK pad twice and reenter the time of day.
To Turn Off the Clock Display
If you have several clocks in your kitchen, you may wish
to turn off the time of day clock display on your oven.
7RXFKWKHTIMER/CLOCK pad once to turn off the
time of day display. Although you will not be able to
see it, the clock maintains the correct time of day.
2. Touch the TIMER/CLOCK pad twice to recall the
clock display.
USING THE OVEN: Oven Controls
Clock and Timer
To Set the Timer
The timer does not control oven operations. The
maximum setting on the timer is 9 hours and 59 minutes.
If you make a mistake, touch the TIMER/CLOCK pad
and begin again.
7RXFKWKHTIMER/CLOCK pad.
3. Touch the START pad. The time will start counting
down, although the display does not change until one
minute has passed.
2. Touch the + or – pad until the amount of time you
want shows in the display. The maximum time that
can be entered in minutes is 59. Times more than 59
minutes should be changed to hours and minutes.
:KHQWKHWLPHUUHDFKHVWKHFRQWUROZLOOEHHS
times followed by one beep every 6 seconds until the
TIMER/CLOCK pad is touched.
To Reset the Timer
If the display is still showing the time remaining, you
may change it by touching the TIMER/CLOCK pad, then
touching the + or – pad until the time you want appears
in the display.
,IWKHUHPDLQLQJWLPHLVQRWLQWKHGLVSOD\ FORFNVWDUW
WLPHRUFRRNLQJWLPHDUHLQWKHGLVSOD\ UHFDOOWKH
remaining time by touching the TIMER/CLOCK pad and
then touching the + or – pad to enter the new time you
want.
To Cancel the Timer
Touch the TIMER/CLOCK pad twice.
49-80713 Rev. 2
7
USING THE OVEN: Special Features
Special Features
Your new touch pad control has additional features that you may choose to use. The following are the features and
how you may activate them.
The special feature modes can only be activated while the display is showing the time of day clock. They remain in
the control’s memory until the steps are repeated.
When the display shows your choice, touch the START pad. The special features will remain in memory after a
power failure, except for the Sabbath feature, which will have to be reset.
Tones at the End of a Timed Cycle
At the end of a timed cycle, 3 short beeps will sound
followed by one beep every 6 seconds, until the CLEAR/
OFF pad is touched. This continuous 6-second beep may
be canceled.
To cancel the 6-second beep:
7RXFKWKH%$.(DQG%52,/+,/2SDGVDWWKHVDPH
time for 2 seconds until the display shows SF.
3. Touch the START parestored.
If you wish to use the Cook Time feature to bake in the
oven and then have the oven automatically turn off, you
will need to press the Cook Time button, enter a cooking
time duration, and press Start. Then enter special
features to start Sabbath mode as detailed above.
2. Touch the BROIL HI/LO pad. The display shows CON
BEEP FRQWLQXRXVEHHS 7RXFKWKH%52,/+,/2SDG
again. The display shows BEEP 7KLVFDQFHOVWKHRQH
EHHSHYHU\VHFRQGV
12-Hour Shut-Off
With this feature, should you forget and leave the oven
on, the control will automatically turn off the oven after
KRXUVGXULQJEDNLQJIXQFWLRQVRUDIWHUKRXUVGXULQJ
a broil function.
2. Touch the DELAY START pad. The display will
show 12 shdn KRXUVKXWRII 7RXFKWKHDELAY
START pad again and the display will show no shdn
QRVKXWRII If you wish to turn off this feature, follow the steps below:
3. Touch the START pad to activate the no shut-off and
leave the control set in this special features mode.
Touch the BAKE and BROIL HI/LO pads at the same
time for 2 seconds until the display shows SF.
Cook and Hold
Your new control has a cook and hold feature that keeps
cooked foods warm for up to 3 hours after the cooking
function is finished.
To activate this feature, follow the steps below:
7RXFKWKHBAKE and BROIL HI/LO pads at the same
time for 2 seconds until the display shows SF.
2. Touch the COOKING TIME pad. The display will
show Hld OFF.
Touch the COOKING TIME pad again to activate the
feature. The display will show Hld ON.
3. Touch the START pad to activate the cook and
hold feature and leave the control set in this special
features mode.
12-Hour, 24-Hour or Clock Black-Out
<RXUFRQWUROLVVHWWRXVHDKRXUFORFN
If you would prefer to have a 24-hour military time clock
or black-out the clock display, follow the steps below:
7RXFKWKHBAKE and BROIL HI/LO pads at the same
time for 2 seconds until the display shows SF.
2. Touch the TIMER/CLOCK pad once. The display will
show 12 hr.
Touch the TIMER/CLOCK pad again to black-out the
clock display. The display will show OFF.
3. Touch the START pad to activate your choice and
leave the control set in this special features mode.
NOTE: If the clock is in the black-out mode you will not
be able to use the Delay Start function.
Touch the TIMER/CLOCK pad again to change to the
24-hour military time clock. The display will show 24 hr.
8
49-80713 Rev. 2
Control Lockout
Your control will allow you to lock out the touch pads so
they cannot be activated when touched.
To lock the controls:
3. Touch the START pad to activate the control lockout
feature and leave the control set in this special
features mode.
7RXFKWKHBAKE and BROIL HI/LO pads at the same
time for 2 seconds until the display shows SF.
When this feature is on and the touch pads are touched
the control will beep and the display will show LOC.
2. Touch the SELF CLEAN pad. The display will show
LOC OFF.
NOTE: The control lockout mode will not affect the clock,
timer and oven light touch pads.
Touch the SELF CLEAN pad again. The display will
show LOC.
Fahrenheit or Centigrade Temperature Selection
Your oven control is set to use the Fahrenheit
temperature selections but you may change this to use
the Centigrade selections.
3. Touch the BROIL HI/LO and COOKING TIME pads
again at the same time for 2 seconds. The display will
show C &HQWLJUDGH 7RXFKWKHBAKE and BROIL HI/LO pads at the same
time for 2 seconds until the display shows SF.
4. Touch the START pad.
2. Touch the BROIL HI/LO and COOKING TIME pads
at the same time for 2 seconds. The display will show
F )DKUHQKHLW Changing the Speed of the +/– Pads
As you use the +/– pads when setting a time or
temperature, you may notice the display changes slowly.
This special feature allows you to change the speed.
To set the speed you prefer, follow the steps below:
7RXFKWKHBAKE and BROIL HI/LO pads at the same
time for 2 seconds until the display shows SF.
USING THE OVEN: Special Features
Special Features
3. Touch the + pad to increase the speed up to the
number 5.
Touch the – pad to decrease the speed down to the
QXPEHU
4. Touch the START pad to activate the setting and
leave the control set in this special features mode.
2. Touch the + pad. The display will show you a set
VSHHGEHWZHHQDQG
49-80713 Rev. 2
9
USING THE OVEN: Sabbath Feature
Sabbath Feature
(Designed for use on the Jewish Sabbath and Holidays.) (on some models)
The Sabbath feature can be used for baking/roasting only. It cannot be used for broiling, self-cleaning, or Delay Start
cooking.
NOTE:7KHRYHQOLJKWFRPHVRQDXWRPDWLFDOO\ RQVRPHPRGHOV ZKHQWKHGRRULVRSHQHGDQGJRHVRIIZKHQWKH
GRRULVFORVHG7KHEXOEPD\EHUHPRYHG6HHWKH2YHQ/LJKW%XOEVHFWLRQ2QPRGHOVZLWKDOLJKWVZLWFKRQWKH
control panel, the oven light may be turned on and left on.
How to Set Sabbath Feature for Regular Baking/Roasting
NOTE: To understand how the oven control works,
SUDFWLFHXVLQJUHJXODUEDNLQJ QRQ6DEEDWK EHIRUH
entering Sabbath mode.
Make sure the clock shows the correct time of day.
7RXFKDQGKROGERWKWKHBAKE and BROIL HI/LO
pads, at the same time, until the display shows SF.
NOTE: If bake or broil appears in the display, the BAKE
and BROIL HI/LO pads were not touched at the same
time. Touch the CLEAR/OFF pad and begin again.
2. Tap the DELAY START pad until SAb bAtH appears
in the display.
3. Touch the START pad and Š will appear in the
display.
4. Touch the BAKE pad. No signal will be given.
5 The preset starting temperature will automatically
EHVHWWRƒ7DSWKHRU±SDGWRLQFUHDVHRU
GHFUHDVHWKHWHPSHUDWXUHLQƒLQFUHPHQWV7KH
WHPSHUDWXUHFDQEHVHWEHWZHHQƒDQGƒ1R
signal or temperature will be given.
6. Touch the START pad.
$IWHUDUDQGRPGHOD\SHULRGRIDSSUR[LPDWHO\
VHFRQGVWRPLQXWHŠ will appear in the display
indicating that the oven is baking/roasting. If Š
does not appear in the display, start again at step 4.
To adjust the oven temperature, touch the BAKE pad
and tap the + or – pad to increase or decrease the
WHPSHUDWXUHLQƒLQFUHPHQWV7RXFKWKHSTART pad.
NOTE: The CLEAR/OFF and COOKING TIME pads are
active during the Sabbath feature.
How to Set Sabbath Feature for Timed Baking/Roasting Immediate Start and Automatic Stop
NOTE: To understand how the oven control works,
SUDFWLFHXVLQJUHJXODU QRQ6DEEDWK ,PPHGLDWH6WDUW
and Automatic Stop before entering the Sabbath mode.
Make sure the clock shows the correct time of day.
7RXFKDQGKROGERWKWKHBAKE and BROIL HI/LO
pads, at the same time, until the display shows SF.
NOTE: If bake or broil appears in the display, the
BAKE and BROIL HI/LO pads were not touched
at the same time. Touch the CLEAR/OFF pad and
begin again.
2. Tap the DELAY START pad until SAb bAtH appears
in the display.
3. Touch the START pad and Š will appear in the display.
4. Touch the COOKING TIME pad.
5. Touch the + or – pad to set the desired length of cooking
WLPHEHWZHHQPLQXWHDQGKRXUVDQGPLQXWHV7KH
cooking time that you entered will be displayed.
6. Touch the START pad.
7. Touch the BAKE pad. No signal will be given.
8. The preset starting temperature will automatically
EHVHWWRƒ7DSWKHRU – pad to increase or
GHFUHDVHWKHWHPSHUDWXUHLQƒLQFUHPHQWV7KH
WHPSHUDWXUHFDQEHVHWEHWZHHQƒDQGƒ1R
signal or temperature will be given.
9 Touch the START pad.
$IWHUDUDQGRPGHOD\SHULRGRIDSSUR[LPDWHO\
VHFRQGVWRPLQXWHŠ will appear in the display
indicating that the oven is baking/roasting. If Š
does not appear in the display, start again at step 7.
To adjust the oven temperature, touch the BAKE pad
and tap the + or – pad to increase or decrease the
WHPSHUDWXUHLQƒLQFUHPHQWV7RXFKWKHSTART pad.
When cooking is finished, the display will change from
Š to ŠDQGZLOODSSHDULQGLFDWLQJWKDWWKHRYHQ
has turned OFF but is still set in Sabbath. Remove the
cooked food.
How to Exit the Sabbath Feature
7RXFKWKHCLEAR/OFF pad.
2. If the oven is cooking, wait for a random delay period
RIDSSUR[LPDWHO\VHFRQGVWRPLQXWHXQWLORQO\Š
is in the display.
3. Touch and hold both the BAKE and BROIL HI/LO
pads, at the same time, until the display shows SF.
4. Tap the DELAY START pad until 12 shdn or no shdn
appears in the display. 12 shdn indicates that the
RYHQZLOODXWRPDWLFDOO\WXUQRIIDIWHUKRXUV no shdn
indicates that the oven will not automatically turn off.
5. Touch the START pad.
NOTE: If a power outage occurred while the oven was
in Sabbath mode, the oven will automatically turn off and
the oven control must be reset.
49-80713 Rev. 2
Automatic Ignition
The oven burner is lit by electric ignition.
To light the burner, do the following:
7RXFKWKHSDGIRUWKHGHVLUHGIXQFWLRQ
After the oven reaches the selected temperature, the
oven burner cycles off completely, then on with a full
flame to keep the oven temperature controlled.
2. Touch the + or – pad until the desired temperature
LVGLVSOD\HG7KHEXUQHUVKRXOGLJQLWHZLWKLQ
seconds.
Oven Vent
When the oven is on, heated air moves through a vent
behind the grille.
The vent area could get hot during oven use.
The vent is needed for proper air flow in the oven and
good baking results. Do not block this vent. Doing so
may cause oven failure or fire.
Power Outage
The oven burner will not light in the event of an
electrical power outage.
Oven Light
Touch the OVEN LIGHT pad to turn the light on or off.
49-80713 Rev. 2
CAUTION Do not attempt to light it manually with
a match.
USING THE OVEN:$XWR,JQLWLRQ2YHQ9HQW3RZHU2XWDJH2YHQ/LJKW
USING THE OVEN
USING THE OVEN: Oven Racks
Oven Racks (Cont.)
The racks are designed with stop-locks so that, when
placed correctly on the rack supports, they will stop
before coming completely out of the oven and will not tilt
when you are removing food from them or placing food
on them.
%XPS
When placing cookware on a rack, pull the rack out to
WKHEXPSRQWKHUDFNVXSSRUW3ODFHWKHFRRNZDUHRQ
the rack; then slide the rack back into the oven. This will
eliminate reaching into the hot oven.
To remove a rack from the oven, pull the rack toward
you, tilt the front end upward and pull the rack out.
To replace, place the rack on the rack support with the
VWRSORFNV FXUYHGH[WHQVLRQRIWKHUDFN IDFLQJXSDQG
toward the rear of the oven. Tilt up the front and push
the rack toward the back of the oven until it goes past
the bump on the rack support. Then lower the front of
the rack and push it all the way back.
Rack Positions
The oven has 4 rack supports, identified in this
LOOXVWUDWLRQDV$ ERWWRP %&DQG' WRS 5DFNSRVLWLRQVIRUFRRNLQJDUHVXJJHVWHGLQWKH%DNLQJ
5RDVWLQJDQG%URLOLQJVHFWLRQV
49-80713 Rev. 2
Your oven temperature is controlled very accurately using an oven control system. It is recommended that you
operate the oven for a number of weeks using the time given on recipes as a guide to become familiar with your new
oven’s performance.
If you think an adjustment is necessary, see the Adjust the Oven Thermostat section. It lists easy Do It Yourself
instructions on how to adjust the thermostat.
How to Set Your Oven for Baking/
Roasting
To avoid possible burns, place the racks in the correct
position before you turn the oven on.
7RXFKWKHBAKE pad.
2. Touch the + or – pad to set the oven temperature.
3. Touch the START pad.
When the oven starts to heat, the changing
WHPSHUDWXUHZLOOEHLQWKHGLVSOD\ 7KHGLVSOD\VWDUWV
FKDQJLQJRQFHWKHWHPSHUDWXUHUHDFKHVƒ)
7RFKDQJHWKHRYHQWHPSHUDWXUHGXULQJWKH%DNHF\FOH
touch the BAKE pad and set the new temperature.
4. Touch the CLEAR/OFF pad when the baking is
finished.
NOTE: A cooling fan may automatically turn on and off
to cool internal parts. This is normal, and the fan may
continue to run even after the oven is turned off.
Oven Racks
Arrange the oven rack or racks in the desired locations
while the oven is cool. The correct rack position
depends on the kind of food and the browning desired.
As a general rule, place most foods in the middle of the
RYHQRQHLWKHUUDFNSRVLWLRQ%RU&6HHWKHFKDUWIRU
suggested rack positions.
Type of Food
Rack Position
Angel food cake
A
)UR]HQSLHV RQFRRNLHVKHHW
A
%XQGWRUSRXQGFDNHV
$RU%
Roasting
$RU%
%LVFXLWVPXIILQVEURZQLHV
cookies, cupcakes, layer cakes,
pies, pie shells
%RU&
Casseroles
%RU&
Preheating
3UHKHDWWKHRYHQLIWKHUHFLSHFDOOVIRULW3UHKHDWPHDQV
bringing the oven up to the specified temperature before
putting the food in the oven. To preheat, set the oven at
WKHFRUUHFWWHPSHUDWXUH²VHOHFWLQJDKLJKHUWHPSHUDWXUH
does not shorten preheat time.
3UHKHDWLQJLVQHFHVVDU\IRUJRRGUHVXOWVZKHQEDNLQJ
cakes, cookies, pastry and breads. For most casseroles
and roasts, preheating is not necessary. For ovens
ZLWKRXWDSUHKHDWLQGLFDWRUOLJKWRUWRQHSUHKHDW
minutes. After the oven is preheated, place the food in
the oven as quickly as possible to prevent heat from
escaping.
Aluminum Foil and Oven Liners
CAUTION Do not use any type of foil or oven
liner to cover the oven bottom. These items can trap
heat or melt, resulting in damage to the product and
risk of shock, smoke or fire. Damage from improper
use of these items is not covered by the product
warranty.
USING THE OVEN:%DNLQJ)HDWXUH
Baking Feature
Foil may be used to catch spills by placing a sheet on
a lower rack, several inches below the food. Do not use
more foil than necessary and never entirely cover an
RYHQUDFNZLWKDOXPLQXPIRLO.HHSIRLODWOHDVW´
from oven walls to prevent poor heat circulation.
Baking Pans
8VHWKHSURSHUEDNLQJSDQ7KHW\SHRIILQLVKRQWKH
pan determines the amount of browning that will occur.
Ŷ'DUNURXJKRUGXOOSDQVDEVRUEKHDWUHVXOWLQJLQD
EURZQHUFULVSHUFUXVW8VHWKLVW\SHIRUSLHV
Ŷ6KLQ\EULJKWDQGVPRRWKSDQVUHIOHFWKHDWUHVXOWLQJ
in a lighter, more delicate browning. Cakes and
cookies require this type of pan.
Ŷ*ODVVEDNLQJGLVKHVDOVRDEVRUEKHDW:KHQEDNLQJLQ
glass baking dishes, the temperature may need to be
UHGXFHGE\ƒ)
Ŷ,I\RXDUHXVLQJGDUNQRQVWLFNSDQV\RXPD\ILQGWKDW
\RXQHHGWRUHGXFHWKHRYHQWHPSHUDWXUHƒ)WR
prevent overbrowning.
49-80713 Rev. 2
USING THE OVEN:%DNLQJ)HDWXUH
Baking Feature (Cont.)
Pan Placement
Pies
For even cooking and proper browning, there must
EHHQRXJKURRPIRUDLUFLUFXODWLRQLQWKHRYHQ%DNLQJ
results will be better if baking pans are centered as
much as possible rat her than being placed to the front
or to the back of the oven.
For best results, bake pies in dark, rough or dull pans
WRSURGXFHDEURZQHUFULVSHUFUXVW)UR]HQSLHVLQIRLO
pans should be placed on an aluminum cookie sheet for
baking since the shiny foil pan reflects heat away from
the pie crust; the cookie sheet helps retain it.
3DQVVKRXOGQRWWRXFKHDFKRWKHURUWKHZDOOVRIWKH
RYHQ$OORZWR»LQFKVSDFHEHWZHHQSDQVDVZHOO
as from the back of the oven, the door and the sides. If
you need to use two racks, stagger the pans so one is
not directly above the other.
Cakes
Cookies
:KHQEDNLQJFRRNLHVIODWFRRNLHVKHHWV ZLWKRXWVLGHV produce better-looking cookies. Cookies baked in a jelly
UROOSDQ VKRUWVLGHVDOODURXQG PD\KDYHGDUNHUHGJHV
and pale or light browning may occur.
Do not use a cookie
sheet so large that it
touches the walls or
the door of the oven.
Never entirely cover
a rack with a large
cookie sheet.
For best results during
baking, use only one
cookie sheet in the
oven at a time.
When baking cakes, warped or bent pans will cause
uneven baking results and poorly shaped products. A
cake baked in a pan larger than the recipe recommends
will usually be crisper, thinner and drier than it should
be. If baked in a pan smaller than recommended, it
may be undercooked and batter may overflow. Check
WKHUHFLSHWRPDNHVXUHWKHSDQVL]HXVHGLVWKHRQH
recommended.
Peeking
Set the timer for the estimated cooking time and do not
open the door to look at your food. Most recipes provide
minimum and maximum baking times such as “bake
PLQXWHV´
DO NOT open the door to check until the minimum time.
Opening the oven door frequently during cooking allows
heat to escape and makes baking times longer. Your
baking results may also be affected.
49-80713 Rev. 2
Roasting is cooking by dry heat. Tender meat or poultry can be roasted uncovered in your oven. Roasting
temperatures, which should be low and steady, keep spattering to a minimum.
Before You Begin Roasting…
5RDVWLQJLVUHDOO\DEDNLQJSURFHGXUHXVHGIRUPHDWV7KHUHIRUHWKHRYHQFRQWUROVDUHVHWIRU%DNLQJRU7LPHG
%DNLQJ <RXPD\KHDUDVOLJKWFOLFNLQJVRXQGLQGLFDWLQJWKHRYHQLVZRUNLQJSURSHUO\ 7LPHG%DNLQJZLOOWXUQWKH
oven on and off automatically.
0RVWPHDWVFRQWLQXHWRFRRNVOLJKWO\DIWHUEHLQJUHPRYHGIURPWKHRYHQ7KHLQWHUQDOWHPSHUDWXUHZLOOULVHDERXWƒ
WRƒ)GXULQJWKHUHFRPPHQGHGVWDQGLQJWLPHRIWRPLQXWHV7KLVDOORZVURDVWVWRILUPXSDQGPDNHVWKHP
easier to carve.
7RFRPSHQVDWHIRUWKLVULVHLQWHPSHUDWXUH\RXPD\ZDQWWRUHPRYHWKHURDVWVRRQHU DWƒWRƒ)OHVVWKDQWKH
WHPSHUDWXUHLQWKH5RDVWLQJ*XLGH 5(0(0%(5)RRGZLOOFRQWLQXHWRFRRNLQWKHKRWRYHQDQGWKHUHIRUHVKRXOGEHUHPRYHGZKHQWKHGHVLUHGLQWHUQDO
temperature has been reached.
How to Set Your Oven for Roasting
3ODFHWKHUDFNLQ$RU%SRVLWLRQ1RSUHKHDWLQJLV
necessary.
&KHFNWKHZHLJKWRIWKHPHDW3ODFHWKHPHDWIDW
side up, or poultry breast side up, on roasting grid in
a shallow pan. The melting fat will baste the meat.
6HOHFWDSDQDVFORVHWRWKHVL]HRIWKHPHDWDV
SRVVLEOH $EURLOHUSDQZLWKJULGLVDJRRGSDQIRU
WKLV
3. Touch the BAKE pad.
USING THE OVEN: Roasting Feature
Roasting Feature
To change the oven temperature during the roasting
cycle, touch the BAKE pad and set the new
temperature.
4. Touch the + or – pad to set the oven temperature.
5. Touch the START pad.
6. Touch the CLEAR/OFF pad when roasting is finished.
49-80713 Rev. 2
USING THE OVEN:7LPHG%DNLQJ)HDWXUH
Timed Baking Feature
How to Set Your Oven for Time Bake
The oven control allows you to turn the oven on or off
automatically at specific times that you set. Examples
RI,PPHGLDWH6WDUW RYHQWXUQVRQQRZDQG\RXVHWLW
WRWXUQRIIDXWRPDWLFDOO\DWWKHHQGRIFRRNLQJWLPH DQG'HOD\6WDUWDQG6WRS VHWWLQJWKHRYHQWRWXUQRQ
automatically at a later time and turn off after a preset
FRRNLQJWLPH ZLOOEHGHVFULEHG
NOTE: An attention tone will sound if you are using
7LPHG%DNLQJDQGGRQRWWRXFKWKHSTART pad after
entering the baking temperature.
How to Set Immediate Start and
Automatic Stop
CAUTION To avoid possible burns, place the
How to Set Delay Start and Automatic
Stop
CAUTION To avoid possible burns, place the
racks in the correct position before you turn the oven on.
You can set the control to delay the start of cooking,
cook for a specific length of time and then turn off
automatically.
7RXFKWKHBAKE pad.
2. Touch the + or – pad to set the oven temperature.
3. Touch the COOKING TIME pad.
NOTE: If your recipe requires preheating, you may need
to add additional time to the length of the cooking time.
4. Touch the + or – pad to set the baking time.
racks in the correct position before you turn the oven on.
5. Touch the DELAY START pad.
The oven will turn on immediately and cook for a
selected length of time. At the end of cooking time, the
oven will turn off automatically.
6. Touch the + or – pad to set the time of day you want
the oven to turn on and start cooking.
7RXFKWKHBAKE pad.
2. Touch the + or – pad to set the oven temperature.
3. Touch the COOKING TIME pad.
NOTE: If your recipe requires preheating, you may need
to add additional time to the length of the cooking time.
4. Touch the + or – pad to set the baking time.
The oven temperature and the cooking time that
you entered will be displayed.
5. Touch the START pad. The display shows the
oven temperature that you set and the cooking time
FRXQWGRZQ 7KHGLVSOD\VWDUWVFKDQJLQJRQFHWKHWKH
WHPSHUDWXUHUHDFKHVƒ)
The oven will continue to cook for the programmed
amount of time, then shut off automatically.
6. Touch the CLEAR/OFF pad to clear the end of cycle
tone if necessary.
NOTES:
Ŷ7KHORZWHPSHUDWXUH]RQHRIWKLVRYHQ EHWZHHQ
ƒ)DQGƒ) LVDYDLODEOHWRNHHSKRWFRRNHG
foods warm. Food kept in the oven longer than two
hours at these low temperatures may spoil.
7. Touch the START pad.
If you would like to check the times you have set,
touch the DELAY START pad to check the start time
you have set or touch the COOKING TIME pad to
check the length of cooking time you have set.
When the oven turns on at the time of day you have
set, the display will show the changing temperature
VWDUWLQJDWƒ) DQGWKHFRRNLQJWLPHFRXQWGRZQ
At the end of cooking time the oven will turn off and
the end of cycle tone will sound.
8. Touch the CLEAR/OFF pad to clear the end of cycle
tone if necessary.
NOTES:
Ŷ7KHORZWHPSHUDWXUH]RQHRIWKLVRYHQ EHWZHHQƒ)
DQGƒ) LVDYDLODEOHWRNHHSKRWFRRNHGIRRGV
warm. Food kept in the oven longer than two hours at
these low temperatures may spoil.
Ŷ)RRGVWKDWVSRLOHDVLO\VXFKDVPLONHJJV
fish, stuffings, poultry and pork, should not be allowed
to sit for more than one hour before or after cooking.
Room temperature promotes the growth of harmful
EDFWHULD%HVXUHWKHRYHQOLJKWLVRIIEHFDXVHKHDW
from the bulb will speed harmful bacteria growth.
Ŷ)RRGVWKDWVSRLOHDVLO\VXFKDVPLONHJJVILVK
stuffings, poultry and pork, should not be allowed to sit
for more than one hour before or after cooking. Room
temperature promotes the growth of harmful bacteria.
%HVXUHWKHRYHQOLJKWLVRIIEHFDXVHKHDWIURPWKH
bulb will speed harmful bacteria growth.
49-80713 Rev. 2
Adjust the oven thermostat—Do it yourself!
You may find that your new oven cooks differently
WKDQWKHRQHLWUHSODFHG8VH\RXUQHZRYHQIRUDIHZ
weeks to become more familiar with it. If you still think
your new oven is too hot or too cold, you can adjust the
thermostat yourself.
Do not use thermometers, such as those found in
grocery stores, to check the temperature setting of your
RYHQ7KHVHWKHUPRPHWHUVPD\YDU\±GHJUHHV
NOTE: This adjustment will not affect the broiling or
self-cleaning temperatures. The adjustment will be
retained in memory after a power failure.
To Adjust the Thermostat
7RXFKWKHBAKE and BROIL HI/LO pads at the same
time for 2 seconds until the display shows SF.
2. Touch the BAKE pad. A two-digit number shows in
the display.
3. The oven temperature can be adjusted up as much
DVƒ)RUGRZQDVPXFKDVƒ)7RXFKWKH + pad
WRLQFUHDVHWKHWHPSHUDWXUHLQGHJUHHLQFUHPHQWV
Touch the – pad to decrease the temperature in
GHJUHHLQFUHPHQWV
4. When you have made the adjustment, touch the
START pad to go back to the time of day display.
8VH\RXURYHQDV\RXZRXOGQRUPDOO\
The type of margarine will affect baking performance!
Most recipes for baking have been developed using
KLJKIDWSURGXFWVVXFKDVEXWWHURUPDUJDULQH IDW ,I\RXGHFUHDVHWKHIDWWKHUHFLSHPD\QRWJLYHWKH
same results as with a higher fat product.
Recipe failure can result if cakes, pies, pastries, cookies
or candies are made with low-fat spreads. The lower
the fat content of a spread product, the more noticeable
these differences become.
49-80713 Rev. 2
Federal standards require products labeled “margarine”
WRFRQWDLQDWOHDVWIDWE\ZHLJKW/RZIDWVSUHDGV
on the other hand, contain less fat and more water.
The high moisture content of these spreads affects the
texture and flavor of baked goods. For best results with
your old favorite recipes, use margarine, butter or stick
VSUHDGVFRQWDLQLQJDWOHDVWYHJHWDEOHRLO
USING THE OVEN: Thermostat / Margarine
Using the Oven
USING THE OVEN:%URLOLQJ)HDWXUH
Broiling Feature
%URLOLQJLVFRRNLQJIRRGE\GLUHFWKHDWIURPDERYHWKHIRRG0RVWILVKDQGWHQGHUFXWVRIPHDWFDQEHEURLOHG
Follow these directions to keep spattering and smoking to a minimum.
Before You Begin Broiling…
If the meat has fat or gristle around the edge, cut
YHUWLFDOVODVKHVWKURXJKLWDERXWƎDSDUW,IGHVLUHGWKH
IDWPD\EHWULPPHGOHDYLQJDOD\HUDERXWƎWKLFN
Turn the food using tongs only once during broiling.
7LPHWKHIRRGVIRUWKHILUVWVLGHDFFRUGLQJWRWKH%URLOLQJ
Guide.
3ODFHWKHPHDWRQDQ\EURLOHUJULGLQDEURLOHUSDQ
Always use the grid so the fat drips into a broiler pan;
otherwise the juices may become hot enough to catch
on fire.
Turn the food, then use the times given for the second
side as a guide to the preferred doneness.
3RVLWLRQDQ\EURLOHUSDQRQDUDFNRQWKHUHFRPPHQGHG
UDFNSRVLWLRQDVVXJJHVWHGLQWKH%URLOLQJ*XLGH3ODFH
the sump area of a broiler pan to the front of the door.
NOTE: Always broil with the oven door closed.
To test if your broiler is working properly: Cover an
HQWLUHEURLOHUSDQJULGZLWKEUHDG3ODFHDQ\EURLOHUSDQ
RQWKHWKLUGUDFNIURPWKHERWWRP%URLOXQWLOWKHEUHDG
is golden brown. If you have browning on both sides of
the pan, your broiler is working properly. If toast browns
only on one side of the pan, call for service.
How to Set Your Oven for Broiling
7RXFKWKH%52,/+,/2SDG
3. Touch the START pad.
7RXFKWKH%52,/+,/2SDGDJDLQ DOWHUQDWHV
EHWZHHQ/2%URLODQG+,%URLO 4. Touch the CLEAR/OFF pad when broiling is finished.
Questions and Answers
Q. Are there blue flames on both sides of the broil
burner?
A. Yes, but the bright orange glow of the burner igniter
may make the flame difficult to see. If you cannot see
the flame on both sides and feel your broil burner is
not functioning properly, try the “toast test.”
Q. When broiling, is it necessary to always use a grid in
the pan?
$<HV8VLQJWKHJULGVXVSHQGVWKHPHDWRYHUWKHSDQ
As the meat cooks, the juices fall into the pan, thus
keeping meat drier. Juices are protected by the grid
and stay cooler, thus preventing excessive spatter
and smoking.
Q. Should I salt the meat before broiling?
A. No. Salt draws out the juices and allows them to
HYDSRUDWH$OZD\VVDOWDIWHUFRRNLQJ3LHUFLQJWKH
meat with a fork allows juices to escape. Turn the
meat with tongs instead of a fork.
Using the Broiling Feature
Ŷ)RUEHVWUHVXOWVXVHDSDQGHVLJQHGIRUEURLOLQJ,W
LVGHVLJQHGWRPLQLPL]HVPRNLQJDQGVSDWWHULQJE\
trapping the juices in the shielded lower part of the
pan.
NOTE: Always broil with the oven door closed.
Ŷ)RUVWHDNVDQGFKRSVVODVKIDWHYHQO\DURXQGWKH
outside edges of the meat. To slash, cut crosswise
through the outer fat surface just to the edge of the
PHDW8VHWRQJVWRWXUQWKHPHDWRYHUWRSUHYHQW
piercing the meat and losing juices.
Ŷ,IGHVLUHGPDULQDWHPHDWVRUFKLFNHQEHIRUHEURLOLQJ
2UEUXVKZLWKEDUEHFXHVDXFHODVWWRPLQXWHV
only.
Ŷ:KHQDUUDQJLQJWKHIRRGRQWKHSDQGRQRWOHWIDWW\
edges hang over the sides because the dripping fat
will soil the oven bottom.
Ŷ7KHEURLOHUGRHVQRWQHHGWREHSUHKHDWHG+RZHYHU
for very thin foods, or to increase browning, preheat if
desired.
Ŷ8VH/2%URLOWRFRRNIRRGVVXFKDVSRXOWU\RUWKLFN
pork chops evenly without over-browning them.
Ŷ)UR]HQVWHDNVFDQEHEURLOHGE\SRVLWLRQLQJWKHUDFN
at next lowest rack position and increasing cooking
WLPHJLYHQLQWKLVJXLGHWLPHVSHUVLGH
49-80713 Rev. 2
Broiling Guide
7KHVL]HZHLJKWWKLFNQHVVVWDUWLQJWHPSHUDWXUHDQG\RXUSUHIHUHQFHRIGRQHQHVVZLOODIIHFWEURLOLQJWLPHV7KLV
guide is based on meats at refrigerator temperature.
‚7KH86'HSDUWPHQWRI$JULFXOWXUHVD\V³5DUHEHHILVSRSXODUEXW\RXVKRXOGNQRZWKDWFRRNLQJLWWRRQO\ƒ)
PHDQVVRPHIRRGSRLVRQLQJRUJDQLVPVPD\VXUYLYH´ 6RXUFH6DIH)RRG%RRN<RXU.LWFKHQ*XLGH86'$5HY
-XQH
Food
Quantity and/
or Thickness
Rack
Position
First Side
Time (min.)
Second Side
Time (min.)
Comments
Well Done
OE SDWWLHV
C
±
8–9
Well Done
WRƎWKLFN
6SDFHHYHQO\8SWR
patties take about the
same time.
6WHDNVOHVVWKDQƎWKLFN
cook through before
EURZQLQJ3DQIU\LQJLV
recommended. Slash fat.
Ground Beef
Beef Steaks
Rare†
Medium
ƎWKLFN
WR»2OEV
Well Done
Rare
†
Medium
%
8
5
%
±
5–6
%
8–9
%
6–7
%
±
%
25
±
%RQHOHVV
A
±
±
%RQH,Q
A
±
±
± WRR]
HDFK
$RU%
±
Do not turn
over.
Cut through back of shell,
VSUHDGRSHQ%UXVKZLWK
melted butter before
broiling and after half of
broiling time.
WRƎWKLFN %
OE
7–8
5
ƎWKLFN
%
±
Skin side
down
Do Not Turn
Handle and turn very
FDUHIXOO\%UXVKZLWK
lemon butter before and
during cooking, if desired.
3UHKHDWEURLOHUWRLQFUHDVH
browning.
ƎWKLFN
%
±
4–5
Slash fat.
ƎWKLFN DERXWOE
%
±
6–8
ƎWKLFN %
8
4–7
»2ƎWKLFN DERXWOE
%
4–6
» ƎWKLFN
2
WR»2OEV
Well Done
Chicken Breasts
USING THE OVEN: %URLOLQJ)HDWXUH
Broiling Feature
Reduce times about 5 to
PLQXWHVSHUVLGHIRU
FXWXSFKLFNHQ%UXVK
each side with melted
EXWWHU%URLOZLWKVNLQVLGH
down first.
Lobster Tails
Fish Fillets
Salmon Fillets
Pork Chops
Well Done
Lamb Chops
Medium
Slash fat.
Well Done
Medium
Well Done
49-80713 Rev. 2
CARE AND CLEANING: Self-Cleaning
Self-Cleaning
The oven door must be closed and all controls set correctly for the cycle to work properly.
Before a Clean Cycle
For the first self-clean cycle, we recommend venting your
kitchen with an open window or using a ventilation fan or
hood.
Wipe up any heavy spillovers on the oven bottom.
Remove racks, any broiler pan, broiler grid, all cookware
and any aluminum foil from the oven.
7KHVKLQ\VLOYHUFRORUHGRYHQUDFNV RQVRPHPRGHOV can be self-cleaned, but they will darken, lose their luster
and become hard to slide.
Soil on the front frame of the oven and outside the gasket
on the door will need to be cleaned by hand. Clean
these areas with hot water, soap-filled scrubbing pads
or cleansers such as Soft Scrub®. Rinse well with clean
water and dry.
Do not clean the gasket. The fiberglass material of
the oven door gasket cannot withstand abrasion. It is
essential for the gasket to remain intact. If you notice it
becoming worn or frayed, replace it.
Wipe up heavy soil on the oven
bottom.
Make sure the oven light bulb cover is in place and the
oven light is off.
IMPORTANT: The health of some birds is extremely
sensitive to the fumes given off during the self-cleaning
cycle of any oven. Move birds to another well-ventilated
room.
How to Set the Oven for Cleaning
7RXFKWKHSELF CLEAN pad.
When the LOCKED DOOR light is off, open the door.
2. Touch the + or – pad to enter the desired clean time,
if a time other than 4 hours is needed.
The oven shuts off automatically when the clean cycle is
complete.
Clean cycle time is normally 4 hours. You can change
the clean time to any time between 3 hours and 5 hours,
depending on how dirty your oven is.
3. Touch the START pad.
NOTES:
Ŷ7KHZRUGVLOCK DOOR will flash and the oven
control will signal if you set the clean cycle and forget
to close the oven door.
The door locks automatically. The display will show the
clean time remaining. It will not be possible to open the
oven door until the temperature drops below the lock
temperature and the LOCKED DOOR light goes off.
Ŷ7RVWRSDFOHDQF\FOHWRXFKWKHCLEAR OFF pad.
When the LOCKED DOOR light goes off indicating the
oven has cooled below the locking temperature, open
the door.
How to Delay the Start of Cleaning
Delay Start is setting the oven to start the clean cycle
automatically at a later time than the present time of day.
NOTE: %HIRUHEHJLQQLQJPDNHVXUHWKHRYHQFORFN
shows the correct time of day.
The door locks automatically. The display will show the
start time. It will not be possible to open the oven door
until the temperature drops below the lock temperature
and the LOCKED DOOR light goes off.
7RXFKWKHSELF CLEAN pad.
When the LOCKED DOOR light is off, open the door.
2. Touch the + or – pad to enter the desired clean time.
NOTE:
Ŷ<RXFDQILQGRXWZKHQWKHFOHDQF\FOHZLOOVWDUWE\
touching the DELAY START pad.
3. Touch the DELAY START pad. The earliest start time
you can set will appear in the display.
4. Touch the + or – pad to enter the time of day you
want the clean cycle to start.
5. Touch the START pad.
49-80713 Rev. 2
After a Clean Cycle
You may notice some white ash in the oven. Wipe it up
with a damp cloth after the oven cools.
If white spots remain, remove them with a soap-filled
scouring pad and rinse thoroughly with a vinegar and
water mixture.
These deposits are usually a salt residue that cannot be
removed by the clean cycle.
If the oven is not clean after one clean cycle, repeat the
cycle.
NOTES:
Ŷ<RXFDQQRWVHWWKHRYHQIRUFRRNLQJXQWLOWKHRYHQLV
cool enough for the door to unlock.
Ŷ:KLOHWKHRYHQLVVHOIFOHDQLQJ\RXFDQWRXFKWKH
CLOCK pad to display the time of day. To return to the
clean countdown, touch the COOKING TIME pad.
Ŷ,I\RXKDYHOHIWWKHUDFNVLQWKHRYHQGXULQJWKH
self-clean cycle and they become hard to slide, apply
a small amount of vegetable oil to a paper towel and
wipe the edges of the oven racks with the paper towel.
NOTE:8VLQJRWKHUFRRNLQJRLOVZLOOFDXVHD
discoloring or a rust like color residue on the racks and
cavity sides. To clean this residue, use a soap and
water or a vinegar and water solution. Rinse with clean
water and dry with a soft cloth.
Care and Cleaning
%HVXUHHOHFWULFDOSRZHULVRIIDQGDOOVXUIDFHVDUHFRROEHIRUHFOHDQLQJDQ\SDUWRIWKHRYHQ
How to Remove Protective Shipping Film and Packaging Tape
Carefully grasp a corner of the protective shipping film
with your fingers and slowly peel it from the appliance
surface. Do not use any sharp items to remove the film.
Remove all of the film before using the appliance for the
first time.
To assure no damage is done to the finish of the
product, the safest way to remove the adhesive from
packaging tape on new appliances is an application of
a household liquid dishwashing detergent. Apply with a
soft cloth and allow to soak.
NOTE: The adhesive must be removed from all parts. It
cannot be removed if it is baked on.
Removable Storage Drawer
The storage drawer is a good place to store cookware
and bakeware. Do not store plastics and flammable
material in the drawer.
Do not overload the storage drawer. If the drawer is too
heavy, it may slip off the track when opened. To open
the drawer, grasp the center of the handle and pull
straight out.
Most cleaning can be done with the drawer in place.
However, the drawer may be removed if further cleaning
LVQHHGHG8VHVRDSDQGZDUPZDWHUWRWKRURXJKO\
clean.
To remove:
3XOOWKHGUDZHUVWUDLJKWRXWDQGOLIWRYHUWKHJXLGHVWRSV
To replace:
Lift over the guide stops and slide the drawer into place.
To clean both the inside and the outside:
CARE AND CLEANING: Self-Cleaning / General Cleaning
Self-Cleaning
Wipe with soap and water. Rinse well.
Do not use cleansing powders or harsh abrasives which
may scratch the surface.
Oven Air Vents
1HYHUEORFNWKHYHQWV DLURSHQLQJV RIWKHRYHQ7KH\
provide the air inlet and outlet that are necessary for the
oven to operate properly with correct combustion.
Air openings are located under the control panel, above
the door.
49-80713 Rev. 2
CARE AND CLEANING
Care and Cleaning
Oven Light Replacement
The oven light bulb is covered with a removable glass
cover that is held in place with a bail-shaped wire.
Remove the oven door, if desired, to reach the cover
easily.
To remove:
+ROGDKDQGXQGHUWKHFRYHUVRLWGRHVQ¶WIDOOZKHQ
released. With fingers of the same hand, firmly push
back the wire cover holder. Lift off the cover.
Do not remove any screws to remove the cover.
2. Do not touch hot bulb with a wet cloth. Replace bulb
ZLWKDZDWWKRXVHKROGDSSOLDQFHEXOE
Wire cover holder
To replace cover:
3ODFHLWLQWRWKHJURRYHRIWKHOLJKWUHFHSWDFOH3XOOWKH
wire forward to the center of the cover until it snaps into
place. When in place, the wire holds the cover firmly.
%HFHUWDLQWKHZLUHLVLQWKHGHSUHVVLRQLQWKHFHQWHURI
the cover.
2. Connect electrical power to the oven.
Removable Oven Bottom
The oven bottom can be removed to clean large spills,
and to enable you to reach the oven burner. Oven bottom
must be replaced before using the self-clean cycle.
8QORFN
Lock
To remove:
6OLGHWKHWDEDWWKHFHQWHUIURQWRIWKHRYHQERWWRPWR
the left.
2. Lift the oven bottom up and out.
To replace:
6OLSWKHRYHQERWWRPLQWRWKHRYHQVRWKHWDEVLQWKH
rear of the oven bottom fit into the slots in the oven
back.
The oven bottom has a porcelain enamel finish. To make
cleaning easier, protect the oven bottom from excessive
spillovers by placing a cookie sheet on the rack below
the rack you are cooking on. This is particularly important
when baking a fruit pie or other foods with a high acid
content. Hot fruit fillings or other foods that are highly
DFLGLF VXFKDVWRPDWRHVVDXHUNUDXWDQGVDXFHVZLWK
YLQHJDURUOHPRQMXLFH PD\FDXVHSLWWLQJDQGGDPDJH
to the porcelain enamel surface and should be wiped up
immediately.
We don’t recommend using aluminum foil on the oven
bottom. It can affect air flow if the holes are blocked and it
can concentrate heat at the bottom of the oven, resulting
in poor baking performance.
To clean up spillovers, use soap and water, an abrasive
cleaner or soap-filled scouring pad. Rinse well to remove
any soap before self-cleaning.
2. Lower the front of the oven bottom into place and slide
the front tab to the right to lock the oven bottom into
place.
Oven Racks
22
Clean the oven racks with an abrasive cleanser or steel
wool. After cleaning, rinse the racks with clean water and
dry with a clean cloth.
To make the racks slide more easily, apply a small
amount of vegetable oil to a paper towel and wipe the
edges of the oven racks with the paper towel.
NOTE: 7KHVKLQ\VLOYHUFRORUHGRYHQUDFNV RQVRPH
PRGHOV PD\EHFOHDQHGLQWKHVHOIFOHDQLQJRYHQ
However, the racks will darken in color, lose their luster
and become hard to slide if cleaned during the selfcleaning cycle.
NOTE:8VLQJRWKHUFRRNLQJRLOVZLOOFDXVHDGLVFRORULQJ
or a rust like color residue on the racks and cavity sides.
To clean this residue, use a soap and water or a vinegar
and water solution. Rinse with clean water and dry with a
soft cloth.
49-80713 Rev. 2
Control Panel
It’s a good idea to wipe the control panel after each use
of the oven. Clean with mild soap and water or vinegar
and water, rinse with clean water and polish dry with a
soft cloth.
Do not use abrasive cleansers, strong liquid cleaners,
plastic scouring pads or oven cleaners on the control
SDQHO²WKH\ZLOOGDPDJHWKHILQLVK$VROXWLRQRI
vinegar and hot water works well.
Lift-Off Oven Door
The oven door is
removable, but it is heavy.
You may need help
removing and replacing the
door. Do not lift the door by
the handle. This can cause
the glass to break or can
cause damage to the door.
To remove the door, open
it a few inches to the
special stop position that
will hold the door open.
Lift the door straight up and off
Grasp firmly on each side
the hinges.
and lift the door straight up
and off the hinges.
NOTES:
Ŷ%HFDUHIXOQRWWRSODFHKDQGVEHWZHHQWKHKLQJHDQG
the oven door frame as the hinge could snap back and
pinch fingers.
Ŷ:KLOHZRUNLQJLQWKHRYHQDUHDFRYHUWKHKLQJHVZLWK
towels or empty paper towel rolls to prevent pinched
fingers and chipping the porcelain enamel on the frame.
To replace the door, make sure the hinges are in the
VSHFLDOVWRSSRVLWLRQ3RVLWLRQWKHVORWVLQWKHERWWRPRI
the door squarely over the hinges. Then lower the door
slowly and evenly over both hinges at the same time. If
the hinges snap back against the oven frame, pull them
back out.
To clean the inside of the door:
Ŷ'RQRWDOORZH[FHVVZDWHUWRUXQLQWRDQ\KROHVRUVORWV
in the door.
Ŷ%HFDXVHWKHDUHDLQVLGHWKHJDVNHWLVFOHDQHGGXULQJ
the self clean cycle, you do not need to clean this by
hand. Any soap left on the liner causes additional stains
when the oven is heated.
Ŷ7KHDUHDRXWVLGHWKHJDVNHWFDQEHFOHDQHGZLWKD
soap-filled plastic scouring pad.
To clean the outside of the door:
Ŷ8VHVRDSDQGZDWHUWRWKRURXJKO\FOHDQWKHWRSVLGHV
and front of the oven door. Rinse well. You may also
use a glass cleaner to clean the glass on the outside of
the door.
Ŷ6SLOODJHRIPDULQDGHVIUXLWMXLFHVWRPDWRVDXFHV
and basting materials containing acids may cause
discoloration and should be wiped up immediately.
When the surface is cool, clean and rinse.
Ŷ'RQRWXVHRYHQFOHDQHUVFOHDQVLQJSRZGHUVRUKDUVK
DEUDVLYHVRQWKHRXWVLGHRIWKHGRRUVROXWLRQRI
vinegar and hot water works well.
CARE AND CLEANING
Care and Cleaning
The gasket is designed with a gap
at the bottom to allow for proper air
circulation.
Do not rub or clean the door
JDVNHW²LWKDVDQH[WUHPHO\ORZ
resistance to abrasion.
If you notice the gasket becoming
worn, frayed or damaged in any way
or if it has become displaced on the
door, you should have it replaced.
Stainless Steel Surfaces
Do not use a steel wool pad; it will scratch the surface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always wipe
the surface in the direction of the grain. Follow the cleaner
instructions for cleaning the stainless steel surface.
49-80713 Rev. 2
To inquire about purchasing stainless steel appliance
cleaner or polish, or to find the location of a dealer nearest
you, please call our toll-free number:
1DWLRQDO3DUWV&HQWHU
GEAppliances.com
23
CARE AND CLEANING
Care and Cleaning
Adjusting Orifice Hoods
Check the inner cones of the flames. The inner cones of
WKHIODPHVVKRXOGEHDERXWƎORQJ,IWKHIODPHVDUHQRW
ULJKWXVHDƎRSHQHQGZUHQFKRUDGMXVWDEOHMRLQWSOLHUV
to adjust the orifice hood.
Nat
/3
WARNING If you attempt to measure the inner cone
RIWKHIODPHSOHDVHXVHFDXWLRQ%XUQVFRXOGUHVXOW
To shorten the cones, tighten the orifice hood by turning
LQWKH³3URSDQH /3 ´GLUHFWLRQ7ROHQJWKHQWKHFRQHV
loosen the orifice hood by turning in the “Nat” direction.
Broil and Oven Burner Air Adjustment Shutters
Air adjustment shutters for the broil and oven burners
regulate the flow of air to the flame.
Loosen
Air
adjustment
shutter
All ovens are factory adjusted for use with the natural gas
XVHGLQPRVWDUHDV%XWVLQFHWKHJDVLQVRPHDUHDVPD\
be different, you should check all adjustments described.
,I\RXDUHXVLQJ3URSDQH /3 JDVDOOWKHDGMXVWPHQWV
must be made.
The air adjustment shutter for the top burner is in the
center of the rear wall of the oven.
The shutter for the bottom burner is near the back wall.
Remove the oven bottom for access.
Turn the burner full on and check the flames. The burner
flames should not flutter or blow away from the burner.
They should be blue in color with no trace of yellow.
Foreign particles in the gas line may cause an orange
flame at first, but this will soon disappear. If the flames are
yellow or flutter, open the air shutter more. If they blow
away from the burner, close the air shutter more. See the
illustration in the Troubleshooting Tips of this guide for
correct flame appearance.
Shutter for top burner
Loosen
Air adjustment
shutter
Shutter for bottom burner
To adjust the flow of air to either burner, loosen the
3KLOOLSVKHDGVFUHZDQGURWDWHWKHVKXWWHUWRDOORZPRUHRU
less air into the burner tube as needed.
7KHIODPHVIRUWKHWRS EURLO EXUQHUVKRXOGEXUQVWHDG\
ZLWKDSSUR[LPDWHO\ƎEOXHFRQHVDQGVKRXOGQRWH[WHQG
out over the edges of the burner baffle.
To determine if the bottom burner flames are proper,
remove the oven bottom and the burner baffle. The flames
VKRXOGKDYHƎWRƎEOXHFRQHVZLWKQR\HOORZWLSSLQJ
When the baffle is back in place, the flames will resettle.
Flames for top burner
Visually check the color of the flames every 6 months. If
WKH\ORRNOLNHLOOXVWUDWLRQ $ LQWKH7URXEOHVKRRWLQJ7LSVLQ
this guide, call for service.
When checking the flames, before and after
adjustments, the oven door should be closed.
Flames for bottom burner
24
49-80713 Rev. 2
6DYHWLPHDQGPRQH\5HYLHZWKHFKDUWVRQWKHIROORZLQJSDJHVILUVWDQG\RXPD\QRWQHHGWRFDOOIRUVHUYLFH
Problem
Possible Cause
What To Do
Oven will not work
Circuit breaker has been tripped or a fuse
has blown.
Reset circuit breaker or replace fuse.
Oven control not properly set.
Set the control according to this manual.
Control signals after
entering cooking time or
start time
You forgot to enter a bake temperature or
cleaning time.
7RXFKWKH%$.(SDGDQGGHVLUHGWHPSHUDWXUHRU
the SELF CLEAN pad and desired clean time.
There is moisture in the
oven
As your oven heats up, the changing
temperature of the air in the oven may
cause water droplets to form on the door
glass.
These droplets are harmless and will evaporate as
the oven continues to heat up.
Food does not bake
properly
Oven controls improperly set.
6HHWKH%DNLQJRU5RDVWLQJVHFWLRQ
Rack position is incorrect.
6HHWKH%DNLQJVHFWLRQ
Oven thermostat needs adjustment.
6HHWKH$GMXVWWKHRYHQWKHUPRVWDW²'RLW\RXUVHOI
section
Clock not set correctly when timed
cooking.
See the Clock and Timer section
Aluminum foil used improperly in the oven.
6HHWKH%DNLQJRU5RDVWLQJVHFWLRQ
Oven bottom not securely seated in
position.
See the Care and cleaning of the oven section
Oven controls improperly set.
0DNHVXUH\RXWRXFKWKH%52,/+,/2SDG
Oven door not closed.
6HHWKH%URLOLQJVHFWLRQ
Improper rack position being used.
6HHWKH%URLOLQJ*XLGH
Food being cooked in a hot pan.
For best results, use a pan designed for broiling.
Make sure it is cool.
Cookware not suited for broiling.
For best results, use a pan designed for broiling.
Aluminum foil used on the broiling pan and
grid has not been fitted properly and slit as
recommended.
See the Care and cleaning section.
Oven temperature too hot
or too cold
Oven temperature needs adjustment.
6HHWKH$GMXVWWKHRYHQWKHUPRVWDW²'RLW\RXUVHOI
section
Clock and timer do not
work
A fuse in your home may be blown or the
circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
Oven controls improperly set.
See the Clock and timer section.
Oven light does not
work
Light bulb is loose or defective.
Tighten or replace the bulb.
The pad operating the oven light is broken.
Call for service.
Oven will not self-clean
The oven temperature is too high to
set a self-clean operation.
Allow the oven to cool to room temperature
and reset the controls.
Food does not broil
properly
The oven door is not fully closed.
Close door.
Oven controls improperly set.
See the Self-cleaning oven section.
“Crackling” or “popping”
sound
This is the sound of the metal heating
and cooling during both the cooking and
cleaning functions.
This is normal.
Excessive smoking
Excessive soil.
Touch the CLEAR/OFF pad. Open the windows
to rid the room of smoke. Wait until the LOCKED
DOOR light goes off. Wipe up the excess soil and
reset the clean cycle.
Oven door will not open
after a clean cycle
Oven too hot.
Allow the oven to cool below locking temperature.
49-80713 Rev. 2
TROUBLESHOOTING TIPS
Troubleshooting tips ... %HIRUH\RXFDOOIRUVHUYLFH
25
TROUBLESHOOTING TIPS
Troubleshooting tips ... %HIRUH\RXFDOOIRUVHUYLFH
Problem
Possible Cause
What To Do
Oven not clean after a
clean cycle
Oven controls improperly set.
See the Self-cleaning oven section.
Oven was heavily soiled.
Clean up heavy spillovers before starting the clean cycle.
Heavily soiled ovens may need to self-clean again or for a
longer period of time.
"LOCK DOOR" flashes
in the display
The self-clean cycle has been selected
but the door is not closed.
Close the oven door.
LOCKED light flashes
in the display
The oven door is locked because the
temperature inside the oven has not
dropped below the locking temperature.
Touch the CLEAR/OFF pad. Allow the oven to cool.
“F— and a number
or letter” flash in the
display
You have a function error code.
3UHVVWKHCLEAR/OFF pad. Allow the oven to cool for
RQHKRXU3XWWKHRYHQEDFNLQWRRSHUDWLRQ
If the function code repeats.
Disconnect all power to the oven for 5 minutes and then
reconnect power. If the function error code continues
repeating, call for service.
Display goes blank
A fuse in your home may be blown or
the circuit breaker tripped.
Replace the fuse or reset the circuit breaker.
The clock is in black-out mode.
See the Special features section.
Display flashes
3RZHUIDLOXUH
Reset the clock.
Unable to get the
display to show “SF”
Oven control pads were not touched
properly.
The BAKE and BROIL HI/LO pads must be touched at
the same time and held for 2 seconds.
Power outage, clock
flashes
3RZHURXWDJHRUVXUJH
Reset the clock. If the oven was in use, you must reset it
by touching the CLEAR/OFF pad, setting the clock and
resetting any cooking function.
“Burning” or “oily”
odor emitting from the
vent
This is normal in a new oven and will
disappear in time.
To speed the process, set a self-clean cycle for a
minimum of 3 hours. See the Self-cleaning oven section.
Strong odor
Improper air/gas ratio in oven.
Adjust the oven burner air shutter.
Insulation around the inside of the
oven.
This is normal in a new oven, and will disappear in time.
Fan noise
A cooling fan may turn on and off
automatically.
This is normal. The fan will run until the function is over or
the door is opened.
Cannot see flames
on both sides of broil
burner
%ULJKWJORZRILJQLWHUPDNHVIODPHV
difficult to see.
6HHWKH%URLOLQJVHFWLRQ
Burners have yellow
or yellow-tipped
flames
Combustion quality of burner
flames needs to be determined
visually.
8VHWKHLOOXVWUDWLRQVEHORZWRGHWHUPLQHLI\RXU
burner flames are normal. If burner flames look like
A, call for service. Normal burner flames should
ORRNOLNH%RU&GHSHQGLQJRQWKHW\SHRIJDV\RX
XVH:LWK3URSDQH /3 JDVVRPH\HOORZWLSSLQJRQ
outer cones is normal.
A–Yellow flames
Call for service
26
%±<HOORZWLSVRQ
outer cones
Normal for
3URSDQH /3 JDV
C–Soft blue flames
Normal for natural
gas
49-80713 Rev. 2
Notes
49-80713 Rev. 2
27
LIMITED WARRANTY
GE Appliances Gas Oven Limited Warranty
GEAppliances.com
$OOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH® technician. To schedule
service online, visit us at GEAppliances.com/serviceRUFDOO*($SSOLDQFHVDW*(&$5(6 3OHDVH
have your serial number and your model number available when calling for service.
Servicing your appliance may require the use of the onboard data port for diagnostics. This gives a GE Appliances factory
service technician the ability to quickly diagnose any issues with your appliance and helps GE Appliances improve its
products by providing GE Appliances with information on your appliance. If you do not want your appliance data to be
sent to GE Appliances, please advise your technician not to submit the data to GE Appliances at the time of service.
For the period of
GE Appliances will replace
One year
From the date
of the original
purchase
Any part of the oven which fails due to a defect in materials or workmanship. During this
limited one-year warranty, GE Appliances will provide, free of charge, all labor and in-home
service to replace the defective part.
What GE Appliances will not cover:
Ŷ Service trips to your home to teach you how to use
the product.
Ŷ ,PSURSHULQVWDOODWLRQGHOLYHU\RUPDLQWHQDQFH
Ŷ )DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHG
modified or used for other than the intended purpose
or used commercially.
Ŷ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW
breakers.
Ŷ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH
floods or acts of God.
Ŷ ,QFLGHQWDORUFRQVHTXHQWLDOGDPDJHFDXVHGE\
possible defects with this appliance.
Ŷ 'DPDJHFDXVHGDIWHUGHOLYHU\
Ŷ 3URGXFWQRWDFFHVVLEOHWRSURYLGHUHTXLUHGVHUYLFH
Ŷ 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU
LED lamps.
EXCLUSION OF IMPLIED WARRANTIES
6WDSOH\RXUUHFHLSWKHUH3URRIRIWKHRULJLQDOSXUFKDVH
date is needed to obtain service under the warranty.
Your sole and exclusive remedy is product repair as provided in this Limited Warranty. Any implied warranties,
including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or
the shortest period allowed by law.
28
This limited warranty is extended to the original purchaser and any succeeding owner for products purchased for
KRPHXVHZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($SSOLDQFHV$XWKRUL]HG6HUYLFHU
LVQRWDYDLODEOH\RXPD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG
GE Appliances Service location for service. In Alaska, the limited warranty excludes the cost of shipping or service
calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This limited warranty
gives you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor: GE Appliances, a Haier company
/RXLVYLOOH.<
Extended Warranties:3XUFKDVHD*($SSOLDQFHVH[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUH
available while your warranty is still in effect. You can purchase it online anytime at
GEAppliances.com/extended-warranty
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*($SSOLDQFHV6HUYLFHZLOOVWLOOEHWKHUHDIWHU\RXUZDUUDQW\H[SLUHV
49-80713 Rev. 2
Looking For Something More?
GE Appliances offers a variety of accessories to
improve your cooking and maintenance experiences!
Refer to the Consumer Support page for phone numbers
and website information.
The following products and more are available:
Accessories
Grates
ACCESSORIES
Accessories
6XUIDFH%XUQHU+HDGVDQG&DSV
.QREV
Oven Racks
Oven Element
6PDOO%URLOHU3DQ ô´[ó´[ò³
/DUJH %URLOHU3DQ ô´[ó´[ò³
;/ %URLOHU3DQ ´[ó´[³
Parts
Oven racks
Oven elements
Light bulbs
Cleaning Supplies
CitruShine™ Stainless Steel Wipes
&HUDPD%U\WH6WDLQOHVV6WHHO$SSOLDQFH&OHDQHU
Graphite Lubricant
7KHODUJHEURLOHUSDQGRHVQRWILWLQ´´UDQJHV
**The XL broiler pan does not fit in 24” wall ovens, 27” drop ins
RU´´UDQJHV
49-80713 Rev. 2
29
CONSUMER SUPPORT
Consumer Support
GE Appliances Website
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day, any day
RIWKH\HDU<RXFDQDOVRVKRSIRUPRUHJUHDW*($SSOLDQFHVSURGXFWVDQGWDNHDGYDQWDJHRIDOORXURQOLQHVXSSRUW
VHUYLFHVGHVLJQHGIRU\RXUFRQYHQLHQFH,QWKH86GEAppliances.com
Register Your Appliance
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQHDW\RXUFRQYHQLHQFH7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRUHQKDQFHG
communication and prompt service under the terms of your warranty, should the need arise. You may also mail in
WKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO,QWKH86GEAppliances.com/register
Schedule Service
Expert GE Appliances repair service is only one step away from your door. Get on-line and schedule your service at
\RXUFRQYHQLHQFHDQ\GD\RIWKH\HDU,QWKH86GEAppliances.com/service
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV
Extended Warranties
3XUFKDVHD*($SSOLDQFHVH[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH\RXU
warranty is still in effect. You can purchase it on-line anytime. GE Appliances Services will still be there after your
ZDUUDQW\H[SLUHV,QWKH86GEAppliances.com/extended-warranty
RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV
Remote Connectivity
)RUDVVLVWDQFHZLWKZLUHOHVVQHWZRUNFRQQHFWLYLW\ IRUPRGHOVZLWKUHPRWHHQDEOH visit our website at GEAppliances.com/connect RUFDOOLQWKH86
Parts and Accessories
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
9,6$0DVWHU&DUGDQG'LVFRYHUFDUGVDUHDFFHSWHG 2UGHURQOLQHWRGD\KRXUVHYHU\GD\
,QWKH86GEApplianceparts.com or by phone at 877.959.8688 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing
generally should be referred to qualified service personnel. Caution must be exercised, since improper
servicing may cause unsafe operation.
Contact Us
If you are not satisfied with the service you receive from GE Appliances, contact us on our Website with all the
details including your phone number, or write to:
,QWKH86*HQHUDO0DQDJHU&XVWRPHU5HODWLRQV_*($SSOLDQFHV$SSOLDQFH3DUN_/RXLVYLOOH.<
GEAppliances.com/contact
3ULQWHGLQWKH8QLWHG6WDWHV
49-80713 Rev. 2
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising