Canon | i-SENSYS LBP852Cx | User manual | Canon i-SENSYS LBP852Cx User manual

Canon i-SENSYS LBP852Cx User manual
LBP852Cx
Uživatelská příručka
USRMA-4085-00 2019-09 cs
Copyright CANON INC. 2019
Obsah
Důležité bezpečnostní pokyny ............................................................................................................ 2
Instalace
................................................................................................................................................................... 3
Napájení
................................................................................................................................................................... 5
Manipulace
............................................................................................................................................................... 6
Údržba a kontrola
..................................................................................................................................................... 9
Spotřební materiál
.................................................................................................................................................. 10
Základní operace .........................................................................................................................................
Hlavní funkce
15
.......................................................................................................................................................... 17
Součásti a jejich funkce
Přední strana
........................................................................................................................................... 18
..................................................................................................................................................... 19
....................................................................................................................................................... 21
Zadní strana
Vnitřní prostor
.................................................................................................................................................... 23
Víceúčelová přihrádka
Zásuvka na papír
Ovládací panel
Displej
......................................................................................................................................... 24
................................................................................................................................................ 25
.................................................................................................................................................... 26
......................................................................................................................................................... 29
Použití ovládacího panelu
Zadávání textu
........................................................................................................................................ 31
................................................................................................................................................... 34
Zapnutí/Vypnutí zařízení
......................................................................................................................................... 36
Rychlé spuštění tiskárny
...................................................................................................................................... 38
...................................................................................................................................................... 40
Vkládání papíru
Vkládání papíru do zásuvky na papír
..................................................................................................................... 42
Vkládání papíru do víceúčelové přihrádky
Vkládání obálek nebo pohlednic
Vkládání předtištěného papíru
Zadání velikosti a typu papíru
.............................................................................................................. 48
........................................................................................................................... 51
............................................................................................................................. 55
............................................................................................................................... 59
Zadání velikosti a typu papíru v zásuvce na papír
.............................................................................................. 60
Zadání velikosti a typu papíru ve víceúčelové přihrádce
Úspora energie
..................................................................................... 63
....................................................................................................................................................... 66
Přepnutí do režimu spánku
.................................................................................................................................. 67
Nastavení času automatického vypnutí
.................................................................................................................. 69
Tisk dokumentu ............................................................................................................................................ 73
Tisk z počítače
......................................................................................................................................................... 74
Zrušení tisku
...................................................................................................................................................... 77
Různé způsoby tisku
................................................................................................................................................ 79
Tisk z paměti USB (Přímý tisk z USB)
...................................................................................................................... 81
Změna výchozích nastavení tisku USB
............................................................................................................. 90
Tisk dokumentu zabezpečeného kódem PIN (zabezpečený tisk)
Použití šifrovaného tisku
................................................................................ 92
................................................................................................................................ 95
I
Tisk dokumentu uloženého v tiskárně (tisk uložené úlohy)
Vymazání dokumentu uloženého v tiskárně
Nastavení názvu a kódu PIN pro box
....................................................................................... 96
................................................................................................... 100
............................................................................................................. 104
................................................................................................................. 106
Tisk bez otevření souboru (přímý tisk)
Nastavení tisku pro přímý tisk
...................................................................................................................... 109
Tisk přijatých e-mailů (tisk e-mailů)
..................................................................................................................... 120
Praktické možnosti využití s mobilním zařízením ......................................................... 127
Připojení k mobilnímu zařízení
.............................................................................................................................. 128
Využívání zařízení pomocí aplikací
Použití služby AirPrint
......................................................................................................................... 129
....................................................................................................................................... 131
Tisk pomocí služby AirPrint
.......................................................................................................................... 135
Pokud nelze službu AirPrint použít
Použití služby Google Cloud Print
Vzdálená správa zařízení
................................................................................................................ 138
....................................................................................................................... 139
....................................................................................................................................... 143
Síť ............................................................................................................................................................................ 145
Připojení k síti
....................................................................................................................................................... 146
Připojení ke kabelové síti LAN
Nastavení IP adres
............................................................................................................................. 148
............................................................................................................................................ 150
Nastavení adresy IPv4
Nastavení adres IPv6
................................................................................................................................. 151
.................................................................................................................................. 155
Konfigurace zařízení k tisku z počítače
................................................................................................................... 159
Konfigurace protokolů tisku a funkcí WSD
Aktivace IPP/IPPS
........................................................................................................... 160
....................................................................................................................................... 166
Nastavení tiskového serveru
.............................................................................................................................. 173
Konfigurace zařízení na síťové prostředí
Konfigurace nastavení sítě Ethernet
................................................................................................................ 177
.................................................................................................................... 178
Nastavení čekací doby před připojením k síti
Konfigurace služby DNS
........................................................................................................ 180
.................................................................................................................................... 181
Konfigurace služby WINS
................................................................................................................................... 187
Konfigurace protokolu SNTP
.............................................................................................................................. 190
Monitorování a ovládání zařízení pomocí protokolu SNMP
Konfigurace nastavení pro software ke správě zařízení
Konfigurace protokolu SMB
..................................................................................... 193
.......................................................................................... 199
............................................................................................................................... 203
Nastavení počítače pro tisk
.......................................................................................................................... 206
Zabezpečení ...................................................................................................................................................
Ochrana zařízení před neoprávněným přístupem
Zabránění neoprávněnému přístupu
Nastavení přístupových oprávnění
................................................................................................... 211
................................................................................................................... 212
...................................................................................................................... 214
Nastavení hesla správce systému
Nastavení správy ID oddělení
210
................................................................................................................. 215
....................................................................................................................... 218
Nastavení kódu PIN pro Vzdálené uživatelské rozhraní
Omezení komunikace pomocí bran firewall
.................................................................................... 225
.......................................................................................................... 226
II
Zadání IP adres pro přidání do pravidel brány firewall
..................................................................................... 227
Zadání MAC adres pro přidání do pravidel brány firewall
Nastavení serveru proxy
Omezení funkcí zařízení
.................................................................................................................................... 236
........................................................................................................................................ 239
................................................................................................................................ 240
Omezení tiskových operací
Omezení funkcí USB
.......................................................................................................................................... 243
Omezení funkcí ovládacího panelu
Zákaz komunikace HTTP
...................................................................................................................... 246
.................................................................................................................................... 249
Zákaz Vzdáleného uživatelského rozhraní
Zakázání portu LAN
................................................................................. 233
............................................................................................................ 250
.......................................................................................................................................... 251
Skrytí historie tiskových úloh
.............................................................................................................................. 252
Implementace funkcí pro vysokou míru zabezpečení
Používání TLS pro šifrovanou komunikaci
Konfigurace nastavení IPSec
.............................................................................................. 254
............................................................................................................ 255
.............................................................................................................................. 259
Konfigurace ověřování IEEE 802.1X
..................................................................................................................... 269
Konfigurace nastavení pro páry klíčů a digitální certifikáty
Generování párů klíčů
..................................................................................... 275
................................................................................................................................. 276
Použití párů klíčů a digitálních certifikátů vydaných certifikační autoritou
Ověření párů klíčů a digitálních certifikátů
.......................................................... 283
..................................................................................................... 286
Použití Vzdáleného uživatelského rozhraní ........................................................................ 289
Spuštění Vzdáleného uživatelského rozhraní
.......................................................................................................... 290
Obrazovky Vzdáleného uživatelského rozhraní
Správa dokumentů a kontrola stavu zařízení
....................................................................................................... 293
......................................................................................................... 299
Umožnění manipulace s dokumenty koncovým uživatelům
.................................................................................... 304
Nastavení možností nastavení prostřednictvím uživatelského rozhraní
Ukládání/načtení registrovaných dat
Ukládání registrovaných dat
Načtení registrovaných dat
.................................................................. 306
..................................................................................................................... 308
.............................................................................................................................. 309
................................................................................................................................ 311
Nastavení seznamu nabídky ...........................................................................................................
Nabídka nastavení
................................................................................................................................................ 315
Nabídka ovládání
Zdroj papíru
Síť
314
.............................................................................................................................................. 316
..................................................................................................................................................... 335
................................................................................................................................................................... 336
Rozvržení
......................................................................................................................................................... 357
Kvalita tisku
Rozhraní
..................................................................................................................................................... 361
.......................................................................................................................................................... 376
Uživatelská údržba
............................................................................................................................................ 379
Priorita položek nabídky nastavení
Režim tisku
...................................................................................................................................................... 407
Nastavení specifická pro režim tisku
UFR II
PCL
............................................................................................................... 406
.................................................................................................................... 409
........................................................................................................................................................ 410
........................................................................................................................................................... 411
Zobrazování
............................................................................................................................................... 417
III
XPS
........................................................................................................................................................... 427
PDF
........................................................................................................................................................... 438
PS
............................................................................................................................................................. 449
Nastavení MEAP
............................................................................................................................................... 459
Zkontrol. počitadlo
............................................................................................................................................ 461
Inicializace nabídky
........................................................................................................................................... 463
Utility Menu
.......................................................................................................................................................... 464
Nabídka Úloha
...................................................................................................................................................... 470
Nabídka Resetovat
................................................................................................................................................ 472
Nabídka Vybrat podavač
....................................................................................................................................... 474
Odstraňování problémů (FAQ) .......................................................................................................
484
Údržba ................................................................................................................................................................
486
Čištění zařízení
..................................................................................................................................................... 488
Vnější povrchy
.................................................................................................................................................. 489
Fixační jednotka
............................................................................................................................................... 490
Oblast dopravy papíru
....................................................................................................................................... 491
Výměna tonerových kazet
..................................................................................................................................... 496
Postup výměny tonerových kazet
Výměna bubnových kazet
........................................................................................................................ 500
...................................................................................................................................... 503
Postup výměny bubnových kazet
........................................................................................................................ 507
Výměna odpadní nádobky na toner
....................................................................................................................... 509
Jak vyměnit odpadní nádobku na toner
Přemístění zařízení
............................................................................................................... 510
............................................................................................................................................... 512
Udržení a vylepšení kvality tisku
Nastavení sytosti tisku
........................................................................................................................... 514
....................................................................................................................................... 515
Oprava neshody barev a odstínů
Nastavení pozice tisku
Tisk hlášení a seznamů
....................................................................................................................................... 519
.......................................................................................................................................... 523
Zobrazení hodnoty počítadla
................................................................................................................................. 532
Kontrola spotřebního materiálu
Inicializace nastavení
Inicializace nabídky
........................................................................................................................ 517
............................................................................................................................ 535
............................................................................................................................................ 538
........................................................................................................................................... 539
Inicializace nastavení sítě
................................................................................................................................... 540
Dodatek ............................................................................................................................................................. 542
Software třetí strany
To nejlepší z funkcí
............................................................................................................................................. 543
................................................................................................................................................ 544
Šetrnost vůči životnímu prostředí a úspora peněz
................................................................................................. 545
Vyšší účinnost
.................................................................................................................................................. 546
Mnohem více
................................................................................................................................................... 548
Specifikace
........................................................................................................................................................... 550
Hlavní jednotka
................................................................................................................................................ 551
IV
Použitelný papír
............................................................................................................................................... 553
Paper Feeder PF-G
............................................................................................................................................ 559
Cassette Feeding Unit-AU
Funkce tiskárny
Funkce správy
.................................................................................................................................. 560
................................................................................................................................................ 561
.................................................................................................................................................. 565
Systémové prostředí
......................................................................................................................................... 568
Síťové prostředí
................................................................................................................................................ 569
Spotřební materiál
................................................................................................................................................ 570
Možnosti
............................................................................................................................................................... 573
Volitelná zařízení
.............................................................................................................................................. 574
Systémové volitelné doplňky
Instalace ROM
.............................................................................................................................. 575
............................................................................................................................................ 577
Instalace SD karty
Příručky a jejich obsah
....................................................................................................................................... 581
.......................................................................................................................................... 586
Použití dokumentu Uživatelská příručka
................................................................................................................ 587
Rozložení obrazovky dokumentu Uživatelská příručka
Zobrazení dokumentu Uživatelská příručka
........................................................................................... 588
.......................................................................................................... 591
Správa aplikací MEAP
............................................................................................................................................ 593
Používání klientů FTP
............................................................................................................................................ 594
Příprava na použití serveru FTP
.......................................................................................................................... 595
Tisk prostřednictvím klienta FTP (tisk FTP)
............................................................................................................ 598
Zadání nastavení prostřednictvím klienta FTP
Ostatní
....................................................................................................... 600
................................................................................................................................................................. 607
Základní operace v systému Windows
Ukázky písma
Upozornění
................................................................................................................. 608
................................................................................................................................................... 617
...................................................................................................................................................... 622
V
Důležité bezpečnostní pokyny
Důležité bezpečnostní pokyny
Důležité bezpečnostní pokyny .................................................................................................................... 2
Instalace ................................................................................................................................................................. 3
Napájení ................................................................................................................................................................. 5
Manipulace ............................................................................................................................................................ 6
Údržba a kontrola .................................................................................................................................................. 9
Spotřební materiál .............................................................................................................................................. 10
1
Důležité bezpečnostní pokyny
Důležité bezpečnostní pokyny
6867-000
Informace uvedené v této kapitole jsou určeny k tomu, aby se zabránilo poškození majetku nebo zranění uživatele
nebo jiných osob používajících zařízení. Před zahájením používání tohoto zařízení si prostudujte tuto kapitolu a řiďte se
pokyny pro správné používání zařízení. Neprovádějte žádné operace, které nejsou popsány v této příručce. Společnost
Canon nenese odpovědnost za žádné škody vyplývající z používání zařízení způsobem nepopsaným v této příručce,
vzniklé nesprávným používáním nebo jako následek oprav/změn provedených jiným subjektem než je společnost
Canon nebo autorizovaná třetí strana společnosti Canon.
2
Důležité bezpečnostní pokyny
Instalace
6867-001
Přečtěte si pozorně následující upozornění a umístěte zařízení na vhodné místo, abyste zajistili bezpečné a pohodlné
používání zařízení.
Zařízení neinstalujte na místo, kde hrozí riziko požáru nebo úrazu elektrickým proudem
● Umístění, kde dochází k blokování větracích otvorů
(v těsné blízkosti stěn, postelí, gaučů, huňatých přikrývek a podobných předmětů)
● Vlhké nebo prašné místo
● Místo vystavené přímému působení slunečního záření nebo venkovní místo
● Místo vystavené působení vysokých teplot,
● Místo vystavené přímému působení otevřeného ohně
● Do blízkosti látek jako je alkohol, ředidla nebo jiné hořlavé látky
Další varování
● Nepřipojujte k přístroji neschválené kabely. V opačném případě by mohlo dojít ke vzniku požáru nebo úrazu
elektrickým proudem.
● Neumísťujte na přístroj řetízky či jiné kovové předměty či nádoby naplněné kapalinami. Pokud elektrické
součásti uvnitř zařízení přijdou do styku s cizími látkami, může dojít k požáru nebo úrazu elektrickým
proudem.
● Při instalaci a odebírání volitelného příslušenství zařízení vypněte, odpojte napájecí kabel a pak od zařízení
odpojte všechny kabely rozhraní a napájecí kabel. V opačném případě může dojít k poškození napájecího
kabelu nebo kabelů rozhraní, což může vést ke vzniku požáru nebo úrazu elektrickým proudem.
● Pokud se dovnitř zařízení dostanou cizí látky, vytáhněte zástrčku ze síťové zásuvky a obraťte se na místního
autorizovaného prodejce společnosti Canon.
Zařízení neinstalujte na následující místa
Na místo odkud by zařízení mohlo sklouznout nebo spadnout a způsobit
zranění osob.
● Nestabilní místo
● Místo vystavené vibracím
Další upozornění
● Při přenášení zařízení postupujte podle pokynů uvedených v této příručce. V případě nesprávného přenášení
může dojít k pádu zařízení a zranění osob.
● Při instalaci zařízení dávejte pozor, abyste nenechali ruce mezi zařízením a podlahou nebo stěnou. Jinak by
mohlo dojít k vážnému zranění.
3
Důležité bezpečnostní pokyny
Vyhýbejte se nedostatečně větraným místům
● Toto zařízení vytváří malé množství ozónu a další emise, a to i během normálního provozu. Tyto emise
nejsou zdraví škodlivé. Během delšího použití nebo při celkově vyšším vytížení zařízení může být množství
ozónu v okolí zařízení znatelnější, především v nedostatečně větraných místnostech. Místnosti, ve kterých
zařízení pracuje, doporučujeme dostatečně větrat, aby bylo pracovní prostředí příjemné. Vyhněte se rovněž
místům, kde by byli emisím ze zařízení vystaveni lidé.
Zařízení neinstalujte na následující místa, kde hrozí poškození zařízení
● Místo vystavené výrazným změnám teploty nebo vlhkosti
● Místo v blízkosti zařízení, které vytváří magnetické nebo
elektromagnetické vlny
● Laboratoř nebo místo, kde dochází k chemickým reakcím
● Místo vystavené působení žíravých nebo jedovatých plynů
● Místo, které by se v důsledku hmotnosti zařízení mohlo
prohnout, nebo kde by zařízení mohlo výškově poklesnout
(např. koberec apod.)
Neinstalujte zařízení na místa, kde dochází ke kondenzaci vody
● Pokud se teplota v místnosti, kde je zařízení umístěno, rychle zvýší, nebo je-li zařízení přesunuto z chladného
nebo suchého místa do horkého či vlhkého prostředí, mohou se uvnitř zařízení vytvářet kapičky vody
(kondenzace). Používání zařízení v tomto stavu může způsobit uvíznutí papíru, nízkou kvalitu tisku nebo
poškození zařízení. Nechte proto zařízení přizpůsobit okolní teplotě a vlhkosti alespoň po dobu 2 hodin před
použitím.
V nadmořských výškách přesahujících 3 000 metrů nad mořem
● Přístroje s pevným diskem nemusí fungovat správně, když se budou používat ve vysokých výškách
přesahujících 3 000 metrů nad mořem.
4
Důležité bezpečnostní pokyny
Napájení
6867-002
● Používejte pouze zdroj napájení splňující uvedené požadavky na napájení. V opačném případě by mohlo dojít
k požáru nebo úrazu elektrickým proudem.
● Přístroj musí být připojen do elektrické zásuvky s uzemněním prostřednictvím odpovídajícího napájecího
kabelu.
● Nepoužívejte jiné napájecí kabely než ty, které byly dodány se zařízením. Mohlo by dojít k požáru nebo úrazu
elektrickým proudem.
● Dodaný napájecí kabel je určený k použití s tímto zařízením. Nepřipojujte jej k jiným zařízením.
● Napájecí kabel neupravujte, netahejte za něj, neohýbejte ho silou a ani s ním nemynipulujte způsobem, který
by mohl vést k jeho poškození. Na napájecí kabel neumísťujte těžké předměty. Poškození napájecího kabelu
může vést ke vzniku požáru nebo úrazu elektrickým proudem.
● Zástrčku nezapojujte ani neodpojujte mokrýma rukama. Mohlo by dojít k úrazu elektrickým proudem.
● Nepoužívejte s tímto zařízením prodlužovací šňůry nebo vícenásobné zásuvky. V opačném případě by mohlo
dojít ke vzniku požáru nebo úrazu elektrickým proudem.
● Napájecí kabel nesmotávejte ani nesvazujte do uzlu. Mohlo by dojít k požáru nebo úrazu elektrickým
proudem.
● Zástrčku zasuňte do zásuvky střídavého proudu až nadoraz. V opačném případě by mohlo dojít k požáru
nebo úrazu elektrickým proudem.
● Za bouřky zcela odpojte zástrčku napájecího kabelu ze síťové zásuvky. Pokud tak neučiníte, mohlo by dojít
k požáru, k úrazu elektrickým proudem nebo k poškození zařízení.
● Zařízení umístěte v blízkosti elektrické zásuvky a ponechejte u ní dostatek místa, aby bylo možné snadno
odpojit napájecí zástrčku v naléhavých situacích.
Připojení zařízení ke zdroji napájení
● Nepřipojujte napájecí kabel k nepřerušitelnému zdroji napájení. Mohlo by to mít za následek nesprávné
fungování nebo poškození přístroje při výpadku napájení.
● Pokud zapojujete zařízení do vícenásobné zásuvky, nepoužívejte ostatní místa v zásuvce k připojení dalších
zařízení.
● Napájecí kabel nepřipojujte do přídavné síťové zásuvky v počítači.
Další opatření
● Elektrický šum může vést k nesprávné funkci zařízení nebo ke ztrátě dat.
5
Důležité bezpečnostní pokyny
Manipulace
6867-003
● Pokud bude zařízení vydávat neobvyklý hluk, podivný zápach,
kouř či teplo, okamžitě vytáhněte zástrčku ze síťové zásuvky a
obraťte se na autorizovaného prodejce společnosti Canon.
Budete-li dále pokračovat v používání zařízení, může dojít
k požáru nebo úrazu elektrickým proudem.
● Zařízení nerozebírejte ani neupravujte. Uvnitř zařízení jsou
součásti pod vysokým napětím a s vysokou teplotou, které by
mohly způsobit vznik požáru nebo úraz elektrickým proudem.
● Zařízení umístěte tak, aby nemohlo dojít ke kontaktu dětí s napájecím kabelem nebo ostatními kabely nebo
s vnitřními a elektrickými součástmi zařízení. V opačném případě může dojít k neočekávaným nehodám.
● Nepoužívejte v okolí zařízení hořlavé spreje. Pokud elektrické součásti zařízení přijdou do styku s hořlavými
látkami, může dojít k požáru nebo úrazu elektrickým proudem.
● Před přemisťováním vypněte zařízení i počítač a poté odpojte od zařízení napájecí kabel i kabely rozhraní.
V opačném případě by mohlo dojít k poškození napájecího kabelu nebo kabelů rozhraní a k následnému
požáru nebo úrazu elektrickým proudem.
● Pokud zapojujete nebo odpojujete kabel USB, když je napájecí kabel zapojen v zásuvce střídavého proudu,
nedotýkejte se kovových částí konektoru – mohlo by dojít k úrazu elektrickým proudem.
Používáte-li kardiostimulátor
● Toto zařízení vytváří slabý magnetický tok a ultrazvukové vlny. Pokud používáte kardiostimulátor a pociťujete
nestandardní stavy, nepřibližujte se k zařízení a neprodleně se poraďte s lékařem.
● Nepokládejte na zařízení těžké předměty. Předměty by mohly spadnout a způsobit poranění osob.
● V zájmu vlastní bezpečnosti odpojte napájecí kabel, pokud nebudete zařízení delší dobu používat.
● Při otevírání a zavírání krytů buďte opatrní, abyste si neporanili ruce.
● Držte ruce a oblečení stranou od válců ve výstupní části. Pokud se v podavačích zachytí ruce či součásti
oděvu, může dojít ke zranění.
● Vnitřek zařízení a výstupní přihrádka jsou během používání a bezprostředně po něm velmi horké. Abyste se
nepopálili, nedotýkejte se těchto oblastí. Také potištěný papír může být ihned po výstupu horký, při
manipulaci s ním tedy buďte opatrní. V opačném případě byste se mohli popálit.
6
Důležité bezpečnostní pokyny
● Zařízení nepřenášejte, pokud je nasazen volitelný
podavač papíru nebo kazetová podávací jednotka.
V opačném případě může dojít k jejich pádu a
zranění osob.
Laserový paprsek
● Pokud by laserový paprsek unikl a zasáhl oči, mohlo by dojít k poškození zraku.
Při přepravě zařízení
Abyste zabránili poškození zařízení při přepravě, proveďte následující postup.
● Vyjměte tonerové kazety a bubnové kazety.
● Zařízení pomocí balicích materiálů bezpečně zabalte do původní krabice.
Pokud požadujete tiché pracovní prostředí
● Pokud požadujete tiché pracovní prostředí, v závislosti na prostředí použití produktu a provozním režimu
doporučujeme zařízení instalovat jinam než do kanceláře.
Další opatření
● Dodržujte upozornění na štítcích a podobných součástech přilepených na tomto stroji.
● Nevystavujte toto zařízení otřesům nebo nárazům.
● Neotvírejte ani nezavírejte dvířka, kryty nebo jiné části zařízení silou. Mohlo by dojít k poškození zařízení.
● Nedotýkejte se kontaktů (
) uvnitř zařízení. Mohlo by dojít k poškození zařízení.
7
Důležité bezpečnostní pokyny
● Aby nedošlo k uvíznutí papíru, nevypínejte zařízení, neotevírejte nebo nezavírejte kryty a nevkládejte ani
nevyjímejte papír během tisku.
8
Důležité bezpečnostní pokyny
Údržba a kontrola
6867-004
Zařízení pravidelně čistěte. Vlivem usazeného prachu nemusí zařízení pracovat správně. Během čištění dodržujte
následující pokyny. Pokud během provozu dojde k problému, viz část „Odstraňování problémů“.
● Před čištěním zařízení vypněte a odpojte zástrčku od zásuvky střídavého proudu. V opačném případě by
mohlo dojít k požáru nebo úrazu elektrickým proudem.
● Napájecí kabel pravidelně odpojujte a pomocí suchého hadříku ho čistěte od prachu a nečistot.
Nahromaděný prach může absorbovat vzdušnou vlhkost a při kontaktu s elektrickým proudem může dojít ke
vzniku požáru.
● Přístroj čistěte vlhkým, dobře vyždímaným hadříkem. Hadříky vlhčete pouze ve vodě. Nepoužívejte alkohol,
benzin, ředidlo na barvy nebo jiné hořlavé látky. Nepoužívejte papírové ubrousky nebo papírové utěrky.
Pokud elektrické součásti uvnitř zařízení přijdou do styku s těmito látkami a materiály, pak může vznikat
statická elektřina nebo může dojít k požáru či úrazu elektrickým proudem.
● Pravidelně kontrolujte napájecí kabel a zástrčku, zda nejsou poškozené. Kontrolujte, zda na přístroji není rez,
škrábance, praskliny nebo zda není příliš teplý. Při používání nedostatečně udržovaného zařízení může dojít
k požáru nebo úrazu elektrickým proudem.
● Uvnitř tiskárny se nacházejí komponenty zahřáté na vysoké teploty a pod vysokým napětím. Při dotyku
těchto součástí může dojít k popáleninám. Nedotýkejte se žádné části přístroje, která není uvedená
v příručce.
● Při zakládání papíru nebo odstraňování uvíznutého papíru dbejte na to, abyste si o hrany papíru nepořezali
prsty.
● Při odstraňování uvíznutého papíru nebo výměně tonerových kazet nebo něčem podobném dbejte na to,
abyste si tonerem nepotřísnili ruce nebo oblečení. Pokud se toner dostane na ruce nebo oděv, ihned
zasažené místo omyjte studenou vodou.
9
Důležité bezpečnostní pokyny
Spotřební materiál
6867-005
● Nelikvidujte použité tonerové kazety a podobné součásti v otevřeném ohni. Neskladujte tonerové kazety,
kazety válce nebo papír na místech, která jsou vystavena působení otevřeného ohně. Mohlo by dojít ke
vzplanutí toneru, a v důsledku toho k popáleninám nebo vzniku požáru.
● Pokud toner náhodně vylijete nebo vysypete, opatrně shromážděte částečky toneru dohromady nebo je
utřete měkkým navlhčeným hadříkem způsobem, který zabraňuje vdechnutí. K úklidu vylitého toneru nikdy
nepoužívejte vysavač, který není vybaven chrániči proti výbuchu prachu. Mohlo by dojít k poškození vysavače
nebo výbuchu prachu v důsledku statického výboje.
● Dbejte na to, aby nedošlo ke vdechnutí toneru. Pokud dojde ke vdechnutí toneru, okamžitě vyhledejte
lékařskou pomoc.
● Dbejte na to, aby se vám toner nedostal do očí nebo do úst. Pokud se vám toner dostane do očí či úst,
okamžitě postižená místa omyjte studenou vodou a vyhledejte lékařskou pomoc.
● Dbejte na to, aby toner nepřišel do kontaktu s pokožkou. Pokud k tomu dojde, omyjte pokožku mýdlem a
studenou vodou. Pokud dojde k jakémukoli podráždění pokožky, okamžitě vyhledejte lékařskou pomoc.
● Udržujte tonerové kazety a další spotřební materiál mimo dosah malých dětí. Pokud dojde k vdechnutí
toneru, ihned vyhledejte lékařskou pomoc.
● Tonerovou kazetu a podobné součásti nerozebírejte ani neupravujte. Mohlo by dojít k vysypání a rozptýlení
toneru.
Manipulace s tonerovou kazetou
● Tonerovou kazetu držte za držák.
● Nedotýkejte se podávací sekce (
), elektrických kontaktů (
10
) ani paměti tonerové kazety (
).
Důležité bezpečnostní pokyny
● Kromě nezbytných okolností nevytahujte tonerovou kazetu z obalového materiálu ani z tohoto zařízení.
● Tonerová kazeta je magnetický produkt. Nedávejte ji poblíž výrobků citlivých na magnetické pole, včetně
disket a diskových jednotek. Pokud byste to udělali, mohlo by dojít ke ztrátě dat.
Manipulace s kazetou válce
● Kazetu válce držte za držák.
● Dejte pozor, abyste povrch bubnu (
kontaktů (
) nepoškrábali ani ho nevystavili světlu. Nedotýkejte se elektrických
) ani paměti bubnové kazety (
).
● Kazetu válce z balicího materiálu nebo z tohoto zařízení nevyjímejte, pokud to není nezbytné.
Manipulace se zásobníkem odpadního toneru
● Zásobník odpadního toneru nenaklánějte, jinak se může z hrdla zásobníku (
11
) vysypat toner.
Důležité bezpečnostní pokyny
Skladování tonerových kazet a bubnových kazet
● Při skladování dodržujte následující podmínky prostředí, aby bylo použití tonerových kazet bezpečné a
bezproblémové.
Rozsah teplot pro uložení: 0 °C až 35 °C
Rozsah vlhkosti pro uložení: 35 % až 85 % relativní vlhkosti (bez kondenzace)*
● Tonerové kazety ani bubnové kazety nerozbalujte až do jejich použití.
● Po vyjmutí tonerových kazety a bubnových kazet ze zařízení za účelem uložení je umístěte do původního
balicího materiálu.
● Tonerové kazety neukládejte ve svislé ani obrácené poloze. Toner v kazetě ztuhne a nemusí se vrátit do
původního stavu ani po protřepání.
*I
když je vlhkost v povoleném rozsahu pro skladování, mohou se přesto v důsledku rozdílných teplot uvnitř a vně
tonerových kazet a bubnových kazet vytvářet uvnitř kazet kapky vody (kondenzace vody). Kondenzace nepříznivě ovlivňuje
kvalitu tisku tonerových kazet a bubnových kazet.
Tonerové kazety a bubnové kazety neskladujte na následujících místech
● Místa vystavená přímému působení otevřeného ohně
● Místa vystavená přímému působení slunečního záření nebo v blízkosti silného světelného zdroje působícího
po dobu delší než pět minut
● Místa vystavená působení příliš slaného vzduchu
● Místa s výskytem žíravých plynů (např. aerosolové spreje nebo čpavek)
● Místa s výskytem vysokých teplot a vysokou vlhkostí
● Místa vystavená výrazným změnám teploty nebo vlhkosti, kde dochází často ke kondenzaci vody
● Místa s vysokou prašností
● Místa, která jsou v dosahu dětí
Buďte na pozoru před padělanými tonerovými kazetami a kazetami válce
● Vezměte na vědomí, že na trhu jsou k dispozici padělané tonerové kazety a kazety válce značky Canon.
Používání padělané tonerové kazety a kazety válce může zapříčinit špatnou kvalitu tisku nebo nízkou
výkonnost stroje. Společnost Canon nezodpovídá za nesprávné fungování, havárii nebo poškození
způsobené používáním padělaných tonerových kazet nebo kazet válce.
Další informace naleznete na adrese global.canon/ctc.
Dostupnost náhradních dílů, tonerových kazet, bubnových kazet a podobných součástí
● Náhradní díly, tonerové kazety, kazety válce a podobné součásti pro tento stroj budou k dispozici nejméně
sedm (7) let od ukončení výroby tohoto modelu stroje.
Balicí materiály pro tonerové kazety a bubnové kazety
● Balicí materiály pro tonerové kazety a bubnové kazety uschovejte. Jsou třeba při přepravě zařízení.
● Tvar či umístění obalového materiálu se může změnit, nebo může být materiál přidán či odstraněn bez
předchozího upozornění.
12
Důležité bezpečnostní pokyny
Likvidace použitých tonerových kazet, bubnových kazet a podobných součástí
● Použité tonerové kazety, bubnové kazety a podobné součásti vložte do původního balicího materiálu
(zabráníte tak rozptýlení zbývajícího toneru) a zlikvidujte v souladu s platnými místními předpisy.
13
Základní operace
Základní operace
Základní operace .............................................................................................................................................. 15
Hlavní funkce ....................................................................................................................................................... 17
Součásti a jejich funkce ....................................................................................................................................... 18
Přední strana .................................................................................................................................................. 19
Zadní strana ................................................................................................................................................... 21
Vnitřní prostor ................................................................................................................................................ 23
Víceúčelová přihrádka .................................................................................................................................... 24
Zásuvka na papír ............................................................................................................................................ 25
Ovládací panel ................................................................................................................................................ 26
Displej ...................................................................................................................................................... 29
Použití ovládacího panelu ................................................................................................................................... 31
Zadávání textu ................................................................................................................................................ 34
Zapnutí/Vypnutí zařízení .................................................................................................................................... 36
Rychlé spuštění tiskárny ................................................................................................................................. 38
Vkládání papíru ................................................................................................................................................... 40
Vkládání papíru do zásuvky na papír .............................................................................................................. 42
Vkládání papíru do víceúčelové přihrádky ...................................................................................................... 48
Vkládání obálek nebo pohlednic ..................................................................................................................... 51
Vkládání předtištěného papíru ....................................................................................................................... 55
Zadání velikosti a typu papíru ......................................................................................................................... 59
Zadání velikosti a typu papíru v zásuvce na papír .................................................................................... 60
Zadání velikosti a typu papíru ve víceúčelové přihrádce ........................................................................... 63
Úspora energie .................................................................................................................................................... 66
Přepnutí do režimu spánku ............................................................................................................................ 67
Nastavení času automatického vypnutí .......................................................................................................... 69
14
Základní operace
Základní operace
6867-006
Tato kapitola popisuje základní operace, např. používání ovládacího panelu nebo postup vložení papíru. Jedná se o
operace, které jsou při obsluze zařízení prováděny často.
● Funkce nainstalované v zařízení se liší v závislosti na zakoupeném modelu. Před použitím zařízení si přečtěte
část Hlavní funkce(P. 17) a projděte si dostupné funkce.
◼ Součásti a jejich funkce
Tato část popisuje vnitřní a vnější součásti zařízení a jeho funkce, dále pak způsoby používání tlačítek na operačním
panelu a zobrazení na displeji. Součásti a jejich funkce(P. 18)
◼ Použití ovládacího panelu
Tato část popisuje, jak používat tlačítka na ovládacím panelu k různým operacím, jako je úprava nebo kontrola
nastavení. Použití ovládacího panelu(P. 31)
◼ Zapnutí/Vypnutí zařízení
Tato část popisuje, jak zařízení zapnout/vypnout.
Zapnutí/Vypnutí zařízení(P. 36)
15
Základní operace
◼ Vkládání papíru
Tato část popisuje, jak založit papír do zásuvky na papír a do víceúčelové přihrádky.
◼ Úspora energie
Tato část popisuje, jak snížit spotřebu energie.
Úspora energie(P. 66)
16
Vkládání papíru(P. 40)
Základní operace
Hlavní funkce
6867-007
V této příručce jsou popsány všechny funkce týkající se řady, kterou jste zakoupili. Než začnete, zkontrolujte, které
funkce jsou u zakoupeného modelu dostupné.
: S funkcí
: Bez funkce
Funkce
LBP852Cx
Tisk
Oboustranný tisk
Zabezpečený tisk
Přímý tisk z USB
Tisk uložených úloh
Připojení kabelové sítě LAN
Připojení bezdrátové sítě LAN
Propojení s mobilními zařízeními
Správa ID oddělení
MEAP
Paper Feeder PF-G *
Cassette Feeding Unit-AU *
Sada pro tisk čárových kódů *
Sada mezinárodních fontů PCL *
SD KARTA *
*Tato
položka je volitelná.
● Dostupné typy ovladačů najdete na disku Disk CD-ROM/DVD-ROM s uživatelským softwarem dodávaným se
strojem nebo na webu společnosti Canon (https://global.canon).
ODKAZY
Zobrazení dokumentu Uživatelská příručka(P. 591)
17
Základní operace
Součásti a jejich funkce
6867-008
Tato část popisuje části zařízení (vnější součásti, přední a zadní stranu, vnitřní součásti) a jejich funkci. Kromě informací
týkajících se součástí zařízení, která jsou využívána k základním operacím, jakými jsou vkládání papíru a výměna
tonerových kazet, popisuje tato část také tlačítka na ovládacím panelu a obrazovku. V této části naleznete tipy pro
správné používání zařízení.
Přední strana(P. 19)
Zadní strana(P. 21)
Vnitřní prostor(P. 23)
Víceúčelová přihrádka(P. 24)
Zásuvka na papír(P. 25)
Ovládací panel(P. 26)
18
Základní operace
Přední strana
6867-009
Výstupní přihrádka
Potištěný papír se vysouvá do výstupní přihrádky.
Ovládací panel
Ovládací panel obsahuje číselná tlačítka, displej, indikátory stavu atd. Prostřednictvím ovládacího panelu lze
provádět všechny operace a nastavení. Ovládací panel(P. 26)
Displej(P. 29)
Vypínač
Stisknutím vypínače tiskárnu zapněte. Při vypínání napájení nepoužívejte tento vypínač, ale postupujte podle
pokynů uvedených v části Vypnutí tiskárny (postup vypínání)(P. 36) .
Přední kryt
Přední kryt otevřete, chcete-li vyměnit tonerové kazety nebo bubnové kazety.
kazet(P. 500)
Postup výměny bubnových kazet(P. 507)
Postup výměny tonerových
Zásuvka na papír
Do zásuvky na papír vkládejte typ papíru, který používáte nejčastěji.
papír(P. 42)
Vkládání papíru do zásuvky na
Port pro paměť USB (pro paměťová zařízení USB)
K zařízení je možné připojit paměťové zařízení USB a tisknout data přímo z tohoto paměťového zařízení. Data
uložená v paměťovém zařízení USB můžete tisknout přímo, aniž byste použili počítač. ( Tisk z paměti USB
(Přímý tisk z USB)(P. 81) ). Připojte paměťové zařízení USB při exportu nebo importu nastavení zařízení (
Nast. import/export(P. 401) ).
19
Základní operace
Pravý kryt
Pravý kryt otevřete, chcete-li odstranit uvízlý papír.
Rukojeti
Při přenášení držte zařízení za tyto rukojeti.
Přemístění zařízení(P. 512)
Víceúčelová přihrádka
Pokud potřebujete dočasně použít jiný typ papíru, než jaký je vložen do zásuvky na papír, použijte k vložení
tohoto typu papíru víceúčelovou přihrádku. Vkládání papíru do víceúčelové přihrádky(P. 48)
20
Základní operace
Zadní strana
6867-00A
Zadní kryt
Otevřete zadní kryt a nainstalujte volitelnou ROM.
Instalace ROM(P. 577)
Větrací otvor
Vzduch z vnitřku zařízení musí mít možnost unikat ven z důvodu chlazení vnitřních části zařízení. Upozornění.
Umístěním předmětů před ventilační otvory zamezíte ventilaci. Instalace(P. 3)
Zásuvka napájení
Slouží k připojení napájecí šňůry.
Levý kryt
Otevřete levý kryt, chcete-li vyměnit zásobník odpadního toneru.
toner(P. 510)
Jak vyměnit odpadní nádobku na
Typový štítek
Na štítku je uvedeno sériové číslo, které využijete v případě dotazů týkajících se zařízení. Další informace
naleznete v části „Odstraňování problémů (FAQ)“ na webu s online příručkami.
Rukojeti
Při přenášení držte zařízení za tyto rukojeti.
Přemístění zařízení(P. 512)
Kryt slotu pro SD karty
Při instalaci volitelné SD karty otevřete kryt slotu pro SD karty.
Instalace SD karty(P. 581)
Port USB (pro připojení zařízení USB)
Připojte zařízení USB, které se používá s aplikacemi MEAP. Připojte paměťové zařízení USB při exportu nebo
importu nastavení zařízení ( Nast. import/export(P. 401) ).
21
Základní operace
Port USB (pro připojení počítače)
Kabel USB použijte pro propojení stroje s počítačem.
Indikátor ACT
Indikátor ACT bliká během odesílání nebo přijímání dat.
Indikátor LNK
Indikátor LNK bliká zeleně, když je zařízení řádně připojeno k síti.
Port LAN
Sem připojte kabel LAN, chcete-li k zařízení připojit kabelový směrovač LAN apod.
síti LAN(P. 148)
22
Připojení ke kabelové
Základní operace
Vnitřní prostor
6867-00C
Pozice na bubnové kazety
Do těchto pozic vložte bubnové kazety.
Postup výměny bubnových kazet(P. 507)
Pozice na tonerové kazety
Do těchto pozic vložte tonerové kazety příslušné barvy: Y (žlutá) do pozice zcela vlevo, následuje M
(purpurová), C (azurová) a K (černá). Postup výměny tonerových kazet(P. 500)
23
Základní operace
Víceúčelová přihrádka
6867-00E
Vodítka papíru
Vodítka papíru nastavte přesně podle šířky papíru, aby byl papír do zařízení správně podáván. Zatlačte na
uvolňovací páčku zámku označenou na obrázku šipkou, aby se uvolnil zámek, a poté posuňte vodítka papíru.
Nástavec přihrádky
Tento nástavec vytáhněte při vkládání velkého papíru.
ODKAZY
Vkládání papíru do víceúčelové přihrádky(P. 48)
24
Základní operace
Zásuvka na papír
6867-00F
Vodítka papíru
Vodítka papíru nastavte přesně podle velikosti vkládaného papíru, aby byl papír do zařízení správně podáván.
Zatlačte na uvolňovací páčky zámku označené na obrázku šipkami, aby se uvolnil zámek, a poté posuňte
vodítka papíru.
Indikátor úrovně papíru
Ukazuje zbývající množství papíru. Tím, jak se zbývající množství zmenšuje, se značka pohybuje dolů.
ODKAZY
Vkládání papíru do zásuvky na papír(P. 42)
25
Základní operace
Ovládací panel
6867-00H
Displej
Zobrazuje aktuální stav tisku nebo jiné operace, informace o chybách, stav tonerové kazety atd.
Displej(P. 29)
Tlačítko Stav/zrušení úlohy
Pokud toto tlačítko stisknete, když svítí nebo bliká kontrolka [ ], právě tisknutý dokument a dokumenty
čekající na vytištění se uvedou v seznamu. Ze seznamu můžete dokument vybrat a zrušit jeho tisk. Pomocí
ovládacího panelu(P. 78)
Tlačítko Zpět
Stisknutím se vrátíte na předchozí obrazovku. Pokud toto tlačítko stisknete, např. při určování nastavení,
provedené změny nebudou uloženy a na displeji se zobrazí předchozí obrazovka.
Číselná tlačítka (tlačítka [0]-[9])
Stisknutím zadáte číslice a znaky.
Zadávání textu(P. 34)
Tlačítko [*]
Stisknutím přepnete typ zadávaného textu.
26
Základní operace
Připraveno – indikátor
Rozsvítí se, když je zařízení připraveno k tisku nebo jinak bliká.
Hlášení – indikátor
● Rozsvítí se, když dojde k problému s deaktivací tisku. Další informace naleznete v části „Odstraňování
problémů (FAQ)“ na webu s online příručkami.
● Rozsvítí se, když se tiskárna uvede do režimu spánku, zatímco je offline.
Úloha – indikátor
Rozsvítí se, když tiskárna přijímá tisková data nebo když jakákoli tisková data zůstávají v paměti tiskárny.
Bliká, když se tisková data zpracovávají.
Tlačítko Spořič energie
Stisknutím přepnete zařízení do režimu spánku. Pokud je zařízení v režimu spánku, pak se tlačítko rozsvítí
zeleně. Opětovným stisknutím tlačítka režim spánku ukončíte. Přepnutí do režimu spánku(P. 67)
Tlačítko Aplikace
Každým stisknutím tohoto tlačítka přepínáte v cyklu funkce v následujícím pořadí: tisk obrazovky MEAP1
MEAP2 ... MEAP8 přímý tisk z USB tisk obrazovky. Vyberte funkci, kterou chcete použít. Pokud
stisknete toto tlačítko, aniž se přihlásíte pomocí ID oddělení, zobrazí se ověřovací obrazovka.
Tlačítko Vybrat podavač
Stisknutím vyberete zdroj papíru nebo zadáte formát papíru.
Nabídka Vybrat podavač(P. 474)
Tlačítko [ID]
Zobrazí se přihlašovací obrazovka pro použití funkce MEAP. Po ukončení práce se zařízením opětovně
stiskněte tlačítko, čímž se odhlásíte.
Tlačítko Vymazat
Stisknutím odstraníte zadané číslice a znaky.
Tlačítko Online
Zajistí přepínání mezi režimem online (tiskové úlohy jsou přijaty) a offline (nejsou přijímány žádné tiskové
úlohy). Toto tlačítko se rozsvítí zeleně, když je tiskárna online a zhasne, když je tiskárna offline. Obvykle mějte
tiskárnu online, ale nastavte ji offline, když zadáváte nastavení Uživatelská údržba(P. 379) v nabídce
nastavení.
● Pokud klávesu pro délku času nepoužíváte, když je zařízení offline a je zobrazena
Hlavní
obrazovka(P. 29) , zařízení se automaticky přepne do režimu online. Můžete vybrat <Čas auto. resetu>
pro změnu této hodnoty času ( Čas auto. resetu(P. 318) ).
Tlačítko [#]
Stisknutím získáte možnost zadávat symboly, např. „@“ nebo „/“.
27
Základní operace
Tlačítko Obslužný program / Tlačítko [
]
● Zobrazí se nabídka Příslušenství. Můžete zobrazit celkový počet vytištěných stránek a vytisknout pro
kontrolu interní systémové informace. Utility Menu(P. 464)
● Při zadávání nastavení se stisknutím tlačítka vrátíte na předchozí obrazovku. Při zadávání textu se po
stisknutí tlačítka přesune kurzor doleva.
Tlačítko Úloha / Tlačítko [
]
● Zobrazí se nabídka Úlohy. Můžete zkontrolovat protokoly tisku.
Nabídka Úloha(P. 470)
● Při určování nastavení vyberete stisknutím tlačítka položku nad aktuálně vybranou položkou. Při změnách
nastavených hodnot se po stisknutí tlačítka hodnota zvýší.
Tlačítko Nastavení / Tlačítko [
]
● Zde se zobrazuje nabídka nastavení, která vám umožňuje zadat nastavení zařízení.
nastavení(P. 315)
Nabídka
● Při zadávání nastavení přejdete po stisknutí tlačítka na další obrazovku. Při zadávání textu se po stisknutí
tlačítka přesune kurzor doprava.
Tlačítko Obnovit / Tlačítko [
]
● Zobrazí se nabídka Reset. Můžete zrušit všechny procesy, vymazat data z paměti a vypnout napájení.
Nabídka Resetovat(P. 472)
● Při určování nastavení vyberete stisknutím tlačítka položku pod aktuálně vybranou položkou. Při změnách
nastavených hodnot se po stisknutí tlačítka hodnota sníží.
Tlačítko [OK]
Stisknutím uložíte změny nastavení nebo jiné provedené změny.
ODKAZY
Použití ovládacího panelu(P. 31)
28
Základní operace
Displej
6867-00J
Displej zobrazuje stav tisku a obrazovky pro specifikaci nastavení. Zobrazuje také
chybové zprávy a stav tonerové kazety.
Hlavní obrazovka
Indikace stavu
Zobrazí aktuální nebo provozní režim zařízení.
Indikace velikosti papíru
Zobrazí aktuálně vybranou velikost papíru.
Následující formáty papíru se zobrazí ve zkrácené formě.
● Ledger: LD
● Pohlednice s odpovědí: P2
● Legal: LG
● Pohlednice 4 na 1: P4
● Letter (na šířku) : LTR
● Obálka KAKUGATA 2: K2
● Letter (na výšku) : SV
● Obálka NAGAGATA 3: N3
● Statement (na šířku) : STR
● Obálka YOUGATANAGA 3: YN3
● Statement (na výšku) : ST
● Obálka No. 10 (COM10): CO
● Executive (na šířku) : EXR
● Obálka Monarch: MO
● Executive (na výšku): EX
● Obálka ISO-C5: EC5
● Foolscap: FC
● Obálka DL: DL
● 305 x 457 mm / 12 x 18 in: TxE
● Volná velikost: FR
● Kartotéční lístek: IC
● Vlastní velikost papíru na šířku: 80R
● Indian Legal: ILG
● Vlastní velikost papíru na výšku: 80
● Pohlednice: PD
Indikace stavu tonerové kazety
Zobrazuje stav tonerových kazet.
Obrazovka s nabídkou
Stisknutím
(
),
( ),
(
),
nabídkou. Obrazovka se objeví, když se stiskne
(
(
29
) nebo
( ) zobrazíte odpovídající obrazovku s
) je ukázáno níže jako příklad.
Základní operace
Nastavení seznamu nabídky(P. 314)
Dojde-li k chybě
V některých případech se po výskytu chyby zobrazí postup, jak na chybu reagovat. Podle pokynů na obrazovce
problém vyřešte. Jako příklad je níže uvedena obrazovka, která se objeví, pokud došlo k zachycení papíru. Další
informace o zobrazených zprávách naleznete v části „Odstraňování problémů (FAQ)“ na webu s online
příručkami.
ODKAZY
Použití ovládacího panelu(P. 31)
30
Základní operace
Použití ovládacího panelu
6867-00K
Pomocí zobrazených tlačítek zadejte nastavení a upravte hodnoty.
Použití tlačítek
/
Posouvání obrazovky
Jestliže se na obrazovku nevejdou všechny informace, zobrazí se na její pravé straně posuvník. Pokud je
/
posouvat obrazovku nahoru a dolů. Při výběru
zobrazen posuvník, pak je možné pomocí tlačítek
této možnosti se vymění barva textu a pozadí položky.
Změna hodnoty nastavení
Pomocí tlačítek
/
zadejte hodnoty.
● Hodnoty v závorkách „()“ zobrazené pod vstupním polem představují nastavitelný rozsah hodnot.
31
Základní operace
Použití tlačítek
/
Přechod na další obrazovku / návrat na předchozí obrazovku
Stisknutím tlačítka
obrazovku.
přejdete na další obrazovku. Stisknutím tlačítka
● Na další obrazovku lze přejít také stisknutím tlačítka
tlačítka
se vrátíte na předchozí
a vrátit se na předchozí obrazovku stisknutím
.
Přesun kurzoru
Pomocí tlačítek
/
lze zadávat text a hodnoty.
Zadávání textu(P. 34)
Použití tlačítka
Stisknutím tlačítka
Použití tlačítek
uložíte zvolené nastavení.
(
)
Pro návrat na hlavní obrazovku po ukončení nabídky nastavení stiskněte
(
).
Použití číselných tlačítek
Pro zadávání textu a hodnot slouží číselná tlačítka.
Zadávání textu(P. 34)
● V závislosti na zobrazené obrazovce nelze používat k zadávání hodnot číselné klávesy. V takovém případě
hodnoty zadejte pomocí
/
.
32
Základní operace
● Máte možnost změnit celou řadu nastavení zobrazovaných na displeji, jako je např. rychlost posouvání
obrazovky nebo jazyk zobrazování, a to pomocí <Nabídka ovládání> v nabídce nastavení na ovládacím
panelu. Nabídka ovládání(P. 316)
33
Základní operace
Zadávání textu
6867-00L
Pro zadávání textu a hodnot slouží číselná tlačítka.
Přepnutí typu zadávaného textu
Stisknutím
přepnete typ zadávaného textu.
Typy textu, které lze zadat
Níže je uveden text, který lze zadat.
Tlačítko
A
a
(není k dispozici)
12
1
AÁÄBC
aáäbc
2
DEÉF
deéf
3
GHIÍ
ghií
4
JKL
jkl
5
MNOÓ
mnoó
6
34
Základní operace
PQRS
pqrs
7
TUÚŮV
tuúův
8
WXYZ
wxyz
9
(není k dispozici)
0
(mezera) @./-_!?&$%#()[]{}<>*+=",;:'^`|\ (není k dispozici)
● Stiskněte
, když je typ zadávaného textu <A> nebo <a>, čímž se zobrazí povolené symboly na
obrazovce. Pomocí
/
/
/
vyberte symbol, který chcete zadat, a stiskněte
.
Odstraňování textu
Každým stisknutím tlačítka
zadaný text.
je odstraněn jeden znak. Stisknutím a podržením tlačítka
Přesun kurzoru
Pomocí tlačítka
nebo
pohybujte kurzorem.
Zadání mezery
Stiskněte
, a stiskněte
.
Příklad zadávání znaků a číslic
Příklad : „Canon 1“
1
Opakovaně tiskněte tlačítko
, dokud není vybrána možnost <A>.
2
Opakovaně tiskněte tlačítko
, dokud není vybrán znak „C“.
3
Opakovaně tiskněte tlačítko
, dokud není vybrána možnost <a>.
4
Opakovaně tiskněte tlačítko
, dokud není vybráno písmeno „a“.
5
Opakovaně tiskněte tlačítko
, dokud není vybráno písmeno „n“.
6
Opakovaně tiskněte tlačítko
, dokud není vybráno písmeno „o“.
7
Opakovaně tiskněte tlačítko
, dokud není vybráno písmeno „n“.
8
Stiskněte
9
Opakovaně tiskněte tlačítko
10
Stiskněte tlačítko
11
Stiskněte tlačítko
, a stiskněte
.
, dokud není vybrána možnost <12>.
.
.
35
se smaže celý
Základní operace
Zapnutí/Vypnutí zařízení
6867-00R
Vypínač se používá k zapnutí tiskárny. Když se však tiskárna vypíná, dělejte to pomocí ovládacího panelu a nepoužívejte
hlavní vypínač. Postup je stejný jako při zapínání a vypínání počítače.
Zapnutí tiskárny(P. 36)
Vypnutí tiskárny (postup vypínání)(P. 36)
Zapnutí tiskárny
Stiskněte na tiskárně hlavní vypínač. Když se po provedení autodiagnostiky na displeji ovládacího panelu objeví hlavní
obrazovka, zařízení je připraveno k tisku.
● Po autodiagnostice se může zobrazit zpráva. Další informace naleznete v části „Odstraňování problémů
(FAQ)“ na webu s online příručkami.
● Pokud zadáte nastavení rychlého startu, můžete zkrátit čekací dobu po zapnutí.
tiskárny(P. 38)
Rychlé spuštění
Vypnutí tiskárny (postup vypínání)
Při vypínání tiskárny využijte ovládací panel.
Vypnutí tiskárny bez použití hlavního vypínače
● Pokud při vypínání stisknete hlavní vypínač, může dojít k neočekávané chybě. Při vypínání postupujte podle
níže uvedených pokynů.
● Pokud jste aktivovali funkci rychlého startu, můžete při vypínání tiskárny použít hlavní vypínač.
spuštění tiskárny(P. 38)
1
Stiskněte tlačítko
(
).
36
Rychlé
Základní operace
2
Pomocí tlačítek
3
Vyberte možnost <Ano> a stiskněte tlačítko
/
vyberte možnost <Vypínání> a stiskněte tlačítko
.
.
➠ Když se objeví níže uvedená zpráva, napájení se automaticky vypne.
Pokud se zobrazí <Nelze provést.>
● V tiskárně zůstala tisková data. Data vymažte (
(
znovu. Pro zrušení této operace stiskněte
Nabídka Resetovat(P. 472) ) a proveďte operaci
).
● Úplné vypnutí zařízení může trvat delší dobu. Neodpojujte napájecí šňůru, dokud se nevypne displej.
Nezapínejte napájení ihned po vypnutí.
● Počkejte 10 sekund nebo déle a zapněte napájení až potom.
Spotřeba energie po vypnutí
● Zařízení spotřebovává určité množství energie, i když je vypnuté. Chcete-li zcela vyloučit spotřebu energie,
vytáhněte zástrčku napájecího kabelu ze síťové zásuvky.
ODKAZY
Rychlé spuštění tiskárny(P. 38)
37
Základní operace
Rychlé spuštění tiskárny
6867-00S
Pokud nastavíte rychlý start tiskárny, můžete zkrátit čas mezi stisknutím hlavního vypínače a provozuschopností
obrazovek. Způsob vypnutí napájení s cílem provést rychlý start tiskárny se nazývá „rychlé vypnutí“.
Konfigurace nastavení rychlého spuštění(P. 38)
Vypnutí napájení (provedení rychlého vypnutí)(P. 39)
Pokud používáte síť
● Pokud je některé z níže uvedených nastavení <Zap>, funkce rychlého startu je deaktivována.
- RARP, BOOTP, IPv6
- IPSec
Síť(P. 145)
Konfigurace nastavení IPSec(P. 259)
Pokud používáte funkci MEAP
● Zkontrolujte, zda aktuálně nainstalované aplikace MEAP podporují funkci rychlého spuštění.
Konfigurace nastavení rychlého spuštění
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberte možnost <Rychlé spušt.hl.nap.> a stiskněte tlačítko
4
Vyberte možnost <Vyp> nebo <Zap> a stiskněte tlačítko
(
/
).
vyberte možnost <Nabídka ovládání> a stiskněte tlačítko
<Vyp>
Zakáže funkci rychlého spuštění.
<Zap>
Povolí funkci rychlého spuštění.
5
Proveďte tvrdý reset.
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
38
.
.
.
Základní operace
Vypnutí napájení (provedení rychlého vypnutí)
Pokud stisknete hlavní vypínač a tiskárnu vypnete, když je aktivována funkce rychlého spuštění, toto rychlé spuštění se
provede, když se příště tiskárna zapne (rychlé vypnutí).
Po provedení rychlého vypnutí napájecí kabel nevytahujte ze zásuvky
● Po provedení rychlého vypnutí napájecí kabel nevytahujte ze síťové zásuvky. Mohly by se poškodit vnitřní
součásti tiskárny. Než tiskárnu budete přenášet a budete muset vytáhnout vidlici ze zásuvky, tiskárnu
zapněte a poté proveďte standardní vypnutí. Vypnutí tiskárny (postup vypínání)(P. 36)
● Když tiskárna provádí nějakou úlohu nebo je ve stavu chyby nebo jste změnili nastavení pomocí ovládacího
panelu a Vzdáleného uživatelského rozhraní, stisknutím hlavního vypínače se nespustí rychlé vypnutí, ale
klasické vypnutí.
● Pokud se napájení vypne pomocí klasického postupu vypnutí i při aktivované funkci rychlého spuštění,
tiskárna se při dalším zapnutí spustí jako obvykle.
● Pokud nastavíte funkci časovače automatického vypnutí, když je aktivní funkce rychlého spuštění, provede se
rychlé vypnutí. Nastavení času automatického vypnutí(P. 69)
● Pokud po rychlém vypnutí tiskárnu ihned zapnete, může to určitou dobu trvat, než se tiskárna spustí.
39
Základní operace
Vkládání papíru
6867-00U
Papír můžete vložit do zásuvky na papír a do víceúčelového zásobníku. Papír, který používáte nejčastěji, vkládejte do
zásuvky na papír. Zásuvka na papír je vhodná, pokud používáte velké množství papíru. Víceúčelovou přihrádku
používejte v případě, že potřebujete dočasně použít jinou velikost nebo typ papíru, než jaký je vložen do zásuvky na
papír. Dostupné velikosti a typy papíru naleznete v části Použitelný papír(P. 553) .
Informace o papíru
Bezpečnostní opatření týkající se papíru(P. 40)
Uchování papíru potištěného tímto strojem(P. 41)
Jak vkládat papír
Vkládání papíru do zásuvky na papír(P. 42)
Vkládání papíru do víceúčelové přihrádky(P. 48)
Vkládání obálek nebo pohlednic(P. 51)
Vkládání předtištěného papíru(P. 55)
Konfigurace nastavení pro vložený papír
Zadání velikosti a typu papíru(P. 59)
Bezpečnostní opatření týkající se papíru
Nepoužívejte následující typy papíru:
● Může dojít k zachycení papíru nebo chybě tisku.
- Zvrásněný nebo pomačkaný papír
- Zvlněný nebo stočený papír
- Potrhaný papír
- Zvlhlý papír
- Velmi tenký papír
- Tenký hrubý papír
- Papír vytištěný tiskárnou s termickým přenosem
- Zadní strana papíru vytištěného tiskárnou s termickým přenosem
- Papír s výraznou texturou
- Lesklý papír
Poznámky k používání papíru
● Používejte pouze papír, který je zcela aklimatizovaný na prostředí, v němž je zařízení nainstalováno. Papír,
který byl skladován za odlišných podmínek teploty nebo vlhkosti, může způsobit zachycení papíru nebo snížit
kvalitu tisku.
40
Základní operace
Manipulace s papírem a jeho skladování
● Papír se doporučuje použít co nejdříve po vybalení. Nevyužitý papír je třeba přikrýt původním balicím
papírem a skladovat na rovném povrchu.
● Papír skladujte zabalený v původním obalu, aby byl chráněn před vlhkostí či vyschnutím.
● Neskladujte papír tak, že by se mohl zvlnit nebo zohýbat.
● Neskladujte papír svisle a neukládejte na sebe příliš velké množství papíru.
● Papír neskladujte na přímém slunečním světle nebo na místě vystaveném vysoké vlhkosti, suchu nebo
výrazným změnám teploty a vlhkosti.
Při tisku na navlhlý papír
● V oblasti výstupu papíru se může tvořit pára, případně se kolem oblasti výstupu papíru mohou tvořit kapky
vody. Tyto jevy jsou zcela obvyklé, důvodem je teplo vznikající při fixaci toneru na papír, které způsobuje
odpařování vlhkosti obsažené v papíru (k této situaci dochází zejména při nízké pokojové teplotě).
Uchování papíru potištěného tímto strojem
Při manipulaci s papírem potištěným na tomto stroji a jeho uchovávání dodržujte následující bezpečnostní opatření.
◼ Jak potištěný papír skladovat
● Papír uchovávejte na rovné ploše.
● Papír neskladujte spolu s předměty vyrobenými z PVC (polyvinylchlorid), jako jsou průsvitné fólie. Toner se může
roztavit a způsobit přichycení papíru k předmětům z PVC.
● Dbejte na to, aby se papír nepřehnul nebo nepomačkal. Toner může odloupnout.
● Chcete-li výtisky uchovávat po dlouhou dobu (dva roky a déle), použijte např. šanon.
● Při delším skladování může papír vyblednout a může se zdát, že tisk změnil barvu.
● Neskladujte na místě s vysokou teplotou.
◼ Upozornění k používání lepidla
● Používejte vždy nerozpustné lepidlo.
● Před nanesením lepidla si to vyzkoušejte na nepotřebném výtisku.
● Než dáte listy papíru s naneseným lepidlem na sebe, nechte lepidlo úplně uschnout.
41
Základní operace
Vkládání papíru do zásuvky na papír
6867-00W
1660-02Y
Papír, který používáte nejčastěji, vložte do zásuvky na papír. Pokud chcete tisknout na papír, který není vložen do
zásuvky na papír, použijte k vložení papíru víceúčelovou přihrádku. Vkládání papíru do víceúčelové
přihrádky(P. 48)
Vkládání papíru standardní velikosti(P. 42)
Vložení papíru vlastní velikosti(P. 45)
Orientace papíru
V níže uvedené tabulce je uvedena správná orientace papíru při vkládání.
Papír
Orientace
A3, B4, A4 (na šířku),
B5 (na šířku), A5 (na šířku),
Ledger, Legal, Letter (na šířku),
Executive (na šířku), Foolscap,
8K, 16K (na šířku), Indian Legal,
Vlastní (na šířku)
A4 (na výšku), B5 (na výšku),
A5 (na výšku), Letter (na výšku),
Executive (na výšku), 16K (na výšku),
Vlastní (na výšku)
● Pokud vkládáte papír do volitelného podavače papíru nebo kazetové podávací jednotky, postupujte
následujícím způsobem.
Vkládání papíru standardní velikosti
Pro zavedení papíru, jehož velikost je uvedena na značkách velikostí papíru na zásuvce na papír, postupujte podle
následujícího postupu. V případě papíru, jehož velikost není uvedena na značkách velikostí papíru, viz Vložení
papíru vlastní velikosti(P. 45) .
1
Zásuvku na papír vytáhněte, dokud se nezarazí.
2
Upravte polohy vodítek papíru podle formátu papíru, který chcete použít.
42
Základní operace
● Stiskněte uvolňovací páčku (
) pro zarovnání výstupu (
) podle příslušné značky velikostí papíru.
Při vkládání papíru do volitelného podavače papíru nebo kazetové podávací jednotky
● Při vkládání papíru formátu A3 nebo Ledger nastavte páčku (
3
) podle obrázku.
Vložte papír tak, aby byl okraj sady papíru vyrovnaný podle vodítka papíru na levé
straně zásuvky na papír.
● Papír vložte potiskovanou stranou nahoru.
● Stoh papíru prolistujte a sklepněte okraje o rovnou plochu.
Při vkládání nepřekračujte rysku pro maximální množství papíru
● Stoh papíru nesmí přesáhnout linku maximálního množství (
způsobit zachycení papíru.
43
). Vložení velkého množství papíru může
Základní operace
● Postup pro vkládání obálek nebo papíru s logem naleznete v části
papíru(P. 55) .
4
Zavřete zásuvku na papír.
»
Pokračujte částí
Vkládání předtištěného
Zadání velikosti a typu papíru v zásuvce na papír(P. 60)
Při změně velikosti a typu papíru
● Po každé změně velikosti nebo typu papíru vždy zkontrolujte nastavení. Pokud neexistuje shoda mezi
nastavením u vloženého papíru a konfigurovaným nastavením papíru, nebude tisk proveden správně.
Automatická detekce typu papíru
● Zařízení má funkci automatické detekce typu papíru. Pokud je tato funkce povolena, není nutné měnit
nastavení typu papíru, když vložíte běžný nebo těžký papír. Auto.zjist. typ pap.(P. 478)
● Pro tisk z operačního systému, který nepodporuje ovladače tiskárny, nebo z mobilního zařízení nebo z jiného
zařízení, které nepodporuje velikost papíru a nastavení typu, určete <Standard. vel.papíru> a <Výchozí typ
papíru>. Nabídka Vybrat podavač(P. 474)
Tisk na zadní stranu potištěného dokumentu (ruční oboustranný tisk)
Zařízení umožňuje tisk na zadní stranu potištěného papíru. Vyrovnejte možné zvlnění potištěného papíru a
vložte ho do víceúčelové přihrádky ( Vkládání papíru do víceúčelové přihrádky(P. 48) ) prázdnou stranou
nahoru (již potištěnou stranou dolů).
● Když chcete tisknout na zadní stranu papíru, který je již potištěn, nastavte na ovládacím panelu v nabídce
nastavení možnost <Ruční 2str.(V.Ú.př.)> na <2. strana>. Ruční 2str.(V.Ú.př.)(P. 481)
● Je možné tisknout vždy pouze na jeden list papíru.
● Používejte pouze papír potištěný na tomto zařízení.
● Není možné tisknout na stejnou stranu papíru, která již byla potištěna.
44
Základní operace
Vložení papíru vlastní velikosti
Pro zavedení papíru vlastní velikosti nebo papíru, jehož velikost není uvedena na značkách velikostí papíru na zásuvce
na papír, postupujte podle následujícího postupu.
1
Zásuvku na papír vytáhněte, dokud se nezarazí.
2
Roztáhněte vodítka papíru.
● Stiskněte uvolňovací páčku a vysuňte vodítka papíru ven.
3
Vložte papír tak, aby byl okraj sady papíru vyrovnaný s pravou stranou zásuvky na
papír.
● Stoh papírů vložte potiskovanou stranou nahoru.
● Stoh papíru prolistujte a sklepněte okraje o rovnou plochu.
Při vkládání nepřekračujte rysku pro maximální množství papíru
● Stoh papíru nesmí přesáhnout linku maximálního množství (
způsobit zachycení papíru.
45
). Vložení velkého množství papíru může
Základní operace
● Postup pro vkládání obálek nebo papíru s logem naleznete v části
papíru(P. 55) .
4
Vkládání předtištěného
Vyrovnejte vodítka papíru podle okrajů papíru.
● Stiskněte uvolňovací páčku a přisuňte vodítka papíru k sobě a pevně je vyrovnejte podle okrajů papíru.
Vodítka papíru zarovnejte přesně podle okrajů papíru
● Pokud jsou vodítka papíru příliš volná nebo příliš těsná, může dojít k nesprávnému podávání nebo k
zachycení papíru.
Při vkládání papíru do volitelného podavače papíru nebo kazetové podávací jednotky
● Jestliže páčka (
) brání správnému vkládání papíru, například pokud je papír zvednutý nebo na šikmo,
vyjměte papír a nastavte polohu páčky dle velikosti papíru. Poté znovu vložte papír a nastavte polohu
vodítek papíru.
46
Základní operace
5
Zavřete zásuvku na papír.
»
Pokračujte částí
Zadání velikosti a typu papíru v zásuvce na papír(P. 60)
Při změně velikosti a typu papíru
● Pokud do zařízení vložíte papír jiné velikosti nebo jiného typu, nezapomeňte změnit nastavení. Pokud
nastavení velikosti nebo typu papíru nezměníte, zařízení nebude tisknout správně.
Automatická detekce typu papíru
● Zařízení má funkci automatické detekce typu papíru. Pokud je tato funkce povolena, není nutné měnit
nastavení typu papíru, když vložíte běžný nebo těžký papír. Auto.zjist. typ pap.(P. 478)
● Pro tisk z operačního systému, který nepodporuje ovladače tiskárny, nebo z mobilního zařízení nebo z jiného
zařízení, které nepodporuje velikost papíru a nastavení typu, určete <Standard. vel.papíru> a <Výchozí typ
papíru>. Nabídka Vybrat podavač(P. 474)
Tisk na zadní stranu potištěného dokumentu (ruční oboustranný tisk)
Zařízení umožňuje tisk na zadní stranu potištěného papíru. Vyrovnejte možné zvlnění potištěného papíru a
vložte ho do víceúčelové přihrádky ( Vkládání papíru do víceúčelové přihrádky(P. 48) ) prázdnou stranou
nahoru (již potištěnou stranou dolů).
● Když chcete tisknout na zadní stranu papíru, který je již potištěn, nastavte na ovládacím panelu v nabídce
nastavení možnost <Ruční 2str.(V.Ú.př.)> na <2. strana>. Ruční 2str.(V.Ú.př.)(P. 481)
● Je možné tisknout vždy pouze na jeden list papíru.
● Používejte pouze papír potištěný na tomto zařízení.
● Není možné tisknout na stejnou stranu papíru, která již byla potištěna.
ODKAZY
Použitelný papír(P. 553)
47
Základní operace
Vkládání papíru do víceúčelové přihrádky
6867-00X
1660-030
Pokud chcete tisknout na papír, který není vložen do zásuvky na papír, vložte papír do víceúčelové přihrádky.
Vkládání papíru do zásuvky na papír(P. 42)
Orientace papíru
V níže uvedené tabulce je uvedena správná orientace papíru při vkládání.
Papír
Orientace
A3, B4, A4 (na šířku),
B5 (na šířku), A5 (na šířku),
A6 (na šířku), Ledger, Legal,
Letter (na šířku),
Statement (na šířku),
Executive (na šířku),
Foolscap, 305 x 457 mm / 12 x 18 in,
Indian Legal, 8K,
16K (na šířku), Kartotéka,
Pohlednice, Odpovědní lístek,
Obálka, Vlastní (na šířku)
A4 (na výšku), A5 (na výšku),
B5 (na výšku), Letter (na výšku),
Executive (na výšku),
Statement (na výšku),
16K (na výšku),
4 na 1 pohlednici, Vlastní (na výšku)
1
Otevřete kryt.
2
Vytáhněte přihrádku na papír.
3
Roztáhněte vodítka papíru.
● Stiskněte uvolňovací páčku a vysuňte vodítka papíru ven.
48
Základní operace
4
Vložte papír do víceúčelové přihrádky nadoraz.
● Papír vložte potiskovanou stranou dolů.
● Stoh papíru prolistujte a sklepněte okraje o rovnou plochu.
Při vkládání papíru dbejte na to, aby papír nepřesahoval limitní značku maximálního množství.
● Stoh papíru nesmí přesáhnout limitní značku maximálního množství (
). Uložení velkého množství
papíru může způsobit zachycení papíru.
● Postup pro vkládání obálek nebo papíru s logem naleznete v části
pohlednic(P. 51) nebo Vkládání předtištěného papíru(P. 55) .
5
Vkládání obálek nebo
Vyrovnejte vodítka papíru podle okrajů papíru.
● Stiskněte uvolňovací páčku a přisuňte vodítka papíru k sobě a pevně je vyrovnejte podle okrajů papíru.
49
Základní operace
Vodítka papíru zarovnejte přesně podle okrajů papíru
● Pokud jsou vodítka papíru příliš volná nebo příliš těsná, může dojít k nesprávnému podávání nebo k
zachycení papíru.
»
Pokračujte částí
Zadání velikosti a typu papíru ve víceúčelové přihrádce(P. 63)
Při změně velikosti a typu papíru
● Výchozí nastavení velikosti a typu papíru je <A4> a <Smíšené typy>. Pokud do zařízení vložíte papír jiné
velikosti nebo typu, musíte změnit příslušné nastavení. Pokud nastavení velikosti nebo typu nezměníte,
zařízení nebude tisknout správně.
Automatická detekce typu papíru
● Zařízení má funkci automatické detekce typu papíru. Pokud je tato funkce povolena, není nutné měnit
nastavení typu papíru, když vložíte běžný nebo těžký papír. Auto.zjist. typ pap.(P. 478)
● Pro tisk z operačního systému, který nepodporuje ovladače tiskárny, nebo z mobilního zařízení nebo z jiného
zařízení, které nepodporuje velikost papíru a nastavení typu, určete <Standard. vel.papíru> a <Výchozí typ
papíru>. Nabídka Vybrat podavač(P. 474)
Tisk na zadní stranu potištěného dokumentu (ruční oboustranný tisk)
Zařízení umožňuje tisk na zadní stranu potištěného papíru. Vyrovnejte možné zvlnění potištěného papíru a
vložte ho do víceúčelové přihrádky prázdnou stranou dolů (již potištěnou stranou nahoru).
● Když chcete tisknout na zadní stranu papíru, který je již potištěn, nastavte na ovládacím panelu v nabídce
nastavení možnost <Ruční 2str.(V.Ú.př.)> na <2. strana>. Ruční 2str.(V.Ú.př.)(P. 481)
● Je možné tisknout vždy pouze na jeden list papíru.
● Používejte pouze papír potištěný na tomto zařízení.
● Není možné tisknout na stejnou stranu papíru, která již byla potištěna.
ODKAZY
Použitelný papír(P. 553)
50
Základní operace
Vkládání obálek nebo pohlednic
6867-00Y
Před vložením obálek nebo pohlednic proveďte nějaké přípravy, například vyrovnejte možné zvlnění obálek. Také dejte
pozor na orientaci obálek nebo pohlednic a stranu, kterou jsou otočeny nahoru. Pamatujte, že obálky ani pohlednice
nelze vkládat do zásuvky na papír.
Vkládání obálek(P. 51)
Vkládání pohlednic(P. 53)
● Tato část popisuje vkládání obálek v požadované orientaci a postupy, které je třeba před vložením obálek
nebo pohlednic provést. Obecný postup vkládání obálek nebo pohlednic do víceúčelové přihrádky naleznete
v části Vkládání papíru do víceúčelové přihrádky(P. 48) .
Vkládání obálek
◼ Než vložíte obálky
Před vložením obálek je třeba obálky připravit následujícím způsobem.
1
Zavřete chlopně všech obálek.
2
Zmáčkněte je, abyste vytlačili přebytečný vzduch a pevně stiskněte okraje.
3
Uvolněte nepoddajné rohy obálek a vyrovnejte zvlnění.
51
Základní operace
4
Okraje obálek zarovnejte na rovném povrchu.
◼ Vkládání obálek do víceúčelové přihrádky
Obálky vložte v orientaci na výšku (kratší stranou směrem k zařízení) stranou bez lepidla (přední stranou) dolů. Nelze
tisknout na opačnou stranu obálek.
Obálky YOUGATANAGA 3, ISO-C5, Monarch, No. 10 (COM10) nebo DL
Obálky vložte tak, aby okraj s chlopní směřoval k pravé straně, jak ukazuje obrázek.
Obálky KAKUGATA 2 nebo NAGAGATA 3
Vložte oválku tak, aby klopa byla směrem k vám.
52
Základní operace
Vkládání pohlednic
● V případě pohlednic není automatický oboustranný tisk možný. Pokud chcete na pohlednici tisknout z obou
stran, nejprve tiskněte na jednu stranu a potom na druhou.
● Před vložením pohlednic vyrovnejte možné zvlnění. V případě zvlnění by výtisky mohly být našikmo nebo by s
obrázky mohly vytisknout zkresleně.
◼ Vkládání pohlednic do víceúčelové přihrádky
Vložte pohlednici potiskovanou stranou dolů a kratší stranou směrem k zařízení.
Pohlednice
Vložte pohlednici horním koncem směrem k zařízení.
Odpovědní pohlednice
Rozbalte pohlednici a vložte ji pravou stranou směrem k zařízení.
53
Základní operace
Pohlednice 4 na 1
Vložte pohlednici tak, aby pravá strana směřovala ke stroji.
54
Základní operace
Vkládání předtištěného papíru
6867-010
Používáte-li papír s předtištěným logem, při jeho vkládání dávejte pozor na jeho orientaci. Papír vložte tak, aby se
potiskla správná strana papíru s logem.
Vytvoření jednostranných výtisků na papír s logem(P. 55)
Vytvoření oboustranných výtisků na papír s logem(P. 56)
● Tato část popisuje způsob vložení předtištěného papíru správnou stranou nahoru a ve správné orientaci.
Obecný postup vkládání papíru do zásuvky na papír nebo do víceúčelové přihrádky naleznete dále.
Vkládání papíru do zásuvky na papír(P. 42)
Vkládání papíru do víceúčelové přihrádky(P. 48)
Vytvoření jednostranných výtisků na papír s logem
Tisk na papír s logem v orientaci na výšku
Při vkládání papíru do zásuvky na papír
Papír vložte stranou s logem (tiskovou stranou) nahoru.
Při vkládání papíru do víceúčelové přihrádky
Papír vložte stranou s logem (tiskovou stranou) dolů.
55
Základní operace
Tisk na papír s logem v orientaci na šířku
Při vkládání papíru do zásuvky na papír
Papír vložte stranou s logem (tiskovou stranou) nahoru.
Při vkládání papíru do víceúčelové přihrádky
Papír vložte stranou s logem (tiskovou stranou) dolů.
Vytvoření oboustranných výtisků na papír s logem
Když má tisknutý dokument lichý počet stran, nastavte na ovládacím panelu v nabídce nastavení možnost <Alternativní
způsob> na <Vyp>. Alternativní způsob(P. 360)
56
Základní operace
Tisk na papír s logem v orientaci na výšku
Při vkládání papíru do zásuvky na papír
Papír vložte stranou s logem (tiskovou stranou pro první stranu dokumentu) nahoru.
Při vkládání papíru do víceúčelové přihrádky
Papír vložte stranou s logem (tiskovou stranou pro první stranu dokumentu) nahoru.
Tisk na papír s logem v orientaci na šířku
Při vkládání papíru do zásuvky na papír
Papír vložte stranou s logem (tiskovou stranou pro první stranu dokumentu) nahoru.
57
Základní operace
Při vkládání papíru do víceúčelové přihrádky
Papír vložte stranou s logem (tiskovou stranou pro první stranu dokumentu) nahoru.
Nastavení <Způsob podávání pap.>
● Při tisku na předtištěný papír je potřeba obrátit vložený papír vždy, když změníte jednostranný režim tisku na
oboustranný a naopak. Je-li však možnost <Způsob podávání pap.> nastavena na hodnotu <Priorita tisk.
str.>, otočení tiskové strany předtištěného papíru při oboustranném tisku (u zásuvky na papír stranou s
logem směrem dolů nebo u víceúčelové přihrádky směrem nahoru) lze použít také při jednostranném tisku.
Toto nastavení je užitečné zejména v případě, kdy často střídáte režim jednostranného a oboustranného
tisku. Způsob podávání pap.(P. 395)
58
Základní operace
Zadání velikosti a typu papíru
6867-011
Vždy je třeba nastavit velikost a typ vloženého papíru. Pokud jste vložili do zařízení papír s jinými parametry než měl
předchozí papír, je třeba změnit nastavení papíru.
● Pokud nastavení neodpovídá skutečné velikosti a typu vloženého papíru, může dojít k zachycení papíru nebo
k tiskové chybě.
59
Základní operace
Zadání velikosti a typu papíru v zásuvce na papír
6867-012
Zadejte velikost a typ papíru podle toho, jaký papír vložíte do zásuvky na papír.
1
Stiskněte tlačítko
2
Pomocí
/
5> a stiskněte
( ).
vyberte jednu z možností <Vel.pap. v zásuvce 1> až <Vel.pap. v zásuvce
.
● <Vel.pap. v zásuvce 2> až <Vel.pap. v zásuvce 5> se zobrazí, když je nainstalován volitelný podavač papíru
nebo kazetová podávací jednotka.
3
Vyberete velikost a typ papíru a stiskněte tlačítko
.
Informace o možnosti <Auto>
● U následujících velikostí papíru zadejte <Auto>.
- A3
- Ledger
- B4
- Legal
- A4
- Letter
- B5 (na výšku)
- Executive (na výšku)
- A5 (na výšku)
Velikosti papíru, které je možné vložit v orientaci na výšku nebo na šířku
● Papír následujících velikostí je možné vložit v orientaci buď na výšku, nebo na šířku. Chcete-li vybrat
nastavení podle orientace papíru, viz tabulka níže.
Velikost papíru
Orientace
A4
Nastavení
<Auto>
<Auto>
A5
*1
<
A5R>
60
Základní operace
Velikost papíru
Orientace
Nastavení
<Auto>
B5
<
B5R>
<Auto>
Letter
<Auto>
<Auto>
Executive
<
EXECR>
<Auto>
16K
Uživatelská velikost papíru
*2
<
16KR>
<
16K>
<
Vlastní vel. R>
<
Vlastní vel.>
*1 Pokud
používáte ovladač tiskárny Ovladač Canon Generic UFR II, před tiskem zaškrtněte políčko [Podávat
standardní velikosti papíru svisle] na kartě [Zdroj papíru].
*2 Pokud
používáte ovladač tiskárny Ovladač Canon Generic UFR II, před tiskem zaškrtněte políčko [Podávat vlastní
papír svisle] na kartě [Zdroj papíru].
Možnost <Volná velikost>
● Pokud často měníte velikost papíru určeného k vkládání, můžete specifikovat <Volná velikost>, což vám
usnadní práci, protože nemusíte zadávat velikost papíru při každém tisku. Vezměte však na vědomí, že toto
nastavení umožňuje zařízení provádět tisk, i když není shoda mezi nastavením typu papíru v ovladači
tiskárny a velikostí papíru vloženého do zařízení.
● Pokud vyberete možnost <Volná velikost>, rychlost tisku bude nižší.
4
Vyberte jeden z <Typ pap. v zásuvce 1> až <Typ pap. v zásuvce 5> a stiskněte
.
● <Typ pap. v zásuvce 2> až <Typ pap. v zásuvce 5> se zobrazí, když je nainstalován volitelný podavač papíru
nebo kazetová podávací jednotka.
61
Základní operace
5
Vyberte typ papíru a stiskněte tlačítko
.
Možnost <Smíšené typy>
● Pokud často měníte velikost papíru určeného k vkládání, můžete specifikovat <Smíšené typy>, což vám
usnadní práci, protože nemusíte zadávat typ papíru při každém tisku. Vezměte však na vědomí, že toto
nastavení umožňuje zařízení provádět tisk, i když není shoda mezi nastavením typu papíru v ovladači
tiskárny a typem papíru vloženým do zařízení.
Automatická detekce typu papíru
● Zařízení má funkci automatické detekce typu papíru. Pokud je tato funkce povolena, není nutné měnit
nastavení typu papíru, když vložíte běžný nebo těžký papír. Auto.zjist. typ pap.(P. 478)
ODKAZY
Vkládání papíru do zásuvky na papír(P. 42)
Použitelný papír(P. 553)
62
Základní operace
Zadání velikosti a typu papíru ve víceúčelové přihrádce
6867-013
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberete velikost a typ papíru a stiskněte tlačítko
( ).
/
vyberte možnost <Vel.pap.ve vú.přihr.> a stiskněte tlačítko
.
.
Velikosti papíru, které je možné vložit v orientaci na výšku nebo na šířku
● Papír následujících velikostí je možné vložit v orientaci buď na výšku, nebo na šířku. Chcete-li vybrat
nastavení podle orientace papíru, viz tabulka níže.
Velikost papíru
Orientace
A4
B5
A5
Letter
*1
Nastavení
<
A4R>
<
A4>
<
B5R>
<
B5>
<
A5R>
<
A5>
<
LTRR>
<
LTR>
63
Základní operace
Velikost papíru
Orientace
Executive
16K
Statement
Uživatelská velikost papíru
*2
Nastavení
<
EXECR>
<
EXEC>
<
16KR>
<
16K>
<
STMTR>
<
STMT>
<
Vlastní vel. R>
<
Vlastní vel.>
*1 Pokud
používáte ovladač tiskárny Ovladač Canon Generic UFR II, před tiskem zaškrtněte políčko [Podávat
standardní velikosti papíru svisle] na kartě [Zdroj papíru].
*2 Pokud
používáte ovladač tiskárny Ovladač Canon Generic UFR II, před tiskem zaškrtněte políčko [Podávat vlastní
papír svisle] na kartě [Zdroj papíru].
Možnost <Volná velikost>
● Pokud často měníte velikost papíru určeného k vkládání, můžete specifikovat <Volná velikost>, což vám
usnadní práci, protože nemusíte zadávat velikost papíru při každém tisku. Vezměte však na vědomí, že toto
nastavení umožňuje zařízení provádět tisk, i když není shoda mezi nastavením typu papíru v ovladači
tiskárny a velikostí papíru vloženého do zařízení.
● Pokud vyberete možnost <Volná velikost>, rychlost tisku bude nižší.
4
Vyberte možnost <Typ.pap.ve vú.přihr.> a stiskněte tlačítko
5
Vyberte typ papíru a stiskněte tlačítko
Možnost <Smíšené typy>
64
.
.
Základní operace
● Pokud často měníte velikost papíru určeného k vkládání, můžete specifikovat <Smíšené typy>, což vám
usnadní práci, protože nemusíte zadávat typ papíru při každém tisku. Vezměte však na vědomí, že toto
nastavení umožňuje zařízení provádět tisk, i když není shoda mezi nastavením typu papíru v ovladači
tiskárny a typem papíru vloženým do zařízení.
Automatická detekce typu papíru
● Zařízení má funkci automatické detekce typu papíru. Pokud je tato funkce povolena, není nutné měnit
nastavení typu papíru, když vložíte běžný nebo těžký papír. Auto.zjist. typ pap.(P. 478)
ODKAZY
Vkládání papíru do víceúčelové přihrádky(P. 48)
Použitelný papír(P. 553)
65
Základní operace
Úspora energie
6867-014
Můžete ušetřit energii, když nastavíte, aby zařízení automaticky přešlo do úsporného režimu (režim spánku) nebo se
automaticky vypnulo, pokud se po stanovenou dobu neprovede žádná operace nebo když nastavíte, že se zařízení má
v určenou dobu každý den v týdnu automaticky vypnout.
Přepnutí do režimu spánku(P. 67)
Nastavení času automatického vypnutí(P. 69)
66
Základní operace
Přepnutí do režimu spánku
6867-015
Funkce režim spánku snižuje množství energie spotřebované zařízením vypnutím ovládacího panelu. Pokud bude
zařízení po určitou dobu v nečinnosti, např. během přestávky na oběd, můžete ušetřit energii pouhým stisknutím
na ovládacím panelu. Můžete také nastavit čas automatického přepnutí do režimu spánku, pokud víte, že
tlačítka
bude zařízení po určitou dobu v nečinnosti. Můžete změnit interval, po němž se aktivuje funkce automatického spánku
nebo uvést tiskárnu do režimu spánku v určenou hodinu.
V režimu spánku
se rozsvítí zeleně.
● Pokud zařízení přejde do režimu spánku, tlačítko
Situace, kdy zařízení nepřejde do režimu spánku
● Tiskárna nepřejde do režimu spánku, když přijímá data z počítače, nebo je na něj odesílá, když je nějaký kryt
otevřený nebo když není vložena kazeta s tonerem.
Výběr úrovně režimu spánku
Stupeň snížení spotřeby energie v režimu spánku se liší podle vybrané úrovně režimu ( Režim
spánku(P. 316) ). Chcete-li účinně ušetřit energii, doporučujeme používat přístroj s výchozím továrním
nastavením pro úroveň režimu spánku. Pokud chcete změnit nastavení, postupujte podle níže uvedeného
postupu.
(
)
<Nabídka ovládání>
<Režim spánku>
<Vysoká (Hlub.spánek)> nebo
<Stř. (spánek tisk.)>
Změna času uvedení do režimu spánku
Přístroj automaticky přejde do režimu spánku po nastavené době nečinnosti. V zájmu maximální úspory energie
doporučujeme používat výchozí tovární nastavení ( Auto. čas spánku(P. 317) ). Pokud chcete změnit dobu,
která uplyne před provedením automatického spánku, postupujte podle níže uvedeného postupu.
(
)
<Nabídka ovládání>
<Auto. čas spánku>
67
Vyberte čas
Základní operace
● Ihned po zapnutí zařízení může být doba, která uplyne před přechodem zařízení do režimu spánku,
delší než doba uvedená v nabídce.
Automatické spuštění/ukončení režimu spánku ve stanovené době
Tiskárnu můžete nastavit tak, aby se přepnula do režimu spánku ve stanoveném čase. Můžete také nastavit čas,
kdy se režim spánku ukončí.
(
)
<Nabídka ovládání>
nebo <Časovač spánku>
spánku>
<Nastavení časovače>
<Zap>
<Časovač probuzení>
<Čas probuzení> nebo <Čas
Zadejte čas
<Časovač probuzení>
Chcete-li automaticky ukončit režim spánku ve stanoveném čase, zadejte <Zap>.
<Čas probuzení>
Nastavte čas, kdy se má režim spánku automaticky ukončit.
<Časovač spánku>
Chcete-li automaticky spustit režim spánku ve stanoveném čase, zadejte<Zap>.
<Čas spánku>
Nastavte čas, kdy se má režim spánku automaticky spustit.
Když chcete zabránit tomu, aby tiskárna přešla do režimu spánku, pokud dojde k chybě
Můžete zadat nastavení tak, aby zařízení při výskytu chyby nepřecházelo do režimu spánku.
chybě(P. 317)
(
)
<Nabídka ovládání>
<Spánek i při chybě>
Přechod z režimu spánku
Stiskněte tlačítko
.
68
<Vyp>
Spánek i při
Základní operace
Nastavení času automatického vypnutí
6867-016
Můžete zařízení nakonfigurovat tak, aby se automaticky vypnulo, pokud jej delší dobu nikdo používá. Zařízení lze také
nastavit tak, aby se vypnulo v zadaný čas. Tyto funkce vám umožňují předcházet zbytečné spotřebě energie, k níž
dochází, když se napájení nevypne. Ve výchozím továrním nastavení je tato funkce aktivována.
● Pokud zadáte kratší čas do automatického vypnutí, než je čas ve výchozím nastavení (4 hodiny), může to
zkrátit životnost tonerových kazet.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Nabídka ovládání]
4
Nastavení času automatického vypnutí.
69
[Editovat].
Spuštění
Základní operace
[Použít časovač automatického vypnutí]
Zaškrtněte políčko pro vypnutí napájení, když uplyne čas nastavený v možnosti [Čas do automatického
vypnutí].
[Čas do automatického vypnutí]
Určete, na kolik hodin má být přístroj vypnut od přestupu do režimu spánku.
[Nastavit týdenní časovač automatického vypnutí]
Zaškrtněte políčko nastavení automatického vypnutí pro každý den v týdnu.
[Neděle] až [Sobota]
Zadejte čas vypnutí napájení. Pokud není zadán žádný čas, není automatické vypnutí nastaveno na den v
týdnu.
5
Klikněte na tlačítko [OK].
Pokud se zdá, že se vypínání nedokončilo
● Úplné vypnutí zařízení může trvat delší dobu. Neodpojujte napájecí šňůru, dokud se nevypne displej.
70
Základní operace
Situace, které mohou způsobit selhání automatického vypnutí napájení v zadaný čas
● Na tiskárně provádíte nějakou operaci.
● Tiskárna právě tiskne, čistí se nebo provádí nějakou jinou operaci.
● Je zobrazena chybová zpráva.
Pokud nelze napájení vypnout automaticky v zadaném čase, provede se v intervalu po 1 minutě opakovaný
pokus, a to až 10krát. Pokud nelze napájení vypnout ani po deseti opakovaných pokusech, automatické vypnutí
v daném dnu se neprovede.
71
Tisk dokumentu
Tisk dokumentu
Tisk dokumentu ................................................................................................................................................ 73
Tisk z počítače ...................................................................................................................................................... 74
Zrušení tisku ................................................................................................................................................... 77
Různé způsoby tisku ............................................................................................................................................ 79
Tisk z paměti USB (Přímý tisk z USB) ............................................................................................................... 81
Změna výchozích nastavení tisku USB ...................................................................................................... 90
Tisk dokumentu zabezpečeného kódem PIN (zabezpečený tisk) ..................................................................... 92
Použití šifrovaného tisku .......................................................................................................................... 95
Tisk dokumentu uloženého v tiskárně (tisk uložené úlohy) ............................................................................. 96
Vymazání dokumentu uloženého v tiskárně .......................................................................................... 100
Nastavení názvu a kódu PIN pro box ..................................................................................................... 104
Tisk bez otevření souboru (přímý tisk) .......................................................................................................... 106
Nastavení tisku pro přímý tisk ............................................................................................................... 109
Tisk přijatých e-mailů (tisk e-mailů) ............................................................................................................... 120
72
Tisk dokumentu
Tisk dokumentu
6867-017
V této části je popsáno, jak tisknout dokumenty vytvořené na vašem počítači, jak tisknout soubory uložené na
paměťovém zařízení USB a jak tisknout dokumenty zadáním kódu PIN z ovládacího panelu.
◼ Tisk z počítače
Dokument vytvořený v počítači lze tisknout pomocí ovladače tiskárny.
Tisk z počítače(P. 74)
◼ Používání užitečných funkcí tisku
Tiskové funkce můžete použít pro tisk souborů uložených na paměťovém zařízení USB pomocí připojení tohoto zařízení
přímo k tiskárně bez využití počítače a nastavením požadavku, že se před zahájením tisku musí zadat kód PIN. Různé
způsoby tisku(P. 79)
73
Tisk dokumentu
Tisk z počítače
6867-018
Pomocí ovladače tiskárny lze tisknout dokument vytvořený pomocí aplikace v počítači. Ovladač tiskárny zahrnuje
užitečná nastavení, například zvětšení/zmenšení a oboustranný tisk, díky nimž lze dokumenty tisknout mnoha
způsoby. Než budete moci tuto funkci použít, je třeba provést některé kroky, například nainstalovat do počítače
ovladač tiskárny. Další informace najdete v příručkách k příslušným ovladačům na webu s online příručkami.
Nápověda k ovladači tiskárny(P. 74)
Použití volitelných položek(P. 74)
Základní operace tisku(P. 75)
Nápověda k ovladači tiskárny
Obrazovku nápovědy zobrazíte kliknutím na možnost [Nápověda] na obrazovce ovladače tiskárny. Na této obrazovce
najdete podrobné popisy, které Uživatelská příručka neuvádí.
Použití volitelných položek
Je-li k zařízení připojen volitelný podavač papíru nebo kazetová podávací jednotka, proveďte v ovladači tiskárny
následující postup.
● Před prováděním tohoto postupu se přihlaste k počítači s účtem správce.
Otevřete složku tiskáren ( Zobrazení složky tiskárny(P. 608) ) Klikněte pravým tlačítkem na
ikonu ovladače tiskárny pro toto zařízení [Vlastnosti tiskárny] nebo [Vlastnosti] karta [Nastavení
zařízení] [Zdroj papíru] Vyberte zdroj papíru [OK] [OK]
74
Tisk dokumentu
Základní operace tisku
Tato část popisuje postup tisku dokumentu v počítači pomocí ovladače tiskárny.
Nastavení papíru v zařízení
● Obvykle je nutné před tiskem zadat velikost a typ papíru vloženého v každém zdroji papíru.
1
Otevřete dokument v aplikaci a zobrazte dialogové okno pro tisk.
2
Vyberte svou tiskárnu a klikněte na [Předvolby] nebo [Vlastnosti].
3
Podle potřeby zadejte nastavení tisku a klikněte na [OK].
● Přepněte kartu podle nastavení.
75
Tisk dokumentu
Když jste nakonfigurovali [Optimalizace tisku reklamních poutačů] *
● Chcete-li dosáhnout lepších výsledků tisku, doporučujeme na stroji zadat následující nastavení.
- <Režim upoz. na toner> : <Tisk POP>
- <Rychlost tisku POP> : <Režim 2>
- <Auto kalibrace POP> : <Zap>
Režim upoz. na toner(P. 400)
Rychlost tisku POP(P. 399)
Auto kalibrace POP(P. 400)
● Papír, společně s touto funkcí používat, podléhá omezení. V části Typy papíru dostupné při použití
Optimalizace tisku reklamních poutačů(P. 556) jsou uvedeny použitelné velikosti a typy papíru.
● Pokud v tonerové kazetě zbývá malé množství, může se provést automatická kalibrace, což způsobí
pomalé spuštění tisku.
● Když není nakonfigurována možnost <Auto kalibrace POP>, doporučujeme před tiskem POP provést
<Kalibrace tisku POP>. Oprava neshody barev a odstínů(P. 517)
*Další
informace o [Optimalizace tisku reklamních poutačů] najdete v příručkách k příslušným ovladačům na webu
s online příručkami.
4
Klikněte na [Tisk] nebo [OK].
➠ Zahájí se tisk.
● Informace o zrušení tisku najdete v části
Zrušení tisku(P. 77) .
76
Tisk dokumentu
Zrušení tisku
6867-019
Tisk lze zrušit z počítače nebo z ovládacího panelu zařízení.
Pomocí počítače(P. 77)
Pomocí ovládacího panelu(P. 78)
Pomocí počítače
Tisk lze zrušit pomocí ikony tiskárny zobrazené na hlavním panelu na ploše počítače.
1
Dvakrát klikněte na ikonu tiskárny.
Pokud ikona tiskárny není zobrazena
● Otevřete složku tiskáren ( Zobrazení složky tiskárny(P. 608) ), pravým tlačítkem klikněte na ikonu
tiskárny a klikněte na možnost [Zobrazit aktuální tiskové úlohy], případně dvakrát klikněte na ikonu
příslušného ovladače tiskárny.
2
Vyberte dokument, který chcete zrušit, a klikněte na možnost [Dokument]
3
Klikněte na [Ano].
[Storno].
➠ Tisk vybraných dokumentů se zruší.
● Po zrušení tisku se může vysunout několik stránek.
Zrušení pomocí Vzdáleného uživatelského rozhraní
● Tisk lze zrušit ze stránky [Stav úlohy] ve Vzdáleném uživatelském rozhraní:
tištěných dokumentů(P. 299)
77
Kontrola aktuálního stavu
Tisk dokumentu
Zrušení z aplikace
● U některých aplikací se objeví obrazovka podobná níže uvedené obrazovce. Tisk lze zrušit kliknutím na
tlačítko [Storno].
Pomocí ovládacího panelu
Když se tisková data odešlou na tiskárnu z počítače, kontrolka [
panelu, pokud je kontrolka rozsvícená nebo bliká.
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberte možnost <Ano> a stiskněte tlačítko
(
/
] se rozsvítí (nebo bliká). Tisk lze zrušit z ovládacího
).
vyberte dokument, který chcete zrušit, a stiskněte
.
➠ Zobrazí se zpráva <Rušení úloh> a vybraná tisková úloha se zruší.
● Po zrušení tisku se může vysunout několik stránek.
ODKAZY
Tisk z počítače(P. 74)
Správa dokumentů a kontrola stavu zařízení(P. 299)
78
.
Tisk dokumentu
Různé způsoby tisku
6867-01A
Můžete využívat různé užitečné tiskové funkce a pomocí ovladače tiskárny také provádět základní tiskové operace.
◼ Tisk z paměti USB (Přímý tisk z USB)
Soubory PDF a obrazové soubory uložené na paměťovém zařízení USB lze tisknout po připojení zařízení USB přímo
k zařízení. Pomocí této funkce lze tisknout bez počítače. Tisk z paměti USB (Přímý tisk z USB)(P. 81)
◼ Tisk dokumentu zabezpečeného kódem PIN (zabezpečený tisk)
Nastavením kódu PIN pro data odeslaná do tiskárny z počítače se data nevytisknou, dokud se na ovládacím panelu
tiskárny nezadá správný kód PIN. Tato funkce je užitečná, když se tisknou důvěrné dokumenty. Tisk dokumentu
zabezpečeného kódem PIN (zabezpečený tisk)(P. 92)
◼ Tisk dokumentu uloženého v tiskárně (tisk uložené úlohy)
Můžete uložit tisková data odeslaná z počítače na kartu SD. Uložená data lze vytisknout libovoněkrát.
dokumentu uloženého v tiskárně (tisk uložené úlohy)(P. 96)
Tisk
◼ Tisk bez otevření souboru (přímý tisk)
Můžete tisknout soubory (PDF, JPEG, atd.) uložené na počítači tak, že je odešlete na tiskárnu pomocí webového
prohlížeče. Není třeba žádnou speciální aplikaci. Tisk bez otevření souboru (přímý tisk)(P. 106)
79
Tisk dokumentu
◼ Tisk přijatých e-mailů (tisk e-mailů)
Můžete přímo tisknout e-mailové zprávy a jejich přílohy přijaté tiskárnou, aniž použijete počítač.
mailů (tisk e-mailů)(P. 120)
80
Tisk přijatých e-
Tisk dokumentu
Tisk z paměti USB (Přímý tisk z USB)
6867-01C
Soubory uložené na paměťovém zařízení USB lze přímo tisknout po připojení zařízení USB k zařízení. Pomocí této
funkce lze tisknout bez počítače.
Dostupná paměťová zařízení USB
Můžete použít USB zařízení ve formátu FAT32.
● Nepoužívejte nestandardní paměťová zařízení USB. U některých paměťových zařízení USB se soubory
nemusí správně vytisknout.
● Nepřipojujte žádné jiné zařízení než paměťové zařízení USB. Paměťová zařízení USB nelze připojit
pomocí rozbočovače USB nebo prodlužovacího kabelu.
● Nepoužívejte paměťová zařízení USB se speciálními funkcemi, např. vestavěnými funkcemi
zabezpečení.
1
Připojte paměťové zařízení USB ke zdířce USB na pravé straně tiskárny.
➠ Automaticky se otevře se následující obrazovka.
● Pokud se obrazovka neobjeví, stiskněte
(
).
● Během připojení k tiskárně paměťovým zařízením USB ani tiskárnou netřeste a chraňte je před nárazy.
2
Pomocí tlačítek
/
vyberte možnost <Vybrat soubory> a stiskněte tlačítko
81
.
Tisk dokumentu
3
Vyberte typ souboru k tisku a stiskněte
4
Vyberte soubor, který chcete vytisknout, a stiskněte tlačítko
.
.
● Můžete vybrat více souborů.
● Chcete-li výběr zrušit, vyberte soubor, který jste předtím vybrali (označený jako
Chcete-li zrušit všechny výběry, vyberte možnost <Vynulovat vše>, a stiskněte
● Chcete-li zobrazit obsah složky, vyberte složku a stiskněte tlačítko
na vyšší úrovni, stiskněte tlačítko
nebo
nebo
), a stiskněte tlačítko
.
. Chcete-li se vrátit ke složce
.
● Složky a soubory v nižších úrovních nebo s delšími názvy se nemusí zobrazit.
● Přejdete-li do jiné složky, zruší se předchozí výběr souborů.
5
Vyberte možnost <Použít> a stiskněte tlačítko
.
Když tisknete dokument XPS pomocí tiskového lístku
Když chcete nějaký soubor vytisknout ve formátu XPS, lze ho vytisknout pomocí tiskového lístku (nastavení
tisku) připojeného k danému souboru.
1
Vyberte možnost <Použít tisk. tiket> a stiskněte tlačítko
2
Vyberte možnost <Spustit tisk> a stiskněte tlačítko
.
.
➠ Tisk se zahájí. Když se tisk ukončí, odstraňte paměťové zařízení USB z tiskárny.
zařízení USB.(P. 89)
82
Odpojte paměťové
.
Tisk dokumentu
6
Podle potřeby zadejte nastavení tisku.
● Vyberte požadovanou nastavovanou položku, stiskněte
, a proveďte nastavení.
Ikony* v popisu
Nastavení pro tisk souborů PDF
Nastavení pro tisk souborů XPS
Nastavení pro tisk souborů JPEG
Nastavení pro tisk souborů TIFF
* Ikony
jsou vynechány pro nastavení zobrazená bez ohledu na formát souboru.
<Počet kopií>
Nastavte počet kopií. Pomocí číselných tlačítek zadejte množství a stiskněte
.
<Rozsah tisku>/<Rozsah tisku (TIFF)>
Zadejte rozsah (strany) tisku. Pomocí
tisku
/
vyberte <Metoda určení>
vyberte metodu určení rozsahu
.
<Vše>
Vytisknout všechny strany.
<Zadat stránky>
Vytiskne pouze zadané strany. Pro zadání stran vyberte <Rozsah papíru>
<Poslední strana> pomocí číselných kláves
vyberte <Použít>
zadejte <První strana> a
.
<Barevný režim>
Zadejte, zda chcete tisknout barevně nebo černobíle. Pomocí
83
/
vyberte nastavení a stiskněte
.
Tisk dokumentu
<Auto (Barvy/Černá)>
Automaticky vybírat barevný nebo černobílý tisk v závislosti na typu dokumentu.
<Černá>
Černobílý tisk, i když je dokument barevný.
<2stranný tisk>
Vyberte, zda chcete tisknout na obě strany papíru. Pomocí tlačítek
/
vyberte nastavení a stiskněte
● <2stranný tisk> nemusí být u některých velikostí či typů papíru k dispozici.
Použitelný papír(P. 553)
<Umístění vazby>
Zadejte, zda u oboustranného tisku chcete listy vázat podél dlouhého okraje nebo krátkého okraje pomocí
vázacího nástroje, například sešívačky. Pomocí
/
vyberte místo vazby a stiskněte
.
<Delší strana>
Vazba má provést po dlouhé straně papíru.
<Kratší strana>
Vazba má provést po krátké straně papíru.
84
.
Tisk dokumentu
<Vybrat papír>
Vyberte zdroj papíru, v němž je již papír umístěn. Pomocí tlačítek
.
tlačítko
/
vyberte zdroj papíru a stiskněte
● Když chcete tisknout soubor PDF nebo XPS, zadejte <Auto>, aby se optimální zdroj papíru vybral
automaticky.
● Zdroj papíru s vloženým papírem vlastní velikosti nelze vybrat.
<Polotóny>
Můžete vybrat metodu tisku k reprodukci polotónů (střední hodnoty mezi světlejšími a tmavšími oblastmi
obrazu).
Soubory PDF a XPS
Můžete zadat <Difúze chyb> jako metodu reprodukce polotónů nebo zadat metodu reprodukce polotónů
samostatně pro každý typ obrazových dat. Pokud chcete zadat <Difúze chyb>, pomocí
/
vyberte <Difúze
<Zap> stiskněte
. Pokud chcete metodu reprodukce zadat samostatně pro každý
chyb> stiskněte
typ obrazových dat, pomocí
dat
stiskněte
/
vyberte <Rozlišení/gradace>
vyberte metodu reprodukce polotónů
stiskněte
stiskněte
vyberte typ obrazových
.
<Difúze chyb>
Tento režim je vhodný pro tisk dat s textem a tenké linky a zakřivené linky dat z aplikací CAD atd.
● Stabilita textury a fixovaného toneru může být při použití nastavení <Difúze chyb> snížena.
<Rozlišení/gradace>
Vyberte metodu reprodukce polotónů, když je možnost <Difúze chyb> nastavena na <Vyp>. Toto nastavení
můžete provést pro každý typ obrazových dat obsažených v jednom dokumentu.
Typ obrázku
Vyberte typ obrazových dat, pro který chcete změnit nastavení. <Text> představuje písmena a znaky,
<Grafika> představuje čáry a číslice a <Obraz> představuje fotografie a další typy obrázků.
85
Tisk dokumentu
<Rozlišení>
Tiskne text s jasnými okraji a vytváří jemný tisk. Je vhodný pro tisk textu a jemných čar.
<Gradace>
Tiskne gradace a obrysy s hladkými okraji. Je vhodný pro tisk čísel a grafů využívajících gradace.
● Pokud je možnost <Difúze chyb> nastavena na <Zap>, nezobrazí se možnost <Rozlišení/gradace>.
Soubory JPEG a TIFF
Pomocí tlačítek
/
vyberte metodu reprodukce polotónů a stiskněte
.
<Difúze chyb>
Tento režim je vhodný pro tisk dat s textem a tenké linky a zakřivené linky dat z aplikací CAD atd.
● Stabilita textury a fixovaného toneru může být při použití nastavení <Difúze chyb> snížena.
<Rozlišení>
Tiskne text s jasnými okraji a vytváří jemný tisk. Je vhodný pro tisk textu a jemných čar.
<Gradace>
Tiskne gradace a obrysy s hladkými okraji. Je vhodný pro tisk čísel a grafů využívajících gradace.
<Shoda vel. papíru>
Automaticky provede zvětšené nebo zmenšené tisky podle Oblast tisku(P. 557) papíru. Výtisky se zvětší
nebo zmenší a zároveň se zachovají proporce originálu. Pomocí
/
vyberte nastavení a stiskněte
.
● Toto nastavení není dostupné, pokud je možnost <Auto> nastavena v <Vybrat papír>.
<Přiblížení>
Povolí nebo zakáže zvětšování/zmenšování obrázků. Výtisky se zvětší nebo zmenší a zachovají se původní
proporce obrázku. Pomocí
/
vyberte nastavení a stiskněte
.
86
Tisk dokumentu
<Vyp>
Když je obrázek v
Oblast tisku(P. 557) papíru, je vytištěn v té velikosti, v jaké je. Když je obrázek větší než
tisknutelná oblast, výtisky se zmenší.
<Auto>
Provede zvětšení nebo zmenšení výtisku podle
Oblast tisku(P. 557) .
<Zvětšit tisk. oblast>
Zadejte, zda chcete tisknout obrázek rozšířením
vyberte nastavení a stiskněte
.
Oblast tisku(P. 557) plně na velikost papíru. Pomocí
/
● Pokud vyberete <Zap>, některé části obrázku mohou u okraje papíru chybět nebo může být papír v
závislosti na originálu částečně znečištěný.
<N na 1>
Vyberte, zda se má tisknout více stránek na jeden list a postupně je skládat z levého horního rohu. Chcete-li
například tisknout čtyři stránky na jeden list, vyberte <4 na 1>. Pomocí
/
vyberte nastavení a stiskněte
● Toto nastavení není dostupné, pokud je možnost <Auto> nastavena v <Vybrat papír>.
<Kompletace>
Když tisknete dokument o více stránkách zadejte metodu třídění výtisků. Pomocí
třídit, a stiskněte
.
87
/
vyberte, zda výtisky
.
Tisk dokumentu
<Vyp>
Výtisky se netřídí. Vytiskne se zadaný počet kopií každé stránky. Pokud například tisknete tři kopie
čtyřstránkového dokumentu, budou výtisky uspořádány v následujícím pořadí stránek: 1, 1, 1, 2, 2, 2, 3, 3, 3,
4, 4, 4.
<Třídit>
Výtisky se seskupí do úplných sad podle pořadových čísel stránek. Pokud například tisknete tři kopie
čtyřstránkového dokumentu, budou výtisky uspořádány v následujícím pořadí stránek: 1, 2, 3, 4, 1, 2, 3, 4, 1,
2, 3, 4.
<Orientace obrazu>
Zdejte orientaci tisku obrázku. Pomocí
/
vyberte orientaci tisku a stiskněte
.
<Auto>
Automaticky určí orientaci tisku založenou na šířce a výšce obrázku.
<Vertikální>
Vyberte při tisku obrázku, který je dlouhý na výšku.
<Horizontální>
Vyberte při tisku obrázku, který je dlouhý na šířku.
● Pokud zadané nastavení možnosti <Vertikální> nebo <Horizontální> neodpovídá orientaci obrázku,
vytiskne se zmenšený obrázek.
<Poloha tisku>
Zdejte pozici tisku obrázku. Pomocí
/
vyberte pozici tisku a stiskněte
88
.
Tisk dokumentu
<Auto>
Pokud data TIFF obsahují informace, které určují polohu tisku, obrázek se vytiskne podle této informace, jinak
se vytiskne do středu papíru. Data JPEG se vždy tisknou na střed papíru.
<Uprostřed>
Obrázky se tisknou na střed papíru.
<Nahoře vlevo>
Obrázky se tisknou vlevo nahoru.
7
Vyberte možnost <Spustit tisk> a stiskněte tlačítko
.
➠ Zahájí se tisk.
● Pro zrušení tisku použijte ovládací panel.
8
Zrušení tisku(P. 77)
Odpojte paměťové zařízení USB.
1
Vyberte možnost <Odebrat jedn. USB> a stiskněte tlačítko
2
Vyberte možnost <Ano> a stiskněte
.
.
➠ Počkejte, až se zobrazí zpráva uvedená níže.
3
Odpojte paměťové zařízení USB.
● Pokud vyberete v kroku 1 na obrazovce možnost <Řadit soubory>, můžete změnit pořadí zobrazených
souborů, když zvolíte soubory k tisku.
TIPY
Plánujete-li vždy tisknout se stejným nastavením:
Změna výchozích nastavení tisku USB(P. 90)
89
Tisk dokumentu
Změna výchozích nastavení tisku USB
6867-01E
Nastavení, která se původně zobrazí pro zadání tisku se nazývají výchozí zobrazení. Změníte-li tato výchozí nastavení
podle často prováděných operací, nebudete muset provádět stejná nastavení při každém tisku.
(
)
TIFF>
<Nastavení tisku USB>
Vyberte položku nastavení
PDF/XPS
<Výchozí nast.PDF/XPS> nebo <Vých. nast.JPEG/
Změňte výchozí hodnotu vybrané položky
JPEG/TIFF
Položky nastavení
Vyberte položku, kterou chcete nastavit, a změňte výchozí hodnotu.
◼ Vyberte pořadí zobrazených souborů k tisku
Můžete nastavit pořadí, v němž se soubory budou tisknout z paměťového zařízení USB, kde jsou zobrazeny pro výběr.
(
)
<Nastavení tisku USB>
standardní pořadí zobrazených souborů
<Název (vzestupně)>
Soubory se seřadí vzestupně podle názvu.
<Název (sestupně)>
Soubory se seřadí sestupně podle názvu.
90
<Vých.nast. řaz. soub>
Vyberte
Tisk dokumentu
<Datum/čas (vzestup.)>
Soubory se seřadí vzestupně podle data/času.
<Datum/čas (sestupně)>
Soubory se seřadí sestupně podle data/času.
ODKAZY
Tisk z paměti USB (Přímý tisk z USB)(P. 81)
91
Tisk dokumentu
Tisk dokumentu zabezpečeného kódem PIN
(zabezpečený tisk)
6867-01F
Pokud při tisku z počítače přiřadíte dokumentu kód PIN, uchová se dokument na volitelné SD kartě instalované na
přístroji a nevytiskne se až do zadání správného kódu PIN na ovládacím panelu zařízení. Tato funkce se nazývá
„Zabezpečený tisk“ a dokument chráněný kódem PIN se nazývá „Zabezpečený dokument“. Pomocí funkce Zabezpečený
tisk lze zajistit, že důvěrné dokumenty nezůstanou bez dozoru. Před použitím této funkce je třeba instalovat do zařízení
volitelnou SD kartu ( Instalace SD karty(P. 581) ).
Zaslání zabezpečeného dokumentu z počítače do zařízení(P. 92)
Vytisknutí zabezpečených dokumentů(P. 93)
Změna doby platnosti zabezpečených dokumentů(P. 94)
Zaslání zabezpečeného dokumentu z počítače do zařízení
Postupujte podle níže uvedených pokynů. Můžete poslat dokument chráněný kódem PIN.
1
Otevřete dokument v aplikaci a zobrazte dialogové okno pro tisk.
2
Vyberte tento přístroj a klikněte na [Předvolby] nebo [Vlastnosti].
3
Vyberte možnost [Zabezpečený tisk] v nabídce [Způsob výstupu].
➠ Zobrazí se místní obrazovka [Informace]. Přečtěte si zprávu a klikněte na tlačítko [Ano] nebo [Ne].
4
Podle potřeby zadejte nastavení tisku a klikněte na [OK].
● Přepněte kartu podle nastavení.
92
Tisk dokumentu
5
Klikněte na [Tisk] nebo [OK].
➠ Zabezpečený dokument se po zaslání do zařízení uchová na kartě SD, dokud nebude vytištěn.
● Funkci šifrovaného tisku můžete použít také se zlepšeným zabezpečením.
tisku(P. 95)
Použití šifrovaného
Vytisknutí zabezpečených dokumentů
Slouží k tisku zabezpečených dokumentů zaslaných na zařízení. Po vypršení doby platnosti ( Změna doby platnosti
zabezpečených dokumentů(P. 94) ) se zabezpečený dokument odstraní z paměti zařízení a již nebude možné ho
vytisknout.
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberte zabezpečený dokument, který chcete vytisknout, a stiskněte tlačítko
(
/
).
vyberte možnost <Zabezpečený tisk> a stiskněte tlačítko
● Pokud je na kartě SD pouze zabezpečený dokument, tato obrazovka se neobjeví.
93
.
.
Tisk dokumentu
Pokud se zobrazí uživatelské jméno
● Jsou-li na kartě SD uloženy zabezpečené dokumenty od dvou či více uživatelů, před objevením se
obrazovky ukázané výše se objeví obrazovka uživatelské volby zobrazená dole. Vyberte své uživatelské
jméno a stiskněte
4
.
Zadejte PIN a stiskněte
.
➠ Zahájí se tisk.
● Pro zrušení tiskové úlohy použijte ovládací panel.
Zrušení tisku(P. 77)
Změna doby platnosti zabezpečených dokumentů
Dobu platnosti můžete změnit mezi okamžikem odeslání dat zabezpečeného dokumentu do zařízení do okamžiku, kdy
se po uplynutí určité doby odstraní.
1
Stiskněte tlačítko
2
Pomocí
3
Vyberte možnost <Čas vym.zabezp.tisku> a stiskněte tlačítko
4
/
(
).
vyberte <Nabídka ovládání> a stiskněte
.
.
Zadejte dobu, po kterou se na kartě SD uchovají zabezpečené dokumenty, a stiskněte
tlačítko
.
● Po vypršení zde zadané doby se zabezpečený dokument z karty SD vymaže.
ODKAZY
Použití šifrovaného tisku(P. 95)
Instalace SD karty(P. 581)
94
Tisk dokumentu
Použití šifrovaného tisku
6867-01H
Tisková data jsou před odesláním do zařízení šifrována, což zvyšuje bezpečnost více než běžná zabezpečená tisková
funkce.
◼ Aktivace funkce šifrovaného tisku
Chcete-li použít funkci šifrovaného tisku, proveďte předem následující operaci.
Otevřete složku tiskáren ( Zobrazení složky tiskárny(P. 608) ) Klikněte pravým tlačítkem na
ikonu tiskárny [Vlastnosti tiskárny] nebo [Vlastnosti] karta [Nastavení zařízení] [Podrobnosti]
karta [Jiná nastavení] Zapněte [Encrypted Secure Print] [OK] [OK]
◼ Zaslání šifrovaného dokumentu z počítače do zařízení
Viz Nápovědu. Nápovědu můžete zobrazit pomocí ovladače tiskárny.
Otevřete složku tiskáren ( Zobrazení složky tiskárny(P. 608) ) Klikněte pravým tlačítkem na
ikonu tiskárny [Vlastnosti tiskárny] nebo [Vlastnosti] karta [Encrypted-P] [Help]
◼ Vytisknutí šifrovaných dokumentů
Po zaslání šifrovaného dokumentu do zařízení tento dokument vytiskněte. Šifrované dokumenty budou po uplynutí
doby uchovávání ( Změna doby platnosti zabezpečených dokumentů(P. 94) ) automaticky odstraněny a již je
nebude možné vytisknout. Metoda nastavení doby uchovávání je běžná pro zabezpečené dokumenty a šifrované
dokumenty.
(
)
<Šifrovaný tisk>
Vyberte šifrovaný dokument k tisku
Pomocí číselných
kláves zadejte kód PIN
Pokud v kódu PIN používáte alfanumerické znaky nebo symboly
● Funkce šifrovaného tisku umožňuje používat abecední znaky a symboly a rovněž čísla při zadávání
kódu PIN na ovladači tiskárny. Pokud ovšem používáte abecední znak nebo symbol v kódu PIN,
nemůžete tisknout šifrovaný dokument z ovládacího panelu tiskárny. K tisku šifrovaného dokumentu
použijte [Stav úlohy] nebo vzdálené uživatelské rozhraní. Kontrola aktuálního stavu tištěných
dokumentů(P. 299)
95
Tisk dokumentu
Tisk dokumentu uloženého v tiskárně (tisk uložené
úlohy)
6867-01J
Data vytištěná z počítače lze uložit na SD kartu nainstalovanou v zařízení. Protože uložená data lze přímo vytisknout ze
zařízení, můžete eliminovat potřebu obsluhy počítače při každém tisku. Je vhodné uložit dokument, který má být tištěn
několikrát, například přední list faxu. Instalace SD karty(P. 581)
Uložení dokumentu v tiskárně(P. 96)
Tisk dokumentu uloženého v tiskárně(P. 98)
● Data uložená na SD kartě nebudou smazána, i když bude napájení vypnuto. Budou ale automaticky smazána
po uplynutí nastavené doby uchovávání a poté je nebude možné vytisknout. Pokud chcete změnit dobu
uchovávání dat nebo zabránit automatickému mazání dat, změňte příslušná nastavení ze Vzdálené UR (
Změna doby uložení dokumentů(P. 100) ). Uložená data lze také odstranit ručně ( Ruční mazání
dokumentů(P. 101) ).
Uložení dokumentu v tiskárně
1
Otevřete dokument v aplikaci a zobrazte dialogové okno pro tisk.
2
Vyberte tento přístroj a klikněte na [Předvolby] nebo [Vlastnosti].
3
Vyberte položku [Uložit] u možnosti [Způsob výstupu] a klikněte na tlačítko [Ano].
96
Tisk dokumentu
4
Zadejte nastavení pro ukládání dokumentů a klikněte na tlačítko [OK].
[Název dat]
Přidělení jména pro tisk dat uložených na kartě SD.
[Zadat název]
[Použít název souboru]
Ručně zadejte jméno. Zadejte přívětivé jméno, které lze snadno identifikovat na
displeji zařízení.
Název se automaticky nastaví podle názvu souboru s tištěnými daty a podle informací
o aplikaci, kterou používáte.
[Poštovní schránky]
Místo použité pro uložení tištěných dat na kartě SD se nazývá box. Vyberte číslo boxu, kam se má
dokument uložit. Danému boxu můžete přidělit název, abyste box mohli snáze identifikovat. Nastavení
názvu a kódu PIN pro box(P. 104)
5
Podle potřeby zadejte nastavení tisku a klikněte na [OK].
● Přepněte kartu podle nastavení.
● Nastavení provedené zde se uloží i do dokumentu. Když se dokument bude tisknout příště, vytiskne se s
uloženým nastavením.
97
Tisk dokumentu
6
Klikněte na [Tisk] nebo [OK].
➠ Dokument se odešle do tiskárny a uloží se do zadaného boxu.
Tisk dokumentu uloženého v tiskárně
1
Stiskněte tlačítko
(
).
● Když je tiskárna offline, nefunguje, i když stisknete
(
). Nastavte tiskárnu na režim online.
Tlačítko
Online(P. 27)
2
Pomocí tlačítek
3
Vyberte číslo boxu dokumentu k tisku a stiskněte
/
vyberte možnost <Tisk uložených úloh> a stiskněte tlačítko
.
.
Pokud je box chráněn kódem PIN
● Když se zobrazí obrazovka pro zadání PIN, zadejte PIN a stiskněte
kontaktujte správce tiskárny.
98
. Pokud si kódem PIN nejste jistí,
Tisk dokumentu
4
Vyberte dokument, který chcete vytisknout, a stiskněte tlačítko
.
➠ Zahájí se tisk.
● Pro zrušení tisku použijte ovládací panel.
Zrušení tisku(P. 77)
● Dokumenty uložené na kartě SD se dají také vytisknout ze stránky [Schránka] vzdáleného uživatelského
rozhraní ( Stránka [Schránka](P. 297) ). Otevřete box, v němž jsou dokumenty uloženy, zaškrtněte pole
pro tisk dokumentu a klikněte na [Tisk].
ODKAZY
Vymazání dokumentu uloženého v tiskárně(P. 100)
Nastavení názvu a kódu PIN pro box(P. 104)
Instalace SD karty(P. 581)
99
Tisk dokumentu
Vymazání dokumentu uloženého v tiskárně
6867-01K
Ve výchozím nastavení jsou data, která jsou uložena na SD kartě, automaticky vymazána po uplynutí určité doby; poté
je nelze vytisknout. Pokud chcete změnit dobu uchovávání dat nebo zabránit automatickému mazání dat, změňte
příslušná nastavení ze Vzdálené UR. Uložené dokumenty lze také odstranit ručně.
Změna doby uložení dokumentů(P. 100)
Ruční mazání dokumentů(P. 101)
Změna doby uložení dokumentů
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Nabídka ovládání]
4
Změňte nastavení doby uložení.
[Editovat].
● Pokud chcete zabránit automatickému vymazání dokumentů, vyberte [Vyp].
100
Spuštění
Tisk dokumentu
5
Klikněte na tlačítko [OK].
Ruční mazání dokumentů
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se.
Spuštění Vzdáleného
uživatelského rozhraní(P. 290)
Pokud se přihlásíte v režimu běžného uživatele
● Zařízení je ve výchozím nastavení nakonfigurováno tak, aby dokumenty nemohli mazat jiní uživatelé (běžní
uživatelé) než správce. Chcete-li koncovým uživatelům povolit práci s dokumenty, musíte změnit nastavení.
Umožnění manipulace s dokumenty koncovým uživatelům(P. 304)
● Vymazat můžete pouze dokument, u nějž uživatelské jméno odpovídá jménu použitému k přihlášení
pomocí vzdáleného uživatelského rozhraní.
2
Klikněte na tlačítko [Schránka].
101
Tisk dokumentu
3
Klikněte na číslo boxu, kde je uložen dokument určený ke smazání.
Pokud je box chráněn kódem PIN
● Když se zobrazí obrazovka uvedená níže, zadejte PIN a klikněte na [OK].
4
Zaškrtněte políčko u dokumentu, který chcete vymazat, a klikněte na [Smazat].
➠ Vybraný dokument se vymaže.
● Můžete kliknout na textový odkaz pod [Název souboru] a zkontrolovat detaily dokumentu.
102
Tisk dokumentu
● Může určitou dobu trvat, než se na kartě SD vytvoří volné místo, protože uložená data se mažou na pozadí.
103
Tisk dokumentu
Nastavení názvu a kódu PIN pro box
6867-01L
Pro otevření daného boxu můžete zadat název a PIN. Pokud boxu zadáte čitelné jméno, budete ho moci snadno
rozeznat při výběru místa pro uložení dokumentů pomocí ovladače tiskárny. Pokud zadáte PIN, uložené dokumenty
budou moci používat pouze vybraní uživatelé a zvýší se tím zabezpečení dokumentů.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Schránka].
3
Klikněte na číslo boxu, u nějž chcete zadat nastavení.
Pokud je box chráněn kódem PIN
● Když se zobrazí obrazovka uvedená níže, zadejte PIN a klikněte na [OK].
4
[Nastavení].
104
Spuštění
Tisk dokumentu
5
Zadejte název a PIN.
[Název schránky]
Chcete-li nastavit název pole, zadejte potřebné znaky.
[Nastavit PIN]
Pro nastavení kódu PIN vyberte pole [Nastavit PIN] a zadejte číslo pro PIN do pole [PIN]. Pro potvrzení
zadejte stejné číslo do textového pole [Potvrdit].
● Jako první číslici kódu PIN nesmíte „0“. Jako PIN bude zadáno číslo po odstranění nuly na prvním místě.
6
Klikněte na tlačítko [OK].
105
Tisk dokumentu
Tisk bez otevření souboru (přímý tisk)
6867-01R
Můžete vytisknout soubor z webového prohlížeče (vzdálené uživatelské rozhraní), aniž byste soubor otvírali. Navíc
můžete tisknout také soubor PDF přímo z webu, a to po zadání URL.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se.
uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Přímý tisk].
3
Klikněte na typ souboru, který chcete tisknout.
[Soubor PDF]
Klikněte pro tisk souboru PDF.
106
Spuštění Vzdáleného
Tisk dokumentu
[Soubor PS]
Klikněte pro tisk souboru PS nebo EPS.
[Obrazový soubor]
Klikněte pro tisk souboru JPEG nebo TIFF.
[Soubor XPS]
Klikněte pro tisk souboru XPS.
4
Klikněte na tlačítko [Procházet].
● Když se objeví dialogové okno pro výběr souboru, vyberte soubor k tisku a klikněte na [Otevřít].
● Když tisknete soubor PDF, vyberte [Cesta k souboru].
Když tisknete soubor PDF z webu
● Vyberte možnost [URL] a zadejte URL souboru PDF. Pokud se vyžaduje ověření uživatele, zadejte
uživatelské jméno a heslo.
Když je soubor PDF chráněn heslem
● Heslo zadejte do pole [Heslo dokumentu].
Když tisknete soubor PDF spojený s policy serverem
● Zadejte nastavení pro [Uživatelské jméno serveru zásad zabezpečení] a [Heslo serveru zásad zabezpečení].
5
Podle potřeby zadejte nastavení tisku.
6
Klikněte na tlačítko [Spustit tisk].
➠ Zobrazí se následující obrazovka a zahájí se tisk.
107
Nastavení tisku pro přímý tisk(P. 109)
Tisk dokumentu
● Vyberete-li možnost [Na seznam úloh], pak se zobrazí stránka [Stav úlohy] a ukáže se stav tisku.
Kontrola aktuálního stavu tištěných dokumentů(P. 299)
● Než se tisk zahájí, může to nějakou dobu trvat.
ODKAZY
Použití Vzdáleného uživatelského rozhraní(P. 289)
108
Tisk dokumentu
Nastavení tisku pro přímý tisk
6867-01S
Když chcete změnit nastavení přímého tisku podle tištěného dokumentu, zadejte následující nastavení.
Když zadáváte nastavení tisku pro soubory XPS
● Odstraňte zaškrtnutí [Preferovat tiskový tiket]. Pokud je zaškrtnutí aktivní, některé položky nejsou dostupné.
Ikony* v popisu
Nastavení pro tisk souborů PDF
Nastavení pro tisk souborů PS/EPS
Nastavení pro tisk souborů JPEG
Nastavení pro tisk souborů TIFF
Nastavení pro tisk souborů XPS
* Ikony
jsou vynechány pro nastavení zobrazená bez ohledu na formát souboru.
[Specifikovat rozsah tisku]
109
Tisk dokumentu
[Rozsah tisku]
Zadejte rozsah (stránky) tisku.
[Vše]
Zadejte tisk všech stránek.
[Zadat stránky]
Zadejte rozsah tisku. Toto nastavení není k dispozici pro soubory JPEG.
[Nastavení kvality]
[Gradace]
Nastavte gradaci pro zpracování tiskových dat.
[Vysoká 1]
Tento tiskový režim je vhodný pro tisk fotografií nebo podobných věcí v průměrné
kvalitě.
[Vysoká 2]
Zadejte toto nastavení pro tisk fotografií nebo podobných věcí ve vysoké kvalitě.
[Polotóny]
Můžete vybrat metodu tisku k reprodukci půltónů (střední hodnoty mezi světlejšími a tmavšími oblastmi
obrazu). U souborů PDF a XPS můžete zadat [Rozlišení] nebo [Gradace] pro každý typ obrazových dat
obsažených v jednom dokumentu: [Text], [Grafika], a [Obraz].
[Difúze chyb]
Je-li toto políčko zaškrtnuté, můžete tisknout v režimu, který je vhodný pro tisk dat
obsahujících text a tenké čáry, křivky dat CAD atd. Toto se použije pro všechny typy
obrazových dat, a proto nemůžete vybrat [Rozlišení] nebo [Gradace].
● Stabilita textury a fixovaného toneru může být při použití nastavení [Difúze chyb]
snížena.
[Rozlišení]
Tiskne text s jasnými okraji a vytváří jemný tisk. Je vhodný pro tisk textu a jemných čar.
[Gradace]
Tiskne gradace a obrysy s hladkými okraji. Je vhodný pro tisk čísel a grafů využívajících
gradace.
[Difúze chyb]
Tento režim je vhodný pro tisk dat s textem a tenké linky a zakřivené linky dat z
aplikací CAD atd.
110
Tisk dokumentu
● Stabilita textury a fixovaného toneru může být při použití nastavení [Difúze chyb]
snížena.
[Zdokonalené vyhlazování]
Proveďte nastavení pro režim vyhlazování, který umožňuje vyhlazený tisk okrajů čar, obrázků a textu.
[Vyp]
Neprovádí vyhlazování.
[Vyhlazený 1]
Hladce tiskne okraje čar, obrázků a textu.
[Vyhlazený 2]
Okraje budou hladší než pomocí [Vyhlazený 1].
[Grafika]
Pokud je toto pole zaškrtnuté, je režim vyhlazování použit na čáry a obrázky, je-li
zadána možnost [Vyhlazený 1] nebo [Vyhlazený 2].
[Text]
Pokud je toto pole zaškrtnuté, je režim vyhlazování použit na text, je-li zadána možnost
[Vyhlazený 1] nebo [Vyhlazený 2].
111
Tisk dokumentu
[Nastavení barev]
[Barevný režim]
Zadejte, zda chcete tisknout barevně nebo černobíle.
[Auto (Barvy/Černá a bílá)]
Automaticky vybírat barevný nebo černobílý tisk v závislosti na typu dokumentu.
[Černá a bílá]
Černobílý tisk, i když je dokument barevný.
[Barvy]
Barevný tisk.
112
Tisk dokumentu
[Režim shody]
Vyberte režim zpracování pro barevný tisk.
[ICC profil]
Použijte profil pro shodu barev.
[Gama]
Proveďte korekci barev nastavením hodnoty gama pro úpravu jasu.
[Zdrojový profil RGB]
Vyberte vhodný profil pro data RGB, který odpovídá používanému monitoru. U souborů XPS můžete tuto
položku nastavit pro každý typ obrazových dat obsažených v jednom dokumentu: [Text], [Grafika] a [Obraz].
Použije se profil RGB, který je podobný průměrnému profilu většiny monitorů
pro počítače se systémem Windows. Pokud používáte monitor, který
podporuje sRGB, můžete tisknout barvy, které se blíží barvám zobrazeným na
[sRGB v3.0 (Canon)]
monitoru.
[Monitor Canon HDTV gama 1,5 až 2,4] Pokud chcete upravit jas po srovnání mezi vytištěnými barvami a barvami
zobrazenými na monitoru, proveďte potřebná nastavení zde. Čím vyšší
hodnota, tím tmavší vytištěné barvy.
[Žádný]
Provádí separaci barev z dat RGB do CMYK bez použití profil zdroje RGB.
● U souborů XPS je tato položka k dispozici, pokud je možnost [Režim shody] nastavena na [ICC profil].
[CMYK simulační profil]
Při tisku dat CMYK můžete vybrat cíl simulace. Zařízení převede data CMYK na model barev CMYK závislý na
zařízení na základě vybraného cíle simulace.
[JapanColor(Canon)]
Použijte profil JapanColor. Tisk se provede v barvách, které se blíží japonským
tiskovým normám.
[U.S. Web Coated v1.00 (Canon)] Použijte profil U.S. Web Coated. Tisk se provede v barvách, které se blíží americkým
tiskovým normám.
[Euro Standard v1.00 (Canon)]
Použijte profil Euro Standard. Tisk se provede v barvách, které se blíží evropským
tiskovým normám.
[Žádný]
Tiskne data CMYK pomocí modelu barev CMYK závislého na zařízení bez použití
profilu simulace CMYK.
● Když je tato položka nastavena na [Žádný] , gradace tmavých barev se může v závislosti na datech zhroutit.
[Výstupní profil]
Můžete vybrat vhodné profily pro data, které hodláte vytisknout. Pokud jde o soubory PDF a XPS, můžete tuto
položku nastavit pro každý typ obrazových dat obsažených v jednom dokumentu: [Text], [Grafika] a [Obraz].
[Normal]
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám
zobrazeným na monitoru.
113
Tisk dokumentu
[Photo]
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii.
[TR Normal]
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám
zobrazeným na monitoru a že je dobře kontrolováno stékání toneru do textu
a jemných čar.
[TR Photo]
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii a že je dobře
kontrolováno stékání toneru do textu a jemných čar.
● U souborů XPS je tato položka k dispozici, pokud je možnost [Režim shody] nastavena na [ICC profil].
[Způsob shody]
Zadejte, který prvek má mít ve shodě barev prioritu před ostatními pomocí [Zdrojový profil RGB]. Pokud jde o
soubory XPS, můžete tuto položku nastavit pro každý typ obrazových dat obsažených v jednom dokumentu:
[Text], [Grafika] a [Obraz].
[Percepční]
Shoda se provede s prioritou na percepční.
[Nasycení]
Shoda se provede s prioritou na sytost.
[Kolorimetrický]
Shoda se provede tak, že rozdíl barev mezi originály a výtisky je minimální.
[Použít škálu odstínů šedé]
Pokud je toto pole zaškrtnuto, šedá data se převedou na data CMYK podle profilu stupňů šedé v zařízení.
● Tisk se může provést pouze s tonerem K (černá) v závislosti na nastavení možnosti [Výstupní profil] nebo
[Použít čistě černý text].
[Použít čistě černý text]
Pokud je toto pole zaškrtnuto, černý text se vytiskne pouze s tonerem K (černá). Na rozdíl od tisku s
barevným tonerem (CMY) se neobjeví šmouhy barevného toneru na okrajích. Doporučujeme toto nastavení
běžně používat.
[Černý přetisk]
Nastavte, jak tisknout, když je černý text překryt na barevném pozadí nebo barevném obrázku s vybranou
možností [Použít čistě černý text]. Pokud je toto pole zaškrtnuto, vytiskne se nejprve pouze barevné pozadí
nebo obrázek a potom černý text se vytiskne na pozadí nebo obrázek pouze s tonerem K (černá). V případě,
že toto pole není zaškrtnuto, nejprve se vytisknou data po tom, co je černý text vyňat z barevného pozadí
nebo obrázku, čímž vznikne příslušné bílé místo, a potom se černý text vytiskne na toto bílé místo.
● V případě, že toto pole není zaškrtnuto, může být tisk slabší nebo okraje textu mohou být bíle lemovány.
[Provést smíšený přetisk]
Pokud je toto pole zaškrtnuto, budou data CMYK, pro něž je nastaven přetisk, přetištěna jako kompozitní
data.
114
Tisk dokumentu
● Pokud je možnost [CMYK simulační profil] nastavena jinak než na položku [Žádný], přetisk se neprovede,
ani když je toto políčko zaškrtnuto.
[Jas]
Můžete nastavit jas celého obrazu v krocích po 5 %. Čím je hodnota nižší, tím je obraz světlejší.
[Korekce gama]
Úprava jasu lze provést tak, aby jas nejjasnějších a nejtmavších částí originálu nebyl ve výsledku tisku
ovlivněn. [1.4] je standardní nastavení (bez korekce) a čím větší je hodnota nastavení, tím tmavší bude výtisk.
Tuto položku můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu: [Text],
[Grafika] a [Obraz].
● Tato položka je dostupná, pokud je pro možnost [Režim shody] vybráno nastavení [Gama].
[Photo Optimizer PRO]
Pokud je toto pole zaškrtnuto, tisk se provádí s automatickou korekcí kontrastu obrazových dat, vyvážení
barev, sytosti a gradace.
[Korekce červených očí]
„Efekt červených očí“ je jev, který způsobuje, že oči lidských objektů fotografovaných pomocí blesku či výbojky
vypadají nepřirozeně červeně. Nastavte, zda chcete automaticky detekovat efekt červených očí na obrázku a
opravit příslušné části, aby jejich zbarvení bylo přirozené. Zaškrtněte pole a vyberte úroveň korekce v
možnosti [Úroveň korekce červených očí].
[Rozjasnění tváře]
V případě fotografií, na nichž jsou tváře lidských objektů nepřirozeně tmavé v důsledku podsvícení nebo
podexponování, nastavte, zda chcete obrázek tisknout s korekcí celého jasu tak, aby tvář objektů byla
přirozeně jasná. Zaškrtněte pole a vyberte úroveň korekce v možnosti [Úroveň rozjasnění tváře].
[Konverze odstínů šedé]
Můžete vybrat metodu převodu barevných tiskových dat na černobílá data. Pro soubory XPS můžete zadat
převodní metodu pro každý typ obrazových dat: [Text], [Grafika] a [Obraz].
[sRGB]
[NTSC]
Barevná data se převedou na černobílá s důrazem na rozdílnost barev, takže se
dosáhne plynulého odstupňování.
Barevná data se převedou na černobílá s důrazem na zobrazení ekvivalentní
televizním snímkům (NTSC).
[Jednotné RGB]
Barevná data se převedou na černobílá s cílem ekvalizovat všechny úrovně RGB pouze
na základě jasu.
● Tato položka je dostupná, pokud je pro možnost [Barevný režim] vybráno nastavení [Černá a bílá].
[Kompenzace šedé]
V případě černých nebo šedých dat s barevnými informacemi definujícími R=G=B vyberte, zda chcete tisknout
pouze s černým (K) tonerem. Tuto položku můžete nastavit pro každý typ obrazových dat obsažených v
jednom dokumentu: [Text], [Grafika] a [Obraz].
115
Tisk dokumentu
● Když tuto položku nastavíte na [Vyp], provede se tisk pomocí čtyř barevných tonerů CMYK.
[Nastavení tisku]
[Kopie]
Nastavte počet kopií.
[Velikost papíru]
Zadejte velikost papíru, na který se má tisknout.
● Když chcete tisknout soubor PDF nebo XPS, zadejte [Auto] aby se optimální zdroj papíru vybral
automaticky. Pokud se žádná optimální velikost nenajde, zvolí se velikost papíru nastavená v <Standardní
velikost papíru> ( Standard. vel.papíru(P. 476) ).
[Typ papíru]
Zadejte typ papíru, na který se má tisknout.
[Ruční podání]
Pokud zaškrtnete dané pole, dokument se vytiskne pouze na papír vložený do víceúčelové přihrádky.
116
Tisk dokumentu
[Zvětšit/Zmenšit dle velikosti papíru]
Pokud pole zaškrtnete, výtisky se zvětší nebo zmenší podle
nebo zmenší a zároveň se zachovají proporce originálu.
Oblast tisku(P. 557) papíru. Výtisky se zvětší
● Pokud je možnost [Velikost papíru] nastavena na [Auto], tato položka není dostupná.
[Orientace obrazu]
Zadejte orientaci tisku obrázku.
[Auto]
Automaticky určí orientaci tisku založenou na šířce a výšce obrázku.
[Vertikální]
Vyberte při tisku obrázku, který je dlouhý na výšku.
[Horizontální]
Vyberte při tisku obrázku, který je dlouhý na šířku.
● Pokud zadané nastavení možnosti [Vertikální] nebo [Horizontální] neodpovídá orientaci obrázku, vytiskne
se zmenšený obrázek.
[Poloha tisku]
Zadejte umístění, kam se má vytisknout obrázek.
[Auto]
Pokud data TIFF obsahují informace, které určují polohu tisku, obrázek se vytiskne
podle této informace, jinak se vytiskne do středu papíru. Data JPEG se vždy tisknou na
střed papíru.
[Uprostřed]
Obrázky se tisknou na střed papíru.
[Nahoře vlevo]
Obrázky se tisknou vlevo nahoru.
[Zoom]
Povolí nebo zakáže zvětšování/zmenšování obrázků. Výtisky se zvětší nebo zmenší a zachovají se původní
proporce obrázku.
[Vyp]
Když je obrázek v
Oblast tisku(P. 557) papíru, je vytištěn v té velikosti, v jaké je.
Když je obrázek větší než tisknutelná oblast, výtisky se zmenší.
[Auto]
Provede zvětšení nebo zmenšení výtisků podle oblasti tisku papíru.
[Zvětšit tiskovou oblast]
Pokud zaškrtnete pole, obrázek se vytiskne na celou plochu papíru Oblast tisku(P. 557) . Část obrázku
však může kolem okrajů papíru chybět nebo může být papír částečně znečištěný, což závisí na originálu.
[Tisk 2stranný]
Zaškrtněte pole pro tisk na obě strany papíru.
117
Tisk dokumentu
[Umístění vazby]
Určete, zda chcete výtisky svázat podél krátkého nebo dlouhého okraje vázacím nástrojem, například
sešívačkou. Orientace tisku se změní podle zadané polohy vazby. Můžete také zadat okraj pro svázání (
Vnitřní okraj(P. 359) ).
[Delší strana]
Vazba má provést po dlouhé straně papíru.
[Kratší strana]
Vazba má provést po krátké straně papíru.
[Zobrazit varování]
Můžete zadat, jak se má tiskárna chovat, když dojde k chybě.
[Tisk]
Vytiskne se informace o chybě a nevytiskne se obrázek.
[Panel]
Nevytiskne se obrázek a chybová zpráva se zobrazí na ovládacím panelu.
[Vyp]
Nevytiskne se obrázek a nezobrazí se chybová zpráva.
[N na 1]
Zadejte, zda tisknout více stránek na jeden list postupným skládáním na list. Chcete-li například tisknout čtyři
stránky na jeden list, vyberte [4 na 1].
● Pokud je možnost [Velikost papíru] nastavena na [Auto], tato položka není dostupná.
[Pořadí stran]
Vyberte rozložení stránky.
118
Tisk dokumentu
[Kompletace]
Když tisknete dokument o více stránkách zadejte metodu třídění výtisků. Tato položka se zobrazí, když se
vsune karta SD.
[Vyp]
Výtisky se netřídí. Vytiskne se zadaný počet kopií každé stránky. Pokud například
tisknete tři kopie čtyřstránkového dokumentu, budou výtisky uspořádány
v následujícím pořadí stránek: 1, 1, 1, 2, 2, 2, 3, 3, 3, 4, 4, 4.
[Třídit]
Výtisky se seskupí do úplných sad podle pořadových čísel stránek. Pokud například
tisknete tři kopie čtyřstránkového dokumentu, budou výtisky uspořádány
v následujícím pořadí stránek: 1, 2, 3, 4, 1, 2, 3, 4, 1, 2, 3, 4.
[Tisk komentáře]
Vyberte, zda chcete tisknout poznámky.
[Auto]
Vytiskne poznámky v souboru PDF.
[Vyp]
Nevytiskne žádné poznámky.
[Uložit do schránky]
Můžete dokument uložit na kartě SD instalované v tiskárně, aniž provedete tisk. Zaškrtněte pole pro ukládání
dokumentů do boxu zadaného v [Číslo schránky (00–99)]. Dokumenty v boxu můžete tisknout z ovládacího
panelu tolikrát, kolikrát chcete. Způsob tisku je popsán v Tisk dokumentu uloženého v tiskárně(P. 98) .
Tato položka se zobrazí, když je instalována karta SD.
ODKAZY
Tisk bez otevření souboru (přímý tisk)(P. 106)
119
Tisk dokumentu
Tisk přijatých e-mailů (tisk e-mailů)
6867-01U
Funkce E-Mail Print umožňuje tisk zprávy a připojených obrazových souborů e-mailů přijatých z poštovního serveru
POP3, bez použití počítače. E-maily lze přijímat ručně i automaticky v pravidelných intervalech. Pokud používáte
protokol SMTP, vytisknou se e-maily odesílané přímo do zařízení bez poštovních serverů.
Konfigurace nastavení e-mailu(P. 120)
Ruční přijímání e-mailů(P. 124)
● Když v nabídce Nastavení nastavíte možnost <TIFF Spooler> na <Zap>, přijatá data se před tiskem dočasně
uloží v tiskárně nebo na kartu SD. Tím se sníží výskyt chyb. TIFF Spooler(P. 419)
Konfigurace nastavení e-mailu
Tato část pojednává o tom, jak zadat nastavení pro přijímání a tisk e-mailů z tiskárny. Pomocí počítače zadejte
nastavení pro příjem e-mailů a na ovládacím panelu tiskárny zadejte nastavení pro tisk e-mailů.
Pomocí počítače
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
Vzdáleného uživatelského rozhraní(P. 290)
[Nastavení tisku e-mailu].
120
Spuštění
Tisk dokumentu
4
Klikněte na tlačítko [Editovat].
5
Zadejte nastavení pro tisk e-mailů.
Když provádíte tisk e-mailů z poštovního serveru POP3
Když se zahájí příjem e-mailu, všechny e-maily uložené ve schránce poštovního serveru se vytisknou. Pokud
odešlete e-maily, které chcete vytisknout na tiskárně předem, můžete automaticky tisknout e-maily v
pravidelných intervalech nebo vytisknout všechny uložené e-maily tehdy, kdy to určíte.
● Doporučujeme používat danou e-mailovou adresu pouze pro tisk e-mailů, protože všechny e-maily přijaté
tiskárnou se z poštovního serveru smažou.
Podmínky použití protokolu POP3
● Poštovní sever POP3 musí podporovat příkaz UIDL. Podrobnosti získáte u správce sítě nebo serveru.
121
Tisk dokumentu
[Název serveru POP3]
Zadejte název poštovního serveru nebo IP adresu pro přijímání e-mailů.
[Uživatelské jméno POP3]
Zadejte alfanumerické znaky pro uživatelské jméno používané pro připojení k poštovnímu serveru.
[Nastavit/Změnit heslo]
Chcete-li nastavit heslo pro připojení k poštovnímu serveru, zaškrtněte políčko a do textového pole [Heslo]
zadejte alfanumerické znaky pro heslo. Heslo potvrďte jeho opětovným zadáním do textového pole [Potvrdit].
[Interval PŘ. POP3]
Zadejte interval pro automatické připojení k poštovnímu serveru v minutách. Nové e-maily v poštovní
schránce na poštovním serveru se automaticky přijmou a vytisknou v zadaných časových intervalech. Toto
nastavení můžete provést také pomocí <Interval PŘ. POP3> v nabídce nastavení na ovládacím panelu (
Interval PŘ. POP3(P. 355) ).
Zabránění automatickému přijímání e-mailů
● Nastavte [Interval PŘ. POP3] na [0]. Pokud nastavíte [0], musíte e-maily přijímat ručně.
e-mailů(P. 124)
Ruční přijímání
[POP3 PŘ.]
Zaškrtnutím pole umožníte tisk e-mailů z poštovního serveru POP3. Toto nastavení můžete zadat také pomocí
<POP3 PŘ.> v nabídce nastavení na ovládacím panelu ( POP3 PŘ.(P. 355) ).
[Číslo portu serveru POP3]
Zadejte číslo portu poštovního serveru, který přijímá e-maily.
Když provádíte tisk e-mailů pomocí protokolu SMTP
Pokud jsou do zařízení odeslány e-maily prostřednictvím SMTP, zařízení vytiskne e-maily ihned po jejich přijetí.
Tuto funkci povolte, pokud chcete předávat faxové dokumenty z multifunkčních tiskáren Canon do tohoto
zařízení a tisknout je na něm ( Pro předávání faxových dokumentů z multifunkčních tiskáren
Canon(P. 124) ).
[SMTP PŘ.]
Zaškrtnutím pole umožníte tisk e-mailů pomocí protokolu SMTP. Toto nastavení můžete zadat také pomocí
<SMTP PŘ.> v nabídce nastavení na ovládacím panelu ( SMTP PŘ.(P. 355) ).
122
Tisk dokumentu
[Číslo portu serveru SMTP]
Zadejte číslo portu SMTP serveru, který přijímá e-maily.
6
Klikněte na tlačítko [OK].
7
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Pomocí ovládacího panelu
8
Podle potřeby zadejte další nastavení pro tisk e-mailů.
Zadejte, zda chcete tisknout e-mailovou zprávu.
Tisk textu e-mailu(P. 420)
Můžete omezit počet stránek, které se mají v e-mailové zprávě vytisknout.
Omezit tisk e-mailu(P. 420)
Můžete zadat nastavení pro tisk připojených obrázků.
Orientace obrazu(P. 417)
Přiblížení(P. 418)
Poloha tisku(P. 418)
TIFF Spooler(P. 419)
Zobrazit varování(P. 419)
123
Tisk dokumentu
Zvětšit tisk. oblast(P. 421)
Zdrojový profil RGB(P. 421)
Profil sim. CMYK(P. 422)
Výstupní profil(P. 422)
Způsob shody(P. 423)
Polotóny(P. 423)
Korek. foto.(jen CL)(P. 424)
Konverze odst. šedé(P. 426)
Zadejte, zda chcete zobrazit chybu při tisku e-mailu.
Zobrazit varování(P. 321)
Ruční přijímání e-mailů
Pokud je aktivován tisk e-mailů z poštovního serveru POP3, můžete e-maily rovněž ručně přijímat a tisknout. Pokud se
chcete připojit k poštovnímu serveru před automatickým přijetím e-mailů nebo je tiskárna nastavena tak, že
automaticky e-maily nepřijímá, postupujte podle pokynů níže pro ruční přijímání e-mailů.
1
Stiskněte tlačítko
(
).
● Když je tiskárna offline, nefunguje, i když stisknete
(
). Nastavte tiskárnu na režim online.
Tlačítko Online(P. 27)
2
Pomocí tlačítek
3
Vyberte možnost <Přijatý e-mail> a stiskněte tlačítko
4
Vyberte možnost <Ano> a stiskněte tlačítko
/
vyberte možnost <Nástroj.tisk e-mailů> a stiskněte tlačítko
.
.
.
➠ Tiskárna je připojena k poštovnímu serveru. Tisk e-mailů se zahájí pro nové e-maily v poštovní schránce
poštovního serveru, pokud nějaké jsou.
Pro předávání faxových dokumentů z multifunkčních tiskáren Canon
Na tomto přístroji povolte funkci SMTP RX a poté zadejte IP adresu přístroje jako adresu internetového faxu (I
Fax) na zdrojové multifunkční tiskárně. Předané faxové dokumenty se po přijetí okamžitě vytisknou.
124
Tisk dokumentu
● Přiložené soubory lze vytisknout, pouze pokud jsou ve formátu TIFF. Pro každý faxový dokument lze
vytisknout pouze jeden soubor TIFF.
● Pokud je tonerová kazeta téměř prázdná, nelze přijímat žádné faxové dokumenty. Faxové dokumenty, které
nemohly být přijaty na toto zařízení, jsou vytištěny na zdrojové multifunkční tiskárně.
● Je-li na zařízení nainstalována volitelná karta SD, je maximální velikost tisknutelného souboru TIFF omezena
na 100 MB.
ODKAZY
Kontrola historie dokumentů(P. 300)
Seznam protokolu o příjmu e-mailů(P. 525)
125
Praktické možnosti využití s mobilním zařízením
Praktické možnosti využití
s mobilním zařízením
Praktické možnosti využití s mobilním zařízením ...................................................................... 127
Připojení k mobilnímu zařízení ......................................................................................................................... 128
Využívání zařízení pomocí aplikací ................................................................................................................... 129
Použití služby AirPrint ................................................................................................................................... 131
Tisk pomocí služby AirPrint .................................................................................................................... 135
Pokud nelze službu AirPrint použít ........................................................................................................ 138
Použití služby Google Cloud Print ................................................................................................................. 139
Vzdálená správa zařízení .................................................................................................................................. 143
126
Praktické možnosti využití s mobilním zařízením
Praktické možnosti využití s mobilním zařízením
6867-01W
Díky zkombinování zařízení s mobilním přístrojem, například smartphonem nebo tabletem, budete moci využít
vhodnou aplikaci pro snadný tisk. Mobilní zařízení můžete využít také pro ovládání tiskárny na dálku, ke kontrole stavu
tisku a ke změně nastavení tiskárny.
Připojení k mobilnímu zařízení(P. 128)
Využívání zařízení pomocí aplikací(P. 129)
Vzdálená správa zařízení(P. 143)
127
Praktické možnosti využití s mobilním zařízením
Připojení k mobilnímu zařízení
6867-01X
Propojte mobilní zařízení a tiskárnu pomocí ro uteru bezdrátové sítě LAN. Postup nastavení a provozu ro uteru
bezdrátové sítě LAN a mobilních zařízení najdete v návodech k použití příslušných zařízení nebo kontaktujte výrobce.
● Tiskárna se nedodává s routerem bezdrátové sítě LAN. Podle potřeby si jej musíte zajistit sami.
128
Praktické možnosti využití s mobilním zařízením
Využívání zařízení pomocí aplikací
6867-01Y
Pomocí aplikací můžete z mobilního zařízení připojeného ke stroji tisknout a provádět další operace. Jsou podporovány
různé aplikace, včetně těch určených výhradně pro značku Canon. Použití přizpůsobte zařízení, aplikaci a situaci.
◼ Použití dokumentu Canon PRINT Business (Tiskové středisko Canon)
Tato aplikace slouží k tisku a dalším operacím z mobilních zařízení, která podporují systém iOS/Android. Při tisku není
nutné provádět operace na zařízení. Další informace o podporovaných operačních systémech, způsobech podrobného
nastavení a operacích naleznete v nápovědě k příslušné aplikaci nebo na serveru společnosti Canon (https://
global.canon/gomp/).
● Aplikaci Canon PRINT Business (Tiskové středisko Canon) si můžete stáhnout zdarma, bude vám však
účtován poplatek za připojení k internetu.
◼ Tisk pomocí služby Canon Print Service (Služba Canon Print)
Můžete snadno tisknout z nabídky aplikací podporujících tiskový subsystém systému Android. Další informace o
podporovaných operačních systémech, podrobném nastavení a operacích naleznete na serveru společnosti Canon
(https://global.canon).
◼ Tisk pomocí funkce Mopria®
Toto zařízení podporuje také technologii Mopria®. Pomocí funkce Mopria® můžete tisknout z mobilních zařízení
podporujících systém Android. Operace a nastavení jsou shodná, i když se výrobce a model liší. Když například
používáte tiskárny podporující funkci Mopria® vyrobené různými výrobci nebo tiskárnu podporující funkci Mopria®
nacházející se na místě, kde jste na návštěvě, můžete tisknout bez instalace aplikace určené speciálně pro daného
výrobce nebo model. Další informace o podpoře modelu a provozních prostředí najdete na stránce http://
www.mopria.org.
Potvrzení nastavení služby Mopria®
Přihlaste se ke Vzdálenému uživatelskému rozhraní v režimu správce ( Spuštění Vzdáleného
uživatelského rozhraní(P. 290) ) [Nastavení/Uložení] [Síť] [Nastavení technologie Mopria]
[Editovat] Zkontrolujte, zda je zaškrtnuto políčko [Použít technologii Mopria] [OK]
129
Praktické možnosti využití s mobilním zařízením
◼ Tisk pomocí služby Google Cloud Print
Pomocí aplikací a služeb, které podporují Google Cloud Print, můžete tisknout z počítače nebo mobilního zařízení bez
použití ovladače tiskárny. Použití služby Google Cloud Print(P. 139)
130
Praktické možnosti využití s mobilním zařízením
Použití služby AirPrint
6867-020
Díky možnosti zaslat tisková data ze zařízení Apple, můžete tisknout data bez použití ovladače tiskárny.
Nastavení AirPrint
Konfigurace nastavení služby AirPrint(P. 131)
Otevření obrazovky služby AirPrint(P. 133)
Funkce služby AirPrint
Tisk pomocí služby AirPrint(P. 135)
Odstraňování problémů
Pokud nelze službu AirPrint použít(P. 138)
Konfigurace nastavení služby AirPrint
Můžete zaregistrovat údaje, včetně názvu zařízení a instalačního umístění, pomocí nichž lze zařízení identifikovat.
Můžete také deaktivovat službu AirPrint zařízení. Tato nastavení lze změnit pomocí Vzdáleného uživatelského rozhraní.
1
2
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Spuštění
Vzdáleného uživatelského rozhraní(P. 290)
Klikněte na tlačítko [Nastavení/Uložení].
● Používáte-li mobilní zařízení, například iPad, iPhone nebo iPod touch, výrazu „klikněte“ v tomto oddíle
rozumějte jako „klepněte“.
3
Klikněte na položku [Síť]
[Nastavení AirPrint].
131
Praktické možnosti využití s mobilním zařízením
4
Klikněte na tlačítko [Editovat].
5
Zadejte požadované nastavení a klikněte na tlačítko [OK].
[Použít AirPrint]
Zaškrtnutím políčka povolte službu AirPrint. Zrušením zaškrtnutí tohoto políčka lze službu AirPrint opět
zakázat.
132
Praktické možnosti využití s mobilním zařízením
[Název tiskárny]/[Umístění]/[Zeměpisná šířka]/[Zeměpisná délka]
Zadejte název a údaje o instalačním umístění, pomocí nichž bude možné toto zařízení identifikovat při
obsluze zařízení Apple. Tyto informace jsou užitečné v případě, že máte k dispozici více než jednu tiskárnu
se službou AirPrint.
Když zaškrtnete okénko [Použít AirPrint]
Také následující položky jsou automaticky nastaveny na možnost <Zap>.
● <Nastavení mDNS> v IPv4 a IPv6
Konfigurace služby DNS(P. 181)
Zákaz komunikace HTTP(P. 249)
● <HTTP>
● <Tisk IPP>
Konfigurace protokolů tisku a funkcí WSD(P. 160)
Pokud změníte [Název tiskárny]
● Pokud změníte možnost [Název tiskárny], kterou jste zadali dříve, může se stát, že nebude možné tisknout
ze zařízení Mac, které bylo možné doposud k tisku používat. K tomuto jevu dochází kvůli <Název mDNS>
( Konfigurace služby DNS(P. 181) ) v IPv4 se také mění automaticky. V tomto případě znovu přidejte
zařízení do zařízení Mac.
Použití ovládacího panelu
● Službu AirPrint můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
(
)
<Síť>
Zkontrolujte zprávu
<AirPrint>
<Vyp> nebo
<Zap>
Otevření obrazovky služby AirPrint
Z obrazovky služby AirPrint máte přístup k nastavením služby AirPrint a také k informacím o spotřebním materiálu,
například papíru a tonerové kazety. Můžete zde rovněž nakonfigurovat nastavení funkcí zabezpečení ( Používání TLS
pro šifrovanou komunikaci(P. 255) ).
1
Klikněte na [Předvolby systému] v doku na ploše
2
Vyberte svou tiskárnu a klikněte na [Volby a materiály].
3
Klikněte na [Zobrazit webovou stránku tiskárny].
4
Přihlaste se k Vzdálené uživatelské rozhraní.
[Tiskárny a skenery].
● Chcete-li nastavení služby AirPrint změnit, přihlaste se v režimu správce.
➠ Zobrazí se stránka vyhrazená pro AirPrint.
133
Praktické možnosti využití s mobilním zařízením
Ochranné známky
Apple, Bonjour, iPad, iPhone, iPod touch, Mac, macOS, OS X a Safari jsou ochranné známky společnosti Apple Inc.,
registrované v USA a v dalších zemích. AirPrint a logo AirPrint jsou ochranné známky společnosti Apple Inc.
134
Praktické možnosti využití s mobilním zařízením
Tisk pomocí služby AirPrint
6867-021
K tisku e-mailů, fotografií, webových stránek a dalších dat není nutné použít počítač. Služba AirPrint umožňuje přímý
tisk ze zařízení Apple, například iPad, iPhone a iPod touch.
Tisk ze zařízení iPad, iPhone nebo iPod touch(P. 135)
Tisk z počítače Mac(P. 136)
Požadavky na systém
Chcete-li tisknout pomocí služby AirPrint, je třeba použít jedno z následujících zařízení Apple.
● iPad (všechny modely)
● iPhone (3GS nebo novější)
● iPod touch (3. generace nebo novější)
● Mac (Mac OS X 10.7 nebo novější)*
* OS
X 10.9 nebo novější, pokud používáte připojení USB.
Síťové prostředí
Jsou podporována následující prostředí.
● Zařízení Apple a toto zařízení jsou připojená do stejné sítě LAN.
● Počítač Mac a toto zařízení jsou propojené přes rozhraní USB.
Když používáte připojení USB
● Nastavte položku <OS PC připoj. s USB> na možnost <Mac OS>.
OS PC připoj. s USB(P. 329)
Tisk ze zařízení iPad, iPhone nebo iPod touch
1
Ujistěte se, že je zařízení zapnuté a připojené k zařízení Apple.
● Informace o tom, jak to provést, najdete v dokumentu „Začínáme“.
Příručky a jejich obsah(P. 586)
2
Z aplikace v zařízení Apple zobrazte možnosti nabídky klepnutím na tlačítko
3
V rozevírací nabídce klepněte na možnost [Tisk].
135
.
Praktické možnosti využití s mobilním zařízením
4
Vyberte toto zařízení z nabídky [Tiskárna] v [Možnosti tiskárny].
● Zobrazí se tiskárny připojené k síti. V tomto kroku vyberte toto zařízení.
● Nabídka [Možnosti tiskárny] není zobrazena v aplikacích, které nepodporují službu AirPrint. Z takových
aplikací nelze tisknout.
5
Podle potřeby zadejte nastavení tisku.
● Dostupná nastavení a velikosti papíru se liší v závislosti na používané aplikaci.
6
Klepněte na tlačítko [Tisk].
➠ Zahájí se tisk.
Kontrola stavu tisku
● Během tisku dvakrát stiskněte tlačítko Domů na zařízení Apple
a klepněte na možnost [Tisk].
Tisk z počítače Mac
1
Ověřte, že je zařízení zapnuté a připojené k počítači Mac.
● Informace o tom, jak to provést, najdete v dokumentu „Začínáme“.
Příručky a jejich obsah(P. 586)
2
Přidejte stroj do počítače Mac pomocí možnosti [Předvolby systému]
3
Otevřete dokument v aplikaci a zobrazte dialogové okno pro tisk.
[Tiskárny
a skenery].
● Způsob zobrazení dialogového okna pro tisk se liší v závislosti na použité aplikaci. Další informace naleznete
v příručce s pokyny k používané aplikaci.
4
V dialogovém okně tisku vyberte toto zařízení.
● Zobrazí se tiskárny připojené k počítači Mac. Nyní vyberte toto zařízení.
5
Podle potřeby zadejte nastavení tisku.
● Dostupná nastavení a velikosti papíru se liší v závislosti na používané aplikaci.
136
Praktické možnosti využití s mobilním zařízením
6
Klikněte na [Tisk].
➠ Zahájí se tisk.
137
Praktické možnosti využití s mobilním zařízením
Pokud nelze službu AirPrint použít
6867-022
Pokud službu AirPrint nelze použít, vyzkoušejte následující řešení.
● Ověřte, že je zařízení zapnuté. Pokud je zařízení zapnuté, vypněte je, počkejte alespoň 10 sekund a potom je znovu
zapněte a zkontrolujte, zda se tím problém vyřešil.
● Zkontrolujte, zda na zařízení nejsou zobrazeny chybové zprávy.
● Přesvědčte se, že zařízení Apple a toto zařízení jsou připojená ke stejné síti LAN. Je-li zařízení zapnuté, může trvat
několik minut, než bude připravené na komunikaci.
● Je třeba, aby na zařízeních Apple byla povolena služba Bonjour.
● Je třeba, aby bylo zařízení nakonfigurováno na možnost tisku z počítače, i když nebude zadáno ID oddělení ani
heslo. Blokování úloh pokud je zadáno neznámé ID oddělení(P. 223)
● Ověřte, že je v zařízení vložen papír a že je v tonerových kazetách dostatek toneru.
AirPrint(P. 133)
138
Otevření obrazovky služby
Praktické možnosti využití s mobilním zařízením
Použití služby Google Cloud Print
6867-023
Pomocí služby Google Cloud Print může uživatel s účtem Google tisknout ze smartphonu, tabletu nebo počítače
připojeného k internetu pomocí aplikací, které jsou se službou Google Cloud Print kompatibilní. Na rozdíl od běžného
tisku z počítače tento způsob tisku nevyžaduje ovladač tiskárny.
Kontrola nastavení zařízení(P. 139)
Změna nastavení služby Google Cloud Print(P. 139)
Registrace zařízení ve službě Google Cloud Print(P. 140)
● Při registraci zařízení nebo při tisku dokumentů pomocí služby Google Cloud Print je třeba připojit zařízení
k internetu. Zodpovídáte také za uhrazení veškerých poplatků za internetové připojení.
● V některých zemích či oblastech nemusí být možné tuto funkci použít.
● Google Cloud Print nepodporuje tisk z adres IPv6.
● Použití služby Google Cloud Print vyžaduje účet Google. Nemáte-li takový účet zřízený, vytvořte si ho na
webu Google.
Kontrola nastavení zařízení
Před nastavením služby Google Cloud Print zkontrolujte následující položky:
● Přesvědčte se, že zařízení je přiřazena adresa IPv4 a že je připojeno k počítači prostřednictvím sítě.
Připojení ke
kabelové síti LAN(P. 148)
● Zkontrolujte správnost nastavení data a času.
Nastavení data/času(P. 326)
● Pokud je povolena funkce Správa ID oddělení, přesvědčte se, že je zařízení nakonfigurováno na povolení tisku
z počítače i bez zadání ID oddělení a kódu PIN. Blokování úloh pokud je zadáno neznámé ID oddělení(P. 223)
Změna nastavení služby Google Cloud Print
Povolte v zařízení funkci Google Cloud Print. Funkci Google Cloud Print můžete v zařízení také zakázat.
1
Stiskněte tlačítko
2
Pomocí tlačítek
(
/
).
vyberte možnost <Síť> a stiskněte tlačítko
139
.
Praktické možnosti využití s mobilním zařízením
● Když se zobrazí zpráva, stiskněte
.
3
Vyberte možnost <Google Cloud Print> a stiskněte tlačítko
4
Vyberte možnost <Použít Cloud Print> a stiskněte tlačítko
5
Vyberte možnost <Vyp> nebo <Zap> a stiskněte tlačítko
.
.
.
Registrace zařízení ve službě Google Cloud Print
Registrace zařízení ve službě Google Cloud Print umožňuje tisknout data prakticky odkudkoli.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
[Nastavení Google Cloud Print].
140
Spuštění
Praktické možnosti využití s mobilním zařízením
4
Klikněte na tlačítko [Uložit] v části [Stav uložení].
Pokud je možnost [Uložit] nedostupná
● Je třeba povolit službu Google Cloud Print. Klikněte na možnost [Editovat], zaškrtněte políčko [Použít
Google Cloud Print] a klikněte na tlačítko [OK].
Opětovná registrace zařízení
● Chcete-li zařízení znovu zaregistrovat po změně majitele nebo z jiných důvodů, zrušte registraci a znovu jej
zaregistrujte.
5
Klikněte na odkaz adresy URL zobrazené v poli [Adresa URL pro uložení].
141
Praktické možnosti využití s mobilním zařízením
6
Zaregistrujte zařízení podle pokynů na obrazovce.
➠ Nyní lze tisknout z aplikací podporujících službu Google Cloud Print, jako je Google Chrome™.
● Informace o nejnovějších aplikacích, které podporují službu Google Cloud Print, naleznete na webu služby
Google Cloud Print.
Registrace z mobilního zařízení nebo aplikace Google Chrome
Zařízení můžete také zaregistrovat z mobilního zařízení nebo Google Chrome. Na displeji zařízení se zobrazí
následující obrazovka pro potvrzení. Pro dokončení registrace proveďte
<Ano>
.
● Pro provedení registrace musí být zobrazena hlavní obrazovka. Stisknutím
(
) otevřete hlavní
obrazovku a poté přejděte k registraci.
● Informace o postupu registrace najdete v příručce k mobilnímu zařízení nebo na webových stránkách služby
Google Cloud Print.
142
Praktické možnosti využití s mobilním zařízením
Vzdálená správa zařízení
6867-024
Vzdálené uživatelské rozhraní je možné použít v mobilním zařízení prostřednictvím nainstalovaného webového
prohlížeče. Díky tomu můžete pomocí mobilního zařízení zkontrolovat stav zařízení a konfigurovat jeho nastavení.
Upozorňujeme, že obrazovka Vzdáleného uživatelského rozhraní se na některých zařízeních nebo v některých
prostředích nemusí zobrazit řádně.
Spuštění Vzdáleného uživatelského rozhraní z mobilního zařízení
Zadejte IP adresu zařízení do webového prohlížeče a spusťte Vzdálené uživatelské rozhraní. Nejprve zkontrolujte IP
adresu nastavenou v zařízení ( Tisk stavu sítě(P. 523) ). V případě jakýchkoli dotazů kontaktujte správce sítě.
1
Na mobilním zařízení spusťte webový prohlížeč.
2
Do pole pro adresu zadejte text „http://(IP adresa zařízení)/“.
● Chcete-li použít adresu IPv6, dejte adresu IPv6 do závorek (příklad: http://[fe80::2e9e:fcff:fe4e:dbce]/).
ODKAZY
Použití Vzdáleného uživatelského rozhraní(P. 289)
143
Síť
Síť
Síť ............................................................................................................................................................................ 145
Připojení k síti .................................................................................................................................................... 146
Připojení ke kabelové síti LAN ....................................................................................................................... 148
Nastavení IP adres ........................................................................................................................................ 150
Nastavení adresy IPv4 ............................................................................................................................ 151
Nastavení adres IPv6 ............................................................................................................................. 155
Konfigurace zařízení k tisku z počítače ............................................................................................................ 159
Konfigurace protokolů tisku a funkcí WSD .................................................................................................... 160
Aktivace IPP/IPPS ................................................................................................................................... 166
Nastavení tiskového serveru ........................................................................................................................ 173
Konfigurace zařízení na síťové prostředí ......................................................................................................... 177
Konfigurace nastavení sítě Ethernet ............................................................................................................. 178
Nastavení čekací doby před připojením k síti ................................................................................................ 180
Konfigurace služby DNS ............................................................................................................................... 181
Konfigurace služby WINS .............................................................................................................................. 187
Konfigurace protokolu SNTP ........................................................................................................................ 190
Monitorování a ovládání zařízení pomocí protokolu SNMP ........................................................................... 193
Konfigurace nastavení pro software ke správě zařízení ................................................................................ 199
Konfigurace protokolu SMB .......................................................................................................................... 203
Nastavení počítače pro tisk .................................................................................................................... 206
144
Síť
Síť
6867-025
Zařízení bylo navrženo k flexibilnímu používání napříč různými prostředími a kromě základních síťových funkcí
zahrnuje pokročilé technologie. Není nutné, abyste byli odborníky v oblasti sítí, protože zařízení bylo navrženo s cílem
zajistit pohodlné a snadné používání. Uvolněte se a krok za krokem proveďte síťové nastavení.
◼ Připojení k počítači / Zobrazení síťových nastavení zařízení
Připojení k síti(P. 146)
◼ Konfigurace tisku
Konfigurace zařízení k tisku z počítače(P. 159)
◼ Přizpůsobení zařízení k pohodlnější práci v síti
Konfigurace zařízení na síťové prostředí(P. 177)
145
Síť
Připojení k síti
6867-026
Tiskárnu lze připojit k síti pomocí pevné sítě LAN, což vyžaduje jedinečnou síťovou IP adresu. Pro konkrétní nastavení
IP adresy kontaktujte vaše poskytovatele internetových služeb nebo správce sítě.
● Pokud je zařízení připojeno k nezabezpečené síti, může dojít k úniku osobních údajů.
● Zařízení není dodáváno s kabelem ani směrovačem sítě LAN. Opatřete si je podle potřeby.
◼ Než začnete
Připojte zařízení k síti podle těchto kroků.
Zkontrolujte nastavení počítače.
● Ujistěte se, že je počítač správně připojen k síti. Další informace naleznete v příručkách
dodaných se zařízeními, která používáte, nebo je získáte od výrobce.
● Ujistěte se, že v počítači byla provedena síťová nastavení. Pokud nebyla síť řádně
nastavena, nebude možné zařízení používat v síti, ani když provedete následující
zbývající postup.
● Podle používané sítě může být nutné změnit nastavení způsobu komunikace
(poloviční duplex / plný duplex) nebo typu sítě Ethernet (10BASE-T/100BASE-TX/
1000BASE-T) ( Konfigurace nastavení sítě Ethernet(P. 178) ). Další informace
o nastavení získáte od poskytovatele služeb Internetu nebo správce sítě.
● Kontrola adresy MAC zařízení.
Adresa MAC(P. 354)
● Informace o připojení k síti IEEE 802.1X najdete v části
IEEE 802.1X(P. 269)
146
Konfigurace ověřování
Síť
Připojení k pevné síti LAN.
Připojení ke kabelové síti LAN(P. 148)
Nastavení IP adresy.
● V okamžiku nákupu je funkce Auto IP aktivována a zařízení bude automaticky získávat
IP adresy. Nicméně, tato funkce může být používána pouze podle prostředí sítě. V
tomto případě nastavte IP adresu ručně nebo nakonfigurujte systém tak, aby získával
IP adresu pomocí DHCP nebo jiného protokolu.
Nastavení IP adres(P. 150)
147
Síť
Připojení ke kabelové síti LAN
6867-027
Připojte zařízení k počítači pomocí směrovače. Připojte zařízení ke směrovači pomocí kabelu sítě LAN.
1
Připojte kabel LAN.
● Připojte zařízení ke směrovači pomocí kabelu LAN.
● Zatlačte konektor na místo, dokud nezacvakne.
2
Zkontrolujte, zda kontrolka LNK (
) svítí.
● Pokud se indikátor LNK nerozsvítí, mohlo dojít k určitému problému s kabelovým připojením LAN. Další
informace naleznete v části „Odstraňování problémů (FAQ)“ na webu s online příručkami.
3
Zadejte adresu IP.
Nastavení IP adres(P. 150)
● V okamžiku nákupu je funkce Auto IP aktivována a zařízení bude automaticky získávat IP adresy. Nicméně,
tato funkce může být používána pouze podle prostředí sítě. V tomto případě nastavte IP adresu ručně nebo
nakonfigurujte systém tak, aby získával IP adresu pomocí DHCP nebo jiného protokolu.
148
Síť
ODKAZY
Připojení k síti(P. 146)
149
Síť
Nastavení IP adres
6867-028
Připojení zařízení k síti vyžaduje jedinečnou IP adresu. K dispozici jsou dvě verze IP adres: IPv4 a IPv6. Tato nastavení
nakonfigurujte podle síťového prostředí. Chcete-li používat adresy IPv6, je třeba řádně nakonfigurovat nastavení adres
IPv4.
150
Síť
Nastavení adresy IPv4
6867-029
1660-00W
Adresu IPv4 zařízení lze přidělit automaticky dynamickým protokolem IP adresy,
například protokolem DHCP, nebo zadat ručně. Připojujete-li zřízení ke kabelové síti
LAN, přesvědčte se, že konektory kabelu LAN jsou pevně zastrčeny do portů (
Připojení ke kabelové síti LAN(P. 148) ).
Nastavení adresy IPv4
1
Stiskněte tlačítko
2
Pomocí tlačítek
(
/
).
vyberte možnost <Síť> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
.
3
Vyberte možnost <Nastavení TCP/IP>
4
Nakonfigurujte nastavení IP adresy.
<Nastavení IPv4>
<Režim IP>.
<Auto>
Vyberte, pokud chcete automaticky přiřazovat IP adresu pomocí protokolu, jako je DHCP.
<Ruční>
Vyberte, pokud chcete nastavení IP adresy nakonfigurovat ručně zadáním IP adresy.
Automatické přiřazení IP adresy
1
Vyberte možnost <Auto> a stiskněte
2
Vyberte možnost <Protokol> a stiskněte
.
.
151
Síť
3
Vyberte možnost <Použít DHCP>, <Použít BOOTP> nebo <Použít RARP> a stiskněte tlačítko
.
● Můžete použít pouze jeden z protokolů DHCP, BOOTP a RARP. Pokud je vybraný protokol nastaven na
<Zap>, další dva protokoly se automatiky nastaví na <Vyp>.
4
Vyberte možnost <Zap> a stiskněte
5
Stiskněte tlačítko
6
Vyberte možnost <Auto. adresa IP> a stiskněte
7
Vyberte možnost <Zap> a stiskněte
.
.
.
.
Když používáte DHCP
Když vypnete a zapnete napájení, přidělí se jiná IP adresa, než je ta stávající. Tím se může tisk znemožnit.
Chcete-li použít DHCP, zadejte po poradě se správcem sítě jedno z následujících nastavení.
● Konfigurace funkce dynamické aktualizace DNS
Konfigurace služby DNS(P. 181)
● Zadání nastavení pro server DHCP tak, aby přiděloval stále stejnou IP adresu
Pokud nechcete použít protokol DHCP/BOOTP/RARP k přiřazení IP adresy
● Nastavte všechny protokoly na možnost <Vyp>. Jestliže nastavíte položku <Použít DHCP>, <Použít BOOTP>
nebo <Použít RARP> na možnost <Zap>, když jsou servery DHCP/BOOTP/RARP nedostupné, zařízení bude
hledat dostupné služby v síti, a zbytečně tak plýtvat časem i komunikačními zdroji.
IP adresy, které mají přednost
● IP adresy přiřazené pomocí protokolu DHCP/BOOTP/RARP mají přednost před adresami získanými funkcí
Auto IP.
Ruční zadání IP adresy
1
Vyberte možnost <Ruční> a stiskněte
2
Vyberte možnost <Nastavení adresy IP> a stiskněte
.
152
.
Síť
3
Zadejte IP adresu, masku podsítě a adresu brány (případně výchozí bránu).
● Vyberte nastavovanou položku, stiskněte
, zadejte adresu a stiskněte
.
Jak zadávat adresy
● Pomocí
/
se posouvejte k cílovému poli (vstupní oblast oddělená tečkami) a pomocí číselných
kláves zvyšujte nebo snižujte hodnotu.
Když si nejste jisti, jakou IP adresu zadat
● IP adresu lze určit z nastavení routeru v síti.
5
Proveďte tvrdý reset.
Určení IP adresy, která se přidělí tiskárně(P. 153)
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
Kontrola správnosti nastavení
● Ověřte, že na počítači můžete zobrazit obrazovku Vzdáleného uživatelského rozhraní.
Vzdáleného uživatelského rozhraní(P. 290)
Spuštění
Při změně IP adresy po instalaci ovladače tiskárny
● Musíte znovu zadat port, který chcete použít. Postup změny portu najdete v příručkách k příslušným
ovladačům na webu s online příručkami.
Určení IP adresy, která se přidělí tiskárně
Když chcete pro tiskárnu použít pevnou IP adresu, můžete ji určit podle níže uvedeného postupu.
◼ Určení IP adresy
IP adresa se skládá ze čtyř číslic oddělených tečkou (.) (příklad: 192.168.1.45). Každé číslo musí být v rozsahu od
0 do 255. Obecně platí, že první tři čísla jsou stejná jako u routeru, protože jsou pro síť společná. Určete poslední
číslo (například 45 ve 192.168.1.45), které se liší od čísel ostatních zařízení.
153
Síť
◼ Kontrola nastavení routeru
Když chcete použít pevnou IP adresu, zkontrolujte nastavení DHCP, které automaticky přiděluje IP adresu v síti.
Abyste se vyhnuli duplicitě IP adresy, musíte ji nastavit mimo rozsah IP adres přidělených DHCP. Router často
funguje jako server DHCP, a proto zkontrolujte nastavení routeru.
● Pokyny k tomu, jak zobrazit nastavovací obrazovku routeru, najdete v příručce k routeru.
1
Zobrazte obrazovku nastavení routeru.
2
Zkontrolujte rozsah IP adres přidělených DHCP.
● Rozsah IP adres přidělených DHCP se nastavuje podle vašeho routeru.
Příklad obrazovky nastavení DHCP routeru:
3
Zadejte IP adresu tiskárny.
● Na obrazovce s příkladem ukázané v kroku 2 přidělte tiskárně IP adresu v rozsahu 192.168.11.66 až
192.168.11.254, protože IP adresa, kterou přiděluje router pomocí DHCP je v rozsahu 192.168.11.2 až
192.168.11.65.
ODKAZY
Nastavení adres IPv6(P. 155)
Tisk stavu sítě(P. 523)
Konfigurace služby WINS(P. 187)
154
Síť
Nastavení adres IPv6
6867-02A
Adresy IPv6 zařízení lze nakonfigurovat pomocí funkce Vzdálené UR. Před
nastavením adres IPv6 zkontrolujte nastavení adresy IPv4 ( Nastavení adresy
IPv4(P. 151) ). Chcete-li používat adresy IPv6, je třeba správně nastavit adresu IPv4.
Zařízení může používat více následujících adres IPv6:
Typ
Popis
Místní spojovací adresa
Adresa platná pouze v rámci podsítě nebo linky, nelze ji používat ke komunikaci se zařízeními za
hranicí směrovače. Místní spojovací adresa se nastaví automaticky po povolení funkce IPv6 zařízení.
Ruční adresa
Adresa, kterou zadáváte ručně. Při použití této adresy zadejte délku předpony a adresu výchozího
směrovače.
Bezstavová adresa
Adresa, která se generuje automaticky pomocí adresy MAC zařízení a předpony sítě oznámené
směrovačem. Po restartování zařízení (nebo zapnutí napájení) se bezstavové adresy vymažou.
Stavová adresa
1
Adresa získaná ze serveru DHCP pomocí protokolu DHCPv6.
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
[Nastavení TCP/IP].
155
Spuštění
Síť
4
Klikněte na tlačítko [Editovat] v části [Nastavení IPv6].
5
Zaškrtněte políčko [Použít IPv6] a nakonfigurujte požadovaná nastavení.
156
Síť
[Použít IPv6]
Zaškrtnutím políčka povolte funkci IPv6 v zařízení. Nepoužíváte-li funkci IPv6, zaškrtnutí políčka zrušte.
[Použít bezstavovou adresu]
Políčko zaškrtněte při používání bezstavové adresy. Nepoužíváte-li bezstavovou adresu, zaškrtnutí políčka
zrušte.
[Použít ruční adresu]
Chcete-li ručně zadat adresu IPv6, políčko zaškrtněte a do odpovídajících textových polí zadejte IP adresu,
délku předpony a adresu výchozího směrovače.
[IP adresa]
Zadejte adresu IPv6. Nemůžete zadat adresu, která začíná písmeny „ff“ (neboli adresu vícesměrového
vysílání), adresu „0000::0000“ (samé nuly), ani adresu, která začíná „0:0:0:0:0:ffff“ nebo „0:0:0:0:0:0.“
[Délka prefixu]
Zadejte číslo označující počet bitů dostupných pro síťovou adresu.
[Výchozí adresa routeru]
Podle potřeby zadejte adresu IPv6 výchozího routeru. Nemůžete zadat adresu, která začíná písmeny „ff“
(neboli adresu vícesměrového vysílání), adresu „0000::0000“ (samé nuly), ani adresu, která začíná
„0:0:0:0:0:ffff“ nebo „0:0:0:0:0:0.“
[Použít DHCPv6]
Políčko zaškrtněte při používání stavové adresy. Nepoužíváte-li funkci DHCPv6, zaškrtnutí políčka zrušte.
6
Klikněte na tlačítko [OK].
7
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
157
Síť
➠ Nastavení se aktivují po provedení tvrdého resetu.
Kontrola správnosti nastavení
● Zkontrolujte, zda lze pomocí počítače zobrazit Vzdálené uživatelské rozhraní tak, že zadáte adresu IPv6
zařízení. Spuštění Vzdáleného uživatelského rozhraní(P. 290)
Volba nastavení pomocí ovládacího panelu
● IPv6 adresy můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
IPv6(P. 339)
Nastavení
Při změně IP adresy po instalaci ovladače tiskárny
● Musíte znovu zadat port, který chcete použít. Postup změny portu najdete v příručkách k příslušným
ovladačům na webu s online příručkami.
ODKAZY
Nastavení adresy IPv4(P. 151)
Tisk stavu sítě(P. 523)
158
Síť
Konfigurace zařízení k tisku z počítače
6867-02C
Při používání zařízení jako síťové tiskárny lze nakonfigurovat protokoly a porty používané k tisku a vytvořit pro zařízení
tiskový server. Před konfigurací zařízení pro tisk z počítače proveďte základní nastavení, včetně instalace ovladače
tiskárny. Další informace najdete v příručkách k příslušným ovladačům na webu s online příručkami.
● Tiskové protokoly představují pravidla doručování dat dokumentů vytvořených v počítači do zařízení a lze je
vybrat podle účelu tisku nebo síťového prostředí.
● Porty představují brány k předávání dat dokumentů z počítače do tiskárny. Nesprávná nastavení portů jsou
častou příčinou situace, kdy nelze vytisknout dokumenty z počítače zapojeného do sítě.
159
Síť
Konfigurace protokolů tisku a funkcí WSD
6867-02E
Nakonfigurujte protokoly, které se používají k tisku dokumentů z počítače zapojeného v síti. Tiskové protokoly
podporované zařízením naleznete v části Síťové prostředí(P. 569) . Tato část popisuje nastavení LPD, RAW, IPP/IPPS
a WSD.
Pro použití FTP
● Informace o konfiguraci nastavení naleznete v níže uvedené položce.
Používání klientů FTP(P. 594)
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Nakonfigurujte tiskové protokoly.
[Nastavení TCP/IP].
160
Spuštění
Síť
Konfigurace nastavení LPD
1
Klikněte na [Editovat] v [Nastavení LPD].
2
Nastavení podle potřeby nakonfigurujte.
[Použít tisk LPD]
Pokud pro tisk používáte LPD, zaškrtněte příslušné pole. Když ho nepoužíváte, zaškrtnutí zrušte.
[Tisknout stránku protokolu LPD]
Zaškrtněte pole pro zahrnutí informací o uživatelském jménu a názvech souborů na výtiscích. Když tyto
informace nechcete tisknout, zaškrtnutí zrušte.
[Časová prodleva PŘ]
Nastavte časové období, po němž tisková úloha automaticky skončí, pokud tisková data nelze přijmout v
důsledku komunikační chyby nebo nějakému jinému problému.
3
Klikněte na [OK].
Konfigurace nastavení RAW
1
Klikněte na [Editovat] v [Nastavení RAW].
161
Síť
2
Nastavení podle potřeby nakonfigurujte.
[Použít tisk RAW]
Používáte-li k tisku formát RAW, zaškrtněte políčko. Pokud službu IPP nepoužíváte, zaškrtnutí políčka
zrušte.
[Použít obousměrnou komunikaci]
Když používáte obousměrnou komunikaci k informování počítače o stavu tiskárny a dokončení tisku,
zaškrtněte dané pole. Když ho nepoužíváte, zaškrtnutí zrušte.
[Časová prodleva PŘ]
Nastavte časové období, po němž tisková úloha automaticky skončí, pokud tisková data nelze přijmout v
důsledku komunikační chyby nebo nějakému jinému problému.
3
Klikněte na [OK].
Konfigurace nastavení IPP/IPPS
1
Klikněte na [Editovat] v [Nastavení tisku IPP].
2
Nastavení podle potřeby nakonfigurujte.
162
Síť
[Použít tisk IPP]
Pokud pro tisk používáte IPP/IPPS, zaškrtněte příslušné pole. Když ho nepoužíváte, zaškrtnutí zrušte.
[Použít TLS]
Pokud pro tisk používáte IPPS (tisk IPP se šifrovanou komunikací TLS), zaškrtněte příslušné pole. Když ho
nepoužíváte, zaškrtnutí zrušte.
Při používání protokolu IPPS povolte funkci šifrované komunikace TLS.
komunikaci(P. 255)
Používání TLS pro šifrovanou
Pokud vyberete [RSA] pro [Algoritmus klíče] s generováním klíče pro síťovou komunikaci, nastavte délku
klíče [1024 bitů] nebo delší. Tisk IPPS možná nebude správně proveditelný, pokud je nastavena délka klíče
[512 bitů], v závislosti na používaném operačním systému.
[Použít ověření IPP]
Když používáte funkci ověření uživatele pro tisk IPP, zaškrtněte pole a nastavte uživatelské jméno a heslo.
Když ho nepoužíváte, zaškrtnutí zrušte.
[Uživatelské jméno]
Zadejte alfanumerické znaky pro uživatelské jméno použité při ověřování IPP.
[Nastavit/Změnit heslo]
Chcete-li zadat nebo změnit heslo, zaškrtněte toto políčko a formou alfanumerických znaků zadejte heslo
do textového pole [Heslo]. Heslo potvrďte jeho opětovným zadáním do textového pole [Potvrdit].
3
Klikněte na [OK].
Konfigurace nastavení WSD
1
Klikněte na [Editovat] v [Nastavení tisku WSD].
163
Síť
2
Nastavení podle potřeby nakonfigurujte.
[Použít tisk WSD]
Pokud pro tisk používáte WSD, zaškrtněte příslušné pole. Když ho nepoužíváte, zaškrtnutí zrušte.
[Použít procházení WSD]
Políčko zaškrtněte, pokud chcete získávat informace o zařízení z počítače pomocí protokolu WSD. Toto
políčko se automaticky zaškrtne, je-li zaškrtnuto políčko [Použít tisk WSD].
[Použít Multicast Discovery]
Políčko zaškrtněte, pokud chcete nastavit zařízení tak, aby odpovídalo na požadavky na zprávy
vícesměrového zjišťování. Pokud je zaškrtávací pole prázdné, přístroj zůstane v režimu spánku, i když na
síti běží zprávy vícesměrového zjišťování.
3
5
Klikněte na [OK].
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
164
Síť
Použití ovládacího panelu
● Tisk LPD, RAW a IPP můžete povolit nebo zakázat z nabídky nastavení na ovládacím panelu.
Nastavení LPD(P. 341)
Nastavení RAW(P. 341)
Tisk IPP(P. 342)
● K nastavení WSD můžete také získat přístup z nabídky nastavení na ovládacím panelu.
WSD(P. 342)
Postupy nastavení pro váš počítač
Po nastavení tiskárny můžete konfigurovat nastavení nebo instalovat aplikace také na počítač. Proveďte
nastavení na počítači podle potřeby.
● Konfigurace portů tiskárny
Pokud se změní IP adresa zařízení nebo pokud se přidá tiskárna pomocí složky tiskáren systému Windows,
může dojít k chybám tisku. Tyto chyby jsou obvykle způsobeny nesprávným nastavením portu tiskárny.
Mohlo být zadáno například nesprávné číslo nebo typ portu. V takovém případě musíte nakonfigurovat porty
tiskárny. Postup změny portu najdete v příručkách k příslušným ovladačům na webu s online příručkami.
● Nastavení síťových zařízení WSD v systému Windows Vista/7/8/10
K instalaci ovladače tiskárny použijte port WSD. Další informace najdete v příručkách k příslušným
ovladačům na webu s online příručkami.
● Aktivace IPP/IPPS
Instalujte ovladače tiskárny zadáním portu IPP.
Aktivace IPP/IPPS(P. 166)
ODKAZY
Nastavení tiskového serveru(P. 173)
165
Síť
Aktivace IPP/IPPS
6867-02F
Chcete-li nastavit tiskový protokol na IPP nebo IPPS, nainstalujte ovladač tiskárny prostřednictvím níže uvedeného
postupu, který vyhovuje operačnímu systému vašeho počítače. Ovladač tiskárny je součástí disku Disk CD-ROM/DVDROM s uživatelským softwarem, který se dodává se zařízením. Před zahájením postupu vložte disk Disk CD-ROM/DVDROM s uživatelským softwarem s uživatelským softwarem do ovladače v počítači.
● Před prováděním tohoto postupu se přihlaste k počítači s účtem správce.
● Nastavte tisk IPP pomocí vzdáleného uživatelského rozhraní a potom zahajte daný postup.
Konfigurace protokolů tisku a funkcí WSD(P. 160)
● Zavřete obrazovku nastavení, která se zobrazí po vložení disku CD-ROM/DVD-ROM.
1
Otevřete složku tiskárny.
2
Klikněte na [Přidat tiskárnu].
3
4
Zobrazení složky tiskárny(P. 608)
Používáte-li systém Windows Vista/7/Server 2008, klikněte na možnost [Přidat
síťovou, bezdrátovou nebo Bluetooth tiskárnu].
Klikněte na [Požadovaná tiskárna není v seznamu.].
166
Síť
5
Vyberte [Vybrat sdílenou tiskárnu podle názvu], zadejte cíl připojení a klikněte na
[Další].
● Chcete-li použít IPP, zadejte jako destinaci připojení „http://<IP adresa zařízení>/ipp“.
Příklad: http://192.168.1.81/ipp
● Chcete-li použít IPPS, zadejte jako destinaci připojení „https://<IP adresa zařízení>/ipp“.
Příklad: https://192.168.1.81/ipp
● Když používáte server DNS, zadejte „<název hostitele zařízení>.<název domény>“ namísto „IP adresy
zařízení“ (příklad: https://my_printer.example.com/ipp).
6
Klikněte na [Z disku].
7
Klikněte na [Procházet].
167
Síť
8
Určete složku, ve které jsou obsaženy ovladače tiskárny, vyberte soubor INF a potom
klepněte na [Otevřít].
● Zadejte složku níže uvedeným způsobem podle operačního systému počítače. Pokud si nejste jisti, zda
počítač používá 32bitovou, nebo 64bitovou verzi operačního systému, podívejte se do části Kontrola
bitové architektury(P. 611) .
32bitové operační systémy
Vyberte složku [UFR II]-váš jazyk-[32BIT]-[Driver] na disku Disk CD-ROM/DVD-ROM s uživatelským
softwarem.
64bitové operační systémy
Vyberte složku [UFR II]-váš jazyk-[x64]-[Driver] na disku Disk CD-ROM/DVD-ROM s uživatelským softwarem.
Pokud používáte funkci ověřování IPP
● Po zobrazení výzvy k zadání hesla zadejte uživatelské jméno a heslo a klikněte na [OK].
protokolů tisku a funkcí WSD(P. 160)
9
Konfigurace
Postupujte podle kroků uvedených na obrazovkách.
➠ Ovladač tiskárny je nainstalován. Chcete-li použít IPPS, instalujte veřejné klíče tiskárny do počítače.
◼ Instalace veřejných klíčů tiskárny
Použití IPPS vyžaduje také instalaci veřejných klíčů tiskárny do počítače.
● [Běžné jméno] párů klíčů se musí nastavit předem na „IP adresu“ nebo „<název hostitele>.<název domény>“
použitých při připojení k tiskárně. Generování párů klíčů(P. 276)
168
Síť
1
Spusťte internetový prohlížeč.
2
Do pole adresy zadejte „https://<IP adresa zařízení>/“ a stiskněte klávesu [ENTER].
● Příklad: https://192.168.1.81/
● Když používáte server DNS, zadejte „<název hostitele zařízení>.<název domény>“ namísto „IP adresy
zařízení“ (příklad: https://my_printer.example.com/).
3
Klikněte na [Pokračovat na tento web (nedoporučujeme).].
➠ Zobrazí se stránka přihlášení.
4
Klikněte na položku [Nástroje]
5
Vyberte [Důvěryhodné servery] na kartě [Zabezpečení] a klikněte na [Servery].
[Možnosti internetu].
169
Síť
6
Zkontrolujte, zda se zobrazí „https://<IP adresa stroje> nebo <jméno hostitele
7
Vyrušte políčko [Povolit chráněný režim (vyžaduje restartování aplikace Internet
8
Klikněte na [OK].
stroje>.<jméno domény>/“, a poté klikněte na [Přidat]
[Zavřít].
Explorer)], pokud je zaškrtnuto.
➠ Obrazovka se vrátí na obrazovku vzdáleného uživatelského rozhraní.
9
Zavřete internetový prohlížeč.
10
Opakujte kroky 1 až 3 a spusťte vzdálené uživatelské rozhraní.
11
Klikněte na [Chyba certifikátu]
[Zobrazit certifikáty] na pravé straně pole pro
adresu.
170
Síť
12
Klikněte na [Nainstalovat certifikát].
13
Klikněte na [Další].
14
Vyberte možnost [Všechny certifikáty umístit v následujícím úložišti] a klikněte na
15
16
tlačítko [Procházet].
Vyberte [Důvěryhodné kořenové certifikační autority] a podle pokynů na obrazovce
projděte nápovědu pro import certifikátu.
Pokud jste v kroku 7 zrušili zaškrtnutí políčka [Povolit chráněný režim (vyžaduje
restartování aplikace Internet Explorer)], zaškrtněte toto políčko.
171
Síť
ODKAZY
Nastavení tiskového serveru(P. 173)
172
Síť
Nastavení tiskového serveru
6867-02H
Pomocí tiskového serveru lze snížit zatížení počítače, z něhož tisknete. Tiskový server také umožňuje na každém
počítači nainstalovat ovladače tiskárny v rámci sítě, což vám ušetří potíže s instalací ovladačů tiskárny v každém
počítači pomocí disku CD-ROM/DVD-ROM. Chcete-li nastavit počítač v síti jako tiskový server, nakonfigurujte nastavení
pro sdílení tiskárny.
● Před prováděním tohoto postupu se přihlaste k počítači s účtem správce.
● Podle operačního systému a bitové architektury (32bitové nebo 64bitové) tiskového serveru a klientských
počítačů se může stát, že nebude možné nainstalovat ovladače tiskárny přes síť.
● Při implementaci tiskového serveru v doménovém prostředí se poraďte se správcem sítě.
Provádění správy ID oddělení při použití tiskového serveru
● Během instalace ovladače tiskárny je třeba přidat službu Canon Driver Information Assist Service (Služba
asistence informací ovladače Canon). Další informace najdete v příručkách k příslušným ovladačům na webu
s online příručkami.
1
2
3
Otevřete složku tiskárny.
Zobrazení složky tiskárny(P. 608)
Pravým tlačítkem klikněte na ikonu tiskárny a poté klikněte na položku [Vlastnosti
tiskárny] nebo [Vlastnosti].
Klikněte na kartu [Sdílení], vyberte možnost [Sdílet tuto tiskárnu] a zadejte sdílený
název zařízení.
173
Síť
Když se zobrazí [Změnit možnosti sdílení]
● Klikněte na [Změnit možnosti sdílení].
4
Podle potřeby nainstalujte další ovladače.
● Tato akce je nutná, pokud chcete ovladače tiskáren nainstalovat přes tiskový server do dalších počítačů
používajících jinou bitovou architekturu.
1
Klikněte na [Další ovladače].
2
Zaškrtněte políčko u bitové architektury používané dalšími počítači a klikněte na tlačítko [OK].
● Podle operačního systému tiskového serveru vyberte další ovladače z následujících.
Tiskový server
Označte zaškrtávací políčko:
32bitový operační systém
[x64]
64bitový operační systém
[x86] v části [Procesor]
174
Síť
● Pokud nevíte, zda systém Windows představuje 32bitovou, nebo 64bitovou verzi, podívejte se do části
Kontrola bitové architektury(P. 611) .
3
Vložte Disk CD-ROM/DVD-ROM s uživatelským softwarem do jednotky v počítači a klikněte na [Procházet].
4
Určete složku, která obsahuje přídavné ovladače, vyberte soubor INF a potom klikněte na [Otevřít].
● Podle operačního systému tiskového serveru vyberte složku, jak je to uvedeno níže.
Pokud tiskový server používá 32bitový operační systém
Vyberte složku [UFR II]-váš jazyk-[x64]-[Driver] na disku Disk CD-ROM/DVD-ROM s uživatelským
softwarem.
Pokud tiskový server používá 64bitový operační systém
Vyberte složku [UFR II]-váš jazyk-[32BIT]-[Driver] na disku Disk CD-ROM/DVD-ROM s uživatelským
softwarem.
5
Klikněte na [OK].
➠ Spustí se instalace přídavných ovladačů. Počkejte, až se zobrazí karta [Sdílení].
Když se zobrazí [Řízení uživatelských účtů]
● Klikněte na [Ano].
5
Klikněte na [OK].
◼ Instalace ovladačů tiskáren do počítače přes tiskový server
1
Vyhledejte na tiskovém serveru sdílenou tiskárnu.
2
Dvakrát klikněte na sdílenou tiskárnu.
3
Ovladače tiskáren nainstalujte podle pokynů na obrazovce.
Zobrazení sdílených tiskáren na
tiskovém serveru(P. 609)
175
Síť
ODKAZY
Tisk z počítače(P. 74)
176
Síť
Konfigurace zařízení na síťové prostředí
6867-02J
Konfigurace sítě se liší podle účelu dané sítě. Zařízení bylo navrženo tak, aby bylo kompatibilní s maximálním
množstvím síťových konfigurací, a zahrnuje řadu technologií. Poraďte se se správcem sítě a nastavte konfiguraci
odpovídající danému síťovému prostředí.
177
Síť
Konfigurace nastavení sítě Ethernet
6867-02K
Ethernet představuje standard datové komunikace v místní síti (LAN). Můžete zadat
režim komunikace a typ sítě Ethernet. Zařízení lze obecně používat beze změny
výchozích nastavení ( Ovladač ethernetu(P. 352) ), můžete je však změnit podle
používaného síťového prostředí.
1
Stiskněte tlačítko
2
Pomocí tlačítek
(
/
).
vyberte možnost <Síť> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
.
3
Vyberte <Ovladač ethernetu>
4
Zvolte, zda chcete nastavení sítě Ethernet konfigurovat automaticky nebo ručně.
<Automatická detekce>.
Automatická konfigurace nastavení sítě Ethernet
Vyberte možnost <Zap> a stiskněte tlačítko
. Zařízení rozpozná a automaticky nastaví režim komunikace a
typ sítě Ethernet, který lze použít.
Ruční konfigurace nastavení sítě Ethernet
1
Vyberte možnost <Vyp> a stiskněte tlačítko
2
Vyberte režim komunikace.
.
● Vyberte možnost <Režim komunikace>
vyberte možnost <Poloviční duplex> nebo <Úplný
duplex>
<Poloviční duplex>
Buď zasílá, nebo přijímá komunikační data. Zvolte, pokud je zařízení připojeno k síťovému zařízení
používajícímu poloviční duplex.
<Úplný duplex>
Současně zasílá i přijímá komunikační data. Toto nastavení použijte ve většině prostředí.
178
Síť
3
Vyberte typ sítě Ethernet.
● Vyberte <Typ ethernetu>
Vyberte typ Ethernetu
● Když vyberete možnost <1000 Base-T>, nastavení pro <Režim komunikace> se změní na <Úplný
duplex>.
5
Proveďte tvrdý reset.
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
ODKAZY
Nastavení čekací doby před připojením k síti(P. 180)
179
Síť
Nastavení čekací doby před připojením k síti
6867-02L
Pokud síť nabízí nadbytečné možnosti připojení pomocí více přepínačů či mostů, musí zahrnovat mechanismus, jak
zabránit zacyklení paketů. Účinným řešením je definování role každého přepínacího portu. Po dobu několika desetin
sekundy po změně způsobu, jakým jsou připojena síťová zařízení, případně po přidání nového zařízení, však může
přesto docházet k přerušování komunikace. Pokud dochází k tomuto typu problémů, nastavte čekací dobu pro
připojení k síti.
1
Stiskněte tlačítko
2
Pomocí tlačítek
(
/
).
vyberte možnost <Síť> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
3
Vyberte možnost <Čekání při spuštění> a stiskněte tlačítko
4
Zadejte čekací dobu v sekundách a stiskněte tlačítko
.
● Pomocí číselných kláves zadejte čas.
5
Proveďte tvrdý reset.
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
ODKAZY
Konfigurace nastavení sítě Ethernet(P. 178)
180
.
.
Síť
Konfigurace služby DNS
6867-02R
DNS (Domain Name System) je služba pro rozpoznávání názvů, která přiřazuje název hostitele (či domény) k IP adrese.
Nastavení možností DNS, mDNS či DHCP nakonfigurujte podle svých potřeb. Upozorňujeme, že postup konfigurace
služby DNS se liší u adres IPv4 a IPv6.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Nakonfigurujte nastavení služby DNS.
Vzdáleného uživatelského rozhraní(P. 290)
[Nastavení TCP/IP].
Konfigurace služby IPv4 DNS
1
Klikněte na tlačítko [Editovat] v části [Nastavení IPv4].
181
Spuštění
Síť
2
Nakonfigurujte nastavení služby IPv4 DNS.
[Nastavení DNS]
[Adresa primárního serveru DNS]
Zadejte IP adresu serveru DNS. IP adresu můžete zadat i z ovládacího panelu (
IPv4(P. 336) ).
Nastavení
[Adresa sekundárního serveru DNS]
Zadejte IP adresu případného sekundárního serveru DNS. IP adresu můžete zadat i z ovládacího
panelu ( Nastavení IPv4(P. 336) ).
[Jméno hostitele]
Formou alfanumerických znaků zadejte název hostitele zařízení, které chcete zaregistrovat na
serveru DNS.
[Jméno domény]
Formou alfanumerických znaků zadejte název domény, do níž zařízení patří, například
„priklad.com“.
[Dynamická aktualizace DNS]
Políčko zaškrtněte, pokud chcete dynamicky aktualizovat záznamy služby DNS po každé změně IP
adresy zařízení.
[Nastavení mDNS]
[Použít mDNS]
mDNS (multicast DNS) je protokol přijatý službou Bonjour, který slouží k přiřazení názvu hostitele
k adrese IP bez použití systému DNS. Chcete-li funkci mDNS povolit, zaškrtněte políčko a zadejte
182
Síť
název mDNS do textového pole [Název mDNS]. Toto políčko lze zaškrtnout pouze v případě, že je
zaškrtnuté políčko [Použít IPv4].
[Nastavení volby DHCP]
[Získat jméno hostitele]
Zaškrtnutím políčka povolíte Možnost 12 sloužící k získávání názvu hostitele ze serveru DHCP.
Můžete také zadat, zda získat název hostitele z ovládacího panelu ( Nastavení IPv4(P. 336) ).
[Dynamická aktualizace DNS]
Zaškrtnutím políčka povolíte Možnost 81 sloužící k dynamické aktualizaci záznamů DNS
prostřednictvím serveru DHCP. To, zda provádět dynamickou aktualizaci záznamů DNS můžete také
zadat z ovládacího panelu ( Nastavení IPv4(P. 336) ).
[Získat adresu serveru DNS]
Zaškrtnutím políčka povolíte možnost 6 pro získání adresy serveru DNS ze serveru DHCP.
[Získat název domény]
Zaškrtnutím políčka povolíte možnost 15 pro získání názvu domény ze serveru DHCP.
[Získat adresu serveru WINS]
Zaškrtnutím políčka povolíte možnost 44 pro získání adresy serveru WINS ze serveru DHCP.
3
Klikněte na tlačítko [OK].
Konfigurace služby IPv6 DNS
1
Klikněte na tlačítko [Editovat] v části [Nastavení IPv6].
183
Síť
2
Nakonfigurujte nastavení služby IPv6 DNS.
● Před konfigurací těchto nastavení musí být zaškrtnuté políčko [Použít IPv6].
IPv6(P. 155)
[Nastavení DNS]
184
Nastavení adres
Síť
[Adresa primárního serveru DNS]
Zadejte IP adresu serveru DNS. Nemůžete zadat adresu, která začíná písmeny „ff“ (neboli adresu
vícesměrového vysílání), adresu „0000::0000“ (samé nuly), ani adresu, která začíná „0:0:0:0:0:ffff“
nebo „0:0:0:0:0:0.“
[Adresa sekundárního serveru DNS]
Zadejte IP adresu případného sekundárního serveru DNS. Nemůžete zadat adresu, která začíná
písmeny „ff“ (neboli adresu vícesměrového vysílání), adresu „0000::0000“ (samé nuly), ani adresu,
která začíná „0:0:0:0:0:ffff“ nebo „0:0:0:0:0:0.“
[Použít IPv4 jména hostitele/domény]
Políčko zaškrtněte, pokud chcete používat stejný název hostitele a domény jako ve funkci IPv4.
[Jméno hostitele]
Formou alfanumerických znaků zadejte název hostitele zařízení, které chcete zaregistrovat na
serveru DNS.
[Jméno domény]
Formou alfanumerických znaků zadejte název domény, do níž zařízení patří, například
„priklad.com“.
[Dynamická aktualizace DNS]
Políčko zaškrtněte, pokud chcete dynamicky aktualizovat záznamy služby DNS po každé změně IP
adresy zařízení. Pro zadání typů adres, které chcete zaregistrovat na serveru DNS, zaškrtněte
políčko [Uložit ruční adresu], [Uložit stavovou adresu] nebo [Uložit bezstavovou adresu].
[Nastavení mDNS]
[Použít mDNS]
mDNS (multicast DNS) je protokol přijatý službou Bonjour, který slouží k přiřazení názvu hostitele
k IP adrese bez použití systému DNS. Chcete-li funkci mDNS povolit, zaškrtněte políčko. Toto políčko
lze zaškrtnout pouze v případě, že je zaškrtnuto políčko [Použít IPv6].
[Použít stejný název mDNS jako IPv4]
Zaškrtnutím políčka se použije stejný název mDNS jako název nastavený v IPv4. Chcete-li nastavit
jiný název, zrušte zaškrtnutí políčka a zadejte název mDNS do textového pole [Název mDNS].
[Nastavení volby DHCP]
[Získat adresu serveru DNS]
Zaškrtnutím políčka povolíte možnost 23 pro získání adresy serveru DNS ze serveru DHCP.
[Získat název domény]
Zaškrtnutím políčka povolíte možnost 24 pro získání názvu domény ze serveru DHCP.
3
5
Klikněte na tlačítko [OK].
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
185
Síť
➠ Nastavení se aktivují po provedení tvrdého resetu.
ODKAZY
Nastavení adresy IPv4(P. 151)
Nastavení adres IPv6(P. 155)
Tisk stavu sítě(P. 523)
186
Síť
Konfigurace služby WINS
6867-02S
WINS (Windows Internet Name Service) je služba, která přiřazuje název NetBIOS (tj. název počítače nebo tiskárny v síti
SMB) k IP adrese. K povolení služby WINS je nutné zadat server WINS.
● Funkce není dostupná v síti IPv6.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Klikněte na tlačítko [Editovat] v části [Konfigurace WINS].
Vzdáleného uživatelského rozhraní(P. 290)
[Nastavení TCP/IP].
187
Spuštění
Síť
5
Zaškrtněte políčko [Rozlišení WINS], zadejte požadovaná nastavení a klikněte na
tlačítko [OK].
[Rozlišení WINS]
Chcete-li pro rozlišení názvů používat službu WINS, zaškrtněte toto políčko. Pokud službu WINS nepoužíváte,
zaškrtnutí políčka zrušte.
[Adresa serveru WINS]
Zadejte IP adresu serveru WINS.
● Pokud se IP adresa serveru WINS získává ze serveru DHCP, přepíše získaná IP adresa IP adresu zadanou
v textovém poli [Adresa serveru WINS].
[Rozsah ID]
Při rozdělování sítě do několika skupin s ID oboru (identifikátory pro skupiny zařízení v síti) zadejte ID oboru
pro váš počítač. Pokud pro váš počítač není nastaveno ID oboru, ponechte textové pole prázdné.
[Název serveru SMB]
Při registraci zařízení na serveru WINS zadejte název serveru, který se má použít v síti SMB.
● Nelze používat mezery.
● Název serveru zadaný v [Název serveru] pod [Nastavení SMB] se automaticky použije pro případný [Název
serveru SMB]. Změna názvu serveru v [Název serveru SMB] se provede také v [Název serveru] pod
[Nastavení SMB].
[Název pracovní skupiny SMB ]
Při registraci přístroje na serveru WINS zadejte název pracovní skupiny, do které přístroj patří v síti SMB.
● Nelze používat mezery.
188
Síť
● Název pracovní skupiny zadaný v [Název pracovní skupiny] pod [Nastavení SMB] se automaticky použije
pro případný [Název pracovní skupiny SMB]. Změna názvu pracovní skupiny v [Název pracovní skupiny
SMB] se provede také v [Název pracovní skupiny] pod[Nastavení SMB].
6
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Volba nastavení pomocí ovládacího panelu
● Nastavení WINS můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
WINS(P. 340)
ODKAZY
Konfigurace protokolu SMB(P. 203)
189
Rozlišení
Síť
Konfigurace protokolu SNTP
6867-02U
Protokol SNTP (Simple Network Time Protocol) umožňuje upravit systémové hodiny
pomocí časového serveru v síti. Když používáte protokol SNTP, systém pravidelně
kontroluje časový server, takže systémový čas je vždy přesný.
● Funkce SNTP zařízení podporuje server NTP (verze 3) i SNTP (verze 3 a 4).
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Klikněte na tlačítko [Editovat] v části [Nastavení SNTP].
Vzdáleného uživatelského rozhraní(P. 290)
[Nastavení TCP/IP].
190
Spuštění
Síť
5
Zaškrtněte políčko [Použít SNTP] a zadejte požadovaná nastavení.
[Použít SNTP]
Políčko zaškrtněte, pokud chcete provádět synchronizaci pomocí funkce SNTP. Pokud funkci SNTP nechcete
používat, zaškrtnutí políčka zrušte.
[Název serveru NTP]
Zadejte IP adresu serveru NTP nebo SNTP. Je-li v síti dostupná služba DNS, můžete místo toho zadat „<host
name>.<domain name>“ (nebo FQDN) pomocí alfanumerických znaků (příklad: ntp.example.com).
[Interval pollingu]
Zadejte interval mezi dvěma synchronizacemi.
6
Klikněte na tlačítko [OK].
7
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
191
Síť
➠ Nastavení se aktivují po provedení tvrdého resetu.
Testování komunikace se serverem NTP/SNTP
● Chcete-li zobrazit stav komunikace s uloženým serverem, klikněte na možnost [Nastavení/Uložení] [Síť]
[Nastavení TCP/IP] a potom na možnost [Kontrola připojení NTP serveru] v zobrazené nabídce [Nastavení
SNTP]. Pokud bylo vytvořeno funkční připojení, zobrazí se výsledek (viz níže). Upozorňujeme, že touto
operací se neupraví systémové hodiny.
Volba nastavení pomocí ovládacího panelu
● Nastavení SNTP můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
192
SNTP(P. 345)
Síť
Monitorování a ovládání zařízení pomocí protokolu
SNMP
6867-02W
SNMP (Simple Network Management Protocol) je protokol určený k monitorování a ovládání komunikačních zařízení
v síti pomocí funkce MIB (Management Information Base). Zařízení podporuje protokol SNMPv1 a protokol SNMPv3
s vylepšenými funkcemi zabezpečení. Stav zařízení lze zkontrolovat z počítače při tisku dokumentů nebo pomocí
Vzdáleného uživatelského rozhraní. Můžete povolit buď protokol SNMPv1, nebo SNMPv3, případně oba současně. U
každé verze zadejte nastavení odpovídající síťovému prostředí a účelům používání.
SNMPv1
Protokol SNMPv1 využívá informace nazývané „komunita“ k určení rozsahu komunikace SNMP. Protože se tyto
informace objevují na síti ve formě prostého textu, bude síť ohrožena útoky. Chcete-li zajistit zabezpečení sítě,
vypněte protokol SNMPv1 a používejte SNMPv3.
SNMPv3
Při použití protokolu SNMPv3 můžete implementovat správu síťových zařízení chráněnou robustními funkcemi
zabezpečení. Upozorňujeme, že před konfigurací protokolu SNMPv3 musí být povolena funkce TLS Vzdáleného
uživatelského rozhraní ( Používání TLS pro šifrovanou komunikaci(P. 255) ).
● Zařízení nepodporuje funkci upozornění pomocí depeší protokolu SNMP.
● Máte-li v počítači nebo na síti nainstalovaný software pro správu pomocí SNMP, můžete zařízení vzdáleně
konfigurovat, monitorovat a ovládat z počítače. Další informace naleznete v příručkách dodaných se
softwarem pro správu.
1
2
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
Klikněte na tlačítko [Nastavení/Uložení].
193
Spuštění
Síť
3
Klikněte na položku [Síť]
4
Klikněte na tlačítko [Editovat].
5
Zadejte nastavení protokolu SNMPv1.
[Nastavení SNMP].
● Nepotřebujete-li změnit nastavení SNMPv1, pokračujte dalším krokem.
194
Síť
[Použít SNMPv1]
Zaškrtnutím políčka povolte protokol SNMPv1. Ostatní nastavení protokolu SNMPv1 můžete zadat, pouze
pokud je toto políčko zaškrtnuté.
[Použít název komunity 1]/[Použít název komunity 2]
Zaškrtněte toto políčko, chcete-li zadat název komunity. Pokud není nutné zadávat název komunity, zrušte
zaškrtnutí políčka.
[Název komunity 1]/[Název komunity 2]
Alfanumerickými znaky zadejte název komunity.
[Povolení přístupu MIB]
Pro každou komunitu vyberte [Čtení/Zápis] nebo [Pouze Čtení] pro přístupová oprávnění k objektům MIB.
[Čtení/Zápis]
Povoluje zobrazení i změnu hodnot objektů MIB.
[Pouze Čtení]
Povoluje pouze zobrazení hodnot objektů MIB.
[Vyčleněná komunita]
Vyhrazená komunita představuje předvolenou komunitu, určenou výhradně pro správce používající software
Canon, například iW Management Console. Nastavte přístupová oprávnění k objektům MIB výběrem
možnosti [Vyp], [Čtení/Zápis], nebo [Pouze Čtení].
6
[Vyp]
Nepoužívá vyhrazenou komunitu.
[Čtení/Zápis]
Povoluje zobrazení i změnu hodnot objektů MIB pomocí vyhrazené komunity.
[Pouze Čtení]
Povoluje pouze zobrazení hodnot objektů MIB pomocí vyhrazené komunity.
Zadejte nastavení protokolu SNMPv3.
● Nepotřebujete-li změnit nastavení SNMPv3, pokračujte dalším krokem.
195
Síť
[Použít SNMPv3]
Zaškrtnutím tohoto políčka povolíte protokol SNMPv3. Ostatní nastavení protokolu SNMPv3 můžete zadat,
pouze pokud je toto políčko zaškrtnuté.
[Oprávnit uživatele]
Toto pole zaškrtněte, pokud chcete povolit [Uživatelská nastavení 1] až [Uživatelská nastavení 5]. Pokud
chcete zakázat uživatelská nastavení, zrušte označení příslušného zaškrtávacího pole.
[Uživatelské jméno]
Formou alfanumerických znaků zadejte uživatelské jméno.
[Povolení přístupu MIB]
Vyberte [Čtení/Zápis] nebo [Pouze Čtení] pro přístupová oprávnění k objektům MIB.
[Čtení/Zápis]
Povoluje zobrazení i změnu hodnot objektů MIB.
[Pouze Čtení]
Povoluje pouze zobrazení hodnot objektů MIB.
[Nastavení zabezpečení]
Výběrem [Ověření Ano/Šifrování Ano], [Ověření Ano/Šifrování Ne] nebo [Ověření Ne/Šifrování Ne] nastavte
požadovanou kombinaci nastavení ověřování a šifrování.
[Algoritmus ověření]
Kliknutím na položku [Ověření Ano/Šifrování Ano] nebo [Ověření Ano/Šifrování Ne] pro možnost [Nastavení
zabezpečení] nastavte algoritmus odpovídající prostředí.
[Algoritmus šifrování]
Kliknutím na položku [Ověření Ano/Šifrování Ano] pro nastavení [Nastavení zabezpečení] nastavte algoritmus
odpovídající prostředí.
[Nastavit/Změnit heslo]
Chcete-li zadat nebo změnit heslo, zaškrtněte toto políčko a formou alfanumerických znaků zadejte heslo do
textového pole [Heslo pro ověření] nebo [Heslo šifrování]. Heslo potvrďte jeho opětovným zadáním do
textového pole [Potvrdit]. Pro algoritmus ověřování a šifrování lze nastavit samostatné heslo.
[Název kontextu 1] až [Název kontextu 5]
Zadejte název kontextu prostřednictvím alfanumerických znaků.
196
Síť
7
Zadejte nastavení Získávání informací o správě tiskárny.
● Díky funkci SNMP lze pomocí počítače v síti monitorovat a pravidelně získávat informace o správě tiskárny,
například tiskové protokoly a porty tiskárny.
[Získat informace správy tiskárny od hostitele]
Políčko zaškrtněte, pokud chcete povolit monitorování informací správy tiskárny pomocí protokolu SNMP.
Chcete-li monitorování informací správy tiskárny zakázat, zaškrtnutí políčka zrušte.
[Odmítnout pakety SNMP v režimu spánku]
Zaškrtněte pole pro smazání paketů SNMP přijatých během režimu spánku. Pokud pakety nechcete smazat,
zaškrtnutí políčka zrušte.
● Pokud pole zaškrtnete, aplikace, které používají protokol SNMP, jako například Canon software
imageWARE Series, mohou mít zakázán přístup k tiskárně.
8
Klikněte na tlačítko [OK].
9
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Zakázání protokolu SNMPv1
● Zakážete-li protokol SNMPv1, některé funkce zařízení nebudou dostupné, například získávání informací
o zařízení pomocí ovladače tiskárny.
197
Síť
Použití ovládacího panelu
● K nastavení SNMP můžete také získat přístup z nabídky nastavení na ovládacím panelu.
SNMP(P. 349)
Nastavení
Povolení protokolu SNMPv1 i SNMPv3
● Jsou-li povoleny obě verze protokolu SNMP, doporučuje se nastavit přístupová oprávnění MIB v protokolu
SNMPv1 na možnost [Pouze Čtení]. Přístupová oprávnění MIB lze nastavit nezávisle ve verzi SNMPv1 a
SNMPv3 (a pro každého uživatele ve verzi SNMPv3). Výběrem možnosti [Čtení/Zápis] (plná přístupová
oprávnění) ve verzi SNMPv1 se zruší robustní funkce zabezpečení zahrnuté ve verzi SNMPv3, protože většinu
nastavení zařízení lze pak ovládat pomocí protokolu SNMPv1.
ODKAZY
Používání TLS pro šifrovanou komunikaci(P. 255)
198
Síť
Konfigurace nastavení pro software ke správě zařízení
6867-02X
Shromažďování a správu různých informací o síťových zařízeních můžete zjednodušit tak, že do sítě implementujete
software pro správu zařízení, například iW Management Console. Informace, jako jsou nastavení zařízení a chybové
protokoly, se získávají a distribuují prostřednictvím serverového počítače. Je-li zařízení zapojeno do takové sítě,
aplikace iW Management Console vyhledá zařízení v síti pomocí protokolů, jako je SLP (Service Location Protocol),
s cílem získat od zařízení informace, včetně stavu napájení. Nastavení protokolu SLP lze provést pomocí Vzdáleného
uživatelského rozhraní.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Zadejte nastavení protokolu SLP.
[Nastavení TCP/IP].
Zadání vícesměrového zjišťování zařízení
1
Klikněte na tlačítko [Editovat] v části [Nastavení Multicast Discovery].
199
Spuštění
Síť
2
Zaškrtněte políčko [Odpovědět Discovery] a zadejte požadovaná nastavení.
[Odpovědět Discovery]
Políčko zaškrtněte, chcete-li nastavit, aby zařízení odpovídalo na pakety vícesměrového zjišťování
softwaru pro správu zařízení, a povolit monitorování softwarem pro správu zařízení. Pokud chcete
tiskárnu nastavit tak, aby neodpovídala, zaškrtnutí zrušte.
[Název rozsahu]
Chcete-li zařízení zahrnout do určitého oboru, formou určitých znaků zadejte název oboru.
3
Klikněte na tlačítko [OK].
Upozornění softwaru pro správu zařízení na stav zařízení
1
Klikněte na tlačítko [Editovat] v části [Nastavení oznámení režimu spánku].
2
Zaškrtněte políčko [Oznámit] a zadejte požadovaná nastavení.
200
Síť
[Oznámit]
Políčko zaškrtněte, pokud chcete software pro správu zařízení upozorňovat na stav napájení zařízení. Je-li
zaškrtnuto políčko [Oznámit], nebude docházet ke zbytečné komunikaci zařízení během režimu spánku
a sníží se celková spotřeba energie.
[Číslo portu]
Změňte číslo portu pro tuto funkci podle prostředí sítě.
[Počet směrovačů na trase]
Zadejte počet směrovačů, jimiž mohou procházet pakety upozornění.
[Interval oznámení]
Zadejte, jak často má zařízení upozorňovat software pro správu zařízení na stav napájení.
3
5
Klikněte na tlačítko [OK].
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Použití ovládacího panelu
● Nastavení odpovědí na zjišťování můžete povolit nebo zakázat také z nabídky nastavení na ovládacím
panelu. Odezva Discovery(P. 346)
● K oznámení o stavu napájení můžete také získat přístup z nabídky nastavení na ovládacím panelu.
oznám. spánku(P. 346)
ODKAZY
201
Nast.
Síť
Přepnutí do režimu spánku(P. 67)
202
Síť
Konfigurace protokolu SMB
6867-02Y
Server Message Block (SMB) představuje protokol ke sdílení zdrojů, například souborů a tiskáren, s více než jedním
zařízením v síti a používá se k registraci zařízení jako sdílené tiskárny na síti SMB.
● SMB podporuje pouze NetBIOS přes TCP/IP a nepodporuje NetBEUI. Nastavte IP adresu dříve, než
nakonfigurujete nastavení SMB. Nastavení IP adres(P. 150)
● SMB je povoleno jen když je v tiskárně instalována volitelná SD karta.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Klikněte na tlačítko [Editovat].
[Nastavení SMB].
203
Spuštění
Síť
5
Zaškrtněte políčko [Použít SMB server] a zadejte požadovaná nastavení.
[Použít SMB server]
Pokud pole zaškrtnete, počítač je na síti SMB označen jako server SMB.
[Název serveru]
Zadejte název serveru, který se má zobrazit v síti SMB. Název se musí lišit od názvů ostatních počítačů a
tiskáren v síti.
● Nelze používat mezery.
● Název serveru zadaný v [Název serveru SMB] pod [Konfigurace WINS]se automaticky použije pro případný
[Název serveru]. Změna názvu serveru v [Název serveru] se provede také v [Název serveru SMB] pod
[Konfigurace WINS].
[Název pracovní skupiny]
Zadejte název pracovní skupiny, do které přístroj patří. Pokud v síťovém prostředí není žádná pracovní
skupina, vytvořte pracovní skupinu v systému Windows a zadejte její název.
● Nelze používat mezery.
● Název pracovní skupiny zadaný v [Název pracovní skupiny SMB] pod [Konfigurace WINS] se automaticky
použije pro případný [Název pracovní skupiny]. Změna názvu serveru v [Název pracovní skupiny] se
provede také v [Název pracovní skupiny SMB] pod [Konfigurace WINS].
[Poznámky]
Podle potřeby zadejte do přístroje komentáře.
204
Síť
[Použít zprávu LM]
Zaškrtněte políčko pro oznámení správci LAN, že existuje tiskárna. Pokud to oznamovat nechcete, zrušte
zaškrtnutí a snížíte tím objem práce.
[Použít tisk SMB]
Když na tiskárně používáte tisk SMB, pole zaškrtněte.
[Název tiskárny]
Zadejte název přístroje.
● Nelze používat mezery.
6
Klikněte na tlačítko [OK].
7
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
»
Pokračujte částí
Nastavení počítače pro tisk(P. 206) .
Použití ovládacího panelu
● Nastavení serveru SMB můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
SMB(P. 348)
● Nastavení tisku SMB můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
SMB(P. 348)
ODKAZY
Konfigurace služby WINS(P. 187)
205
Síť
Nastavení počítače pro tisk
6867-030
Nastavte připojení a instalujte ovladač tiskárny na počítači, aby se dalo na tiskárně tisknout z počítače přes síť SMB.
Připojení k síti SMB(P. 206)
Instalace ovladače tiskárny(P. 207)
Připojení k síti SMB
1
Zobrazení okna [Vlastnosti připojení k místní síti].
2
Zaškrtněte políčko [Klient sítě Microsoft].
3
4
Zaškrtněte políčko [Protokol IP verze 4 (TCP/IPv4)] nebo [Internetový protokol] a
klikněte na [Vlastnosti].
Klikněte na kartu [Obecné]
[Pokročilé].
206
Síť
5
Klikněte na kartu [Služba WINS], vyberte [Povolit rozhraní NetBIOS nad protokolem
6
Klepejte na [OK], dokud se nezavřou všechna dialogová okna.
TCP/IP] a potom klikněte na [OK].
● Pokud jste k tomu vyzváni, restartujte počítač.
Instalace ovladače tiskárny
Další informace o instalaci najdete v příručkách k příslušným ovladačům na webu s online příručkami.
Pokud se při instalaci objeví obrazovka výběru portu
● Postupujte podle následujících kroků.
1
Klikněte na [Přidat port].
2
Vyberte možnost [Síť] a klikněte na tlačítko [OK].
207
Síť
3
Ze seznamu vyberte „Název pracovní skupiny“, „Název serveru“, a „Název tiskárny“, které
byly zadány v nastavení protokolu SMB v daném pořadí. Konfigurace protokolu
SMB(P. 203)
208
Zabezpečení
Zabezpečení
Zabezpečení ...................................................................................................................................................... 210
Ochrana zařízení před neoprávněným přístupem .......................................................................................... 211
Zabránění neoprávněnému přístupu ............................................................................................................ 212
Nastavení přístupových oprávnění ............................................................................................................... 214
Nastavení hesla správce systému .......................................................................................................... 215
Nastavení správy ID oddělení ................................................................................................................ 218
Nastavení kódu PIN pro Vzdálené uživatelské rozhraní ......................................................................... 225
Omezení komunikace pomocí bran firewall .................................................................................................. 226
Zadání IP adres pro přidání do pravidel brány firewall ........................................................................... 227
Zadání MAC adres pro přidání do pravidel brány firewall ...................................................................... 233
Nastavení serveru proxy ............................................................................................................................... 236
Omezení funkcí zařízení .................................................................................................................................... 239
Omezení tiskových operací ........................................................................................................................... 240
Omezení funkcí USB ..................................................................................................................................... 243
Omezení funkcí ovládacího panelu ............................................................................................................... 246
Zákaz komunikace HTTP ............................................................................................................................... 249
Zákaz Vzdáleného uživatelského rozhraní .................................................................................................... 250
Zakázání portu LAN ...................................................................................................................................... 251
Skrytí historie tiskových úloh ........................................................................................................................ 252
Implementace funkcí pro vysokou míru zabezpečení .................................................................................... 254
Používání TLS pro šifrovanou komunikaci ..................................................................................................... 255
Konfigurace nastavení IPSec ........................................................................................................................ 259
Konfigurace ověřování IEEE 802.1X ............................................................................................................... 269
Konfigurace nastavení pro páry klíčů a digitální certifikáty ........................................................................... 275
Generování párů klíčů ............................................................................................................................ 276
Použití párů klíčů a digitálních certifikátů vydaných certifikační autoritou ............................................. 283
Ověření párů klíčů a digitálních certifikátů ............................................................................................. 286
209
Zabezpečení
Zabezpečení
6867-031
Důvěrné informace jsou dnes běžně zpracovávány elektronickými informačními zařízeními, včetně počítačů a tiskáren,
a některé z těchto zařízení se mohou kdykoliv stát terčem útoku třetích stran se škodlivými úmysly. Útočníci mohou
buď přímo získat neoprávněný přístup k zařízením, nebo nepřímo využít nedbalosti či chyb při používání zařízení. V
každém případě vám při úniku důvěrných informací hrozí ztráty, jejichž rozsah nelze předvídat. Z důvodu ochrany před
těmito hrozbami je zařízení vybaveno řadou bezpečnostních funkcí. V závislosti na síťovém prostředí proveďte
potřebnou konfiguraci.
● Můžete získat ten nejlepší bezpečnostní systém tím, že vytvoříte prostředí znemožňující přístup k tiskárnám
v místní síti přes internet a použijete takové prostředí společně s bezpečnostními funkcemi zařízení.
Zabránění neoprávněnému přístupu(P. 212)
◼ Nastavení základního zabezpečení informací
Ochrana zařízení před neoprávněným přístupem(P. 211)
◼ Opatření na ochranu před nedbalostí a nesprávným použitím
Omezení funkcí zařízení(P. 239)
Tisk dokumentu zabezpečeného kódem PIN
(zabezpečený tisk)(P. 92)
◼ Implementace funkcí pro vysokou míru zabezpečení
Implementace funkcí pro vysokou míru zabezpečení(P. 254)
210
Zabezpečení
Ochrana zařízení před neoprávněným přístupem
6867-032
Zabraňte třetím stranám v neoprávněném přístupu a používání zařízení. Můžete implementovat několik
bezpečnostních opatření, mezi která patří například správa přístupových oprávnění uživatelů a použití bran firewall.
211
Zabezpečení
Zabránění neoprávněnému přístupu
6867-033
Zde jsou popsána bezpečnostní opatření, která zabraňují neoprávněnému přístupu z externí sítě. Tuto část si musí
přečíst všichni uživatelé a správci ještě před použitím zařízení, jiných tiskáren a multifunkčních zařízení připojených
k síti. V posledních letech nabízí tiskárny a multifunkční zařízení s připojením k síti řadu různých užitečných funkcí,
například tisk z počítače, ovládání z počítače pomocí vzdáleného přístupu a odesílání naskenovaných dokumentů přes
Internet. Na druhou stranu je nutné podniknout bezpečnostní opatření vedoucí k omezení rizik spojených s únikem
informací, protože tiskárny a multifunkční zařízení jsou více vystavené různým hrozbám. Jedná se například
o neoprávněný přístup a odcizení dat při připojení zařízení k síti. V této části jsou vysvětlena nastavení, která je potřeba
zadat v rámci ochrany před neoprávněným přístupem ještě před použitím tiskárny či multifunkčního zařízení
s připojením k síti.
Bezpečnostní opatření zabraňující neoprávněnému přístupu z externí sítě
Přiřazení privátní IP adresy(P. 212)
Použití firewallu k omezení vysílání(P. 213)
Zadání šifrované komunikace TLS (P. 213)
Nastavení kódu PIN pro správu informací uložených v multifunkčním stroji(P. 213)
Přiřazení privátní IP adresy
IP adresa je číselné označení přiřazené ke každému zařízení, které je součástí počítačové sítě. „Globální IP adresa“ se
používá ke komunikaci při připojování k Internetu a „soukromá IP adresa“ slouží ke komunikaci v rámci místní sítě,
například v síti LAN společnosti. Když je k tiskárně nebo multifunkčnímu zařízení přiřazena globální IP adresa, toto
zařízení je přístupné veřejnosti přes Internet. To znamená větší riziko spojené s neoprávněným přístupem k citlivým
informacím z externí sítě. Pokud je však přiřazena soukromá IP adresa, tiskárna či multifunkční zařízení jsou uzavřené
v místní síti a přístup k zařízení mohou získat jen uživatelé v této místní síti, například v síti LAN společnosti.
Globální IP adresa
Mají k ní přístup uživatelé v rámci místní sítě
Soukromá IP adresa
Mají k ní přístup uživatelé v rámci místní sítě
Přiřaďte soukromou IP adresu k tiskárně / multifunkčnímu zařízení. Ověřte, zda je IP adresa přiřazená k používané
tiskárně / multifunkčnímu zařízení soukromá. Soukromou IP adresu najdete v jednom z následujících rozsahů.
Rozsahy soukromých IP adres
● 10.0.0.0 až 10.255.255.255
● 172.16.0.0 až 172.31.255.255
● 192.168.0.0 až 192.168.255.255
Informace, jak ověřovat IP adresu, naleznete v části
Nastavení IP adres(P. 150) .
● Když je globální IP adresa přiřazena k tiskárně / multifunkčnímu zařízení, můžete vytvořit síťové prostředí,
které sníží riziko neoprávněného přístupu. Toho lze dosáhnout instalací bezpečnostního softwaru, například
212
Zabezpečení
brány firewall, který zabraňuje přístupu z externích sítí. Pokud chcete k tiskárně / multifunkčnímu zařízení
přiřadit globální IP adresu, obraťte se na správce sítě.
Použití firewallu k omezení vysílání
Brána firewall je systém, který zabraňuje neoprávněnému přístupu z externích sítí a chrání před útoky a narušeními
směrovanými do místní sítě. Bránu firewall lze použít v síťovém prostředí k blokování přístupu z externí sítě, který se
jeví jako nebezpečný. Toho lze dosáhnout omezením komunikace z určité IP adresy v externí síti. Funkce, která je
součástí tiskárny / multifunkčního zařízení Canon, umožňuje nastavit filtr IP adres. Informace o nastavení filtru IP
adres najdete v části Zadání IP adres pro přidání do pravidel brány firewall(P. 227) .
Zadání šifrované komunikace TLS
Informace o komunikaci šifrované pomocí protokolu TLS najdete v části Implementace funkcí pro vysokou míru
zabezpečení(P. 254) a postupy nastavení najdete v části Používání TLS pro šifrovanou komunikaci(P. 255) .
Nastavení kódu PIN pro správu informací uložených v multifunkčním stroji
Pokud se třetí strana se zlými úmysly pokusí získat neoprávněný přístup k tiskárně / multifunkčnímu zařízení,
nastavení kódu PIN pro data uložená v zařízení sníží v těchto případech riziko úniku dat. Tiskárna / multifunkční
zařízení Canon umožňuje chránit různé typy dat za použití kódu PIN.
Nastavení kódu PIN pro každou funkci
● Nastavení kódu PIN pro použití Vzdáleného uživatelského rozhraní
Více informací najdete v části Nastavení kódu PIN pro Vzdálené uživatelské rozhraní(P. 225) .
● Nastavení kódu PIN na nastavení správce systému
Další informace naleznete v části
Nastavení hesla správce systému(P. 215) .
Výše jsou uvedeny některé příklady bezpečnostních opatření na ochranu před neoprávněným přístupem. Informace
o jiných bezpečnostních opatřeních najdete v části Zabezpečení(P. 210) . Zaveďte potřebná bezpečnostní opatření
zabraňující neoprávněnému přístupu, která jsou vhodná pro vaše prostředí.
213
Zabezpečení
Nastavení přístupových oprávnění
6867-034
Zabraňte neoprávněnému přístupu k zařízení tím, že povolíte přístup pouze uživatelům s přístupovým oprávněním pro
použití zařízení. Přístupová oprávnění se nastavují zvlášť pro správce systému, účet nazvaný „ID oddělení“ a Vzdálené
uživatelské rozhraní. Po nastavení oprávnění musí uživatelé zadat ID a kód PIN v případech, kdy chtějí tisknout nebo
měnit nastavení.
Heslo správce systému je určeno pro výlučně správce, zatímco ID oddělení je pro obecné uživatele. Obě zadávají
manažeři systému. A nastavením přístupového kódu PIN pro vzdálené uživatelské rozhraní můžete omezit použití
vzdáleného uživatelského rozhraní.
Heslo manažera systému
Zadání nastavení pro tiskárnu ze vzdáleného uživatelského rozhraní vyžaduje heslo manažera systému. Heslo je
nastaveno na výchozí hodnotu "7654321" a lze ho změnit tak, aby ke změně nastavení měli přístup jen určití
správci.
Nastavení hesla správce systému(P. 215)
ID oddělení (Správa ID oddělení)
ID oddělení je účet pro správu tiskových úloh. Lze uložit několik ID oddělení, čímž se zadají přístupová práva pro
uživatele (nebo skupinu uživatelů). Pokud se uživatel snaží vytisknout dokument, když je aktivováno ID oddělení,
zobrazí se obrazovka pro zadání ID oddělení a uživatel musí zadat ID svého oddělení. Lze zobrazit informace pro
každé ID oddělení, například kolik stran bylo vytištěno.
Nastavení správy ID oddělení(P. 218)
Kód PIN pro Vzdálené uživatelské rozhraní (přístupový kód PIN pro Vzdálené
uživatelské rozhraní)
Toto je kód PIN určený pro použití Vzdáleného uživatelského rozhraní. Přístup k tomuto rozhraní tak mohou mít
jen uživatelé, kteří znají tento kód PIN.
Nastavení kódu PIN pro Vzdálené uživatelské rozhraní(P. 225)
214
Zabezpečení
Nastavení hesla správce systému
6867-035
Změna nastavení konfigurovaného v tiskárně ze vzdáleného uživatelského rozhraní vyžaduje administrativní práva.
Postupujte podle procedury uvedené níže a změňte heslo správce systému.Informace o nastavení hesla správce
systému je klíčová pro zabezpečení tiskárny, proto se ujistěte, že toto heslo znají pouze správci.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Editovat].
[Nastavení správy].
215
Spuštění
Zabezpečení
5
Zadejte aktuální heslo do [Aktuální heslo správce systému].
● Výchozí heslo je „7654321“.
6
Zadejte nové heslo.
[Nastavit/Změnit heslo]
Chcete-li zadat nebo změnit heslo, zaškrtněte toto políčko a formou alfanumerických znaků zadejte heslo do
textového pole [Heslo]. Heslo potvrďte jeho opětovným zadáním do textového pole [Potvrdit].
● Pokud kliknete na [OK] a pole je zaškrtnuté a textová pole [Heslo] a [Potvrdit] jsou nechána prázdná,
aktuálně nastavené heslo se vymaže.
7
Zadejte podle potřeby jméno správce systému a kontaktní informace a klikněte na
[OK].
216
Zabezpečení
[Správce systému]
Zadejte jméno správce.
[Kontaktní informace]
Zadejte kontaktní informace správce.
[E-mailová adresa]
Formou alfanumerických znaků zadejte e-mailovou adresu správce.
[Komentář správce systému]
Zadejte komentáře správce.
● Zapamatujte si heslo, které jste zadali. Pokud jste heslo zapomněli, spojte se s místním autorizovaným
prodejcem Canon nebo zavolejte na linku pomoci Canon.
ODKAZY
Nastavení přístupových oprávnění(P. 214)
Kontrola informací správce systému(P. 302)
217
Zabezpečení
Nastavení správy ID oddělení
6867-036
Přístup k zařízení lze řídit pomocí více ID pro více uživatelů nebo skupin. Pokud je funkce správa ID oddělení povolena,
zobrazí se při pokusu o použití zařízení přihlašovací obrazovka a uživatel musí zadat své ID oddělení a kód PIN, aby
mohl zařízení používat. Správy ID oddělení obsahuje informace o minulém používání zařízení pro každé ID oddělení.
Chcete-li konfigurovat správu ID oddělení, uložte potřebná ID oddělení a poté povolte funkci správy ID oddělení.
Jestliže chcete povolit správu ID oddělení pro tisk prováděný prostřednictvím počítače, musíte provést doplňková
nastavení.
Uložení/úprava ID oddělení a kódu PIN(P. 218)
Povolení správy ID oddělení(P. 220)
Nastavení správy ID oddělení pro tisk z počítače(P. 222)
Blokování úloh pokud je zadáno neznámé ID oddělení(P. 223)
Pro správu stavu tisku každého oddělení
Kontrola počtu stránek vytištěných pro každé oddělení(P. 533)
Uložení/úprava ID oddělení a kódu PIN
Uložte ID oddělení a nastavte pro ně kód PIN. Uložte všechna ID oddělení, která chcete spravovat.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Spuštění
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Správa ID oddělení] a uložte či upravte příslušná ID oddělení.
218
Zabezpečení
Uložení ID oddělení
1
Klikněte na tlačítko [Uložit nové oddělení].
2
Zadejte požadované nastavení a klikněte na tlačítko [OK].
[ID oddělení]
Zadejte identifikační číslo oddělení, které chcete zaregistrovat.
[Nastavit PIN]
Chcete-li nastavit kód PIN, zaškrtněte dané políčko a zadejte stejné číslo do textových polí [PIN]
a [Potvrdit].
Úprava nastavení uložených ID oddělení
1
Úpravy můžete provést po kliknutí na příslušný textový odkaz v části [ID oddělení].
2
Podle potřeby změňte nastavení a klikněte na tlačítko [OK].
Vymazání ID oddělení
● Klikněte na tlačítko [Smazat] nacházející se vpravo od ID oddělení, které chcete smazat
tlačítko [OK].
219
Klikněte na
Zabezpečení
Povolení správy ID oddělení
Jakmile uložíte všechna potřebná ID oddělení, povolte správu ID oddělení.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Spuštění
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Správa ID oddělení]
4
Zaškrtněte políčko [Povolit správu ID oddělení] a klikněte na tlačítko [OK].
[Povolit správu ID oddělení]
220
[Nastavení].
Zabezpečení
Zaškrtnutím políčka povolte správu ID oddělení. Pokud funkci správy ID oddělení používat nechcete,
zaškrtnutí políčka zrušte.
● Informace o zaškrtávacím políčku [Přijmout tiskové úlohy s neznámými ID], najdete v části
úloh pokud je zadáno neznámé ID oddělení(P. 223) .
Blokování
Když je povolena správa ID oddělení
● Když se uživatelé snaží z ovládacího panelu vytisknout soubor v paměťovém
zařízení USB nebo dokument uložený na kartě SD, objeví se ověřovací
obrazovka. Zadejte ID oddělení a PIN, vyberte <Přihlásit se> a stiskněte
.
● Chcete-li se přihlásit na Vzdálené uživatelské rozhraní v režimu běžného uživatele, musíte zadat ID oddělení
a PIN. Spuštění Vzdáleného uživatelského rozhraní(P. 290)
◼ Když se používá ovladač tiskárny XPS
Když chcete použít správu ID oddělení, když se používá ovladač tiskárny XPS, nastavte klíčové páry pro
šifrovanou komunikaci TLS ( Používání TLS pro šifrovanou komunikaci(P. 255) ). Po dokončení nastavení
klíčových párů nakonfigurujte nastavení uvedené níže.
Přihlaste se ke Vzdálenému uživatelskému rozhraní v režimu správce systému ( Spuštění
Vzdáleného uživatelského rozhraní(P. 290) ) [Nastavení/Uložení] [Síť] [Nastavení TCP/IP]
[Editovat] v [Nastavení potvrzení PIN správy ID oddělení] Zaškrtněte políčka [Použít potvrzení
PIN správy ID oddělení] [OK]
[Použít potvrzení PIN správy ID oddělení]
Zaškrtnutím políčka povolíte správu ID oddělení pro tisk s ovladačem tiskárny XPS. Pokud funkci správy ID
oddělení používat nechcete, zaškrtnutí políčka zrušte.
● Pokud není na tiskárně nastaven žádný klíčový pár, nemůžete aktivovat [Použít potvrzení PIN správy ID
oddělení]. Konfigurace nastavení pro páry klíčů a digitální certifikáty(P. 275)
221
Zabezpečení
Nastavení správy ID oddělení pro tisk z počítače
Jestliže chcete povolit správu ID oddělení pro tisk z počítače, musíte prostřednictvím ovladačů tiskárny, které jsou
nainstalovány v počítači, zadat příslušná nastavení. Podle potřeby zadejte ID oddělení a kód PIN.
● Před prováděním tohoto postupu se přihlaste k počítači s účtem správce.
1
Otevřete složku tiskárny.
2
Pravým tlačítkem klikněte na ikonu tiskárny a poté klikněte na položku [Vlastnosti
3
Zobrazení složky tiskárny(P. 608)
tiskárny] nebo [Vlastnosti].
Klikněte na kartu [Nastavení zařízení] (Nastavení zařízení) a zadejte požadované
nastavení.
1
Vyberte [Správa ID oddělení] v [Správa uživatelů] a poté klikněte na [Nastavení], viz níže.
2
Podle potřeby zadejte nastavení a klikněte na tlačítko [OK].
222
Zabezpečení
[Povolit nastavení PIN]
Zaškrtnutím tohoto políčka povolíte nastavení kódu PIN.
[ID oddělení]
Zadejte identifikační číslo oddělení.
[PIN]
Podle potřeby zadejte PIN odpovídající ID oddělení.
[Ověřit]
Kliknutím na toto tlačítko ověřte, zda je zadáno správné ID a kód PIN. Pokud je zařízení propojené
s počítačem pomocí portu USB nebo WSD (Web Services on Devices), tato funkce není k dispozici.
[Potvrdit ID oddělení/PIN při tisku]
Zaškrtnutím políčka zobrazíte místní obrazovku [Potvrdit ID oddělení/PIN] (Potvrdit ID oddělení/kód
PIN) pokaždé, když tisknete z počítače.
[Ověření ID oddělení/kódu PIN v zařízení]
Políčko zaškrtněte, pokud je zařízení propojeno s počítačem pomocí portu USB nebo WSD.
3
Klikněte na tlačítko [OK].
Přihlášení k zařízení
● Pokud se pokusíte o tisk z počítače ve chvíli, kdy je povolena správa ID
oddělení, zobrazí se následující místní okno (pokud není zaškrtnutí v
políčku [Potvrdit ID oddělení/PIN při tisku (Potvrdit ID oddělení/kód
PIN při tisku)]):
Blokování úloh pokud je zadáno neznámé ID oddělení
Výchozí tovární nastavení je takové, že je povolena i správa ID oddělení, takže můžete tisknout z počítače, aniž byste
museli zadávat ID a PIN. Pokud chcete toto nastavení změnit tak, aby bylo nutné pro tisk zadat ID a PIN, postupujte
následovně.
1
2
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
Klikněte na tlačítko [Nastavení/Uložení].
223
Spuštění
Zabezpečení
3
4
Klikněte na položku [Správa ID oddělení]
[Nastavení].
Vymažte zaškrtnutí z políčka [Přijmout tiskové úlohy s neznámými ID] a klikněte na
tlačítko [OK].
● Pokud vymažete zaškrtnutí, uživatelé nemohou tisknout pomocí metody, která není podporována správou
ID oddělení ani nemohou provádět přímý tisk ze vzdáleného uživatelského rozhraní, k němuž se uživatelé
přihlásí v režimu správy.
ODKAZY
Nastavení přístupových oprávnění(P. 214)
Nastavení hesla správce systému(P. 215)
224
Zabezpečení
Nastavení kódu PIN pro Vzdálené uživatelské rozhraní
6867-037
Pro přístup ke Vzdálenému uživatelskému rozhraní lze nastavit kód PIN. Všichni uživatelé používají společný kód PIN.
● Pokud je povolena správa ID oddělení, toto nastavení není nutné.
1
Stiskněte tlačítko
2
Pomocí tlačítek
(
/
Nastavení správy ID oddělení(P. 218)
).
vyberte možnost <Síť> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
3
Vyberte <Nastavení vzdál. UR>
4
Vyberte možnost <Zap> a stiskněte tlačítko
5
Nastavte kód PIN.
● Zadejte číslo pro PIN a stiskněte
.
<Nast.zab.příst. VzUR>.
.
.
● Jelikož se pro potvrzení zobrazí <Potvrdit PIN>, zadejte znovu stejné číslice kódu PIN.
Pokud jsou nastavení Vzdáleného uživatelského rozhraní inicializována
● Je také inicializován kód PIN pro přístup ke Vzdálenému uživatelskému rozhraní. Po inicializaci znovu
nastavte kód PIN. Inicializace nabídky(P. 539)
ODKAZY
Nastavení přístupových oprávnění(P. 214)
Nastavení hesla správce systému(P. 215)
225
Zabezpečení
Omezení komunikace pomocí bran firewall
6867-038
Bez řádného zabezpečení mohou třetí strany získat neoprávněný přístup k počítačům a dalším komunikačním
zařízením, které jsou připojené k síti. Chcete-li zabránit tomuto neoprávněnému přístupu, zadejte nastavení pro
filtrování paketů. Je to funkce, která slouží k omezení komunikace se zařízeními s určitými IP adresami nebo MAC
adresami.
226
Zabezpečení
Zadání IP adres pro přidání do pravidel brány firewall
6867-039
Můžete buď umožnit komunikaci pouze se zařízeními s určitými IP adresami, nebo blokovat zařízení s určitými IP
adresami a komunikaci s ostatními povolit. Můžete zadat jednu IP adresu nebo rozsah IP adres. Pro příjem dat můžete
zadat IP adresy zadáním čísel portů.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Editovat] a zadejte typ filtru, který chcete použít.
[Filtr IP adresy].
227
Spuštění
Zabezpečení
[Adresa IPv4: Filtr VYS.]
Zaškrtněte, chcete-li omezit odesílání dat ze zařízení do počítače zadáním adres IPv4.
[Adresa IPv4: Filtr PŘ.]
Zaškrtněte, chcete-li omezit přijímání dat ze zařízení do počítače zadáním adres IPv4 a číslo portu.
[Adresa IPv6: Filtr VYS.]
Zaškrtněte, chcete-li omezit odesílání dat ze zařízení do počítače zadáním adres IPv6.
[Adresa IPv6: Filtr PŘ.]
Zaškrtněte, chcete-li omezit přijímání dat ze zařízení do počítače zadáním adres IPv6 a číslo portu.
5
Zadejte nastavení filtrování paketů.
Pro filtr TX
Vyberte výchozí zásady pro povolení, nebo omezení komunikace dalších zařízení s tímto zařízením a poté
zadejte IP adresy pro výjimky.
1
Zaškrtněte políčko [Použít filtr] a kliknutím na přepínač [Odmítnout] nebo [Povolit] nastavte
[Výchozí zásady].
[Použít filtr]
Pole zaškrtněte, pokud chcete komunikaci omezit. Zrušením zaškrtnutí políčka omezení zakážete.
[Výchozí zásady]
Vyberte, zda se má povolit nebo odmítnout komunikace jiných zařízení s tímto zařízením.
228
Zabezpečení
2
[Povolit]
Pokud vyberete tuto možnost, pak komunikační pakety, které jsou odeslány nebo
přijaty ze zařízení, jejichž IP adresy jsou uvedeny v seznamu [Adresy s výjimkou],
budou blokovány. Komunikace s ostatními zařízeními je povolena.
[Odmítnout]
Pokud vyberete tuto možnost, pak projdou pouze komunikační pakety, které jsou
odeslány nebo přijaty ze zařízení, jejichž IP adresy jsou uvedeny v seznamu [Adresy s
výjimkou]. Komunikace s ostatními zařízeními je zakázána.
Zadejte adresy do seznamu výjimek.
● Zadejte IP adresu (nebo rozsah IP adres) do pole [Uložit adresu] a klikněte na tlačítko [Přidat].
Kontrola správnosti zadaných adres
● Pokud zadáte IP adresy nesprávně, nebude možné se k zařízení připojit prostřednictvím Vzdáleného
uživatelského rozhraní. V takovém případě je třeba nastavit <Filtr adresy> na možnost <Vyp>. Filtr
adresy(P. 354)
Když jste vybrali [Odmítnout] pod [Výchozí zásady]
● Pakety zpětné smyčky, vícesměrového a všesměrového vysílání nelze filtrovat.
Odstranění adresy IP ze seznamu výjimek
● Vyberte adresu IP a klikněte na možnost [Smazat].
3
Klikněte na tlačítko [OK].
Pro filtr RX
Pokud vyberete možnost [Povolit] v části [Výchozí zásady], zadejte IP adresy zařízení, jejichž komunikace se
zařízením by měla být blokována. Pokud vyberete možnost [Odmítnout] v části [Výchozí zásady], zadejte IP
adresy zařízení, která by měla komunikovat se zařízením.
1
Klikněte na [Uložit nový].
2
Zadejte adresy do seznamu výjimek.
229
Zabezpečení
● Zadejte IP adresu (nebo rozsah IP adres) do pole [Uložit adresu].
● Chcete-li zadat číslo portu, zaškrtněte políčko [Zadat číslo portu]; zadejte číslo portu do [Číslo portu] a
klikněte na [Přidat].
Kontrola správnosti zadaných adres
● Pokud zadáte IP adresy nebo čísla portů nesprávně, nemusí být možné se k zařízení připojit
prostřednictvím Vzdáleného uživatelského rozhraní. V takovém případě je třeba nastavit <Filtr adresy>
na <Vyp>. Filtr adresy(P. 354)
Vymazání nastaveného čísla portu
● Vyberte číslo portu, který chcete vymazat, a klikněte na [Smazat].
3
4
Klikněte na [OK].
Zaškrtněte políčko [Použít filtr] a kliknutím na přepínač [Odmítnout] nebo [Povolit] nastavte
[Výchozí zásady].
230
Zabezpečení
[Použít filtr]
Pole zaškrtněte, pokud chcete komunikaci omezit. Zrušením zaškrtnutí políčka omezení zakážete.
[Výchozí zásady]
Vyberte, zda se má povolit nebo odmítnout komunikace jiných zařízení s tímto zařízením.
[Povolit]
Pokud vyberete tuto možnost, pak komunikační pakety, které jsou odeslány nebo
přijaty ze zařízení, jejichž IP adresy jsou uvedeny v seznamu [Adresy s výjimkou],
budou blokovány. Komunikace s ostatními zařízeními je povolena.
[Odmítnout]
Pokud vyberete tuto možnost, pak projdou pouze komunikační pakety, které jsou
odeslány nebo přijaty ze zařízení, jejichž IP adresy jsou uvedeny v seznamu [Adresy s
výjimkou]. Komunikace s ostatními zařízeními je zakázána.
Úprava zadané adresy IP ze seznamu výjimek
● Klikněte na odpovídající textový odkaz pod položkou [Adresy s výjimkou] na obrazovce, která se
zobrazí, změňte podle potřeby nastavení, a klikněte na možnost [OK].
Odstranění adresy IP ze seznamu výjimek
● Vyberte adresu IP, kterou chcete vymazat, a klikněte na možnost [Smazat].
5
6
Klikněte na [OK].
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
231
Zabezpečení
➠ Nastavení se aktivují po provedení tvrdého resetu.
Použití ovládacího panelu
● Filtrování IP adresy můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
adresy(P. 354)
ODKAZY
Zadání MAC adres pro přidání do pravidel brány firewall(P. 233)
232
Filtr
Zabezpečení
Zadání MAC adres pro přidání do pravidel brány firewall
6867-03A
Můžete buď umožnit komunikaci pouze se zařízeními s určitými MAC adresami, nebo blokovat zařízení s určitými MAC
adresami a komunikaci s ostatními povolit.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Editovat] a zadejte typ filtru.
[Filtr MAC adresy].
233
Spuštění
Zabezpečení
[Filtr VYS.]
Zaškrtněte, chcete-li omezit odesílání dat ze zařízení do počítače zadáním adres MAC.
[Filtr PŘ.]
Zaškrtněte, chcete-li omezit přijímání dat ze zařízení do počítače zadáním adres MAC.
5
Zadejte nastavení filtrování paketů.
● Vyberte předpoklady (výchozí zásady) pro povolení, nebo omezení komunikace dalších zařízení s tímto
zařízením a poté zadejte adresy MAC pro výjimky.
1
Zaškrtněte políčko [Použít filtr] a kliknutím na přepínač [Povolit] nebo [Odmítnout] nastavte [Výchozí
zásady].
[Použít filtr]
Pole zaškrtněte, pokud chcete komunikaci omezit. Zrušením zaškrtnutí políčka omezení zakážete.
[Výchozí zásady]
Vyberte výchozí zásady, zda se má povolit, nebo odmítnout komunikace jiných zařízení s tímto zařízením.
Pokud vyberete tuto možnost, pak komunikační pakety, které jsou odeslány nebo
[Povolit]
přijaty ze zařízení, jejichž adresy MAC jsou uvedeny v seznamu [Adresy s výjimkou],
budou blokovány. Komunikace s ostatními zařízeními je povolena.
[Odmítnout]
2
Pokud vyberete tuto možnost, pak projdou pouze komunikační pakety, které jsou
odeslány nebo přijaty ze zařízení, jejichž adresy MAC jsou uvedeny v seznamu [Adresy
s výjimkou]. Komunikace s ostatními zařízeními je zakázána.
Zadejte adresy do seznamu výjimek.
234
Zabezpečení
● Do textového pole [Uložit adresu] zadejte adresu MAC a klikněte na tlačítko [Přidat].
● Jednotlivé adresy není nutné oddělovat pomlčkami nebo dvojtečkami.
Kontrola správnosti zadaných adres
● Pokud zadáte MAC adresy nesprávně, nebude možné se k zařízení připojit prostřednictvím Vzdáleného
uživatelského rozhraní. V takovém případě je třeba nastavit <Filtr adresy> na možnost <Vyp>. Filtr
adresy(P. 354)
Když jste vybrali [Odmítnout] v části [Výchozí zásady]
● Odchozí pakety vícesměrového a všesměrového vysílání nelze filtrovat.
Odstranění adresy MAC ze seznamu výjimek
● Vyberte adresu MAC a klikněte na možnost [Smazat].
3
6
Klikněte na tlačítko [OK].
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Použití ovládacího panelu
● Filtrování adresy MAC můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
adresy(P. 354)
ODKAZY
Zadání IP adres pro přidání do pravidel brány firewall(P. 227)
235
Filtr
Zabezpečení
Nastavení serveru proxy
6867-03C
Proxy (nebo HTTP proxy server) je buď počítač, nebo software, který ostatním zařízením zprostředkovává komunikaci
HTTP, a to zejména komunikaci se zdroji mimo síť, např. při procházení webových stránek. Klientská zařízení jsou k
vnější síti připojena přes server proxy a nekomunikují tedy s vnějšími zdroji přímo. Nastavení serveru proxy jednak
usnadňuje řízení provozu mezi vnitřní a vnější sítí, a zároveň přispívá ke zvýšení zabezpečení díky blokování
neoprávněného přístupu a konsolidaci antivirové ochrany. Pokud k tisku přes Internet používáte službu Google Cloud
Print, můžete zvýšit zabezpečení nastavením serveru proxy. Při nastavování serveru proxy se ujistěte, že máte
potřebné informace týkající se serveru proxy, včetně IP adresy, čísla portu a uživatelského jména a hesla pro ověření.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Klikněte na tlačítko [Editovat] v části [Nastavení proxy].
[Nastavení TCP/IP].
236
Spuštění
Zabezpečení
5
Zaškrtněte políčko [Použít proxy] a zadejte požadovaná nastavení.
[Použít proxy]
Pokud zaškrtnete toto políčko, bude při komunikaci se serverem HTTP použit zadaný server proxy.
[Adresa serveru Proxy HTTP]
Zadejte adresu serveru proxy. V závislosti na prostředí zadejte IP adresu nebo název hostitele.
[Číslo portu serveru Proxy HTTP]
Podle potřeby změňte číslo portu.
[Použít proxy se stejnou doménou]
Zaškrtnete-li toto políčko, můžete použít také zadaný proxy server ke komunikaci se zařízeními ve stejné
doméně.
[Použít ověření Proxy]
Chcete-li povolit ověření serverem proxy, zaškrtněte políčko a do textového pole [Uživatelské jméno] zadejte
uživatelské jméno formou alfanumerických znaků.
[Nastavit/Změnit heslo]
Chcete-li nastavit nebo změnit heslo pro ověření serverem proxy, pokud je povoleno, zaškrtněte políčko a do
textového pole [Heslo] zadejte nové heslo formou alfanumerických znaků. Heslo potvrďte jeho opětovným
zadáním do textového pole [Potvrdit].
6
Klikněte na tlačítko [OK].
7
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
237
Zabezpečení
➠ Nastavení se aktivují po provedení tvrdého resetu.
Použití ovládacího panelu
● K nastavení proxy můžete také získat přístup z nabídky nastavení na ovládacím panelu.
proxy(P. 344)
ODKAZY
Použití služby Google Cloud Print(P. 139)
238
Nastavení
Zabezpečení
Omezení funkcí zařízení
6867-03E
Některé z funkcí zařízení jsou používány jen zřídka nebo je u některých vyšší riziko nesprávného použití. Z
bezpečnostních důvodů je možné v zařízení nastavit omezení těchto funkcí buď jejich částečným, nebo úplným
zakázáním.
Omezení funkcí tisku
Omezení tiskových operací(P. 240)
Omezení funkcí USB
Omezení funkcí USB(P. 243)
Omezení funkcí ovládacího panelu
Omezení funkcí ovládacího panelu(P. 246)
Omezení síťových funkcí včetně komunikace HTTP
Zákaz komunikace HTTP(P. 249)
Zákaz Vzdáleného uživatelského rozhraní(P. 250)
Zakázání portu LAN(P. 251)
Skrytí historie tiskových úloh
Skrytí historie tiskových úloh(P. 252)
239
Zabezpečení
Omezení tiskových operací
6867-03F
Můžete určit nastavení, která zabrání automatickému tisku přijatých tiskových dat, čímž se sníží zbytečné používání
papíru a znemožní se používání zařízení třetím stranám. Chcete-li tuto funkci používat, musíte nainstalovat volitelnou
SD kartu. Instalace SD karty(P. 581)
● I když se tiskové operace omezí, lze vytisknout seznamy nastavení a hlášení.
seznamů(P. 523)
1
Tisk hlášení a
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
[Nastavení správy].
240
Spuštění
Zabezpečení
4
Klikněte na tlačítko [Editovat].
5
Zadejte heslo správce systému do pole [Aktuální heslo správce systému].
6
Zaškrtněte políčko [Omezit úlohy tiskárny] a klikněte na tlačítko [OK].
[Omezit úlohy tiskárny]
Pole zaškrtněte, pokud chcete tiskové operace tiskárny omezit. Zrušením zaškrtnutí políčka omezení
zakážete.
241
Zabezpečení
7
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Když jsou tiskové operace omezeny
● Z ovladačů tiskárny lze provádět pouze uložené tiskové úlohy.
(tisk uložené úlohy)(P. 96)
Tisk dokumentu uloženého v tiskárně
● Ze vzdáleného uživatelského rozhraní lze tisknout pouze soubory typu PDF, PS, EPS a XPS uložené v boxech.
Tisk bez otevření souboru (přímý tisk)(P. 106)
● Přímý tisk z paměťového zařízení USB a tisk e-mailů nejsou k dispozici.
ODKAZY
Tisk dokumentu uloženého v tiskárně (tisk uložené úlohy)(P. 96)
242
Zabezpečení
Omezení funkcí USB
6867-03H
Rozhraní USB představuje pohodlný způsob, jak připojit periferní zařízení a ukládat nebo přemísťovat data. Pokud však
není rozhraní USB řádně zabezpečeno, může být cestou k úniku informací. Při manipulaci s paměťovými zařízeními
USB buďte obzvlášť opatrní. V této části je popsán postup, jak omezit připojení k zařízení přes port USB a jak zakázat
použití paměťových zařízení USB.
Omezení připojení k počítači pomocí kabelu USB(P. 243)
Omezení funkce přímého tisku z USB(P. 244)
Omezení připojení k počítači pomocí kabelu USB
Můžete deaktivovat port USB pro připojení počítače, přičemž port je umístěn na levé straně tiskárny. Připojení k
počítači prostřednictvím USB bude zakázáno, ale paměťové zařízení USB lze připojit k portu USB na pravé straně
tiskárny.
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberte možnost <Výběr rozhraní> a stiskněte tlačítko
(
/
).
vyberte možnost <Rozhraní> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
4
Vyberte možnost <USB> a stiskněte tlačítko
.
5
Vyberte možnost <Vyp> a stiskněte tlačítko
.
<Vyp>
Zakáže port USB nacházející se na levé straně zařízení.
<Zap>
Povolí port USB nacházející se na levé straně zařízení.
243
.
.
Zabezpečení
6
Proveďte tvrdý reset.
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
Omezení funkce přímého tisku z USB
Tisk dat je možné zakázat i z paměťového zařízení USB. Tím se znemožní tisk dat uložených v paměti USB.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Editovat].
[Nastavení správy].
244
Spuštění
Zabezpečení
5
Zadejte heslo správce systému do pole [Aktuální heslo správce systému].
6
Vymažte zaškrtnutí z políčka [Přímý tisk z USB] a klikněte na tlačítko [OK].
[Přímý tisk z USB]
Zrušením zaškrtnutí zakážete přímý tisk z paměťového zařízení USB. Zaškrtnutím políčka povolíte tisk z
paměťového zařízení USB. Pokud zaškrtnete i políčko [Automaticky zobrazit obrazovku přímého tisku z USB],
automaticky se objeví obrazovka přímého tisku z USB, když se paměťové zařízení USB připojí k tiskárně.
ODKAZY
Tisk z paměti USB (Přímý tisk z USB)(P. 81)
245
Zabezpečení
Omezení funkcí ovládacího panelu
6867-03J
Můžete omezit použití kláves na ovládacím panelu s cílem zabránit tomu, aby se nastavení tiskárny libovolně měnilo.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Editovat].
[Nastavení správy].
246
Spuštění
Zabezpečení
5
Zadejte heslo správce systému do pole [Aktuální heslo správce systému].
6
Zaškrtněte políčko u klávesy, jejíž používání chcete omezit, a klikněte na [OK].
[Tlačítka k zamčení]
Můžete zaškrtnout pole a zamknout tak odpovídající klávesu. i když je stisknuta na ovládacím panelu.
Vymazáním zaškrtnutí klávesu odemknete. Z ovládacího panelu můžete také zamknout klávesu Nastavení (
Správa nastavení(P. 330) ).
247
Zabezpečení
● Funkce kláves
Ovládací panel(P. 26)
248
Zabezpečení
Zákaz komunikace HTTP
6867-03K
Protokol HTTP se používá při komunikaci přes síť, například pokud přistupujete k zařízení prostřednictvím Vzdáleného
uživatelského rozhraní. Pokud používáte připojení přes rozhraní USB nebo z jiného důvodu protokol HTTP nevyužíváte,
můžete komunikaci HTTP zakázat, a tím blokovat škodlivé útoky třetích stran, které mohou být vedeny přes nevyužité
porty HTTP.
● Zákazem protokolu HTTP dojde k zákazu některých síťových funkcí, například Vzdáleného uživatelského
rozhraní, tisku WSD a tisku pomocí služby Google Cloud Print.
1
Stiskněte tlačítko
2
Pomocí tlačítek
(
/
).
vyberte možnost <Síť> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
3
Vyberte <Nastavení TCP/IP>
4
Vyberte možnost <Vyp> a stiskněte tlačítko
<HTTP>.
.
<Vyp>
Zakazuje komunikaci HTTP.
<Zap>
Povoluje komunikaci HTTP.
5
Proveďte tvrdý reset.
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
ODKAZY
Použití Vzdáleného uživatelského rozhraní(P. 289)
Konfigurace protokolů tisku a funkcí WSD(P. 160)
Použití služby Google Cloud Print(P. 139)
Když se používá ovladač tiskárny XPS(P. 221)
249
.
Zabezpečení
Zákaz Vzdáleného uživatelského rozhraní
6867-03L
Vzdálené uživatelské rozhraní je užitečným nástrojem, který umožňuje zadat nastavení zařízení z počítače
prostřednictvím webového prohlížeče. Zařízení i počítač musí být propojené prostřednictvím sítě, aby bylo možné
Vzdálené uživatelské rozhraní použít. Pokud je zařízení připojeno k počítači prostřednictvím rozhraní USB nebo pokud
Vzdálené uživatelské rozhraní nepotřebujete používat, můžete toto rozhraní zakázat, a tím snížit riziko, že by vaše
zařízení ovládali na dálku prostřednictvím sítě třetí strany se škodlivými úmysly.
1
Stiskněte tlačítko
2
Pomocí tlačítek
(
/
).
vyberte možnost <Síť> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
3
Vyberte <Nastavení vzdál. UR>
4
Vyberte možnost <Vyp> a stiskněte tlačítko
<Vzdálené UR>.
.
<Vyp>
Zakáže Vzdálené uživatelské rozhraní.
<Zap>
Povolí Vzdálené uživatelské rozhraní.
5
Proveďte tvrdý reset.
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
ODKAZY
Použití Vzdáleného uživatelského rozhraní(P. 289)
Zákaz komunikace HTTP(P. 249)
250
.
Zabezpečení
Zakázání portu LAN
6867-03R
Port LAN je rozhraní, které spojuje kabel LAN pro použití sítě. Když tiskárnu používáte prostřednictvím USB, můžete
port LAN zakázat a síť zcela vypnout, přičemž se zablokují škodlivé vstupy třetích stran přes port LAN.
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberte možnost <Výběr rozhraní> a stiskněte tlačítko
(
/
).
vyberte možnost <Rozhraní> a stiskněte tlačítko
● Když se zobrazí zpráva, stiskněte
.
4
Vyberte možnost <Síť> a stiskněte tlačítko
5
Vyberte možnost <Vyp> a stiskněte tlačítko
.
.
<Vyp>
Zakáže port LAN.
<Zap>
Povolí port LAN.
6
Proveďte tvrdý reset.
Provedení tvrdého resetu(P. 472)
➠ Nastavení se aktivují po provedení tvrdého resetu.
251
.
.
Zabezpečení
Skrytí historie tiskových úloh
6867-03S
Chcete-li chránit soukromí uživatelů, můžete na obrazovce vzdáleného uživatelského rozhraní zakázat zobrazení
historie tiskových úloh a vytisknout seznam historie tisku. Historie tiskových úloh se aktualizuje a uchová, i když je
nastavena tak, že je skrytá, takže správci mohou historii podle potřeby prohlížet.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Editovat].
[Zobrazit Výpis úlohy].
252
Spuštění
Zabezpečení
5
Vymažte zaškrtnutí z políčka [Zobrazit Výpis úlohy] a klikněte na tlačítko [OK].
[Zobrazit Výpis úlohy]
Pokud zaškrtnutí zrušíte, historie tiskových úloh se na obrazovce vzdáleného uživatelského rozhraní
nezobrazí a nelze ani vytisknout seznam historie tisku. Chcete-li historii úloh zobrazit, zaškrtněte políčko.
[Povolit vyvolání výpisu úlohy se softwarem pro správu]
Pokud políčko zaškrtnete, lze použít software pro správu zařízení, jako iW Management Console a historii
tiskových úloh tak získat. Zrušením zaškrtnutí zakážete softwaru pro správu získat historii tiskových úloh. Tato
funkce se automaticky aktivuje, když se zaškrtne políčko [Zobrazit Výpis úlohy].
ODKAZY
Kontrola historie dokumentů(P. 300)
Nabídka Úloha(P. 470)
253
Zabezpečení
Implementace funkcí pro vysokou míru zabezpečení
6867-03U
Autorizovaní uživatelé jsou ohroženi škodlivými útoky třetích stran, jedná se např. o sniffing (falšování), spoofing
(odposlech) nebo tampering (nepovolené úpravy) dat při jejich průchodu sítí, které mohou způsobit ztráty, jejichž
rozsah nelze předvídat. Zařízení podporuje následující funkce, které slouží ke zvýšení zabezpečení a utajení, a tím
chrání vaše důležité a cenné informace před těmito útoky.
Šifrovaná komunikace TLS
Protokol TLS se používá pro šifrování dat odesílaných prostřednictvím sítě a často také pro komunikaci přes
webový prohlížeč nebo e-mailovou aplikaci. Protokol TLS umožňuje bezpečnou síťovou komunikaci, jestliže
přistupujete k zařízení z počítače prostřednictvím Vzdáleného uživatelského rozhraní. Používání TLS pro
šifrovanou komunikaci(P. 255)
Komunikace IPSec
Zatímco protokol TLS šifruje pouze data používaná v konkrétní aplikaci, jako je například webový prohlížeč nebo
e-mailová aplikace, protokol IPSec šifruje celé IP pakety (nebo jejich datové části). Díky tomu poskytuje protokol
IPSec mnohem univerzálnější systém zabezpečení než protokol TLS. Konfigurace nastavení IPSec(P. 259)
Ověřování IEEE 802.1X
Standard IEEE 802.1X je mechanizmus blokování neoprávněného přístupu k síti využívající hromadnou správu
informací o ověřování uživatele. Pokud se zařízení pokusí připojit k síti 802.1X, musí projít procesem ověření
uživatele, který prokáže, zda se o připojení pokouší autorizovaný uživatel. Informace o ověření je odeslána ke
kontrole na server RADIUS, který na základě výsledku ověření buď povolí, nebo odmítne komunikaci se sítí.
Pokud se ověření nezdaří, přepínač LAN zablokuje přístup z vnější sítě. Zařízení se může k síti 802.1X připojit
jako klientské zařízení. Konfigurace ověřování IEEE 802.1X(P. 269)
ODKAZY
Konfigurace nastavení pro páry klíčů a digitální certifikáty(P. 275)
254
Zabezpečení
Používání TLS pro šifrovanou komunikaci
6867-03W
Komunikaci mezi zařízením a webovým prohlížečem v počítači je možné šifrovat a tisková data IPP lze vytisknout přes
internet pomocí funkce Transport Layer Security (TLS). TLS je mechanismus šifrování dat odeslaných nebo přijatých
prostřednictvím sítě. TLS musí být povoleno, když se Vzdálené uživatelské rozhraní používá pro zadání nastavení pro
IPSec (metoda předsdíleného klíče), ověřování IEEE 802.1X (TTLS/PEAP) nebo SNMPv3. Chcete-li použít šifrovanou
komunikaci TLS, musíte nastavit pár klíčů a povolit funkci TLS. Mějte připraven pár klíčů pro použití ( Konfigurace
nastavení pro páry klíčů a digitální certifikáty(P. 275) ).
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Klikněte na [Editovat] v části [Nastavení TLS].
[Nastavení TCP/IP].
255
Spuštění
Zabezpečení
5
Upravit nastavení TLS.
[Nastavení klíče a certifikátu]
Vyberte klíč ze seznamu klíčů a certifikátů.
● Vyberte klíč ze seznamu klíčů a certifikátů; poté klikněte na [Výchozí nastavení klíče].
Zobrazení podrobností o certifikátu
● Máte možnost zkontrolovat podrobné informace o certifikátu nebo můžete certifikát ověřit kliknutím na
příslušný textový odkaz pod položkou [Název klíče], nebo na ikonu certifikátu. Ověření párů klíčů a
digitálních certifikátů(P. 286)
Pokud se nezobrazí zpráva [Výchozí nastavení klíče]
● Pokud je TLS již aktivováno pomocí [Nastavení vzdáleného UR] nebo [Nastavení tisku IPP], [Výchozí
nastavení klíče] se nezobrazí. Chcete-li změnit používaný klíč, podívejte se do kroku 6 a zrušte zaškrtnutí
[Použít TLS] pod [Nastavení vzdáleného UR] nebo [Nastavení tisku IPP].
256
Zabezpečení
[Přípustné verze]
Vyberte povolené verze pro TLS.
[Algoritmy šifrování, které mají být omezeny]
Vyberte šifrovací algoritmy, které mají být omezeny pro použití pro TLS. Pokud neprovedete žádné omezení,
vyberte [Žádný].
6
Povolte TLS pro Vzdálené uživatelské rozhraní.
Použití TLS pro komunikaci se Vzdáleným uživatelským rozhraním
1
Klikněte na položku [Zabezpečení]
2
Klikněte na tlačítko [Editovat].
3
Zaškrtněte políčko [Použít TLS] a klikněte na tlačítko [OK].
[Nastavení vzdáleného UR].
[Použít TLS]
Pokud pro komunikaci se Vzdáleným uživatelským rozhraním používáte TLS, zaškrtněte políčko. Když ho
nepoužíváte, zaškrtnutí zrušte.
257
Zabezpečení
Používání TLS pro funkci, která je kompatibilní se šifrovanou komunikací
Používání TLS pro tisk IPP
Proveďte následující nastavení pro provedení tisku IPP pomocí TLS. Pokud jde o další nastavení tisku IPP, viz
Konfigurace protokolů tisku a funkcí WSD(P. 160) .
[Síť] [Nastavení TCP/IP]
[OK]
7
[Editovat] v [Nastavení tisku IPP]
Zaškrtněte políčko [Použít TLS]
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Použití ovládacího panelu
● Šifrovanou komunikaci TLS můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
Nastavení vzdál. UR(P. 351)
Spuštění Vzdáleného uživatelského rozhraní s TLS
● Pokud zkoušíte spustit Vzdálené uživatelské rozhraní, když je povoleno TLS, může se zobrazit upozornění
zabezpečení ohledně certifikátu zabezpečení. V takovém případě zkontrolujte, že je do pole adresy zadána
správná adresa URL a poté zobrazte obrazovku Vzdáleného uživatelského rozhraní. Spuštění Vzdáleného
uživatelského rozhraní(P. 290)
ODKAZY
Generování párů klíčů(P. 276)
Použití párů klíčů a digitálních certifikátů vydaných certifikační autoritou(P. 283)
Konfigurace nastavení IPSec(P. 259)
Konfigurace ověřování IEEE 802.1X(P. 269)
Monitorování a ovládání zařízení pomocí protokolu SNMP(P. 193)
258
Zabezpečení
Konfigurace nastavení IPSec
6867-03X
Internet Protocol Security (IPSec nebo IPsec) je sada protokolů pro šifrování dat přepravovaných prostřednictvím sítě,
včetně internetových sítí. Zatímco protokol TLS šifruje pouze data používaná v konkrétní aplikaci, jako je například
webový prohlížeč nebo e-mailová aplikace, protokol IPSec šifruje celé IP pakety nebo jejich datové části a poskytuje tak
univerzálnější systém zabezpečení. Sada protokolů IPSec zařízení pracuje v transportním režimu, ve kterém jsou
šifrovány datové části IP paketů. Zařízení se může díky této funkci připojit přímo k počítači ve stejné virtuální privátní
síti (VPN). Nejprve potřebným způsobem nakonfigurujte počítač a poté také zařízení.
Uložení zásad zabezpečení(P. 259)
Povolení komunikace IPSec(P. 266)
Použití protokolu IPSec s filtrem IP adres
● Během příjmu paketů se použije nastavení protokolu IPSec přednostně před natavením filtru IP adres,
zatímco při vysílání paketů se použije nastavení IP adres přednostně před nastavením IPSec. Zadání IP
adres pro přidání do pravidel brány firewall(P. 227)
Uložení zásad zabezpečení
Chcete-li použít IPSec pro šifrovanou komunikaci, musíte si před aktivací nastavení IPSec zaregistrovat zásady
zabezpečení (SP) ( Povolení komunikace IPSec(P. 266) ). Zásady zabezpečení sestávají ze skupin následujících
nastavení. Můžete registrovat více zásad podle kombinace adresy IP a čísla portu. Jakmile zásady uložíte, zadejte
pořadí, v jakém mají být použity.
Přepínač
Přepínač slouží k definování podmínek, za jakých mají IP pakety použít komunikaci IPSec. Volitelné podmínky
zahrnují IP adresy a čísla portů zařízení a také zařízení, se kterými je možné komunikovat.
IKE
IKE nakonfiguruje verzi protokolu IKEv1, který slouží pro výměnu klíčů. Pokyny se liší v závislosti na vybrané
metodě ověřování.
[Metoda předsdíleného klíče]
Klíč alfanumerických znaků lze sdílet s ostatními zařízeními. Předem povolte TLS pro Vzdálené UR (
TLS pro šifrovanou komunikaci(P. 255) ).
Používání
[Metoda digitálního podpisu]
Toto zařízení a ostatní zařízení se ověřují vzájemným ověřením digitálních podpisů. Připravte si pár klíčů
k použití ( Použití párů klíčů a digitálních certifikátů vydaných certifikační autoritou(P. 283) ).
Nastavení protokolů a možností
Zadejte nastavení pro hlavičky ESP a AH, které se přidávají do paketů během komunikace IPSec. Hlavičky AH
a ESP nelze používat současně. Můžete také vybrat, zda povolit metodu PFS pro větší bezpečnost.
259
Zabezpečení
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v Režimu správy.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na [Seznam zásad zabezpečení IPSec].
5
Klikněte na [Uložit zásady zabezpečení IPSec].
[Nastavení IPSec].
260
Spuštění
Zabezpečení
6
Zadejte název zásad v položce [Název zásad zabezpečení] a zaškrtněte políčko
[Umožnit zásady zabezpečení].
[Název zásad zabezpečení]
Zadejte alfanumerické znaky pro název, který se používá k identifikaci zásad.
[Umožnit zásady zabezpečení]
Zaškrtnutím tohoto políčka povolíte zásady. Pokud zásady nepoužíváte, zaškrtnutí políčka zrušte.
7
Zadejte nastavení přepínače.
[Lokální adresa]
Vyberte typ IP adresy zařízení, pro které se mají zásady použít, a to z následujícího seznamu.
261
Zabezpečení
[Všechny IP adresy]
Vyberte, chcete-li pro všechny IP pakety použít IPSec.
[Adresa IPv4]
Vyberte sadu IPSec pro všechny IP pakety, které se odesílají do adresy IPv4 přístroje
nebo z ní.
[Adresa IPv6]
Vyberte sadu IPSec pro všechny IP pakety, které se odesílají do adresy IPv6 přístroje
nebo z ní.
[Ruční nastavení IPv4]
Vyberte, chcete-li zadat jednu IPv4 adresu nebo rozsah IPv4 adres, pro které se má
použít protokol IPSec. Zadejte adresu IPv4 (nebo rozsah) do textového pole [Ručně
nastavované adresy].
[Ruční nastavení IPv6]
Vyberte, chcete-li zadat jednu IPv6 adresu nebo rozsah IPv6 adres, pro které se má
použít protokol IPSec. Zadejte adresu IPv6 (nebo rozsah) do textového pole [Ručně
nastavované adresy].
[Ručně nastavované adresy]
Je-li v části [Lokální adresa] vybrána možnost [Ruční nastavení IPv4] nebo [Ruční nastavení IPv6], zadejte IP
adresu, pro kterou mají být zásady použity.
[Nastavení podsítě]
Pokud zadáváte adresy IPv4 ručně, můžete rozsah adres vyjádřit pomocí masky podsítě. Zadejte masku
podsítě oddělením čísel tečkou (příklad: „255.255.255.240“).
[Vzdálená adresa]
Vyberte typ IP adresy dalších zařízení, pro které se mají zásady použít, a to z následujícího seznamu.
[Všechny IP adresy]
Vyberte, chcete-li pro všechny IP pakety použít IPSec.
[Všechny IPv4 adresy]
Vyberte, chcete-li použít protokol IPSec pro všechny IP pakety, které se odesílají na
určitou adresu nebo z určité adresy IPv4.
[Všechny IPv6 adresy]
Vyberte, chcete-li použít protokol IPSec pro všechny IP pakety, které se odesílají na
určitou adresu nebo z určité adresy IPv6.
[Ruční nastavení IPv4]
Vyberte, chcete-li zadat jednu IPv4 adresu nebo rozsah IPv4 adres, pro které se má
použít protokol IPSec. Zadejte adresu IPv4 (nebo rozsah) do textového pole [Ručně
nastavované adresy].
[Ruční nastavení IPv6]
Vyberte, chcete-li zadat jednu IPv6 adresu nebo rozsah IPv6 adres, pro které se má
použít protokol IPSec. Zadejte adresu IPv6 (nebo rozsah) do textového pole [Ručně
nastavované adresy].
[Ručně nastavované adresy]
Je-li v části [Vzdálená adresa] vybrána možnost [Ruční nastavení IPv4] nebo [Ruční nastavení IPv6], zadejte IP
adresu, pro kterou mají být zásady použity.
[Nastavení podsítě]
Pokud zadáváte adresy IPv4 ručně, můžete rozsah adres vyjádřit pomocí masky podsítě. Zadejte masku
podsítě oddělením čísel tečkou (příklad: „255.255.255.240“).
[Lokální port]/[Vzdálený port]
Pokud chcete pro jednotlivé protokoly vytvořit samostatné zásady, např. protokol HTTP nebo SMTP, zadejte
příslušné číslo portu pro jednotlivé protokoly, aby bylo možné určit, pro který se má použít protokol IPSec.
● Protokol IPSec se nepoužije u paketů, které mají zadanou adresu vícesměrového nebo všesměrového
vysílání.
8
Zadejte nastavení IKE.
262
Zabezpečení
[Režim IKE]
Zobrazí se režim, který se používá pro protokol výměny klíčů. Obvykle vyberte hlavní režim.
● Pokud není IP adresa pevná, vyberte agresivní režim. Upozorňujeme, že v agresivním režimu je
zabezpečení nižší než v hlavním režimu.
[Způsob OVĚŘ.]
Vyberte [Metoda předsdíleného klíče] nebo [Metoda digitálního podpisu] pro metodu, která se má použít při
ověřování zařízení.
● Když je v položce [Režim IKE] vybrán agresivní režim, nastavení [Metoda předsdíleného klíče] nešifruje
sdílený klíč.
[Algoritmus ověření/šifrování]
Chcete-li automaticky nastavit algoritmus, který se používá k výměně klíčů, zaškrtněte políčko [Auto]. Pokud
toto políčko zaškrtnete, algoritmus bude nastaven níže uvedeným způsobem.
[Ověření]
[SHA1 a MD5]
[Šifrování]
[3DES-CBC a AES-CBC]
[DH Group]
[Group 2 (1024)]
Chcete-li algoritmus nastavit ručně, zrušte zaškrtnutí políčka a vyberte požadovaný algoritmus.
[Ověření]
Vyberte hashovací algoritmus.
[Šifrování]
Vyberte algoritmus šifrování.
[DH Group]
Vyberte skupinu Diffie-Hellman, která určuje sílu klíče.
Použití možnosti [Metoda předsdíleného klíče] k ověřování
1
Vyberte možnost [Metoda předsdíleného klíče] pro [Způsob OVĚŘ.] a klikněte na [Nastavení
sdíleného klíče].
2
Formou alfanumerických znaků zadejte předsdílený klíč a klikněte na [OK].
263
Zabezpečení
Použití možnosti [Metoda digitálního podpisu] k ověřování
1
Vyberte možnost [Metoda digitálního podpisu] pro [Způsob OVĚŘ.] a klikněte na [Klíč a certifikát].
2
Vyberte pár klíčů, který chcete použít, a klikněte na možnost [Výchozí nastavení klíče].
Zobrazení podrobností o páru klíčů nebo certifikátu
● Máte možnost zkontrolovat podrobné informace o certifikátu nebo můžete certifikát ověřit kliknutím
na příslušný textový odkaz pod možností [Název klíče] nebo na ikonu certifikátu. Ověření párů klíčů
a digitálních certifikátů(P. 286)
9
Zadejte nastavení sítě IPSec.
[Použít PFS]
Zaškrtnutím políčka povolíte metodu PFS (Perfect Forward Secrecy) pro klíče relace IPSec. Povolení metody
PFS zvyšuje zabezpečení, ale zároveň zvyšuje i zatížení sítě. Ujistěte se, že je metoda PFS povolena také pro
ostatní zařízení. Pokud metodu PFS nepoužíváte, zaškrtnutí políčka zrušte.
[Platnost]
Zadejte, jak dlouho se SA používá jako komunikační tunel. Podle potřeby zaškrtněte políčko [Specifikovat dle
času] nebo [Specifikovat dle velikosti], případně obě. Pokud zaškrtnete obě pole, relace IPSec SA se ukončí,
jakmile bude jedna z podmínek splněna.
264
Zabezpečení
[Specifikovat dle času]
Zadejte dobu trvání relace v minutách. Zadaný čas se použije jak pro IPSec SA, tak pro
IKE SA.
[Specifikovat dle velikosti]
Zadejte velikost v megabytech, která určí, jaký objem dat může být během relace
přenesen. Zadaná velikost se použije pouze pro IPSec SA.
Pokud jste zaškrtli pouze pole [Specifikovat dle velikosti]
● Platnost IKE SA nelze specifikovat dle velikosti, a proto se použije počáteční hodnota (480 minut) položky
[Specifikovat dle času].
[Algoritmus ověření/šifrování]
Vyberte protokol a algoritmus, které se použijí pro komunikaci IPSec.
Automatické nastavení připojení
Vyberte [Auto].
[Ověření ESP]
Protokol ESP je povolen a algoritmus ověření je nastaven na možnost [SHA1 a MD5].
[Šifrování ESP]
Protokol ESP je povolen a algoritmus šifrování je nastaven na možnost [3DES-CBC a
AES-CBC].
Použití protokolu ESP
Zvolte možnost [ESP] a vyberte algoritmus ověření a algoritmus šifrování.
[Ověření ESP]
Vyberte hashovací algoritmus, který chcete použít pro ověření ESP.
[Šifrování ESP]
Vyberte algoritmus šifrování pro ESP.
Použití protokolu AH
Zvolte možnost [AH] a v položce [Ověření AH] vyberte hashovací algoritmus, který se použije k ověření AH.
[Režim připojení]
Zobrazí se režim připojení protokolu IPSec. Zařízení podporuje transportní režim, ve kterém jsou šifrovány
datové části IP paketů. Tunelový režim, ve kterém jsou celé IP pakety (hlavičky i datové části) zapouzdřeny,
není dostupný.
10
Klikněte na [OK].
● Pokud potřebujete uložit další zásady zabezpečení, vraťte se ke kroku 5.
11
Uspořádejte pořadí zásad v seznamu [Seznam zásad zabezpečení IPSec].
● Zásady jsou používány v pořadí od nejvyšší pozice k nejnižší. Kliknutím na [Zvýšit prioritu] nebo [Snížit
prioritu] změníte pořadí zásady směrem nahoru nebo dolů.
265
Zabezpečení
Úprava zásad
● Chcete-li upravit nastavení, klikněte na textový odkaz pod položkou [Název zásad zabezpečení].
Odstranění zásad
● Klikněte na tlačítko [Smazat] nacházející se vpravo od zásad, které chcete odstranit.
12
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a potom klikněte na [Provést].
➠ Po provedení tvrdého resetu je nastavení aktivní.
Povolení komunikace IPSec
Po dokončení uložení zásad zabezpečení povolte komunikaci IPSec.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v Režimu správy.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
[Nastavení IPSec].
266
Spuštění
Zabezpečení
4
Klikněte na [Editovat].
5
Zaškrtněte políčko [Použít IPSec] a klikněte na [OK].
[Použít IPSec]
Používáte-li v zařízení protokol IPSec, zaškrtněte toto políčko. Pokud jej nepoužíváte, zaškrtnutí políčka
zrušte.
[Povolit přijmout pakety bez zásad zabezpečení]
Jestliže používáte protokol IPSec a toto políčko zaškrtnete, budou odesílány/přijímány také pakety, které
nejsou pro uložené zásady dostupné. Chcete-li zakázat odesílání/přijímání paketů, které nejsou pro zásady
dostupné, zaškrtnutí políčka zrušte.
6
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a potom klikněte na [Provést].
267
Zabezpečení
➠ Po provedení tvrdého resetu je nastavení aktivní.
Použití ovládacího panelu
● Komunikaci IPSec lze také povolit či zakázat z nabídky nastavení na ovládacím panelu.
ODKAZY
Konfigurace nastavení pro páry klíčů a digitální certifikáty(P. 275)
Seznam zásad IPSec(P. 465)
268
IPSec(P. 346)
Zabezpečení
Konfigurace ověřování IEEE 802.1X
6867-03Y
Zařízení se může k síti 802.1X připojit jako klientské zařízení. Typická síť 802.1X sestává se serveru RADIUS (ověřovací
server), přepínače LAN (ověřovatel) a klientského zařízení se softwarem umožňujícím ověření (žádající porty). Pokud se
zařízení pokusí připojit k síti 802.1X, musí projít procesem ověření uživatele, který prokáže, zda se o připojení pokouší
autorizovaný uživatel. Informace o ověření je odeslána ke kontrole na server RADIUS, který na základě výsledku
ověření buď povolí, nebo odmítne komunikaci se sítí. Pokud se ověření nezdaří, přepínač LAN (nebo přístupový bod)
zablokuje přístup z vnější sítě.
Z následujících možností vyberte metodu ověřování. Pokud je to nutné, pak ještě před konfigurací ověřování IEEE
802.1X nainstalujte nebo uložte pár klíčů nebo certifikát vydaný certifikační autoritou (CA) ( Použití párů klíčů a
digitálních certifikátů vydaných certifikační autoritou(P. 283) ).
TLS
Zařízení a ověřovací server se navzájem ověří tím, že si vzájemně ověří své certifikáty. Pro ověření klienta (při
ověřování zařízení) je vyžadován pár klíčů vydaný certifikační autoritou (CA). Pro ověření serveru je možné
kromě certifikátu CA předinstalovaného v zařízení použít ještě certifikát CA, který lze nainstalovat
prostřednictvím Vzdáleného uživatelského rozhraní.
TTLS
Tato metoda ověřování využívá k ověření klienta uživatelské jméno a heslo a k ověření serveru CA certifikát. Jako
interní protokol je možné vybrat protokol MSCHAPv2 nebo PAP. Metodu TTLS lze použít zároveň s metodou
PEAP. Před konfigurací této metody ověřování povolte funkci TLS pro Vzdálené uživatelské rozhraní (
Používání TLS pro šifrovanou komunikaci(P. 255) ).
PEAP
Požadovaná nastavení se téměř shodují s nastaveními pro metodu TTLS. Protokol MS-CHAPv2 se používá jako
interní protokol. Před konfigurací této metody ověřování povolte funkci TLS pro Vzdálené uživatelské rozhraní
( Používání TLS pro šifrovanou komunikaci(P. 255) ).
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
2
Klikněte na tlačítko [Nastavení/Uložení].
Vzdáleného uživatelského rozhraní(P. 290)
269
Spuštění
Zabezpečení
3
Klikněte na položku [Síť]
4
Klikněte na tlačítko [Editovat].
5
[Nastavení IEEE 802.1X].
Zaškrtněte políčko [Použít IEEE 802.1X], do textového pole [Přihlašovací jméno]
zadejte přihlašovací jméno a zadejte požadovaná nastavení.
270
Zabezpečení
[Použít IEEE 802.1X]
Zaškrtnutím políčka povolte ověřování IEEE 802.1X.
[Přihlašovací jméno]
Formou alfanumerických znaků zadejte jméno (identitu EAP), které bude použito k identifikaci uživatele.
Nastavení TLS
1
Zaškrtněte políčko [Použít TLS] a klikněte na tlačítko [Klíč a certifikát].
● Nelze používat TLS s TTLS nebo PEAP.
2
Vyberte klíč ze seznamu klíčů a certifikátů a klikněte na tlačítko [Výchozí nastavení klíče].
Zobrazení podrobností o páru klíčů nebo certifikátu
● Máte možnost zkontrolovat podrobné informace o certifikátu nebo můžete certifikát ověřit kliknutím
na příslušný textový odkaz pod položkou [Název klíče], nebo na ikonu certifikátu. Ověření párů
klíčů a digitálních certifikátů(P. 286)
Nastavení TTLS/PEAP
1
Zaškrtněte políčko [Použít TTLS] nebo [Použít PEAP].
271
Zabezpečení
Interní protokol pro ověřování TTLS
● Můžete vybrat možnost MSCHAPv2 nebo PAP. Pokud chcete použít možnost PAP, klikněte na přepínač
[PAP].
2
Klikněte na tlačítko [Změnit uživatelské jméno/heslo].
● Chcete-li zadat uživatelské jméno jiné než přihlašovací jméno, zrušte zaškrtnutí políčka [Použít
přihlašovací jméno jako uživatelské jméno]. Políčko zaškrtněte, chcete-li použít přihlašovací jméno jako
uživatelské jméno.
3
Nastavte uživatelské jméno či heslo a klikněte na možnost [OK].
272
Zabezpečení
[Uživatelské jméno]
Formou alfanumerických znaků zadejte uživatelské jméno.
[Změnit heslo]
Chcete-li nastavit či změnit heslo, zaškrtněte políčko a formou alfanumerických znaků zadejte nové heslo
do textových polí [Heslo] a [Potvrdit].
6
Klikněte na tlačítko [OK].
7
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
➠ Nastavení se aktivují po provedení tvrdého resetu.
Použití ovládacího panelu
● Ověřování IEEE 802.1X můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
IEEE802.1X(P. 354)
273
Zabezpečení
ODKAZY
Konfigurace nastavení pro páry klíčů a digitální certifikáty(P. 275)
274
Zabezpečení
Konfigurace nastavení pro páry klíčů a digitální
certifikáty
6867-040
Chcete-li komunikaci šifrovat pomocí vzdáleného zařízení, je třeba předem přes nezabezpečenou síť zaslat a přijmout
šifrovací klíč. Tento problém lze vyřešit pomocí kryptografie veřejných klíčů. Kryptografie veřejných klíčů zajišťuje
zabezpečenou komunikaci díky ochraně důležitých a cenných informací před útoky, jako je sniffing (falšování),
spoofing (odposlech) nebo tampering (nepovolené úpravy) dat při jejich průchodu sítí.
Pár klíčů
Pár klíčů sestává z veřejného klíče a tajného klíče. Pro šifrování nebo dešifrování dat jsou nutné
oba tyto klíče. Kryptografie veřejných klíčů zajišťuje bezpečnou komunikaci dat v síti právě
proto, že údaje, které byly zašifrovány jedním klíčem z páru klíčů, nemohou být vráceny do své
původní datové podoby bez použití druhého klíče. Je možné uložit až osm párů klíčů ( Použití
párů klíčů a digitálních certifikátů vydaných certifikační autoritou(P. 283) ). Pár klíčů pro
šifrovanou komunikaci TLS lze pro zařízení vygenerovat ( Generování párů klíčů(P. 276) ).
Certifikát CA
Digitální certifikáty, včetně certifikátů CA, jsou podobné jiným způsobům identifikace, např.
řidičským průkazům. Digitální certifikát se skládá z digitálního podpisu, pomocí něhož může
zařízení detekovat data spojená s odposlechem nebo nepovolenými úpravami. Pro třetí strany
je velmi obtížné digitální certifikáty zneužít. Digitální certifikát, který obsahuje veřejný klíč
vydaný certifikační autoritou (CA), je označován jako certifikát CA. Certifikáty CA jsou používány
pro ověření jiného zařízení, se kterým zde popisované zařízení komunikuje, např. tisk z aplikace
Google Cloud Print nebo ověřování IEEE 802.1X. Je možné zaregistrovat až 150 certifikátů CA,
včetně 72 certifikátů předinstalovaných v zařízení ( Použití párů klíčů a digitálních
certifikátů vydaných certifikační autoritou(P. 283) ).
275
Zabezpečení
Generování párů klíčů
6867-041
Pokud šifrovaná komunikace probíhající prostřednictvím protokolu Transport Layer Security (TLS) vyžaduje pár klíčů, je
možné ho pomocí zařízení vygenerovat. Protokol TLS lze použít při přístupu k zařízení prostřednictvím Vzdáleného
uživatelského rozhraní nebo při tisku IPP. Pro zařízení je možné registrovat až osm párů klíčů, včetně
předinstalovaných párů. Certifikáty podepsané svým držitelem jsou používány s páry klíčů vygenerovanými pomocí
možnosti „Komunikace v síti“. Pomocí možnosti „Klíč a žádost o podepsání certifikátu (CSR)“ můžete požádat o digitální
certifikát od certifikační autority pro pár klíčů vygenerovaný zařízením.
Generovat klíč pro síťovou komunikaci(P. 276)
Generovat klíč a žádost o podepsání certifikátu (CSR)(P. 278)
Generovat klíč pro síťovou komunikaci
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Generovat klíč].
[Nastavení klíče a certifikátu].
276
Spuštění
Zabezpečení
Odstranění uloženého páru klíčů
● Klikněte na tlačítko [Smazat] napravo od ID oddělení, které chcete smazat
klikněte na tlačítko [OK].
● Pokud je pár klíčů z nějakého důvodu aktuálně používán, např. pokud se pod položkou [Použití
klíče]zobrazuje informace „TLS“ nebo „IEEE 802.1X“, pak tento pár klíčů nelze smazat. V takovém případě je
před smazáním nutné příslušnou funkci zakázat nebo vyměnit.
5
Vyberte možnost [Komunikace v síti] a klikněte na tlačítko [OK].
6
Zadejte nastavení pro klíč a certifikát.
[Nastavení klíče]
[Název klíče]
277
Zabezpečení
Zadáním alfanumerických znaků pojmenujte dvojici klíčů. Zadejte název, který budete schopni později v
seznamu snadno nalézt.
[Algoritmus podpisu]
V rozevíracím seznamu vyberte algoritmus.
[Algoritmus klíče]
K vygenerování páru klíčů se používá algoritmus RSA nebo ECDSA. V rozbalovacím seznamu vyberte
délku klíče. Čím vyšší je hodnota délky klíče, tím pomalejší je komunikace. Zabezpečení je však vyšší.
● [512 bitů] nelze vybrat pro délku klíče, pokud je nastaveno [SHA384] nebo [SHA512] pro
možnost [Algoritmus podpisu].
[Nastavení certifikátu]
[Počáteční datum platnosti (dd/mm rrrr)]
Zadejte datum zahájení platnosti certifikátu.
[Koncové datum platnosti (dd/mm rrrr)]
Zadejte datum ukončení platnosti certifikátu. Nelze nastavit dřívější datum, než je [Počáteční datum
platnosti (dd/mm rrrr)].
[Země/Region]
Zadejte znaky pro internetový kód příslušné země.
[Stát]/[Město]
Podle potřeby zadejte umístění formou alfanumerických znaků.
[Organizace]/[Organizační jednotka]
Podle potřeby zadejte název organizace formou alfanumerických znaků.
[Běžné jméno]
Podle potřeby zadejte běžný název certifikátu formou alfanumerických znaků. Pro „běžný název“ je
často používána zkratka „CN“.
Chcete-li provést tisk IPPS, v položce [Běžné jméno] musí být zadána „IP adresa“ nebo „<jméno
hostitele>.<jméno domény>“, které se používají k připojení prostřednictvím IPPS.
● Zadejte „IP adresu“, když je pevná.
● Zadejte „<název hostitele>.<název domény>“, pokud se používá server DNS.
IPPS(P. 166)
7
Klikněte na tlačítko [OK].
● Vygenerování páru klíčů pro síťovou komunikaci trvá přibližně 10 až 15 minut.
● Jakmile je pár klíčů vygenerován, uloží se automaticky do zařízení.
Generovat klíč a žádost o podepsání certifikátu (CSR)
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
2
Klikněte na tlačítko [Nastavení/Uložení].
Spuštění Vzdáleného uživatelského rozhraní(P. 290)
278
Aktivace IPP/
Zabezpečení
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Generovat klíč].
[Nastavení klíče a certifikátu].
Odstranění uloženého páru klíčů
● Klikněte na tlačítko [Smazat] napravo od ID oddělení, které chcete smazat
klikněte na tlačítko [OK].
● Pokud je pár klíčů z nějakého důvodu aktuálně používán, např. pokud se pod položkou [Použití
klíče]zobrazuje informace „TLS“ nebo „IEEE 802.1X“, pak tento pár klíčů nelze smazat. V takovém případě je
před smazáním nutné příslušnou funkci zakázat nebo vyměnit.
5
Vyberte možnost [Klíč a žádost o podepsání certifikátu (CSR)] a klikněte na tlačítko
[OK].
279
Zabezpečení
6
Zadejte nastavení pro klíč a certifikát.
[Nastavení klíče]
[Název klíče]
Zadáním alfanumerických znaků pojmenujte dvojici klíčů. Zadejte název, který budete schopni později v
seznamu snadno nalézt.
[Algoritmus podpisu]
V rozevíracím seznamu vyberte algoritmus.
[Algoritmus klíče]
K vygenerování páru klíčů se používá algoritmus RSA nebo ECDSA. V rozbalovacím seznamu vyberte
délku klíče. Čím vyšší je hodnota délky klíče, tím pomalejší je komunikace. Zabezpečení je však vyšší.
● [512 bitů] nelze vybrat pro délku klíče, pokud je nastaveno [SHA384] nebo [SHA512] pro
možnost [Algoritmus podpisu].
[Nastavení žádosti o podepsání certifikátu (CSR)]
[Země/Region]
Zadejte znaky pro internetový kód příslušné země.
[Stát]/[Město]
Podle potřeby zadejte umístění formou alfanumerických znaků.
[Organizace]/[Organizační jednotka]
Podle potřeby zadejte název organizace formou alfanumerických znaků.
[Běžné jméno]
280
Zabezpečení
Podle potřeby zadejte běžný název certifikátu formou alfanumerických znaků. Pro „běžný název“ je
často používána zkratka „CN“.
Chcete-li provést tisk IPPS, v položce [Běžné jméno] musí být zadána „IP adresa“ nebo „<jméno
hostitele>.<jméno domény>“, které se používají k připojení prostřednictvím IPPS.
● Zadejte „IP adresu“, když je pevná.
● Zadejte „<název hostitele>.<název domény>“, pokud se používá server DNS.
Aktivace IPP/
IPPS(P. 166)
7
Klikněte na tlačítko [OK].
● Vygenerování klíče a žádosti o podepsání certifikátu (CSR) trvá přibližně 10 až 15 minut.
8
Klikněte na tlačítko [Uložit v souboru].
● Zobrazí se dialogové okno pro uložení souboru. Zvolte místo pro jeho uložení a klikněte na tlačítko [Uložit].
➠ Soubor klíče a žádosti o podepsání certifikátu (CSR) se uloží do počítače.
9
Připojte uložený soubor a odešlete žádost certifikační autoritě.
◼ Uložení digitálního certifikátu od certifikační autority.
Pár klíčů vygenerovaný žádostí o podepsání certifikátu (CSR) nemůžete použít, dokud nebude certifikát uložen. Jakmile
certifikační autorita vystaví digitální certifikát, uložte jej podle následujících pokynů.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
Vzdáleného uživatelského rozhraní(P. 290)
[Nastavení klíče a certifikátu].
281
Spuštění
Zabezpečení
4
Klikněte na možnost [Název klíče] nebo [Certifikát] pro certifikát, který chcete uložit.
5
Klikněte na tlačítko [Uložit certifikát].
6
Klikněte na tlačítko[Procházet] v [Cesta k souboru], zadejte soubor, pro který chcete
žádat o podepsání certifikátu (CSR), a klikněte na tlačítko [Uložit].
ODKAZY
Použití párů klíčů a digitálních certifikátů vydaných certifikační autoritou(P. 283)
Ověření párů klíčů a digitálních certifikátů(P. 286)
Používání TLS pro šifrovanou komunikaci(P. 255)
Konfigurace nastavení IPSec(P. 259)
282
Zabezpečení
Použití párů klíčů a digitálních certifikátů vydaných
certifikační autoritou
6867-042
Páry klíčů a certifikáty používané s tímto zařízením je možné získat od certifikační autority (CA). Prostřednictvím
Vzdáleného uživatelského rozhraní je možné tyto soubory uložit a poté registrovat. Ujistěte se, že pár klíčů a certifikát
splňují požadavky zařízení ( Registrace klíčů a certifikátů(P. 565) ). Lze zaregistrovat až 8 párů klíčů (včetně
předinstalovaných) a lze registrovat až 150 certifikátů CA (včetně 72 předinstalovaných).
1
2
3
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Spuštění
Vzdáleného uživatelského rozhraní(P. 290)
Klikněte na tlačítko [Nastavení/Uložení].
Klikněte na možnost [Zabezpečení]
CA certifikátu].
[Nastavení klíče a certifikátu] nebo [Nastavení
● Kliknutím na možnost [Nastavení klíče a certifikátu] nainstalujte pár klíčů. Kliknutím na možnost [Nastavení
CA certifikátu] nainstalujte certifikát CA.
283
Zabezpečení
4
Klikněte na možnost [Uložit klíč a certifikát] nebo [Uložit CA certifikát].
Odstranění uloženého páru klíčů nebo certifikátu CA
● Klikněte na tlačítko [Smazat] nacházející se vpravo od páru klíčů nebo certifikátu CA, který chcete smazat
klikněte na tlačítko [OK].
● Pokud je pár klíčů z nějakého důvodu aktuálně používán, např. pokud se zobrazuje údaj „[TLS]“ nebo „[IEEE
802.1X]“ pod položkou [Použití klíče]. V takovém případě je nutné před smazáním příslušnou funkci zakázat
nebo pár klíčů nahradit. Předinstalované certifikáty CA nelze odstranit.
5
Klikněte na tlačítko [Instalovat].
Odstranění páru klíčů nebo certifikátu CA
● Klikněte na tlačítko [Smazat] nacházející se vpravo od souboru, který chcete smazat, a poté klikněte na
tlačítko [OK].
6
Klikněte na tlačítko [Browse] (Procházet), zadejte soubor, který se má nainstalovat, a
poté klikněte na tlačítko [Spustit instalaci].
● Pár klíčů nebo certifikát CA se nainstaluje do zařízení.
284
Zabezpečení
7
Uložte pár klíčů nebo certifikát CA.
Uložení páru klíčů
1
Klikněte na tlačítko [Uložit] nacházející se vpravo od páru klíčů, který chcete zaregistrovat.
2
Zadejte název páru klíčů a heslo a poté klikněte na tlačítko [OK].
[Název klíče]
Formou alfanumerických znaků zadejte název dvojice klíčů, které chcete registrovat.
[Heslo]
Formou alfanumerických znaků zadejte heslo soukromého klíče nastaveného pro soubor, který chcete
uložit.
Uložení certifikátu CA
Klikněte na tlačítko [Uložit] nacházející se vpravo od certifikátu CA, který chcete zaregistrovat.
ODKAZY
Generování párů klíčů(P. 276)
Ověření párů klíčů a digitálních certifikátů(P. 286)
Používání TLS pro šifrovanou komunikaci(P. 255)
Konfigurace nastavení IPSec(P. 259)
Konfigurace ověřování IEEE 802.1X(P. 269)
285
Zabezpečení
Ověření párů klíčů a digitálních certifikátů
6867-043
Po uložení párů klíčů a certifikátů CA je možné zobrazit podrobné informace nebo ověřit platnost a podpis.
1
2
3
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Spuštění
Vzdáleného uživatelského rozhraní(P. 290)
Klikněte na tlačítko [Nastavení/Uložení].
Klikněte na možnost [Zabezpečení]
CA certifikátu].
[Nastavení klíče a certifikátu] nebo [Nastavení
● Kliknutím na možnost [Nastavení klíče a certifikátu] nainstalujte pár klíčů. Kliknutím na možnost [Nastavení
CA certifikátu] nainstalujte certifikát CA.
4
Klikněte na ikonu páru klíčů nebo certifikátu, který chcete ověřit.
286
Zabezpečení
● Podrobné informace o certifikátu je možné zobrazit na této obrazovce.
5
Zkontrolujte podrobnosti certifikátu a klikněte na [Ověření certifikátu].
● Výsledky z ověření certifikátu se zobrazí podle znázornění níže.
ODKAZY
Generování párů klíčů(P. 276)
Použití párů klíčů a digitálních certifikátů vydaných certifikační autoritou(P. 283)
287
Použití Vzdáleného uživatelského rozhraní
Použití Vzdáleného uživatelského
rozhraní
Použití Vzdáleného uživatelského rozhraní ................................................................................... 289
Spuštění Vzdáleného uživatelského rozhraní .................................................................................................. 290
Obrazovky Vzdáleného uživatelského rozhraní .............................................................................................. 293
Správa dokumentů a kontrola stavu zařízení ................................................................................................. 299
Umožnění manipulace s dokumenty koncovým uživatelům ......................................................................... 304
Nastavení možností nastavení prostřednictvím uživatelského rozhraní ...................................................... 306
Ukládání/načtení registrovaných dat .............................................................................................................. 308
Ukládání registrovaných dat ......................................................................................................................... 309
Načtení registrovaných dat ........................................................................................................................... 311
288
Použití Vzdáleného uživatelského rozhraní
Použití Vzdáleného uživatelského rozhraní
6867-044
Pomocí webového prohlížeče lze vzdáleně ovládat zařízení a kontrolovat jeho stav nebo dokumenty, které čekají na
vytištění. Lze také provádět některá nastavení pro přístroj. Správa systému je tak mnohem jednodušší, protože vše
potřebné můžete udělat přímo od svého pracovního stolu. Další informace o systémových požadavcích pro Vzdálené
uživatelské rozhraní naleznete v části Systémové prostředí(P. 568) .
Funkce Vzdáleného uživatelského rozhraní
Správa dokumentů a kontrola stavu zařízení(P. 299)
Nastavení možností nastavení prostřednictvím uživatelského rozhraní(P. 306)
Ukládání/načtení registrovaných dat(P. 308)
Základy Vzdáleného uživatelského rozhraní
Spuštění Vzdáleného uživatelského rozhraní(P. 290)
Obrazovky Vzdáleného uživatelského rozhraní(P. 293)
289
Použití Vzdáleného uživatelského rozhraní
Spuštění Vzdáleného uživatelského rozhraní
6867-045
Chcete-li zařízení vzdáleně ovládat, je třeba do webového prohlížeče zadat IP adresu zařízení a spustit Vzdálené
uživatelské rozhraní. Nejprve zkontrolujte IP adresu nastavenou v zařízení ( Tisk stavu sítě(P. 465) ). V případě
jakýchkoli dotazů kontaktujte správce sítě.
1
Spusťte internetový prohlížeč.
2
Do pole adresy zadejte „http://(IP adresa zařízení)/“ a stiskněte klávesu [ENTER].
● Chcete-li použít adresu IPv6, dejte adresu IPv6 do závorek (příklad: http://[fe80::2e9e:fcff:fe4e:dbce]/).
Použití serveru DNS
● Namísto „IP adresy zařízení“
hostitele>.<název domény>“.
(příklad:
https://my_printer.example.com/)
můžete
zadat
„<název
Pokud se zobrazí upozornění zabezpečení
● Upozornění zabezpečení se může zobrazit v případě, že je komunikace Vzdáleného uživatelského rozhraní
šifrovaná ( Používání TLS pro šifrovanou komunikaci(P. 255) ). Jsou-li nastavení certifikátu či TLS bez
chyb, pokračujte v procházení na webu.
3
Přihlaste se k Vzdálené uživatelské rozhraní.
Když je zakázána správa ID oddělení
Vyberte možnost [Režim správy] (Jednostranný tisk) nebo [Režim běžného uživatele] (Oboustranný tisk).
[Režim správy]
Prostřednictvím uživatelského rozhraní můžete provádět všechny operace a nastavení. Do pole [Heslo]
zadejte heslo správce systému.
290
Použití Vzdáleného uživatelského rozhraní
● Výchozí heslo správce systému je „7654321“.
Nastavení hesla správce systému(P. 215)
[Režim běžného uživatele]
Můžete zkontrolovat stav dokumentů či zařízení a také změnit některé nastavení. Pokud chcete odstranit
své tiskové dokumenty, zadejte uživatelské jméno dokumentů do položky [Uživatelské jméno]. Uživatelské
jméno se nastaví automaticky pro tisk dokumentů na základě údajů, jako je název počítače nebo
přihlašovací jméno k počítači.
O [Uživatelské jméno]
● Ve výchozím nastavení není možnost [Uživatelské jméno] zobrazena, čímž se běžným uživatelům
znemožňuje pracovat s dokumenty. Pokud chcete s dokumenty pracovat v režimu běžného uživatele,
Umožnění
přihlaste se v režimu správce a aktivujte [Povolit proces úlohy běžného uživatele].
manipulace s dokumenty koncovým uživatelům(P. 304)
[Přístupový kód PIN vzdáleného UR]
Pokud se zobrazí [Přístupový kód PIN vzdáleného UR], zadejte PIN (
uživatelské rozhraní(P. 225) ).
Nastavení kódu PIN pro Vzdálené
Když je povolena správa ID oddělení
Zadejte příslušné ID do pole [ID oddělení] a kód PIN do pole [PIN] (
oddělení(P. 218) ).
4
Nastavení správy ID
Klikněte na tlačítko [Přihlásit se].
➠ Zobrazí se stránka portálu (hlavní stránka).
Obrazovky Vzdáleného uživatelského rozhraní(P. 293)
291
Použití Vzdáleného uživatelského rozhraní
292
Použití Vzdáleného uživatelského rozhraní
Obrazovky Vzdáleného uživatelského rozhraní
6867-046
Tato kategorie popisuje běžné obrazovky Vzdáleného uživatelského rozhraní.
Stránka portálu (hlavní stránka)(P. 293)
Stránka [Monitor stavu/Zrušit](P. 295)
Stránka [Nastavení/Uložení](P. 296)
Stránka [Schránka](P. 297)
Stránka [Přímý tisk](P. 298)
Stránka portálu (hlavní stránka)
[Odhlásit se]
Dojde k odhlášení od Vzdáleného uživatelského rozhraní. Zobrazí se přihlašovací obrazovka.
[Odeslat e-mail správci systému]
Zobrazí se okno k vytvoření e-mailu správci systému zadanému v poli [Nastavení správy] v části
[Zabezpečení].
Ikona aktualizace
Aktualizuje právě zobrazenou stránku.
293
Použití Vzdáleného uživatelského rozhraní
Základní informace o zařízení
Zobrazí aktuální stav zařízení a chybové zprávy. Pokud došlo k výskytu chyby, zobrazí se také odkaz na
stránku s informacemi o chybě.
Informace o spotřebním materiálu
Zobrazuje informace o papíru (zbývající množství, velikost atd.) a o stavu tonerových kazet a dalšího
spotřebního materiálu.
Deska hlášení
Zobrazí se zpráva od správce systému zadaná v [Deska hlášení/Odkaz na podporu] pod [Nastavení/Uložení]
[Licence/Jiné].
Odkaz na podporu
Zobrazí odkaz na technickou podporu tiskárny, který je zadán v položce [Deska hlášení/Odkaz na podporu]
pod [Nastavení/Uložení] [Licence/Jiné].
[Monitor stavu/Zrušit]
Zobrazí stránku [Monitor stavu/Zrušit]. Tuto stránku můžete použít ke kontrole aktuálního stavu tisku,
zrušení zpracování tisku a zobrazení historie tiskových úloh.
[Nastavení/Uložení]
Zobrazí se stránka [Nastavení/Uložení]. Pokud jste přihlášeni v režimu správce, můžete měnit nastavení
položek a ukládat/načítat registrovaná data. Nastavení možností nastavení prostřednictvím
uživatelského rozhraní(P. 306)
[Schránka] (pouze když je vložena volitelná karta SD)
Zobrazí stránku [Schránka]. Můžete tisknout a mazat dokumenty uložené v tiskárně.
uloženého v tiskárně (tisk uložené úlohy)(P. 96)
Tisk dokumentu
[Přímý tisk]
Můžete tisknout soubor uložený v počítači, aniž ho musíte otevírat.
(P. 106)
Tisk bez otevření souboru (přímý tisk)
[Služba správy služeb]
Spouští službu Služba správy služeb (SMS), která se používá k správě aplikací MEAP (software na podporu
funkcí). Průvodce funkcemi pro MEAP Application Management
294
Použití Vzdáleného uživatelského rozhraní
Stránka [Monitor stavu/Zrušit]
[Na portál]
Vrátí se na stránku portálu (hlavní stránka)
Nabídka
Kliknete-li na položku, její obsah se zobrazí na pravé stránce.
zařízení(P. 299)
Správa dokumentů a kontrola stavu
Zobrazení cesty
Označuje řadu stránek, které jste postupně otevřeli, než se zobrazila aktuální stránka. Díky tomu můžete
zjistit, na které stránce se přesně nacházíte.
Ikona aktualizace
Aktualizuje právě zobrazenou stránku.
Ikona Nahoru
Umožní přesunout jezdec posuvníku do horní části stránky, pokud se nacházíte v dolní části stránky.
295
Použití Vzdáleného uživatelského rozhraní
Stránka [Nastavení/Uložení]
[Na portál]
Vrátí se na stránku portálu (hlavní stránka)
Nabídka
Kliknete-li na položku, její obsah se zobrazí na pravé stránce.
prostřednictvím uživatelského rozhraní(P. 306)
Nastavení možností nastavení
Zobrazení cesty
Označuje řadu stránek, které jste postupně otevřeli, než se zobrazila aktuální stránka. Díky tomu můžete
zjistit, na které stránce se přesně nacházíte.
Ikona Nahoru
Umožní přesunout jezdec posuvníku do horní části stránky, pokud se nacházíte v dolní části stránky.
Nabídka na stránce [Nastavení/Uložení]
● Nastavení na stránce [Nastavení/Uložení] můžete změnit pouze když jste přihlášení v režimu správce.
● Pokud se přihlásíte v obecném uživatelském režimu, položky [Utility Menu], [Kalibrace], [Ovládání
zařízení], [Správa ID oddělení] a [Import/Export] se nezobrazí.
296
Použití Vzdáleného uživatelského rozhraní
Stránka [Schránka]
[Na portál]
Vrátí se na stránku portálu (hlavní stránka)
[Schránka]
Zobrazí se seznam boxů. Box můžete otevřít a zkontrolovat podrobnosti dokumentů uložených v boxu,
dokumenty vytisknout a vymazat. Tisk dokumentu uloženého v tiskárně (tisk uložené úlohy)(P. 96)
Zobrazení cesty
Označuje řadu stránek, které jste postupně otevřeli, než se zobrazila aktuální stránka. Díky tomu můžete
zjistit, na které stránce se přesně nacházíte.
Ikona aktualizace
Aktualizuje právě zobrazenou stránku.
Číslo boxu
Můžete zadat číslo boxu a kliknout na [Otevřít], čímž otevřete box se zadaným číslem.
Seznam boxů
Můžete kliknout na textový odkaz pod [Číslo schránky] a otevřít příslušný box.
Ikona Nahoru
Umožní přesunout jezdec posuvníku do horní části stránky, pokud se nacházíte v dolní části stránky.
297
Použití Vzdáleného uživatelského rozhraní
Stránka [Přímý tisk]
[Na portál]
Vrátí se na stránku portálu (hlavní stránka)
Nabídka
Zobrazí se stránka pro zadání formátu souboru, který se má vytisknout pomocí funkce přímého tisku.
bez otevření souboru (přímý tisk)(P. 106)
Tisk
Zobrazení cesty
Označuje řadu stránek, které jste postupně otevřeli, než se zobrazila aktuální stránka. Díky tomu můžete
zjistit, na které stránce se přesně nacházíte.
Ikona Nahoru
Umožní přesunout jezdec posuvníku do horní části stránky, pokud se nacházíte v dolní části stránky.
298
Použití Vzdáleného uživatelského rozhraní
Správa dokumentů a kontrola stavu zařízení
6867-047
Kontrola aktuálního stavu tištěných dokumentů(P. 299)
Kontrola historie dokumentů(P. 300)
Kontrola informací o chybách(P. 301)
Kontrola specifikací zařízení(P. 301)
Kontrola informací správce systému(P. 302)
Kontrola celkového počtu výtisků(P. 302)
Kontrola historie tonerových/bubnových kazet(P. 303)
● Název souboru dokument se nemusí zobrazit kompletně. K názvu souboru může být přidán název aplikace
pro tisk.
Kontrola aktuálního stavu tištěných dokumentů
Můžete zkontrolovat stav tisku (právě se tiskne nebo čeká na vytištění) dokumentů určených k tisku z počítače a
dokumenty vymazat nebo jejich tisk přerušit.
Přihlaste se ke Vzdálenému uživatelskému rozhraní ( Spuštění Vzdáleného uživatelského
rozhraní(P. 290) ) [Monitor stavu/Zrušit] [Stav úlohy]
[Zrušit]
Můžete vymazat ty dokumenty, které jsou právě tisknuty nebo které na vytištění čekají.
[Přerušit] *
Dočasně pozastaví aktuálně probíhající tiskovou úlohu a zahájí zadanou tiskovou úlohu. Pro přerušenou
tiskovou úlohu se tisk zbývajících stránek zahájí v okamžiku, kdy se dokončí přerušená tisková úloha.
[Prioritní tisk] *
Posune pořadí dokumentu čekajícího na vytištění nahoru o jedno místo.
299
Použití Vzdáleného uživatelského rozhraní
[Pozastavit] */[Obnovit] *
Stisknutím [Pozastavit] dočasně přerušíte aktuální tiskovou úlohu. Stisknutím [Obnovit] restartujete
pozastavenou tiskovou úlohu.
● V případě zabezpečeného nebo šifrovaného dokumentu se po kliknutí na možnost [Obnovit] zobrazí
obrazovka s výzvou k zadání kódu PIN. Zadejte správný kód PIN a klikněte na možnost [OK].
* Nezobrazí se, když je možnost <Přerušit tisk> v nabídce ovládacího panelu nastavena na <Vyp> (
tisk(P. 328) ).
Přerušit
● Stav všech tiskových úloh je zobrazen bez ohledu na nastavení správy ID oddělení.
● Výchozí nastavení neumožňuje provádění některých operacích v režimu běžného uživatele, například
vymazání dokumentu, který se má tisknout, nebo přerušení tiskové úlohy. Pokud chcete pracovat s
dokumenty v režimu běžného uživatele, přihlaste se v režimu správce a povolte [Povolit proces úlohy
běžného uživatele]. Umožnění manipulace s dokumenty koncovým uživatelům(P. 304)
● Pokud se pomocí svého uživatelského jména přihlásíte v režimu pro běžné uživatele, zobrazí se vaše
uživatelské jméno pouze na dokumentech, které jste vytiskli.
● U pozastavených a zabečených dokumentů kliknutím na tlačítko [Úloha č.] zobrazíte podrobné
informace. Můžete zkontrolovat uživatelské jméno a počet stránek vytištěného dokumentu.
Kontrola historie dokumentů
Historie tisku a historie přijatých e-mailů jsou zobrazeny ve formě seznamu.
Přihlaste se ke Vzdálenému uživatelskému rozhraní ( Spuštění Vzdáleného uživatelského
rozhraní(P. 290) ) [Monitor stavu/Zrušit] [Výpis úlohy]
[Výpis úlohy] (Tisk)
Historii tisku lze zobrazit pro každý typ tisku.
[Výpis úlohy] (E-mail RX)
Zobrazí se historie příjmu e-mailů. Pokud během příjmu e-mailu dojde k chybě, zobrazí se použitelný kód
chyby v [Výsledky PŘ.]. Chybové kódy při přijetí e-mailu(P. 565)
300
Použití Vzdáleného uživatelského rozhraní
[Zobrazit] (pouze historie tisku)
Když z rozbalovacího seznamu vyberete typ tisku a kliknete na [Zobrazit], ve formě seznamu se zobrazí
historie vybraného typu tisku.
● Když je do tiskárny vložena jakákoli volitelná karta SD, historie se vymaže, když se provede vypnutí nebo
reset tiskárny.
● Pokud se do přístroje přihlásíte v obecném uživatelském režimu, když je aktivní funkce [Povolit proces úlohy
běžného uživatele] nezobrazí se název dokumentu pro jiné úlohy, než je ta vaše; místo toho se zobrazí
hvězdičky, například „********“. Umožnění manipulace s dokumenty koncovým uživatelům(P. 304)
Kontrola informací o chybách
Tato stránka se zobrazí, pokud poté, co došlo k chybě, kliknete na stránce portálu (hlavní stránka) na zprávu pod
položkou [Chybová informace]. Stránka portálu (hlavní stránka)(P. 293)
Přihlaste se ke Vzdálenému uživatelskému rozhraní ( Spuštění Vzdáleného uživatelského
rozhraní(P. 290) ) [Monitor stavu/Zrušit] [Chybová informace]
Kontrola specifikací zařízení
Můžete zobrazit informace včetně maximální rychlosti tisku a funkcí tiskárny.
Přihlaste se ke Vzdálenému uživatelskému rozhraní ( Spuštění Vzdáleného uživatelského
rozhraní(P. 290) ) [Monitor stavu/Zrušit] [Funkce zařízení]
301
Použití Vzdáleného uživatelského rozhraní
Kontrola informací správce systému
Zobrazí se informace o zařízení a správci systému. Tyto informace jsou nastaveny v položce [Zabezpečení]
[Nastavení správy] na stránce [Nastavení/Uložení] ( Nastavení hesla správce systému(P. 215) ).
Přihlaste se ke Vzdálenému uživatelskému rozhraní ( Spuštění Vzdáleného uživatelského
rozhraní(P. 290) ) [Monitor stavu/Zrušit] [Informace o zařízení]
Kontrola celkového počtu výtisků
Zobrazí se celkový počet stránek, které byly vytištěny.
302
Použití Vzdáleného uživatelského rozhraní
Přihlaste se ke Vzdálenému uživatelskému rozhraní ( Spuštění Vzdáleného uživatelského
rozhraní(P. 290) ) [Monitor stavu/Zrušit] [Zkontrolovat počitadlo]
Kontrola historie tonerových/bubnových kazet
Můžete zkontrolovat protokoly o použití tonerových kazet a bubnových kazet.
Přihlaste se ke Vzdálenému uživatelskému rozhraní ( Spuštění Vzdáleného uživatelského
rozhraní(P. 290) ) [Monitor stavu/Zrušit] [Protokol kazety]
ODKAZY
Obrazovky Vzdáleného uživatelského rozhraní(P. 293)
303
Použití Vzdáleného uživatelského rozhraní
Umožnění manipulace s dokumenty koncovým
uživatelům
6867-048
Můžete konfigurovat nastavení tak, aby se daly vymazat dokumenty nebo přerušit jejich tisk, i když se přihlásíte ke
Vzdálenému uživatelskému rozhraní v režimu běžného uživatele.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Zabezpečení]
4
Klikněte na tlačítko [Editovat].
[Nastavení správy].
304
Spuštění
Použití Vzdáleného uživatelského rozhraní
5
6
Zadejte heslo správce systému do pole [Aktuální heslo správce systému].
Zaškrtněte políčko [Povolit proces úlohy běžného uživatele] a klikněte na tlačítko
[OK].
[Povolit proces úlohy běžného uživatele]
Pokud zaškrtnete dané políčko, běžní uživatelé budou moci pracovat s dokumenty, u nichž jméno uživatele
odpovídá jménu použitému při přihlášení. Pokud běžným uživatelům nechcete umožnit práci s dokumenty,
zaškrtnutí odstraňte.
ODKAZY
Obrazovky Vzdáleného uživatelského rozhraní(P. 293)
305
Použití Vzdáleného uživatelského rozhraní
Nastavení možností nastavení prostřednictvím
uživatelského rozhraní
6867-049
Prostřednictvím Vzdáleného uživatelského rozhraní můžete změnit různá nastavení zařízení. Většinu nastavení je
možné zadat i prostřednictvím zařízení, existuje však několik nastavení, která lze zadat pouze prostřednictvím
uživatelského rozhraní.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Spuštění
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku nastavení, kterou chcete nastavit, a klikněte na [Editovat].
● Další informace o nabídce nastavení najdete níže u každé položky
Položky nabídky
Odkazy
Možnosti
Nabídka kontroly
Nabídka ovládání(P. 316)
Nastavení zdroje papíru
Nabídka Vybrat podavač(P. 474)
Síť
Síť(P. 336)
306
Použití Vzdáleného uživatelského rozhraní
Položky nabídky
Odkazy
Rozvržení
Rozvržení(P. 357)
Kvalita tisku
Kvalita tisku(P. 361)
Údržba prováděná uživatelem
Uživatelská údržba(P. 379)
Výstup/kontrola
Nabídka nástrojů
Tisk hlášení a seznamů(P. 523)
Nabídka Úloha(P. 470)
Kalibrace
Oprava neshody barev a odstínů(P. 517)
Ovládání zařízení
Můžete ovládat stav tiskárny.
Tlačítko Online(P. 27)
Jemný reset(P. 472)
Přepnutí do režimu spánku(P. 67)
Nastavení správy
Správa ID oddělení
Nastavení správy ID oddělení(P. 218)
Zabezpečení
Zabezpečení(P. 210)
Import/Export
Ukládání/načtení registrovaných dat(P. 308)
Licence/další
● Můžete změnit zprávy zobrazené na desce zpráv a odkaz na stránku podpory,
které jsou zobrazeny na stránce portálu (hlavní stránka).
● Software můžete registrovat nebo aktualizovat ( Průvodce funkcemi pro
registraci a aktualizaci software ).
● V některých zemích či oblastech nemusí být možné tuto funkci použít.
ODKAZY
Obrazovky Vzdáleného uživatelského rozhraní(P. 293)
Nastavení seznamu nabídky(P. 314)
307
Použití Vzdáleného uživatelského rozhraní
Ukládání/načtení registrovaných dat
6867-04A
Data v možnostech nastavení, která jsou registrována v zařízení, je možné uložit do počítače (exportovat). Data, která
jsou uložena v počítači, je také možné registrovat v zařízení (importovat). Data exportovaná z daného zařízení lze
importovat do jiného zařízení stejného modelu. Různá nastavení lze tedy snadno kopírovat do více zařízení. K použití
těchto funkcí je nutné přihlásit se v režimu správce.
Ukládání registrovaných dat(P. 309)
Načtení registrovaných dat(P. 311)
Dokud se import/export nedokončí, zařízení nevypínejte
● Proces může trvat několik minut. Pokud zařízení v průběhu procesu vypnete, může dojít k poškození dat
nebo zařízení.
Během exportu/importu zařízení neovládejte
● Před spuštěním exportu/importu zkontrolujte, zda neprobíhají žádné operace, např. tisk dokumentů.
Import/export pomocí ovládacího panelu
● Můžete si také uložit/načíst data nastavení pomocí paměťového zařízení USB použitím ovládacího panelu
zařízení. Nast. import/export(P. 401)
308
Použití Vzdáleného uživatelského rozhraní
Ukládání registrovaných dat
6867-04C
Můžete exportovat data o nastavení zařízení a uložit je do počítače. Důležitá nastavení doporučujeme pravidelně
zálohovat.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Import/Export]
4
Vyberte nastavení, která chcete exportovat, a nastavte heslo šifrování.
[Export].
309
Spuštění
Použití Vzdáleného uživatelského rozhraní
[Nastavení/Uložení základních informací]
Pokud chcete exportovat data nastavení položek, které lze odeslat z možnosti [Nastavení/Uložení] na stránce
portálu, zaškrtněte toto políčko.
[Informace o nastavení aplikace MEAP]
Toto políčko zaškrtněte, chcete-li exportovat data nastavení aplikací MEAP.
[Všechny informace o nastavení PDL]
Chcete-li exportovat data nastavení položek, které lze nastavit z
tisku(P. 409) , zaškrtněte toto políčko.
Nastavení specifická pro režim
[Heslo šifrování]
Zadejte heslo pro šifrování dat určených k exportu, pomocí znaků. Zadejte stejné heslo do pole [Potvrdit].
Pokud není nastaveno žádné heslo, export dat není možný.
● Heslo je požadováno, když se importují exportovaná data.
5
6
Načtení registrovaných dat(P. 311)
Klikněte na tlačítko [Spustit export].
Podle pokynů na obrazovce zadejte umístění, do kterého mají být exportovaná data
nastavení uložena.
➠ Data nastavení se uloží.
ODKAZY
Obrazovky Vzdáleného uživatelského rozhraní(P. 293)
Nastavení seznamu nabídky(P. 314)
310
Použití Vzdáleného uživatelského rozhraní
Načtení registrovaných dat
6867-04E
Načtěte (importujte) data, která byla ze zařízení exportována. Můžete rovněž importovat nastavení z jiného zařízení,
musí se však jednat o stejný model.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Import/Export]
4
Zadejte soubor nastavení, který má být importován, a zadejte heslo.
[Import].
311
Spuštění
Použití Vzdáleného uživatelského rozhraní
[Cesta k souboru]
Klikněte na možnost [Procházet] a vyberte soubor.
[Heslo pro odšifrování]
Zadejte heslo nastavené, když byla nastavení exportována.
5
Klikněte na tlačítko [Spustit import].
6
Klikněte na tlačítko [OK].
➠ Zadaná data pro nastavení budou importována do zařízení.
7
Klikněte na tlačítko [Restart].
➠ Nastavení se po restartování zařízení povolí.
ODKAZY
Obrazovky Vzdáleného uživatelského rozhraní(P. 293)
Nastavení seznamu nabídky(P. 314)
312
Nastavení seznamu nabídky
Nastavení seznamu nabídky
Nastavení seznamu nabídky ................................................................................................................... 314
Nabídka nastavení ............................................................................................................................................ 315
Nabídka ovládání .......................................................................................................................................... 316
Zdroj papíru .................................................................................................................................................. 335
Síť ................................................................................................................................................................. 336
Rozvržení ...................................................................................................................................................... 357
Kvalita tisku .................................................................................................................................................. 361
Rozhraní ....................................................................................................................................................... 376
Uživatelská údržba ....................................................................................................................................... 379
Priorita položek nabídky nastavení ........................................................................................................ 406
Režim tisku ................................................................................................................................................... 407
Nastavení specifická pro režim tisku ............................................................................................................. 409
UFR II ..................................................................................................................................................... 410
PCL ........................................................................................................................................................ 411
Zobrazování ........................................................................................................................................... 417
XPS ........................................................................................................................................................ 427
PDF ........................................................................................................................................................ 438
PS .......................................................................................................................................................... 449
Nastavení MEAP ........................................................................................................................................... 459
Zkontrol. počitadlo ....................................................................................................................................... 461
Inicializace nabídky ....................................................................................................................................... 463
Utility Menu ....................................................................................................................................................... 464
Nabídka Úloha ................................................................................................................................................... 470
Nabídka Resetovat ............................................................................................................................................ 472
Nabídka Vybrat podavač ................................................................................................................................... 474
313
Nastavení seznamu nabídky
Nastavení seznamu nabídky
6867-04F
Toto zařízení zahrnuje různá nastavení. Každé nastavení můžete podrobně upravit. Zadejte nastavení z obrazovek
nabídky na ovládacím panelu.
POZNÁMKA
Priorita nastavení
● Nastavení zadaná v ovladači tiskárny mají přednost před
nastaveními zadanými na ovládacím panelu.
● Když provádíte Přímý tisk z USB nebo Přímý tisk, nastavení
zadaná pro tisk nebo uložená v datech TIFF mají přednost
před nastaveními zadanými na ovládacím panelu.
● Nabídku nastavení můžete vytisknout ve formě seznamu a zkontrolovat aktuální nastavení:
Konfigurační stránka(P. 465)
Tisk stavu sítě(P. 465)
314
Nastavení seznamu nabídky
Nabídka nastavení
6867-04H
Tato nastavení můžete zadat pro ovládací prostředí tiskárny a pro tisk. Když na
ovládacím panelu stisknete
(
), objeví se nabídka Nastavení a ukážou se
nastavované položky pod každou položkou příslušné funkce.
Nabídka ovládání(P. 316)
Zdroj papíru(P. 335)
Síť(P. 336)
Rozvržení(P. 357)
Kvalita tisku(P. 361)
Rozhraní(P. 376)
Uživatelská údržba(P. 379)
Režim tisku(P. 407)
Nastavení specifická pro režim tisku(P. 409)
Nastavení MEAP(P. 459)
Zkontrol. počitadlo(P. 461)
Inicializace nabídky(P. 463)
315
Nastavení seznamu nabídky
Nabídka ovládání
6867-04J
Nastavení týkající se režimu spánku a toho, jak se tiskárna má chovat pokud dojde k
chybě, jsou uvedena s krátkým popisem. Výchozí nastavení jsou označena křížkem
( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na používaných volitelných
možnostech nebo dalších položkách nastavení.
Režim spánku(P. 316)
Spánek i při chybě(P. 317)
Prior Eko při hl.sp.(P. 317)
Auto. čas spánku(P. 317)
Spánek při použ. USB(P. 318)
Nastavení časovače(P. 318)
Auto.přeskočit chybu(P. 320)
Jazyk(P. 320)
Výstraha(P. 320)
Zobrazit varování(P. 321)
Akce po upozornění(P. 324)
Nastavení data/času(P. 326)
Rychlé spušt.hl.nap.(P. 328)
Karta SD(P. 328)
Přerušit tisk(P. 328)
Čas vym.zabezp.tisku(P. 329)
Výpis zabez. úlohy(P. 329)
OS PC připoj. s USB(P. 329)
Výběr PDL (PnP)(P. 330)
Správa nastavení(P. 330)
RMT-SW(P. 331)
Upravit obrazovku(P. 331)
Animované instrukce(P. 332)
Zobraz. měrku toneru(P. 332)
Ozn. o dokonč. nast.(P. 332)
Zkontr. nast. papíru(P. 333)
Rychlost posunu(P. 333)
Canon Genuine Mode(P. 333)
Režim spánku
Funkce režimu spánku snižuje spotřebu energie tiskárny tak, že se dočasně zastaví některé vnitřní operace. Zadejte
úroveň režimu spánku. Přepnutí do režimu spánku(P. 67)
Vysoká (Hlub.spánek)
Stř. (spánek tisk.)
Úrovně režimu spánku
● Účinek snížení spotřeby energie je menší u <Stř. (spánek tisk.)> a větší u <Vysoká (Hlub.spánek)>.
Pokud používáte obslužný software související se sítí
● Pokud nastavíte režim spánku na <Vysoká (Hlub.spánek)>, může nastat chyba v komunikaci u obslužného
softwaru.
316
Nastavení seznamu nabídky
Spánek i při chybě
Zadejte, zda se má tiskárna automaticky převést do režimu spánku, když dojde k chybě.
Vyp
Zap
(
)
<Nabídka ovládání>
<Spánek i při chybě>
<Vyp> nebo <Zap>
Prior Eko při hl.sp.
Vyberte, pokud chcete dále snížit spotřebu energie, pokud jsou zařízení a počítač připojeny pomocí portu USB.
Vyp
Zap
(
)
<Nabídka ovládání>
<Prior Eko při hl.sp.>
<Vyp> nebo <Zap>
● Je možné, že když provedete operaci pro provedení tisku, když je tato položka nastavena na <Zap>,
zařízení neopustí režim spánku. V tom případě stiskněte
pro ukončení režimu spánku.
Auto. čas spánku
Pokud je zařízení po zadanou dobu bez obsluhy nebo nemá tisknout žádná data, s ohledem na úsporu energie přejde
do režimu spánku (automatické přepnutí do režimu spánku). Zadejte dobu, po které zařízení automaticky přejde do
režimu spánku. V zájmu maximální úspory energie doporučujeme používat výchozí tovární nastavení. Přepnutí do
režimu spánku(P. 67)
1 min.
5 min.
10 min.
15 min.
30 min.
60 min.
317
Nastavení seznamu nabídky
Spánek při použ. USB *
Zadejte, zda tiskárně umožnit přepnutí do režimu spánku, když používáte USB přes NW pro přístup k zařízení USB z
počítače přes síť. Nast. pokr. funkcí(P. 376)
Nepovolit
Povolit
(
)
<Nabídka ovládání>
<Spánek při použ. USB>
<Nepovolit> nebo
<Povolit>
Nastavení časovače
Můžete zadat nastavení pro funkce tiskárny a čas pro přepnutí do režimu spánku a pro funkci automatického resetu,
která se zobrazuje na hlavní obrazovce, pokud není po danou dobu stisknuta žádná klávesa.
Časovač probuzení
Zadejte, zda se má tiskárna z režimu spánku automaticky probudit po uplynutí zadané doby.
režimu spánku(P. 67)
Přepnutí do
Vyp
Zap
Čas probuzení
Nastavte čas, kdy se má režim spánku automaticky ukončit, pokud je položka <Časovač probuzení> nastavena
na <Zap>. Přepnutí do režimu spánku(P. 67)
00:00 až 12:00
až 23:59
Čas auto. resetu
Pokud se po zadanou dobu nestiskne žádné tlačítko, obrazovka aktuální nabídky se automaticky přepne na
hlavní obrazovku a tiskárna se vrátí do režimu online (automatické resetování). Zadejte interval, v jakém se bude
provádět automatické resetování. Vyberte <Vyp>, čímž funkci automatického resetování zakážete.
Vyp
10 s.
20 s.
30 s.
40 s.
50 s.
1 min.
2 min.
3 min.
4 min.
5 min.
6 min.
7 min.
8 min.
318
Nastavení seznamu nabídky
9 min.
(
)
resetu>
<Nabídka ovládání>
<Nastavení časovače>
<Čas auto.
Vyberte čas
Časovač spánku
Zadejte, zda se má tiskárna automaticky uvést do režimu spánku po uplynutí zadané doby.
režimu spánku(P. 67)
Přepnutí do
Vyp
Zap
Čas spánku
Nastavte čas přechodu do režimu spánku, pokud je možnost <Časovač spánku> nastavena na <Zap>.
Přepnutí do režimu spánku(P. 67)
00:00 až 12:00
až 23:59
Časovač kalibrace
Vyberte, zda chcete automaticky provést kalibraci v zadanou dobu.
Vyp
Zap
(
)
kalibrace>
<Nabídka ovládání>
<Nastavení časovače>
<Časovač
<Vyp> nebo <Zap>
Čas kalibrace
Nastavte čas provedení kalibrace, pokud je možnost <Časovač kalibrace> nastavena na <Zap>.
00:00 až 12:00
až 23:59
(
kalibrace>
)
<Nabídka ovládání>
<Nastavení časovače>
Nastavte čas
319
<Čas
Nastavení seznamu nabídky
Auto.přeskočit chybu
Pokud během tisku dojde k chybě, tisk se zastaví. Pokud chcete pokračovat v tisku, i když dojde k chybě, zadejte <Zap>.
Informace o chybách, během kterých může aktuální tisková úloha pokračovat s tímto nastavením, naleznete v kapitole
„Odstraňování problémů (FAQ)“ na webové stránce online manuálu.
Vyp
Zap
(
)
<Nabídka ovládání>
<Auto.přeskočit chybu>
<Vyp> nebo <Zap>
Jazyk
Můžete změnit jazyk zobrazený na obrazovce ovládacího panelu, přihlašovací obrazovce vzdáleného uživatelského
rozhraní a v seznamech nastavení.
Čeština
Dansk
Deutsch
English
Español
Français
Italiano
Magyar
Nederlands
Norsk
Polski
Português
Русский
Suomi
Svenska
Türkçe
中文(简体)
한국어
(
)
<Nabídka ovládání>
<Jazyk>
Vyberte jazyk
Výstraha
Vyberte, zda má zařízení pípnout, když dojde k potížím, jako je uvíznutí papíru nebo chyba operace.
Vyp
320
Nastavení seznamu nabídky
Zap
(
)
<Nabídka ovládání>
<Výstraha>
<Vyp> nebo <Zap>
Zobrazit varování
Vyberte, zda se má informovat o varování pomocí zprávy, když se tiskárna dostane do stavu varování.
Upoz. toner. kazety
Vyberte, zda se má zobrazit příslušná zpráva, když se přiblíží čas výměny tonerové kazety.
Vyp
Zap
(
)
kazety>
<Nabídka ovládání>
<Zobrazit varování>
<Upoz. toner.
<Vyp> nebo <Zap>
Konec živ. ton. kaz.
Vyberte, zda se má zobrazit příslušná zpráva, když tonerová kazeta dosáhne konce životnosti.
Vyp
Zap
(
)
kaz.>
<Nabídka ovládání>
<Zobrazit varování>
<Konec živ. ton.
<Vyp> nebo <Zap>
Upoz. bubn. kazety
Vyberte, zda se má zobrazit příslušná zpráva, když se přiblíží čas výměny bubnové kazety.
Vyp
Zap
(
kazety>
)
<Nabídka ovládání>
<Zobrazit varování>
<Vyp> nebo <Zap>
321
<Upoz. bubn.
Nastavení seznamu nabídky
Konec živ. bubn. kaz
Vyberte, zda se má zobrazit příslušná zpráva, když bubnová kazeta dosáhne konce životnosti.
Vyp
Zap
(
)
<Nabídka ovládání>
<Zobrazit varování>
<Konec živ. bubn.
<Vyp> nebo <Zap>
kaz>
Upoz. fix. jednotky
Vyberte, zda se má zobrazit příslušná zpráva, když se přiblíží čas výměny fixační jednotky.
Vyp
Zap
(
)
<Nabídka ovládání>
<Zobrazit varování>
<Upoz. fix.
<Vyp> nebo <Zap>
jednotky>
Upoz. jednotky ITB
Vyberte, zda se má zobrazit příslušná zpráva, když se přiblíží čas výměny jednotky ITB.
Vyp
Zap
(
)
ITB>
<Nabídka ovládání>
<Zobrazit varování>
<Upoz. jednotky
<Vyp> nebo <Zap>
Upoz. odpad. toneru
Vyberte, zda se má zobrazit příslušná zpráva, když se přiblíží čas výměny zásobníku odpadního toneru.
Vyp
Zap
(
toneru>
)
<Nabídka ovládání>
<Zobrazit varování>
<Vyp> nebo <Zap>
322
<Upoz. odpad.
Nastavení seznamu nabídky
Zkon/vym 2. přen vál
Vyberte, zda se má zobrazit příslušná zpráva, když se přiblíží čas výměny sekundárního vnějšího přenosového
válce.
Vyp
Zap
(
)
vál>
<Nabídka ovládání>
<Zobrazit varování>
<Zkon/vym 2. přen
<Vyp> nebo <Zap>
Zkon/vym pod/výs vál
Vyberte, zda se má zobrazit příslušná zpráva, když se přiblíží čas výměny válce podavače.
Vyp
Zap
(
)
vál>
<Nabídka ovládání>
<Zobrazit varování>
<Zkon/vym pod/výs
<Vyp> nebo <Zap>
Konec živ. fix. jed.
Vyberte, zda se má zobrazit příslušná zpráva, když fixační jednotka dosáhne konce životnosti.
Vyp
Zap
(
jed.>
)
<Nabídka ovládání>
<Zobrazit varování>
<Konec živ. fix.
<Vyp> nebo <Zap>
Konec živ. jed. ITB
Vyberte, zda se má zobrazit příslušná zpráva, když jednotka ITB dosáhne konce životnosti.
Vyp
Zap
323
Nastavení seznamu nabídky
(
)
ITB>
<Nabídka ovládání>
<Zobrazit varování>
<Konec živ. jed.
<Vyp> nebo <Zap>
Zásuvka prázdná
Zadejte, zda se má zobrazit příslušná zpráva, když v zásuvce na papír dojde papír.
Vyp
Zap
(
)
prázdná>
<Nabídka ovládání>
<Zobrazit varování>
<Zásuvka
<Vyp> nebo <Zap>
Chyba přen. e-mailu
Vyberte, zda se má zobrazit příslušná zpráva. když během tisku e-mailu dojde ke komunikační chybě.
Vyp
Zap
(
)
mailu>
<Nabídka ovládání>
<Zobrazit varování>
<Chyba přen. e-
<Vyp> nebo <Zap>
Akce po upozornění
Určete, jak se má zařízení chovat, když se zobrazí zpráva o životnosti spotřebního materiálu.
Upoz. toner. kazety
Vyberte, zda se má tisková kazeta automaticky zastavit, jakmile se tonerová kazeta přiblíží ke konci své
životnosti.
Pokračovat v tisku
Zastavit tisk
(
kazety>
)
<Nabídka ovládání>
<Akce po upozornění>
<Pokračovat v tisku> nebo <Zastavit tisk>
324
<Upoz. toner.
Nastavení seznamu nabídky
<Pokračovat v tisku>
Když se přiblíží čas výměny tonerové kazety, zobrazí se zpráva <Blíží se konec životnosti tonerové kazety X.>,
ale tisk může pokračovat.
<Zastavit tisk>
Když se přiblíží čas výměny tonerové kazety, zobrazí se zpráva <Blíží se konec životnosti tonerové kazety X.>
a tisk je dočasně zastaven. Chcete-li pokračovat v tisku, stiskněte
(
).
● „X“ ve výše uvedené zprávě představuje barvu CMYK.
Upoz. bubn. kazety
Vyberte, zda se má tisk automaticky zastavit, když se přiblíží čas výměny bubnové kazety.
Pokračovat v tisku
Zastavit tisk
(
)
kazety>
<Nabídka ovládání>
<Akce po upozornění>
<Upoz. bubn.
<Pokračovat v tisku> nebo <Zastavit tisk>
<Pokračovat v tisku>
Když se přiblíží čas výměny bubnové kazety, zobrazí se zpráva <Blíží se konec životnosti bubnové kazety N.>,
ale tisk může pokračovat.
<Zastavit tisk>
Když se přiblíží čas výměny bubnové kazety, zobrazí se zpráva <Blíží se konec životnosti bubnové kazety N.>
(
).
a tisk je dočasně zastaven. Chcete-li pokračovat v tisku, stiskněte
● „N“ ve výše uvedené zprávě představuje číslo 1 až 4.
Upoz. odpad. toneru
Vyberte, zda se má tisk automaticky zastavit, když se přiblíží čas výměny zásobníku odpadního toneru.
325
Nastavení seznamu nabídky
Pokračovat v tisku
Zastavit tisk
(
)
toneru>
<Nabídka ovládání>
<Akce po upozornění>
<Upoz. odpad.
<Pokračovat v tisku> nebo <Zastavit tisk>
<Pokračovat v tisku>
Když se přiblíží čas výměny zásobníku odpadního toneru, zobrazí se zpráva <Vyměňte brzy zásobník
odpadního toneru.>, ale tisk může pokračovat.
<Zastavit tisk>
Když se přiblíží čas výměny zásobníku odpadního toneru, zobrazí se zpráva <Vyměňte brzy zásobník
odpadního toneru.> a tisk je dočasně zastaven. Chcete-li pokračovat v tisku, stiskněte
(
).
Nastavení data/času
Nastavte aktuální datum a čas.
Datum
Nastavte aktuální datum v pořadí rok, měsíc a den. Pomocí tlačítek
číselných tlačítek zadejte datum.
/
posunujte kurzor a pomocí
01/01 2001 až 31/12 2030
(
času>
)
<Nabídka ovládání>
<Datum>
<Nastavení data/
Nastavte datum
Čas (24 hodin)
Zadejte aktuální čas ve 24hodinovém formátu. Pomocí tlačítek
tlačítky zadejte čas.
00:00:00 až 23:59:59
326
/
přesuňte kurzor a poté číselnými
Nastavení seznamu nabídky
(
)
<Nabídka ovládání>
<Nastavení data/času>
<Čas (24
<Nabídka ovládání>
<Nastavení data/času>
<Letní
Zkontrolujte zprávu
<Nastavení DST>
hodin)>
Nastavte čas
Letní čas
Zadejte nastavení pro letní čas.
Nastavení DST
Určuje, zda se má nastavit letní čas.
Vyp
Zap
(
)
čas>
<Zap>
Proveďte tvrdý reset (
<Vyp> nebo
Provedení tvrdého resetu(P. 472) )
Počáteční datum/čas
Určuje počáteční datum a čas letního času.
Měsíc
Týden
Den
Čas (24 hodin)
(
)
<Nabídka ovládání>
<Nastavení data/času>
<Letní
čas>
Zkontrolujte zprávu
<Počáteční datum/čas>
Nastavte datum a
čas
Proveďte tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Koncové datum/čas
Určuje koncové datum a čas letního času.
Měsíc
Týden
Den
Čas (24 hodin)
327
Nastavení seznamu nabídky
(
)
<Nabídka ovládání>
<Nastavení data/času>
čas>
Zkontrolujte zprávu
<Koncové datum/čas>
čas
Proveďte tvrdý reset (
<Letní
Nastavte datum a
Provedení tvrdého resetu(P. 472) )
Časová zóna
Udává časové pásmo podle regionu, kde se tiskárna používá.
GMT-12:00 až GREEN. CAS 0:00
(
)
až GMT+12:00
<Nabídka ovládání>
Zkontrolujte zprávu
<Nastavení data/času>
Nastavte časové pásmo
<Časová zóna>
Proveďte tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Rychlé spušt.hl.nap.
Pokud zadáte nastavení rychlého startu, můžete zkrátit dobu od zapnutí hlavního vypínače do doby, kdy jsou
obrazovky funkční. Rychlé spuštění tiskárny(P. 38)
Vyp
Zap
Karta SD *
Aktivujte nebo deaktivujte kartu SD.
Vyp
Zap
(
)
<Nabídka ovládání>
zprávu
<Karta SD>
<Vyp> nebo <Zap>
Zkontrolujte
Proveďte tvrdý reset (
resetu(P. 472) )
Přerušit tisk *
Vyberte, zda chcete povolit použití funkce Přerušení tisku.
Vyp
Zap
328
Provedení tvrdého
Nastavení seznamu nabídky
(
)
<Nabídka ovládání>
<Přerušit tisk>
<Vyp> nebo <Zap>
Čas vym.zabezp.tisku *
Nastavte čas, do kdy se mají zabezpečené dokumenty uložené v tiskárně smazat.
zabezpečených dokumentů(P. 94)
Změna doby platnosti
1 hod.
2 hod.
3 hod.
6 hod.
12 hod.
24 hod.
Výpis zabez. úlohy *
V závislosti na načasování vypnutí nemusí být vygenerován tiskový protokol a celkový počet vytištěných stránek nemusí
být spočítán. Pokud tuto funkci nastavíte na <Zap>, bude se určitě generovat tisk protokolu a celkový počet vytištěných
stránek. Rychlost tisku se však může snížit.
Vyp
Zap
(
)
<Nabídka ovládání>
zprávu
<Výpis zabez. úlohy>
<Vyp> nebo <Zap>
Proveďte tvrdý reset (
Zkontrolujte
Provedení tvrdého
resetu(P. 472) )
OS PC připoj. s USB
Vyberte operační systém počítače, který se připojuje k zařízení přes rozhraní USB.
Mac OS
Windows
Jiný
● Nastavení zařízení musí odpovídat operačnímu systému počítače. Jinak počítač nerozpozná zařízení
správně.
● Jestliže váš počítač používá operační systém OS X 10.10 nebo starší a chcete tisknout z ovladače
tiskárny pomocí USB, nastavte tuto položku na možnost <Jiný>.
329
Nastavení seznamu nabídky
(
)
<Nabídka ovládání>
<OS PC připoj. s USB>
Zkontrolujte zprávu
Vyberte operační systém počítače, který se má připojit k zařízení
Tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Výběr PDL (PnP)
Zadejte ovladač tiskárny, který se má nainstalovat, když se tiskárna připojí k počítači prostřednictvím USB nebo se
vyhledá pomocí sítě WSD.
UFR II
UFR II (V4)
PCL6
PCL6 (V4)
PS3
XPS (Přímé)
(
)
<Nabídka ovládání>
<Výběr PDL (PnP)>
Zadejte jazyk popisu stránky
Proveďte tvrdý reset (
Zkontrolujte zprávu
Provedení tvrdého
resetu(P. 472) )
Správa nastavení
Zadejte, zda se má omezit použití klávesa
(
) na ovládacím panelu zabraňuje libovolným změnám nastavení.
Zámek tl. Nastavení
Pokud zadáte <Zap>, nabídka nastavení není funkční, i když se stiskne tlačítko
(
).
Vyp
Zap
(
)
Nastavení>
<Nabídka ovládání>
<Správa nastavení>
Zkontrolujte zprávu
<Zámek tl.
<Vyp> nebo <Zap>
● Pokud vyberete <Zap>, klávesu nastavení lze odemknout pouze ze vzdáleného uživatelského rozhraní.
Omezení funkcí ovládacího panelu(P. 246)
330
Nastavení seznamu nabídky
RMT-SW
Pomocí zařízení nechte tuto položku nastavenou na <Off>. Můžete být požádáni o změnu nastavení na <On>, aby
servisní zástupce společnosti Canon mohl na zařízení provést vzdálenou údržbu.
Off
On
(
)
<Nabídka ovládání>
<RMT-SW>
<Off> nebo <On>
Upravit obrazovku
Můžete upravit kontrast a jas displeje.
Kontrast
Upravte kontrast (rozdíl v jasu mezi světlými a tmavými oblastmi) displeje podle instalačního umístění zařízení.
-3 až 0
až +3
(
)
<Nabídka ovládání>
obrazovku>
<Upravit
<Kontrast>
Použitím tlačítka
/
lze upravit kontrast
Úprava kontrastu
Nastavením hodnoty „+“ se obrazovka rozjasní. Nastavením hodnoty „-“ obrazovka ztmavne.
Jas pozadí
Výběrem ze tří úrovní upravte jas podsvícení displeje. Volbou <Vyp> podsvícení vypnete.
Vyp
Úroveň 1
Úroveň 2
Úroveň 3
331
Nastavení seznamu nabídky
(
)
<Nabídka ovládání>
pozadí>
<Upravit obrazovku>
<Jas
Zadejte úroveň jasu
Animované instrukce
Vyberte, zda na obrazovce zobrazit animované instrukce, když dojde k zachycení papíru nebo když vyměníte tonerové
kazety atp.
Vyp
Zap
(
)
<Nabídka ovládání>
<Animované instrukce>
<Vyp> nebo <Zap>
Zobraz. měrku toneru
Vyberte, zda se má v pravém dolním rohu displeje zobrazovat ikona indikátoru stavu tonerové kazety.
Vyp
Zap
(
)
<Nabídka ovládání>
<Zobraz. měrku toneru>
Ozn. o dokonč. nast.
Zadejte dobu v sekundách, po kterou se má zobrazovat zpráva, když se změní
nastavení. Pokud zadáte <Vyp>, zpráva se již nebude zobrazovat.
Vyp
1 s.
2 s.
3 s.
332
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
(
)
<Nabídka ovládání>
<Ozn. o dokonč. nast.>
Zadejte počet
sekund
Zkontr. nast. papíru
Vyberte, zda se má při nastavení zásobníku papíru zobrazit zpráva s výzvou ke kontrole nastavení papíru.
Vyp
Zap
(
)
<Nabídka ovládání>
<Zkontr. nast. papíru>
<Vyp> nebo <Zap>
Rychlost posunu
Nastavte rychlost posunování znaků na displeji zprava doleva výběrem ze tří úrovní.
Pomalá
Normální
Rychlá
(
)
<Nabídka ovládání>
<Rychlost posunu>
Vyberte rychlost
Canon Genuine Mode
Režim, při kterém jsou používány originální tonerové kazety Canon.
Vyp
Zap
(
)
<Nabídka ovládání>
<Canon Genuine Mode>
<Zap>
333
<Vyp> nebo
Nastavení seznamu nabídky
● V případě potřeby může nastavení změnit zástupce servisu. Pokud není tato položka zobrazena, kontaktujte
správce stroje.
334
Nastavení seznamu nabídky
Zdroj papíru
6867-04K
Viz část
Nabídka Vybrat podavač(P. 474) .
335
Nastavení seznamu nabídky
Síť
6867-04L
Všechna nastavení týkající se sítě jsou uvedena s krátkým popisem. Výchozí
nastavení jsou označena křížkem ( ).
Pokud se nezobrazí zpráva <Síť>
● Pokud je možnost <Síť> pod <Výběr rozhraní> nastavena na <Vyp>, <Síť> se v nabídce nastavení nezobrazí.
Výběr rozhraní(P. 376)
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na používaných volitelných
možnostech nebo dalších položkách nastavení.
Nastavení TCP/IP(P. 336)
Mopria(P. 347)
Google Cloud Print(P. 348)
SMB(P. 348)
Nastavení SNMP(P. 349)
Spooler(P. 351)
Přijímat paralelně(P. 351)
Čekání při spuštění(P. 351)
Nastavení vzdál. UR(P. 351)
Registr/aktual SW(P. 352)
Ovladač ethernetu(P. 352)
Priorita rež. spánku(P. 353)
IEEE802.1X(P. 354)
Filtr adresy(P. 354)
Adresa MAC(P. 354)
Nast. tisku e-mailu(P. 355)
Sledovací služba(P. 356)
Inic. síť. nastavení(P. 356)
Nastavení TCP/IP
Zadejte nastavení týkající se používání zařízení v síti TCP/IP, například nastavení IP adresy.
Nastavení IPv4
Zadejte nastavení týkající se používání zařízení v síti IPv4.
IPv4
Povolte nebo zakažte na tiskárně funkci IPv4.
Vyp
Zap
(
IPv4>
)
<Síť>
<IPv4>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
tvrdého resetu(P. 472) )
336
<Nastavení TCP/IP>
Proveďte tvrdý reset (
<Nastavení
Provedení
Nastavení seznamu nabídky
Režim IP
Vyberte způsob nastavení IP adresy.
Nastavení adresy IPv4(P. 151)
Auto
Ruční
Protokol *
Vyberte protokol, který chcete použít, když je možnost <Režim IP> nastavena na <Auto>. Pokud vybraný
protokol nastavíte na <Zap>, další dva protokoly se automaticky nastaví na <Vyp>. Nastavení adresy
IPv4(P. 151)
Použít DHCP
Vyp
Zap
Použít BOOTP
Vyp
Zap
Použít RARP
Vyp
Zap
Auto. adresa IP *
Vyberte, zda se má adresa IP získávat automaticky. Zadejte <Zap> když je možnost <Režim IP> nastaven na
<Auto>. Nastavení adresy IPv4(P. 151)
Vyp
Zap
Nastavení adresy IP
Nakonfigurujte IP adresu používanou k identifikaci zařízení, například počítačů a tiskáren, v síti TCP/IP.
Nastavení adresy IPv4(P. 151)
IP adresa
0.0.0.0
na 255.255.255.255
Maska podsítě
0.0.0.0
na 255.255.255.255
Adresa brány
0.0.0.0
na 255.255.255.255
DNS
Zadejte nastavení pro adresu serveru Domain Name System (DNS), která poskytuje jméno hostitele pro
/
posunujte kurzor a pomocí číselných tlačítek zadejte adresu. Pomocí
rozlišení IP adresy. Pomocí
vzdáleného uživatelského rozhraní zadejte jiná nastavení pro DNS. Konfigurace služby DNS(P. 181)
Primární adresa
0.0.0.0
na 255.255.255.255
337
Nastavení seznamu nabídky
Sekundární adresa
0.0.0.0
na 255.255.255.255
(
)
<Síť>
Zkontrolujte zprávu
<DNS>
IPv4>
adresu
<Nastavení TCP/IP>
Vyberte server, který chcete konfigurovat
Proveďte tvrdý reset (
<Nastavení
Zadejte
Provedení tvrdého resetu(P. 472) )
Nastavení mDNS *
Zadejte nastavení používání funkce DNS bez serverů DNS.
Konfigurace služby DNS(P. 181)
mDNS
Vyp
Zap
(
)
<Síť>
Přečtěte si zprávu
IPv4>
<Nastavení mDNS>
tvrdý reset (
Provedení tvrdého resetu(P. 472) )
<Nastavení TCP/IP>
<mDNS>
<Vyp> nebo <Zap>
<Nastavení
Proveďte
Název mDNS *
Pokud je možnost <mDNS> nastavena na <Zap>, nastavte tuto položku.
(
)
IPv4>
<Síť>
Přečtěte si zprávu
<Nastavení mDNS>
Proveďte tvrdý reset (
<Nastavení TCP/IP>
<Název mDNS>
<Nastavení
Nastavte název
Provedení tvrdého resetu(P. 472) )
Možnost DHCP
Když je povoleno DHCP, vyberte, zda se má získat název hostitele a zda se má pomocí možností DHCP
provádět dynamická aktualizace DNS.
Získat jm. hostitele
Vyp
Zap
Dynamická aktual.DNS
Vyp
Zap
338
Nastavení seznamu nabídky
(
)
IPv4>
<Síť>
Zkontrolujte zprávu
<Možnost DHCP>
<Nastavení
<Získat jm. hostitele> nebo <Dynamická
<Vyp> nebo <Zap>
aktual.DNS>
<Nastavení TCP/IP>
Proveďte tvrdý reset (
Provedení tvrdého
resetu(P. 472) )
Nastavení IPv6
Vyberte, zda se má tiskárna používat v síti IPv6. Pomocí Vzdáleného uživatelského rozhraní můžete zadat
nastavení adresy IPv6. Nastavení adres IPv6(P. 155)
IPv6
Povolte nebo zakažte na tiskárně funkci IPv6.
Vyp
Zap
(
)
IPv6>
<Síť>
<IPv6>
Zkontrolujte zprávu
<Nastavení TCP/IP>
<Vyp> nebo <Zap>
Proveďte tvrdý reset (
<Nastavení
Provedení
tvrdého resetu(P. 472) )
Nastavení mDNS *
Zadejte nastavení používání funkce DNS bez serverů DNS.
Konfigurace služby DNS(P. 181)
mDNS
Vyp
Zap
(
)
<Síť>
Přečtěte si zprávu
IPv6>
<Nastavení mDNS>
<mDNS>
tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Použ.náz.IPv4 (mDNS) *
Vyp
Zap
339
<Nastavení TCP/IP>
<Vyp> nebo <Zap>
<Nastavení
Proveďte
Nastavení seznamu nabídky
(
)
<Síť>
Přečtěte si zprávu
IPv6>
<Nastavení mDNS>
<Zap>
Proveďte tvrdý reset (
<Nastavení TCP/IP>
<Nastavení
<Použ.náz.IPv4 (mDNS)>
<Vyp> nebo
Provedení tvrdého resetu(P. 472) )
Název mDNS *
Pokud je možnost <Použ.náz.IPv4 (mDNS)> nastavena na <Vyp>, nastavte tuto položku.
(
)
IPv6>
<Síť>
Přečtěte si zprávu
<Nastavení mDNS>
Proveďte tvrdý reset (
<Nastavení TCP/IP>
<Název mDNS>
<Nastavení
Nastavte název
Provedení tvrdého resetu(P. 472) )
Rozlišení WINS
Zadejte, zda se má používat služba WINS (Windows Internet Name Service), která poskytuje název systému
NetBIOS k rozpoznávání IP adres ve smíšeném prostředí systému NetBIOS a protokolu TCP/IP. Pomocí
Vzdáleného uživatelského rozhraní můžete zadat podrobná nastavení, která se použijí, když se aktivuje služba
WINS. Konfigurace služby WINS(P. 187)
Vyp
Zap
(
)
<Síť>
WINS>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<Nastavení TCP/IP>
Proveďte tvrdý reset (
<Rozlišení
Provedení tvrdého
resetu(P. 472) )
FTP
Vyberte, zda změnit nastavení pro tisk a nastavení provedená na tiskárně z FTP.
Tisk FTP
Vyberte, zda tisknout z FTP. Použijte Vzdálené uživatelské rozhraní pro nastavení uživatelského jména a hesla,
které se používá pro tisk z FTP. Příprava na použití serveru FTP(P. 595)
Vyp
Zap
(
IP>
(
)
<Síť>
<FTP>
Zkontrolujte zprávu
<Tisk FTP>
Provedení tvrdého resetu(P. 472) )
340
<Nastavení TCP/
<Vyp> nebo <Zap>
Proveďte tvrdý reset
Nastavení seznamu nabídky
Povolit nast. z FTP
Vyberte, zda změnit nastavení provedená na tiskárně z FTP.
Vyp
Zap
(
)
IP>
tvrdý reset (
<Síť>
Zkontrolujte zprávu
<Nastavení TCP/
<FTP>
<Povolit nast. z FTP>
<Vyp> nebo <Zap>
Proveďte
Provedení tvrdého resetu(P. 472) )
Nastavení LPD
Povolte nebo zakažte tiskový protokol LPD, který lze použít na jakékoli hardwarové platformě a v jakémkoli
operačním systému. Nastavte také časové období, po němž tisková úloha automaticky skončí, pokud tisková
data nelze přijmout v důsledku komunikační chyby nebo nějakému jinému problému. Pomocí Vzdáleného
uživatelského rozhraní zadejte nastavení pro tisk bannerové stránky, když je aktivováno LPD. Konfigurace
protokolů tisku a funkcí WSD(P. 160)
Tisk LPD
Vyp
Zap
(
)
LPD>
<Síť>
<Tisk LPD>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<Nastavení TCP/IP>
Proveďte tvrdý reset (
<Nastavení
Provedení
tvrdého resetu(P. 472) )
Časová prodleva PŘ. *
1 až 60
(min.)
(
)
<Síť>
Přečtěte si zprávu
<Nastavení TCP/IP>
LPD>
<Časová prodleva PŘ.>
Nastavte dobu časového limitu
tvrdý reset (
Provedení tvrdého resetu(P. 472) )
<Nastavení
Proveďte
Nastavení RAW
Povolte nebo zakažte RAW, tiskový protokol specifický pro systém Windows. Nastavte také časové období, po
němž tisková úloha automaticky skončí, pokud tisková data nelze přijmout v důsledku komunikační chyby nebo
nějakému jinému problému. Pomocí Vzdáleného uživatelského rozhraní zadejte nastavení pro dvousměrnou
komunikaci. Konfigurace protokolů tisku a funkcí WSD(P. 160)
341
Nastavení seznamu nabídky
Tisk RAW
Vyp
Zap
(
)
<Síť>
RAW>
Zkontrolujte zprávu
<Tisk RAW>
<Nastavení TCP/IP>
<Vyp> nebo <Zap>
<Nastavení
Proveďte tvrdý reset (
Provedení
tvrdého resetu(P. 472) )
Časová prodleva PŘ. *
1 až 60
(min.)
(
)
<Síť>
Přečtěte si zprávu
<Časová prodleva PŘ.>
RAW>
tvrdý reset (
<Nastavení TCP/IP>
<Nastavení
Nastavte dobu časového limitu
Proveďte
Provedení tvrdého resetu(P. 472) )
Tisk IPP
Povolte nebo zakažte IPP, který umožňuje tisk z externí sítě prostřednictvím internetu. Pomocí Vzdáleného
uživatelského rozhraní zadejte nastavení pro šifrování TLS odesílaných dat a ověřování uživatele. Konfigurace
protokolů tisku a funkcí WSD(P. 160)
Vyp
Zap
(
IPP>
)
<Síť>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<Nastavení TCP/IP>
Proveďte tvrdý reset (
<Tisk
Provedení tvrdého
resetu(P. 472) )
WSD
Povolte nebo zakažte automatické procházení a získávání informací pro zařízení pomocí protokolu WSD.
Konfigurace protokolů tisku a funkcí WSD(P. 160)
Tisk WSD
Zadejte, zda tisknout se zařízením pomocí WSD.
Vyp
Zap
342
Nastavení seznamu nabídky
(
)
IP>
(
<Síť>
<WSD>
Zkontrolujte zprávu
<Tisk WSD>
<Nastavení TCP/
<Vyp> nebo <Zap>
Proveďte tvrdý reset
Provedení tvrdého resetu(P. 472) )
Procházení WSD *
Zadejte, zda získat informace o tiskárně z počítače pomocí WSD. Pokud je možnost <Tisk WSD> nastavena na
<Zap>, položka <Procházení WSD> je fixována na <Zap> a není zobrazena v nabídce nastavení.
Vyp
Zap
(
)
IP>
<Síť>
Zkontrolujte zprávu
<Nastavení TCP/
<WSD>
<Procházení WSD>
<Vyp> nebo <Zap>
tvrdý reset (
Proveďte
Provedení tvrdého resetu(P. 472) )
Multicast Discovery
Vyberte, zda nastavit tiskárnu tak, aby odpovídala na zprávy vícesměrového zjišťování.
Vyp
Zap
(
)
IP>
tvrdý reset (
<Síť>
<WSD>
Zkontrolujte zprávu
<Multicast Discovery>
<Nastavení TCP/
<Vyp> nebo <Zap>
Proveďte
Provedení tvrdého resetu(P. 472) )
● Pokud je možnost <Multicast Discovery> nastavena na <Vyp>, tiskárna zůstane v režimu spánku, i
když jsou na síti zprávy vícesměrového zjišťování.
HTTP
Povolte nebo zakažte HTTP. HTTP se vyžaduje pro komunikaci s počítačem, například když se používá Vzdálené
uživatelské rozhraní a provádí se tisk WSD. Zákaz komunikace HTTP(P. 249)
Vyp
Zap
343
Nastavení seznamu nabídky
Nastavení proxy
Zadejte nastavení používání proxy serveru, která se týkají komunikace HTTP.
proxy(P. 236)
Nastavení serveru
Proxy
Povolte nebo zakažte proxy server, když tiskárna provádí komunikaci HTTP.
Vyp
Zap
(
)
proxy>
<Síť>
Zkontrolujte zprávu
<Proxy>
<Vyp> nebo <Zap>
<Nastavení TCP/IP>
Proveďte tvrdý reset (
<Nastavení
Provedení
tvrdého resetu(P. 472) )
Adresa serveru *
Nastavte adresu proxy serveru, který chcete použít. Zadejte IP adresu, název domény a další nezbytné
informace, které se hodí pro vaše provozní prostředí. Pomocí tlačítek
/
posunujte kurzor a pomocí
číselných tlačítek zadejte adresu ( Zadávání textu(P. 34) ).
(
)
proxy>
(
<Síť>
Zkontrolujte zprávu
<Adresa serveru>
<Nastavení TCP/IP>
Zadejte adresu serveru
<Nastavení
Proveďte tvrdý reset
Provedení tvrdého resetu(P. 472) )
Číslo portu *
Zadejte číslo portu proxy serveru, který chcete použít.
1 až 80
až 65535
(
proxy>
)
<Síť>
Zkontrolujte zprávu
<Číslo portu>
Zadejte číslo portu
<Nastavení TCP/IP>
<Nastavení
Proveďte tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Stejná doména *
Povolte nebo zakažte proxy server, když tiskárna provádí komunikaci HTTP se zařízeními ve stejné doméně.
Použít proxy
Nepoužít proxy
344
Nastavení seznamu nabídky
(
)
<Síť>
Zkontrolujte zprávu
proxy>
<Stejná doména>
proxy>
Proveďte tvrdý reset (
<Nastavení TCP/IP>
<Nastavení
<Použít proxy> nebo <Nepoužít
Provedení tvrdého resetu(P. 472) )
Ověření proxy *
Povolte nebo zakažte funkci ověření serveru proxy.
Vyp
Zap
(
)
proxy>
<Síť>
Zkontrolujte zprávu
<Ověření proxy>
<Nastavení TCP/IP>
<Vyp> nebo <Zap>
<Nastavení
Proveďte tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Uživatelské jméno *
Pokud chcete povolit ověření serveru proxy, zadejte pro ověření uživatelské jméno o délce maximálně 24
alfanumerických znaků. Uživatelské jméno zadejte pomocí číselných tlačítek ( Zadávání textu(P. 34) )
(
)
<Síť>
Přečtěte si zprávu
proxy>
<Uživatelské jméno>
reset (
Provedení tvrdého resetu(P. 472) )
<Nastavení TCP/IP>
Zadejte uživatelské jméno
<Nastavení
Proveďte tvrdý
Heslo *
Pokud chcete nastavit heslo pro ověření serveru proxy, zadejte maximálně 24 alfanumerických znaků. Heslo
zadejte pomocí číselných tlačítek ( Zadávání textu(P. 34) ).
(
proxy>
)
<Síť>
<Heslo>
Přečtěte si zprávu
Zadejte heslo
<Nastavení TCP/IP>
Proveďte tvrdý reset (
<Nastavení
Provedení
tvrdého resetu(P. 472) )
SNTP
Vyberte, zda chcete získat čas ze síťového časového serveru. Pomocí Vzdáleného uživatelského rozhraní zadejte
nastavení adresy serveru. Konfigurace protokolu SNTP(P. 190)
Vyp
Zap
345
Nastavení seznamu nabídky
(
)
IP>
<Síť>
Zkontrolujte zprávu
<SNTP>
<Nastavení TCP/
<Vyp> nebo <Zap>
Proveďte tvrdý reset (
Provedení
tvrdého resetu(P. 472) )
Odezva Discovery
Vyberte, zda chcete nastavit zařízení tak, aby reagovalo na pakety vícesměrového zjišťování v síti. Pomocí
Vzdáleného uživatelského rozhraní zadejte název oboru, který se použije k zahrnutí zařízení konkrétního oboru.
Konfigurace nastavení pro software ke správě zařízení(P. 199)
Vyp
Zap
(
)
<Síť>
Discovery>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<Nastavení TCP/IP>
Proveďte tvrdý reset (
<Odezva
Provedení tvrdého
resetu(P. 472) )
IPSec
Zvolte, zda se má provádět šifrování komunikace vytvořením sítě VPN pomocí protokolu IPSec. Pomocí
Vzdáleného uživatelského rozhraní zaregistrujte a zadejte zásady zabezpečení. Konfigurace nastavení
IPSec(P. 259)
Vyp
Zap
(
IP>
)
<Síť>
<IPSec>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<Nastavení TCP/
Proveďte tvrdý reset (
Provedení
tvrdého resetu(P. 472) )
Nast. oznám. spánku
Zadejte nastavení komunikace SLP, pokud chcete systém imageWARE upozorňovat na stav napájení zařízení. Jeli možnost <Oznám. režimu spánku> nastavena na <Zap>, můžete očekávat, že nebude docházet ke zbytečné
komunikaci zařízení během režimu spánku a sníží se celková spotřeba energie. Konfigurace nastavení pro
software ke správě zařízení(P. 199)
Oznám. režimu spánku
Povolte nebo zakažte komunikaci SLP. Pokud vyberete možnost <Zap>, bude systém imageWARE
upozorňován na stav napájení zařízení.
Vyp
Zap
346
Nastavení seznamu nabídky
(
)
<Síť>
Zkontrolujte zprávu
oznám. spánku>
<Nastavení TCP/IP>
<Oznám. režimu spánku>
<Vyp> nebo <Zap>
<Nast.
Proveďte
Provedení tvrdého resetu(P. 472) )
tvrdý reset (
Číslo portu *
Zadejte číslo portu pro komunikaci SLP se softwarem pro správu.
1 až 11427
až 65535
(
)
<Síť>
Přečtěte si zprávu
oznám. spánku>
portu
<Číslo portu>
Proveďte tvrdý reset (
<Nastavení TCP/IP>
<Nast.
Pomocí číselných kláves zadejte číslo
Provedení tvrdého resetu(P. 472) )
Směrovače na trase *
Zadejte počet směrovačů, jimiž mohou procházet pakety upozornění.
0 až 3
až 254
(
)
<Síť>
Přečtěte si zprávu
oznám. spánku>
<Směrovače na trase>
směrovačů k procházení
Proveďte tvrdý reset (
<Nastavení TCP/IP>
<Nast.
Pomocí číselných kláves zadejte počet
Provedení tvrdého resetu(P. 472) )
Interval oznámení *
Zadejte, jak často má zařízení upozorňovat systém imageWARE na stav napájení.
až 65535
60 až 600
(
)
<Síť>
oznám. spánku>
oznámení
Přečtěte si zprávu
<Interval oznámení>
Proveďte tvrdý reset (
<Nastavení TCP/IP>
Pomocí číselných kláves zadejte interval
Provedení tvrdého resetu(P. 472) )
Mopria
Vyberte, zda chcete použít technologii Mopria®.
Tisk pomocí funkce Mopria®(P. 129)
347
<Nast.
Nastavení seznamu nabídky
Vyp
Zap
(
)
<Zap>
<Síť>
Přečtěte si zprávu
Proveďte tvrdý reset (
<Mopria>
<Vyp> nebo
Provedení tvrdého resetu(P. 472) )
Google Cloud Print
Povolte nebo zakažte službu Google Cloud Print.
Změna nastavení služby Google Cloud Print(P. 139)
Použít Cloud Print
Vyp
Zap
Stav uložení
SMB *
Vyberte, zda chcete použít zařízení jako sdílenou tiskárnu v síti SMB. Pomocí Vzdáleného uživatelského rozhraní zadejte
další nastavení SMB, jako je název serveru a název pracovní skupiny. Konfigurace protokolu SMB(P. 203)
Server SMB
Vyberte, zda chcete zobrazit zařízení jako server SMB na obrazovce konfigurace sítě SMB.
Vyp
Zap
(
SMB>
)
<Síť>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<SMB>
Proveďte tvrdý reset (
resetu(P. 472) )
Tisk SMB *
Povolte nebo zakažte tisk SMB.
Vyp
Zap
348
<Server
Provedení tvrdého
Nastavení seznamu nabídky
(
)
SMB>
<Síť>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<SMB>
Proveďte tvrdý reset (
<Tisk
Provedení tvrdého
resetu(P. 472) )
Nastavení SNMP
Zadejte nastavení monitorování a ovládání zařízení z počítače, který používá software kompatibilní s protokolem
SNMP. Monitorování a ovládání zařízení pomocí protokolu SNMP(P. 193)
Nastavení SNMPv1
Zadejte nastavení pro používání SNMPv1. Pomocí Vzdáleného uživatelského rozhraní zadejte název komunity a
přístupová oprávnění k objektům MIB (Management Information Base).
SNMPv1
Povolte nebo zakažte SNMPv1.
Vyp
Zap
(
)
<Síť>
Zkontrolujte zprávu
<SNMPv1>
SNMPv1>
<Nastavení SNMP>
<Vyp> nebo <Zap>
<Nastavení
Proveďte tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Nast. vyčlen.komun.
Vyhrazená komunita představuje předvolenou komunitu, určenou výhradně pro správce používající software
Canon, například nástroj iW Management Console. Nastavte přístupová oprávnění k objektům MIB
(Management Information Base).
Vyčleněná komuna
Vyp
Čtení/Zápis
Pouze Čtení
(
)
SNMPv1>
<Síť>
Přečtěte si zprávu
<Nast. vyčlen.komun.>
přístupová oprávnění
<Nastavení SNMP>
<Vyčleněná komuna>
Proveďte tvrdý reset (
<Nastavení
Vyberte
Provedení tvrdého resetu(P. 472) )
Nastavení SNMPv3
Zadejte nastavení pro používání protokolu SNMPv3. Pomocí Vzdáleného uživatelského rozhraní zadejte
podrobná nastavení, která se použijí, pokud je povolen protokol SNMPv3.
349
Nastavení seznamu nabídky
SNMPv3
Povolte nebo zakažte SNMPv3.
Vyp
Zap
(
)
<Síť>
SNMPv3>
Zkontrolujte zprávu
<SNMPv3>
<Nastavení SNMP>
<Vyp> nebo <Zap>
<Nastavení
Proveďte tvrdý reset (
Provedení tvrdého resetu(P. 472) )
Uživatelská nastavení N (N=1, 2, 3, 4, 5) *
Zadejte heslo pro ověřování a heslo pro šifrování jako uživatelské informace použité v SNMPv3. Pomocí
Vzdáleného uživatelského rozhraní zaregistrujte informace o uživateli. Monitorování a ovládání zařízení
pomocí protokolu SNMP(P. 193)
Heslo ověření /Heslo šifrování
Pro každé heslo zadejte 6 až 16 alfanumerických znaků. Heslo zadejte pomocí číselných tlačítek.
(
)
<Síť>
SNMPv3>
Přečtěte si zprávu
<Nastavení SNMP>
Vyberte číslo nastavení uživatele
jméno
Zkontrolujte uživatelské
<Heslo ověření> nebo <Heslo šifrování>
tvrdý reset (
<Nastavení
Zadejte heslo
Proveďte
Provedení tvrdého resetu(P. 472) )
Odmítn.pakety spán.
Vyberte, zda chcete smazat pakety SNMP přijaté během režimu spánku.
Vyp
Zap
(
SNMP>
(
)
<Síť>
Zkontrolujte zprávu
<Odmítn.pakety spán.>
<Nastavení
<Vyp> nebo <Zap>
Proveďte tvrdý reset
Provedení tvrdého resetu(P. 472) )
● Pokud vyberete pole <Zap>, aplikace, které používají protokol SNMP, jako například Canon software
imageWARE Series, mohou mít zakázán přístup k tiskárně.
350
Nastavení seznamu nabídky
Spooler *
Vyberte, zda chcete zahrnout kartu SD mezi úložná místa obdržených tiskových dat. Pokud vyberete <Zap>, kapacita
zařízení pro příjem tiskových dat se zvýší.
Vyp
Zap
(
)
<Síť>
Přečtěte si zprávu
Proveďte tvrdý reset (
<Zap>
<Spooler>
<Vyp> nebo
Provedení tvrdého resetu(P. 472) )
Přijímat paralelně
Určení, zda se mají tiskové úlohy tisknout v pořadí přijatém při odeslání tiskových dat pro více úloh do tiskárny z
jednoho počítače. Pokud vyberete možnost <Vyp>, budou úlohy vytištěny v přijatém pořadí, ale rychlost tisku může být
pomalejší.
Vyp
Zap
(
)
<Zap>
<Síť>
Přečtěte si zprávu
Proveďte tvrdý reset (
<Přijímat paralelně>
<Vyp> nebo
Provedení tvrdého resetu(P. 472) )
● I když vyberete možnost <Vyp>, nemusí být v některých případech úlohy uloženy v přijatém pořadí,
například při realizaci funkce Stored Job Print.
Čekání při spuštění
Zadejte čekací dobu před připojením k síti. Nastavení vyberte podle síťového prostředí.
připojením k síti(P. 180)
0
Nastavení čekací doby před
až 300 (s)
Nastavení vzdál. UR
Zadejte nastavení pro použití Vzdáleného uživatelského rozhraní. Pomocí Vzdáleného uživatelského rozhraní můžete
zadávat nastavení zařízení z webového prohlížeče.
351
Nastavení seznamu nabídky
Vzdálené UR
Povolte nebo zakažte Vzdálené uživatelské rozhraní.
Zákaz Vzdáleného uživatelského rozhraní(P. 250)
Vyp
Zap
Nast.zab.příst. VzUR
Vyberte, zda chcete používat kód PIN k přístupu do Vzdáleného uživatelského rozhraní.
pro Vzdálené uživatelské rozhraní(P. 225)
Nastavení kódu PIN
Vyp
Zap
TLS *
Povolte nebo zakažte TLS pro komunikaci Vzdáleného uživatelského rozhraní. Pokud chcete TLS používat pro
šifrované komunikace, musíte nastavit páry klíčů pomocí Vzdáleného uživatelského rozhraní ( Používání TLS
pro šifrovanou komunikaci(P. 255) ).
Vyp
Zap
(
)
UR>
<Síť>
Zkontrolujte zprávu
<TLS>
<Vyp> nebo <Zap>
<Nastavení vzdál.
Proveďte tvrdý reset (
Provedení
tvrdého resetu(P. 472) )
Registr/aktual SW *
Při registraci nebo aktualizaci aplikace MEAP můžete zkontrolovat komunikaci s distribučním serverem, ke kterému se
chcete připojit.
Nast správ softwaru
Režim komunikace
(
)
softwaru>
<Síť>
Zkontrolujte zprávu
<Režim komunikace>
<Registr/aktual SW>
<Ano>
<Nast správ
Zkontrolujte zprávu
Zkontrolujte zprávu
Ovladač ethernetu
Zadejte režim komunikace Ethernet (poloviční duplex / plný duplex) a typ sítě Ethernet (10 Base-T/100 Base-TX/1000
Base-T). Konfigurace nastavení sítě Ethernet(P. 178)
352
Nastavení seznamu nabídky
Automatická detekce
Zvolte, zda chcete režim komunikace a typ sítě Ethernet zjistit automaticky, nebo vybrat ručně.
Vyp
Zap
Režim komunikace *
Pokud je možnost<Automatická detekce> nastavena na <Vyp>, vyberte režim komunikace Ethernet.
Poloviční duplex
Úplný duplex
Typ ethernetu *
Pokud je možnost <Automatická detekce> nastavena na <Vyp>, vyberte typ Ethernetu.
10 Base-T
100 Base-TX
1000 Base-T
Priorita rež. spánku
Vyberte, zda dát prioritu rychlému návratu z režimu spánku nebo více energeticky úspornému efektu režimu spánku.
Optimální vyvážení
Ukončit rychlost
Úspora energie
(
)
<Síť>
položku nastavení
Přečtěte si zprávu
Proveďte tvrdý reset (
<Priorita rež. spánku>
Vyberte
Provedení tvrdého resetu(P. 472) )
Optimální vyvážení
Zařízení se rychle vrátí z režimu spánku. Pokud zařízení přímo připojená k přístroji podporují EEE (Energy
Efficient Ethernet), lze spotřebu energie snížit ještě více. Toto nastavení běžně používejte.
Ukončit rychlost
Zařízení se vrátí z režimu spánku rychleji.
Úspora energie
Rychlost komunikace je během režimu spánku nižší za účelem co nejnižší spotřeby energie.
353
Nastavení seznamu nabídky
● Tato položka je dostupná, pokud je pro možnost <Režim spánku> vybráno nastavení <Vysoká
(Hlub.spánek)>. Přepnutí do režimu spánku(P. 67)
IEEE802.1X
Povolte nebo zakažte ověřování IEEE 802.1X. Pomocí Vzdáleného uživatelského rozhraní zadejte podrobná nastavení,
která se použijí, pokud je povoleno ověřování IEEE 802.1X. Konfigurace ověřování IEEE 802.1X(P. 269)
Vyp
Zap
(
)
<Síť>
Přečtěte si zprávu
<Vyp> nebo <Zap>
zprávu
<IEEE802.1X>
Proveďte tvrdý reset (
Přečtěte si
Provedení tvrdého
resetu(P. 472) )
Filtr adresy
Povolit nebo zakázat komunikaci omezenou pomocí IP adresy a MAC adresy. Pomocí Vzdálené UR zadejte adresu,
kterou chcete omezit. Základní operace tisku(P. 75)
Vyp
Zap
(
)
<Zap>
<Síť>
Přečtěte si zprávu
Proveďte tvrdý reset (
<Filtr adresy>
Provedení tvrdého resetu(P. 472) )
Adresa MAC
Zkontrolujte adresu MAC zařízení, což je jedinečné číslo každého komunikačního zařízení.
(Pouze displej)
(
)
<Síť>
Přečtěte si zprávu
354
<Adresa MAC>
<Vyp> nebo
Nastavení seznamu nabídky
Nast. tisku e-mailu
Zadejte nastavení pro použití funkce tisku e-mailů. Pomocí Vzdáleného uživatelského rozhraní můžete zadávat další
nastavení tisku e-mailů včetně nastavení poštovního serveru. Tisk přijatých e-mailů (tisk e-mailů)(P. 120)
Interval PŘ. POP3
Zadejte interval pro automatické připojení k poštovnímu serveru v minutách. Nové e-maily v poštovní schránce
na poštovním serveru se automaticky přijmou a vytisknou v zadaných časových intervalech.
0
až 90 (min.)
(
)
<Síť>
POP3>
Přečtěte si zprávu
<Nast. tisku e-mailu>
<Interval PŘ.
Pomocí číselných kláves zadejte interval automatického příjmu eProveďte tvrdý reset (
mailů
Provedení tvrdého resetu(P. 472) )
● Pokud vyberete „0“, e-maily nebudou přijímány automaticky. V takovém případě přijímejte e-maily
ručně. Ruční přijímání e-mailů(P. 124)
POP3 PŘ.
Povolte nebo zakažte tisk e-mailů pro poštovní server POP3.
Vyp
Zap
(
PŘ.>
)
<Síť>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<Nast. tisku e-mailu>
Proveďte tvrdý reset (
resetu(P. 472) )
SMTP PŘ.
Povolte nebo zakažte tisk e-mailů pro protokol SMTP.
Vyp
Zap
355
Provedení tvrdého
<POP3
Nastavení seznamu nabídky
(
)
PŘ.>
<Síť>
Zkontrolujte zprávu
<Vyp> nebo <Zap>
<Nast. tisku e-mailu>
Proveďte tvrdý reset (
<SMTP
Provedení tvrdého
resetu(P. 472) )
Sledovací služba
Povolte komunikaci se serverem vzdáleného monitorování a zobrazení vpisů komunikace.
Test komunikace
Povolte komunikaci se serverem vzdáleného monitorování. Provedením této položky se povolí pravidelné
odesílání informací o zařízení do serveru vzdáleného monitorování připojeného k zařízení.
(
)
<Síť>
Zkontrolujte zprávu
Zkontrolujte zprávu
komunikace>
<Sledovací služba>
<Test
<Ano>
Protokol komunikace
Zobrazte výpisy komunikace, včetně informací o chybách generovaných pomocí <Test komunikace>.
(Pouze displej)
(
)
komunikace>
<Síť>
Zkontrolujte zprávu
Vyberte protokol
<Sledovací služba>
Vyberte čas
Inic. síť. nastavení
Vyberte, chcete-li vrátit nastavení sítě na výchozí tovární hodnoty.
356
Inicializace nastavení sítě(P. 540)
<Protokol
Nastavení seznamu nabídky
Rozvržení
6867-04R
Nastavení vzhledu tisku včetně okrajů mezery pro vazbu a poloh tisku jsou uvedeny
s krátkými popisy. Výchozí nastavení jsou označena křížkem ( ).
Počet kopií(P. 357)
Přesah Y/Přesah X(P. 357)
Umístění vazby(P. 358)
Vnitřní okraj(P. 359)
Alternativní způsob(P. 360)
Počet kopií
Nastavte počet kopií.
1
až 9999
(
)
<Rozvržení>
<Počet kopií>
Pomocí číselných kláves zadejte počet
kopií
Přesah Y/Přesah X
Bez ohledu na zdroj papíru můžete u všech druhů tisku zadat nastavení pro posun pozice tisku v krocích 0,5 mm.
-50,0 až 0,0
až +50,0 (mm)
(
)
<Rozvržení>
<Přesah Y> nebo <Přesah X>
hodnotu přesahu
<Přesah Y>
Posune pozici tisku svisle.
357
Pomocí
/
zadejte
Nastavení seznamu nabídky
<Přesah X>
Posune pozici tisku vodorovně.
Hodnoty přesahu
Pro <Přesah Y> nastavte plusovou (+) hodnotu pro posunutí pozice tisku dolů. Pro <Přesah X> nastavte
plusovou (+) hodnotu pro posunutí pozice tisku doprava. Nastavte minusovou (-) hodnotu pro posunutí
pozice tisku v opačném směru.
<Přesah X>
<Přesah Y>
Zadání jemného nastavení pozice tisku
Můžete vybrat <Uprav. polohu tisku> v části <Uživatelská údržba> pro jemné zadání pozice tisku pro každý zdroj
papíru. Rozsah dostupných hodnot přesahu je od -5,0 mm až +5,0 mm ve svislém směru a od -3,5 mm až +3,5
mm ve vodorovném směru. Nastavení pozice tisku(P. 519)
Umístění vazby
Zadejte, zda výtisky chcete vázat podél dlouhého okraje nebo krátkého okraje pomocí vázacího nástroje, například
sešívačky. V takovém případě zadejte také nastavení <Vnitřní okraj> pro upravení okraje pro svázání.
Delší strana
Kratší strana
(
)
<Rozvržení>
<Umístění vazby>
<Delší strana>
Zadejte pro vazba výtisků po dlouhé straně papíru.
358
<Delší strana> nebo <Kratší strana>
Nastavení seznamu nabídky
<Kratší strana>
Zadejte pro vazba výtisků po krátké straně papíru.
Vnitřní okraj
Upravte šířku okraje zadanou v <Umístění vazby> tím, že posunete polohu tisku tiskových dat. Pokud vyberete „0,0“,
okraj se nezmění.
-50,0 až 0,0
až +50,0 (mm)
(
)
<Rozvržení>
<Vnitřní okraj>
Pomocí
/
zadejte hodnotu
přesahu
Hodnoty mezery
Zadejte směr a šířku pro posun pozice tisku tiskových dat. Okraj, kde se mezera změní, se liší v závislosti na
tom, zda je nastavena „+“ nebo „-“ hodnota. Šířku mezery můžete upravit v krocích 0,5 mm.
Dokument na výšku
Hodnota nastavení
Vazba podél dlouhého okraje Vazba podél krátkého okraje
„+“ hodnota
Levý konec papíru
(pro levou vazbu)
Horní konec papíru
(pro horní vazbu)
„-“ hodnota
Pravý konec papíru
(pro pravou vazbu)
Spodní konec papíru
(pro spodní vazbu)
Dokument na šířku
359
Nastavení seznamu nabídky
Hodnota nastavení
Vazba podél dlouhého okraje Vazba podél krátkého okraje
„+“ hodnota
Levý konec papíru
(pro horní vazbu)
Horní konec papíru
(pro pravou vazbu)
„-“ hodnota
Pravý konec papíru
(pro spodní vazbu)
Horní konec papíru
(pro pravou vazbu)
Alternativní způsob
Pokud provádíte oboustranný tisk dokumentu, který obsahuje lichý počet stran, můžete vybrat, zda chcete poslední
stranu zpracovat v jednostranném režimu tisku. Pokud vyberete <Zap>, bude tisk dokončen rychleji než běžný
oboustranný tisk.
Vyp
Zap
(
)
<Rozvržení>
<Alternativní způsob>
<Vyp> nebo <Zap>
Když se tisk dokumentu se sudým počtem stran dokončí v jednostranném režimu tisku
V následujících případech je poslední strana zpracována v jednostranném režimu tisku, i když dokument
obsahuje sudý počet stran.
● Poslední strana je prázdná.
● Poslední stranu nelze vytisknout z toho důvodu, že velikost papíru není k dispozici pro oboustranný tisk.
Když použijete papír s předtištěným logem
● Pokud je poslední strana zpracována v jednostranném režimu tisku s možností <Alternativní způsob>
nastavenou na <Zap>, nemusí orientace nebo strana tisku poslední strany odpovídat ostatním stranám. V
takovém případě nastavte možnost <Alternativní způsob> na <Vyp>.
360
Nastavení seznamu nabídky
Kvalita tisku
6867-04S
Nastavení kvality tisku včetně gradace a hustoty toneru jsou uvedeny s krátkými
popisy. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na dalších položkách nastavení.
Gradace(P. 361)
Úspora toneru(P. 362)
Sytost: X (X=C, M, Y, K)(P. 362)
Sytost X (jemné nast.) (X=C, M, Y, K)(P. 362)
Barevný režim(P. 362)
Polotóny(P. 363)
Kompenzace šedé(P. 364)
CMS(P. 365)
Nastavení gradace(P. 370)
Zdokon. vyhlazování(P. 371)
Korekce obj. toneru(P. 372)
Kontrola čar(P. 372)
Snížit kvalitu(P. 373)
Sp. režim. vyhlaz.(P. 373)
Gradace
Zadejte gradaci pro zpracování tiskových dat.
Vysoká 1
Vysoká 2
(
)
<Kvalita tisku>
<Gradace>
<Vysoká 1> nebo <Vysoká 2>
<Vysoká 1>
Tento tiskový režim je vhodný pro tisk fotografií nebo podobných věcí v průměrné kvalitě.
<Vysoká 2>
Zadejte toto nastavení pro tisk fotografií nebo podobných věcí ve vysoké kvalitě.
361
Nastavení seznamu nabídky
Úspora toneru
Zadejte toto nastavení, když chcete zkontrolovat kompletaci, jako je rozvržení, například před vytištěním velké úlohy.
Vzhledem k tomu, že tento režim tisku šetří toner, mohou být jemné čáry a části se světlejší sytostí tisku rozmazané.
Vyp
Zap
(
)
<Kvalita tisku>
<Úspora toneru>
<Vyp> nebo <Zap>
Sytost: X (X=C, M, Y, K) *
Pro každou barvu CMYK upravte sytost toneru, která se má použít na tisk. Tato možnost se nezobrazí, když je možnost
<Úspora toneru> nastavena na <Zap>. Nastavení sytosti tisku(P. 515)
-8 až 0
až +8
Sytost X (jemné nast.) (X=C, M, Y, K) *
Pro každou barvu CMYK můžete provést jemné nastavení sytosti toneru použité na tisk samostatně pro tři oblasti
sytosti. Tato možnost se nezobrazí, když je možnost <Úspora toneru> nastavena na <Zap>. Nastavení sytosti
tisku(P. 515)
Vysoká
-8 až 0
až +8
Střední
-8 až 0
až +8
Nízká
-8 až 0
až +8
Barevný režim
Zadejte, zda chcete tisknout barevně nebo černobíle.
Auto (Barvy/Černá)
Barvy
Černá
(
)
<Kvalita tisku>
<Barevný režim>
362
Vyberte režim barvy
Nastavení seznamu nabídky
<Auto (Barvy/Černá)>
Automaticky vybírat barevný nebo černobílý tisk v závislosti na typu dokumentu.
<Barvy>
Barevný tisk.
<Černá>
Černobílý tisk, i když je dokument barevný.
Polotóny
Můžete vybrat metodu tisku k reprodukci polotónů (střední hodnoty mezi světlejšími a tmavšími oblastmi obrazu).
Difúze chyb
Tento režim je vhodný pro tisk dat s textem a tenké linky a zakřivené linky dat z aplikací CAD atd.
Vyp
Zap
(
)
<Kvalita tisku>
<Polotóny>
<Difúze chyb>
<Vyp> nebo
<Zap>
● Stabilita textury a fixovaného toneru může být při použití nastavení <Difúze chyb> snížena.
Rozlišení/gradace *
Vyberte metodu reprodukce polotónů, když je možnost <Difúze chyb> nastavena na <Vyp>. Tuto položku
můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Text
Rozlišení
Gradace
Grafika
Rozlišení
Gradace
Obraz
Rozlišení
363
Nastavení seznamu nabídky
Gradace
(
)
<Kvalita tisku>
typ dat obrázku
<Polotóny>
<Rozlišení/gradace>
Vyberte
<Rozlišení> nebo <Gradace>
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Rozlišení>
Zajistí jemný tisk s ostrou reprodukcí okrajů znaků. Tento režim tisku je vhodný pro tisk znaků a tenkých čar s
jasnými okraji.
<Gradace>
Zajistí tisk se stupňováním a čáry s hladkými okraji. Je vhodný pro tisk čísel nebo grafů obsahující oblasti s
odstupňováním.
Kompenzace šedé
V případě černých nebo šedých dat s barevnými informacemi definujícími R=G=B vyberte, zda chcete tisknout pouze s
černým (K) tonerem nebo se čtyřbarevným tonerem CMYK. Tuto položku můžete nastavit pro každý typ obrazových dat
obsažených v jednom dokumentu.
Text
Vyp
Zap
Grafika
Vyp
Zap
Obraz
Vyp
Zap
(
)
<Kvalita tisku>
<Kompenzace šedé>
<Vyp> nebo <Zap>
364
Vyberte typ obrazových dat
Nastavení seznamu nabídky
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Vyp>
Tiskne se čtyřbarevným tonerem CMYK. Reprodukce gradace tmavých barev je lepší než pomocí <Zap>.
<Zap>
Tiskne pouze s černým (K) tonerem. Neshodě barev kvůli použití barevného (CMY) toneru lze předejít.
CMS
Nastavte metody zpracování pro korekci barev. Můžete provést různá nastavení pro různé typy dat obsažené v jednom
dokumentu.
Výběr CMS
Nastavte, zda se má provést korekce barev na straně tiskárny nebo na straně hostitele (strana ovladače
tiskárny).
Tiskárna
Hostitel
(
)
<Kvalita tisku>
<CMS>
<Výběr CMS>
<Tiskárna> nebo
<Hostitel>
CMS/Gama
Vyberte režim zpracování pro barevný tisk. Tuto položku můžete nastavit pro každý typ obrazových dat
obsažených v jednom dokumentu.
Text
CMS
Gama
Grafika
CMS
Gama
Obraz
CMS
Gama
365
Nastavení seznamu nabídky
(
)
<Kvalita tisku>
obrazových dat
<CMS>
<CMS/Gama>
Vyberte typ
<CMS> nebo <Gama>
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<CMS>
Použijte profil pro shodu barev.
<Gama>
Proveďte korekci barev nastavením hodnoty gama pro úpravu jasu.
Zdrojový profil RGB
Vyberte vhodný profil pro data RGB, který odpovídá používanému monitoru. Tuto položku můžete nastavit pro
každý typ obrazových dat obsažených v jednom dokumentu.
Text
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
Grafika
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
Obraz
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
(
)
<Kvalita tisku>
obrazových dat
<CMS>
Vyberte profil
366
<Zdrojový profil RGB>
Vyberte typ
Nastavení seznamu nabídky
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<sRGB v3.0 (Canon)>
Použije se profil RGB, který je podobný průměrnému profilu většiny monitorů pro počítače se systémem
Windows. Pokud používáte monitor, který podporuje sRGB, můžete tisknout barvy, které se blíží barvám
zobrazeným na monitoru.
<Canon HDTV gama 1,5> až <Canon HDTV gama 2,4>
Pokud chcete upravit jas po srovnání mezi vytištěnými barvami a barvami zobrazenými na monitoru,
proveďte potřebná nastavení zde. Čím vyšší hodnota, tím tmavší vytištěné barvy.
● Tato položka je dostupná, pokud je pro možnost <CMS/Gama> vybráno nastavení <CMS>.
Výstupní profil
Můžete vybrat vhodné profily pro data, které hodláte vytisknout. Můžete tuto položku nastavit pro každý typ
obrazových dat obsažených v jednom dokumentu.
Text
Normal
Photo
Grafika
Normal
Photo
Obraz
Normal
Photo
(
)
<Kvalita tisku>
obrazových dat
<CMS>
<Normal> nebo <Photo>
367
<Výstupní profil>
Vyberte typ
Nastavení seznamu nabídky
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Normal>
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám zobrazeným na monitoru.
<Photo>
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii.
● Tato položka je dostupná, pokud je pro možnost <CMS/Gama> vybráno nastavení <CMS>.
Způsob shody
Zadejte, který prvek má mít ve shodě barev prioritu před ostatními, pomocí <Zdrojový profil RGB>. Tuto položku
můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Text
Percepční
Nasycení
Kolorimetrický
Grafika
Percepční
Nasycení
Kolorimetrický
Obraz
Percepční
Nasycení
Kolorimetrický
(
)
<Kvalita tisku>
obrazových dat
<CMS>
<Způsob shody>
Vyberte typ
Vyberte metodu určení shody
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
368
Nastavení seznamu nabídky
<Percepční>
Shoda se provede s prioritou na barevnou percepční.
<Nasycení>
Shoda se provede s prioritou na sytost.
<Kolorimetrický>
Shoda se provede tak, že rozdíl barev mezi originály a výtisky je minimální.
Korekce gama
Úprava jasu lze provést tak, aby jas nejjasnějších a nejtmavších částí originálu nebyl ve výsledku tisku ovlivněn.
Tuto položku můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Text
1.0
1.4
1.8
2.2
Grafika
1.0
1.4
1.8
2.2
Obraz
1.0
1.4
1.8
2.2
(
)
<Kvalita tisku>
obrazových dat
<CMS>
<Korekce gama>
Vyberte typ
Vyberte hodnotu nastavení
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
369
Nastavení seznamu nabídky
<1.0> až <2.2>
Nastavte tuto položku, když chcete upravit jas výtisků. <1.4> je standardní nastavení (bez korekce) a čím vyšší
je nastavená hodnota, tím bude tisk tmavší.
● Tato položka je dostupná, pokud je pro možnost <CMS/Gama> vybráno nastavení <Gama>.
Nastavení gradace
Proveďte nastavení pro režim vyhlazování, který umožňuje vyhlazený tisk gradace čar, obrázků a fotografií.
Gradace
Zadejte, zda chcete povolit nebo zakázat režim vyhlazování. Gradace se tisknout vyhlazeněji, je-li zadána
možnost <Vyhlazený 2> spíše než možnost <Vyhlazený 1>.
Vyp
Vyhlazený 1
Vyhlazený 2
(
)
<Kvalita tisku>
<Nastavení gradace>
<Gradace>
Vyberte
způsob zpracování
Grafika *
Zadejte, zda chcete použít režim vyhlazování na čáry a obrázky pokud je možnost <Gradace> nastavena na
<Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
(
)
<Kvalita tisku>
<Nastavení gradace>
<Grafika>
<Vyp>
nebo <Zap>
Obraz *
Zadejte, zda chcete použít režim vyhlazování na obrazová data, jako jsou fotografie, pokud je možnost
<Gradace> nastavena na <Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
370
Nastavení seznamu nabídky
(
)
<Kvalita tisku>
<Nastavení gradace>
<Obraz>
<Vyp> nebo
<Zap>
Zdokon. vyhlazování
Proveďte nastavení pro režim vyhlazování, který umožňuje vyhlazený tisk okrajů čar, obrázků a textu.
Zdokon. vyhlazování
Zadejte, zda chcete povolit nebo zakázat režim vyhlazování. Okraje budou hladší, je-li zadána možnost
<Vyhlazený 2> spíše než možnost <Vyhlazený 1>.
Vyp
Vyhlazený 1
Vyhlazený 2
(
)
vyhlazování>
<Kvalita tisku>
<Zdokon. vyhlazování>
<Zdokon.
Vyberte způsob zpracování
Grafika *
Zadejte, zda chcete použít režim vyhlazování na čáry a obrázky pokud je možnost <Zdokon. vyhlazování>
nastavena na <Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
(
)
<Kvalita tisku>
<Zdokon. vyhlazování>
<Grafika>
<Vyp>
nebo <Zap>
Text *
Zadejte, zda chcete použít režim vyhlazování na text, pokud je možnost <Zdokon. vyhlazování> nastavena na
<Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
371
Nastavení seznamu nabídky
(
)
<Kvalita tisku>
<Zdokon. vyhlazování>
<Text>
<Vyp> nebo
<Zap>
Korekce obj. toneru
Nastavte, jak upravit množství toneru při tisku vysoce sytých oblastí.
Normální
Priorita gradace
Priorita textu
(
)
<Kvalita tisku>
<Korekce obj. toneru>
Vyberte způsob
korekce
<Normální>
Tiskne text a čáry pomocí množství toneru, které zachová rozlišení, a tiskne další typy dat pomocí množství
toneru, které zachová odstín.
<Priorita gradace>
Tiskne všechny typy dat pomocí množství toneru, které zachová odstín.
<Priorita textu>
Tiskne všechny typy dat pomocí množství toneru, které zachová rozlišení.
Kontrola čar
Nastavte metodu zpracování obrazu čar.
Priorita rozlišení
Priorita gradace
372
Nastavení seznamu nabídky
(
)
<Kvalita tisku>
<Kontrola čar>
<Priorita rozlišení> nebo <Priorita
gradace>
<Priorita rozlišení>
Zpracuje čáry tak, že se zachová rozlišení podobné zpracování textu.
<Priorita gradace>
Zpracuje čáry tak, že se zachová odstín a gradaci podobné zpracování obrázků.
Snížit kvalitu
Vyberte, zda chcete pokračovat v tisku automatickým snížením kvality, když je ke zpracování k dispozici nedostatečná
paměť.
Pokračovat v tisku
Zastavit tisk
(
)
<Kvalita tisku>
<Snížit kvalitu>
<Pokračovat v tisku> nebo <Zastavit
tisk>
● Pokud vyberete možnost <Zastavit tisk>, zobrazí se chybová zpráva a tisk se zastaví, až zařízení vyčerpá
paměť. Můžete stisknout
(
) pro pokračování v tisku snížením kvality.
Sp. režim. vyhlaz.
Změňte nastavení, pokud je výstupní sytost tisku nerovnoměrná nebo přechody tisku nejsou hladké.
Režim 1
Režim 2
Režim 3
Režim 4
Režim 5
Režim 6
373
Nastavení seznamu nabídky
(
)
<Kvalita tisku>
<Sp. režim. vyhlaz.>
Vyberte režim
<Režim 1>
Toto nastavení používejte pro většinu prostředí.
<Režim 2>
Zadejte toto nastavení, pokud vnitřní oblast vysoce sytých obrázků, velkých znaků nebo tlustých čar nelze
vytisknout s hladkými přechody.
<Režim 3>
Zadejte toto nastavení, pokud najednou vypozorujete následující příznaky.
● Vnitřní oblast vysoce sytých obrázků, velkých znaků nebo tlustých čar nelze vytisknout s hladkými
přechody.
● Obvod nízko sytých obrázků, znaků nebo čar nelze vytisknout s hladkými přechody.
● Znaky nebo čáry na jednolitém pozadí nelze vytisknout s hladkými přechody.
374
Nastavení seznamu nabídky
<Režim 4>
Zadejte toto nastavení, pokud obvod nízko sytých obrázků, znaků nebo čar nelze vytisknout s hladkými
přechody.
<Režim 5>
Zadejte toto nastavení, pokud se obrazových datech, jako jsou fotografie, obrázky, gradace nebo stínované
vzory zobrazí pruhy vedoucí k nerovnoměrným výtiskům.
<Režim 6>
Zadejte toto nastavení, pokud tisk jako celek není hladký.
● Pokud je zadána možnost <Režim 2> nebo <Režim 4>, mohou být oblasti s nízkou sytostí vybarveny
nerovnoměrně.
● Pokud je zadána možnost <Režim 3>, mohou být oblasti se slabou sytostí nebo stínované vzory vybarveny
nerovnoměrně.
● Pokud je zadána možnost <Režim 5>, nemusí být obvod znaků, čar nebo obrázků vytištěn hladce.
● Pokud je zadána možnost <Režim 6>, může se zobrazit barevná nerovnoměrnost.
375
Nastavení seznamu nabídky
Rozhraní
6867-04U
Všechna nastavení týkající se rozhraní pro komunikaci s počítačem a USB jsou
uvedena s krátkým popisem. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na používaných volitelných
možnostech nebo dalších položkách nastavení.
Výběr rozhraní(P. 376)
Čas. limit vypršel(P. 377)
Rozpozn. připojení(P. 378)
Rozšíř.vyrov.pam.PŘ.(P. 378)
Výběr rozhraní
Vyberte rozhraní použité pro zařízení.
USB
Povolte nebo zakažte port USB.
Omezení připojení k počítači pomocí kabelu USB(P. 243)
Vyp
Zap
Síť
Povolte nebo zakažte port LAN.
Zakázání portu LAN(P. 251)
Vyp
Zap
Rozšířené funkce USB
Zadejte nastavení pro výběr funkce pro použití zařízení USB nebo výběr ovladače zařízení, který chcete použít.
Nast. pokr. funkcí
Vyberte, které aplikace MEAP a USB přes síť mají mít prioritu, když je k přístroji připojeno zařízení USB.
Priorita MEAP
Priorita USB přes NW
376
Nastavení seznamu nabídky
(
)
<Rozhraní>
zprávu
<Výběr rozhraní>
<Rozšířené funkce USB>
nebo <Priorita USB přes NW>
Přečtěte si
<Nast. pokr. funkcí>
Proveďte tvrdý reset (
<Priorita MEAP>
Provedení tvrdého resetu(P. 472) )
<Priorita MEAP>
Zadejte toto pro udělení priority aplikacím MEAP.
<Priorita USB přes NW>
Zadejte toto pro udělení priority USB přes síť. Tato funkce vám umožňuje z počítače používat zařízení USB
připojené k portu USB přístroje.
Úložné zařízení USB
Zadejte nastavení pro ovladač zařízení pro používání paměťového zařízení USB.
Ovladač MEAP
Povolte nebo zakažte konkrétní ovladač zařízení MEAP, když se paměťové zařízení USB připojí k tiskárně.
Pokud chcete provést funkci přímého tisku (přímý tisk z USB) z paměťového zařízení USB bez použití
počítače, vyberte možnost <Vyp>.
Vyp
Zap
(
)
<Rozhraní>
<Výběr rozhraní>
zprávu
<Rozšířené funkce USB>
MEAP>
<Vyp> nebo <Zap>
Přečtěte si
<Úložné zařízení USB>
Proveďte tvrdý reset (
Provedení tvrdého
resetu(P. 472) )
Čas. limit vypršel
Zadejte, jak se má zařízení chovat, pokud je přerušen příjem tiskových dat.
Čas. limit vypršel
Zadejte, zda chcete zrušit tisk, pokud je příjem tiskových po zadanou dobu přerušen.
Vyp
Zap
377
<Ovladač
Nastavení seznamu nabídky
(
)
<Rozhraní>
<Čas. limit vypršel>
<Čas. limit vypršel>
<Čas. limit vypršel>
<Čas. limit
<Vyp>
nebo <Zap>
Čas. limit vypršel *
Nastavte dobu časového limitu.
5 až 15
až 300 (s)
(
)
<Rozhraní>
vypršel>
Pomocí číselných kláves nastavte dobu
Rozpozn. připojení
LAN se může vyskytnout problém, jako je nesprávný překryvný tisk nebo překroucené znaky. V takovém případě
nastavte <Rozpozn. připojení> na <Vyp>.
Vyp
Zap
(
)
<Rozhraní>
zprávu
<Rozpozn. připojení>
<Vyp> nebo <Zap>
Proveďte tvrdý reset (
Zkontrolujte
Provedení tvrdého
resetu(P. 472) )
Rozšíř.vyrov.pam.PŘ.
Vyberte, zda chcete zvýšit prostor paměti integrované v zařízení pro příjem tiskových dat z počítače. Pokud vyberete
možnost <Zap>, dobu, než bude počítač uvolněn od zpracování či přenosu tiskových dat, lze snížit, když počítač odesílá
velký objem dat nebo komplikovaně strukturovaná data.
Vyp
Zap
(
)
<Rozhraní>
zprávu
<Rozšíř.vyrov.pam.PŘ.>
<Vyp> nebo <Zap>
Proveďte tvrdý reset (
resetu(P. 472) )
378
Zkontrolujte
Provedení tvrdého
Nastavení seznamu nabídky
Uživatelská údržba
6867-04W
Nastavení týkající se úpravy zařízení, včetně korekce pozice tisku pro každý zdroj
papíru a zlepšení kvality tisku, jsou uvedeny s krátkými popisy. Tato nastavení
můžete zadat, když je zařízení offline. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na používaných volitelných
možnostech nebo dalších položkách nastavení.
Uprav. polohu tisku(P. 379)
Obnovení tisku(P. 380)
Inicializovat počty(P. 380)
Zkontr. vel. papíru(P. 381)
Opr opak mezer tisku(P. 382)
Nahradit velikost(P. 382)
Auto.zjist. typ pap.(P. 382)
Prefer.pod.krat. str(P. 383)
Spec. režim obrazu(P. 383)
Sp. režim přenosu(P. 384)
Korekce zvrásnění(P. 384)
Sp. režim fixace 4(P. 385)
Zlepšit fix. toneru(P. 385)
Režim přep. Bar./ČB(P. 385)
Čištění nabíj válce(P. 386)
Opravit čáru bubnu(P. 386)
Spec. režim sytosti(P. 387)
Údržba karty SD(P. 387)
Spec. režim tisku(P. 388)
Spec. režim tisku E(P. 394)
Aktualizace firmwaru(P. 394)
První kalibrace(P. 394)
Způsob podávání pap.(P. 395)
Upr.tepl.pohot. rež.(P. 396)
Zobrazit seznam úloh(P. 396)
Úpr. výstupu papíru(P. 397)
Nes. zm. sil. bar. 3(P. 397)
Korekce neshody bar.(P. 398)
Oprava sytosti ČB(P. 398)
Rychlost tisku POP(P. 399)
Kor bar tisku POP(P. 399)
Režim upoz. na toner(P. 400)
Auto kalibrace POP(P. 400)
Nast. import/export(P. 401)
Četnost kalibrace(P. 401)
Upozornění k čištění(P. 402)
Načas. upoz. na čiš.(P. 402)
Časov. kontr. toneru(P. 402)
Urč.čas.kontr.toneru(P. 403)
Časov. kontr. bubnu(P. 403)
Urč.časov.kontr.bubn(P. 403)
Akce když není toner(P. 403)
Omez pruh pro pomalý(P. 404)
Snížení kraj. skvrn(P. 405)
Kontrola kondenzace(P. 405)
Uprav. polohu tisku
U každého zdroje papíru můžete nastavit pozici tisku.
Nastavení pozice tisku(P. 519)
Přesah Y (2stranný)
V režimu oboustranného tisku můžete nastavit svislou polohu tisku pro tisk na první stránku (přední strana).
Poloha tisku na druhé stránce (zadní strana) se řídí nastavením zdroje papíru, který je k dispozici při spuštění
tisku.
-5,0 až 0,0
až +5,0 (mm)
379
Nastavení seznamu nabídky
Přesah X (2stranný)
V režimu oboustranného tisku můžete nastavit vodorovnou polohu tisku pro tisk na první stránku (přední
strana). Poloha tisku na druhé stránce (zadní strana) se řídí nastavením zdroje papíru, který je k dispozici při
spuštění tisku.
Víceúčelová přihr.
-3,5 až 0,00 až +3,5 (mm)
Zásuvka 1 až 5 *
-3,5 až 0,00 až +3,5 (mm)
Přesah Y (Víceú.př.)
Můžete nastavit svislou polohu tisku pro tisk na papír z víceúčelové přihrádky.
-5,0 až 0,0
až +5,0 (mm)
Přesah X (Víceú.př.)
Můžete nastavit vodorovnou polohu tisku pro tisk na papír z víceúčelové přihrádky.
-3,5 až 0,00
až +3,5 (mm)
Přesah Y (Zásuvka 1 až 5) *
Můžete nastavit svislou polohu tisku pro tisk na papír podávaný ze zásuvky na papír.
-5,0 až 0,0
až +5,0 (mm)
Přesah X (Zásuvka 1 až 5) *
Můžete nastavit vodorovnou polohu tisku pro tisk na papír podávaný ze zásuvky na papír.
-3,5 až 0,00
až +3,5 (mm)
Obnovení tisku
Vyberte, zda se má znovu vytisknout stránka, jejíž tisk byl přerušen uvíznutím papíru nebo chybou.
Vyp
Zap
(
)
<Uživatelská údržba>
<Obnovení tisku>
<Vyp> nebo <Zap>
Inicializovat počty
Inicializujte počet vytištěných stránek pro jednotlivé spotřební díly.
2. přenos vněj válec
Inicializujte počet stránek vytištěných pomocí stejného sekundárního vnějšího přenosového válce. Tuto operaci
proveďte po výměně sekundárního vnějšího přenosového válce.
380
Nastavení seznamu nabídky
(
)
válec>
<Uživatelská údržba>
<Inicializovat počty>
<2. přenos vněj
<Ano>
Výs vál víceúč přihr
Inicializujte počet stránek vytištěných pomocí stejného podávacího válce víceúčelové přihrádky. Tuto operaci
proveďte po výměně podávacího válce víceúčelové přihrádky.
(
)
přihr>
<Uživatelská údržba>
<Inicializovat počty>
<Výs vál víceúč
<Ano>
Podáv. válec kazety 1 až Podáv. válec kazety 5 *
Inicializujte počet stránek vytištěných pomocí stejného válce podavače. Tuto operaci proveďte po výměně válce
podavače.
(
)
<Uživatelská údržba>
až Podáv. válec kazety 5>
<Inicializovat počty>
<Podáv. válec kazety 1
<Ano>
Zkontr. vel. papíru
Vyberte, zda chcete kontrolovat délku papíru, který je podáván ze zdroje papíru s velikostí papíru nastavenou na
<Volná velikost>. Pokud vyberete možnost <Zap>, zobrazí se zpráva potvrzující velikost papíru a tisk se zastaví, pokud
délka papíru podávaného ze zdroje papíru neodpovídá tiskovým datům.
Vyp
Zap
(
)
<Uživatelská údržba>
<Zkontr. vel. papíru>
<Vyp> nebo <Zap>
● Pokud rozdíl velikosti mezi podaným papírem a tiskovými daty není tak velký, může se stát, že se nezobrazí
žádná zpráva a tisk bude pokračovat, i když vybrané nastavení je <Zap>.
381
Nastavení seznamu nabídky
Opr opak mezer tisku
Nepřetržitý tisk může mít za následek nerovnoměrnou sytost tisku. V takovém případě může nastavení této položky na
hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
<Opr opak mezer tisku>
<Vyp> nebo
<Zap>
Nahradit velikost
Vyberte, zda chcete tisknout se vzájemným zaměňováním velikosti papíru A4 a Letter. Pokud vyberete možnost <Zap>,
použijete se k tisku velikost papíru Letter, když zadáte velikost papíru A4 z počítače, ale velikost papíru A4 není do
zařízení vložena.
Vyp
Zap
(
)
<Uživatelská údržba>
<Nahradit velikost>
<Vyp> nebo <Zap>
Auto.zjist. typ pap.
Funkci automatické detekce typu papíru můžete optimalizovat ( Auto.zjist. typ pap.(P. 478) ) podle velikosti papíru,
kterou používáte nejčastěji. Doporučujeme, abyste za normálních okolností používali pro tuto funkci výchozí tovární
nastavení .
Režim 1
Režim 2
Režim 3
(
)
<Uživatelská údržba>
<Auto.zjist. typ pap.>
382
Vyberte režim
Nastavení seznamu nabídky
<Režim 1>
Toto nastavení zadejte, jestliže často používáte <Běžný L> nebo <Běžný L2> velikosti A4 nebo A3.
<Režim 2>
Toto nastavení zadejte, jestliže často používáte <Běžný> velikosti A4 nebo A3.
<Režim 3>
Toto nastavení zadejte, jestliže často používáte <Běžný> velikosti Letter nebo Ledger.
● Tato položka je povolena, když je možnost <Auto.zjist. typ pap.> v
nastavena jinak než na položku <Nepoužít>.
Nabídka Vybrat podavač(P. 474)
● Pokud výchozí tovární nastavení změníte na jiné nastavení, automatická detekce typu papíru může být
nesprávná.
Prefer.pod.krat. str
Při tisku na papír velikosti, která umožňuje vložení v orientaci na výšku i na šířku, nastavte tuto položku na <Zap>,
pokud chcete papír v orientaci na šířku podat prioritně. Toto nastavení se použije, pouze když je možnost <Zdroj
papíru> nastavena na <Auto>.
Vyp
Zap
(
)
<Uživatelská údržba>
<Prefer.pod.krat. str>
<Vyp> nebo <Zap>
Spec. režim obrazu
Tuto položku nastavte, pokud nelze vytisknout středovou oblast znaků nebo čar tmavé sytosti. Efekt zlepšení je silnější
s nastavením <Úroveň 2> než s <Úroveň 1>.
Vyp
Úroveň 1
Úroveň 2
(
)
<Uživatelská údržba>
<Spec. režim obrazu>
383
Vyberte úroveň
Nastavení seznamu nabídky
● Když vyberete silnější zlepšení, sytost tisku bude menší.
Sp. režim přenosu
Pokud zařízení používáte v prostředí s nízkou vlhkostí, mohou být vytištěné obrazy nebo text rozmazané. V takovém
případě nastavte tuto položku na <Zap>, abyste problém vyřešili.
Vyp
Zap
(
)
<Uživatelská údržba>
<Sp. režim přenosu>
<Vyp> nebo <Zap>
● Pokud vyberete možnost <Zap> a zařízení používáte v prostředí s vysokou vlhkostí, může být sytost tisku
světlejší nebo nerovnoměrná.
Korekce zvrásnění
Při tisku na běžný nebo tenký papír může dojít k pomačkání výtisku. V takovém případě může nastavení této položky
na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
<Korekce zvrásnění>
<Vyp> nebo
<Zap>
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost <Zap>.
Priorita položek nabídky nastavení(P. 406)
384
Nastavení seznamu nabídky
Sp. režim fixace 4
Při používání zařízení v prostředí s nízkou vlhkostí se v prázdné oblasti výtisku mohou objevit zdvojené obrazy. V
takovém případě může nastavení této položky na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
<Sp. režim fixace 4>
<Vyp> nebo <Zap>
Zlepšit fix. toneru
Provádíte-li oboustranný tisk poté, co zařízení nebylo delší dobu používáno, může na vytištěných obrazech dojít
k vynechávání barvy. V takovém případě může nastavení této položky vyřešit tento problém. Účinek vylepšení je silnější
s nastavením <Režim 2> než s nastavením <Režim 1>.
Vyp
Režim 1
Režim 2
(
)
<Uživatelská údržba>
<Zlepšit fix. toneru>
Vyberte režim
Je-li v případě oboustranného tisku tato položka nastavena na jinou možnost než <Vyp>, spuštění tisku může
trvat déle.
Režim přep. Bar./ČB
Při tisku dat obsahujících černá a bílá data a barevná data, můžete specifikovat, zda se má upřednostnit vyšší rychlost
tisku nebo nižší frekvence používání tonerové kazety CMY .
Režim 1
Režim 2
(
)
<Uživatelská údržba>
<Režim přep. Bar./ČB>
385
Vyberte režim
Nastavení seznamu nabídky
<Režim 1>
Přednost má rychlost tisku.
<Režim 2>
Tisk je možný při méně častém používání tonerových kazet CMY.
● Pokud vyberete možnost <Režim 2>, rychlost tisku může být nižší.
Čištění nabíj válce
Někdy mohou být bílé oblasti lehce zabarvené. V takovém případě může nastavení této položky na hodnotu <Zap>
vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
<Čištění nabíj válce>
<Zap>
Jestliže vyberete možnost <Zap>, sytost tisku může být světlejší.
Opravit čáru bubnu
Jestliže se na výtiscích objevují pruhy, může nastavení hodnoty <Zap> vyřešit tento problém.
Vyp
Zap
386
<Vyp> nebo
Nastavení seznamu nabídky
(
)
<Uživatelská údržba>
<Opravit čáru bubnu>
<Vyp> nebo
<Zap>
Spec. režim sytosti
Pokud zařízení používáte v prostředí s vysokou vlhkostí, může být sytost tisku světlejší nebo nerovnoměrná. V takovém
případě nastavte tuto položku na <Zap>, abyste problém vyřešili.
Vyp
Zap
(
)
<Uživatelská údržba>
<Spec. režim sytosti>
<Vyp> nebo <Zap>
● Pokud vyberete možnost <Zap> zařízení používáte v prostředí s vysokou vlhkostí, mohou být vytištěné
obrazy nebo text rozmazané.
Údržba karty SD *
Když se vyskytne chyba na kartě SD nebo když chcete kartu SD vyhodit, můžete vymazat všechna data uložená na této
kartě.
Formát
Inicializuje kartu SD. Všechna uložená data jsou z karty vymazána.
(
)
SD>
<Uživatelská údržba>
<Formát>
<Údržba karty
<Ano>
Zcela odstranit data
Všechna uložená data jsou vymazána z SD karty. Tuto operaci proveďte podle potřeby, například pokud chcete
kartu SD po vymazání všech uložených dat, včetně těch fragmentů, které nelze normálně vymazat, zlikvidovat.
Smazání všech dat z SD karty(P. 584)
387
Nastavení seznamu nabídky
Spec. režim tisku
Obsahuje položky, které můžete nastavit, když se nedaří tisknout správně.
Korekce zvlnění
Při tisku na běžný nebo tenký papír může dojít ke zkroucení výtisku. V takovém případě může problém vyřešit
nastavení této položky na hodnotu <Zap> pro použitý zdroj papíru, který se zkroutil.
Vyp
Zap
(
)
<Uživatelská údržba>
zvlnění>
<Spec. režim tisku>
Vyberte zdroj papíru
<Korekce
<Vyp> nebo <Zap>
Výběr zdroje papíru
Vyberte zdroj papíru, u něhož chcete změnit nastavení Korekce zvlnění.
Přepnutí nastavení
Pro provedení korekce zvlnění vyberte možnost <Zap>.
● Vyberete-li možnost <Zap>, spuštění tisku může trvat déle. Také rychlost tisku se může snížit.
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost
<Zap>. Priorita položek nabídky nastavení(P. 406)
Korekce zvlnění 2
Jestliže jste povolili <Korekce zvlnění>, aniž by skutečně došlo ke korekci zvlnění, problém může vyřešit
nastavení této položky na možnost <Zap>.
Vyp
Zap
388
Nastavení seznamu nabídky
(
)
2>
<Uživatelská údržba>
<Spec. režim tisku>
<Korekce zvlnění
<Vyp> nebo <Zap>
● Pokud vyberete <Zap>, rychlost tisku bude nižší. Výtisky také mohou být vybledlé.
Sp. režim potaž.pap.
V závislosti na typu papíru a podmínkách prostředí může z výtisků odpadávat toner. V takovém případě může
nastavení této položky na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
potaž.pap.>
<Spec. režim tisku>
<Sp. režim
<Vyp> nebo <Zap>
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost
<Zap>. Priorita položek nabídky nastavení(P. 406)
Úpr. hrubého papíru
Při tisku na silný hrubý papír může v závislosti na podmínkách prostředí docházek k následujícím jevům. V
takovém případě může nastavení této položky na hodnotu <Zap> vyřešit tento problém.
● Z výtisků odpadává toner
● Sytost tisku je nižší
● Výtisky se kroutí
Vyp
Zap
(
papíru>
)
<Uživatelská údržba>
<Spec. režim tisku>
<Vyp> nebo <Zap>
389
<Úpr. hrubého
Nastavení seznamu nabídky
● Pokud vyberete možnost <Zap>, rychlost tisku bude nižší.
Spec. režim obálky
Pokud se lepicí klopa obálky po zvlhnutí přilepí k obálce, nastavte tuto položku na <Zap>.
Vyp
Zap
(
)
obálky>
<Uživatelská údržba>
<Spec. režim tisku>
<Spec. režim
<Vyp> nebo <Zap>
● Pokud vyberete možnost <Zap>, mohou být výtisky slabé.
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost
<Zap>. Priorita položek nabídky nastavení(P. 406)
Režim prevence fix.
Jestliže se výstupní listy navzájem slepují, může nastavení této položky na možnost <Zap> vyřešit tento problém.
Vyp
Zap
(
)
fix.>
<Uživatelská údržba>
<Spec. režim tisku>
<Režim prevence
<Vyp> nebo <Zap>
● Pokud vyberete <Zap>, rychlost tisku bude nižší.
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost
<Zap>.
Priorita položek nabídky nastavení(P. 406)
Sp. tenký papír H/H
Používáte-li tenký papír v prostředí s vysokou teplotou nebo vysokou vlhkostí, papír může uvíznout ve fixační
jednotce. V takovém případě může nastavení této položky na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
390
Nastavení seznamu nabídky
(
)
H>
<Uživatelská údržba>
<Spec. režim tisku>
<Sp. tenký papír H/
<Vyp> nebo <Zap>
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost
<Zap>. Priorita položek nabídky nastavení(P. 406)
Opr. oddělení papíru
Dojde-li během tisku k uvíznutí papíru, může nastavení této položky na možnost <Zap> vyřešit tento problém.
Vyp
Zap
(
)
papíru>
<Uživatelská údržba>
<Spec. režim tisku>
<Opr. oddělení
<Vyp> nebo <Zap>
Spec. režim lesku
Používáte-li zařízení v prostředí s vysokou teplotou nebo vysokou vlhkostí, bílé oblasti mohou být lehce
zabarvené. V takovém případě může nastavení této položky na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
lesku>
<Uživatelská údržba>
<Spec. režim tisku>
<Spec. režim
<Vyp> nebo <Zap>
● Jestliže vyberete možnost <Zap>, sytost tisku může být světlejší.
Opravit bílou čáru
Na výtiscích se mohou objevit bílé pruhy (čáry). V takovém případě může problém vyřešit nastavení této položky
na <Zap>.
Vyp
Zap
391
Nastavení seznamu nabídky
(
)
čáru>
<Uživatelská údržba>
<Spec. režim tisku>
<Opravit bílou
<Vyp> nebo <Zap>
● Jestliže vyberete možnost <Zap>, mohou se objevit zdvojené obrazy.
Oprava pruhů ČB
Pokud se na výtiscích objeví pruhy, je možné, že se vyčištěním fixační jednotky problém neodstraní. V takovém
případě může nastavení této položky na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
ČB>
<Uživatelská údržba>
<Spec. režim tisku>
<Oprava pruhů
<Vyp> nebo <Zap>
● Pokud vyberete <Zap>, rychlost tisku bude nižší. Mohou se také objevit zdvojené obrazy.
Kor bar běžn pap 2
Dojde-li během tisku k nerovnoměrnosti lesku, může nastavení této položky na možnost <Zap> vyřešit tento
problém.
Vyp
Zap
(
2>
)
<Uživatelská údržba>
<Spec. režim tisku>
<Kor bar běžn pap
<Vyp> nebo <Zap>
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost
<Zap>. Priorita položek nabídky nastavení(P. 406)
392
Nastavení seznamu nabídky
Omezení zdvojení 3
Pokud se na výtisku objevuje na stejné stránce zdvojený obraz, může nastavení této položky na hodnotu <Zap>
vyřešit tento problém.
Vyp
Zap
(
)
3>
<Uživatelská údržba>
<Spec. režim tisku>
<Omezení zdvojení
<Vyp> nebo <Zap>
● Nastavení na hodnotu <Zap> může mít za následek nerovnoměrný tisk.
Sp. režim fixace 2
V závislosti na podmínkách prostředí může z vytištěných obrazů odpadávat toner. V takovém případě může
nastavení této položky na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
2>
<Uživatelská údržba>
<Spec. režim tisku>
<Sp. režim fixace
<Vyp> nebo <Zap>
● Toto nastavení nemusí být povoleno, pokud je v určitých položkách nastavení vybrána možnost
<Zap>. Priorita položek nabídky nastavení(P. 406)
Omezit vzor kapek
Pokud je sytost tisku vytištěných obrazů nerovnoměrná takovým způsobem, že výtisk vypadá jako vzor kapek
vody, nastavení této položky na hodnotu <Zap> může tento problém vyřešit.
Vyp
Zap
(
kapek>
)
<Uživatelská údržba>
<Spec. režim tisku>
<Vyp> nebo <Zap>
393
<Omezit vzor
Nastavení seznamu nabídky
● Vyberete-li možnost <Zap>, může se snížit kvalita tisku.
Spec. režim tisku E
Dochází-li při nepřetržitém tisku ke vzniku zdvojených obrazů, může nastavení této položky na jinou hodnotu
než <Vyp> vyřešit tento problém. Efekt zlepšení je silnější, když je nastaven <Režim 2>, než když je nastaven
<Režim 1>.
Vyp
Režim 1
Režim 2
(
)
<Uživatelská údržba>
<Spec. režim tisku E>
Vyberte režim
● Výběr možnosti <Režim 1> nebo <Režim 2> může mít za následek nerovnoměrnou sytost tisku.
Aktualizace firmwaru
Upgraduje firmware zařízení.
(
připojení
)
<Uživatelská údržba>
<Aktualizace firmwaru>
<Ano>
Výběr způsobu připojení
Vyberte způsob připojení počítače, který provede aktualizaci firmwaru.
První kalibrace
Zadejte, kdy se po zapnutí napájení automaticky provede kalibrace.
394
Vyberte způsob
Nastavení seznamu nabídky
Po úlohách
Ihned
(
)
<Uživatelská údržba>
<První kalibrace>
<Po úlohách> nebo
<Ihned>
<Po úlohách>
Automaticky spustí kalibraci po dokončení první tiskové úlohy po zapnutí napájení.
<Ihned>
Automaticky spustí kalibraci ihned po zapnutí napájení.
● Pokud vyberete možnost <Ihned>, nějakou dobu trvá, než je zařízení připravené k tisku.
Způsob podávání pap.
Toto nastavení zadejte, chcete-li dokument tisknout na papír s logy. Chcete-li tisknout na papír s logy, je třeba změnit
umístění lícové strany papíru ve zdroji papíru podle toho, zda tisknete jednostranně, nebo oboustranně. Změníte-li
však nastavení na možnost <Priorita tisk. str.>, lze papír vkládat lícem dolů při jednostranném i oboustranném tisku.
Další informace získáte v části Vkládání předtištěného papíru(P. 55) .
Priorita rychlosti
Priorita tisk. str.
(
papíru
)
<Uživatelská údržba>
<Způsob podávání pap.>
<Priorita rychlosti> nebo <Priorita tisk. str.>
Výběr zdroje papíru
Vyberte zdroj papíru, u něhož chcete změnit nastavení Režim podávání papíru.
395
Vyberte zdroj
Nastavení seznamu nabídky
<Priorita rychlosti>
Při používání papíru s předtištěným logem je potřeba změnit, která strana je nahoru, podle toho, zda
provádíte jednostranný, nebo oboustranný tisk.
● Pokud se nechcete zabývat tím, na kterou stranu tisknout, doporučujeme vybrat možnost <Priorita
rychlosti>.
<Priorita tisk. str.>
Chcete-li tisknout na určitou stranu papíru, není třeba obracet papír ve zdroji papíru, ať už je vybrán
jednostranný, nebo oboustranný tisk.
● I když je vybrána možnost <Priorita tisk. str.> pro zdroj papíru (
Použitelný papír(P. 553) ), je zakázána a
zařízení pracuje stejně, jako když je vybrána možnost <Priorita rychlosti>. V tomto případě zaveďte papír
stejně, jako když je vybrána možnost <Priorita rychlosti> ( Vkládání předtištěného papíru(P. 55) ).
● Pokud vyberete <Priorita tisk. str.>, rychlost jednostranného tisku bude nižší.
Upr.tepl.pohot. rež.
Vyberte, zda chcete upravit teplotu fixační jednotky. Vyberete-li možnost <Zap>, doba potřebná k spuštění tisku se
pravděpodobně zkrátí.
Vyp
Zap
(
)
<Uživatelská údržba>
<Upr.tepl.pohot. rež.>
<Vyp> nebo
<Zap>
● Nastavení hodnoty <Zap> zvyšuje spotřebu energie při spuštění zařízení.
Zobrazit seznam úloh
Vyberte, zda chcete zobrazit seznam dat, která se tisknou a čekají na tisk, když na ovládacím panelu stisknete
(
).
Vyp
Zap
396
Nastavení seznamu nabídky
(
● Pokud stisknete
)
(
<Uživatelská údržba>
<Zobrazit seznam úloh>
<Vyp> nebo <Zap>
), když je vybrána možnost <Vyp>, aktuální probíhající tisková úloha bude
zrušena.
Úpr. výstupu papíru
Pokud při použití víceúčelové přihrádky často dochází k uvíznutí papíru, může nastavení této položky na možnost
<Zap> vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
<Úpr. výstupu papíru>
<Vyp> nebo
<Zap>
● Pokud vyberete <Zap>, rychlost tisku bude nižší.
Nes. zm. sil. bar. 3
Dojde-li při tisku na silný papír k neshodě barev, problém může vyřešit změna tohoto nastavení.
Režim 1
Režim 2
(
)
<Uživatelská údržba>
<Nes. zm. sil. bar. 3>
2>
397
<Režim 1> nebo <Režim
Nastavení seznamu nabídky
● Míra zlepšení se může lišit v závislosti papíru, který chcete k tisku použít. Nesplňuje-li výsledek tisku vaše
očekávání, zkuste pro tisk toto nastavení přepnout mezi možnostmi <Režim 1> a <Režim 2>.
Korekce neshody bar.
Dochází-li k neshodě barev, může nastavení této položky na možnost <Zap> vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
<Korekce neshody bar.>
<Vyp> nebo
<Zap>
● Pokud vyberete <Zap>, rychlost tisku bude nižší.
Oprava sytosti ČB
Pokud je položka <Barevný režim> ( Barevný režim(P. 362) ) v části <Kvalita tisku> nebo <Barevný režim> ( Tisk z
paměti USB (Přímý tisk z USB)(P. 81) ) v nastavení tisku pro Přímý tisk z USB nastavena na možnost <Auto (Barvy/
Černá)> nebo <Černá>, na výtisku se mohou objevit vodorovné pruhy nebo může dojít k nerovnoměrné sytosti tisku. V
takovém případě může změna nastavení této položky vyřešit tento problém.
Vyp
Režim 1
Režim 2
(
)
<Uživatelská údržba>
<Oprava sytosti ČB>
Vyberte režim
● Zadáte-li <Režim 1>, nastavte u zdroje papíru, který chcete použít, položku <Auto.zjist. typ pap.> na možnost
<Nepoužít>. Auto.zjist. typ pap.(P. 478)
● Je-li zadána možnost <Režim 1> nebo <Režim 2>, tonery CMYK se spotřebovávají i při černobílém tisku, a to
v závislosti na použitém typu papíru. Může se také snížit rychlost tisku.
● Je-li zadána možnost <Vyp>, může při černobílém tisku docházet k nerovnoměrné sytosti tisku.
398
Nastavení seznamu nabídky
Rychlost tisku POP
Není-li kvalita tisku přijatelná, když máte při tisku v ovladači tiskárny nakonfigurovanou možnost [Optimalizace tisku
reklamních poutačů], doporučujeme zadat možnost <Režim 2>. Výsledkem budou výtisky POP s živějšími tóny barev.
Další informace o [Optimalizace tisku reklamních poutačů] najdete v příručkách k příslušným ovladačům na webu
s online příručkami.
Režim 1
Režim 2
(
)
<Uživatelská údržba>
<Rychlost tisku POP>
<Režim 1> nebo <Režim
2>
● Pokud vyberete možnost <Režim 2>, rychlost tisku bude nižší.
● Je-li nakonfigurována možnost [Optimalizace tisku reklamních poutačů], doporučujeme také nakonfigurovat
následující položky.
- <Režim upoz. na toner>
- <Auto kalibrace POP>
Kor bar tisku POP
Dojde-li při tisku POP k nerovnoměrné sytosti tisku, když je nakonfigurována položka [Optimalizace tisku reklamních
poutačů], zadejte možnost <Zap>.
Vyp
Zap
(
)
<Uživatelská údržba>
<Kor bar tisku POP>
<Vyp> nebo <Zap>
● Jestliže vyberete možnost <Zap>, sytost tisku může být světlejší.
● Je-li nakonfigurována možnost [Optimalizace tisku reklamních poutačů], doporučujeme také nakonfigurovat
následující položky.
- <Režim upoz. na toner>
- <Auto kalibrace POP>
399
Nastavení seznamu nabídky
Režim upoz. na toner
Časování můžete změnit tak, aby se zobrazila zpráva při nízké hladině toneru. <Tisk POP> zobrazuje zprávu dříve než
<Standardní tisk>. Když je v ovladači tiskárny nakonfigurována možnost [Optimalizace tisku reklamních poutačů],
nemusí být kvalita výtisku přijatelná, pokud zbývá malé množství toneru. Doporučujeme proto zadat možnost <Tisk
POP>. Další informace o [Optimalizace tisku reklamních poutačů] najdete v příručkách k příslušným ovladačům na
webu s online příručkami.
Standardní tisk
Tisk POP
(
)
<Uživatelská údržba>
<Režim upoz. na toner>
<Standardní tisk>
nebo <Tisk POP>
● Když je zadána možnost <Tisk POP>, nastavení následujících položek nemá žádný účinek.
- <Časov. kontr. toneru>
Časov. kontr. toneru(P. 402)
- <Urč.čas.kontr.toneru>
Urč.čas.kontr.toneru(P. 403)
● Když zadáte možnost <Tisk POP>, doporučujeme také nakonfigurovat následující položky.
- <Rychlost tisku POP>
- <Auto kalibrace POP>
Auto kalibrace POP
Můžete změnit typ kalibrace, která se bude automaticky provádět. Kromě běžné kalibrace jde o kalibraci, která provede
korekci neshody barevných odstínů, k níž došlo při tisku POP. Když je v ovladači tiskárny nakonfigurována možnost
[Optimalizace tisku reklamních poutačů], doporučujeme vždy zadat možnost <Zap>. Další informace o [Optimalizace
tisku reklamních poutačů] najdete v příručkách k příslušným ovladačům na webu s online příručkami.
Vyp
Zap
(
)
<Uživatelská údržba>
<Auto kalibrace POP>
<Vyp> nebo <Zap>
● Když zadáte možnost <Zap>, kalibrace bude trvat déle. Může to také mít vliv na životnost tonerových kazet.
400
Nastavení seznamu nabídky
● Je-li nakonfigurována možnost [Optimalizace tisku reklamních poutačů], doporučujeme také nakonfigurovat
následující položky.
- <Režim upoz. na toner>
Nast. import/export
Data uložená v zařízení a data z nastavení možností nabídek je možné přenést a uložit do paměťového zařízení USB
připojeného k přístroji. Exportovaná data lze importovat. Při použití stejného modelu mohou jiné přístroje importovat
data exportovaná z tohoto přístroje a naopak.
IMPORT
Můžete importovat data, která byla zapsána ze zařízení do paměťového zařízení USB.
(
)
export>
<Uživatelská údržba>
<IMPORT>
importovat
<Nast. import/
<Ano>
Zadejte heslo
Vyberte soubor, který chcete
Přečtěte si zprávu
EXPORT
Data uložená v zařízení a data z nastavení možností nabídek je možné uložit do paměťového zařízení USB.
(
)
export>
<Uživatelská údržba>
<EXPORT>
<Nast. import/
Zadejte heslo
Heslo (potvrdit)
Přečtěte si
zprávu
● Pro tyto účely můžete použít jeden z portů USB na levé či pravé straně zařízení. Jsou-li k oběma těmto
portům USB připojena paměťová zařízení USB, data se importují a exportují prostřednictvím portu na pravé
straně.
● Pokud se při připojené USB paměti zobrazí obrazovka <Připraveno k tisku souborů z jednotky USB.>,
stiskněte tlačítko
(
).
● Podrobné informace o importu/exportu dat nastavení najdete v
dat(P. 308) .
Ukládání/načtení registrovaných
Četnost kalibrace
Zadejte frekvenci automatické kalibrace. Dochází-li často k neshodě barev, nastavte tuto položku na možnost <Vysoká>
nebo <Velmi vysoká>.
Standardní
Vysoká
Velmi vysoká
401
Nastavení seznamu nabídky
(
)
<Uživatelská údržba>
<Četnost kalibrace>
Nastavte četnost
Upozornění k čištění
Vyberte, zda chcete zobrazit zprávu, která vás vyzve k vyčištění fixační jednotky.
Vyp
Zap
(
)
<Uživatelská údržba>
<Upozornění k čištění>
<Vyp> nebo <Zap>
Načas. upoz. na čiš. *
Pokud jste možnost <Upozornění k čištění> nastavili na <Zap>, můžete zadat, kdy se má zobrazit zpráva s výzvou k
vyčištění fixační jednotky podle počtu vytištěných stran a v jednotkách 1000. Konfigurační strana vám umožňuje
zkontrolovat, kolik stran můžete potisknout, než se zobrazí zpráva s výzvou. ( Konfigurační strana(P. 523) )
1000
až 50000
(
)
<Uživatelská údržba>
vytištěných stran pomocí
<Načas. upoz. na čiš.>
Zadejte počet
nebo
Časov. kontr. toneru
Pokud chcete změnit, kdy se má zobrazit zpráva upozorňující na docházející toner, vyberte možnost <Vlastní>.
Výchozí
Vlastní
(
)
<Uživatelská údržba>
<Časov. kontr. toneru>
<Vlastní>
402
<Výchozí> nebo
Nastavení seznamu nabídky
Urč.čas.kontr.toneru *
Pokud je možnost <Časov. kontr. toneru> nastavena na hodnotu <Vlastní>, zadejte, kdy se má zpráva zobrazit.
1 až 20
až 99 (%)
(
)
<Uživatelská údržba>
<Urč.čas.kontr.toneru>
Pomocí číselných
tlačítek zadejte množství zbývajícího toneru v kazetě
Časov. kontr. bubnu
Chcete-li změnit časování zobrazení příslušné zprávy, když se přiblíží čas výměny bubnové kazety, vyberte možnost
<Vlastní>.
Výchozí
Vlastní
(
)
<Uživatelská údržba>
<Časov. kontr. bubnu>
<Výchozí> nebo
<Vlastní>
Urč.časov.kontr.bubn *
Pokud jste položku <Časov. kontr. bubnu> nastavili na možnost <Vlastní>, zadejte časování zobrazení zprávy.
1 až 20
až 99 (%)
(
)
<Uživatelská údržba>
<Urč.časov.kontr.bubn>
tlačítek zadejte zbývající množství bubnové kazety
Akce když není toner
Zadejte, zda chcete pokračovat v tisku, když tonerová kazeta dosáhne konce životnosti.
Pokračovat v tisku
Pozastavit tisk
Zastavit tisk
403
Pomocí číselných
Nastavení seznamu nabídky
(
)
<Uživatelská údržba>
<Akce když není toner>
Vyberte operaci pro
tisk
<Pokračovat v tisku>
Když tonerová kazeta dosáhne konce životnosti, zobrazí se zpráva <Vyměňte tonerovou kazetu X.>, ale tisk
může pokračovat.
<Pozastavit tisk>
Když tonerová kazeta dosáhne konce životnosti, zobrazí se zpráva <Konec životnosti. Vyměňte tonerovou
(
).
kazetu X.> a tisk je dočasně zastaven. Chcete-li pokračovat v tisku, stiskněte
<Zastavit tisk>
Když tonerová kazeta dosáhne konce životnosti, zobrazí se zpráva <Vyměňte tonerovou kazetu X.> a tisk je
zastaven. Pokud je zobrazena tato zpráva, nemůžete pokračovat v tisku.
● „X“ ve výše uvedené zprávě představuje barvu CMYK.
● Budete-li pokračovat v tisku, kvalita tisku se může zhoršit.
Omez pruh pro pomalý
V závislosti na typu papíru nebo nastavení zařízení se na výtiscích mohou objevit vodorovné čáry. V takovém případě
může nastavení této položky na hodnotu <Zap> vyřešit tento problém.
Vyp
Zap
(
)
<Uživatelská údržba>
<Omez pruh pro pomalý>
<Zap>
404
<Vyp> nebo
Nastavení seznamu nabídky
Snížení kraj. skvrn
Pokud se na spodním okraji výtisků objeví šmouhy, změna nastavení může tento problém vyřešit.
Vyp
Režim 1
Režim 2
(
)
<Uživatelská údržba>
<Snížení kraj. skvrn>
Vyberte režim
● Jestliže provádíte nepřetržitý tisk se zadanou možností <Režim 1> nebo <Režim 2> a počet stránek překročí
určitý konkrétní počet, spustí se automatické čištění a rychlost tisku se tím sníží.
Kontrola kondenzace
Tisk může být nevýrazný z důvodu kondenzace uvnitř hlavní jednotky. V takovém případě může nastavení této položky
na hodnotu <Auto> vyřešit tento problém.
Vyp
Auto
(
)
<Uživatelská údržba>
<Kontrola kondenzace>
<Auto>
405
<Vyp> nebo
Nastavení seznamu nabídky
Priorita položek nabídky nastavení
6867-04X
U následujících položek nabídky nastavení existuje pořadí priority. Jestliže je více položek nastaveno na možnost <Zap>,
projeví se pouze nastavení s nejvyšší prioritou. Nejvyšší prioritě odpovídá číslo 1, přičemž s rostoucím číslem priorita
klesá.
Důležitost
Nastavení
Sp. režim fixace 2(P. 393)
1
Sp. režim fixace 2
2
Sp. režim potaž.pap.
3
Korekce zvlnění
4
Sp. tenký papír H/H
5
Korekce zvrásnění
Korekce zvrásnění(P. 384)
6
Spec. režim obálky
Spec. režim obálky(P. 390)
7
Režim prevence fix.
Režim prevence fix.(P. 390)
8
Kor bar běžn pap 2
Kor bar běžn pap 2(P. 392)
Sp. režim potaž.pap.(P. 389)
Korekce zvlnění(P. 388)
Sp. tenký papír H/H(P. 390)
406
Nastavení seznamu nabídky
Režim tisku
6867-04Y
Všechna nastavení týkající se přepínání režimu tisku jsou uvedena s krátkým
popisem. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na používaných volitelných
možnostech nebo dalších položkách nastavení.
Autom. výběr režimu(P. 407)
Automaticky vybrat(P. 408)
Priorita režimu(P. 408)
◼ Typ režimu tisku
Režim automatického výběru Zařízení přejde do režimu automatického výběru, když je možnost <Automatický výběr> vybrána pro
<Autom. výběr režimu>. Zařízení automaticky rozliší data odeslaná z počítače a vybere režim tisku.
Tento režim běžně používejte při tisku z aplikace.
<PCL>
Režim pro tisk souboru PCL odeslaného z počítače.
<PS>
Režim pro tisk souboru PS odeslaného z počítače.
<PDF>
Režim pro tisk souboru PDF s použitím funkce přímého tisku nebo přímého tisku USB.
<XPS>
Režim pro tisk souboru XPS s použitím funkce přímého tisku nebo přímého tisku USB.
Autom. výběr režimu
Zadejte režim tisku, v němž zařízení pracuje.
Automatický výběr
PCL
PS
PDF
XPS
(
)
<Režim tisku>
<Autom. výběr režimu>
407
Vyberte režim tisku
Nastavení seznamu nabídky
Automaticky vybrat
Povolte nebo zakažte funkci automatického výběru režimu pro režimy tisku při režimu automatického výběru.
Vyp
Zap
(
)
<Režim tisku>
<Automaticky vybrat>
Vyberte režim
<Vyp> nebo <Zap>
tisku
● Pokud jsou všechny režimy tisku nastaveny na <Vyp>, pracuje zařízení v režimu tisku zadaném pro <Priorita
režimu>.
Priorita režimu
Zadejte režim tisku, který je automaticky vybrán, když zařízení nemůže identifikovat řídicí příkaz při režimu
automatického výběru.
Žádný
PCL
PS
PDF
XPS
(
)
<Režim tisku>
<Priorita režimu>
Vyberte režim přednostního
tisku
● Pokud vyberete možnost <Žádný>, zařízení automaticky určí režim tisku, když nemůže identifikovat řídicí
příkaz.
408
Nastavení seznamu nabídky
Nastavení specifická pro režim tisku
6867-050
Pomocí nabídky Nastavení můžete zadat nastavení specifická pro každý režim tisku.
Nastavení specifická pro režim tisku jsou popsána pro každý režim.
UFR II(P. 410)
PCL(P. 411)
Zobrazování(P. 417)
XPS(P. 427)
PDF(P. 438)
PS(P. 449)
409
Nastavení seznamu nabídky
UFR II
6867-051
Tato část popisuje nastavení dostupná při používání UFR II s řídicími příkazy. Výchozí
nastavení jsou označena křížkem ( ).
Uložit papír
Vyberte, zda chcete předcházet výstupu prázdných stran, pokud jsou obsaženy v dokumentech k tisku.
Vyp
Zap
(
)
<UFR II>
<Uložit papír>
410
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
PCL
6867-052
Všechna nastavení týkající se řídicích příkazů PCL jsou uvedena s krátkým popisem.
Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na dalších položkách nastavení nebo
na tom, zda je v zařízení nainstalována volitelná ROM.
Uložit papír(P. 411)
Orientace(P. 411)
Číslo písma(P. 412)
Velikost bodu(P. 412)
Výška(P. 412)
Řádky formulářů(P. 413)
Kód znaku(P. 413)
Vlastní velikost(P. 414)
Měrná jednotka(P. 414)
Rozměr X(P. 414)
Rozměr Y(P. 414)
Připojit CR k LF(P. 415)
Zvětšit šířk.tisk.A4(P. 415)
BarDIMM(P. 415)
FreeScape(P. 416)
Uložit papír
Určuje, zda zařízení bude mít na výstupu prázdnou stranu, kterou lze vytvořit v důsledku neexistujících dat mezi dvěma
kódy pro vyplnění formuláře odeslanými z aplikace.
Vyp
Zap
(
)
<PCL>
<Uložit papír>
Orientace
Umožňuje vám nastavit orientaci papíru.
Na výšku
Na šířku
411
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
(
)
<PCL>
<Orientace>
<Na výšku> nebo <Na šířku>
Číslo písma
Umožňuje vám nastavit výchozí písmo proto tuto funkci zařízení pomocí odpovídajících čísel písem. Platná čísla písem
jsou od 0 do 104.
0
až 104
(
)
<PCL>
<Číslo písma>
Pomocí číselných kláves zadejte číslo
portu
Velikost bodu *
Pokud číslo vybrané v možnosti <Číslo písma> je číslo proporčně rozloženého škálovatelného písma, zobrazí se tato
možnost v možnostech <PCL>. Umožňuje vám zadat velikost v bodech pro výchozí písmo. Velikost v bodech lze upravit
v krocích po 0,25 bodů.
4,00 až 12,00
až 999,75 (bod)
(
)
<PCL>
<Velikost bodu>
Pomocí číselných kláves zadejte hodnotu
nastavení
Výška *
Pokud číslo vybrané v možnosti <Číslo písma> je číslo škálovatelného písma s pevnou roztečí, možnost <Výška> se
zobrazí v možnostech <PCL. Umožňuje vám zadat rozteč výchozího písma. Rozteč lze upravit v krocích po 0,01 cpi
(počet znaků na palec).
0,44 až 10,00
až 99,99 (cpi)
(
)
<PCL>
<Výška>
nastavení
412
Pomocí číselných kláves zadejte hodnotu
Nastavení seznamu nabídky
Řádky formulářů
Umožňuje vám zadat počet řádků tisknutých na jedné straně. Zadat lze 5 až 128 řádků.
5 až 64
až 128 (řádky)
(
)
<PCL>
<Řádky formulářů>
Pomocí číselných kláves zadejte hodnotu
nastavení
Kód znaku
Umožňuje vám vybrat sadu symbolů nejvhodnější pro potřeby hostitelského počítače.
PC8
ROMAN8
ROMAN9
ISOL1
ISOL2
ISOL5
ISOL6
ISOL9
PC775
PC8DN
PC850
PC852
PC858
PC8TK
PC1004
WINL1
WINL2
WINL5
WINBALT
DESKTOP
PSTEXT
LEGAL
ISO4
ISO6
ISO11
ISO15
ISO17
ISO21
ISO60
ISO69
WIN 30
MCTEXT
PC864
ARABIC8
WINARB
PC866
ISOCYR
WINCYR
PC851
GREEK8
ISOGRK
PC8GRK
WINGRK
PC862
HEBREW7
HEBREW8
ISOHEB
(
)
<PCL>
<Kód znaku>
413
Vyberte kód znaku
Nastavení seznamu nabídky
Vlastní velikost
Umožňuje vám zadat vlastní velikost papíru. Pokud vyberete možnost <Nastavit>, můžete zadat vlastní velikost.
Nenastavovat
Nastavit
(
)
<PCL>
<Vlastní velikost>
<Nastavit> nebo <Nenastavovat>
Měrná jednotka *
Umožňuje vám zadat měrnou jednotku, kterou chcete používat k zadání vlastní velikosti papíru.
Milimetry
Palce
(
)
<PCL>
<Měrná jednotka>
<Milimetry> nebo <Palce>
Rozměr X *
Umožňuje vám zadat rozměr X vlastního papíru. Rozměr X lze upravit mezi 64,0 mm a 320,0 mm v krocích po 0,1 mm.
64,0 až 304,8
až 320,0 (mm)
(
)
<PCL>
<Rozměr X>
Pomocí
/
zadejte hodnotu
nastavení
Rozměr Y *
Umožňuje vám zadat rozměr Y vlastního papíru. Rozměr Y lze upravit mezi 120 mm a 1200 mm v krocích po 0,1 mm.
120 až 457,2
až 1200 (mm)
414
Nastavení seznamu nabídky
(
)
<PCL>
<Rozměr Y>
Pomocí
/
zadejte hodnotu
nastavení
Připojit CR k LF
Umožňuje vám zadat, zda chcete přidat nový řádek (CR) po přijetí kódu posunu o řádek (LF).
Ano
Ne
(
)
<PCL>
<Připojit CR k LF>
<Ano> nebo <Ne>
Zvětšit šířk.tisk.A4
Určuje, zda chcete rozšířit šířku tiskové oblasti papíru velikosti A4 na velikost Letter.
Vyp
Zap
(
)
<PCL>
<Zvětšit šířk.tisk.A4>
BarDIMM *
Můžete povolit nebo zakázat funkci tisku čárových kódů v zařízení.
Umožnit
Zakázat
415
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
(
)
<PCL>
<BarDIMM>
<Umožnit> nebo <Zakázat>
FreeScape *
Můžete zadat kód AEC (alternativní kód Escape), který se má používat pro příkazy čárových kódů, jestliže hostitelský
počítač nepodporuje standardní kód Escape.
Vyp
~
"
#
$
/
\
?
{
}
|
(
)
<PCL>
<FreeScape>
416
Vyberte kód Escape
Nastavení seznamu nabídky
Zobrazování
6867-053
Všechna nastavení týkající se obrazových souborů (soubory JPEG a TIFF) dostupných
pro funkci přímého tisku z USB, přímého tisku a tisku e-mailů jsou uvedeny s
krátkými popisy. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na používaných volitelných
možnostech nebo dalších položkách nastavení.
Orientace obrazu(P. 417)
Přiblížení(P. 418)
Poloha tisku(P. 418)
TIFF Spooler(P. 419)
Zobrazit varování(P. 419)
Tisk textu e-mailu(P. 420)
Omezit tisk e-mailu(P. 420)
Zvětšit tisk. oblast(P. 421)
Zdrojový profil RGB(P. 421)
Profil sim. CMYK(P. 422)
Výstupní profil(P. 422)
Způsob shody(P. 423)
Polotóny(P. 423)
Korek. foto.(jen CL)(P. 424)
Konverze odst. šedé(P. 426)
Orientace obrazu
Zadejte orientaci tisku obrázku.
Auto
Vertikální
Horizontální
(
)
<Zobrazování>
<Orientace obrazu>
<Auto>
Automaticky určí orientaci tisku založenou na šířce a výšce obrázku.
<Vertikální>
Vyberte při tisku obrázku, který je dlouhý na výšku.
417
Vyberte orientaci
Nastavení seznamu nabídky
<Horizontální>
Vyberte při tisku obrázku, který je dlouhý na šířku.
● Pokud zadané nastavení možnosti (<Vertikální> nebo <Horizontální>) neodpovídá orientaci obrázku, vytiskne
se zmenšený obrázek.
Přiblížení
Povolí nebo zakáže zvětšování/zmenšování obrázků. Výtisky se zvětší nebo zmenší a zachovají se původní proporce
obrázku.
Vyp
Auto
(
)
<Zobrazování>
<Přiblížení>
<Vyp> nebo <Auto>
<Vyp>
Když je obrázek v
Oblast tisku(P. 557) , je vytištěn v původní velikosti. Když je obrázek větší než
tisknutelná oblast, výtisky se zmenší.
<Auto>
Provede zvětšení nebo zmenšení výtisků podle oblasti tisku papíru.
Poloha tisku
Zadejte umístění, kam se má vytisknout obrázek.
Auto
Uprostřed
Nahoře vlevo
(
)
<Zobrazování>
<Poloha tisku>
418
Vyberte <Auto> nebo pozici
Nastavení seznamu nabídky
<Auto>
Pokud data TIFF obsahují informace, které určují polohu tisku, obrázek se vytiskne podle této informace, jinak
se vytiskne do středu papíru. Data JPEG se vždy tisknou na střed papíru.
<Uprostřed>
Obrázky se tisknou na střed papíru.
<Nahoře vlevo>
Obrázky se tisknou vlevo nahoru.
TIFF Spooler
Vyberte, zda chcete uložit data TIFF na kartu SD před jejich zpracováním k tisku. Nastavte tuto položku na <Zap>,
pokud se při tisku vyskytne chyba.
Vyp
Zap
(
)
nebo <Zap>
<Zobrazování>
<TIFF Spooler>
Proveďte tvrdý reset (
Zkontrolujte zprávu
<Vyp>
Provedení tvrdého resetu(P. 472) )
<Vyp>
Data TIFF se zpracovávají průběžně, jakmile jsou přijata, což snižuje dobu zpracování.
<Zap>
Všechna přijatá data TIFF se zpracovávají najednou, což snižuje výskyt chyb. Když je vložena karta SD, data se
uloží na kartu SD.
● Pokud není vložena žádná karta SD, soubory větší než 40 MB se nemusí vytisknout.
Zobrazit varování
Můžete zadat, jak se má tiskárna chovat, když dojde k chybě.
419
Nastavení seznamu nabídky
Vyp
Tisk
Panel
(
)
<Zobrazování>
<Zobrazit varování>
Vyberte, jak se má tiskárna
chovat
<Vyp>
Nevytiskne se obrázek a nezobrazí se chybová zpráva.
<Tisk>
Vytiskne se informace o chybě a nevytiskne se obrázek.
<Panel>
Nevytiskne se obrázek a chybová zpráva se zobrazí na ovládacím panelu.
Tisk textu e-mailu
Vyberte, zda chcete tisknout e-mailové zprávy, když provádíte funkci tisku e-mailů. Pokud vyberete <Vyp>, vytiskne se
pouze obrázek přiložený k e-mailu.
Vyp
Zap
(
)
<Zobrazování>
<Tisk textu e-mailu>
<Vyp> nebo <Zap>
Omezit tisk e-mailu *
Vyberte, zda chcete omezit počet stran e-mailové zprávy, když je možnost <Tisk textu e-mailu> nastavena na <Zap>.
Pokud vyberete možnost <Zap>, počet stran e-mailové zprávy k tisku je omezen na 5.
Vyp
Zap
420
Nastavení seznamu nabídky
(
)
<Zobrazování>
<Omezit tisk e-mailu>
<Vyp> nebo <Zap>
Zvětšit tisk. oblast
Zadejte, zda chcete tisknout obrázek úplným rozšířením
Oblast tisku(P. 557) podle velikosti papíru.
Vyp
Zap
(
)
<Zobrazování>
<Zvětšit tisk. oblast>
<Vyp> nebo <Zap>
● Pokud vyberete <Zap>, některé části obrázku mohou u okraje papíru chybět nebo může být papír v závislosti
na originálu částečně znečištěný.
Zdrojový profil RGB
Vyberte vhodný profil pro data RGB, který odpovídá používanému monitoru.
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
(
)
<Zobrazování>
<Zdrojový profil RGB>
Vyberte profil
<sRGB v3.0 (Canon)>
Použije se profil RGB, který je podobný průměrnému profilu většiny monitorů pro počítače se systémem
Windows. Pokud používáte monitor, který podporuje sRGB, můžete tisknout barvy, které se blíží barvám
zobrazeným na monitoru.
421
Nastavení seznamu nabídky
<Canon HDTV gama 1,5> až <Canon HDTV gama 2,4>
Pokud chcete upravit jas po srovnání mezi vytištěnými barvami a barvami zobrazenými na monitoru,
proveďte potřebná nastavení zde. Čím vyšší hodnota, tím tmavší vytištěné barvy.
Profil sim. CMYK
Při tisku dat CMYK můžete vybrat cíl simulace. Zařízení převede data CMYK na model barev CMYK závislý na zařízení na
základě vybraného cíle simulace.
Euro Standard v1.00
JapanColor(Canon)
U.S. Web Coated v1.0
(
)
<Zobrazování>
<Profil sim. CMYK>
Vyberte profil
<Euro Standard v1.00>
Použijte profil Euro Standard. Tisk se provede v barvách, které se blíží evropským tiskovým normám.
<JapanColor(Canon)>
Použijte profil JapanColor. Tisk se provede v barvách, které se blíží japonským tiskovým normám.
<U.S. Web Coated v1.0>
Použijte profil U.S. Web Coated. Tisk se provede v barvách, které se blíží americkým tiskovým normám.
Výstupní profil
Můžete vybrat vhodné profily pro data, které hodláte vytisknout.
Normal
Photo
(
)
<Zobrazování>
<Výstupní profil>
422
Vyberte profil
Nastavení seznamu nabídky
<Normal>
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám zobrazeným na monitoru.
<Photo>
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii.
Způsob shody
Zadejte, který prvek má mít prioritu před ostatními ve shodě barev pomocí <Zdrojový profil RGB>.
Percepční
Nasycení
Kolorimetrický
(
)
<Zobrazování>
<Způsob shody>
Vyberte metodu určení
shody
<Percepční>
Shoda se provede s prioritou na percepční.
<Nasycení>
Shoda se provede s prioritou na sytost.
<Kolorimetrický>
Shoda je provedena tak, že jsou hodnoty barev RGB reprodukovány co nejpřesněji.
Polotóny
Můžete vybrat metodu tisku k reprodukci polotónů (střední hodnoty mezi světlejšími a tmavšími oblastmi obrazu).
Rozlišení
Gradace
Difúze chyb
423
Nastavení seznamu nabídky
(
)
<Zobrazování>
<Polotóny>
Vyberte metodu k reprodukci
polotónů
<Rozlišení>
Zajistí jemný tisk s ostrou reprodukcí okrajů znaků. Tento režim tisku je vhodný pro tisk znaků a tenkých čar s
jasnými okraji.
<Gradace>
Zajistí tisk se stupňováním a čáry s hladkými okraji. Je vhodný pro tisk čísel nebo grafů obsahující oblasti s
odstupňováním.
<Difúze chyb>
Tento režim je vhodný pro tisk dat s textem a tenké linky a zakřivené linky dat z aplikací CAD atd.
● Stabilita textury a fixovaného toneru může být při použití nastavení <Difúze chyb> snížena.
Korek. foto.(jen CL) *
Proveďte nastavení pro funkce korekce fotografií či dalších podobných obrazových dat. Tato položka se zobrazí, když je
instalována karta SD.
Photo Optimizer PRO
Nastavte, zda chcete provádět tisk s automatickou korekcí kontrastu obrazových dat, vyvážení barev, sytosti a
gradace.
Vyp
Zap
(
PRO>
)
<Zobrazování>
<Korek. foto.(jen CL)>
<Vyp> nebo <Zap>
424
<Photo Optimizer
Nastavení seznamu nabídky
Korekce červen. očí
„Efekt červených očí“ je jev, který způsobuje, že oči lidských objektů fotografovaných pomocí blesku či výbojky
vypadají nepřirozeně červeně. Nastavte, zda chcete automaticky detekovat efekt červených očí na obrázku a
opravit příslušné části, aby jejich zbarvení bylo přirozené. Můžete vybrat úroveň intenzity korekce ze tří.
Korekce červen. očí
Nastavte, zda chcete provést korekci efektu červených očí.
Vyp
Zap
(
)
<Zobrazování>
<Korek. foto.(jen CL)>
<Korekce červen. očí>
očí>
<Korekce červen.
<Vyp> nebo <Zap>
Úrov.korek. červ.očí *
Zadejte úroveň intenzity korekce, když je možnost <Korekce červen. očí> nastavena na <Zap>.
Slabá
Standardní
Silná
(
)
očí>
<Zobrazování>
<Korek. foto.(jen CL)>
<Úrov.korek. červ.očí>
<Korekce červen.
Vyberte úroveň
Rozjasnění tváře
V případě fotografií, na nichž jsou tváře lidských objektů nepřirozeně tmavé v důsledku podsvícení nebo
podexponování, nastavte, zda chcete obrázek tisknout s korekcí celého jasu tak, aby tvář objektů byla přirozeně
jasná. Můžete vybrat úroveň intenzity korekce ze tří.
Rozjasnění tváře
Nastavte, zda chcete provést korekci pro zjasnění tváře objektů.
Vyp
Zap
(
)
<Zobrazování>
tváře>
<Korek. foto.(jen CL)>
<Rozjasnění tváře>
<Rozjasnění
<Vyp> nebo <Zap>
Úr. rozjasnění tváře *
Zadejte úroveň intenzity korekce, když je možnost <Rozjasnění tváře> nastavena na <Zap>.
Slabá
425
Nastavení seznamu nabídky
Standardní
Silná
(
)
<Zobrazování>
tváře>
<Korek. foto.(jen CL)>
<Úr. rozjasnění tváře>
<Rozjasnění
Vyberte úroveň
Konverze odst. šedé *
Můžete vybrat metodu převodu barevných tiskových dat na černobílá data.
sRGB
NTSC
Jednotné RGB
(
)
<Zobrazování>
<Konverze odst. šedé>
Vyberte způsob
převodu
<sRGB>
Barevná data se převedou na černobílá s důrazem na rozdílnost barev, takže se dosáhne plynulého
odstupňování.
<NTSC>
Barevná data se převedou na černobílá s důrazem na zobrazení ekvivalentní televizním snímkům (NTSC).
<Jednotné RGB>
Barevná data se převedou na černobílá s cílem ekvalizovat všechny úrovně RGB pouze na základě jasu.
● Tato položka je dostupná, pokud je možnost <Barevný režim> (
tisku> nastavena na <Černá>.
426
Barevný režim(P. 362) ) pod <Kvalita
Nastavení seznamu nabídky
XPS
6867-054
Všechna nastavení týkající se souborů XPS dostupných pro přímý tisk z USB a přímý
tisk jsou uvedena s krátkým popisem. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na dalších položkách nastavení.
Režim shody(P. 427)
Nastav. profilu ICC(P. 428)
Nastavení gama(P. 430)
Korek. foto.(jen CL)(P. 431)
Polotóny(P. 433)
Kompenzace šedé(P. 434)
Zdokon. vyhlazování(P. 435)
Konverze odst. šedé(P. 436)
Režim shody
Vyberte režim zpracování pro barevný tisk.
ICC profil
Gama
(
)
<XPS>
<Režim shody>
<ICC profil> nebo <Gama>
<ICC profil>
Použijte profil pro shodu barev.
<Gama>
Proveďte korekci barev nastavením hodnoty gama pro úpravu jasu.
427
Nastavení seznamu nabídky
Nastav. profilu ICC
Nastavte profil, který se má použít při provádění shody barev, a zadejte, který prvek má mít prioritu před ostatními.
Tuto položku můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Zdrojový profil RGB
Vyberte vhodný profil pro data RGB, který odpovídá používanému monitoru.
Text
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
Grafika
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
Obraz
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
(
RGB>
)
<XPS>
<Nastav. profilu ICC>
Vyberte typ obrazových dat
<Zdrojový profil
Vyberte profil
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<sRGB v3.0 (Canon)>
Použije se profil RGB, který je podobný průměrnému profilu většiny monitorů pro počítače se systémem
Windows. Pokud používáte monitor, který podporuje sRGB, můžete tisknout barvy, které se blíží barvám
zobrazeným na monitoru.
<Canon HDTV gama 1,5> až <Canon HDTV gama 2,4>
Pokud chcete upravit jas po srovnání mezi vytištěnými barvami a barvami zobrazenými na monitoru,
proveďte potřebná nastavení zde. Čím vyšší hodnota, tím tmavší vytištěné barvy.
428
Nastavení seznamu nabídky
● Tato položka je dostupná, pokud je pro možnost <Režim shody> vybráno nastavení <ICC profil>.
Výstupní profil
Můžete vybrat vhodné profily pro data, které hodláte vytisknout.
Text
Normal
Photo
Grafika
Normal
Photo
Obraz
Normal
Photo
(
)
<XPS>
obrazových dat
<Nastav. profilu ICC>
<Výstupní profil>
Vyberte typ
<Normal> nebo <Photo>
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Normal>
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám zobrazeným na monitoru.
<Photo>
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii.
● Tato položka je dostupná, pokud je pro možnost <Režim shody> vybráno nastavení <ICC profil>.
Způsob shody
Zadejte, který prvek má mít ve shodě barev prioritu před ostatními, pomocí <Zdrojový profil RGB>. Tuto položku
můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
429
Nastavení seznamu nabídky
Text
Percepční
Nasycení
Kolorimetrický
Grafika
Percepční
Nasycení
Kolorimetrický
Obraz
Percepční
Nasycení
Kolorimetrický
(
)
<XPS>
obrazových dat
<Nastav. profilu ICC>
<Způsob shody>
Vyberte typ
Vyberte metodu určení shody
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Percepční>
Shoda se provede s prioritou na percepční.
<Nasycení>
Shoda se provede s prioritou na sytost.
<Kolorimetrický>
Shoda je provedena tak, že jsou hodnoty barev RGB reprodukovány co nejpřesněji.
Nastavení gama
Nastavte, zda chcete provést korekci barev nastavením hodnoty gama pro úpravu jasu.
Korekce gama
Úprava jasu lze provést tak, aby jas nejjasnějších a nejtmavších částí originálu nebyl ve výsledku tisku ovlivněn.
Tuto položku můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Text
430
Nastavení seznamu nabídky
1.0
1.4
1.8
2.2
Grafika
1.0
1.4
1.8
2.2
Obraz
1.0
1.4
1.8
2.2
(
)
<XPS>
obrazových dat
<Nastavení gama>
<Korekce gama>
Vyberte typ
Vyberte hodnotu nastavení
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<1.0> až <2.2>
Nastavte tuto položku, když chcete upravit jas výtisků. <1.4> je standardní nastavení (bez korekce) a čím vyšší
je nastavená hodnota, tím bude tisk tmavší.
● Tato položka je dostupná, pokud je pro možnost <Režim shody> vybráno nastavení <Gama>.
Korek. foto.(jen CL)
Proveďte nastavení pro funkce korekce fotografií či dalších podobných obrazových dat.
Photo Optimizer PRO
Nastavte, zda chcete provádět tisk s automatickou korekcí kontrastu obrazových dat, vyvážení barev, sytosti a
gradace.
Vyp
431
Nastavení seznamu nabídky
Zap
(
)
<XPS>
PRO>
<Korek. foto.(jen CL)>
<Photo Optimizer
<Vyp> nebo <Zap>
Korekce červen. očí
„Efekt červených očí“ je jev, který způsobuje, že oči lidských objektů fotografovaných pomocí blesku či výbojky
vypadají nepřirozeně červeně. Nastavte, zda chcete automaticky detekovat efekt červených očí na obrázku a
opravit příslušné části, aby jejich zbarvení bylo přirozené. Můžete vybrat úroveň intenzity korekce ze tří.
Korekce červen. očí
Nastavte, zda chcete provést korekci efektu červených očí.
Vyp
Zap
(
)
očí>
<XPS>
<Korek. foto.(jen CL)>
<Korekce červen. očí>
<Korekce červen.
<Vyp> nebo <Zap>
Úrov.korek. červ.očí *
Zadejte úroveň intenzity korekce, když je možnost <Korekce červen. očí> nastavena na <Zap>.
Slabá
Standardní
Silná
(
očí>
)
<XPS>
<Korek. foto.(jen CL)>
<Úrov.korek. červ.očí>
<Korekce červen.
Vyberte úroveň
Rozjasnění tváře
V případě fotografií, na nichž jsou tváře lidských objektů nepřirozeně tmavé v důsledku podsvícení nebo
podexponování, nastavte, zda chcete obrázek tisknout s korekcí celého jasu tak, aby tvář objektů byla přirozeně
jasná. Můžete vybrat úroveň intenzity korekce ze tří.
Rozjasnění tváře
Nastavte, zda chcete provést korekci pro zjasnění tváře objektů.
Vyp
Zap
432
Nastavení seznamu nabídky
(
)
<XPS>
tváře>
<Korek. foto.(jen CL)>
<Rozjasnění tváře>
<Rozjasnění
<Vyp> nebo <Zap>
Úr. rozjasnění tváře *
Zadejte úroveň intenzity korekce, když je možnost <Rozjasnění tváře> nastavena na <Zap>.
Slabá
Standardní
Silná
(
)
<XPS>
rozjasnění tváře>
<Korek. foto.(jen CL)>
<Rozjasnění tváře>
<Úr.
Vyberte úroveň
Polotóny
Můžete vybrat metodu tisku k reprodukci polotónů (střední hodnoty mezi světlejšími a tmavšími oblastmi obrazu).
Difúze chyb
Tento režim je vhodný pro tisk dat s textem a tenké linky a zakřivené linky dat z aplikací CAD atd.
Vyp
Zap
(
)
<XPS>
<Polotóny>
<Difúze chyb>
<Vyp> nebo <Zap>
● Stabilita textury a fixovaného toneru může být při použití nastavení <Difúze chyb> snížena.
Rozlišení/gradace *
Vyberte metodu reprodukce polotónů, když je možnost <Difúze chyb> nastavena na <Vyp>. Tuto položku
můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Text
Rozlišení
Gradace
Grafika
Rozlišení
433
Nastavení seznamu nabídky
Gradace
Obraz
Rozlišení
Gradace
(
)
<XPS>
obrazových dat
<Polotóny>
<Rozlišení/gradace>
Vyberte typ
<Rozlišení> nebo <Gradace>
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Rozlišení>
Zajistí jemný tisk s ostrou reprodukcí okrajů znaků. Tento režim tisku je vhodný pro tisk znaků a tenkých čar s
jasnými okraji.
<Gradace>
Zajistí tisk se stupňováním a čáry s hladkými okraji. Je vhodný pro tisk čísel nebo grafů obsahující oblasti s
odstupňováním.
Kompenzace šedé
V případě černých nebo šedých dat s barevnými informacemi definujícími R=G=B vyberte, zda chcete tisknout pouze s
černým (K) tonerem nebo se čtyřbarevným tonerem CMYK. Tuto položku můžete nastavit pro každý typ obrazových dat
obsažených v jednom dokumentu.
Text
Vyp
Zap
Grafika
Vyp
Zap
Obraz
Vyp
Zap
434
Nastavení seznamu nabídky
(
)
<XPS>
<Kompenzace šedé>
Vyberte typ obrazových dat
<Vyp> nebo <Zap>
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Vyp>
Tiskne se čtyřbarevným tonerem CMYK. Reprodukce gradace tmavých barev je lepší než pomocí <Zap>.
<Zap>
Tiskne pouze s černým (K) tonerem. Neshodě barev kvůli použití barevného (CMY) toneru lze předejít.
Zdokon. vyhlazování
Proveďte nastavení pro režim vyhlazování, který umožňuje vyhlazený tisk okrajů čar, obrázků a textu.
Zdokon. vyhlazování
Zadejte, zda chcete povolit nebo zakázat režim vyhlazování. Okraje budou hladší, je-li zadána možnost
<Vyhlazený 2> spíše než možnost <Vyhlazený 1>.
Vyp
Vyhlazený 1
Vyhlazený 2
(
)
vyhlazování>
<XPS>
<Zdokon. vyhlazování>
<Zdokon.
Vyberte způsob zpracování
Grafika *
Zadejte, zda chcete použít režim vyhlazování na čáry a obrázky pokud je možnost <Zdokon. vyhlazování>
nastavena na <Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
435
Nastavení seznamu nabídky
(
)
<XPS>
<Zdokon. vyhlazování>
<Grafika>
<Vyp> nebo
<Zap>
Text *
Zadejte, zda chcete použít režim vyhlazování na text, pokud je možnost <Zdokon. vyhlazování> nastavena na
<Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
(
)
<XPS>
<Zdokon. vyhlazování>
<Text>
<Vyp> nebo
<Zap>
Konverze odst. šedé
Můžete vybrat metodu převodu barevných tiskových dat na černobílá data.
Text
sRGB
NTSC
Jednotné RGB
Grafika
sRGB
NTSC
Jednotné RGB
Obraz
sRGB
NTSC
Jednotné RGB
(
dat
)
<XPS>
<Konverze odst. šedé>
Vyberte způsob převodu
436
Vyberte typ obrazových
Nastavení seznamu nabídky
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<sRGB>
Barevná data se převedou na černobílá s důrazem na rozdílnost barev, takže se dosáhne plynulého
odstupňování.
<NTSC>
Barevná data se převedou na černobílá s důrazem na zobrazení ekvivalentní televizním snímkům (NTSC).
<Jednotné RGB>
Barevná data se převedou na černobílá s cílem ekvalizovat všechny úrovně RGB pouze na základě jasu.
● Tato položka je dostupná, pokud je možnost <Barevný režim> (
tisku> nastavena na <Černá>.
437
Barevný režim(P. 362) ) pod <Kvalita
Nastavení seznamu nabídky
PDF
6867-055
Všechna nastavení týkající se souborů PDF dostupných pro přímý tisk z USB a přímý
tisk jsou uvedena s krátkým popisem. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na dalších položkách nastavení.
Na velikost papíru(P. 438)
Zvětšit tisk. oblast(P. 438)
N na 1(P. 439)
Tisk komentáře(P. 439)
Nastav. profilu ICC(P. 439)
Čistě černý text(P. 443)
Černý přetisk(P. 444)
Jas(P. 445)
Polotóny(P. 445)
Smíšený přetisk(P. 446)
Zdokon. vyhlazování(P. 446)
Konverze odst. šedé(P. 447)
Na velikost papíru
Zadejte, zda chcete výtisky zvětšit nebo zmenšit podle
zachování původního poměru stran.
Oblast tisku(P. 557) papíru. Výtisky se zvětší nebo zmenší při
Vyp
Zap
(
)
<PDF>
<Na velikost papíru>
<Vyp> nebo <Zap>
Zvětšit tisk. oblast
Zadejte, zda chcete tisknout obrázek úplným rozšířením
Oblast tisku(P. 557) podle velikosti papíru.
Vyp
Zap
(
)
<PDF>
<Zvětšit tisk. oblast>
438
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
● Pokud vyberete <Zap>, některé části obrázku mohou u okraje papíru chybět nebo může být papír v závislosti
na originálu částečně znečištěný.
N na 1
Zadejte, zda tisknout více stránek na jeden list při zmenšené velikosti postupným skládáním na list z levé horní části.
Chcete-li například tisknout čtyři stránky na jeden list, vyberte <4 na 1>.
Vyp
2 na 1
4 na 1
6 na 1
8 na 1
9 na 1
16 na 1
(
)
<PDF>
<N na 1>
Vyberte metodu agregace
Tisk komentáře
Vyberte, zda tisknout poznámky. Pokud vyberete možnost <Auto>, poznámky v souboru PDF se vytisknou.
Vyp
Auto
(
)
<PDF>
<Tisk komentáře>
<Vyp> nebo <Auto>
Nastav. profilu ICC
Nastavte profil, který se má použít při provádění shody barev, a zadejte, který prvek má mít prioritu před ostatními.
Zdrojový profil RGB
Vyberte vhodný profil pro data RGB, který odpovídá používanému monitoru.
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
Žádný
439
Nastavení seznamu nabídky
(
)
RGB>
<PDF>
<Nastav. profilu ICC>
<Zdrojový profil
Vyberte profil
<sRGB v3.0 (Canon)>
Použije se profil RGB, který je podobný průměrnému profilu většiny monitorů pro počítače se systémem
Windows. Pokud používáte monitor, který podporuje sRGB, můžete tisknout barvy, které se blíží barvám
zobrazeným na monitoru.
<Canon HDTV gama 1,5> až <Canon HDTV gama 2,4>
Pokud chcete upravit jas po srovnání mezi vytištěnými barvami a barvami zobrazenými na monitoru,
proveďte potřebná nastavení zde. Čím vyšší hodnota, tím tmavší vytištěné barvy.
<Žádný>
Provádí separaci barev z dat RGB do CMYK bez použití profil zdroje RGB.
Profil sim. CMYK
Při tisku dat CMYK můžete vybrat cíl simulace. Zařízení převede data CMYK na model barev CMYK závislý na
zařízení na základě vybraného cíle simulace.
Euro Standard v1.00
JapanColor(Canon)
U.S. Web Coated v1.0
Žádný
(
)
<PDF>
<Nastav. profilu ICC>
<Profil sim. CMYK>
Vyberte
profil
<Euro Standard v1.00>
Použijte profil Euro Standard. Tisk se provede v barvách, které se blíží evropským tiskovým normám.
440
Nastavení seznamu nabídky
<JapanColor(Canon)>
Použijte profil JapanColor. Tisk se provede v barvách, které se blíží japonským tiskovým normám.
<U.S. Web Coated v1.0>
Použijte profil U.S. Web Coated. Tisk se provede v barvách, které se blíží americkým tiskovým normám.
<Žádný>
Tiskne data CMYK pomocí modelu barev CMYK závislého na zařízení bez použití profilu simulace CMYK.
● Když je tato položka nastavena na <Žádný>, gradace tmavých barev se může v závislosti na datech
zhroutit.
Škála odstínů šedé
Nastavte, zda chcete převést šedá data na data CMYK pomocí profilu stupňů šedé v zařízení.
Vyp
Zap
(
)
<PDF>
<Nastav. profilu ICC>
<Škála odstínů šedé>
<Vyp>
nebo <Zap>
<Vyp>
Tiskne pouze s tonerem K (černý) bez převodu dat na data CMYK.
<Zap>
Převádí data na data CMYK pomocí profilu stupňů šedé v zařízení. Tisk se může provést pouze s tonerem K
(černá) v závislosti na nastavení možnosti <Výstupní profil> nebo <Čistě černý text>.
Výstupní profil
Můžete vybrat vhodné profily pro data, které hodláte vytisknout. Můžete tuto položku nastavit pro každý typ
obrazových dat obsažených v jednom dokumentu.
Text
PS normální
PS foto
PS TR normální
441
Nastavení seznamu nabídky
PS TR foto
Grafika
PS normální
PS foto
PS TR normální
PS TR foto
Obraz
PS normální
PS foto
PS TR normální
PS TR foto
(
)
<PDF>
obrazových dat
<Nastav. profilu ICC>
<Výstupní profil>
Vyberte typ
Vyberte profil
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<PS normální>
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám zobrazeným na monitoru.
<PS foto>
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii.
<PS TR normální>
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám zobrazeným na monitoru a že
je dobře kontrolováno stékání toneru do textu a jemných čar.
<PS TR foto>
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii a že je dobře kontrolováno stékání toneru
do textu a jemných čar.
Tato položka je zakázána, když je provedeno některé z následujících nastavení.
● <Zdrojový profil RGB> je nastaveno na <Žádný>.
442
Nastavení seznamu nabídky
● <Profil sim. CMYK> je nastaveno na <Žádný>.
● <Škála odstínů šedé> je nastaveno na <Vyp>.
Způsob shody
Zadejte, který prvek má mít prioritu před ostatními ve shodě barev pomocí <Zdrojový profil RGB>.
Percepční
Nasycení
Kolorimetrický
(
)
<PDF>
<Nastav. profilu ICC>
<Způsob shody>
Vyberte
metodu určení shody
<Percepční>
Shoda se provede s prioritou na percepční.
<Nasycení>
Shoda se provede s prioritou na sytost.
<Kolorimetrický>
Shoda se provede tak, že rozdíl barev mezi originály a výtisky je minimální.
● Tato položka je zakázána, pokud je pro možnost <Zdrojový profil RGB> vybráno nastavení <Žádný>.
Čistě černý text
Pro černý text, jehož barevné informace definuje „R=G=B=0%“, „C=M=Y=100%“ nebo „C=M=Y=0%/K=100%“, vyberte,
zda jej chcete tisknout pouze tonerem K (černá) nebo podle nastavení <Výstupní profil>.
Vyp
Zap
(
)
<PDF>
<Čistě černý text>
443
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
<Vyp>
Tiskne podle nastavení <Výstupní profil>. Výsledek tisku může být lepší než pomocí možnosti <Zap> v
závislosti na tiskových datech.
<Zap>
Černý text se vytiskne pouze s tonerem K (černá). Na rozdíl od tisku s barevným tonerem (CMY) se neobjeví
šmouhy barevného toneru na okrajích. Doporučujeme toto nastavení běžně používat.
Černý přetisk *
Nastavte, jak tisknout, když je černý text na barevném pozadí nebo barevném obrázku. Tato položka se nezobrazí,
jestliže je možnost <Čistě černý text> nastavena na <Vyp>.
Vyp
Zap
(
)
<PDF>
<Černý přetisk>
<Vyp> nebo <Zap>
<Vyp>
Nejprve se vytisknou data po tom, co je černý text vyňat z barevného pozadí nebo obrázku, čímž vznikne
příslušné bílé místo, a potom se černý text vytiskne na toto bílé místo. Tisk může být slabší než s možností
<Zap>, a okraje textu mohou být bíle lemovány.
<Zap>
Nejprve se vytiskne pouze barevné pozadí nebo obrázek a potom černý text se vytiskne na pozadí nebo
obrázek.
444
Nastavení seznamu nabídky
Jas
Můžete nastavit jas celého obrazu v krocích po 5 %. Čím je hodnota nižší, tím je obraz světlejší.
85 až 100
až 115 (%)
(
)
<PDF>
<Jas>
Pomocí
/
zadejte hodnotu nastavení
Polotóny
Můžete vybrat metodu tisku k reprodukci polotónů (střední hodnoty mezi světlejšími a tmavšími oblastmi obrazu).
Difúze chyb
Tento režim je vhodný pro tisk dat s textem a tenké linky a zakřivené linky dat z aplikací CAD atd.
Vyp
Zap
(
)
<PDF>
<Polotóny>
<Difúze chyb>
<Vyp> nebo
<Zap>
● Stabilita textury a fixovaného toneru může být při použití nastavení <Difúze chyb> snížena.
Rozlišení/gradace *
Vyberte metodu reprodukce polotónů, když je možnost <Difúze chyb> nastavena na <Vyp>. Tuto položku
můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Text
Rozlišení
Gradace
Grafika
Rozlišení
Gradace
Obraz
Rozlišení
Gradace
445
Nastavení seznamu nabídky
(
)
<PDF>
obrazových dat
<Polotóny>
<Rozlišení/gradace>
Vyberte typ
<Rozlišení> nebo <Gradace>
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Rozlišení>
Zajistí jemný tisk s ostrou reprodukcí okrajů znaků. Tento režim tisku je vhodný pro tisk znaků a tenkých čar s
jasnými okraji.
<Gradace>
Zajistí tisk se stupňováním a čáry s hladkými okraji. Je vhodný pro tisk čísel nebo grafů obsahující oblasti s
odstupňováním.
Smíšený přetisk
Nastavte, zda mají být data CMYK, pro něž je nastaven přetisk, přetištěna jako kompozitní data.
Vyp
Zap
(
)
<PDF>
<Smíšený přetisk>
<Vyp> nebo <Zap>
● Nastavení této položky na <Zap> neumožňuje přetisk, pokud je možnost <Profil sim. CMYK> nastavena na
jinou možnost než <Žádný>.
Zdokon. vyhlazování
Proveďte nastavení pro režim vyhlazování, který umožňuje vyhlazený tisk okrajů čar, obrázků a textu.
446
Nastavení seznamu nabídky
Zdokon. vyhlazování
Zadejte, zda chcete povolit nebo zakázat režim vyhlazování. Okraje budou hladší, je-li zadána možnost
<Vyhlazený 2> spíše než možnost <Vyhlazený 1>.
Vyp
Vyhlazený 1
Vyhlazený 2
(
)
<PDF>
vyhlazování>
<Zdokon. vyhlazování>
<Zdokon.
Vyberte způsob zpracování
Grafika *
Zadejte, zda chcete použít režim vyhlazování na čáry a obrázky pokud je možnost <Zdokon. vyhlazování>
nastavena na <Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
(
)
<PDF>
<Zdokon. vyhlazování>
<Grafika>
<Vyp> nebo
<Zap>
Text *
Zadejte, zda chcete použít režim vyhlazování na text, pokud je možnost <Zdokon. vyhlazování> nastavena na
<Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
(
)
<PDF>
<Zdokon. vyhlazování>
<Zap>
Konverze odst. šedé *
Můžete vybrat metodu převodu barevných tiskových dat na černobílá data.
sRGB
NTSC
Jednotné RGB
447
<Text>
<Vyp> nebo
Nastavení seznamu nabídky
(
)
<PDF>
<Konverze odst. šedé>
Vyberte způsob převodu
<sRGB>
Barevná data se převedou na černobílá s důrazem na rozdílnost barev, takže se dosáhne plynulého
odstupňování.
<NTSC>
Barevná data se převedou na černobílá s důrazem na zobrazení ekvivalentní televizním snímkům (NTSC).
<Jednotné RGB>
Barevná data se převedou na černobílá s cílem ekvalizovat všechny úrovně RGB pouze na základě jasu.
● Tato položka je dostupná, pokud je možnost <Barevný režim> (
tisku> nastavena na <Černá>.
448
Barevný režim(P. 362) ) pod <Kvalita
Nastavení seznamu nabídky
PS
6867-056
Všechna nastavení týkající se řídicích příkazů PS jsou uvedena s krátkým popisem.
Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na dalších položkách nastavení.
Čas.limit úl.vypršel(P. 449)
Chyby při tisku PS(P. 449)
Nastav. profilu ICC(P. 450)
Jas(P. 455)
Polotóny(P. 455)
Smíšený přetisk(P. 456)
Čistě černý text(P. 454)
Černý přetisk(P. 454)
Zdokon. vyhlazování(P. 457)
Konverze odst. šedé(P. 458)
Čas.limit úl.vypršel
Pokud doba zadaná v této položce již vypršela od zahájení procesu úlohy, zařízení úlohu automaticky dokončí a přijme
další úlohu.
Pokud časový limit zadat nechcete, zadejte „0 sekund“.
0
až 3600 (sekundy)
(
)
<PS>
<Čas.limit úl.vypršel>
Pomocí číselných kláves zadejte
hodnotu nastavení
Chyby při tisku PS
Určuje, zda se při zjištění chyby PostScript vytiskne chybová stránka.
Vyp
Zap
(
)
<PS>
<Chyby při tisku PS>
449
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
Nastav. profilu ICC
Nastavte profil, který se má použít při provádění shody barev, a zadejte, který prvek má mít prioritu před ostatními.
Zdrojový profil RGB
Vyberte vhodný profil pro data RGB, který odpovídá používanému monitoru.
sRGB v3.0 (Canon)
Canon HDTV gama 1,5
Canon HDTV gama 1,8
Canon HDTV gama 2,4
Žádný
(
)
<PS>
<Nastav. profilu ICC>
<Zdrojový profil RGB>
Vyberte
profil
<sRGB v3.0 (Canon)>
Použije se profil RGB, který je podobný průměrnému profilu většiny monitorů pro počítače se systémem
Windows. Pokud používáte monitor, který podporuje sRGB, můžete tisknout barvy, které se blíží barvám
zobrazeným na monitoru.
<Canon HDTV gama 1,5> až <Canon HDTV gama 2,4>
Pokud chcete upravit jas po srovnání mezi vytištěnými barvami a barvami zobrazenými na monitoru,
proveďte potřebná nastavení zde. Čím vyšší hodnota, tím tmavší vytištěné barvy.
<Žádný>
Provádí separaci barev z dat RGB do CMYK bez použití profil zdroje RGB.
Profil sim. CMYK
Při tisku dat CMYK můžete vybrat cíl simulace. Zařízení převede data CMYK na model barev CMYK závislý na
zařízení na základě vybraného cíle simulace.
Euro Standard v1.00
JapanColor(Canon)
U.S. Web Coated v1.0
Žádný
450
Nastavení seznamu nabídky
(
)
<PS>
<Nastav. profilu ICC>
<Profil sim. CMYK>
Vyberte
profil
<Euro Standard v1.00>
Použijte profil Euro Standard. Tisk se provede v barvách, které se blíží evropským tiskovým normám.
<JapanColor(Canon)>
Použijte profil JapanColor. Tisk se provede v barvách, které se blíží japonským tiskovým normám.
<U.S. Web Coated v1.0>
Použijte profil U.S. Web Coated. Tisk se provede v barvách, které se blíží americkým tiskovým normám.
<Žádný>
Tiskne data CMYK pomocí modelu barev CMYK závislého na zařízení bez použití profilu simulace CMYK.
● Když je tato položka nastavena na <Žádný>, gradace tmavých barev se může v závislosti na datech
zhroutit.
Škála odstínů šedé
Nastavte, zda chcete převést šedá data na data CMYK pomocí profilu stupňů šedé v zařízení.
Vyp
Zap
(
)
<PS>
<Nastav. profilu ICC>
nebo <Zap>
451
<Škála odstínů šedé>
<Vyp>
Nastavení seznamu nabídky
<Vyp>
Tiskne pouze s tonerem K (černý) bez převodu dat na data CMYK.
<Zap>
Převádí data na data CMYK pomocí profilu stupňů šedé v zařízení. Tisk se může provést pouze s tonerem K
(černá) v závislosti na nastavení možnosti <Výstupní profil> nebo <Čistě černý text>.
Výstupní profil
Můžete vybrat vhodné profily pro data, které hodláte vytisknout. Můžete tuto položku nastavit pro každý typ
obrazových dat obsažených v jednom dokumentu.
Text
PS normální
PS foto
PS TR normální
PS TR foto
Grafika
PS normální
PS foto
PS TR normální
PS TR foto
Obraz
PS normální
PS foto
PS TR normální
PS TR foto
(
)
<PS>
obrazových dat
<Nastav. profilu ICC>
<Výstupní profil>
Vyberte typ
Vyberte profil
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<PS normální>
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám zobrazeným na monitoru.
452
Nastavení seznamu nabídky
<PS foto>
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii.
<PS TR normální>
Shoda barev se provádí tak, že se data tisknou v barvách, které se blíží barvám zobrazeným na monitoru a že
je dobře kontrolováno stékání toneru do textu a jemných čar.
<PS TR foto>
Shoda barev se provádí tak, že se výsledek tisku podobá fotografii a že je dobře kontrolováno stékání toneru
do textu a jemných čar.
Tato položka je zakázána, když je provedeno některé z následujících nastavení.
● <Zdrojový profil RGB> je nastaveno na <Žádný>.
● <Profil sim. CMYK> je nastaveno na <Žádný>.
● <Škála odstínů šedé> je nastaveno na <Vyp>.
Způsob shody
Zadejte, který prvek má mít prioritu před ostatními ve shodě barev pomocí <Zdrojový profil RGB>.
Percepční
Nasycení
Kolorimetrický
(
)
<PS>
<Nastav. profilu ICC>
<Způsob shody>
metodu určení shody
<Percepční>
Shoda se provede s prioritou na percepční.
<Nasycení>
Shoda se provede s prioritou na sytost.
<Kolorimetrický>
Shoda se provede tak, že rozdíl barev mezi originály a výtisky je minimální.
453
Vyberte
Nastavení seznamu nabídky
● Tato položka je zakázána, pokud je pro možnost <Zdrojový profil RGB> vybráno nastavení <Žádný>.
Čistě černý text
Pro černý text, jehož barevné informace definuje „R=G=B=0%“, „C=M=Y=100%“ nebo „C=M=Y=0%/K=100%“, vyberte,
zda jej chcete tisknout pouze tonerem K (černá) nebo podle nastavení <Výstupní profil>.
Vyp
Zap
(
)
<PS>
<Čistě černý text>
<Vyp> nebo <Zap>
<Vyp>
Tiskne podle nastavení <Výstupní profil>. Výsledek tisku může být lepší než pomocí možnosti <Zap> v
závislosti na tiskových datech.
<Zap>
Černý text se vytiskne pouze s tonerem K (černá). Na rozdíl od tisku s barevným tonerem (CMY) se neobjeví
šmouhy barevného toneru na okrajích. Doporučujeme toto nastavení běžně používat.
Černý přetisk *
Nastavte, jak tisknout, když je černý text na barevném pozadí nebo barevném obrázku. Tato položka se nezobrazí,
jestliže je možnost <Čistě černý text> nastavena na <Vyp>.
Vyp
Zap
(
)
<PS>
<Černý přetisk>
454
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
<Vyp>
Nejprve se vytisknou data po tom, co je černý text vyňat z barevného pozadí nebo obrázku, čímž vznikne
příslušné bílé místo, a potom se černý text vytiskne na toto bílé místo. Tisk může být slabší než s možností
<Zap>, a okraje textu mohou být bíle lemovány.
<Zap>
Nejprve se vytiskne pouze barevné pozadí nebo obrázek a potom černý text se vytiskne na pozadí nebo
obrázek.
Jas
Můžete nastavit jas celého obrazu v krocích po 5 %. Čím je hodnota nižší, tím je obraz světlejší.
85 až 100
až 115 (%)
(
)
<PS>
<Jas>
Pomocí
/
zadejte hodnotu nastavení
Polotóny
Můžete vybrat metodu tisku k reprodukci polotónů (střední hodnoty mezi světlejšími a tmavšími oblastmi obrazu).
Difúze chyb
Můžete provést jemnější tisk než pomocí <Rozlišení/gradace>. Tento režim tisku je vhodný pro ostrý tisk okrajů
dat s jemnou granularitou, jako jsou znaky a tenké čáry.
Vyp
Zap
(
)
<PS>
<Polotóny>
455
<Difúze chyb>
<Vyp> nebo <Zap>
Nastavení seznamu nabídky
Rozlišení/gradace *
Vyberte metodu reprodukce polotónů, když je možnost <Difúze chyb> nastavena na <Vyp>. Tuto položku
můžete nastavit pro každý typ obrazových dat obsažených v jednom dokumentu.
Text
Rozlišení
Gradace
Grafika
Rozlišení
Gradace
Obraz
Rozlišení
Gradace
(
)
<PS>
obrazových dat
<Polotóny>
<Rozlišení/gradace>
Vyberte typ
<Rozlišení> nebo <Gradace>
Typ obrazových dat
Vyberte typ obrazových dat, pro která chcete změnit nastavení. Vyberte <Text> pro znaky, <Grafika> pro čáry
a číslice nebo <Obraz> pro obrázky, například fotografie.
<Rozlišení>
Zajistí jemný tisk s ostrou reprodukcí okrajů znaků. Tento režim tisku je vhodný pro tisk znaků a tenkých čar s
jasnými okraji.
<Gradace>
Zajistí tisk se stupňováním a čáry s hladkými okraji. Je vhodný pro tisk čísel nebo grafů obsahující oblasti s
odstupňováním.
Smíšený přetisk
Nastavte, zda mají být data CMYK, pro něž je nastaven přetisk, přetištěna jako kompozitní data.
Vyp
Zap
456
Nastavení seznamu nabídky
(
)
<PS>
<Smíšený přetisk>
<Vyp> nebo <Zap>
● Nastavení této položky na <Zap> neumožňuje přetisk, pokud je možnost <Profil sim. CMYK> nastavena na
jinou možnost než <Žádný>.
Zdokon. vyhlazování
Proveďte nastavení pro režim vyhlazování, který umožňuje vyhlazený tisk okrajů čar, obrázků a textu.
Zdokon. vyhlazování
Zadejte, zda chcete povolit nebo zakázat režim vyhlazování. Okraje budou hladší, je-li zadána možnost
<Vyhlazený 2> spíše než možnost <Vyhlazený 1>.
Vyp
Vyhlazený 1
Vyhlazený 2
(
)
<PS>
<Zdokon. vyhlazování>
<Zdokon.
Vyberte způsob zpracování
vyhlazování>
Grafika *
Zadejte, zda chcete použít režim vyhlazování na čáry a obrázky pokud je možnost <Zdokon. vyhlazování>
nastavena na <Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
(
)
<PS>
<Zdokon. vyhlazování>
<Grafika>
<Vyp> nebo
<Zap>
Text *
Zadejte, zda chcete použít režim vyhlazování na text, pokud je možnost <Zdokon. vyhlazování> nastavena na
<Vyhlazený 1> nebo <Vyhlazený 2>.
Vyp
Zap
457
Nastavení seznamu nabídky
(
)
<PS>
<Zdokon. vyhlazování>
<Text>
<Vyp> nebo
<Zap>
Konverze odst. šedé *
Můžete vybrat metodu převodu barevných tiskových dat na černobílá data.
sRGB
NTSC
Jednotné RGB
(
)
<PS>
<Konverze odst. šedé>
Vyberte způsob převodu
<sRGB>
Barevná data se převedou na černobílá s důrazem na rozdílnost barev, takže se dosáhne plynulého
odstupňování.
<NTSC>
Barevná data se převedou na černobílá s důrazem na zobrazení ekvivalentní televizním snímkům (NTSC).
<Jednotné RGB>
Barevná data se převedou na černobílá s cílem ekvalizovat všechny úrovně RGB pouze na základě jasu.
● Tato položka je dostupná, pokud je možnost <Barevný režim> (
tisku> nastavena na <Černá>.
458
Barevný režim(P. 362) ) pod <Kvalita
Nastavení seznamu nabídky
Nastavení MEAP
6867-057
Položky nastavení týkající se hlavní obrazovky na MEAP jsou uvedeny s krátkým
popisem. Výchozí nastavení jsou označena křížkem ( ).
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na dalších položkách nastavení.
Vybrat výchozí obr.(P. 459)
Použít mezipam. DNS(P. 460)
Období platnosti(P. 460)
Přid X-FRAME-OPTIONS(P. 460)
Vybrat výchozí obr.
Můžete zadat obrazovku, která se zobrazí na displeji ovládacího panelu, když se zařízení spustí.
Obrazovka tisku
MEAP
(
)
<Nastavení MEAP>
<Vybrat výchozí obr.>
<MEAP>
<Obrazovka tisku>
Zobrazí se obrazovka pohotovostního režimu tisku (hlavní obrazovka).
<MEAP>
Zobrazí se obrazovka nainstalované aplikace MEAP, pokud je nainstalovaná.
459
<Obrazovka tisku> nebo
Nastavení seznamu nabídky
● Na ovládacím panelu můžete stisknout
(
) pro změnu obrazovek displeje.
Použít mezipam. DNS
Můžete určit, zda se mají v paměti uchovávat informace DNS, s nimiž bylo vyhledávání v aplikaci MEAP úspěšné. Výběr
<Zap. (dané období)> umožňuje dočasné držení a určení platného období držení ( Období platnosti(P. 460) ).
Vyp
Zap. (neomezeno)
Zap. (dané období)
(
)
<Nastavení MEAP>
<Použít mezipam. DNS>
Vyberte hodnotu
nastavení
Období platnosti *
Při nastavení <Použít mezipam. DNS> je <Zap. (dané období)>, zadejte časové období, po které mají být informace DNS
uloženy v paměti.
1 až 60
až 120 (sekund)
(
)
<Nastavení MEAP>
<Období platnosti>
Pomocí číselných tlačítek
nastavte časové období
Přid X-FRAME-OPTIONS
Určete, zda přidat do záhlaví X-FRAME-OPTIONS, když server HTTP vrátí odpověď. Přidání možností X-FRAME-OPTIONS
zabrání překrývání informací o obsahu generovaném jinými servery.
Vyp
Zap
(
)
<Nastavení MEAP>
<Přid X-FRAME-OPTIONS>
<Zap>
460
<Vyp> nebo
Nastavení seznamu nabídky
Zkontrol. počitadlo
6867-058
Můžete zkontrolovat celkový počet vytištěných stránek.
● Můžete také zkontrolovat hodnotu počitadla výběrem možnosti <Zkontrol. počitadlo> v
Menu(P. 464) a také této položce.
101: Celkem 1
Můžete zkontrolovat celkový počet vytištěných stránek.
(Pouze displej)
108: Celkem (ČB 1)
Můžete zkontrolovat počet stránek vytištěných černobíle.
(Pouze displej)
112: Celkem (Čern/v)
Můžete zkontrolovat počet stránek vytištěných černobíle na papír větší než B4.
(Pouze displej)
113: Celkem (ČB/m.)
Můžete zkontrolovat počet stránek vytištěných černobíle na papír velikosti B4 nebo menší.
(Pouze displej)
114:Celkem 1(2str)
Můžete zkontrolovat počet stránek vytištěných v režimu oboustranného tisku.
(Pouze displej)
461
Utility
Nastavení seznamu nabídky
122:Celkem(vše+1C/V)
Můžete zkontrolovat počet stránek vytištěných barevně na papír větší než B4 (kromě tisku e-mailu).
(Pouze displej)
123:Celkem(vše+1C/M)
Můžete zkontrolovat počet stránek vytištěných barevně na papír velikosti B4 nebo menší (kromě tisku e-mailu).
(Pouze displej)
462
Nastavení seznamu nabídky
Inicializace nabídky
6867-059
Vyberte, chcete-li vrátit nastavení nabídky Nastavení uvedené níže na výchozí tovární
hodnoty. Inicializace nabídky(P. 539)
Nastavení, která nelze inicializovat
● Nemůžete inicializovat nastavení zadaná pro položku <Síť> a <Uprav. polohu tisku>. Chcete-li inicializovat
nastavení <Síť>, viz Inicializace nastavení sítě(P. 540) . Chcete-li inicializovat nastavení <Uprav. polohu
tisku>, ručně je obnovte na výchozí tovární nastavení ( Uprav. polohu tisku(P. 379) ).
463
Nastavení seznamu nabídky
Utility Menu
6867-05A
Můžete zobrazit celkový počet vytištěných stránek a vytisknout interní systémové
informace. Když na ovládacím panelu stisknete
(
), zobrazí se nabídka
Příslušenství. Pokud je zařízení offline, můžete zadat nastavení popsaná níže.
Zkontrol. počitadlo(P. 464)
Konfigurační stránka(P. 465)
Tisk stavu sítě(P. 465)
Tisk stavu spotř.m.(P. 465)
Seznam zásad IPSec(P. 465)
Kalibrace(P. 465)
Obslužný program PCL(P. 466)
Obslužný program PS(P. 466)
Čištění(P. 466)
Prev. rozlév. toneru(P. 466)
Čištění ITB(P. 466)
Uprav po vým kaz(P. 466)
Nástroj.tisk e-mailů(P. 467)
Tisk nast. pol.tisku(P. 467)
Seznam počtu stran(P. 467)
Hlášení počitadla(P. 467)
Tisk sys. info. MEAP(P. 467)
Tisk prot. kazety(P. 467)
Sériové číslo(P. 467)
Info.o spotřeb. mat.(P. 467)
Zkontrol. počitadlo
Můžete zkontrolovat celkový počet vytištěných stránek.
Kontrola celkového počtu vytištěných stránek(P. 532)
● Můžete také zkontrolovat hodnotu počitadla výběrem možnosti <Zkontrol. počitadlo> v
nastavení(P. 315) a také této položce.
101: Celkem 1
Můžete zkontrolovat celkový počet vytištěných stránek.
(Pouze displej)
108: Celkem (ČB 1)
Můžete zkontrolovat počet stránek vytištěných černobíle.
(Pouze displej)
112: Celkem (Čern/v)
Můžete zkontrolovat počet stránek vytištěných černobíle na papír větší než B4.
(Pouze displej)
113: Celkem (ČB/m.)
Můžete zkontrolovat počet stránek vytištěných černobíle na papír velikosti B4 nebo menší.
(Pouze displej)
464
Nabídka
Nastavení seznamu nabídky
114:Celkem 1(2str)
Můžete zkontrolovat počet stránek vytištěných v režimu oboustranného tisku.
(Pouze displej)
122:Celkem(vše+1C/V)
Můžete zkontrolovat počet stránek vytištěných barevně na papír větší než B4 (kromě tisku e-mailu).
(Pouze displej)
123:Celkem(vše+1C/M)
Můžete zkontrolovat počet stránek vytištěných barevně na papír velikosti B4 nebo menší (kromě tisku e-mailu).
(Pouze displej)
Konfigurační stránka
Můžete zkontrolovat nastavení zařízení ( Nabídka nastavení(P. 315) ) nakonfigurovaná v zařízení. Můžete také
zkontrolovat další informace, například stav toneru, počet vytištěných stránek a kapacitu paměti (RAM) připojené k
Konfigurační strana(P. 523)
zařízení.
Tisk stavu sítě
Vyberte k tisku seznam nastavení ( Síť(P. 336) ) o síti nakonfigurované v zařízení. Můžete také zkontrolovat
informace o zabezpečení včetně nastavení filtru adres a nastavení IPSec. Tisk stavu sítě(P. 523)
Tisk stavu spotř.m.
Můžete tisknout informace, jako například stav tonerové kazety, varovná hlášení a informace o tom, kde si můžete
koupit nové tonerové kazety. Tisk stavu spotřebního materiálu(P. 524)
Seznam zásad IPSec
Vyberte pro tisk seznamu názvů a nastavení protokolu IPSec ( Konfigurace nastavení IPSec(P. 259) )
nakonfigurovaných v zařízení. Seznam zásad zabezpečení IPSec(P. 525)
Kalibrace
Pokud se vyskytne neshoda barev nebo pokud se změnily barvy a data se nevytisknou ve správných barvách (zadaných
barvách), můžete provést kalibraci. Oprava neshody barev a odstínů(P. 517)
Kalibrace tisku POP
Tuto funkci použijte ke korekci neshody barev a odlišnosti barevných odstínů, pokud k nim dojde při tisku POP.
Úplná kalibrace
Tuto funkci použijte ke korekci neshody barev a odlišnosti barevných odstínů.
465
Nastavení seznamu nabídky
Obslužný program PCL
Vyberte pro tisk seznamu interních informačních položek zaregistrovaných v zařízení pro použití režimu PCL.
Seznam písem
Vyberte pro tisk seznamu písem, které lze použít v režimu PCL.
Seznam písem PCL(P. 527)
Obslužný program PS
Vyberte pro tisk seznamu nastavení pro používání režimu PS a interních informačních položek zaregistrovaných v
zařízení. Seznam režimu PS(P. 528)
Konfigurační stránka
Vyberte pro tisk seznamu nastavení zařízení (
PS(P. 449) ).
Seznam písem
Vyberte pro tisk seznamu písem, které lze použít v režimu PS.
Čištění
Vyberte pro vyčištění fixační jednotky, když se na výtiscích zobrazí černé skvrny nebo pruhy.
jednotka(P. 490)
Fixační
Prev. rozlév. toneru
Během přepravy zařízení na větší vzdálenost můžete zabránit vysypání toneru.
Čištění ITB
Není-li kvalita tisku dobrá, můžete provést čištění jednotky ITB.
(
)
<Čištění ITB>
<Ano>
Uprav po vým kaz
Nelze-li provést tisk POP s očekávanou sytostí, nastavte sytost toneru.
(
)
<Uprav po vým kaz>
<Ano>
466
Přemístění zařízení(P. 512)
Nastavení seznamu nabídky
Nástroj.tisk e-mailů
Vyberte pro ruční příjem e-mailů a tisk protokolu přijatých e-mailů ve formě seznamu.
Přijatý e-mail
Vyberte pro ruční příjem e-mailů z poštovního serveru POP3 a vytiskněte je.
Ruční přijímání e-mailů(P. 124)
Sezn.výp.PŘ. e-mailů
Vyberte pro tisk protokolu obsahující předměty a datum a čas přijetí e-mailů přijatých do zařízení ve formě
seznamu. Protokol tisku e-mailů(P. 531)
Tisk nast. pol.tisku
Vyberte pro tisk značek, které označují současnou pozici tisku.
Nastavení pozice tisku(P. 519)
Seznam počtu stran
Vyberte pro tisk zprávy o počtu vytištěných stran pro každé oddělení, pokud je povolena správa ID oddělení.
počtu stran(P. 526)
Seznam
Hlášení počitadla
Vytvoření hlášení s uvedením celkového počtu dosud vytištěných stránek.
Zpráva počitadla(P. 526)
Tisk sys. info. MEAP
Vyberte pro tisk seznamu informací o aplikacích MEAP nainstalovaných v zařízení a aplikacích systému MEAP, pokud je
povolena funkce MEAP. Tisk systémových informací MEAP(P. 526)
Tisk prot. kazety
Tisk výpisu využití tonerové kazety / bubnové kazety formou seznamu.
Sériové číslo
Vyberte pro zobrazení sériové číslo zařízení.
(
)
<Sériové číslo>
Info.o spotřeb. mat.
Vyberte pro zobrazení informací například o papíru a tonerové kazetě.
467
Tisk výpisu kazet(P. 527)
Nastavení seznamu nabídky
Informace o papíru
Vyberte pro zobrazení aktuálně specifikované velikosti papíru a typu papíru a zbývající úrovně papíru pro každý
zdroj papíru. Kontrola papíru(P. 535)
Model toner. kazety
Vyberte pro zobrazení čísla modelu tonerové kazety pro zařízení.
Kontrola modelu tonerové kazety(P. 535)
Zbývající toner
Zobrazení statusu tonerové kazety.
Kontrola statusu tonerových kazet(P. 536)
● Zobrazený stav tonerové kazety lze použít pouze jako vodítko a může se lišit od skutečného stavu.
Model bubn. kazety
Tuto možnost vyberte, chcete-li zobrazit číslo modelu bubnové kazety pro zařízení.
bubnové kazety(P. 536)
Kontrola modelu
Zbývající hl. bubnu
Zobrazení stavu bubnové kazety.
Kontrola statusu bubnové kazety(P. 536)
● Zobrazený stav bubnové kazety lze použít pouze jako vodítko a může se lišit od skutečného stavu.
468
Nastavení seznamu nabídky
Zásobn. odpad.toneru
Můžete zobrazit číslo modelu odpadní nádobky na toner.
toner(P. 537)
Zjištění čísla modelu odpadní nádobky na
Stav odpadn. toneru
Můžete zobrazit stav odpadní nádobky na toner.
Zjištění stavu odpadní nádobky na toner(P. 537)
469
Nastavení seznamu nabídky
Nabídka Úloha
6867-05C
Můžete tisknout dokumenty uložené na kartě SD a protokol tisku. Když
stisknete
( ) na ovládacím panelu, zobrazí se nabídka Úloha. Pokud je zařízení
offline, můžete zadat nastavení popsaná níže.
Hvězdičky (*)
● Nastavení označená údajem „*1“ se nemusí zobrazit, a to v závislosti na používaných volitelných možnostech
nebo dalších položkách nastavení.
● Nastavení označená údajem „*2“ nemusejí být zobrazena, pokud není pole [Zobrazit Výpis úlohy] Vzdálené
UR vybráno. Skrytí historie tiskových úloh(P. 252)
Šifrovaný tisk(P. 470)
Zabezpečený tisk(P. 470)
Seznam ulož. úloh(P. 470)
Tisk uložených úloh(P. 470)
Výpis tisku úloh(P. 471)
Výpis tisku ulož.úl.(P. 471)
Hlášení výpisu tisku(P. 471)
Hláš. tisku e-mailu(P. 471)
Šifrovaný tisk *1
Tuto možnost vyberte, chcete-li tisknout šifrované dokumenty, které jste do zařízení odeslali z počítače.
zabezpečených dokumentů(P. 93)
Vytisknutí
Zabezpečený tisk *1
Vyberte pro tisk zabezpečených dokumentů, které jste z počítače odeslali do zařízení.
dokumentů(P. 93)
Vytisknutí zabezpečených
Seznam ulož. úloh *1
Vyberte pro tisk seznamu dokumentů uložených na kartě SD vložené do zařízení.
Seznam uložených úloh(P. 529)
Tisk uložených úloh *1
Vyberte pro tisk dokumentů uložených na kartě SD vložené do zařízení.
tiskárně(P. 98)
470
Tisk dokumentu uloženého v
Nastavení seznamu nabídky
Výpis tisku úloh *2
Vyberte pro tisk protokolu dokumentů vytištěných z počítače ve formě seznamu.
Protokol tiskových úloh(P. 529)
Výpis tisku ulož.úl. *1*2
Vyberte pro tisk protokolu tisku dokumentů uložených na kartě SD vložené do zařízení ve formě seznamu.
tiskových úloh(P. 530)
Hlášení výpisu tisku *2
Vyberte pro tisk nastavení a protokolu tisku zpráv ve formě seznamu.
Protokol tisku zpráv(P. 530)
Hláš. tisku e-mailu *2
Vyberte pro tisk protokolu tisku přijatých e-mailů ve formě seznamu.
471
Protokol tisku e-mailů(P. 531)
Protokol
Nastavení seznamu nabídky
Nabídka Resetovat
6867-05E
Můžete zrušit všechny procesy, vymazat data z paměti a vypnout napájení. Když na
ovládacím panelu stisknete
( ), zobrazí se nabídka Reset.
Jemný reset(P. 472)
Podávání formulářů(P. 473)
Vypínání(P. 473)
● Když se zobrazí zpráva Ennn-nnnn (n je číslo), lze provést pouze <Vypínání>.
Jemný reset
Vyberte pro vymazání všech dat úloh tisku, které ještě nejsou dokončené (měkký reset). Tuto položku také můžete
vybrat pro provedení tvrdého resetu, abyste povolili změněná nastavení.
● Před provedením měkkého nebo tvrdého resetu se ujistěte, že zařízení nepoužívají další uživatelé, protože
jinak budou všechna tisková data před vytištěním vymazána.
◼ Provedení měkkého resetu
Měkký reset proveďte, když chcete vymazat všechna tisková data, která se tisknou, čekají na vytištění nebo jsou
přijímána.
(
)
<Jemný reset>
<Ano>
◼ Provedení tvrdého resetu
Tvrdý reset proveďte, když chcete povolit změněná nastavení zařízení nebo vymazat data uložená v paměti zařízení.
1
Stiskněte tlačítko
(
).
472
Nastavení seznamu nabídky
● Pokud se zobrazí nabídka nastavení, nejprve stiskněte
(
) pro návrat na hlavní obrazovku a
potom proveďte tento krok 1.
2
Pomocí
/
vyberte <Jemný reset> stiskněte a podržte
na 5 sekund nebo déle a
uvolněte.
➠ Zobrazí se zpráva <Provést tvrdý reset?>.
3
Vyberte možnost <Ano> a stiskněte tlačítko
.
➠ Po provedení tvrdého resetu se zařízení restartuje.
● Když provedete měkký nebo tvrdý reset, vymažou se i zabezpečené dokumenty uložené na volitelné kartě
SD.
Podávání formulářů
Pokud je tisk zrušen z počítače nebo je při příjmu dat přerušena komunikace, mohou data zůstat v paměti zařízení a
tisk se nedokončí. Další tisková data nelze vytisknout, když jsou zbývající data ponechána, jak jsou. V tomto případě
vyberte možnost <Podávání formulářů> pro nucený tisk dat zbývajících v paměti.
(
)
<Podávání formulářů>
<Ano>
● Pokud se zbývající data nevytisknou, proveďte měkký reset.
● Pokud data stále zůstávají v paměti zařízení po vyplnění formuláře, (indikátor [
] na zařízení svítí), proveďte
měkký reset.
Vypínání
Při vypínání tiskárny využijte ovládací panel bez použití hlavního vypínače.
(P. 36)
473
Vypnutí tiskárny (postup vypínání)
Nastavení seznamu nabídky
Nabídka Vybrat podavač
6867-05F
Nastavení o zdroji papíru a velikosti papíru zavedeného do zařízení jsou uvedena s
krátkými popisy. Když na ovládacím panelu stisknete
( ), zobrazí se nabídka
Vybrat podavač. Výchozí nastavení jsou označena křížkem ( ).
Společná nastavení
● Nastavení jsou stejná jako pro <Zdroj papíru> v
také použijí na nastavení <Zdroj papíru>.
Nabídka nastavení(P. 315) . Nastavení zadaná zde se
Hvězdičky (*)
● Nastavení označená hvězdičkou (*) se nemusí zobrazit, a to v závislosti na používaných volitelných
možnostech nebo dalších položkách nastavení.
Zdroj papíru(P. 474)
Vel.pap.ve vú.přihr.(P. 475)
Velikost papíru v zásuvce N (N=1, 2, 3, 4, 5)(P. 475)
Standard. vel.papíru(P. 476)
Priorita víceúč. př.(P. 477)
Vú. přih. smíš. pap.(P. 477)
Auto. výběr zásuvky(P. 478)
Auto.zjist. typ pap.(P. 478)
Výchozí typ papíru(P. 480)
Typ.pap.ve vú.přihr.(P. 480)
Typ papíru v zásuvce N (N=1, 2, 3, 4, 5)(P. 481)
Ruční 2str.(V.Ú.př.)(P. 481)
2stranný tisk(P. 482)
Zdroj papíru
Vyberte zdroj papíru, ze kterého je papír podáván. Pokud chcete automaticky změnit zdroj papíru na základě velikosti a
typu papíru, vyberte <Auto>.
Auto
Víceúčelová přihr.
Zásuvka 1
Zásuvka 2 *
Zásuvka 3 *
Zásuvka 4 *
Zásuvka 5 *
(
)
<Zdroj papíru>
Vyberte zdroj papíru
474
Nastavení seznamu nabídky
Vel.pap.ve vú.přihr.
Zadejte velikost papíru, který je vložen do víceúčelové přihrádky.
přihrádce(P. 63)
Zadání velikosti a typu papíru ve víceúčelové
A6
A5
A5R
B5
B5R
A4
A4R
B4
A3
LTR
LTRR
LGL
11x17
EXEC
EXECR
305x457 mm
Volná velikost
Vlastní vel.
Vlastní vel. R
Postcard
Reply Postcard
4on1 Postcard
Env. Kakugata2
Env. Nagagata3
Env. Younaga 3
Obálka ISO-C5
Obálka Monarch
Obálka No.10
Obálka DL
India-LGL
Kartotéka
STMT
STMTR
FLSC
8K
16K
16KR
Velikost papíru v zásuvce N (N=1, 2, 3, 4, 5) *
Nastavte velikost papíru vloženého do zásuvky na papír zařízení nebo do volitelného podavače papíru nebo kazetové
podávací jednotky ( Zadání velikosti a typu papíru v zásuvce na papír(P. 60) ).
Zásuvka na papír zařízení
A5R
475
Nastavení seznamu nabídky
B5R
EXECR
Volná velikost
Auto
Vlastní vel.
Vlastní vel. R
India-LGL
FLSC
8K
16K
16KR
Zásuvka na papír podavače papíru nebo kazetové podávací jednotky
A5R
B5R
EXECR
Volná velikost
Auto
Vlastní vel.
Vlastní vel. R
India-LGL
FLSC
8K
16K
16KR
Standard. vel.papíru
Nastavte výchozí velikost papíru. Tisk bude proveden s papírem o velikosti nastavené zde, když chcete tisknout z OS,
který nepodporuje ovladače tiskárny, nebo z mobilního zařízení nebo dalšího zařízení, které nepodporuje nastavení
velikosti papíru.
A6
A5
B5
A4
B4
A3
LTR
LGL
11x17
EXEC
305x457 mm
Postcard
Reply Postcard
4on1 Postcard
Env. Kakugata2
Env. Nagagata3
Env. Younaga 3
Obálka ISO-C5
Obálka Monarch
476
Nastavení seznamu nabídky
Obálka No.10
Obálka DL
India-LGL
Kartotéka
STMT
FLSC
8K
16K
(
)
<Standard. vel.papíru>
Zvolte velikost papíru
Výběr velikosti papíru
Zadejte nastavení podle velikosti papíru, na který se bude tisknout.
Priorita víceúč. př.
Vyberte, zda chcete upřednostnit podávání papíru z víceúčelové přihrádky, pokud je možnost <Zdroj papíru>
nastavena na <Auto>. Pokud vyberete <Zap>, podává se papír z víceúčelové přihrádky, je-li papír stejné velikosti
zaveden ve víceúčelové přihrádce a zásuvce na papír.
Vyp
Zap
(
)
<Priorita víceúč. př.>
<Vyp> nebo <Zap>
● Když je možnost <Vú. přih. smíš. pap.> nastavena na <Zap>, je papír přednostně podáván ze zásuvky na
papír, i když je možnost <Priorita víceúč. př.> nastavena na <Zap>.
Vú. přih. smíš. pap.
Pokud vyberete možnost <Zap> s položkou <Zdroj papíru> nastavenou na <Auto>, je automaticky vybrána víceúčelová
přihrádka, pokud není papír vhodné velikosti vložen do jiné zásuvky na papír.
Vyp
Zap
477
Nastavení seznamu nabídky
(
)
<Vú. přih. smíš. pap.>
<Vyp> nebo <Zap>
Auto. výběr zásuvky
Pokud vyberete<Použít> s položkou <Zdroj papíru> nastavenou na <Auto>, zařízení automaticky vybere zdroj papíru s
vloženým papírem vhodné velikosti. Když také papír dojde, toto nastavení umožní nepřetržitý tisk přepnutím z jednoho
zdroje papíru na jiný, který je naplněn stejným zdrojem papíru.
Nepoužít
Použít
(
)
<Auto. výběr zásuvky>
Vyberte zdroj papíru
<Nepoužít> nebo
<Použít>
Výběr zdroje papíru
Vyberte zdroj papíru, na který chcete použít funkci Automatický výběr zásuvky.
Přepnutí nastavení
Výběrem možnosti <Zap> povolte automatický výběr zásuvek u zdroje papíru, který jste vybrali na předchozí
).
obrazovce (
Auto.zjist. typ pap.
Zadejte, zda chcete automaticky detekovat typ papíru při vložení běžného či silného papíru. Chcete-li tuto funkci
použít, nastavte u zdroje papíru typ papíru na možnost <Smíšené typy>. Dále v ovladači tiskárny nastavte položku [Typ
papíru] na možnost [Výchozí nastavení tiskárny].
Použitelný papír(P. 553)
Typ.pap.ve vú.přihr.(P. 480)
Typ papíru v zásuvce N (N=1, 2, 3, 4, 5)(P. 481)
Základní operace tisku(P. 75)
Víceúčelová přihr.
Nepoužít
Pouze první list
Každý list
Zásuvka 1
Nepoužít
478
Nastavení seznamu nabídky
Použít
Zásuvka 2 *
Nepoužít
Použít
Zásuvka 3 *
Nepoužít
Použít
Zásuvka 4 *
Nepoužít
Použít
Zásuvka 5 *
Nepoužít
Použít
(
papíru
)
<Auto.zjist. typ pap.>
Přečtěte si zprávu
Vyberte zdroj
Vyberte hodnotu nastavení
Výběr zdroje papíru
Vyberte zdroj papíru, pro který chcete provést nastavení týkající se automatické detekce typu papíru.
Přepnutí nastavení (Víceúčelová přihr.)
Když je zadána možnost <Pouze první list>, detekce typu papíru se provede pouze pro první list. Když je
zadána možnost <Každý list>, pak se detekce typu papíru provádí pro každý podaný list.
Přepnutí nastavení (Zásuvka 1 až 5*)
Když je zadána možnost <Použít>, detekce typu papíru se provede pouze pro první list.
● Pokud je tato funkce povolena, rychlost tisku může být nižší. Když je zadána možnost <Každý list>, rychlost
tisku bude nižší.
● Pokud je tato funkce povolena, nemusí být zařízení schopno správně tisknout. Pokud zařízení nemůže
tisknout správně, nastavte tuto funkci na <Nepoužít> a než tisk zkusíte znovu, zadejte typ papíru z ovladače
tiskárny.
479
Nastavení seznamu nabídky
Výchozí typ papíru
Nastavte výchozí typ papíru. Tisk bude proveden s typem papíru nastaveným zde, když chcete tisknout z operačního
systému, který nepodporuje ovladače tiskárny, nebo z mobilního zařízení nebo dalšího zařízení, které nepodporuje
nastavení typu papíru.
Běžný
Běžný L
Běžný L2
Silný 1
Silný 2
Silný 3
Silný 4
Silný 5
Postcard
Obálka
Potažený 1
Potažený 2
Potažený 3
Štítky
Hrubý 1
Hrubý 2
(
)
<Výchozí typ papíru>
Vyberte typ papíru
Výběr typu papíru
Zadejte nastavení stejným způsobem jako nastavení papíru v ovladači tiskárny podle typu papíru k tisku.
Vkládání papíru(P. 40)
● Tisk se provede se zde nastaveným typem papíru, pokud je [Typ papíru] nastaven na [Výchozí nastavení
tiskárny] na straně ovladače tiskárny a typ papíru vloženého do zdroje papíru je nastaven na <Smíšené typy>
na straně zařízení.
Typ.pap.ve vú.přihr.
Nastavte typ papíru zavedeného do víceúčelové přihrádky.
přihrádce(P. 63)
Běžný
Běžný L
480
Zadání velikosti a typu papíru ve víceúčelové
Nastavení seznamu nabídky
Běžný L2
Silný 1
Silný 2
Silný 3
Silný 4
Silný 5
Postcard
Obálka
Potažený 1
Potažený 2
Potažený 3
Štítky
Hrubý 1
Hrubý 2
Smíšené typy
Typ papíru v zásuvce N (N=1, 2, 3, 4, 5) *
Nastavte typ papíru vloženého do zásuvky na papír.
Zadání velikosti a typu papíru v zásuvce na papír(P. 60)
Běžný
Běžný L
Běžný L2
Silný 1
Silný 2
Silný 3
Silný 4
Štítky
Hrubý 1
Hrubý 2
Smíšené typy
Ruční 2str.(V.Ú.př.)
Vyberte, na kterou stranu papíru se má tisknout, když chcete provádět oboustranný tisk ručně z víceúčelové přihrádky.
1. strana
2. strana
(
)
<Ruční 2str.(V.Ú.př.)>
<1. strana> nebo <2. strana>
<1. strana>
Vyberte pro tisk na zadní straně (strana, na níž se má tisknout jako první).
481
Nastavení seznamu nabídky
<2. strana>
Vyberte pro tisk na přední straně (na opačné straně, než která je již potištěná).
2stranný tisk
Vyberte, zda chcete tisknout na obou stranách papíru.
Vyp
Zap
(
)
<2stranný tisk>
<Vyp> nebo <Zap>
482
Odstraňování problémů (FAQ)
Odstraňování problémů (FAQ)
Odstraňování problémů (FAQ) ............................................................................................................... 484
483
Odstraňování problémů (FAQ)
Odstraňování problémů (FAQ)
6867-05H
Když se vyskytne problém, zkuste najít řešení v této kapitole, než se obrátíte na společnost Canon.
484
Údržba
Údržba
Údržba .................................................................................................................................................................. 486
Čištění zařízení .................................................................................................................................................. 488
Vnější povrchy .............................................................................................................................................. 489
Fixační jednotka ........................................................................................................................................... 490
Oblast dopravy papíru .................................................................................................................................. 491
Výměna tonerových kazet ................................................................................................................................ 496
Postup výměny tonerových kazet ................................................................................................................. 500
Výměna bubnových kazet ................................................................................................................................. 503
Postup výměny bubnových kazet ................................................................................................................. 507
Výměna odpadní nádobky na toner ................................................................................................................. 509
Jak vyměnit odpadní nádobku na toner ........................................................................................................ 510
Přemístění zařízení ............................................................................................................................................ 512
Udržení a vylepšení kvality tisku ..................................................................................................................... 514
Nastavení sytosti tisku .................................................................................................................................. 515
Oprava neshody barev a odstínů .................................................................................................................. 517
Nastavení pozice tisku .................................................................................................................................. 519
Tisk hlášení a seznamů ..................................................................................................................................... 523
Zobrazení hodnoty počítadla ............................................................................................................................ 532
Kontrola spotřebního materiálu ...................................................................................................................... 535
Inicializace nastavení ........................................................................................................................................ 538
Inicializace nabídky ....................................................................................................................................... 539
Inicializace nastavení sítě ............................................................................................................................. 540
485
Údržba
Údržba
6867-05J
Tato kapitola popisuje údržbu zařízení, včetně způsobů čištění a inicializace nastavení.
◼ Základní čištění
Čištění zařízení(P. 488)
● Pokud je zařízení znečištěné, viz část
● Na výtiscích jsou černé skvrny, viz
Vnější povrchy(P. 489) .
Fixační jednotka(P. 490) .
◼ Výměna tonerových kazet
● Chcete-li zkontrolovat stav tonerové kazety, viz část
kazet(P. 496) .
● Postup výměny tonerových kazet najdete v části
tonerových kazet(P. 500) .
Výměna tonerových
Postup výměny
◼ Výměna bubnových kazet
● Chcete-li zkontrolovat stav bubnové kazety, viz část
● Postup výměny bubnových kazet najdete v části
Výměna bubnových kazet(P. 503) .
Postup výměny bubnových kazet(P. 507) .
◼ Výměna odpadní nádobky na toner
● Zobrazila se zpráva o výměně, viz
Výměna odpadní nádobky na toner(P. 509) .
● Jak vyměnit odpadní nádobku na toner, viz
Jak vyměnit odpadní nádobku na toner(P. 510) .
◼ Přemístění zařízení
● Informace týkající se přemístění zařízení z důvodu údržby nebo stěhování
kanceláře najdete v části Přemístění zařízení(P. 512) .
◼ Správa kvality tisku
Udržení a vylepšení kvality tisku(P. 514)
● Chcete-li upravit sytost toneru, která se má použít při tisku, viz
● Pokud chcete opravit neshodu barev nebo rozdílný odstín, viz
● Pokud chcete upravit pozici tisku, viz
Nastavení sytosti tisku(P. 515) .
Oprava neshody barev a odstínů(P. 517) .
Nastavení pozice tisku(P. 519) .
486
Údržba
◼ Tisk hlášení a seznamů
● Tištění seznamů nastavení apod., viz
Tisk hlášení a seznamů(P. 523) .
◼ Kontrola celkového počtu stránek vytištěných v zařízení
Pokud chcete zkontrolovat celkový počet výtisků, viz část
Zobrazení hodnoty počítadla(P. 532) .
◼ Inicializace nastavení
Pokud chcete obnovit nastavení, viz část
Inicializace nastavení(P. 538) .
487
Údržba
Čištění zařízení
6867-05K
Zařízení pravidelně čistěte, abyste předešli snížené kvalitě tisku a zajistili bezpečné a snadné používání zařízení. Než
začnete čistit zařízení, pečlivě prostudujte bezpečnostní pokyny. Údržba a kontrola(P. 9)
Části k čištění
Vnější povrch zařízení a větrací otvory
Vnější povrchy(P. 489)
Interní fixační jednotka
Fixační jednotka(P. 490)
Interní oblast dopravy papíru
Oblast dopravy papíru(P. 491)
488
Údržba
Vnější povrchy
6867-05L
Vnější povrchy zařízení čistěte pravidelně, především okolí větracích otvorů, abyste zařízení udrželi v dobrém stavu.
1
Vypněte zařízení a vytáhněte napájecí kabel ze zásuvky střídavého proudu.
● Při vypínání zařízení využijte ovládací panel bez použití hlavního vypínače.
Vypnutí tiskárny (postup
vypínání)(P. 36)
2
Čistěte vnější povrch zařízení a větrací otvory.
● Použijte měkký hadřík mírně navlhčený vodou nebo jemný čisticí prostředek zředěný vodou.
● Popis umístění větracích otvorů naleznete v části
Přední strana(P. 19) .
3
Nechejte vnější povrchy zařízení řádně oschnout.
4
Znovu připojte napájecí kabel ke zdroji napájení a zapněte zařízení.
489
Údržba
Fixační jednotka
6867-05R
Na fixační jednotce uvnitř zařízení může ulpívat špína, která je následně příčinou výskytu černých skvrn na výtiscích.
Chcete-li fixační jednotku vyčistit, postupujte následujícím způsobem. Fixační jednotku nelze vyčistit, pokud v zařízení
čekají dokumenty na vytištění. K vyčištění fixační jednotky potřebujete papír o velikosti A4 nebo Letter. Před
provedením následujícího postupu vložte papír do víceúčelové přihrádky.
● Při čištění se využívá náplň tonerových kazet. Před čištěním ověřte, že je v tonerových kazetách dostatek
toneru. Kontrola statusu tonerových kazet(P. 499)
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberte velikost zavedeného papíru a stiskněte
4
Vyberte možnost <Ano> a stiskněte tlačítko
(
).
/
vyberte možnost <Čištění> a stiskněte tlačítko
.
.
➠ Na displeji se zobrazí zpráva <Nastavte čisticí papír a stiskněte klávesu Online.>.
5
Stiskněte tlačítko
(
).
➠ Čisticí papír je pomalu zaveden do zařízení a zahájí se čištění fixační jednotky.
● Nemůžete zastavit čištění v polovině. Počkejte na dokončení čištění.
490
.
Údržba
Oblast dopravy papíru
6867-05S
Pokud často používáte štítky, jejich lepidlo může ulpět v oblasti dopravy papíru a způsobit uvíznutí papíru. Po použití
štítků setřete následujícím postupem zbytky lepidla z oblasti dopravy papíru.
1
Vypněte zařízení a vytáhněte napájecí kabel ze zásuvky střídavého proudu.
● Když vypínáte napájení, vypněte zařízení z ovládacího panelu bez použití vypínače.
Vypnutí tiskárny
(postup vypínání)(P. 36)
2
Setřete zbytky lepidla, které ulpěly v oblasti dopravy papíru.
● Setřete zbytky lepidla měkkým, dobře vyždímaným hadříkem mírně navlhčeným vodou nebo jemným čisticím
prostředkem zředěným vodou.
Zásuvka na papír
● Následujícím postupem také odstraňte zbytky lepidla z volitelného podavače papíru nebo kazetové
podávací jednotky.
1
Vytáhněte nadoraz zásuvku na papír.
2
Setřete zbytky lepidla, které ulpěly na vodítkách papíru.
● Pokud je v daném zdroji papíru vložen papír, vyjměte jej, a až poté proveďte otření.
3
Zavřete zásuvku na papír.
● Jestliže byl vložen papír, vložte jej zpět.
4
Vkládání papíru do zásuvky na papír(P. 42)
Otevřete pravý kryt.
491
Údržba
5
Setřete zbytky lepidla, které ulpěly na vnitřku hlavní jednotky.
● Při otírání zbytků lepidla, které ulpěly na vnitřku hlavní jednotky, dejte pozor, abyste se nedotkli
jednotky ITB ani senzoru automatické detekce typu papíru.
6
Zavřete pravý kryt.
Víceúčelová přihrádka
1
Otevřete kryt.
2
Setřete zbytky lepidla, které ulpěly na vodítkách papíru.
492
Údržba
3
Sejměte kryt válců podavače.
4
Vytáhněte horní válec podavače nahoru.
5
Setřete zbytky lepidla, které ulpěly na válci podavače.
6
Umístěte válec podavače zpět na místo.
7
Nasaďte zpět kryt válců podavače.
8
Zavřete kryt.
9
Otevřete pravý kryt.
493
Údržba
10
Setřete zbytky lepidla, které ulpěly na vnitřku hlavní jednotky.
● Při otírání zbytků lepidla, které ulpěly na vnitřku hlavní jednotky, dejte pozor, abyste se nedotkli
jednotky ITB ani senzoru automatické detekce typu papíru.
11
Zavřete pravý kryt.
3
Setřete zbytky lepidla, které ulpěly na výstupní přihrádce.
4
Nechejte vnější povrchy zařízení řádně oschnout.
494
Údržba
5
Znovu připojte napájecí kabel ke zdroji napájení a zapněte zařízení.
495
Údržba
Výměna tonerových kazet
6867-05U
Když se blíží doba pro výměnu tonerové kazety, na displeji se zobrazí zpráva. Pokud situaci nevyřešíte a budete
pokračovat v tisku, bude se kvalita tisku postupně zhoršovat. Můžete také zkontrolovat stav tonerové kazety na
displeji.
Když se zobrazí zpráva(P. 496)
Je-li kvalita výtisků neuspokojivá(P. 498)
Kontrola statusu tonerových kazet(P. 499)
◼ Když se zobrazí zpráva
V závislosti na tom, jaká zpráva se zobrazí, budete se muset ujistit, že máte připravenou náhradní tonerovou kazetu
Spotřební materiál(P. 570)
nebo ji přímo vyměnit. Postup výměny tonerových kazet(P. 500)
● „X“ v následující zprávě představuje barvu CMYK.
<Blíží se konec životnosti tonerové kazety X.>
<Blíží se konec životnosti tonerové kazety X.>
Tato zpráva informuje o tom, že tonerovou kazetu pro uvedenou barvu bude třeba brzy vyměnit. Ujistěte se, že
máte připravenou náhradní tonerovou kazetu. Pokud se chystáte k tisku velkého objemu dat a zobrazí se tato
zpráva, vyměňte tonerovou kazetu ještě před spuštěním tisku.
● Když se nezobrazí zpráva <Připraveno k tisku.>, tisk se dočasně zastaví. Pro obnovení tisku stiskněte
(
).
● To, která zpráva se zobrazí, závisí na nastavení <Akce po upozornění> v nabídce nastavení na
ovládacím panelu. Akce po upozornění(P. 324)
● Pro zbývající množství toneru v tonerových kazetách (v procentech), které aktivuje tuto zprávu,
můžete nastavit jakoukoli hodnotu. Urč.čas.kontr.toneru(P. 403)
<Vyměňte tonerovou kazetu X.>
<Konec životnosti. Vyměňte tonerovou kazetu X.>
Tonerová kazeta uvedené barvy dosáhla konce své životnosti. Doporučujeme, abyste vyměnili tonerovou kazetu
za novou.
496
Údržba
● Můžete pokračovat v tisku i po zobrazení této zprávy, ale kvalita tisku se může postupně snižovat.
● Příjem e-mailů a faxových dokumentů bude zakázán.
Tisk přijatých e-mailů (tisk e-mailů)(P. 120)
● Když se zobrazí zpráva <Konec životnosti. Vyměňte tonerovou kazetu X.>, tisk je dočasně zastaven.
Chcete-li pokračovat v tisku, stiskněte
(
).
● To, která zpráva se zobrazí, závisí na nastavení <Akce když není toner> v nabídce nastavení na
ovládacím panelu. Akce když není toner(P. 403)
<Vyměňte tonerovou kazetu X.>
Tonerová kazeta uvedené barvy dosáhla konce své životnosti. Vyměňte tonerovou kazetu.
● Pokud je zobrazena tato zpráva, nemůžete pokračovat v tisku.
● Zda se tato zpráva zobrazí, závisí na nastavení <Akce když není toner> v nabídce nastavení na
ovládacím panelu. Akce když není toner(P. 403)
<Záruka neplatí pro paděl.kaz./ne Canon.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili tonerovou kazetu za novou.
● Můžete pokračovat v tisku i po zobrazení této zprávy, ale kvalita tisku se může postupně snižovat.
Může dojít k poškození zařízení.
<Možná padělaná tonerová kazeta/ne Canon.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili tonerovou kazetu za novou.
497
Údržba
● Můžete stisknout
(
) a pokračovat v tisku, ale kvalita tisku může být horší. Mohli byste
tím zařízení poškodit.
<Nelze tisknout. Možná paděl.toner. kaz./ne Canon.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili tonerovou kazetu za novou.
● Pokud je zobrazena tato zpráva, nemůžete pokračovat v tisku.
Canon Genuine Mode(P. 333)
<Chyba kom. s X. ton. Mimo Canon kaz. se nevztah. záruka.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili tonerovou kazetu za novou. Postup výměny tonerových kazet(P. 500)
◼ Je-li kvalita výtisků neuspokojivá
Pokud se na výtiscích začnou objevovat některé z následujících chyb, jedna z tonerových kazet je prázdná. I když se
nezobrazí žádná zpráva, téměř prázdnou tonerovou kazetu vyměňte. Postup výměny tonerových kazet(P. 500)
Jsou viditelné pruhy / Tisk není rovnoměrný
Některé části jsou vybledlé
Na prázdných místech se objevují paobrazy
Jsou viditelné bílé skvrny
498
Nerovnoměrná sytost
Barvy na výtisku jsou nevýrazné
Údržba
◼ Kontrola statusu tonerových kazet
Stav tonerové kazety můžete zkontrolovat na hlavní obrazovce. Před zahájením tisku velké úlohy se doporučuje
zkontrolovat hladinu.
Indikace stavu kazety
Zobrazení statusu tonerové kazety. Některé vnitřní součásti mohou v závislosti na prostředí dosáhnout konce
životnosti dříve, než dojde samotný toner.
● Zobrazený stav tonerové kazety lze použít pouze jako vodítko a může se lišit od skutečného stavu.
● Stav kazety s tonerem můžete také zkontrolovat pomocí <Zbývající toner> v rámci <Info.o spotřeb.
mat.>. Info.o spotřeb. mat.(P. 467)
ODKAZY
Spotřební materiál(P. 570)
499
Údržba
Postup výměny tonerových kazet
6867-05W
Před výměnou tonerových kazet si přečtěte bezpečnostní upozornění v části
materiál(P. 10) .
Údržba a kontrola(P. 9) a
1
Zcela otevřete přední kryt.
2
Vytáhněte tonerovou kazetu.
3
Vyjměte náhradní tonerovou kazetu z obalového materiálu.
4
Spotřební
Pětkrát nebo šestkrát tonerovou kazetou zatřeste podle znázornění na obrázku, aby
se toner v kazetě rovnoměrně rozprostřel, a poté ji položte na rovný povrch.
● V tomto kroku nesnímejte ochranný kryt (
).
500
Údržba
5
Sejměte ochranný kryt.
6
Vložte tonerovou kazetu.
● Držte tonerovou kazetu ve vodorovné poloze a vyrovnejte ji s vodítkem tonerové kazety (
) a poté ji zasuňte
až nadoraz do pozice.
● Dbejte na to, abyste se nedotkli ozubeného kola (
) či podávací sekce (
ústí pozice.
● Vložte tonerovou kazetu do pozice označené štítkem příslušné barvy (
501
).
) a abyste jimi nenarazili do
Údržba
7
Zavřete přední kryt.
502
Údržba
Výměna bubnových kazet
6867-05X
Když se blíží doba pro výměnu bubnové kazety, na displeji se zobrazí zpráva. Pokud situaci nevyřešíte a budete
pokračovat v tisku, bude se kvalita tisku postupně zhoršovat. Stav bubnové kazety můžete také zkontrolovat na
displeji.
● Bubnové kazety, které byly nebo jsou použity pro určitou konkrétní barvu, se nesmějí znovu použít pro jinou
barvu. Takovéto opětovné použití bubnových kazet může způsobit špatnou kvalitu tisku.
Když se zobrazí zpráva(P. 503)
Je-li kvalita výtisků neuspokojivá(P. 505)
Kontrola statusu bubnové kazety(P. 506)
◼ Když se zobrazí zpráva
V závislosti na tom, jaká zpráva se zobrazí, si budete muset připravit náhradní bubnovou kazetu nebo vyměnit
tonerovou kazetu. Postup výměny bubnových kazet(P. 507)
Spotřební materiál(P. 570)
● „N“ v níže uvedené zprávě představuje číslo 1 až 4.
<Blíží se konec životnosti bubnové kazety N.>
<Blíží se konec životnosti bubnové kazety N.>
Tato zpráva informuje o tom, že bubnovou kazetu bude brzy nutné vyměnit. Ujistěte se, že máte připravenou
náhradní kazetu válce. Pokud se chystáte k tisku velkého objemu dat a zobrazí se tato zpráva, vyměňte kazetu
válce ještě před spuštěním tisku.
● Když se nezobrazí zpráva <Připraveno k tisku.>, tisk je dočasně zastaven. Chcete-li pokračovat v tisku,
stiskněte
(
).
● To, která zpráva se zobrazí, závisí na nastavení <Akce po upozornění> v nabídce nastavení na
ovládacím panelu. Akce po upozornění(P. 324)
● Pro zbývající množství v kazetě válce (v procentech), který aktivuje tuto zprávu, můžete nastavit
jakoukoli hodnotu. Urč.časov.kontr.bubn(P. 403)
<Vyměňte bubnovou kazetu N.>
503
Údržba
<Konec životnosti. Vyměňte bubnovou kazetu N.>
Bubnová kazeta v uvedené pozici dosáhla konce své životnosti. Doporučujeme, abyste vyměnili kazetu válce za
novou.
● Můžete pokračovat v tisku i po zobrazení této zprávy, ale kvalita tisku se může postupně snižovat.
● Bude vypnuto přijímání e-mailů a faxů.
Tisk přijatých e-mailů (tisk e-mailů)(P. 120)
● Když se zobrazí zpráva <Konec životnosti. Vyměňte bubnovou kazetu N.>, tisk je dočasně zastaven.
Chcete-li pokračovat v tisku, stiskněte
(
).
<Vyměňte bubnovou kazetu N.>
Bubnová kazeta v uvedené pozici dosáhla konce své životnosti. Vyměňte tonerovou kazetu.
● Pokud je zobrazena tato zpráva, nemůžete pokračovat v tisku.
<Záruka neplatí pro paděl.kaz./ne Canon.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili kazetu válce za novou.
● Můžete pokračovat v tisku i po zobrazení této zprávy, ale kvalita tisku se může postupně snižovat.
Mohli byste tím zařízení poškodit.
504
Údržba
<Možná padělaná bubnová kazeta/ne Canon.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili kazetu válce za novou.
● Můžete stisknout
(
) a pokračovat v tisku, ale kvalita tisku může být horší. Mohli byste
tím zařízení poškodit.
<Nelze tisknout. Možná paděl. bubn. kaz./ne Canon.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili kazetu válce za novou.
● Pokud je zobrazena tato zpráva, nemůžete pokračovat v tisku.
Canon Genuine Mode(P. 333)
<Chyba kom. s bub. N. Mimo Canon kaz. se nevztah. záruka.>
Tato zpráva varuje před tím, že zařízení nemusí poskytovat tisk v optimální kvalitě. Doporučujeme, abyste
vyměnili kazetu válce za novou.
◼ Je-li kvalita výtisků neuspokojivá
Pokud výtisky začínají vykazovat některé z následujících vlastností, jedna z bubnových kazet je spotřebovaná. Vyměňte
téměř prázdnou bubnovou kazetu, i když není zobrazeno žádné hlášení. Postup výměny bubnových kazet(P. 507)
Jsou viditelné pruhy / Tisk není rovnoměrný
Některé části jsou vybledlé
505
Nerovnoměrná sytost
Údržba
Na prázdných místech se objevují paobrazy
Jsou viditelné bílé skvrny
◼ Kontrola statusu bubnové kazety
Stav bubnové kazety můžete zkontrolovat pomocí položky <Zbývající hl. bubnu> v části <Info.o spotřeb. mat.>. Před
zahájením tisku velké úlohy se doporučuje zkontrolovat hladinu.
ODKAZY
Spotřební materiál(P. 570)
506
Údržba
Postup výměny bubnových kazet
6867-05Y
Před výměnou bubnových kazet si přečtěte bezpečnostní upozornění v části
materiál(P. 10) .
Údržba a kontrola(P. 9) a
1
Zcela otevřete přední kryt.
2
Odjistěte páčku bubnové kazety.
3
Vytáhněte bubnovou kazetu ven.
4
Vyjměte náhradní bubnovou kazetu z obalového materiálu.
507
Spotřební
Údržba
5
Sejměte ochranný kryt.
6
Vložte kazetu válce.
● Vyrovnejte bubnovou kazetu s vodítkem bubnové kazety (
● Dbejte na to, abyste se nedotkli povrchu bubnu (
povrchu bubnu (
) a zasuňte ji až nadoraz do pozice.
) nebo jím nenarazili do ústí pozice. Poškrábání
) může způsobit poruchu.
● Bubnové kazety, které byly nebo jsou použity pro určitou konkrétní barvu, se nesmějí znovu použít pro
jinou barvu. Takovéto opětovné použití bubnových kazet může způsobit špatnou kvalitu tisku.
7
Zajistěte páčku bubnové kazety.
8
Zavřete přední kryt.
508
Údržba
Výměna odpadní nádobky na toner
6867-060
Pokud je zbývající kapacita odpadní nádobky na toner již malá, zobrazí se na displeji příslušná zpráva. Stav odpadní
nádobky na toner lze také zkontrolovat na displeji.
Když se zobrazí zpráva(P. 509)
Zjištění stavu odpadní nádobky na toner(P. 509)
◼ Když se zobrazí zpráva
V závislosti na tom, jaká zpráva se zobrazí, si budete muset připravit náhradní zásobník odpadního toneru nebo jej
Spotřební materiál(P. 570)
přímo vyměnit. Jak vyměnit odpadní nádobku na toner(P. 510)
<Vyměňte brzy zásobník odpadního toneru.>
Tato zpráva informuje o tom, že odpadní nádobku na toner bude třeba brzy vyměnit. Ujistěte se, že máte
připravenou náhradní odpadní nádobku na toner. Pokud se chystáte k tisku velkého objemu dat a zobrazí se
tato zpráva, vyměňte odpadní nádobku na toner ještě před spuštěním tisku.
● Když se nezobrazí zpráva <Připraveno k tisku.>, tisk je dočasně zastaven. Chcete-li pokračovat v tisku,
stiskněte
(
).
● To, která zpráva se zobrazí, závisí na nastavení <Akce po upozornění> v nabídce nastavení na
ovládacím panelu. Akce po upozornění(P. 324)
<Vyměňte zás.odp.toner.>
<Vyměňte zásobník odpadního toneru.>
Odpadní nádobka na toner se zaplnila. Vyměňte odpadní nádobku na toner za novou.
◼ Zjištění stavu odpadní nádobky na toner
Stav odpadní nádobky na toner lze zkontrolovat pomocí položky <Stav odpadn. toneru> v části <Info.o spotřeb. mat.>.
Před tiskem velké úlohy doporučujeme provést kontrolu toho, zda si máte připravit novou odpadní nádobku na toner.
Info.o spotřeb. mat.(P. 467)
ODKAZY
Spotřební materiál(P. 570)
509
Údržba
Jak vyměnit odpadní nádobku na toner
6867-061
Před výměnou odpadní nádobky na toner si přečtěte bezpečnostní upozornění v části
Spotřební materiál(P. 10) .
1
Zcela otevřete přední kryt.
2
Otevřete levý kryt.
3
Vyjměte zásobník odpadního toneru.
Údržba a kontrola(P. 9) a
● Dávejte pozor na to, abyste nádobku nenaklopili, protože byste tak mohli nahromaděný toner vysypat.
● Vložte zásobník odpadního toneru do plastového sáčku, abyste předešli vysypání toneru ze zásobníku.
4
Vyjměte zásobník odpadního toneru z obalového materiálu.
510
Údržba
● Odpadní nádobku na toner nerozebírejte ani neupravujte.
5
Vložte novou odpadní nádobku na toner a zavřete levý kryt.
● Vyrovnejte jej s levým krytem a spodní přihrádkou a zasuňte jej.
6
Zavřete přední kryt.
511
Údržba
Přemístění zařízení
6867-062
Zařízení je těžké. Při přemísťování zařízení dbejte na dodržení následujícího postupu, abyste předešli zranění. Než
začnete s přemísťováním, nejprve se seznamte s bezpečnostními upozorněními. Důležité bezpečnostní
pokyny(P. 2)
1
Při přepravě zařízení na delší vzdálenost proveďte <Prev. rozlév. toneru>.
1
Stiskněte tlačítko
2
Pomocí tlačítka
3
Vyberte možnost <Ano> a stiskněte tlačítko
(
/
).
vyberte možnost <Prev. rozlév. toneru> a stiskněte
.
.
➠ Spustí se čištění.
● Spuštěné čištění nelze zrušit. Počkejte na dokončení operace.
2
Vypněte zařízení a počítač.
● Když vypínáte napájení, nezapomeňte vypnout zařízení z ovládacího panelu bez použití vypínače.
tiskárny (postup vypínání)(P. 36)
3
Vypnutí
Odpojte kabely i napájecí kabel od zařízení v pořadí podle následujících obrázků.
● To, zda jsou kabely označené „*“ připojené, závisí na konkrétním prostředí.
Zástrčka v síťové zásuvce
Napájecí kabel
Zařízení USB*
Kabel USB*
Kabel LAN*
512
Údržba
4
Při přepravě zařízení na delší vzdálenost z něj vyjměte tonerovou kazetu a bubnovou
kazetu.
Postup výměny tonerových kazet(P. 500)
Postup výměny bubnových kazet(P. 507)
5
Zásuvku na papír vytáhněte, dokud se nezarazí, a nadzvednutím přední části ji
6
Zavřete všechny otevřené kryty a přesuňte zařízení na nové místo.
vytáhněte.
● Zařízení je těžké (
Hlavní jednotka(P. 551) ). Zařízení nepřenášejte s vypětím všech sil.
● Zařízení musí přenášet alespoň dvě osoby, a to pomocí madel na bocích zařízení.
Pokud je k přístroji připojen volitelný podavač papíru nebo kazetová podávací jednotka
● Před zvedáním zařízení odpojte podavač papíru nebo kazetovou podávací jednotku a přepravujte je
odděleně od zařízení.
7
Opatrně postavte zařízení na nové místo.
● Informace o postupu instalace zařízení po přemístění naleznete v části Začínáme.
obsah(P. 586)
513
Příručky a jejich
Údržba
Udržení a vylepšení kvality tisku
6867-063
Pokud výsledky tisku nejsou uspokojivé, například když se vytištěné barvy liší od barev originálu nebo je poloha jiná,
než jste očekávali, pokuste se provést následující nastavení.
◼ Nastavení sytosti
Upravte sytost toneru. Úpravu sytosti toneru můžete provést nastavením hladiny sytosti.
tisku(P. 515)
Nastavení sytosti
◼ Korekce neshody barev/odstínu
Proveďte korekci v případě neshody barev nebo rozdílu v odstínu.
Oprava neshody barev a odstínů(P. 517)
◼ Úprava pozice tisku
U každého zdroje papíru můžete nastavit pozici tisku.
Nastavení pozice tisku(P. 519)
514
Údržba
Nastavení sytosti tisku
6867-064
Pokud je výsledný tisk tmavší nebo světlejší, než se očekává, můžete nastavit sytost toneru pro každou barvu CMYK.
Můžete provést jemné nastavení sytosti toneru tak, že celý rozsah sytosti rozdělíte do tří oblastí.
● Pokud je možnost <Úspora toneru> nastavena na hodnotu <Zap>, tuto funkci nelze použít.
toneru(P. 362)
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Upravte sytost.
(
/
).
vyberte možnost <Kvalita tisku> a stiskněte tlačítko
1
Vyberte barvu, jehož sytost chcete upravit, a stiskněte tlačítko
2
Pomocí tlačítek
/
Úspora
.
upravte sytost.
Nastavení sytosti
Nastavte „+“ hodnotu pro zvýšení sytosti. Nastavte „-“ hodnotu pro snížení sytosti.
3
Stiskněte tlačítko
.
Jemné nastavení sytosti toneru pomocí úrovně sytosti
Můžete provádět jemné nastavení sytosti toneru ve třech úrovních sytosti - vysoké, střední a nízké.
1
Pomocí
2
Vyberte požadovanou úroveň sytosti tisku a stiskněte
/
vyberte barvu, jejíž sytost chcete upravit, a stiskněte
515
.
.
.
Údržba
3
Pomocí tlačítek
/
upravte sytost.
Nastavení sytosti
Nastavte „+“ hodnotu pro zvýšení sytosti. Nastavte „-“ hodnotu pro snížení sytosti.
Příklad úpravy každé oblasti sytosti
<Vysoká>
<Střední>
<Nízká>
4
Stiskněte tlačítko
.
● Pokud chcete provést také úpravu na jiných úrovních sytosti, postupujte opět podle kroků 2 až 4.
516
Údržba
Oprava neshody barev a odstínů
6867-065
Jestliže dojde k neshodě barev nebo se obrazy tisknou barvami odlišnými od barev originálu, provedení kalibrace vám
umožní problém napravit. Provedení této korekce vyžaduje dostatečné množství toneru, a proto doporučujeme
Kontrola statusu
předem zkontrolovat zbývající množství toneru a podle potřeby vyměnit tonerové kazety.
tonerových kazet(P. 499)
Korekce neshody barev
Neshoda barev tisku vzniká v důsledku posunu polohy jednotlivých barev na výtisku, ke kterému může dojít při
tisku obrázku pomocí většího počtu tonerových kazet. Neshoda barev může způsobit, že výtisky vypadají
rozmazaně. Pokud dojde k neshodě barev, musíte problém napravit.
Jestliže dochází k neshodě barev
Jestliže nedochází k neshodě barev
Korekce barevných odstínů
Odstínem se rozumí sytost barvy, jako je červená, žlutá, zelená, modrá nebo fialová. Pokud se barevné odstíny
vytištěného obrazu liší od odstínů originálu nebo pokud jsou některé barvy tmavší nebo je celková sytost tisku
menší než u originálu, musíte provést korekci.
Barevné odstíny se nereprodukují
správně
Původní snímek
Barevné odstíny se reprodukují
správně
● Častá kalibrace může mít vliv na životnost tonerových kazet.
● Pokud tonerová kazeta (tonerové kazety) dosáhly konce své živostnosti, může se stát, že kalibrace nebude
správná. V takovém případě tonerovou kazetu (tonerové kazety) vyměňte a kalibraci zkuste znovu.
Postup
výměny tonerových kazet(P. 500)
● Za normálních okolností se kalibrace provádí automaticky v souladu s podmínkami používání zařízení nebo
změnami podmínek okolního prostředí.
● Můžete provést nastavení tak, aby se kalibrace provedla automaticky ihned po zapnutí zařízení, nebo můžete
nastavit frekvenci kalibrace.
První kalibrace(P. 394)
Četnost kalibrace(P. 401)
517
Údržba
1
2
3
Stiskněte tlačítko
/
(
).
pro výběr <Kalibrace>, a stiskněte
Vyberte typ kalibrace a stiskněte
.
.
● Chcete-li provést korekci nesouladu barev, k němuž došlo při tisku POP, vyberte možnost <Kalibrace tisku
POP>.
● Korekce prostřednictvím kalibrace trvá déle při použití možnosti <Kalibrace tisku POP> než při použití
možnosti <Úplná kalibrace>.
4
Vyberte možnost <Ano> a stiskněte tlačítko
.
➠ Začne se provádět nastavení.
● Můžete provést nastavení tak, aby se kalibrace provedla automaticky v zadaný čas.
Časovač kalibrace(P. 319)
Čas kalibrace(P. 319)
● Ačkoli typ kalibrace prováděné automaticky je za běžných okolností shodný s <Úplná kalibrace>, toto
nastavení můžete změnit na <Kalibrace tisku POP>.
Auto kalibrace POP(P. 400)
518
Údržba
Nastavení pozice tisku
6867-066
Pokud se dokument tiskne mimo střed nebo mimo tisknutelnou oblast, upravte pozici tisku. Pozici tisku můžete
upravit pro každý zdroj papíru.
Krok 1: Tisk aktuální pozice tisku(P. 519)
Krok 2: Kontrola směru a vzdálenosti nastavení, které se mají upravit(P. 520)
Krok 3: Upravení pozice tisku pro každý zdroj papíru(P. 521)
Krok 1: Tisk aktuální pozice tisku
Můžete provést „Tisk úpravy pozice tisku“ pro kontrolu směru a vzdálenosti, které se mají upravit.
● Pokud chcete zkontrolovat pozici tisku pro oboustranný tisk, nastavte předem možnost <2stranný tisk> na
<Zap> v nabídce nastavení na ovládacím panelu. 2stranný tisk(P. 482)
1
Stiskněte tlačítko
2
Pomocí tlačítek
vyberte možnost <Zdroj papíru> a stiskněte tlačítko
.
3
Vyberte zdroj papíru, pro který chcete zkontrolovat pozici tisku, a stiskněte
.
4
Stiskněte tlačítko
( ).
/
(
).
➠ Obrazovka se vrátí na hlavní obrazovku.
5
Stiskněte tlačítko
(
).
519
Údržba
6
Vyberte možnost <Tisk nast. pol.tisku> a stiskněte tlačítko
7
Vyberte možnost <Ano> a stiskněte tlačítko
.
.
➠ Výtisk upravení pozice tisku je proveden.
Krok 2: Kontrola směru a vzdálenosti nastavení, které se mají upravit
Pokud provádíte tisk úpravy pozice tisku, vytisknou se kontrolní značky polohy tisku
. Určete směr a vzdálenost,
které se mají upravit, na základě těchto značek. Když je pozice tisku normální, všechny značky se vytisknou v pozici 5
mm od nejbližšího okraje papíru.
Jak kontrolovat výtisky upravení pozice tisku
Okraj papíru, který vyjde jako první, když papír vystupuje, je horní část tisku úpravy pozice tisku. Když pozici
tisku kontrolujete, dávejte pozor na to, který okraj papíru je nahoře.
● Velikost značky
pro kontrolu pozice
tisku odpovídá obrázku níže.
Když je pozice tisku mimo střed
Když se kontrolní značky pozice tisku vytisknou mimo středovou pozici, musíte pozici tisku upravit. Když pozici
tisku upravíte, zadejte směr pomocí „+“ a „-“ a vzdálenost pomocí „mm“. Pomocí „-“ posunete pozici tisku nahoru
a pomocí „+“ ji posunete dolů (korekce svislé pozice). Pomocí „-“ posunete pozici tisku doleva a pomocí „+“ ji
posunete doprava (korekce vodorovné pozice).
Svislý směr (<Přesah Y>)
Vodorovný směr (<Přesah X>)
520
Údržba
V příkladu uvedeném níže je pro posun pozice tisku 5 mm nahoru a 1,5 mm doprava nastavena možnost
„-5,0 mm“ v <Přesah Y> a možnost „+1,50 mm“ je nastavena v <Přesah X>.
Krok 3: Upravení pozice tisku pro každý zdroj papíru
Po potvrzení směru a vzdálenosti, které se mají upravit, zadejte upravenou pozici tisku. Pozici tisku můžete upravit ve
svislém směru rozsahu -5,0 mm až +5,0 mm v krocích 0,1 mm a ve vodorovném směru v rozsahu -3,5 mm až +3,5 mm v
krocích 0,25 mm.
1
Nastavte zařízení na offline.
● Pokud svítí
(
), stiskněte
(
).
2
Stiskněte tlačítko
3
Pomocí tlačítek
4
Vyberte možnost <Uprav. polohu tisku> a stiskněte tlačítko
5
Vyberte kombinaci směru, kterou chcete upravit, a zdroj papíru a stiskněte
(
/
).
vyberte možnost <Uživatelská údržba> a stiskněte tlačítko
.
521
.
.
Údržba
● Pro možnost <Přesah X (2stranný)> nejdříve vyberte zdroj papíru a potom upravte pozici tisku.
Úprava pozice tisku pro oboustranný tisk
● <Přesah Y (2stranný)> a <Přesah X (2stranný)> vám umožní upravit pozici tisku na první stránce (přední
strana). Pozice tisku na druhou stranu (zadní stranu) se upraví na základě hodnot nastavených pro každý
zdroj papíru.
Příklad úpravy pozice tisku
6
První strana (přední strana)
<Přesah Y (2stranný)> nastavení hodnoty
Druhá strana (zadní strana)
<Přesah Y (Víceú.př.)> nastavení hodnoty
Nastavte hodnotu a stiskněte tlačítko
.
● Na základě výtisku podle funkce tisk úpravy pozice tisku použijte
/
k zadání hodnoty.
● Když je zadána možnost <Přesah Y (2stranný)>, pozice tisku se upraví zadáním hodnot pro všechny zdroje
papíru.
● Pro upravení jiné pozice nebo zdroje papíru opakujte kroky 5 a 6.
7
Stiskněte tlačítko
(
).
➠ Obrazovka se vrátí na hlavní obrazovku.
8
Znovu stiskněte tlačítko
(
).
➠ Zařízení přejde do režimu online.
9
Proveďte tisk úpravy pozice tisku a zkontrolujte upravenou pozici tisku na výtisku.
Krok 1: Tisk aktuální pozice tisku(P. 519)
Úprava všech tiskových pozic
K úpravě polohy tisku u všech typů tisku bez ohledu na zdroj papíru můžete použít možnost <Přesah Y> a
<Přesah X> v nabídce nastavení na ovládacím panelu. Polohu tisku můžete upravit v rozsahu -50,0 mm až +50,0
mm v krocích po 0,5 mm v obou směrech: ve svislém i vodorovném směru. Přesah Y/Přesah X(P. 357)
522
Údržba
Tisk hlášení a seznamů
6867-067
Stav spotřebního materiálu a nastavení zařízení můžete zkontrolovat pomocí vytištění hlášení a seznamů.
Hvězdičky (*)
● Nastavení označená údajem „*1“ se nemusí zobrazit, a to v závislosti na volitelných možnostech.
● Nastavení označená údajem „*2“ nemusejí být zobrazena, pokud není pole [Zobrazit Výpis úlohy] Vzdálené
UR vybráno. Skrytí historie tiskových úloh(P. 252)
Konfigurační strana
Můžete zkontrolovat nastavení zařízení ( Nabídka nastavení(P. 315) ), obsah uložený v zařízení a další informace,
a to ve formě seznamu. Tyto další informace zahrnují stav tonerové kazety, počet vytištěných stránek a kapacitu
paměti (RAM) připojené k zařízení. Položky nastavení, před jejichž názvem je uvedena hvězdička (*), jsou položky,
jejichž nastavení bylo změněno oproti výchozím továrním hodnotám.
(
)
<Konfigurační stránka>
<Ano>
Příklad:
Tisk stavu sítě
Můžete zkontrolovat nastavení o síti nakonfigurované v zařízení ( Síť(P. 336) ) ve formě seznamu. Vytisknou se také
informace o zabezpečení včetně nastavení filtru adres a nastavení IPSec.
523
Údržba
(
)
<Tisk stavu sítě>
<Ano>
Příklad:
Tisk stavu spotřebního materiálu
Informace, jako je stav tonerových kazet či bubnových kazet, varovná hlášení a informace o tom, kde můžete zakoupit
nové tonerové kazety, lze zobrazit ve formě seznamu.
(
)
<Tisk stavu spotř.m.>
<Ano>
Příklad:
524
Údržba
Seznam zásad zabezpečení IPSec
Pokud vytisknete seznam zásad zabezpečení IPSec, můžete zkontrolovat seznam názvů zásad a nastavení IPSec
uložené v zařízení.
(
)
<Seznam zásad IPSec>
<Ano>
Příklad:
Seznam protokolu o příjmu e-mailů
Můžete zkontrolovat protokol obsahující předměty a datum a čas přijetí e-mailů přijatých do zařízení ve formě
seznamu.
(
)
<Nástroj.tisk e-mailů>
<Sezn.výp.PŘ. e-mailů>
Příklad:
525
<Ano>
Údržba
Seznam počtu stran
Můžete zkontrolovat počet stran vytištěných pro každé oddělení vytištěním zprávy, když je povolena možnost [Správa
ID oddělení].
(
)
<Seznam počtu stran>
<Ano>
Příklad:
Zpráva počitadla
Vytvoření hlášení s uvedením celkového počtu dosud vytištěných stránek.
(
)
<Hlášení počitadla>
<Ano>
Příklad:
Tisk systémových informací MEAP
Můžete zkontrolovat informace o aplikacích MEAP nainstalovaných v zařízení a aplikacích systému MEAP, pokud je
povolena funkce MEAP.
526
Údržba
(
)
<Tisk sys. info. MEAP>
<Ano>
Příklad:
Tisk výpisu kazet
Můžete zkontrolovat protokoly o použití tonerových kazet a bubnových kazet formou seznamu.
(
)
<Tisk prot. kazety>
<Ano>
Příklad:
Seznam písem PCL
Můžete zkontrolovat, jaká písma jsou k dispozici v režimu PCL ve formě seznamu.
(
)
<Obslužný program PCL>
527
Ukázky písma(P. 617)
<Seznam písem>
<Ano>
Údržba
Příklad:
Seznam režimu PS
Nastavení pro používání režimu PS a interních informačních položek zaregistrovaných v zařízení se vytisknou ve formě
seznamu.
Konfigurační strana(P. 528)
Seznam písem(P. 529)
◼ Konfigurační strana
Můžete zkontrolovat nastavení zařízení (
(
)
PS(P. 449) ) a obsah zaregistrovaný v zařízení ve formě seznamu.
<Obslužný program PS>
Příklad:
528
<Konfigurační stránka>
<Ano>
Údržba
◼ Seznam písem
Můžete zkontrolovat, jaká písma jsou k dispozici v režimu PS ve formě seznamu.
(
)
<Obslužný program PS>
<Seznam písem>
Příklad:
Seznam uložených úloh *1
Můžete tisknout seznam dokumentů uložených na kartě SD vložené do zařízení.
(
)
<Seznam ulož. úloh>
<Ano>
Příklad:
Protokol tiskových úloh *2
Můžete vytisknout protokol dokumentů vytištěných z počítače ve formě seznamu.
529
<Ano>
Údržba
(
)
<Výpis tisku úloh>
<Ano>
Příklad:
Protokol tiskových úloh *1*2
Můžete vytisknout protokol tisku dokumentů uložených na kartě SD vložené do zařízení ve formě seznamu.
(
)
<Výpis tisku ulož.úl.>
<Ano>
Příklad:
Protokol tisku zpráv *2
Můžete tisknout nastavení a protokol tisku zpráv ve formě seznamu.
(
)
<Hlášení výpisu tisku>
<Ano>
Příklad:
530
Údržba
Protokol tisku e-mailů *2
Můžete tisknout protokol tisku přijatých e-mailů ve formě seznamu.
(
)
<Hláš. tisku e-mailu>
<Ano>
Příklad:
ODKAZY
Utility Menu(P. 464)
Nabídka Úloha(P. 470)
531
Údržba
Zobrazení hodnoty počítadla
6867-068
Můžete zkontrolovat počet vytištěných stránek.
Kontrola celkového počtu vytištěných stránek(P. 532)
Kontrola počtu stránek vytištěných pro každé oddělení(P. 533)
Kontrola celkového počtu vytištěných stránek
Můžete zkontrolovat celkový počet dosud vytištěných stránek a také aktuální počet černobíle vytištěných stránek a
barevně vytištěných stránek.
(
)
<Zkontrol. počitadlo>
Vyberte nastavení, které chcete zobrazit
<101: Celkem 1>
Můžete zkontrolovat celkový počet vytištěných stránek.
<108: Celkem (ČB 1)>
Můžete zkontrolovat počet stránek vytištěných černobíle.
<112: Celkem (Čern/v)>
Můžete zkontrolovat počet stránek vytištěných černobíle na papír větší než B4.
<113: Celkem (ČB/m.)>
Můžete zkontrolovat počet stránek vytištěných černobíle na papír velikosti B4 nebo menší.
<114:Celkem 1(2str)>
Můžete zkontrolovat počet stránek vytištěných v režimu oboustranného tisku.
<122:Celkem(vše+1C/V)>
Můžete zkontrolovat počet stránek vytištěných barevně na papír větší než B4 (kromě tisku e-mailu).
532
Údržba
<123:Celkem(vše+1C/M)>
Můžete zkontrolovat počet stránek vytištěných barevně na papír velikosti B4 nebo menší (kromě tisku emailu).
Kontrola počtu stránek vytištěných pro každé oddělení
Můžete zkontrolovat počet stránek vytištěných pro každé oddělení.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na tlačítko [Správa ID oddělení].
➠ Počet vytištěných stránek se zobrazí pro každé ID oddělení v částí [Vytištěné strany].
533
Spuštění
Údržba
Vytištění výsledku kontroly
Seznam počtu stran(P. 526)
Vymazání počtu stránek na nulu
● Pokud chcete vymazat počtu stránek na nulu pro každé oddělení, klikněte na textový odkaz v části [ID
oddělení] a klikněte na [Vynulovat počet] [OK].
● Pokud chcete počitadla všech oddělení vrátit na nulu, klikněte na [Vynulovat všechny počty]
534
[OK].
Údržba
Kontrola spotřebního materiálu
6867-069
Můžete použít ovládací panel ke kontrole informací o spotřebním materiálu.
Kontrola papíru(P. 535)
Kontrola modelu tonerové kazety(P. 535)
Kontrola statusu tonerových kazet(P. 536)
Kontrola modelu bubnové kazety(P. 536)
Kontrola statusu bubnové kazety(P. 536)
Zjištění čísla modelu odpadní nádobky na toner(P. 537)
Zjištění stavu odpadní nádobky na toner(P. 537)
Kontrola papíru
Můžete zobrazit aktuálně specifikovanou velikost papíru a typ papíru a zbývající úrovně papíru pro každý zdroj papíru.
(
)
<Info.o spotřeb. mat.>
<Informace o papíru>
Vyberte zdroj
papíru
Výběr zdroje papíru
Vyberte zdroj papíru, ze kterého jsou zobrazené informace.
Kontrola modelu tonerové kazety
Můžete zobrazit číslo modelu tonerové kazety pro zařízení.
(
)
<Info.o spotřeb. mat.>
<Model toner. kazety>
Výběr barvy
Vyberte barvu zobrazení čísla modelu.
535
Vyberte barvu
Údržba
Kontrola statusu tonerových kazet
Zobrazení statusu tonerové kazety.
(
)
<Info.o spotřeb. mat.>
<Zbývající toner>
● Zobrazené hodnoty lze použít pouze jako vodítko a mohou se lišit od skutečného stavu.
Kontrola modelu bubnové kazety
Můžete zobrazit číslo modelu bubnové kazety pro zařízení.
(
)
<Info.o spotřeb. mat.>
<Model bubn. kazety>
kazetu
Výběr bubnové kazety
Vyberte bubnovou kazetu, u které chcete zobrazit číslo modelu.
Kontrola statusu bubnové kazety
Zobrazení stavu bubnové kazety.
(
)
<Info.o spotřeb. mat.>
<Zbývající hl. bubnu>
536
Vyberte bubnovou
Údržba
● Zobrazené hodnoty lze použít pouze jako vodítko a mohou se lišit od skutečného stavu.
Zjištění čísla modelu odpadní nádobky na toner
Zobrazí číslo modelu odpadní nádobky na toner použité v zařízení.
(
)
<Info.o spotřeb. mat.>
<Zásobn. odpad.toneru>
Zjištění stavu odpadní nádobky na toner
Zobrazí stav odpadní nádobky na toner použité v zařízení.
(
)
<Info.o spotřeb. mat.>
<Stav odpadn. toneru>
537
Údržba
Inicializace nastavení
6867-06A
Můžete obnovit následující nastavení:
Inicializace nabídky(P. 539)
Inicializace nastavení sítě(P. 540)
538
Údržba
Inicializace nabídky
6867-06C
Můžete obnovit nastavení zařízení (
Nabídka nastavení(P. 315) ) na výchozí nastavení z výroby.
Netikněte hlavní vypínač, když probíhá inicializace
● Pokud zařízení vypnete při inicializaci, může se poškodit.
Pokud byl zadán přístupový kód PIN Vzdáleného uživatelského rozhraní
● Je také inicializován kód PIN Vzdáleného uživatelského rozhraní. Po inicializaci zadejte znovu kód PIN
Vzdáleného uživatelského rozhraní. Nastavení kódu PIN pro Vzdálené uživatelské rozhraní(P. 225)
● Pokud chcete inicializovat nastavení sítě, postupujte podle postupu v části
sítě(P. 540) .
Inicializace nastavení
● Pokud chcete inicializovat nastavení v <Uprav. polohu tisku>, postupujte podle postupu v části
polohu tisku(P. 379) .
(
)
<Inicializace nabídky>
<Ano>
tvrdého resetu(P. 472) )
539
Proveďte tvrdý reset (
Uprav.
Provedení
Údržba
Inicializace nastavení sítě
6867-06E
Můžete obnovit nastavení sítě (
Síť(P. 336) ) na výchozí nastavení z výroby.
Neinicializujte síťová nastavení, pokud zařízení tiskne nebo přijímá tisková data
● Mohlo by to vést k nesprávnému tisku, uvíznutí papíru nebo poškození zařízení.
(
)
nastavení>
<Síť>
Přečtěte si zprávu
<Ano>
<Inic. síť.
Proveďte tvrdý reset (
540
Provedení tvrdého resetu(P. 472) )
Dodatek
Dodatek
Dodatek ............................................................................................................................................................... 542
Software třetí strany ......................................................................................................................................... 543
To nejlepší z funkcí ............................................................................................................................................ 544
Šetrnost vůči životnímu prostředí a úspora peněz ........................................................................................ 545
Vyšší účinnost ............................................................................................................................................... 546
Mnohem více ................................................................................................................................................ 548
Specifikace ......................................................................................................................................................... 550
Hlavní jednotka ............................................................................................................................................ 551
Použitelný papír ............................................................................................................................................ 553
Paper Feeder PF-G ........................................................................................................................................ 559
Cassette Feeding Unit-AU ............................................................................................................................. 560
Funkce tiskárny ............................................................................................................................................ 561
Funkce správy ............................................................................................................................................... 565
Systémové prostředí ..................................................................................................................................... 568
Síťové prostředí ............................................................................................................................................ 569
Spotřební materiál ............................................................................................................................................ 570
Možnosti ............................................................................................................................................................ 573
Volitelná zařízení .......................................................................................................................................... 574
Systémové volitelné doplňky ........................................................................................................................ 575
Instalace ROM ....................................................................................................................................... 577
Instalace SD karty .................................................................................................................................. 581
Příručky a jejich obsah ...................................................................................................................................... 586
Použití dokumentu Uživatelská příručka ........................................................................................................ 587
Rozložení obrazovky dokumentu Uživatelská příručka ................................................................................. 588
Zobrazení dokumentu Uživatelská příručka .................................................................................................. 591
Správa aplikací MEAP ........................................................................................................................................ 593
Používání klientů FTP ........................................................................................................................................ 594
Příprava na použití serveru FTP .................................................................................................................... 595
Tisk prostřednictvím klienta FTP (tisk FTP) .................................................................................................... 598
Zadání nastavení prostřednictvím klienta FTP .............................................................................................. 600
Ostatní ............................................................................................................................................................... 607
Základní operace v systému Windows .......................................................................................................... 608
Ukázky písma ............................................................................................................................................... 617
Upozornění ................................................................................................................................................... 622
541
Dodatek
Dodatek
6867-06F
Tato kapitola obsahuje technické specifikace tohoto zařízení, pokyny k používání dokumentu Uživatelská příručka,
odmítnutí odpovědnosti, informace o autorských právech a další důležité informace pro zákazníky.
542
Dodatek
Software třetí strany
6867-06H
Informace týkající se softwaru třetích stran získáte kliknutím na následující ikony.
543
Dodatek
To nejlepší z funkcí
6867-06J
Vyzkoušejte funkce popsané v této části. Funkce jsou uvedeny v rámci tří nadpisů: „Šetrnost vůči životnímu prostředí a
úspora peněz“, „Vyšší účinnost“ a „Mnohem více“.
544
Dodatek
Šetrnost vůči životnímu prostředí a úspora peněz
6867-06K
Existuje mnoho způsobů, jak ušetřit za papír, tonerové kazety, elektřinu a další výdaje.
Oboustranný tisk
Můžete tisknout na obě strany papíru. Použijte oboustranný tisk, abyste ušetřili papír, a to nejen u velkých
tiskových úloh, ale také když chcete vytisknout jen několik stránek. Pro ještě větší úsporu můžete použít
oboustranný tisk N stránek na jedné. Na jediný list papíru můžete vytisknout až 32 stránek, což je ekonomické a
šetří se tím životní prostředí.
Tisk z počítače(P. 74)
Režim spánku
Pokud zařízení nebudete nějakou dobu používat, můžete šetřit energii tím, že tiskárnu přepnete do režimu
spánku, a to buď manuálně nebo automaticky. Není potřeba, abyste pokaždé tiskárnu vypínali, přesto můžete
zajistit, že bude mít minimální odběr. Funkce automatického vypnutí může úsporu energie ještě zvýšit, protože
tiskárna se vypne, když se nepoužívá delší dobu. Tyto pohodlné funkce pracují v pozadí a šetří energii i vaše
prostředky každý den.
Přepnutí do režimu spánku(P. 67)
Nastavení času automatického vypnutí(P. 69)
545
Dodatek
Vyšší účinnost
6867-06L
Tady je několik jednoduchých operací, které mohou zefektivnit složité úkoly.
Tisk bez programů
Data PDF/PS/EPS/JPEG/TIFF/XPS můžete k tisku odesílat ze Vzdáleného uživatelského rozhraní přímo do zařízení.
Tisknout lze i bez počítače připojením paměťového zařízení USB do zařízení. Nemusíte otevírat soubory, takže
není nutné spouštět žádný program. Je to velmi pohodlné, když spěcháte a nemáte přístup k počítači.
Tisk bez otevření souboru (přímý tisk)(P. 106)
Tisk z paměti USB (Přímý tisk z USB)(P. 81)
Vzdálená správa pomocí Vzdáleného uživatelského rozhraní
Vzdálené uživatelské rozhraní umožňuje spravovat zařízení dálkově z počítače, přímo od pracovního stolu.
Můžete zkontrolovat stav papíru a tonerových kazet nebo ověřit aktuální stav tiskových úloh a rozhodnout, zda
je vhodné dočasně přerušit tiskové úlohy a vytisknout naléhavé dokumenty, nebo zda předřadit dokumenty
ostatním úlohám čekajícím na vytištění. Ušetřete si čas a starosti tím, že nebudete muset chodit tam a zpět
z kanceláře k tiskárně.
Použití Vzdáleného uživatelského rozhraní(P. 289)
Šetřete čas díky zkratkám
546
Dodatek
Pokud máte k tisku více dokumentů, bylo by vhodné je vytisknout všechny najednou. Canon
PageComposer umožňuje kombinovat více dokumentů a tisknout je najednou. Můžete také ukládat často
tištěné dokumenty, jako například přední listy faxu, a to na SD kartu zařízení; poté je můžete tisknout přímo z
ovládacího panelu. Není třeba se vracet do počítače a spouštět ovladač tiskárny. Tyto zkratky šetří čas a
umožňují vám pracovat efektivněji.
Tisk z počítače(P. 74)
Tisk dokumentu uloženého v tiskárně (tisk uložené úlohy)(P. 96)
Rychlé nastavení tisku pomocí intuitivního postupu
Pomocí náhledu obrázku v ovladači tiskárny můžete snadno zadat rozvržení stránky a také umístění vazby,
přepínat mezi jednostranným a oboustranným tiskem atd. Jednoduchým kliknutím můžete snadno provést
požadovaná nastavení a současně ověřit jejich účinek.
Tisk z počítače(P. 74)
547
Dodatek
Mnohem více
6867-06R
Existuje velké množství funkcí pro veškeré vaše potřeby, ať jste doma, v kanceláři nebo na cestách.
Použití smartphonu nebo tabletu
Když potřebujete rychle vytisknout návrh vytvořený v tabletu při služební cestě, oceníte aplikaci Canon Mobile.
To vše snadno a rychle a zcela bez počítače! Rozsáhlejší možnosti pro práci i zábavu díky funkcím, které byly
navrženy pro naši rychlou dobu.
Praktické možnosti využití s mobilním zařízením(P. 127)
Snadný tisk pomocí služby Google Cloud Print
Připojte se ke službě Google Cloud Print pomocí notebooku nebo mobilního telefonu, odešlete svá data a
počkejte na vytištěné dokumenty. Pomocí tohoto zařízení, služby Google Cloud Print a svého mobilního zařízení
můžete tisknout cokoli potřebujete, odkudkoli to potřebujete.
Použití služby Google Cloud Print(P. 139)
Zachovejte soukromí svých výtisků
Běžně platí, že když něco tisknete z počítače, ihned to vyjede z tiskárny. Pokud však máte citlivé dokumenty,
tento způsob není zrovna vhodný. Stačí použít zabezpečený tisk a nikdo nebude moci vaše dokumenty
vytisknout bez zadání vašeho hesla na ovládacím panelu zařízení. Nenechávejte důvěrné dokumenty ležet v
přihrádce, kde si je může kdokoli prohlédnout.
548
Dodatek
Tisk dokumentu zabezpečeného kódem PIN (zabezpečený tisk)(P. 92)
549
Dodatek
Specifikace
6867-06S
Specifikace se mohou bez předchozího upozornění změnit z důvodů vylepšení zařízení nebo budoucí verze.
◼ Specifikace zařízení
Hlavní jednotka(P. 551)
Použitelný papír(P. 553)
◼ Specifikace volitelných zařízení
Paper Feeder PF-G(P. 559)
Cassette Feeding Unit-AU(P. 560)
◼ Funkční specifikace
Funkce tiskárny(P. 561)
Funkce správy(P. 565)
◼ Prostředí pro používání zařízení
Systémové prostředí(P. 568)
Síťové prostředí(P. 569)
550
Dodatek
Hlavní jednotka
6867-06U
● Informace o velikostech a typech papíru pro každý zdroj papíru viz „
Typ
Stolní
Podporované barvy
Plné barvy
Rozlišení pro zápis
600 dpi x 600 dpi
Počet odstínů
256
Přijatelný papír
Velikosti papíru
Použitelný papír(P. 553) “.
● Max: 320,0 mm x 457,2 mm
● Max (zásuvka na papír): 297,0 mm x 431,8 mm
● Min (zásuvka na papír): 148,0 mm x 148,0 mm
● Min (víceúčelová přihrádka): 64,0 mm x 127,0 mm
Hmotnost papíru
● Zásuvka na papír: 60 g/m² až 256 g/m²*1
● Víceúčelová přihrádka: 60 g/m² až 300 g/m²
Typ papíru
Doba zahřívání *2
Použitelný papír(P. 553)
Po zapnutí napájení
34,0 sekund nebo méně
Aktivace z režimu spánku
4,0 sekund nebo méně
Doba prvního tisku
(A4)
Rychlost tisku *3
(A4)
● Plné barvy: Přibližně 7,4 sekund
● Černobílé: Přibližně 6,7 sekund
● Plné barvy: 36 listů/minutu
● Černobílé: 36 listů/minutu
Systém podávání papíru / kapacita *4 Zásuvka na papír
640 listů (64 g/m²)/550 listů (80 g/m²) x 1
Víceúčelová přihrádka
120 listů (64 g/m²)/100 listů (80 g/m²) x 1
551
Dodatek
Výstupní systém papíru / kapacita *4 Výstupní přihrádka
200 listů (60 g/m² až 90 g/m²)
100 listů (90 g/m² až 300 g/m²)
Napájení
AC 220 V - 240 V, 4,7 A, 50 Hz / 60 Hz
Spotřeba energie *2
Maximální spotřeba energie
1 500 W nebo méně
V režimu spánku
Přibližně 2,0 W
Když je hlavní napájení vypnuto
0,1 W nebo méně
Rozměry
(Š x H x V)
556 mm x 608 mm x 403 mm
Hmotnost
Hlavní jednotka *5
Přibližně 38,0 kg
Spotřební materiál
Spotřební materiál(P. 570)
Prostor pro instalaci
Viz část „Začínáme“
Příručky a jejich obsah(P. 586)
Kapacita paměti
Paměť RAM: 1 GB
Podmínky prostředí
Teplota: 10 °C až 30 °C
Vlhkost: 20 % až 80 % relativní vlhkosti (bez kondenzace)
*1Při
vkládání papíru o délce 364,0 mm nebo více v orientaci na šířku nesmí být hmotnost papíru 199 g/m² nebo více.
*2Může
se lišit v závislosti na prostředí a podmínkách, v nichž je zařízení používáno.
*3Rychlost
tisku se měří na základě interního testování při použití papíru velikosti A4 a jednostranném tisku v poměru
100 % vůči předloze. Interní testování zahrnovalo nepřetržitý tisk stejné jedné stránky obsahu na běžný papír. Rychlost
tisku se může lišit v závislosti na typu papíru, velikosti papíru nebo směru podávání papíru.
Zařízení může automaticky přerušit nebo zpomalit činnost kvůli úpravě stavu tiskárny, například kontrole teploty některé
jednotky nebo udržení kvality obrazu během nepřetržitého tisku.
*4Může
se lišit v závislosti na prostředí instalace a typu použitého papíru.
*5Tonerové
kazety a bubnové kazety nejsou zahrnuty.
552
Dodatek
Použitelný papír
6867-06W
◼ Podporované velikosti papíru
Velikosti papíru, které je možné vložit do zásuvky na papír, víceúčelové přihrádky nebo volitelných zdrojů papíru, jsou
uvedeny níže.
: Dostupná
: Nedostupná
Velikost papíru
Zásuvka na papír *1
Víceúčelová
přihrádka
Automatický oboustranný tisk
*2
A3
B4
A4
B5
A5
A6
Ledger (11 x 17)
Legal (LGL)
Letter (LTR)
*1Včetně
volitelného modulu Paper Feeder PF-G/ Cassette Feeding Unit-AU.
*2Automatický
*3K
oboustranný tisk je k dispozici bez výměny papíru.
dispozici jsou následující velikosti.
● Pokud je papír vložen v orientaci na výšku (pouze při používání ovladače tiskárny Ovladač Canon Generic UFR II):
šířka 148,0 mm až 297,0 mm, délka 148,0 mm až 297,0 mm
● Pokud je papír vložen v orientaci na šířku:
šířka 148,0 mm až 297,0 mm, délka 148,0 mm až 431,8 mm
*4K
dispozici jsou následující velikosti.
● Pokud je papír vložen v orientaci na výšku (pouze při používání ovladače tiskárny Ovladač Canon Generic UFR II):
šířka 120,0 mm až 320,0 mm, délka 120,0 mm až 320,0 mm
● Pokud je papír vložen v orientaci na šířku:
šířka 64,0 mm až 320,0 mm, délka 120,0 mm až 457,2 mm
šířka 200,0 mm až 297,0 mm, délka 457,3 mm až 1200,0 mm (dlouhá velikost: pouze při používání ovladače tiskárny Ovladač Canon Generic
UFR II)
*5K
dispozici jsou následující velikosti.
● Šířka 148,0 mm až 320,0 mm, délka 148,0 mm až 457,2 mm
553
Dodatek
Velikost papíru
Zásuvka na papír *1
Víceúčelová
přihrádka
Automatický oboustranný tisk
*2
Statement (STMT)
Executive (EXEC)
Foolscap (FLSC)
305 x 457 mm / 12 x 18 in
8K
16K
Kartotéční lístek
Indian Legal (India-LGL)
Pohlednice
Pohlednice s odpovědí
Pohlednice 4 na 1
Obálka NAGAGATA 3
Obálka KAKUGATA 2
Obálka YOUGATANAGA 3 (Younaga 3)
Obálka No. 10 (COM10)
*1Včetně
volitelného modulu Paper Feeder PF-G/ Cassette Feeding Unit-AU.
*2Automatický
*3K
oboustranný tisk je k dispozici bez výměny papíru.
dispozici jsou následující velikosti.
● Pokud je papír vložen v orientaci na výšku (pouze při používání ovladače tiskárny Ovladač Canon Generic UFR II):
šířka 148,0 mm až 297,0 mm, délka 148,0 mm až 297,0 mm
● Pokud je papír vložen v orientaci na šířku:
šířka 148,0 mm až 297,0 mm, délka 148,0 mm až 431,8 mm
*4K
dispozici jsou následující velikosti.
● Pokud je papír vložen v orientaci na výšku (pouze při používání ovladače tiskárny Ovladač Canon Generic UFR II):
šířka 120,0 mm až 320,0 mm, délka 120,0 mm až 320,0 mm
● Pokud je papír vložen v orientaci na šířku:
šířka 64,0 mm až 320,0 mm, délka 120,0 mm až 457,2 mm
šířka 200,0 mm až 297,0 mm, délka 457,3 mm až 1200,0 mm (dlouhá velikost: pouze při používání ovladače tiskárny Ovladač Canon Generic
UFR II)
*5K
dispozici jsou následující velikosti.
● Šířka 148,0 mm až 320,0 mm, délka 148,0 mm až 457,2 mm
554
Dodatek
Velikost papíru
Zásuvka na papír *1
Víceúčelová
přihrádka
Automatický oboustranný tisk
*2
Obálka Monarch
Obálka C5 (ISO-C5)
Obálka DL
Uživatelská velikost papíru
*1Včetně
*4
*5
volitelného modulu Paper Feeder PF-G/ Cassette Feeding Unit-AU.
*2Automatický
*3K
*3
oboustranný tisk je k dispozici bez výměny papíru.
dispozici jsou následující velikosti.
● Pokud je papír vložen v orientaci na výšku (pouze při používání ovladače tiskárny Ovladač Canon Generic UFR II):
šířka 148,0 mm až 297,0 mm, délka 148,0 mm až 297,0 mm
● Pokud je papír vložen v orientaci na šířku:
šířka 148,0 mm až 297,0 mm, délka 148,0 mm až 431,8 mm
*4K
dispozici jsou následující velikosti.
● Pokud je papír vložen v orientaci na výšku (pouze při používání ovladače tiskárny Ovladač Canon Generic UFR II):
šířka 120,0 mm až 320,0 mm, délka 120,0 mm až 320,0 mm
● Pokud je papír vložen v orientaci na šířku:
šířka 64,0 mm až 320,0 mm, délka 120,0 mm až 457,2 mm
šířka 200,0 mm až 297,0 mm, délka 457,3 mm až 1200,0 mm (dlouhá velikost: pouze při používání ovladače tiskárny Ovladač Canon Generic
UFR II)
*5K
dispozici jsou následující velikosti.
● Šířka 148,0 mm až 320,0 mm, délka 148,0 mm až 457,2 mm
● Je možné, že některé velikosti papíru se v závislosti na ovladači tiskárny nezobrazí. Pokud se požadovaná
velikost papíru nezobrazí, stáhněte si vhodný ovladač tiskárny z webu Canon. Nemůžete-li jej stáhnout,
kontaktujte místního autorizovaného prodejce společnosti Canon nebo linku podpory společnosti Canon.
◼ Podporované typy papíru
V tomto přístroji je možné používat papír bez chlóru.
● V závislosti na použitém typu papíru se kvalita tisku může zhoršit.
: K dispozici
: Není k dispozici
555
Dodatek
Typ papíru
Zásuvka na papír *1 Víceúčelová přihrádka
Běžný L2
60 g/m²
Běžný L *3
60 g/m² až 74 g/m²
Běžný *3
75 g/m² až 90 g/m²
Silný 1
91 g/m² až 120 g/m²
Silný 2
121 g/m² až 163 g/m²
Silný 3
164 g/m² až 220 g/m²
*4
Silný 4
221 g/m² až 256 g/m²
*4
Silný 5
257 g/m² až 300 g/m²
Potažený 1
100 g/m² až 130 g/m²
Potažený 2
131 g/m² až 160 g/m²
Potažený 3
161 g/m² až 220 g/m²
Hrubý 1
60 g/m² až 74 g/m²
Hrubý 2
75 g/m² až 103 g/m²
Automatický oboustranný
tisk *2
Štítky
Pohlednice *5
Obálka
*1Včetně
volitelného modulu Paper Feeder PF-G/ Cassette Feeding Unit-AU.
*2Automatický
*3K
oboustranný tisk je k dispozici bez výměny papíru.
dispozici je také recyklovaný papír.
*4Při
vkládání papíru o délce 364,0 mm nebo více v orientaci na šířku nesmí být hmotnost papíru 199 g/m² nebo více.
*5Tisknutelné
inkoustové tiskové pohlednice nebo pohlednice pro odpovědi nelze použít.
◼ Typy papíru dostupné při použití Optimalizace tisku reklamních poutačů
Typy papíru, které jsou k dispozici, když je v ovladači tiskárny nakonfigurována možnost [Optimalizace tisku reklamních
poutačů], jsou uvedeny níže.
556
Dodatek
● Další informace o [Optimalizace tisku reklamních poutačů] najdete v příručkách k příslušným ovladačům na
webu s online příručkami.
● Je-li nakonfigurována možnost [Optimalizace tisku reklamních poutačů], nelze použít funkci oboustranného
tisku.
● Můžete použít papír takových velikostí, které lze zadat jako vlastní velikost. Pokud však používáte papír
o šířce 199,0 mm a méně nebo 298,0 mm a více, kvalita tisku se může zhoršit. Doporučujeme používat papír
o šířce 200,0 až 297,0 mm.
: K dispozici
: Není k dispozici
Typ papíru *1*2
Hmotnost papíru
Rychlost tisku POP *3
<Režim 1> <Režim 2>
Běžný
75 g/m² až 90 g/m²
*4
Silný 1
91 g/m² až 120 g/m²
*4
Silný 2
121 g/m² až 128 g/m²
*4
129 g/m² až 163 g/m²
*5
Potažený 1
100 g/m² až 130 g/m²
*6
Potažený 2
131 g/m² až 160 g/m²
*6
*1Jestliže nakonfigurujete možnost [Optimalizace tisku reklamních poutačů], musíte zadat typ papíru, který chcete
použít.
*2Pokud je detekován nepodporovaný typ papíru, zobrazí se chybová zpráva. Nahraďte jej podporovaným typem papíru
a poté proveďte tisk.
*3Podrobné
informace o změně nastavení a souvisejících tématech najdete v části
Rychlost tisku POP(P. 399) .
*4V závislosti na podmínkách prostředí se kvalita tisku může zhoršit. Není-li kvalita výtisku přijatelná, doporučujeme
nastavit <Režim 2>.
*5Kvalita
*6I
tisku se může zhoršit bez ohledu na podmínky prostředí.
když je nastavena možnost <Režim 1>, tisk se provede stejně jako při nastavení <Režim 2>.
◼ Typ papíru a nastavení zařízení
Vkládání papíru(P. 40)
◼ Oblast tisku
Vystínovaná plocha na následujícím obrázku ukazuje oblast dokumentu, kterou lze vytisknout.
557
Dodatek
● U obálek NAGAGATA 3 a YOUGATANAGA 3 je horní a dolní okraj 10 mm a levý
a pravý okraj 5 mm. U všech ostatních obálek je horní, dolní, levý a pravý
okraj 10 mm.
● U papíru o šířce 312 mm nebo více je levý a pravý okraj 5 mm nebo více.
558
Dodatek
Paper Feeder PF-G
6867-06X
Velikosti papíru
● Max: 297,0 mm x 431,8 mm
● Min: 148,0 mm x 148,0 mm
Hmotnost papíru
60 g/m² až 256 g/m²
Kapacita zásuvek na papír * 640 listů (64 g/m²)/550 listů (80 g/m²) x 1
Rozměry
556 mm x 585 mm x 125 mm
(Š x H x V)
Hmotnost
*Může
Přibližně 10,0 kg
se lišit v závislosti na prostředí instalace a typu použitého papíru.
559
Dodatek
Cassette Feeding Unit-AU
6867-06Y
Velikosti papíru
● Max: 297,0 mm x 431,8 mm
● Min: 148,0 mm x 148,0 mm
Hmotnost papíru
60 g/m² až 256 g/m²
Kapacita zásuvek na papír * 640 listů (64 g/m²)/550 listů (80 g/m²) x 2
Rozměry
641 mm x 717 mm x 325 mm
(Š x H x V)
Hmotnost
*Může
Přibližně 23,0 kg
se lišit v závislosti na prostředí instalace a typu použitého papíru.
560
Dodatek
Funkce tiskárny
6867-070
◼ Funkce tiskárny UFR II
Typ
Velikost tisku
Rychlost tisku
Interní
Použitelný papír(P. 553)
Stejné jako „Rychlost tisku“ na „Hlavní jednotce“
Hlavní jednotka(P. 551)
Rozlišení
Zpracování dat
600 dpi x 600 dpi
Popisný jazyk stránky (PDL) UFR II
Podporovaný protokol
TCP/IP a SMB (s instalovanou SD kartou)
Rezidentní písma
Není
Rozhraní
USB
USB 2.0 Hi-Speed
Kabelová síť LAN
10Base-T, 100Base-TX, 1000Base-T (splňuje požadavky IEEE 802.3)
◼ Funkce tiskárny PS
Typ
Velikost tisku
Rychlost tisku
Interní
Použitelný papír(P. 553)
Stejné jako „Rychlost tisku“ na „Hlavní jednotce“
Hlavní jednotka(P. 551)
Rozlišení
Zpracování dat
600 dpi x 600 dpi
Popisný jazyk stránky (PDL) Adobe®PostScript®3TM
(*Originální Adobe PostScript. Podporovaná verze je 3018)
561
Dodatek
Podporovaný protokol
TCP/IP a SMB (s instalovanou SD kartou)
Rezidentní písma
136 písem Roman
Rozhraní
USB
USB 2.0 Hi-Speed
Kabelová síť LAN
10Base-T, 100Base-TX, 1000Base-T (splňuje požadavky IEEE 802.3)
◼ Funkce PCL tiskárny
Typ
Interní
Velikost tisku
Použitelný papír(P. 553)
Rychlost tisku
Stejné jako „Rychlost tisku“ na „Hlavní jednotce“
Hlavní jednotka(P. 551)
Rozlišení
Zpracování dat
600 dpi x 600 dpi
Popisný jazyk stránky (PDL) PCL6, PCL5
Podporovaný protokol
TCP/IP a SMB (s instalovanou SD kartou)
Rezidentní písma
93 římských, 10 bitmapových písem, 2 OCR písma, Andalé Mono WT J/K/S/T*1 (japonština,
korejština, zjednodušená čínština a tradiční čínština), písma pro čárový kód*2
Rozhraní
USB
USB 2.0 Hi-Speed
Kabelová síť LAN
10Base-T, 100Base-TX, 1000Base-T (splňuje požadavky IEEE 802.3)
*1Vyžaduje
volitelnou sadu Sada mezinárodních fontů PCL
*2Vyžaduje
volitelnou sadu Sada pro tisk čárových kódů
◼ Funkce přímého tisku USB
Tisknutelné formáty souborů ● PDF (verze 1.7)
● JPEG
● TIFF
● XPS
562
Dodatek
◼ Funkce tisku uložených úloh
● Do zařízení lze uložit až 1 000 dokumentů (celkem 3 GB).
◼ Funkce přímého tisku
Tisknutelné formáty souborů *1 ● PDF (verze 1.7)*2
● PS
● EPS
● JPEG
● TIFF
● XPS
*1Tisk
nemusí být proveden správně v závislosti na datech.
*2Zařízení
podporuje šifrovací algoritmus PDF RC4 128 bitů/AES 128 bitů/AES 256 bitů.
Maximální velikost tisknutelného souboru je uvedena níže.
● Soubory PDF/XPS (s instalovanou SD kartou) : 2 GB
(bez instalované SD karty) : 20 MB
● Soubory JPEG
(s instalovanou SD kartou) : 2 GB
(bez instalované SD karty) : 2 GB
● Soubory TIFF*1
(s instalovanou SD kartou) : 2 GB
(bez instalované SD karty) : 2 GB
*1V
závislosti na struktuře souborů nemusí být možné vytisknout ani soubory TIFF nepřesahující horní limit velikosti.
V takovém případě nastavte <TIFF Spooler> na <Zap> a zkuste tisknout znovu. TIFF Spooler(P. 419)
◼ Funkce tisku e-mailů
Osnova tisku e-mailu
Obecné
● E-mailová zpráva je vytištěna s informacemi v hlavičce e-mailu.
● E-mailová zpráva HTML je vytištěna jako prostý text.
● Pokud řádek (bez řádkového podávání) v e-mailové zprávě obsahuje více než 1 000 znaků, nadbytečné
znaky se umístí na nový řádek a může se stát, že nebudou správně vytištěny.
Pokud je možnost <TIFF Spooler> nastavena na <Zap>
● Pokud velikost e-mailové zprávy přesáhne 25 MB nebo velikost e-mailu přesáhne 1,5 GB, pak se e-mailová
zpráva nevytiskne.
● Pokud data v záhlaví e-mailu přesáhnou 20 KB, pak se nadbytečná data nevytisknou.
● Pokud není nainstalována žádná karta SD, nemusí být vytištěny soubory TIFF větší než 40 MB.
● Pokud na SD kartě není dostatek volného místa, není možný tisk e-mailů v režimu E-Mail Print.
563
Dodatek
● Pokud je tonerová kazeta téměř prázdná, nelze přijímat žádné e-maily.
Podporované formáty kódování
● 7 bitů
● 8 bitů
● binární
● uuencode
● x-uuencode
● base64
● určený-tisknutelný
Sady podporovaných znaků *
● us-ascii
● iso-8859-1
● iso-8859-15
Formáty přiložených obrazových souborů pro tisk ● JPEG
● TIFF
*Pokud
není zadána žádná znaková sada, použije se „us-ascii“.
Připojené obrazové soubory
● Některé soubory nejsou k dispozici, v závislosti na struktuře souborů.
● Pro každý e-mail můžete vytisknout až tři připojené soubory. (Nadměrné připojené soubory se nevytisknou.)
● Pokud je nainstalována karta SD, je velikost tisknutelného souboru na jeden soubor 100 MB nebo méně.
564
Dodatek
Funkce správy
6867-071
◼ Nastavení brány firewall
● Lze zadat až 16 IP adres (nebo rozsahy IP adres) jak pro IPv4, tak pro IPv6.
● Lze zadat až 16 adres MAC.
◼ Registrace klíčů a certifikátů
● Při instalaci klíče nebo certifikátu CA z počítače musí být splněny následující požadavky:
Formát
● Certifikát CA: X.509 DER/PEM
Přípona souboru
Algoritmus veřejného klíče
(a délka klíče)
● Klíč: „.p12“ nebo „.pfx“
● Certifikát CA: „.cer“ nebo „.pem“
● RSA (512 bitů, 1024 bitů, 2048 bitů, 4096 bitů)
● DSA (1024 bitů, 2048 bitů, 3072 bitů)
● ECDSA (P256, P384, P521)
● RSA: SHA-1, SHA-256, SHA-384*, SHA-512*, MD2, MD5
Algoritmus podpisu certifikátu
● DSA: SHA-1
● ECDSA: SHA-1, SHA-256, SHA-384, SHA-512
*SHA384-RSA
a SHA512-RSA jsou dostupné, pouze pokud je délka klíče RSA 1024 bitů a více.
● Zařízení nepodporuje použití seznamu odvolaných certifikátů (CRL).
◼ Maximální počet protokolů úloh, které lze zobrazit
[Tisková úloha/Přímý tisk]
Zobrazí se až 200 dokumentů vytištěných z počítačů a paměťových zařízení USB.
[Uložená úloha]
Zobrazí se historie až 200 vytištěných dokumentů uložených v zařízení (pouze pokud je
nainstalována karta SD).
[Hlášení]
Zobrazí se historie až 16 dokumentů vytištěných jako seznamy nastavení a sestavy (až
128 dokumentů, pokud je nainstalována karta SD).
[Tisk e-mailu]
Zobrazí se historie až 16 e-mailů vytištěných po přijetí (až 128 dokumentů, pokud je
nainstalována karta SD).
◼ Chybové kódy při přijetí e-mailu
Podrobnosti o chybových kódech.
565
Dodatek
Chybový kód
Příčina
Akce
Poštovní server POP3 byl odpojen.
407
Data s kapacitou 1 KB (1024 bajtů)
nebylo možné získat během 10
minut při přijímání e-mailů.
● Obraťte se na svého správce sítě.
● Pokud k chybám dochází často u stejných emailových dat, zkontrolujte, zda jsou e-mailová data
v normálním stavu.
408
Odpověď „ERR“ byla vrácena z
poštovního serveru POP3.
412
Data s kapacitou 1 KB (1024 bajtů)
nebylo možné získat během 10
minut při přijímání e-mailů.
420
Velikost dat elektronické pošty
přesahuje 1,5 GB.
Pokud je v zařízení nainstalována karta SD, musí být
velikost dat e-mailu k odeslání 1,5 GB nebo méně.
421
Velikost e-mailové zprávy
přesahuje 25 MB.
Pokud je v zařízení nainstalována karta SD, musí být
velikost zprávy e-mailu k odeslání 25 MB nebo méně.
422
Velikost připojeného souboru
přesahuje 100 MB.
Pokud je na zařízení nainstalována karta SD, musí být
velikost každého připojeného souboru 100 MB nebo
méně.
423
Přijatý připojený soubor je v
nepodporovaném formátu.
Přiložené soubory musí být ve formátu JPEG nebo TIFF.
K e-mailu, který chcete odeslat, nepřipojujte žádné
soubory jiných formátů.
424
Je přiloženo více než tři soubory.
Nadměrné připojené soubory se nevytisknou.
430
Odesílatel přijatého e-mailu není
znám.
Před odesláním e-mailů nezapomeňte nastavit
odesílatele.
Obraťte se na svého správce sítě.
● Obraťte se na svého správce sítě.
● Pokud k chybám dochází často u stejných emailových dat, zkontrolujte, zda jsou e-mailová data
v normálním stavu.
Chcete-li zabránit odesílání e-mailů v rozdělené podobě,
proveďte následující akci.
● Zmenšete velikost e-mailu určeného k odeslání.
Byl přijat rozdělený e-mail.
(Zmenšete velikost e-mailu tak, aby byla menší než
velikost způsobující rozdělení e-mailu.)
● Před odesláním nakonfigurujte aplikaci tak, aby se
zabránilo rozdělování e-mailů.
431
Přijatý e-mail obsahuje
nepodporované kódování nebo
znakové kódy.
Chcete-li odesílat e-maily, použijte kódování a kódy
znaků podporované zařízením. Osnova tisku emailu(P. 563)
Přijatý e-mail je v
nepodporovaném formátu.
Zkontrolujte formát e-mailu. Doporučujeme odesílat emaily v textovém formátu.
432
Přijatá data jsou neplatná.
Zkontrolujte, zda jsou data odeslaného e-mailu
normální.
433
Přijatý e-mail je ve formátu HTML.
Toto zařízení nepodporuje e-maily ve formátu HTML. (Emailová zpráva HTML je vytištěna jako prostý text.)
434
V e-mailu není žádná zpráva.
Přijatý e-mail neobsahuje žádnou zprávu.
435
Předaný faxový dokument je
nezákonný.
Připojený soubor není ve formátu TIFF nebo překračuje
velikost pro tisk.
436
Předaný faxový dokument nemá
žádný připojený soubor.
Kvůli nepřipojenému souboru se žádný dokument
nevytiskne.
566
Dodatek
440
Tisk byl z nějakého důvodu zrušen. Znovu odešlete e-mail.
441
Během zpracování došlo k chybě.
Znovu odešlete e-mail.
V zařízení došlo k chybě.
Proveďte příslušnou akci podle zprávy na displeji
zařízení. Další informace naleznete v části
„Odstraňování problémů (FAQ)“ na webu s online
příručkami.
499
● Pokud se vyskytnou dvě nebo více chyb, zobrazí se pouze chybový kód nižšího čísla.
● Chybové kódy můžete také zkontrolovat pomocí seznamu historie e-mailů RX (E-Mail RX History List).
Seznam protokolu o příjmu e-mailů(P. 525)
567
Dodatek
Systémové prostředí
6867-072
Systémové požadavky pro Vzdálené UR *1
Windows
● Windows Vista / 7 / 8 / 10: Internet Explorer 7.0 nebo novější
Systémové požadavky dokumentu Uživatelská příručka Windows
● Internet Explorer 9 nebo novější
● Microsoft Edge
● Firefox
● Firefox ESR
● Chrome*2
macOS
● Safari
● Firefox
● Chrome*2
Linux
● Firefox
iOS
● Safari*2
Android
● Chrome*2
*1Před
provedením změn nastavení zařízení nastavte svůj webový prohlížeč, aby povoloval všechny soubory cookie a
používal JavaScript.
*2Pouze
při procházení příručky na internetu.
568
Dodatek
Síťové prostředí
6867-073
◼ Specifikace sítě
Rozhraní
10BASE-T, 100BASE-TX, 1000BASE-T (RJ-45)
Podporovaný protokol
Komunikační protokol
● TCP/IP (typ rámce: Ethernet II)
Tiskové aplikace
● LPD
● Raw
● IPP
● IPPS
● WSD
● Mopria
● Google Cloud Print
● AirPrint
● Windows 10 Mobile Print
569
Dodatek
Spotřební materiál
6867-074
Tato kapitola popisuje spotřební materiály zařízení a odhadované načasování pro jejich
výměnu. Spotřební materiál nakupujte u místního autorizovaného prodejce Canon.
Seznamte se s bezpečnostními i zdravotními opatřeními, které je třeba dodržovat při
manipulaci se spotřebním materiálem a při jeho skladování ( Spotřební
materiál(P. 10) ). Pro dosažení optimální kvality tisku se doporučuje použití
originálního toneru, kazet a dílů Canon.
● V závislosti na prostředí instalace a velikosti či typu používaného papíru může být nutné vyměnit spotřební
materiál ještě před koncem odhadované doby životnosti.
◼ Tonerové kazety
Dodané tonerové kazety
Průměrná výtěžnost a hmotnost tonerových kazet dodaných se zařízením je uvedena níže.
Tonerová kazeta Canon 059
● Černá
- Průměrná výtěžnost* tonerové kazety
7 000 listů
- Hmotnost
Přibližně 1,1 kg
● Y (žlutá), M (purpurová) a C (azurová)
- Průměrná výtěžnost* tonerové kazety
5 000 listů
- Hmotnost
Přibližně 1,0 kg
Tonerová kazeta Canon 059 H
● Černá
- Průměrná výtěžnost* tonerové kazety
15 500 listů
- Hmotnost
Přibližně 1,2 kg
● Y (žlutá), M (purpurová) a C (azurová)
- Průměrná výtěžnost* tonerové kazety
13 500 listů
570
Dodatek
- Hmotnost
Přibližně 1,1 kg
*Průměrná
výtěžnost je založena na standardu „ISO/IEC 19798“ (celosvětový standard vydaný Mezinárodní organizací pro
standardizaci (ISO) [International Organization for Standardization] pro způsob měření výtěžnosti tonerové kazety
v monochromatických elektrografických tiskárnách a víceúčelových zařízeních, která fungují i jako tiskárny) při tisku na
papír velikosti A4 při výchozím nastavení sytosti tisku.
*Typ
dodávaných tonerů se liší podle zemí a oblastí. Podrobnosti vám poskytne prodejce, u kterého jste uskutečnili nákup.
Výměna tonerových kazet
Pro dosažení optimální kvality tisku se doporučuje použití originálních tonerových kazet Canon.
Originální tonerová kazeta Canon
Průměrná výtěžnost * a hmotnost
Průměrná výtěžnost tonerové kazety
7 000 listů
Černá tonerová kazeta Canon 059
Hmotnost
Přibližně 1,1 kg
Průměrná výtěžnost tonerové kazety
Žlutá tonerová kazeta Canon 059
Purpurová tonerová kazeta Canon 059
Azurová tonerová kazeta Canon 059
5 000 listů
Hmotnost
Přibližně 1,0 kg
Průměrná výtěžnost tonerové kazety
15 500 listů
Černá tonerová kazeta Canon 059 H
Hmotnost
Přibližně 1,2 kg
Průměrná výtěžnost tonerové kazety
13 500 listů
Žlutá tonerová kazeta Canon 059 H
Purpurová tonerová kazeta Canon 059 H
Hmotnost
Azurová tonerová kazeta Canon 059 H
Přibližně 1,1 kg
● Pokud vyměňujete tonerové kazety
Postup výměny tonerových kazet(P. 500)
◼ Kazeta válce
571
Dodatek
Dodaná bubnová kazeta
Průměrná výtěžnost a hmotnost bubnových kazet dodaných se zařízením je uvedena níže.
● Průměrná výtěžnost bubnové kazety*
70 000 listů
● Hmotnost
Přibližně 0,6 kg
*Průměrná
výtěžnost je na základě našich hodnoticích kritérií při tisku v intervalu 3 listů (přerušovaný tisk 3 listů) běžného
papíru velikosti A4.
Náhradní kazety válce
K dosažení optimální kvality tisku se doporučuje používat originální kazety válce značky Canon.
Originální bubnová kazeta Canon
Průměrná výtěžnost * a hmotnost
Průměrná výtěžnost bubnové kazety
70 000 listů
Kazeta válce Canon 053
Hmotnost
Přibližně 0,6 kg
● Při výměně bubnových kazet
Postup výměny bubnových kazet(P. 507)
◼ Zásobník odpadního toneru WT-C1
Průměrný počet stránek, které lze vytisknout na jeden zásobník odpadního toneru, je přibližně 100 000
(v případě běžného papíru velikosti A4).
● Při výměně odpadní nádobky na toner
Jak vyměnit odpadní nádobku na toner(P. 510)
572
Dodatek
Možnosti
6867-075
Instalace možností na zařízení umožňuje využívat další funkce.
◼ Znalosti o tom, jaké typy možností jsou k dispozici
Volitelná zařízení(P. 574)
◼ Vyhledání volitelného zařízení podle účelu
Přidání zásuvky na papír
Paper Feeder PF-G(P. 559)
Cassette Feeding Unit-AU(P. 574)
573
Dodatek
Volitelná zařízení
6867-076
Možnosti zařízení lze využít na maximum pomocí dále popsaných volitelných zařízení. Volitelná zařízení lze zakoupit
u prodejce, u kterého jste zařízení zakoupili, nebo od místního prodejce produktů Canon.
Paper Feeder PF-G
Použití volitelného podavače papíru vám umožní vložit jinou velikost papíru, než
jakou lze vložit do standardní zásuvky na papír, čímž se sníží časová náročnost
a pracnost výměny velikosti papíru.
● Do zařízení lze nainstalovat až tři jednotky podavače papíru. Pokud však používáte volitelnou kazetovou
podávací jednotku, lze nainstalovat nejvýše dvě jednotky podavače papíru.
Metoda instalace
Viz část „Začínáme“.
Cassette Feeding Unit-AU
Použití volitelné kazetové podávací jednotky vám umožní vložit dvě jiné velikosti
papíru, než jaké lze vložit do standardní zásuvky na papír, čímž se sníží časová
náročnost a pracnost výměny velikosti papíru.
Metoda instalace
Viz část „Začínáme“.
574
Dodatek
Systémové volitelné doplňky
6867-077
Možnosti zařízení lze využít na maximum pomocí dále popsaných volitelných zařízení. Volitelná zařízení lze zakoupit
u prodejce, u kterého jste zařízení zakoupili, nebo od místního prodejce produktů Canon.
Sada pro tisk čárových kódů(P. 575)
Sada mezinárodních fontů PCL(P. 575)
SD KARTA(P. 576)
Sada pro tisk čárových kódů
Pokud je v zařízení nainstalována sada Sada pro tisk čárových kódů, musí být přidán režim tisku
čárových kódů, který umožňuje tisk čárových kódů z počítače.
Sada pro tisk čárových kódů obsahuje následující písma čárových kódů.
● OCR-B
● Symb. FontInform
● Symbole stethos
● BarDIMM ©1997
● USPS ZEBRA+4Stat
Tento doplněk umožňuje generovat čárové kódy v různých formátech. Pokud chcete tisknout
čárové kódy, je třeba povolit tisk PCL. Informace o použití sady Sada pro tisk čárových kódů
naleznete v příručce Barcode Printing Guide (Příručka k tisku čárových kódů) (příručka ve formátu
PDF).
Metoda instalace
Instalace ROM(P. 577)
Sada mezinárodních fontů PCL
Pokud je na stroji nainstalováno Sada mezinárodních fontů PCL, přidají se pro tiskárnu PCL
následující písma. Výsledkem jsou výstupy ve více jazycích v prostředí SAP Unicode.
● Andale® a WorldType® Collection J (japonská verze)
● Andale® a WorldType® Collection K (korejská verze)
● Andale® a WorldType® Collection S (verze ve zjednodušené čínštině)
● Andale® a WorldType® Collection T (verze v tradiční čínštině)
Aby mohly být podporovány rozdíly v designu znaků v závislosti na oblasti, jsou povoleny čtyři
verze písma.
Metoda instalace
Instalace ROM(P. 577)
575
Dodatek
SD KARTA
Kartu SD můžete nainstalovat a používat níže popsané funkce.
● Zabezpečený tisk
Tisk dokumentu zabezpečeného kódem PIN (zabezpečený tisk)(P. 92)
● Tisk uložené úlohy
Tisk dokumentu uloženého v tiskárně (tisk uložené úlohy)(P. 96)
● Přerušení tisku, Prioritní tisk, Pozastavit/Obnovit
Kontrola aktuálního stavu tištěných dokumentů(P. 299)
● Tisk SMB
Konfigurace protokolu SMB(P. 203)
● Služba zařazování
Spooler(P. 351)
Metoda instalace
Instalace SD karty(P. 581)
● Při likvidaci použité SD karty je nutné <Zcela odstranit data> nebo je fyzicky zničit tak, abyste zabránili úniku
vašich osobních údajů. Instalace SD karty(P. 581)
576
Dodatek
Instalace ROM
6867-078
Tato část popisuje, jak do zařízení nainstalovat volitelnou
paměť ROM. Paměť ROM se používá připojená ke
konektorům ROM v pravém krytu zařízení. Před instalací
paměti ROM si přečtěte upozornění uvedená v
Instalace(P. 3) .
Upozornění týkající se instalace paměti ROM
● Nedovolte, aby jakýkoli kov, například šrouby, přišly do kontaktu s deskami tištěných spojů v zařízení.
Zařízení by se tak mohlo poškodit.
● Nedotýkejte se vnitřních součástí, tištěných spojů, konektorů ani přepínačů. Mohlo by dojít k poškození
zařízení.
● Nezapínejte zařízení, když je otevřený kryt paměti ROM. Mohlo by dojít k poškození zařízení.
Upozornění týkající se statické elektřiny
Paměť ROM obsahuje součásti, které jsou citlivé na statickou elektřinu. Dodržujte následující upozornění, aby
nedošlo k poškození paměti ROM statickou elektřinou.
● Ještě před manipulací s pamětí ROM se dotkněte nějaké kovové věci v místnosti, abyste ze svého těla vybili
náboj statické elektřiny.
● Při práci se nedotýkejte žádné věci, která může pravděpodobně generovat statickou elektřinu, jako je displej.
● Aby nedošlo k problémům kvůli statické elektřině, neodstraňujte ROM z balicího materiálu dříve než těsně
před připojením k ROM konektorům.
1
Vypněte zařízení a vytáhněte zástrčku ze zásuvky střídavého proudu.
● Při vypínání zařízení využijte ovládací panel bez použití hlavního vypínače.
vypínání)(P. 36)
2
1
Sejměte zadní kryt.
Zatlačte na západku a mírně kryt otevřete směrem k sobě.
577
Vypnutí tiskárny (postup
Dodatek
2
3
Sejměte pravý kryt ve směru šipky.
Odeberte kryt ROM.
1
Pomocí mince vyšroubujte šrouby.
2
Otevřete kryt ROM a sejměte jej ve směru šipky.
4
Vložte paměť ROM.
● Po zarovnání paměti ROM se dvěma konektory ROM v zařízení paměť zatlačte dolů, dokud se nezastaví.
578
Dodatek
Odpojení paměti ROM
● Uchopte okraje paměti ROM a vytáhněte ji ven podle obrázku níže.
5
Dejte kryt ROM zpět na místo.
1
Zavřete kryt ROM tak, že zasunete západku krytu ROM ve směru šipky.
2
Pomocí mince zašroubujte šrouby.
6
Vložte zadní kryt ve směru šipky a zavřete jej a při tom tlačte na západku.
579
Dodatek
● Pokud zároveň chcete instalovat SD kartu, proveďte krok
Instalace SD karty(P. 581) .
◼ Kontrola správné instalace Sada pro tisk čárových kódů
Vytiskněte Konfigurační stránka(P. 465) a potvrďte, že se v „PCL“ zobrazila
možnost „BarDIMM“.
Pokud se možnost „BarDIMM“ zobrazila, paměť ROM se nainstalovaná
správně.
Pokud se možnost „BarDIMM“ nezobrazila
● Paměť ROM není vložena správně. Vyjměte paměť ROM ze zařízení a znovu
ji zapojte.
580
Dodatek
Instalace SD karty
6867-079
Tato část popisuje způsob připojení a inicializace karty SD. Vložte
kartu SD do otvoru pro kartu SD na levé straně zařízení. Před
vložením karty SD si přečtěte upozornění v části
Instalace(P. 3) . Upozorňujeme, že data v zařízení, která jsou
uložena na kartě SD, podléhají šifrování. Tím je zajištěno
bezpečné používání karty SD v počítači nebo v jiné situaci,
protože šifrovaná data na kartě SD jsou chráněna před
neoprávněným získáním.
● Před připojením karty SD zkontrolujte, zda je karta SD chráněna proti zápisu. Pokud ano, odemkněte kartu a
teprve potom ji vložte.
1
Vypněte zařízení a vytáhněte zástrčku ze zásuvky střídavého proudu.
● Při vypínání zařízení využijte ovládací panel bez použití hlavního vypínače.
vypínání)(P. 36)
2
Sejměte kryt otvoru na kartu SD.
1
Pomocí mince vyšroubujte šrouby.
2
Otevřete kryt otvoru na kartu SD a sejměte jej ve směru šipky.
581
Vypnutí tiskárny (postup
Dodatek
3
Vložte kartu SD.
● Vložte kartu do otvoru na kartu SD, dokud nezaklapne na místo.
Vyjímání karty SD
● Zatlačte na SD kartu, dokud necvakne, jak je znázorněno na obrázku, povolte prst a kartu vyjměte.
4
1
Dejte kryt otvoru na kartu SD zpět na místo.
Zavřete kryt otvoru na kartu SD tak, že zasunete západku krytu.
582
Dodatek
2
Pomocí mince zašroubujte šrouby.
Bezpečnostní otvor na kartu SD chráněný proti
odcizení
● Kryt otvoru na kartu SD má bezpečnostní otvor, do něhož lze
připojit bezpečnostní vodič nebo něco podobného.
● Bezpečnostní otvor má šířku 3,4 mm a výšku 7,4 mm.
● Pokud máte dotazy k bezpečnostnímu otvoru, obraťte se na
místního autorizovaného prodejce společnosti Canon.
◼ Inicializace SD karty
Když po vložení karty SD poprvé zařízení zapnete, na displeji se zobrazí <Format SD
Card?>. Stisknutím
zahajte inicializaci karty SD. Po provedení inicializace je karta
SD připravena k použití.
Pokud se nezobrazí zpráva <Format SD Card?>
● Inicializujte kartu SD výběrem <Formát> v části <Údržba karty SD> v nabídce nastavení na ovládacím panelu.
Údržba karty SD(P. 387)
583
Dodatek
◼ Kontrola správné instalace SD karty v zařízení
Vytiskněte Konfigurační strana(P. 523) a karta SD je vložena správně,
pokud je možnost „Karta SD“ v části „Nabídka kontroly“ nastavena na
„Zapnuto“.
Pokud nejsou uvedeny žádné informace o stavu karty SD
● Karta SD není vložena správně. Vyjměte kartu SD ze zařízení a znovu ji
vložte.
◼ Konfigurace informací na kartě SD
Pokud byla po instalaci ovladače tiskárny přidána SD karta, je nutné nakonfigurovat informace o SD kartě v ovladači
tiskárny. Použití volitelných položek(P. 74)
◼ Smazání všech dat z SD karty
Před likvidací karty SD můžete použít postup níže k odstranění všech dat na kartě. Postup odstraní i ty fragmenty dat,
které jinak odstranit nelze. Tím se eliminuje riziko, že by si vaše data přečetly třetí strany, abyste kartu SD mohli
zlikvidovat bezpečně.
● Postup uvedený níže nelze použít pro jiné karty SD, než jsou volitelné karty „SD KARTA“.
1
Nastavte zařízení na offline.
● Pokud svítí
(
), stiskněte
2
Stiskněte tlačítko
3
Pomocí tlačítek
4
Pokračujte s <Údržba karty SD>
(
/
(
).
)
vyberte možnost <Uživatelská údržba> a stiskněte tlačítko
.
● Když se zobrazí zpráva, stiskněte
<Zcela odstranit data> v tomto pořadí.
.
584
Dodatek
5
Vyberte možnost <Ano> a stiskněte tlačítko
.
➠ Zařízení se restartuje. Potom se zařízení automaticky vypne.
● Po provedení <Zcela odstranit data> se nastavení pro <Karta SD> změní na <Vyp>.
585
Dodatek
Příručky a jejich obsah
6867-07A
Se zařízením se dodávají následující příručky. Podle potřeby do nich nahlédněte.
Začínáme
Jako první si přečtěte tuto příručku. Popisuje postup instalace zařízení.
Uživatelská příručka
(Tato příručka)
Tato příručka popisuje všechny funkce zařízení a lze ji zobrazit pomocí webového
prohlížeče. Informace lze procházet podle kategorií nebo zadat klíčové slovo
a vyhledat stránky ke konkrétnímu tématu. Použití dokumentu Uživatelská
příručka(P. 587)
586
Dodatek
Použití dokumentu Uživatelská příručka
6867-07C
Uživatelská příručka je dokument, který lze zobrazit v počítači nebo mobilním zařízení, popisující veškeré funkce
zařízení. Můžete vyhledávat ze zamýšleného použití nebo zadat klíčové slovo, a tak rychle najít hledanou stránku. Tato
část popisuje rozložení obrazovky dokumentu Uživatelská příručka a jak tuto příručku číst. Můžete nastavit, jak bude
vypadat vzhled dokumentu Uživatelská příručka.
◼ Rozložení obrazovky dokumentu Uživatelská příručka
V této části jsou popsána konfigurace obrazovek dokumentu Uživatelská příručka a způsob používání tlačítek na
obrazovce. Rozložení obrazovky dokumentu Uživatelská příručka(P. 588)
◼ Zobrazení dokumentu Uživatelská příručka
Tato část popisuje význam značek použitých v dokumentu Uživatelská příručka, jak jsou znázorněny klávesy na
ovládacím panelu a tlačítka na displeji počítače a další fakta, která slouží k pochopení informací obsažených v
dokumentu Uživatelská příručka. Zobrazení dokumentu Uživatelská příručka(P. 591)
◼ Nastavení, jak bude vypadat vzhled dokumentu Uživatelská příručka.
Můžete změnit velikost znaků použitých v dokumentu Uživatelská příručka a přepnout rozvržení obrazovky, čímž
přizpůsobíte zobrazení dokumentu Uživatelská příručka zařízení, které používáte.
● Pokud nemáte přístup k aplikaci Adobe Reader, abyste si prohlédli příručky ve formátu PDF, zkuste další
programy, například PDF Preview vyvíjený společností Vivid Document Imaging Technologies.
Vyhledání požadovaného tématu
Vyhledávání v obsahu
● Hledanou stránku můžete najít výběrem tématu na kartě „Obsah“ v levé části obrazovky.
Hledání podle klíčového slova
● Vyhledávejte zadáním klíčového slova, například „obálka“ nebo „tonerová kazeta“. Zobrazí se stránky
obsahující dané klíčové slovo. Z výsledků pak můžete vybrat hledanou stránku. Můžete také zadávat slovní
spojení, například „připojení k síti“. Vyhledávání pomocí klíčového slova podporuje také použití logického
operátoru AND k vyhledávání více klíčových slov. Uspořádání obrazovky vyhledávání a způsob jejího
používání naleznete pod heslem Hledat(P. 589) .
587
Dodatek
Rozložení obrazovky dokumentu Uživatelská příručka
6867-07E
Dokument Uživatelská příručka je rozdělený na několik obrazovek, jejichž obsah se liší.
Domovská stránka
Zobrazí se při otevření dokumentu Uživatelská příručka.
/
Kliknutím na tlačítko
též zobrazíte veškeré sekce v kapitolách. Kliknutím na tlačítko
předchozímu zobrazení na displeji.
se vrátíte k
/
Kliknutím přepnete zobrazení mezi obsahem a vyhledáváním. Pokud je zobrazen obsah, přepíná se
každým kliknutím na tlačítko
mezi skrytím a zobrazením obrazovky. Jestliže je zobrazena obrazovka
vyhledávání, přepíná se každým kliknutím na tlačítko
mezi skrytím a zobrazením obrazovky.
Kliknutím nastavíte parametry, které určují zobrazení například velikosti znaků nebo rozvržení dokumentu
Uživatelská příručka.
Kliknutím zobrazíte informace o zobrazení dokumentu Uživatelská příručka, jak v něm vyhledávat a další
informace.
/
Kliknutím zobrazíte předchozí nebo následující téma.
[Upozornění]
Kliknutím zobrazíte důležité informace, které byste při používání zařízení měli vědět.
588
Dodatek
Stránka s tématy
Obsahuje informace o způsobu konfigurace a použití zařízení.
Navigace
Podívejte se, které téma kapitoly je právě zobrazené.
Kliknutím se vrátíte na příslušnou stránku. Kliknutím na tlačítko „Zpět“ ve webovém prohlížeči se vrátíte na
předchozí stránku.
/
Kliknutím na tlačítko
popisy.
zobrazíte skryté podrobné popisy. Kliknutím na tlačítko
zavřete podrobné
Kliknutím se vrátíte nahoru na začátek stránky.
Hledat
Kliknutím na tlačítko
zobrazíte obrazovku vyhledávání. Obsahuje textové pole, pomocí něhož lze hledat
podle klíčového slova a vyhledat požadovanou stránku.
589
Dodatek
[Zde zadejte klíčová slova]
zobrazte výsledky hledání. Když klíčová slova
Zadejte klíčové slovo nebo slova a kliknutím na tlačítko
oddělíte mezerou (prázdným znakem), můžete vyhledat stránky obsahujících všechna klíčová slova.
Stránky, obsahující přesnou frázi, můžete vyhledat pouze pokud uzavřete klíčová slova do dvojitých
uvozovek.
Výsledek hledání
Zobrazí výsledky vyhledávání stránek obsahujících zadaná klíčová slova. Ve výsledcích vyhledejte
požadovanou stránku a klikněte na název tématu dané stránky.
● Zadaná klíčová slova se ve výsledcích hledání objeví tučně.
590
Dodatek
Zobrazení dokumentu Uživatelská příručka
6867-07F
V této části jsou popsány značky, tlačítka, obrazovky a další položky použité v dokumentu Uživatelská příručka.
Varování a upozornění jsou též uvedeny v části „Důležité bezpečnostní pokyny“ v dokumentu „Začínáme“ dodávaném
se zařízením. Viz též tyto pokyny.
Značky
Upozornění týkající se bezpečnosti, omezení a manipulace se zařízením, užitečné tipy a další informace jsou
označeny následujícími značkami.
Uvádí varování týkající se operací, které by mohly vést k úmrtí nebo
poranění osob, pokud by nebyly správně provedeny. Z důvodu
zajištění bezpečného provozu přístroje těmto varováním vždy věnujte
pozornost.
Uvádí upozornění týkající se operací, které by mohly vést k poranění
osob, pokud by nebyly správně provedeny. Z důvodu zajištění
bezpečného provozu přístroje těmto upozorněním vždy věnujte
pozornost.
Označuje operaci, která nesmí být provedena. Pečlivě si tyto pokyny
přečtěte a neprovádějte popsané operace.
Označuje provozní požadavky a omezení. Tyto položky si pečlivě
přečtěte, abyste mohli přístroj správně obsluhovat a aby nedošlo k
poškození přístroje nebo majetku.
Označuje potvrzení operace nebo obsahuje dodatečné vysvětlení
postupu.
Upozorňují na funkce nebo tipy, které mohou být užitečné při
používání zařízení.
Tlačítka použitá v příručce
Tlačítka na ovládacím panelu a tlačítka na obrazovce počítače jsou zobrazena následujícím způsobem:
Typ
Příklad
Tlačítka na ovládacím panelu
(
)
<Nastavení časovače>
Nastavení zobrazená na ovládacím panelu
<Uvíznul papír.>
Tlačítka a další text rozhraní zobrazený na obrazovce počítače [Předvolby]
/
Použité v této příručce
Pomocí tlačítek
/
lze vybrat požadované nastavení. Jsou popsána pouze při prvním použitelném výskytu
na stránce a od druhého výskytu dále jsou vynechána. Například tlačítka
/
se objeví v kroku 2, ale jsou
vynechána v kroku 3.
Příklad:
591
Dodatek
1
Stiskněte tlačítko
2
Pomocí tlačítek
3
Vyberte možnost <Nastavení TCP/IP>
(
/
).
vyberte možnost <Síť> a stiskněte tlačítko
<Nastavení IPv4>
.
<Nastavení adresy IP>.
Obrazovky použité v tomto průvodci
V závislosti na použitém operačním systému se dialogová okna použitá v této příručce mohou mírně odlišovat
od oken, která skutečně vidíte. Také vzhled ovladačů a softwaru tiskárny se může lišit podle jejich verze.
Ilustrace použité v příručce
Ilustrace tonerové kazety použité v této Uživatelská příručka používají kazetu Tonerová kazeta Canon 059 H.
592
Dodatek
Správa aplikací MEAP
6867-07J
Do zařízení si můžete nainstalovat aplikace MEAP (software pro vylepšení funkcí), abyste přidali různé funkce. Tyto
funkce lze přizpůsobit podle svých potřeb, například pro konfiguraci ověřovacího systému pomocí karet IC nebo
správu výtisků založených na protokolech. Pokud chcete spravovat aplikace MEAP, získejte přístup do zařízení z
počítače pomocí webového prohlížeče. Další informace najdete v části Průvodce funkcemi pro MEAP Application
Management .
593
Dodatek
Používání klientů FTP
6867-07K
Klienta FTP můžete používat k přístupu na server FTP zařízení a zadat nastavení pro tisk dokumentů a síťovou
komunikaci. Tisk a nastavení lze provádět pomocí příkazového řádku nainstalovaného v operačním systému jako
standard. To nevyžaduje žádné zvláštní ovladače ani aplikace.
Příprava na použití serveru FTP
Zadejte nastavení pro povolení komunikace mezi zařízením a klienty.
FTP(P. 595)
Příprava na použití serveru
Tisk prostřednictvím klienta FTP (tisk FTP)
Dokument zaslaná do zařízení lze vytisknout prostřednictvím FTP.
FTP)(P. 598)
Tisk prostřednictvím klienta FTP (tisk
Zadání nastavení prostřednictvím klienta FTP
Nastavení zařízení si lze stáhnout v textovém formátu a upravit je.
klienta FTP(P. 600)
594
Zadání nastavení prostřednictvím
Dodatek
Příprava na použití serveru FTP
6867-07L
Vzhledem k tomu, že výchozí nastavení z výroby neumožňují operace z klientů FTP, zadejte nastavení tak, aby tyto
operace byly možné.
1
Spusťte Vzdálené uživatelské rozhraní a přihlaste se v režimu správce.
Vzdáleného uživatelského rozhraní(P. 290)
2
Klikněte na tlačítko [Nastavení/Uložení].
3
Klikněte na položku [Síť]
4
Klikněte na tlačítko [Editovat] v části [Nastavení FTP].
[Nastavení TCP/IP].
595
Spuštění
Dodatek
5
Zadejte požadované nastavení a klikněte na tlačítko [OK].
[Použít tisk FTP]
Pro tisk prostřednictvím klienta FTP zaškrtněte políčko. Jinak nechte políčko nezaškrtnuté.
[Uživatelské jméno pro tisk FTP]
Zadejte alfanumerické znaky pro uživatelské jméno používané pro přihlášení k FTP serveru pro tisk v systému
FTP.
● Nelze nastavit „kořen“.
[Nastavit/Změnit heslo]
Vyberte pole pro zadání hesla FTP Print a zadejte alfanumerické znaky pro heslo do textového pole [Heslo].
Heslo potvrďte jeho opětovným zadáním do textového pole [Potvrdit].
● Pokud kliknete na [OK] a pole je zaškrtnuté a textová pole [Heslo] a [Potvrdit] jsou nechána prázdná,
aktuálně nastavené heslo se vymaže.
[Použít UTF-8 pro zobrazení názvu tiskové úlohy FTP]
Zaškrtněte políčko, pokud používáte kód znaku UTF-8 pro název souboru, který chcete vytisknout.
[Povolit nastavení přes FTP]
Zaškrtnutím políčka umožníte změny nastavení zařízení prostřednictvím klienta FTP. Pokud změny nastavení
nechcete povolit, nechte políčko nezaškrtnuté.
6
Proveďte tvrdý reset.
● Klikněte na [Ovládání zařízení], vyberte [Tvrdý reset] a pak klikněte na tlačítko [Provést].
596
Dodatek
➠ Nastavení se aktivují po provedení tvrdého resetu.
Použití ovládacího panelu
● Tisk FTP a nastavení FTP můžete povolit nebo zakázat také z nabídky nastavení na ovládacím panelu.
FTP(P. 340)
ODKAZY
Tisk prostřednictvím klienta FTP (tisk FTP)(P. 598)
Zadání nastavení prostřednictvím klienta FTP(P. 600)
597
Dodatek
Tisk prostřednictvím klienta FTP (tisk FTP)
6867-07R
Dokumenty ve formátu TEXT/JPEG/TIFF lze tisknout z klientů FTP přes síť. Předem zkontrolujte IP adresu nastavenou v
zařízení ( Tisk stavu sítě(P. 523) ). Pokud si IP adresou nejste jisti, obraťte se na správce sítě.
1
Start [Příkazový řádek].
● Otevřete nabídku [Start] a vyberte [Všechny programy] nebo [Programy]
[Příslušenství]
[Příkazový
řádek].
Pro uživatele macOS
● Spusťte Terminál.
Pro uživatele systému UNIX
● Zobrazte obrazovku konzole.
2
Zkopírujte dokument, který chcete vytisknout, do adresáře zobrazeného v
příkazovém řádku.
● Na příkladu na obrazovce je dokument zkopírován do složky „USER_NAME“ v [Uživatelé] na disku C:.
3
Zadejte „ftp <IP adresa zařízení>“ a stiskněte tlačítko [ENTER].
● Příklad: ftp 192.168.1.45
4
Zadejte jméno uživatele pro tisk FTP a stiskněte tlačítko [ENTER].
● Výchozí jméno uživatele je „guest“.
● Pro přihlášení nelze použít anonymní jméno (uživatel bez účtu).
5
Zadejte heslo pro tisk FTP a stiskněte tlačítko [ENTER].
● Výchozí heslo je „7654321“.
➠ Zobrazí se „230 Uživatel <jméno uživatele pro tisk FTP> se přihlásil.“
598
Dodatek
6
Zadejte „bin“ a stiskněte tlačítko [ENTER].
➠ Režim datového přenosu se změní na binární režim.
● Binární režim také musíte zadat při tisku textového dokumentu.
7
Zadejte „put <název souboru k tisku>“ a stiskněte tlačítko [ENTER].
● Příklad: put příklad.txt
➠ Dokument se vytiskne.
8
Zadejte „quit“ a stiskněte tlačítko [ENTER].
9
Zadejte „exit“ a stiskněte tlačítko [ENTER].
➠ Příkazový řádek se ukončí.
599
Dodatek
Zadání nastavení prostřednictvím klienta FTP
6867-07S
Z klienta FTP přes síť TCP/IP můžete zadat nastavení, jako jsou síťová nastavení zařízení. Předem zkontrolujte IP adresu
nastavenou v zařízení ( Tisk stavu sítě(P. 523) ). Pokud si IP adresou nejste jisti, obraťte se na správce sítě.
1
Start [Příkazový řádek].
● Otevřete nabídku [Start] a vyberte [Všechny programy] nebo [Programy]
[Příslušenství]
[Příkazový
řádek].
Pro uživatele macOS
● Spusťte Terminál.
Pro uživatele systému UNIX
● Zobrazte obrazovku konzole.
2
Zadejte „ftp <IP adresa zařízení>“ a stiskněte tlačítko [ENTER].
● Příklad: ftp 192.168.1.45
3
Zadejte „root“ pro jméno uživatele a stiskněte tlačítko [ENTER].
4
Zadejte heslo pro správce systému a stiskněte tlačítko [ENTER].
● Výchozí heslo je „7654321“.
Nastavení hesla správce systému(P. 215)
➠ Zobrazí se „230 Uživatel se přihlásil.“
5
Zadejte „cd config“ a stiskněte tlačítko [ENTER].
6
Zadejte „get CONFIG <název souboru>“ a stiskněte tlačítko [ENTER].
● Příkaz „CONFIG“ musí být napsán velkými písmeny.
● V <názvu souboru> lze použít libovolné znaky (například: get CONFIG Nastavení.txt).
➠ Soubor pro nastavení je stažen do adresáře, který se zobrazí po spuštění funkce Command Prompt. Na
příkladu na obrazovce je soubor stažen do složky „USER_NAME“ v [Uživatelé] na disku C:.
600
Dodatek
7
Stažený soubor upravte pomocí textového editoru, jako je Poznámkový blok.
Seznam položek nastavení konfiguračního souboru
Obecná nabídka (obecná nastavení)
Název položky
Hodnota nastavení
Výchozí nastavení z výroby
Nastavení
DEVICE_NAME
(Název zařízení)
Až 128 znaků
LBP852Cx
SYS_LOC
(Umístění)
Až 128 znaků
(Prázdné)
SYS_CONTACT
(Správce systému)
Až 128 znaků
(Prázdné)
ROOT_PWD
(Heslo manažera systému)
Až 16 alfanumerických znaků
7654321
USER_JOB_CONT
ON, OFF
(Povolit zpracování úloh koncového uživatele)
LINK_URL1
(Adresa URL na technickou podporu)
OFF
Až 512 alfanumerických znaků https://global.canon
Nabídka TCP/IP (nastavení TCP/IP)
Název položky
Hodnota nastavení
Výchozí nastavení z výroby
Nastavení
INT_ADDR
(IP adresa)
IP adresa
0.0.0.0
NET_MASK
(Maska podsítě)
IP adresa
0.0.0.0
DEF_GW
(Adresa brány)
IP adresa
0.0.0.0
DHCP_ENB
(Použití DHCP)
ON, OFF
OFF
RARP_ENB
(Použití RARP)
ON, OFF
OFF
BOOTP_ENB
(Použití BOOTP)
ON, OFF
OFF
DNS_PADDR
IP adresa
0.0.0.0
601
Dodatek
(Adresa primárního serveru DNS)
DNS_SADDR
(Adresa primárního serveru DNS)
IP adresa
HOST_NAME
(Název hostitele)
Až 47 alfanumerických znaků
„Canon“+
„posledních 6 čísel
adresy MAC“
DOMAIN_NAME
(Název domény)
Až 47 alfanumerických znaků
(Prázdné)
DDNS_ENB
(Dynamická aktualizace DNS)
ON, OFF
OFF
WINS_ENB
(Rozlišení WINS)
ON, OFF
OFF
WINS_SERVER
(Adresa serveru WINS)
IP adresa
0.0.0.0
ARP_PING_ENB
(Použití ARP/PING)
ON, OFF
OFF
LPD_ENB
(Použití tisku LPD)
ON, OFF
ON
LPD_BANN
ON, OFF
(Tisk stránky skládaného papíru LPD)
OFF
RAW_ENB
(Použití tisku RAW)
ON, OFF
ON
RAW_BIDIR_ENB
(Použití obousměrné komunikace)
ON, OFF
OFF
FTP_PRINT_ENB
(Použití tisku FTP)
ON, OFF
OFF
FTP_PRINT_USER
(Uživatelské jméno pro tisk FTP)
Až 24 alfanumerických znaků
guest
FTP_PRINT_PWD
(Heslo pro tisk FTP)
Až 24 alfanumerických znaků
7654321
IPP_ENB
(Použití IPP)
ON, OFF
ON
IPP_AUTH_ENB
(Použití ověřování IPP)
ON, OFF
OFF
0.0.0.0
IPP_AUTH_ACCUNT1
Až 24 alfanumerických znaků (povinné při ověřování IPP)
(Uživatelské jméno pro ověřování IPP)
guest
IPP_AUTH_PASSWD1
(Heslo pro ověřování IPP)
Až 24 alfanumerických znaků (povinné při ověřování IPP)
WSD_ENB
(Použití tisku WSD)
ON, OFF
ON
WSD_BROWSING
(Použití procházení WSD)
ON, OFF
ON
WSD_MULTICAST_DISCOVERY
(Použití vícesměrového zjišťování)
ON, OFF
ON
602
7654321
Dodatek
HTTP_ENB
(Použití HTTP)
ON, OFF
ON
SNTP_ENB
(Použití SNTP)
ON, OFF
OFF
SNTP_ADDR
(Název serveru NTP)
IP adresa nebo název hostitele
SNTP_INTERVAL
(Interval dotazování)
1 až 48 (hod.)
24
DISCOVERY_ENB
(Reakce na zjištění)
ON, OFF
ON
DISCOVERY_SCOPE_NAME
(Název oboru)
Až 32 alfanumerických znaků
EMAIL_PRINT_ENB
(POP3 RX)
ON, OFF
EMAIL_POP_ADDR
(Název serveru POP3)
Až 48 alfanumerických znaků
(Prázdné)
EMAIL_POP_ACCOUNT
(Uživatelské jméno POP3)
Až 32 alfanumerických znaků
(Prázdné)
EMAIL_POP_PASSWD
(Heslo POP3)
Až 32 alfanumerických znaků
(Prázdné)
EMAIL_POP_INTERVAL
(Interval POP3 RX)
0 až 90 (min.)
EMAIL_POP_PORTNO
(Číslo portu serveru POP3)
0 až 65535
110
IPV4_USE
(Použití IPv4)
ON, OFF
ON
IPV6_USE
(Použití IPv6)
ON, OFF
OFF
IPV6_STATELESS_USE
(Použití bezstavové adresy)
ON, OFF
ON
IPV6_MANUAL_ADDR_USE
(Použití ruční adresy)
ON, OFF
OFF
IPV6_MANUAL_ADDR_SET
(IP adresa)
IP adresa
(Prázdné)
IPV6_MANUAL_ADDR_PREFIX
(Délka předpony)
0 až 128
64
IPV6_MANUAL_ROUTER_ADDR
(Výchozí adresa směrovače)
IP adresa
(Prázdné)
IPV6_DHCPV6_USE
(Použití DHCPv6)
ON, OFF
OFF
IPV6_DNS_ADDRESS_PRI
(Adresa primárního serveru DNS)
IP adresa
(Prázdné)
IPV6_DNS_ADDRESS_SEC
(Adresa primárního serveru DNS)
IP adresa
(Prázdné)
(Prázdné)
default
OFF
0
603
Dodatek
IPV6_DNS_NAME_SAME_AS_IPV4
ON, OFF
(Použití názvů hostitele IPv4/domény)
OFF
IPV6_DNS_HOST_NAME_V6
(Název hostitele)
Až 47 alfanumerických znaků
„Canon“+
„posledních 6 čísel
adresy MAC“
IPV6_DNS_DOMAIN_NAME_V6
(Název domény)
Až 47 alfanumerických znaků
(Prázdné)
IPV6_DNS_DYNAMIC_SET
(Dynamická aktualizace DNS)
ON, OFF
OFF
IPV6_DNS_STATELESS
(Registrace bezstavové adresy)
ON, OFF
OFF
IPV6_DNS_MANUAL
(Registrace ruční adresy)
ON, OFF
OFF
IPV6_DNS_STATEFUL
(Registrace stavové adresy)
ON, OFF
OFF
Nabídka serveru SMB (nastavení SMB)
Název položky
Hodnota nastavení
Výchozí nastavení z výroby
Nastavení
SMB_ENB
(Použití SMB)
ON, OFF
SMB_SERVER
(Název serveru)
Až 16 znaků
(Prázdné)
SMB_WG
(Název pracovní skupiny)
Až 16 znaků
WORKGROUP
SMB_COMMENT
(Komentáře)
Až 192 znaků
(Prázdné)
SMB_LM_ENB
(Použití oznámení LM)
ON, OFF
OFF
SMB_PRINT_ENB
(Použití tisku SMB)
ON, OFF
OFF
SMB_PRINTER
(Název tiskárny)
Až 13 znaků
OFF
PRINTER
Nabídka SNMP (Nastavení SNMP)
Název položky
Hodnota nastavení
Výchozí nastavení z výroby
Nastavení
SNMP_V1_ENB
(Použití SNMPv1)
ON, OFF
ON
SNMP_COMMUNITY1_ENB
(Použití názvu komunity 1)
ON, OFF
ON
SNMP_COMMUNITY1_ACCESS
RW (Čtení/zápis), RO (Pouze čtení)
RO
604
Dodatek
(Povolení přístupu MIB)
SNMP_COMMUNITY1_NAME
(Název komunity 1)
Až 32 alfanumerických
znaků
SNMP_COMMUNITY2_ENB
(Použití názvu komunity 2)
ON, OFF
OFF
SNMP_COMMUNITY2_ACCESS
(Povolení přístupu MIB)
RW (Čtení/zápis), RO (Pouze čtení)
RO
SNMP_COMMUNITY2_NAME
(Název komunity 2)
Až 32 alfanumerických
znaků
SNMP_V3_ENB
(Použití SNMPv3)
ON, OFF
OFF
SNMP_GET_PRT_MNG_INFO
ON, OFF
(Získání informací o správě tiskárny z hostitele)
OFF
public
public2
Nabídka SLUŽBA ZAŘAZOVÁNÍ (nastavení služby zařazování)
Název položky
SPOOL_ENB
(Použití služby zařazování)
Hodnota nastavení Výchozí nastavení z výroby
ON, OFF
OFF
Nabídka SPUSTIT ČASOVAČ (nastavení doby čekání na připojení při spuštění)
Název položky
Hodnota nastavení Výchozí nastavení z výroby
STRT_DELAY_TIME
0 až 300 (s)
(Doba čekání na připojení při spuštění)
0
Nabídka RUI (Nastavení Vzdáleného uživatelského rozhraní)
Název položky
Hodnota nastavení Výchozí nastavení z výroby
RUI_ENB
ON, OFF
(Použití Vzdáleného uživatelského rozhraní)
8
ON
Zadejte „put <název souboru> CONFIG“ a stiskněte tlačítko [ENTER].
● Zadejte název upraveného souboru v položce <název souboru> (například: put Nastavení.txt CONFIG).
➠ Soubor nastavení se odešle.
9
Zadejte „get reset“ a stiskněte tlačítko [ENTER].
➠ Zařízení se restartuje. Nastavení se po restartování zařízení povolí.
605
Dodatek
10
Potvrďte, že zařízení bylo normálně restartováno, stiskněte klávesu [C] a přitom
11
Zadejte „quit“ a stiskněte tlačítko [ENTER].
12
Zadejte „exit“ a stiskněte tlačítko [ENTER].
držte klávesu [CTRL].
➠ Příkazový řádek se ukončí.
ODKAZY
Síť(P. 336)
606
Dodatek
Ostatní
6867-07U
Tato část popisuje základní operace systému Windows a obsahuje odmítnutí odpovědnosti, údaje o autorských
právech a další informace.
607
Dodatek
Základní operace v systému Windows
6867-07W
Zobrazení složky tiskárny(P. 608)
Povolení služby [Zjišťování sítě](P. 608)
Zobrazení sdílených tiskáren na tiskovém serveru(P. 609)
Zobrazení obrazovky [Instalace softwarových programů / příruček](P. 610)
Tisk zkušební stránky v systému Windows(P. 610)
Kontrola bitové architektury(P. 611)
Kontrola názvu počítače(P. 612)
Kontrola portu tiskárny(P. 613)
Kontrola obousměrné komunikace(P. 614)
Při tisku z aplikace Windows Store(P. 615)
● V závislosti na použitém počítači se obsluha může lišit.
◼ Zobrazení složky tiskárny
Windows Vista
[Start] vyberte [Ovládací panely]
[Tiskárna].
Windows 7/Server 2008 R2
[Start] vyberte [Zařízení a tiskárny].
Windows 8/Server 2012
Klikněte pravým tlačítkem na levý dolní roh obrazovky
tiskárny].
Windows 8.1/Server 2012 R2
Klikněte pravým tlačítkem na nabídku [Start]
vyberte [Ovládací panely]
vyberte [Ovládací panely]
[Zobrazit zařízení a tiskárny].
Windows 10
[
] vyberte [Systém Windows]
[Ovládací panely]
Windows Server 2008
[Start] vyberte [Ovládací panely]
dvakrát klikněte na možnost [Tiskárny].
Windows Server 2016
Klikněte pravým tlačítkem na možnost [
]
[Hardware a zvuk]
vyberte [Ovládací panely]
[Zobrazit zařízení a
[Zařízení a tiskárny].
[Hardware]
[Zařízení a tiskárny].
◼ Povolení služby [Zjišťování sítě]
Povolte službu [Zjišťování sítě], aby bylo vidět počítače na síti.
Windows Vista
[Start] vyberte [Ovládací panely]
[Zjišťování sítě].
[Zobrazit úlohy a stav sítě]
Windows 7/Server 2008 R2
[Start] vyberte [Ovládací panely] [Zobrazit úlohy a stav sítě]
vyberte [Zapnout zjišťování sítě] v nabídce [Zjišťování sítě].
Windows 8/Server 2012
608
vyberte [Zapnout zjišťování sítě] v nabídce
[Změnit pokročilé nastavení sdílení]
Dodatek
Klikněte pravým tlačítkem na levý dolní roh obrazovky vyberte [Ovládací panely] [Zobrazit úlohy a stav sítě]
[Změnit pokročilé nastavení sdílení] vyberte [Zapnout zjišťování sítě] v nabídce [Zjišťování sítě].
Windows 8.1/Server 2012 R2
Klikněte pravým tlačítkem na nabídku [Start] vyberte [Ovládací panely] [Zobrazit úlohy a stav sítě]
[Změnit pokročilé nastavení sdílení] vyberte [Zapnout zjišťování sítě] v nabídce [Zjišťování sítě].
Windows 10
[
] vyberte [Systém Windows] [Ovládací panely] [Zobrazit úlohy a stav sítě]
nastavení sdílení] vyberte [Zapnout zjišťování sítě] v nabídce [Zjišťování sítě].
[Změnit pokročilé
Windows Server 2008
[Start] vyberte [Ovládací panely] dvakrát klikněte na možnost [Centrum síťových připojení a sdílení]
vyberte [Zapnout zjišťování sítě] v nabídce [Zjišťování sítě].
Windows Server 2016
Klikněte pravým tlačítkem na možnost [ ] vyberte [Ovládací panely] [Zobrazit úlohy a stav sítě]
pokročilé nastavení sdílení] vyberte [Zapnout zjišťování sítě] v nabídce [Zjišťování sítě].
[Změnit
◼ Zobrazení sdílených tiskáren na tiskovém serveru
1
Otevřete Windows Explorer.
Windows Vista/7/Server 2008
[Start] vyberte [Všechny programy] nebo [Programy]
Windows 8/Server 2012
Klikněte pravým tlačítkem na levý dolní roh obrazovky
[Příslušenství]
[Průzkumník Windows].
vyberte [Průzkumník souborů].
Windows 8.1/Server 2012 R2
Klikněte pravým tlačítkem na možnost [Start]
Windows 10/Server 2016
Klikněte pravým tlačítkem na možnost [
2
]
vyberte [Průzkumník souborů].
vyberte [Průzkumník souborů].
Ve složce [Síť] nebo [Místa v síti] vyberte tiskový server.
● Chcete-li zobrazit počítače v síti, může být nutné zapnout funkci zjišťování sítě nebo vyhledat počítače v síti.
➠ Zobrazí se sdílené tiskárny.
609
Dodatek
◼ Zobrazení obrazovky [Instalace softwarových programů / příruček]
Pokud se po vložení dodaného disku CD-ROM/DVD-ROM nezobrazí obrazovka [Instalace softwarových programů /
příruček], postupujte podle následujících kroků. Název diskové jednotky CD-ROM/DVD-ROM je v této příručce označen
jako „D:“. Písmeno jednotky CD-ROM/DVD-ROM se může lišit v závislosti na počítači, který používáte.
Windows Vista/7/Server 2008
[Start] zadejte „D:\MInst.exe“ v [Prohledat programy a soubory] nebo [Spustit hledání]
[ENTER].
stiskněte klávesu
Windows 8/Server 2012
Klikněte pravým tlačítkem v dolním levém rohu obrazovky na
[OK]
[Spustit]
Zadejte „D:\MInst.exe“
klikněte na
Windows 8.1/Server 2012 R2
Klikněte pravým tlačítkem na [Start]
[Spustit]
Zadejte „D:\MInst.exe“
klikněte na [OK]
Windows 10
Klikněte na [Zeptejte se mě něco]
výsledek vyhledávání.
; zadejte „D:\MInst.exe“
; klikněte na [D:\MInst.exe] zobrazené jako
Windows Server 2016
Klikněte na [
]
zadejte „D:\MInst.exe“
ve výsledcích hledání klikněte na položku [D:\MInst.exe].
◼ Tisk zkušební stránky v systému Windows
Můžete zkontrolovat, zda je ovladač tiskárny funkční, a to vytištěním zkušební stránky v systému Windows.
1
Vložte papír o velikosti A4 do víceúčelové přihrádky.
2
Otevřete složku tiskárny.
3
Vkládání papíru(P. 40)
Zobrazení složky tiskárny(P. 608)
Klikněte pravým tlačítkem na ikonu ovladače tiskárny pro dané zařízení a klikněte na
možnost [Vlastnosti tiskárny] nebo [Vlastnosti].
610
Dodatek
4
Klikněte na možnost [Tisk zkušební stránky] na kartě [Obecné].
➠ Vytiskne se zkušební stránka.
◼ Kontrola bitové architektury
Pokud si nejste jisti, zda se v počítači používá 32- nebo 64bitový systém Windows, postupujte podle následujících
pokynů.
1
Zobrazení okna [Ovládací panely].
Windows Vista/7/Server 2008
[Start] vyberte [Ovládací panely].
Windows 8/Server 2012
Klikněte pravým tlačítkem na levý dolní roh obrazovky
Windows 8.1/Server 2012 R2
Klikněte pravým tlačítkem na možnost [Start]
vyberte [Ovládací panely].
vyberte [Ovládací panely].
Windows 10/Server 2016
Pokračujte krokem 2.
611
Dodatek
2
Zobrazení okna [Systém].
Windows Vista/7/8/Server 2008 R2/Server 2012
Klikněte na možnost [Systém a údržba] nebo [Systém a zabezpečení]
Windows 10/Server 2016
Klikněte na možnost [ ]
[Nastavení]
[Systém]
[Systém].
vyberte [Informace o produktu].
Windows Server 2008
Dvakrát klikněte na možnost [Systém].
3
Zkontrolujte bitovou architekturu.
Pro 32bitové verze je zobrazeno
[32bitový operační systém].
Pro 64bitové verze je zobrazeno
[64bitový operační systém].
◼ Kontrola názvu počítače
1
Zobrazení okna [Ovládací panely].
Windows Vista/7/Server 2008
[Start] vyberte [Ovládací panely].
Windows 8/Server 2012
Klikněte pravým tlačítkem na levý dolní roh obrazovky
Windows 8.1/Server 2012 R2
Klikněte pravým tlačítkem na možnost [Start]
Windows 10
Klikněte na možnost [
]
vyberte [Ovládací panely].
; vyberte [Systém Windows]
Windows Server 2016
Klikněte pravým tlačítkem na možnost [
]
vyberte [Ovládací panely].
[Ovládací panely].
vyberte [Ovládací panely].
612
Dodatek
2
Zobrazení okna [Systém].
Windows Vista/7/8/10/Server 2008 R2/Server 2012/Server 2016
Klikněte na možnost [Systém a údržba] nebo [Systém a zabezpečení]
[Systém].
Windows Server 2008
Dvakrát klikněte na možnost [Systém].
3
Zkontrolujte název počítače.
◼ Kontrola portu tiskárny
1
2
Otevřete složku tiskárny.
Zobrazení složky tiskárny(P. 608)
Klikněte pravým tlačítkem na ikonu ovladače tiskárny pro dané zařízení a klikněte na
možnost [Vlastnosti tiskárny] nebo [Vlastnosti].
613
Dodatek
3
Na kartě [Porty] zkontrolujte, zda je port vybrán správně.
◼ Kontrola obousměrné komunikace
1
2
Otevřete složku tiskárny.
Zobrazení složky tiskárny(P. 608)
Klikněte pravým tlačítkem na ikonu ovladače tiskárny pro dané zařízení a klikněte na
možnost [Vlastnosti tiskárny] nebo [Vlastnosti].
614
Dodatek
3
Na kartě [Porty] se ujistěte, zda je zaškrtnuté pole [Povolit obousměrnou
komunikaci].
◼ Při tisku z aplikace Windows Store
Windows 8/Server 2012
Zobrazte symboly na pravé straně obrazovky
používáte [Tisk].
Windows 8.1/Server 2012 R2
Zobrazte symboly na pravé straně obrazovky
[Zařízení] [Tisk] Ovladač, který používáte
Klepněte nebo klikněte na možnost [Zařízení]
Ovladač, který
Klepněte nebo klikněte na možnost
[Tisk].
Windows 10
Klepněte nebo klikněte na možnost [Tisk] v aplikaci
Ovladač, který používáte
[Tisk].
● Pokud tisknete tímto způsobem, je k dispozici pouze omezené množství nastavení tisku.
● Pokud se zobrazí zpráva [Tiskárna vyžaduje vaši pozornost. Přepněte na plochu a podívejte se, co je potřeba
udělat.], přejděte na plochu a postupujte podle pokynů v zobrazeném dialogovém okně. Tato zpráva se
615
Dodatek
zobrazí, pokud je zařízení nastavené na možnost zobrazení uživatelského jména při tisku a podobných
činnostech.
616
Dodatek
Ukázky písma
6867-07X
Seznamy písem vytištěné z nabídky Příslušenství jsou vyčerpávajícím seznamem všech nyní dostupných písem. Seznam
obsahuje názvy a vytištěné ukázky písem uložených v zařízení.
Škálovatelná písma (PCL)(P. 618)
Škálovatelná písma OCR (PCL) (P. 621)
Rastrová písma (PCL)(P. 621)
617
Dodatek
Škálovatelná písma (PCL)
618
Dodatek
619
Dodatek
620
Dodatek
Škálovatelná písma OCR (PCL)
Rastrová písma (PCL)
621
Dodatek
Upozornění
6867-07Y
◼ Logo IPv6 Ready
Sada protokolů, které toto zařízení podporuje, získala logo IPv6 Ready Phase-2 ustanovené
organizací IPv6 Forum.
◼ Informace o produktu požadované podle NAŘÍZENÍ KOMISE (EU) č. 801/2013 ve znění
nařízení (ES) č. 1275/2008
Spotřeba elektrické energie výrobku v pohotovostním režimu při připojení na síť, když jsou všechny pevné síťové porty
připojeny a všechny bezdrátové síťové porty aktivovány (jestliže jsou k dispozici současně).
Název modelu
LBP852Cx
Spotřeba elektrické energie výrobku v pohotovostním režimu při připojení na síť
3,0 W nebo méně
● Výše uvedené hodnoty jsou aktuální hodnoty pro jednotlivá zařízení, které byly vybrané arbitrárně, a mohou
se lišit od hodnot zjištěných během provozu zařízení. Volitelné síťové porty nejsou během měření připojené
nebo aktivované.
◼ Směrnice OEEZ a směrnice o bateriích
Pouze Evropská unie a EHP (Norsko, Island a Lichtenštejnsko)
Tento symbol znamená, že podle směrnice OEEZ (2012/19/EU), směrnice o bateriích (2006/66/ES) a/nebo podle
vnitrostátních právních prováděcích předpisů k těmto směrnicím nemá být tento výrobek likvidován s odpadem z
domácností.
Je‑li v souladu s požadavky směrnice o bateriích vytištěna pod výše uvedeným symbolem chemická značka, udává, že
tato baterie nebo akumulátor obsahuje těžké kovy (Hg = rtuť, Cd = kadmium, Pb = olovo) v koncentraci vyšší, než je
příslušná hodnota předepsaná směrnicí.
Tento výrobek má být vrácen do určeného sběrného místa, např. v rámci autorizovaného systému odběru jednoho
výrobku za jeden nově prodaný podobný výrobek, nebo do autorizovaného sběrného místa pro recyklaci odpadních
elektrických a elektronických zařízení (OEEZ), baterií a akumulátorů. Nevhodné nakládání s tímto druhem odpadu by
622
Dodatek
mohlo mít negativní dopad na životní prostředí a lidské zdraví, protože elektrická a elektronická zařízení zpravidla
obsahují potenciálně nebezpečné látky.Vaše spolupráce na správné likvidaci tohoto výrobku napomůže efektivnímu
využívání přírodních zdrojů.
Chcete‑li získat podrobné informace týkající se recyklace tohoto výrobku, obraťte se prosím na místní úřad, orgán pro
nakládání s odpady, schválený systém nakládání s odpady či společnost zajišťující likvidaci domovního odpadu, nebo
navštivte webové stránky www.canon-europe.com/weee nebo www.canon-europe.com/battery.
◼ Environmental Information
Reducing your environmental impact while saving money
Power Consumption and Activation Time
The amount of electricity a device consumes depends on the way the device is used. This product is designed and set
in a way to allow you to reduce your electricity costs. After the last print it switches to Ready Mode. In this mode it can
print again immediately if required. If the product is not used for a time, the device switches to its Power Save Mode.
The devices consume less power (Watt) in these modes.
If you wish to set a longer Activation Time or would like to completely deactivate the Power Save Mode, please
consider that this device may then only switch to a lower energy level after a longer period of time or not at all.
Canon does not recommend extending the Activation Times from the optimum ones set as default.
Energy Star®
The Energy Star® programme is a voluntary scheme to promote the development and purchase of energy efficient
models, which help to minimise environmental impact.
Products which meet the stringent requirements of the Energy Star® programme for both environmental benefits and
the amount of energy consumption will carry the Energy Star® logo accordingly.
Paper types
This product can be used to print on both recycled and virgin paper (certified to an environmental stewardship
scheme), which complies with EN12281 or a similar quality standard. In addition it can support printing on media
down to a weight of 64g/m².
Lighter paper means less resources used and a lower environmental footprint for your printing needs.
Duplex printing (Standard duplex printing products only)
Duplex printing capability enables you to print on both sides automatically, and therefore helps to reduce the use of
valuable resources by reducing your paper consumption.
The duplex function has been auto enabled during the set up and driver installation and Canon strongly recommends
that you do not disable this function. You should continue to use the duplex function to reduce the environmental
impact of your work with this product at all times.
623
Dodatek
◼ Odmítnutí odpovědnosti
● Informace uvedené v tomto dokumentu podléhají změnám bez předchozího upozornění.
● SPOLEČNOST CANON INC. NEPOSKYTUJE NA TENTO MATERIÁL ZÁRUKY JAKÉHOKOLIV DRUHU, VÝSLOVNÉ ANI
VYPLÝVAJÍCÍ, NENÍ-LI ZDE UVEDENO JINAK, ZAHRNUJÍCÍ BEZ OMEZENÍ ZÁRUKY PRODEJNOSTI,
OBCHODOVATELNOSTI, VHODNOSTI PRO URČITÝ ÚČEL POUŽITÍ NEBO NEPORUŠENÍ CIZÍCH PRÁV. SPOLEČNOST
CANON INC. NENÍ ODPOVĚDNÁ ZA ŽÁDNÉ PŘÍMÉ, NÁHODNÉ NEBO NÁSLEDNÉ ŠKODY JAKÉKOLI POVAHY, ZTRÁTY
NEBO NÁKLADY VYPLÝVAJÍCÍ Z POUŽÍVÁNÍ TOHOTO MATERIÁLU.
◼ Ochranné známky
„MEAP“ je ochranná známka společnosti CANON Inc., která se vztahuje k „aplikační platformě“ pro multifunkční a
jednoúčelové tiskárny Canon.
Mopria®, logo Mopria® a logo Mopria® Alliance jsou registrované ochranné známky a servisní značky společnosti
Mopria Alliance, Inc. v USA a dalších zemích. Neoprávněné používání je přísně zakázáno.
Adobe, Acrobat a Reader jsou registrované ochranné známky společnosti Adobe Systems Incorporated v USA a/nebo
dalších zemích.
Apple, Bonjour, iPad, iPhone, iPod touch, Mac, macOS, OS X, Safari, AirPrint a logo AirPrint jsou ochranné známky
společnosti Apple Inc.
Microsoft, Windows, Windows Vista, Windows Server, Internet Explorer, Word a Excel jsou registrované ochranné
známky nebo ochranné známky společnosti Microsoft Corporation v USA a/nebo dalších zemích.
IOS je ochranná známka nebo registrovaná ochranná známka společnosti Cisco v USA a dalších zemích a používá se
v rámci licence.
Google Cloud Print, Google Chrome a Android jsou registrované ochranné známky nebo ochranné známky společnosti
Google Inc.
This product contains the Universal Font Scaling Technology or UFST® under license from Monotype Imaging, Inc.
UFST® is a trademark of Monotype Imaging, Inc. registered in the United States Patent and Trademark Office and may
be registered in certain jurisdictions.UFST: Copyright © 1989 - 1996, 1997, 2003, 2004, 2008, all rights reserved, by
Monotype Imaging Inc.
Java a všechny ochranné známky a loga založené na systému Java jsou ochranné známky nebo registrované ochranné
známky společnosti Oracle a/nebo souvisejících společností.
624
Dodatek
Adobe, PostScript a logo PostScript jsou registrované ochranné známky nebo ochranné známky společnosti Adobe
Systems Incorporated v USA a/nebo dalších zemích.
Copyright © 2007 -08 Adobe Systems Incorporated. All rights reserved.
Protected by U.S. Patents 5,737,599; 5,781,785; 5,819,301; 5,929,866; 5,943,063; 6,073,148; 6,515,763; 6,639,593;
6,754,382; 7,046,403; 7,213,269; 7,242,415; Patents pending in the U.S. and other countries.
All instances of the name PostScript in the text are references to the PostScript language as defined by Adobe Systems
Incorporated unless otherwise stated. The name PostScript also is used as a product trademark for Adobe Systems'
implementation of the PostScript language interpreter.
Except as otherwise stated, any reference to a "PostScript printing device," "PostScript display device," or similar item
refers to a printing device, display device or item (respectively) that contains PostScript technology created or licensed
by Adobe Systems Incorporated and not to devices or items that purport to be merely compatible with the PostScript
language.
Adobe, the Adobe logo, PostScript, the PostScript logo, and PostScript 3 are either registered trademarks or
trademarks of Adobe Systems Incorporated in the United States and/or other countries.
Linux is a registered trademark of Linus Torvalds. Microsoft and Windows are either registered trademarks or
trademarks of Microsoft Corporation in the United States and/or other countries.
All other trademarks are the property of their respective owners.
Všechny další názvy produktů a značek jsou registrovanými ochrannými známkami, ochrannými známkami nebo
servisními značkami příslušných vlastníků.
◼ Copyright
Je zakázáno kopírovat celý obsah tohoto dokumentu nebo jeho části bez předchozího souhlasu.
◼ Právní omezení použití vašeho výrobku a používání obrázků
Používání tohoto přístroje ke skenování, tisku nebo jinému druhu reprodukce určitých dokumentů a používání
obrazů, které byly naskenovány, vytištěny nebo jinak reprodukovány pomocí tohoto přístroje může být zakázáno
zákonem a mohlo by vyústit v trestní nebo občanskoprávní odpovědnost. Neúplný seznam těchto dokumentů je
uveden níže. Tento seznam slouží pouze jako vodítko. Pokud si nejste jisti legálností použití produktu ke
skenování, tisku nebo jiné reprodukci jakéhokoli dokumentu a/nebo použití obrázků naskenovaných, vytištěných
nebo jinak reprodukovaných, měli byste se předem obrátit na svého právního poradce a požádat ho o radu.
● Papírové peníze
● Cestovní šeky
● Platební příkazy
● Stravenky
625
Dodatek
● Certifikáty o vkladech
● Pasy
● Poštovní známky (orazítkované nebo neorazítkované)
● Imigrační dokumenty
● Identifikační jmenovky nebo insignie
● Interní daňové známky (orazítkované nebo neorazítkované)
● Dokumenty k vojenské povinnosti nebo dokumenty k odvodu
● Obligace nebo jiné certifikáty o bezdlužnosti
● Šeky nebo dokumenty vydané státními orgány
● Akcie a cenné papíry
● Technické a řidičské průkazy a nabývací listiny
● Listiny potvrzující autorská práva/umělecká díla bez svolení vlastníka autorských práv
V_181009
626
SIL OPEN FONT LICENSE
This Font Software is licensed under the SIL Open Font License,
Version 1.1.
This license is copied below, and is also available with a FAQ at:
http://scripts.sil.org/OFL
----------------------------------------------------------SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007
----------------------------------------------------------PREAMBLE
The goals of the Open Font License (OFL) are to stimulate worldwide
development of collaborative font projects, to support the font
creation efforts of academic and linguistic communities, and to
provide a free and open framework in which fonts may be shared and
improved in partnership with others.
The OFL allows the licensed fonts to be used, studied, modified and
redistributed freely as long as they are not sold by themselves. The
fonts, including any derivative works, can be bundled, embedded,
redistributed and/or sold with any software provided that any reserved
names are not used by derivative works. The fonts and derivatives,
however, cannot be released under any other type of license. The
requirement for fonts to remain under this license does not apply to
any document created using the fonts or their derivatives.
DEFINITIONS
"Font Software" refers to the set of files released by the Copyright
Holder(s) under this license and clearly marked as such. This may
include source files, build scripts and documentation.
"Reserved Font Name" refers to any names specified as such after the
copyright statement(s).
"Original Version" refers to the collection of Font Software
components as distributed by the Copyright Holder(s).
"Modified Version" refers to any derivative made by adding to,
deleting, or substituting -- in part or in whole -- any of the
components of the Original Version, by changing formats or by porting
the Font Software to a new environment.
"Author" refers to any designer, engineer, programmer, technical
writer or other person who contributed to the Font Software.
PERMISSION & CONDITIONS
Permission is hereby granted, free of charge, to any person obtaining
a copy of the Font Software, to use, study, copy, merge, embed,
modify, redistribute, and sell modified and unmodified copies of the
Font Software, subject to the following conditions:
627
SIL OPEN FONT LICENSE
1) Neither the Font Software nor any of its individual components, in
Original or Modified Versions, may be sold by itself.
2) Original or Modified Versions of the Font Software may be bundled,
redistributed and/or sold with any software, provided that each copy
contains the above copyright notice and this license. These can be
included either as stand-alone text files, human-readable headers or
in the appropriate machine-readable metadata fields within text or
binary files as long as those fields can be easily viewed by the user.
3) No Modified Version of the Font Software may use the Reserved Font
Name(s) unless explicit written permission is granted by the
corresponding Copyright Holder. This restriction only applies to the
primary font name as presented to the users.
4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font
Software shall not be used to promote, endorse or advertise any
Modified Version, except to acknowledge the contribution(s) of the
Copyright Holder(s) and the Author(s) or with their explicit written
permission.
5) The Font Software, modified or unmodified, in part or in whole,
must be distributed entirely under this license, and must not be
distributed under any other license. The requirement for fonts to
remain under this license does not apply to any document created using
the Font Software.
TERMINATION
This license becomes null and void if any of the above conditions are
not met.
DISCLAIMER
THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF
MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT
OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE
COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL
DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING
FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM
OTHER DEALINGS IN THE FONT SOFTWARE.
628
6OXŀE\WěHW¯FKVWUDQ
3RNXGSURVWěHGQLFWY¯P352'8.78Y\Xŀ¯Y£WHVOXŀE\WěHW¯FKVWUDQSRGO«K£MHMLFKY\XŀLW¯Q¯ŀHXYHGHQ¿P
SRGP¯QN£P3ěLSě¯VWXSXNREVDKXQÝMDN«WěHW¯VWUDQ\QHERSRNXGWDNRY¿REVDK]¯VN£WH QDSě¯NODGWH[W
REU£]N\YLGHD]YXNRY«]£]QDP\QHERVRIWZDUH SURVWěHGQLFWY¯P62)7:$58WDNPLPRSě¯SDG\NG\WR
PDMLWHOREVDKXQHERSě¯VOXģQ«]£NRQ\Y¿VORYQÝSRYROXM¯QHVP¯WH D JHQHURYDWY\WY£ěHWGDWDE£]HDQLMLQDN
Y\WY£ěHWWUYDO«NRSLHWDNRY«KRREVDKXDQLXFKRY£YDWNRSLHSDPÝWLFDFKHG«OHQHŀSRYROXMH]£KODY¯W«WR
SDPÝWL E NRS¯URYDWSěHNO£GDWXSUDYRYDWY\WY£ěHWRGYR]HQ£G¯ODSURG£YDWSıMÏRYDWSěHY£GÝWGLVWULEXRYDW
YHěHMQÝ]REUD]RYDWQHERXG¯OHWGDOģ¯OLFHQFHWěHW¯PVWUDQ£P F NODPDY¿P]SıVREHPXY£GÝW]GURMYODVWQLFWY¯
DQL G RGVWUDQLWVNU¿WDQLSR]PÝQLWŀ£GQ£DXWRUVN£SU£YDRFKUDQQ«]Q£PN\DQLGDOģ¯XSR]RUQÝQ¯QDMLQ£
YODVWQLFN£SU£YDIDOģRYDWDQLY\PD]DWLQIRUPDFHDXWRUDSU£YQ¯XSR]RUQÝQ¯DQLMLQ«ģW¯WN\RSıYRGXÏL]GURML
PDWHUL£OX
- 1 -
6RIWZDUHSRGO«KDM¯F¯GDOģ¯POLFHQÏQ¯PSRGP¯QN£P
3RGUREQÝMģ¯LQIRUPDFHDRGSRY¯GDM¯F¯OLFHQÏQ¯SRGP¯QN\QDOH]QHWHYQ¯ŀHXYHGHQ«WDEXOFHVRIWZDUX DSě¯VOXģQ¿FKOLFHQÏQ¯FKSRGP¯QHN
7DEXONDVRIWZDUX
1£]Y\VRIWZDUX
/LFHQÏQ¯SRGP¯QN\DXVWDQRYHQ¯
9L]VWUDQD
$GREH3RVW6FULSW
+WWS&OLHQW$OSKD5HOHDVH
&U\SWR$3,
H[SDW
-0(
OLEMLQJOH
0'
1(76103
2SHQ66/
VHUYOHWMDU
- 2 -
%XGHWHOLSRWěHERYDW]GURMRY¿NµGQ£VOHGXM¯F¯KRVRIWZDUX]DģOHWHSURV¯PHPDLOVQ¯ŀHXYHGHQ¿PLLQIRUPDFHPL
YDQJOLÏWLQÝQHERMDSRQģWLQÝQDDGUHVXRLSRVVJ#FDQRQFRMS! 1£]HYPRGHOXNWHU¿MVWHVL]DNRXSLOL
,'ϯVORSURGXNWXXYHGHQ«QDģW¯WNXQD]DGQ¯Ï£VWLKODYQ¯MHGQRWN\
3RGUREQÝMģ¯ LQIRUPDFH DRGSRY¯GDM¯F¯ OLFHQÏQ¯ SRGP¯QN\ QDOH]QHWH YQ¯ŀH XYHGHQ« WDEXOFH VRIWZDUX
DSě¯VOXģQ¿FKOLFHQÏQ¯FKSRGP¯QHN
7DEXONDVRIWZDUX
1£]Y\VRIWZDUX
/LFHQÏQ¯SRGP¯QN\DXVWDQRYHQ¯
9L]VWUDQD /LQX[
JOLEF
MVRQJOLE
JOLE
26*L5HOHDVH
- 3 -
$GREH3RVW6FULSW
&RS\ULJKW$GREH6\VWHPV,QFRUSRUDWHGDQGLWVOLFHQVRUV $OOULJKWVUHVHUYHG
3RUWLRQVLQFOXGHVRIWZDUHXQGHUWKHIROORZLQJWHUPV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7KLVSURGXFWFRQWDLQVHLWKHU%6$)(DQGRU7,3(0VRIWZDUHE\56$6HFXULW\,QF
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQVRI3RROFB&RS\ULJKW1H;7,QFDQGSRUWLRQVRI*UDSKLFVFB&RS\ULJKW 1H;7,QFDVDQ
XQSXEOLVKHGZRUN $OO5LJKWV5HVHUYHG
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KH$SDFKH6RIWZDUH/LFHQVH9HUVLRQ
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ KWWSZZZDSDFKHRUJ 3RUWLRQV&RS\ULJKW F 7KH$SDFKH6RIWZDUH)RXQGDWLRQ $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU 5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KH HQGXVHU GRFXPHQWDWLRQ LQFOXGHG ZLWK WKH UHGLVWULEXWLRQ LI DQ\ PXVW LQFOXGH WKH IROORZLQJ
DFNQRZOHGJPHQW 7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ KWWSZZZDSDFKHRUJ $OWHUQDWHO\ WKLV DFNQRZOHGJPHQW PD\ DSSHDU LQ WKH VRIWZDUH LWVHOI LI DQG ZKHUHYHU VXFK WKLUGSDUW\
DFNQRZOHGJPHQWVQRUPDOO\DSSHDU
7KHQDPHV;HUFHVDQG$SDFKH6RIWZDUH)RXQGDWLRQPXVWQRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWV
GHULYHG IURP WKLV VRIWZDUH ZLWKRXW SULRU ZULWWHQ SHUPLVVLRQ )RU ZULWWHQ SHUPLVVLRQ SOHDVH FRQWDFW
DSDFKH#DSDFKHRUJ
3URGXFWVGHULYHGIURPWKLVVRIWZDUHPD\QRWEHFDOOHG$SDFKHQRUPD\$SDFKHDSSHDULQWKHLUQDPH
ZLWKRXWSULRUZULWWHQSHUPLVVLRQRIWKH$SDFKH6RIWZDUH)RXQGDWLRQ
7+,662)7:$5(,63529,'('CC$6,6 $1'$1<(;35(66('25,03/,(':$55$17,(6,1&/8',1*
%87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $
3$57,&8/$5 385326( $5( ',6&/$,0(' ,1 12 (9(17 6+$// 7+( $3$&+( 62)7:$5(
)281'$7,2125,76&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)
- 4 -
68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25 %86,1(66
,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1&2175$&7
675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<287
2)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
7KLVVRIWZDUHFRQVLVWVRIYROXQWDU\FRQWULEXWLRQVPDGHE\PDQ\LQGLYLGXDOVRQEHKDOIRIWKH$SDFKH6RIWZDUH
)RXQGDWLRQDQG ZDVRULJLQDOO\EDVHG RQ VRIWZDUH FRS\ULJKW F ,QWHUQDWLRQDO %XVLQHVV 0DFKLQHV ,QF
KWWSZZZLEPFRP )RU PRUH LQIRUPDWLRQ RQ WKH $SDFKH 6RIWZDUH )RXQGDWLRQ SOHDVH VHH
KWWSZZZDSDFKHRUJ!
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
3RUWLRQV&RS\ULJKW F 7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU
5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OO DGYHUWLVLQJ PDWHULDOV PHQWLRQLQJ IHDWXUHV RU XVH RI WKLV VRIWZDUH PXVW GLVSOD\ WKH IROORZLQJ
DFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
1HLWKHU WKH QDPH RI WKH 8QLYHUVLW\ QRUWKHQDPHV RI LWV FRQWULEXWRUV PD\ EHXVHG WRHQGRUVH RUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(5(*(176$1'&2175,%87256$6,6$1'$1<(;35(66
25 ,03/,(' :$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2)
0(5&+$17$%,/,7< $1' ),71(66 )25$3$57,&8/$5385326( $5( ',6&/$,0(' ,1 12 (9(17
6+$// 7+( 5(*(176 25 &2175,%87256 %( /,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/
63(&,$/ (;(03/$5< 25 &216(48(17,$/ '$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72
352&85(0(17 2) 68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25
%86,1(66 ,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1
&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<
:$< 287 2) 7+( 86( 2) 7+,6 62)7:$5( (9(1 ,) $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQV&RS\ULJKW F 7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD$OOULJKWVUHVHUYHG
- 5 -
7KLVFRGHLVGHULYHGIURPVRIWZDUHFRQWULEXWHGWR%HUNHOH\E\-DPHV$:RRGVGHULYHGIURPRULJLQDOZRUNE\
6SHQFHU7KRPDVDQG-RVHSK2URVW
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVDUHSHUPLWWHGSURYLGHGWKDWWKHDERYHFRS\ULJKWQRWLFHDQG
WKLVSDUDJUDSKDUHGXSOLFDWHGLQDOOVXFKIRUPVDQGWKDWDQ\GRFXPHQWDWLRQDGYHUWLVLQJPDWHULDOVDQGRWKHU
PDWHULDOVUHODWHGWRVXFKGLVWULEXWLRQDQGXVHDFNQRZOHGJHWKDWWKHVRIWZDUHZDVGHYHORSHGE\WKH8QLYHUVLW\
RI&DOLIRUQLD%HUNHOH\ 7KHQDPHRIWKH8QLYHUVLW\PD\QRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHG
IURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,6 62)7:$5( ,6 3529,'(' CC$6 ,6 $1' :,7+287 $1< (;35(66 25 ,03/,(' :$55$17,(6
,1&/8',1*:,7+287/,0,7$7,217+(,03/,(':$55$17,(62)0(5&+$17,%,/,7<$1'),71(66
)25$3$57,&8/$5385326(
3RUWLRQV&RS\ULJKW F ;&RQVRUWLXP
3HUPLVVLRQLVKHUHE\JUDQWHGIUHHRIFKDUJHWRDQ\SHUVRQREWDLQLQJDFRS\RIWKLVVRIWZDUHDQGDVVRFLDWHG
GRFXPHQWDWLRQILOHV WKH6RIWZDUH WRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKH
ULJKWVWRXVHFRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHVXEOLFHQVHDQGRUVHOOFRSLHVRIWKH6RIWZDUHDQGWR
SHUPLWSHUVRQVWRZKRPWKH6RIWZDUHLVIXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
7KHDERYHFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHVKDOOEHLQFOXGHGLQDOOFRSLHVRUVXEVWDQWLDOSRUWLRQVRI
WKH6RIWZDUH
7+( 62)7:$5( ,6 3529,'(' $6,6 :,7+287 :$55$17< 2) $1< .,1' (;35(66 25,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7<),71(66 )25 $
3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 ,1 12 (9(17 6+$// 7+(; &216257,80 %(
/,$%/( )25$1< &/$,0 '$0$*(6 25 27+(5 /,$%,/,7< :+(7+(5 ,1$1 $&7,21 2) &2175$&7
72572527+(5:,6($5,6,1*)5202872)25,1&211(&7,21:,7+7+(62)7:$5(257+(
86(2527+(5'($/,1*6,17+(62)7:$5(
([FHSWDVFRQWDLQHGLQWKLVQRWLFHWKHQDPHRIWKH;&RQVRUWLXPVKDOOQRWEHXVHGLQDGYHUWLVLQJRURWKHUZLVH
WR SURPRWH WKH VDOH XVH RU RWKHU GHDOLQJV LQ WKLV 6RIWZDUH ZLWKRXW SULRU ZULWWHQ DXWKRUL]DWLRQ IURP WKH ;
&RQVRUWLXP
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
127,&(5(*$5',1*6$%/27521
0DUFK
- 6 -
3RUWLRQVRIWKLVSURGXFWDUHEDVHGRQ0RGLILFDWLRQVFUHDWHGIURPWKH2ULJLQDO&RGHNQRZQDVWKH6DEORWURQ
;6/7 3URFHVVRU 7KH 6DEORWURQ ;6/7 3URFHVVRU LV VXEMHFW WR WKH 0R]LOOD 3XEOLF /LFHQVH 9HUVLRQ WKH
/LFHQVH <RXPD\REWDLQDFRS\RI
WKH/LFHQVHDWKWWSZZZPR]LOODRUJ03/
6RIWZDUH GLVWULEXWHG XQGHU WKH /LFHQVH LV GLVWULEXWHG RQDQ$6 ,6EDVLV :,7+287 :$55$17< 2) $1<
.,1'HLWKHUH[SUHVVRULPSOLHG6HHWKH/LFHQVHIRUWKHVSHFLILFODQJXDJHJRYHUQLQJULJKWVDQGOLPLWDWLRQVXQGHU
WKH/LFHQVH
7KH2ULJLQDO&RGHLVWKH6DEORWURQ;6/73URFHVVRU
7KH ,QLWLDO 'HYHORSHU RI WKH 2ULJLQDO &RGH LV *LQJHU $OOLDQFH /WG 3RUWLRQV FUHDWHG E\ *LQJHU $OOLDQFH DUH
&RS\ULJKW & *LQJHU$OOLDQFH/WG$OO5LJKWV5HVHUYHG
3XUVXDQWWRVHFWLRQVDQGRIWKH/LFHQVHWKH0RGLILFDWLRQVFUHDWHGE\$GREH6\VWHPV,QFRUSRUDWHGDUH
DYDLODEOHDV6RXUFH&RGH7KH0RGLILFDWLRQVPD\EHGRZQORDGHGYLDWKH,QWHUQHWIURP
KWWSSDUWQHUVDGREHFRPDVQWHFK[POVDEORWURQLQGH[MVS
7KH2ULJLQDO&RGHPD\EHGRZQORDGHGYLDWKH,QWHUQHWIURP
KWWSVVRXUFHIRUJHQHWSURMHFWVVDEORWURQ
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
3RUWLRQV &RS\ULJKW F 7KH 5HJHQWV RI WKH
8QLYHUVLW\RI&DOLIRUQLD $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU
5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OO DGYHUWLVLQJ PDWHULDOV PHQWLRQLQJ IHDWXUHV RU XVH RI WKLV VRIWZDUH PXVW GLVSOD\ WKH IROORZLQJ
DFNQRZOHGJHPHQW 7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWV
FRQWULEXWRUV
1HLWKHU WKH QDPH RI WKH 8QLYHUVLW\ QRUWKHQDPHV RI LWV FRQWULEXWRUV PD\ EHXVHG WRHQGRUVH RUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
- 7 -
7+,662)7:$5(,63529,'('%<7+(5(*(176$1'&2175,%87256$6,6$1'$1<(;35(66
25 ,03/,(' :$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2)
0(5&+$17$%,/,7< $1' ),71(66 )25$3$57,&8/$5385326( $5( ',6&/$,0(' ,1 12 (9(17
6+$// 7+( 5(*(176 25 &2175,%87256 %( /,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/
63(&,$/ (;(03/$5< 25 &216(48(17,$/ '$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72
352&85(0(17 2) 68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25
%86,1(66 ,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1
&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<
:$< 287 2) 7+( 86( 2) 7+,6 62)7:$5( (9(1 ,) $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQV&RS\ULJKW F E\$QGUHL$OH[DQGUHVFX 7KLVFRGHDFFRPSDQLHVWKHERRN
$OH[DQGUHVFX$QGUHL0RGHUQ&'HVLJQ*HQHULF3URJUDPPLQJDQG'HVLJQ3DWWHUQV$SSOLHG&RS\ULJKW
F $GGLVRQ:HVOH\
3HUPLVVLRQWRXVHFRS\PRGLI\GLVWULEXWHDQGVHOOWKLVVRIWZDUHIRUDQ\SXUSRVHLVKHUHE\JUDQWHGZLWKRXWIHH
SURYLGHG WKDW WKH DERYH FRS\ULJKW QRWLFH DSSHDU LQ DOO FRSLHV DQG WKDW ERWK WKDW FRS\ULJKW QRWLFH DQG WKLV
SHUPLVVLRQ QRWLFHDSSHDU LQ VXSSRUWLQJ GRFXPHQWDWLRQ 7KHDXWKRU RU $GGLVRQ:HOVH\ /RQJPDQ PDNH QR
UHSUHVHQWDWLRQVDERXWWKHVXLWDELOLW\RIWKLVVRIWZDUHIRUDQ\SXUSRVH,WLVSURYLGHGDVLVZLWKRXWH[SUHVVRU
LPSOLHGZDUUDQW\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQVGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQV &RS\ULJKW k 8QLFRGH ,QF $OO ULJKWV UHVHUYHG 'LVWULEXWHG XQGHU WKH 7HUPV RI 8VH LQ
KWWSZZZXQLFRGHRUJFRS\ULJKWKWPO
3HUPLVVLRQ LVKHUHE\ JUDQWHG IUHHRI FKDUJHWRDQ\ SHUVRQREWDLQLQJ D FRS\RIWKH 8QLFRGHGDWDILOHVDQG
DVVRFLDWHG GRFXPHQWDWLRQ WKH 'DWD )LOHV RU 8QLFRGH VRIWZDUH DQG DVVRFLDWHG GRFXPHQWDWLRQ WKH
6RIWZDUH WRGHDOLQWKH'DWD)LOHVRU6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKHULJKWVWRXVH
FRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHDQGRUVHOOFRSLHVRIWKH'DWD)LOHVRU6RIWZDUHDQGWRSHUPLWSHUVRQV
WRZKRPWKH'DWD)LOHVRU6RIWZDUHDUHIXUQLVKHGWRGRVRSURYLGHGWKDW D WKHDERYHFRS\ULJKWQRWLFH V DQG
WKLVSHUPLVVLRQQRWLFHDSSHDULQDOOFRSLHVRIWKH'DWD)LOHVRU6RIWZDUH E ERWKWKHDERYHFRS\ULJKWQRWLFH V DQGWKLVSHUPLVVLRQQRWLFHDSSHDULQDVVRFLDWHGGRFXPHQWDWLRQDQG F WKHUHLVFOHDUQRWLFHLQHDFKPRGLILHG
'DWD)LOHRULQWKH6RIWZDUHDVZHOODVLQWKHGRFXPHQWDWLRQDVVRFLDWHGZLWKWKH'DWD)LOH V RU6RIWZDUHWKDW
WKHGDWDRUVRIWZDUHKDVEHHQPRGLILHG
7+( '$7$ ),/(6 $1' 62)7:$5( $5( 3529,'(' $6 ,6 :,7+287 :$55$17< 2) $1< .,1'
(;35(6625,03/,(',1&/8',1*%87127/,0,7('727+(:$55$17,(62)0(5&+$17$%,/,7<
- 8 -
),71(66)25$3$57,&8/$5385326($1'121,1)5,1*(0(172)7+,5'3$57<5,*+76,112
(9(176+$// 7+( &23<5,*+7 +2/'(5 25 +2/'(56 ,1&/8'(',1 7+,6 127,&( %(/,$%/( )25
$1< &/$,0 25 $1< 63(&,$/ ,1',5(&7 25 &216(48(17,$/ '$0$*(6 25 $1< '$0$*(6
:+$762(9(5 5(68/7,1* )520 /2662) 86( '$7$ 25352),76 :+(7+(5 ,1 $1$&7,212)
&2175$&71(*/,*(1&(2527+(57257,286$&7,21$5,6,1*2872)25,1&211(&7,21:,7+
7+(86(253(5)250$1&(2)7+('$7$),/(62562)7:$5(
([FHSWDVFRQWDLQHGLQWKLVQRWLFHWKHQDPHRIDFRS\ULJKWKROGHUVKDOOQRWEHXVHGLQDGYHUWLVLQJRURWKHUZLVH
WRSURPRWHWKHVDOHXVHRURWKHUGHDOLQJVLQWKHVH'DWD)LOHVRU6RIWZDUHZLWKRXWSULRUZULWWHQDXWKRUL]DWLRQRI
WKHFRS\ULJKWKROGHU
8QLFRGHDQGWKH8QLFRGHORJRDUHWUDGHPDUNVRI8QLFRGH,QFDQGPD\EHUHJLVWHUHGLQVRPHMXULVGLFWLRQV$OO
RWKHU WUDGHPDUNV DQG UHJLVWHUHG WUDGHPDUNV PHQWLRQHG KHUHLQ DUH WKH SURSHUW\ RI WKHLU UHVSHFWLYH RZQHUV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
$GREHVKDOOUHWDLQDQGUHSURGXFHDQGUHTXLUHLWV6XEOLFHQVHHVWRUHWDLQDQGUHSURGXFH-,0 VIROORZLQJFRS\ULJKW
QRWLFHZLWKLQHDFKFRS\RIWKHOLFHQVHGSURJUDPVLQDQ\IRUPLQZKROHRULQSDUWk-0,&RQVXOWDQWV
,QF$OOULJKWVUHVHUYHG BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
3RUWLRQV&RS\ULJKW F 7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD $OOULJKWVUHVHUYHG
7KLVFRGHLVGHULYHGIURPVRIWZDUHFRQWULEXWHGWR%HUNHOH\E\&KULV7RUHN
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU
5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OO DGYHUWLVLQJ PDWHULDOV PHQWLRQLQJ IHDWXUHV RU XVH RI WKLV VRIWZDUH PXVW GLVSOD\ WKH IROORZLQJ
DFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
1HLWKHU WKH QDPH RI WKH 8QLYHUVLW\ QRUWKHQDPHV RI LWV FRQWULEXWRUV PD\ EHXVHG WRHQGRUVH RUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(5(*(176$1'&2175,%87256$6,6$1'$1<(;35(66
25 ,03/,(' :$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2)
- 9 -
0(5&+$17$%,/,7< $1' ),71(66 )25$3$57,&8/$5385326( $5( ',6&/$,0(' ,1 12 (9(17
6+$// 7+( 5(*(176 25 &2175,%87256 %( /,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/
63(&,$/ (;(03/$5< 25 &216(48(17,$/ '$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72
352&85(0(17 2) 68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25
%86,1(66 ,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1
&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<
:$< 287 2) 7+( 86( 2) 7+,6 62)7:$5( (9(1 ,) $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KH/RNL/LEUDU\
3RUWLRQV &RS\ULJKW F E\ $QGUHL $OH[DQGUHVFX 7KLV FRGH DFFRPSDQLHV WKH ERRN $OH[DQGUHVFX
$QGUHL 0RGHUQ & 'HVLJQ *HQHULF 3URJUDPPLQJ DQG 'HVLJQ 3DWWHUQV $SSOLHG &RS\ULJKW F $GGLVRQ:HVOH\
3HUPLVVLRQWRXVHFRS\PRGLI\GLVWULEXWHDQGVHOOWKLVVRIWZDUHIRUDQ\SXUSRVHLVKHUHE\JUDQWHGZLWKRXWIHH
SURYLGHG WKDW WKH DERYH FRS\ULJKW QRWLFH DSSHDU LQ DOO FRSLHV DQG WKDW ERWK WKDW FRS\ULJKW QRWLFH DQG WKLV
SHUPLVVLRQ QRWLFHDSSHDU LQ VXSSRUWLQJ GRFXPHQWDWLRQ 7KHDXWKRU RU $GGLVRQ:HVOH\ /RQJPDQ PDNH QR
UHSUHVHQWDWLRQVDERXWWKHVXLWDELOLW\RIWKLVVRIWZDUHIRUDQ\SXUSRVH,WLVSURYLGHGDVLVZLWKRXWH[SUHVVRU
LPSOLHGZDUUDQW\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
8SGDWHG,QIRUPDWLRQ$GGLWLRQDO7KLUG3DUW\&RGH,QIRUPDWLRQDYDLODEOHDWKWWSZZZDGREHFRPJRWKLUGSDUW\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
- 10 -
+WWS&OLHQW$OSKD5HOHDVH
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ
KWWSZZZDSDFKHRUJ DQGLVVXEMHFWWRWKHIROORZLQJWHUPVDQGFRQGLWLRQV
&RS\ULJKW F 7KH$SDFKH6RIWZDUH)RXQGDWLRQ$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQ
DUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLV
OLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKWQRWLFHWKLV
OLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHU
PDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHHQGXVHUGRFXPHQWDWLRQLQFOXGHGZLWKWKHUHGLVWULEXWLRQLIDQ\PXVW
LQFOXGHWKHIROORZLQJDFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ
KWWSZZZDSDFKHRUJ $OWHUQDWHO\WKLVDFNQRZOHGJHPHQWPD\DSSHDULQWKHVRIWZDUHLWVHOILIDQG
ZKHUHYHUVXFKWKLUGSDUW\DFNQRZOHGJHPHQWVQRUPDOO\DSSHDU
7KHQDPHV7KH-DNDUWD3URMHFW&RPPRQV;HUFHV&ULPVRQ9HORFLW\
DQG$SDFKH6RIWZDUH)RXQGDWLRQPXVWQRWEHXVHGWRHQGRUVHRUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWSULRUZULWWHQSHUPLVVLRQ)RUZULWWHQ
SHUPLVVLRQSOHDVHFRQWDFWDSDFKH#DSDFKHRUJ
3URGXFWVGHULYHGIURPWKLVVRIWZDUHPD\QRWEHFDOOHG-DNDUWD&RPPRQV
;HUFHV&ULPVRQ9HORFLW\RU$SDFKHQRUPD\-DNDUWD&RPPRQV
;HUFHV&ULPVRQ9HORFLW\RU$SDFKHDSSHDULQWKHLUQDPHVZLWKRXWSULRU
ZULWWHQSHUPLVVLRQRIWKH$SDFKH*URXS
- 11 -
12:$55$17< 7+,662)7:$5(,63529,'('$6,6$1'$1<(;35(66('25
,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25
$3$57,&8/$5385326($5(',6&/$,0(',112(9(176+$//
7+($3$&+(62)7:$5()281'$7,2125,76&2175,%87256
%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87
127/,0,7('72352&85(0(172)68%67,787(*22'625
6(59,&(6/2662)86('$7$25352),7625%86,1(66
,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)
/,$%,/,7<:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257
,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<
2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)7+(
3266,%,/,7<2)68&+'$0$*(
7KLVVRIWZDUHFRQVLVWVRIYROXQWDU\FRQWULEXWLRQVPDGHE\PDQ\LQGLYLGXDOVRQ
EHKDOIRIWKH$SDFKH6RIWZDUH)RXQGDWLRQ)RUPRUHLQIRUPDWLRQRQWKH$SDFKH
6RIWZDUH)RXQGDWLRQSOHDVHVHHKWWSZZZDSDFKHRUJ!
- 12 -
&U\SWR$3,
&23<5,*+7,1)250$7,21
&RS\ULJKW F 7KH/HJLRQ2I7KH%RXQF\&DVWOH KWWSZZZERXQF\FDVWOHRUJ 3HUPLVVLRQLVKHUHE\JUDQWHGIUHHRIFKDUJHWRDQ\SHUVRQREWDLQLQJDFRS\RIWKLVVRIWZDUHDQGDVVRFLDWHG
GRFXPHQWDWLRQILOHV WKH6RIWZDUH WRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKH
ULJKWVWRXVHFRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHVXEOLFHQVHDQGRUVHOOFRSLHVRIWKH6RIWZDUHDQGWR
SHUPLWSHUVRQVWRZKRPWKH6RIWZDUHLVIXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
7KHDERYHFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHVKDOOEHLQFOXGHGLQDOOFRSLHVRUVXEVWDQWLDOSRUWLRQVRI
WKH6RIWZDUH
7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<2)$1<.,1'(;35(6625,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66 )25 $
3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 ,1 12 (9(17 6+$// 7+( $87+256 25
&23<5,*+7+2/'(56%(/,$%/()25$1<&/$,0'$0$*(62527+(5/,$%,/,7<:+(7+(5,1$1
$&7,212)&2175$&772572527+(5:,6($5,6,1*)5202872)25,1&211(&7,21:,7+
7+(62)7:$5(257+(86(2527+(5'($/,1*6,17+(62)7:$5(
- 13 -
H[SDW
&RS\ULJKW F 7KDL2SHQ6RXUFH6RIWZDUH&HQWHU/WG
DQG&ODUN&RRSHU
&RS\ULJKW F ([SDWPDLQWDLQHUV
3HUPLVVLRQLVKHUHE\JUDQWHGIUHHRIFKDUJHWRDQ\SHUVRQREWDLQLQJDFRS\RIWKLVVRIWZDUHDQGDVVRFLDWHG
GRFXPHQWDWLRQILOHV WKH6RIWZDUH WRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKH
ULJKWVWRXVHFRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHVXEOLFHQVHDQGRUVHOOFRSLHVRIWKH6RIWZDUHDQGWR
SHUPLWSHUVRQVWRZKRPWKH6RIWZDUHLVIXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
7KHDERYHFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHVKDOOEHLQFOXGHGLQDOOFRSLHVRUVXEVWDQWLDOSRUWLRQVRI
WKH6RIWZDUH
7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<2)$1<.,1'(;35(6625,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66 )25 $
3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 ,1 12 (9(17 6+$// 7+( $87+256 25
&23<5,*+7+2/'(56%(/,$%/()25$1<&/$,0'$0$*(62527+(5/,$%,/,7<:+(7+(5,1$1
$&7,212)&2175$&772572527+(5:,6($5,6,1*)5202872)25,1&211(&7,21:,7+
7+(62)7:$5(257+(86(2527+(5'($/,1*6,17+(62)7:$5(
- 14 -
-0(
6RIWZDUHLVDಯFRPPHUFLDOLWHPರDVWKDWWHUPLVGHILQHGLQ&)5 2FW FRQVLVWLQJRIಯFRPPHUFLDO
FRPSXWHUVRIWZDUHರDQGಯFRPPHUFLDOFRPSXWHUVRIWZDUHGRFXPHQWDWLRQರDVVXFKWHUPVDUHXVHGLQ&)5
6HSW &RQVLVWHQW ZLWK &)5 DQG &)5 WKURXJK -XQH DOO 86
*RYHUQPHQW(QG8VHUVDFTXLUH6RIWZDUHZLWKRQO\WKRVHULJKWVVHWIRUWKKHUHLQ
- 15 -
OLEMLQJOH
&RS\ULJKW*RRJOH,QF
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU 5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHQDPHRIWKHDXWKRUPD\QRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXW
VSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,6 62)7:$5( ,6 3529,'(' %< 7+( $87+25 CC$6 ,6 $1' $1< (;35(66 25 ,03/,('
:$55$17,(6,1&/8',1*%87127/,0,7('727+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<
$1'),71(66)25$3$57,&8/$5385326($5(',6&/$,0(',112(9(176+$//7+($87+25%(
/,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/ 63(&,$/ (;(03/$5< 25 &216(48(17,$/
'$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72 352&85(0(17 2) 68%67,787( *22'6 25
6(59,&(6/2662) 86( '$7$25 352),76 25 %86,1(66 ,17(55837,21 +2:(9(5 &$86('
$1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1 &2175$&7 675,&7 /,$%,/,7< 25 7257
,1&/8',1* 1(*/,*(1&( 25 27+(5:,6( $5,6,1* ,1 $1< :$< 287 2) 7+( 86( 2) 7+,6
62)7:$5((9(1,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
- 16 -
0'
56$'DWD6HFXULW\,QF0'0HVVDJH'LJHVW$OJRULWKP
- 17 -
1(76103
9DULRXVFRS\ULJKWVDSSO\WRWKLVSDFNDJHOLVWHGLQYDULRXVVHSDUDWHSDUWV
EHORZ 3OHDVHPDNHVXUHWKDW\RXUHDGDOOWKHSDUWV 8SXQWLO
WKHSURMHFWZDVEDVHGDW8&'DYLVDQGWKHILUVWSDUWFRYHUVDOOFRGH
ZULWWHQGXULQJWKLVWLPH )URPRQZDUGVWKHSURMHFWKDVEHHQ
EDVHGDW6RXUFH)RUJHDQG1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QFKROGWKH
FRS\ULJKWRQEHKDOIRIWKHZLGHU1HW6103FRPPXQLW\FRYHULQJDOO
GHULYDWLYHZRUNGRQHVLQFHWKHQ $QDGGLWLRQDOFRS\ULJKWVHFWLRQKDV
EHHQDGGHGDV3DUWEHORZDOVRXQGHUD%6'OLFHQVHIRUWKHZRUN
FRQWULEXWHGE\&DPEULGJH%URDGEDQG/WGWRWKHSURMHFWVLQFH
$QDGGLWLRQDOFRS\ULJKWVHFWLRQKDVEHHQDGGHGDV3DUWEHORZDOVR
XQGHUD%6'OLFHQVHIRUWKHZRUNFRQWULEXWHGE\6XQ0LFURV\VWHPV,QF
WRWKHSURMHFWVLQFH
&RGHKDVEHHQFRQWULEXWHGWRWKLVSURMHFWE\PDQ\SHRSOHRYHU
WKH\HDUVLWKDVEHHQLQGHYHORSPHQWDQGDIXOOOLVWRIFRQWULEXWRUV
FDQEHIRXQGLQWKH5($'0(ILOHXQGHUWKH7+$1.6VHFWLRQ
3DUW&088&'FRS\ULJKWQRWLFH %6'OLNH &RS\ULJKWE\&DUQHJLH0HOORQ8QLYHUVLW\
'HULYDWLYH:RUN
&RS\ULJKW7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD
$OO5LJKWV5HVHUYHG
3HUPLVVLRQWRXVHFRS\PRGLI\DQGGLVWULEXWHWKLVVRIWZDUHDQGLWV
GRFXPHQWDWLRQIRUDQ\SXUSRVHDQGZLWKRXWIHHLVKHUHE\JUDQWHG
SURYLGHGWKDWWKHDERYHFRS\ULJKWQRWLFHDSSHDUVLQDOOFRSLHVDQG
WKDWERWKWKDWFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHDSSHDULQ
VXSSRUWLQJGRFXPHQWDWLRQDQGWKDWWKHQDPHRI&08DQG7KH5HJHQWVRI
WKH8QLYHUVLW\RI&DOLIRUQLDQRWEHXVHGLQDGYHUWLVLQJRUSXEOLFLW\
SHUWDLQLQJWRGLVWULEXWLRQRIWKHVRIWZDUHZLWKRXWVSHFLILFZULWWHQ
SHUPLVVLRQ
- 18 -
&08$1'7+(5(*(1762)7+(81,9(56,7<2)&$/,)251,$',6&/$,0$//
:$55$17,(6:,7+5(*$5'727+,662)7:$5(,1&/8',1*$//,03/,('
:$55$17,(62)0(5&+$17$%,/,7<$1'),71(66 ,112(9(176+$//&0825
7+(5(*(1762)7+(81,9(56,7<2)&$/,)251,$%(/,$%/()25$1<63(&,$/
,1',5(&725&216(48(17,$/'$0$*(625$1<'$0$*(6:+$762(9(55(68/7,1*
)5207+(/2662)86('$7$25352),76:+(7+(5,1$1$&7,212)
&2175$&71(*/,*(1&(2527+(57257,286$&7,21$5,6,1*2872)25,1
&211(&7,21:,7+7+(86(253(5)250$1&(2)7+,662)7:$5(
3DUW1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QFFRS\ULJKWQRWLFH %6' &RS\ULJKW F 1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QF
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRIWKH1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QFQRUWKH
QDPHVRILWVFRQWULEXWRUVPD\EHXVHGWRHQGRUVHRUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQ
SHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
- 19 -
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW&DPEULGJH%URDGEDQG/WGFRS\ULJKWQRWLFH %6' 3RUWLRQVRIWKLVFRGHDUHFRS\ULJKW F &DPEULGJH%URDGEDQG/WG
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHQDPHRI&DPEULGJH%URDGEDQG/WGPD\QRWEHXVHGWRHQGRUVHRU
SURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRU
ZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(5CC$6,6 $1'$1<
(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5%(
/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25
&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)
68%67,787(*22'6256(59,&(6/2662)86('$7$25352),7625
%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(
2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1
,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW6XQ0LFURV\VWHPV,QFFRS\ULJKWQRWLFH %6' - 20 -
&RS\ULJKWk6XQ0LFURV\VWHPV,QF1HWZRUN&LUFOH6DQWD&ODUD &DOLIRUQLD86$$OOULJKWVUHVHUYHG
8VHLVVXEMHFWWROLFHQVHWHUPVEHORZ
7KLVGLVWULEXWLRQPD\LQFOXGHPDWHULDOVGHYHORSHGE\WKLUGSDUWLHV
6XQ6XQ0LFURV\VWHPVWKH6XQORJRDQG6RODULVDUHWUDGHPDUNVRUUHJLVWHUHG WUDGHPDUNVRI6XQ0LFURV\VWHPV,QFLQWKH86DQGRWKHUFRXQWULHV
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRIWKH6XQ0LFURV\VWHPV,QFQRUWKH
QDPHVRILWVFRQWULEXWRUVPD\EHXVHGWRHQGRUVHRUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQ
SHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
- 21 -
3DUW6SDUWD,QFFRS\ULJKWQRWLFH %6' &RS\ULJKW F 6SDUWD,QF
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRI6SDUWD,QFQRUWKHQDPHVRILWVFRQWULEXWRUVPD\
EHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUH
ZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW&LVFR%8371,&FRS\ULJKWQRWLFH %6' &RS\ULJKW F &LVFR,QFDQG,QIRUPDWLRQ1HWZRUN
&HQWHURI%HLMLQJ8QLYHUVLW\RI3RVWVDQG7HOHFRPPXQLFDWLRQV
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
- 22 -
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRI&LVFR,QF%HLMLQJ8QLYHUVLW\RI3RVWVDQG
7HOHFRPPXQLFDWLRQVQRUWKHQDPHVRIWKHLUFRQWULEXWRUVPD\
EHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUH
ZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW)DEDVRIW5 '6RIWZDUH*PE+ &R.*FRS\ULJKWQRWLFH %6' &RS\ULJKW F )DEDVRIW5 '6RIWZDUH*PE+ &R.*
RVV#IDEDVRIWFRP
$XWKRU%HUQKDUG3HQ]EHUQKDUGSHQ]#IDEDVRIWFRP!
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
- 23 -
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHQDPHRI)DEDVRIW5 '6RIWZDUH*PE+ &R.*RUDQ\RILWVVXEVLGLDULHV EUDQGRUSURGXFWQDPHVPD\QRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWV GHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(5CC$6,6 $1'$1<
(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5%(
/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25
&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)
68%67,787(*22'6256(59,&(6/2662)86('$7$25352),7625
%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(
2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1
,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
- 24 -
2SHQ66/
2SHQ66//LFHQVH
&RS\ULJKW F 7KH2SHQ66/3URMHFW $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQV
DUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU 5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQ
WKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKH
GLVWULEXWLRQ
$OODGYHUWLVLQJPDWHULDOVPHQWLRQLQJIHDWXUHVRUXVHRIWKLV
VRIWZDUHPXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/3URMHFW
IRUXVHLQWKH2SHQ66/7RRONLW KWWSZZZRSHQVVORUJ 7KHQDPHV2SHQ66/7RRONLWDQG2SHQ66/3URMHFWPXVWQRWEHXVHGWR
HQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXW
SULRUZULWWHQSHUPLVVLRQ)RUZULWWHQSHUPLVVLRQSOHDVHFRQWDFW
RSHQVVOFRUH#RSHQVVORUJ
3URGXFWVGHULYHGIURPWKLVVRIWZDUHPD\QRWEHFDOOHG2SHQ66/
QRUPD\2SHQ66/DSSHDULQWKHLUQDPHVZLWKRXWSULRUZULWWHQ
SHUPLVVLRQRIWKH2SHQ66/3URMHFW
5HGLVWULEXWLRQVRIDQ\IRUPZKDWVRHYHUPXVWUHWDLQWKHIROORZLQJ
DFNQRZOHGJPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/3URMHFW
IRUXVHLQWKH2SHQ66/7RRONLW KWWSZZZRSHQVVORUJ - 25 -
7+,662)7:$5(,63529,'('%<7+(2SHQ66/352-(&7CC$6,6 $1'$1<
(;35(66('25,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(2SHQ66/352-(&725
,76&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/
63(&,$/(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87
127/,0,7('72352&85(0(172)68%67,787(*22'6256(59,&(6
/2662)86('$7$25352),7625%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1&2175$&7
675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('
2)7+(3266,%,/,7<2)68&+'$0$*(
7KLVSURGXFWLQFOXGHVFU\SWRJUDSKLFVRIWZDUHZULWWHQE\(ULF<RXQJ
HD\#FU\SWVRIWFRP 7KLVSURGXFWLQFOXGHVVRIWZDUHZULWWHQE\7LP
+XGVRQ WMK#FU\SWVRIWFRP 2ULJLQDO66/HD\/LFHQVH
&RS\ULJKW & (ULF<RXQJ HD\#FU\SWVRIWFRP $OOULJKWVUHVHUYHG
7KLVSDFNDJHLVDQ66/LPSOHPHQWDWLRQZULWWHQ
E\(ULF<RXQJ HD\#FU\SWVRIWFRP 7KHLPSOHPHQWDWLRQZDVZULWWHQVRDVWRFRQIRUPZLWK1HWVFDSHV66/
7KLVOLEUDU\LVIUHHIRUFRPPHUFLDODQGQRQFRPPHUFLDOXVHDVORQJDV
WKHIROORZLQJFRQGLWLRQVDUHDKHDUHGWR 7KHIROORZLQJFRQGLWLRQV
DSSO\WRDOOFRGHIRXQGLQWKLVGLVWULEXWLRQEHLWWKH5&56$
OKDVK'(6HWFFRGHQRWMXVWWKH66/FRGH 7KH66/GRFXPHQWDWLRQ
LQFOXGHGZLWKWKLVGLVWULEXWLRQLVFRYHUHGE\WKHVDPHFRS\ULJKWWHUPV
H[FHSWWKDWWKHKROGHULV7LP+XGVRQ WMK#FU\SWVRIWFRP - 26 -
&RS\ULJKWUHPDLQV(ULF<RXQJ VDQGDVVXFKDQ\&RS\ULJKWQRWLFHVLQ
WKHFRGHDUHQRWWREHUHPRYHG
,IWKLVSDFNDJHLVXVHGLQDSURGXFW(ULF<RXQJVKRXOGEHJLYHQDWWULEXWLRQ
DVWKHDXWKRURIWKHSDUWVRIWKHOLEUDU\XVHG
7KLVFDQEHLQWKHIRUPRIDWH[WXDOPHVVDJHDWSURJUDPVWDUWXSRU
LQGRFXPHQWDWLRQ RQOLQHRUWH[WXDO SURYLGHGZLWKWKHSDFNDJH
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQV
DUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OODGYHUWLVLQJPDWHULDOVPHQWLRQLQJIHDWXUHVRUXVHRIWKLVVRIWZDUH
PXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVFU\SWRJUDSKLFVRIWZDUHZULWWHQE\
(ULF<RXQJ HD\#FU\SWVRIWFRP 7KHZRUG FU\SWRJUDSKLF FDQEHOHIWRXWLIWKHURXLQHVIURPWKHOLEUDU\
EHLQJXVHGDUHQRWFU\SWRJUDSKLFUHODWHG ,I\RXLQFOXGHDQ\:LQGRZVVSHFLILFFRGH RUDGHULYDWLYHWKHUHRI IURP WKHDSSVGLUHFWRU\ DSSOLFDWLRQFRGH \RXPXVWLQFOXGHDQDFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHZULWWHQE\7LP+XGVRQ WMK#FU\SWVRIWFRP 7+,662)7:$5(,63529,'('%<(5,&<281*CC$6,6 $1'
$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5385326(
$5(',6&/$,0(' ,112(9(176+$//7+($87+2525&2175,%87256%(/,$%/(
)25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25&216(48(17,$/
'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)68%67,787(*22'6
256(59,&(6/2662)86('$7$25352),7625%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1&2175$&7675,&7
/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<
2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)7+(3266,%,/,7<2)
68&+'$0$*(
7KHOLFHQFHDQGGLVWULEXWLRQWHUPVIRUDQ\SXEOLFDOO\DYDLODEOHYHUVLRQRU
- 27 -
GHULYDWLYHRIWKLVFRGHFDQQRWEHFKDQJHG LHWKLVFRGHFDQQRWVLPSO\EH
FRSLHGDQGSXWXQGHUDQRWKHUGLVWULEXWLRQOLFHQFH
>LQFOXGLQJWKH*183XEOLF/LFHQFH@
- 28 -
VHUYOHWMDU
-DYD3ODWIRUP,QWHUIDFH /LFHQVHHPD\QRW
PRGLI\WKH-DYD3ODWIRUP
,QWHUIDFH -3,LGHQWLILHGDVFODVVHV
FRQWDLQHGZLWKLQWKHMDYD[SDFNDJHRUDQ\
VXESDFNDJHVRIWKHMDYD[SDFNDJH E\
FUHDWLQJDGGLWLRQDOFODVVHVZLWKLQWKH-3,RU
RWKHUZLVHFDXVLQJWKHDGGLWLRQWRRU
PRGLILFDWLRQRIWKHFODVVHVLQWKH-3, ,Q
WKHHYHQWWKDW/LFHQVHHFUHDWHVDQ\
-DYDUHODWHG$3,DQGGLVWULEXWHVXFK$3,WR
RWKHUVIRUDSSOHWRUDSSOLFDWLRQGHYHORSPHQW
\RXPXVWSURPSWO\SXEOLVKEURDGO\DQ
DFFXUDWHVSHFLILFDWLRQIRUVXFK$3,IRUIUHH
XVHE\DOOGHYHORSHUVRI-DYDEDVHG
VRIWZDUH
5HVWULFWLRQV 6RIWZDUHLVFRQILGHQWLDO
FRS\ULJKWHGLQIRUPDWLRQRI6XQDQG
WLWOHWRDOOFRSLHVLVUHWDLQHGE\6XQ
DQGRULWVOLFHQVRUV /LFHQVHHVKDOOQRW
PRGLI\GHFRPSLOHGLVDVVHPEOHGHFU\SW
H[WUDFWRURWKHUZLVHUHYHUVHHQJLQHHU
6RIWZDUH 6RIWZDUHPD\QRWEHOHDVHG
DVVLJQHGRUVXEOLFHQVHGLQZKROHRULQ
SDUW 6RIWZDUHLVQRWGHVLJQHGRULQWHQGHG
IRUXVHLQRQOLQHFRQWURORIDLUFUDIWDLU
WUDIILFDLUFUDIWQDYLJDWLRQRUDLUFUDIW
FRPPXQLFDWLRQVRULQWKHGHVLJQ
FRQVWUXFWLRQRSHUDWLRQRUPDLQWHQDQFHRI
DQ\QXFOHDUIDFLOLW\ /LFHQVHHZDUUDQWV
WKDWLWZLOOQRWXVHRUUHGLVWULEXWHWKH
6RIWZDUHIRUVXFKSXUSRVHV
'LVFODLPHURI:DUUDQW\ 6RIWZDUHLV
- 29 -
SURYLGHG$6,6ZLWKRXWDZDUUDQW\
RIDQ\NLQG $//(;35(6625,03/,('
5(35(6(17$7,216$1':$55$17,(6,1&/8',1*
$1<,03/,(':$55$17<2)0(5&+$17$%,/,7<
),71(66)25$3$57,&8/$5385326(25
121,1)5,1*(0(17$5(+(5(%<(;&/8'('
7HUPLQDWLRQ 7KLV/LFHQVHLVHIIHFWLYH
XQWLOWHUPLQDWHG /LFHQVHHPD\
WHUPLQDWHWKLV/LFHQVHDWDQ\WLPHE\
GHVWUR\LQJDOOFRSLHVRI6RIWZDUH 7KLV
/LFHQVHZLOOWHUPLQDWHLPPHGLDWHO\ZLWKRXW
QRWLFHIURP6XQLI/LFHQVHHIDLOVWRFRPSO\
ZLWKDQ\SURYLVLRQRIWKLV/LFHQVH 8SRQ
VXFKWHUPLQDWLRQ/LFHQVHHPXVWGHVWUR\DOO
FRSLHVRI6RIWZDUH
([SRUW5HJXODWLRQV 6RIWZDUHLQFOXGLQJ
WHFKQLFDOGDWDLVVXEMHFWWR86
H[SRUWFRQWUROODZVLQFOXGLQJWKH86
([SRUW$GPLQLVWUDWLRQ$FWDQGLWVDVVRFLDWHG
UHJXODWLRQVDQGPD\EHVXEMHFWWRH[SRUWRU
LPSRUWUHJXODWLRQVLQRWKHUFRXQWULHV
/LFHQVHHDJUHHVWRFRPSO\VWULFWO\ZLWKDOO
VXFKUHJXODWLRQVDQGDFNQRZOHGJHVWKDWLW
KDVWKHUHVSRQVLELOLW\WRREWDLQOLFHQVHVWR
H[SRUWUHH[SRUWRULPSRUW6RIWZDUH
6RIWZDUHPD\QRWEHGRZQORDGHGRURWKHUZLVH
H[SRUWHGRUUHH[SRUWHG L LQWRRUWRD
QDWLRQDORUUHVLGHQWRI&XED,UDT,UDQ
1RUWK.RUHD/LE\D6XGDQ6\ULDRUDQ\
FRXQWU\WRZKLFKWKH86KDVHPEDUJRHG
JRRGVRU LL WRDQ\RQHRQWKH86
7UHDVXU\'HSDUWPHQW VOLVWRI6SHFLDOO\
'HVLJQDWHG1DWLRQVRUWKH86 &RPPHUFH
- 30 -
'HSDUWPHQW V7DEOHRI'HQLDO2UGHUV
- 31 -
/LQX[
*18*(1(5$/38%/,&/,&(16(
9HUVLRQ-XQH &RS\ULJKW & )UHH6RIWZDUH)RXQGDWLRQ,QF )UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWHYHUEDWLPFRSLHV
RIWKLVOLFHQVHGRFXPHQWEXWFKDQJLQJLWLVQRWDOORZHG
3UHDPEOH
7KHOLFHQVHVIRUPRVWVRIWZDUHDUHGHVLJQHGWRWDNHDZD\\RXUIUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVW
WKH*18*HQHUDO3XEOLF/LFHQVHLVLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUHDQGFKDQJHIUHHVRIWZDUHWR
PDNHVXUHWKHVRIWZDUHLVIUHHIRUDOOLWVXVHUV7KLV*HQHUDO3XEOLF/LFHQVHDSSOLHVWRPRVWRIWKH)UHH
6RIWZDUH)RXQGDWLRQ VVRIWZDUHDQGWRDQ\RWKHUSURJUDPZKRVHDXWKRUVFRPPLWWRXVLQJLW 6RPHRWKHU)UHH
6RIWZDUH)RXQGDWLRQVRIWZDUHLVFRYHUHGE\WKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDG <RXFDQDSSO\
LWWR\RXUSURJUDPVWRR :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRPQRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUH
GHVLJQHGWRPDNHVXUHWKDW\RXKDYHWKHIUHHGRPWRGLVWULEXWHFRSLHVRIIUHHVRIWZDUH DQGFKDUJHIRUWKLV
VHUYLFHLI\RXZLVK WKDW\RXUHFHLYHVRXUFHFRGHRUFDQJHWLWLI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUH
RUXVHSLHFHVRILWLQQHZIUHHSURJUDPVDQGWKDW\RXNQRZ\RXFDQGRWKHVHWKLQJV 7RSURWHFW\RXUULJKWVZHQHHGWRPDNHUHVWULFWLRQVWKDWIRUELGDQ\RQHWRGHQ\\RXWKHVHULJKWVRUWRDVN\RX
WRVXUUHQGHUWKHULJKWV7KHVHUHVWULFWLRQVWUDQVODWHWRFHUWDLQUHVSRQVLELOLWLHVIRU\RXLI\RXGLVWULEXWHFRSLHVRI
WKHVRIWZDUHRULI\RXPRGLI\LW )RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIVXFKDSURJUDPZKHWKHUJUDWLVRUIRUDIHH\RXPXVWJLYHWKH
UHFLSLHQWVDOOWKHULJKWVWKDW\RXKDYH<RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKHVRXUFHFRGH
$QG\RXPXVWVKRZWKHPWKHVHWHUPVVRWKH\NQRZWKHLUULJKWV :HSURWHFW\RXUULJKWVZLWKWZRVWHSV FRS\ULJKWWKHVRIWZDUHDQG RIIHU\RXWKLVOLFHQVHZKLFKJLYHV\RX
OHJDOSHUPLVVLRQWRFRS\GLVWULEXWHDQGRUPRGLI\WKHVRIWZDUH $OVRIRUHDFKDXWKRU VSURWHFWLRQDQGRXUVZHZDQWWRPDNHFHUWDLQWKDWHYHU\RQHXQGHUVWDQGVWKDWWKHUHLV
QRZDUUDQW\IRUWKLVIUHHVRIWZDUH,IWKHVRIWZDUHLVPRGLILHGE\VRPHRQHHOVHDQGSDVVHGRQZHZDQWLWV
UHFLSLHQWVWRNQRZWKDWZKDWWKH\KDYHLVQRWWKHRULJLQDOVRWKDWDQ\SUREOHPVLQWURGXFHGE\RWKHUVZLOOQRW
UHIOHFWRQWKHRULJLQDODXWKRUV UHSXWDWLRQV - 32 -
)LQDOO\DQ\IUHHSURJUDPLVWKUHDWHQHGFRQVWDQWO\E\VRIWZDUHSDWHQWV:HZLVKWRDYRLGWKHGDQJHUWKDW
UHGLVWULEXWRUVRIDIUHHSURJUDPZLOOLQGLYLGXDOO\REWDLQSDWHQWOLFHQVHVLQHIIHFWPDNLQJWKHSURJUDP
SURSULHWDU\7RSUHYHQWWKLVZHKDYHPDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH VIUHHXVHRU
QRWOLFHQVHGDWDOO 7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQIROORZ 7(506$1'&21',7,216)25&23<,1*',675,%87,21$1'02',),&$7,21
7KLV/LFHQVHDSSOLHVWRDQ\SURJUDPRURWKHUZRUNZKLFKFRQWDLQVDQRWLFHSODFHGE\WKHFRS\ULJKWKROGHU
VD\LQJLWPD\EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV*HQHUDO3XEOLF/LFHQVH7KH3URJUDPEHORZUHIHUVWR
DQ\VXFKSURJUDPRUZRUNDQGDZRUNEDVHGRQWKH3URJUDPPHDQVHLWKHUWKH3URJUDPRUDQ\GHULYDWLYH
ZRUNXQGHUFRS\ULJKWODZWKDWLVWRVD\DZRUNFRQWDLQLQJWKH3URJUDPRUDSRUWLRQRILWHLWKHUYHUEDWLPRU
ZLWKPRGLILFDWLRQVDQGRUWUDQVODWHGLQWRDQRWKHUODQJXDJH +HUHLQDIWHUWUDQVODWLRQLVLQFOXGHGZLWKRXW
OLPLWDWLRQLQWKHWHUPPRGLILFDWLRQ (DFKOLFHQVHHLVDGGUHVVHGDV\RX $FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWV
VFRSH7KHDFWRIUXQQLQJWKH3URJUDPLVQRWUHVWULFWHGDQGWKHRXWSXWIURPWKH3URJUDPLVFRYHUHGRQO\LILWV
FRQWHQWVFRQVWLWXWHDZRUNEDVHGRQWKH3URJUDP LQGHSHQGHQWRIKDYLQJEHHQPDGHE\UXQQLQJWKH
3URJUDP :KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH3URJUDPGRHV <RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH3URJUDP VVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\
PHGLXPSURYLGHGWKDW\RXFRQVSLFXRXVO\DQGDSSURSULDWHO\SXEOLVKRQHDFKFRS\DQDSSURSULDWHFRS\ULJKW
QRWLFHDQGGLVFODLPHURIZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRI
DQ\ZDUUDQW\DQGJLYHDQ\RWKHUUHFLSLHQWVRIWKH3URJUDPDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP <RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\DQG\RXPD\DW\RXURSWLRQRIIHUZDUUDQW\
SURWHFWLRQLQH[FKDQJHIRUDIHH <RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH3URJUDPRUDQ\SRUWLRQRILWWKXVIRUPLQJDZRUNEDVHGRQWKH
3URJUDPDQGFRS\DQGGLVWULEXWHVXFKPRGLILFDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQDERYHSURYLGHG
WKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV D <RXPXVWFDXVHWKHPRGLILHGILOHVWRFDUU\SURPLQHQWQRWLFHVVWDWLQJWKDW\RXFKDQJHGWKHILOHVDQG
WKHGDWHRIDQ\FKDQJH E <RXPXVWFDXVHDQ\ZRUNWKDW\RXGLVWULEXWHRUSXEOLVKWKDWLQZKROHRULQSDUWFRQWDLQVRULVGHULYHG
IURPWKH3URJUDPRUDQ\SDUWWKHUHRIWREHOLFHQVHGDVDZKROHDWQRFKDUJHWRDOOWKLUGSDUWLHVXQGHU
WKHWHUPVRIWKLV/LFHQVH - 33 -
F ,IWKHPRGLILHGSURJUDPQRUPDOO\UHDGVFRPPDQGVLQWHUDFWLYHO\ZKHQUXQ\RXPXVWFDXVHLWZKHQ
VWDUWHGUXQQLQJIRUVXFKLQWHUDFWLYHXVHLQWKHPRVWRUGLQDU\ZD\WRSULQWRUGLVSOD\DQDQQRXQFHPHQW
LQFOXGLQJDQDSSURSULDWHFRS\ULJKWQRWLFHDQGDQRWLFHWKDWWKHUHLVQRZDUUDQW\ RUHOVHVD\LQJWKDW\RX
SURYLGHDZDUUDQW\ DQGWKDWXVHUVPD\UHGLVWULEXWHWKHSURJUDPXQGHUWKHVHFRQGLWLRQVDQGWHOOLQJWKH
XVHU KRZWR YLHZ D FRS\ RIWKLV /LFHQVH ([FHSWLRQ LIWKH3URJUDP LWVHOI LV LQWHUDFWLYHEXWGRHVQRW
QRUPDOO\ SULQW VXFK DQ DQQRXQFHPHQW \RXU ZRUN EDVHG RQ WKH 3URJUDP LV QRW UHTXLUHG WR SULQW DQ
DQQRXQFHPHQW 7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGLILHGZRUNDVDZKROH,ILGHQWLILDEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHG
IURPWKH3URJUDPDQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQGVHSDUDWHZRUNVLQWKHPVHOYHVWKHQ
WKLV/LFHQVHDQGLWVWHUPVGRQRWDSSO\WRWKRVHVHFWLRQVZKHQ\RXGLVWULEXWHWKHPDVVHSDUDWHZRUNV%XW
ZKHQ\RXGLVWULEXWHWKHVDPHVHFWLRQVDVSDUWRIDZKROHZKLFKLVDZRUNEDVHGRQWKH3URJUDPWKH
GLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQG
WRWKHHQWLUHZKROHDQGWKXVWRHDFKDQGHYHU\SDUWUHJDUGOHVVRIZKRZURWHLW 7KXVLWLVQRWWKHLQWHQWRIWKLVVHFWLRQWRFODLPULJKWVRUFRQWHVW\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RX
UDWKHUWKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRUFROOHFWLYHZRUNVEDVHGRQWKH
3URJUDP ,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRWEDVHGRQWKH3URJUDPZLWKWKH3URJUDP RUZLWKDZRUN
EDVHGRQWKH3URJUDP RQDYROXPHRIDVWRUDJHRUGLVWULEXWLRQPHGLXPGRHVQRWEULQJWKHRWKHUZRUNXQGHU
WKHVFRSHRIWKLV/LFHQVH <RXPD\FRS\DQGGLVWULEXWHWKH3URJUDP RUDZRUNEDVHGRQLWXQGHU6HFWLRQ LQREMHFWFRGHRU
H[HFXWDEOHIRUPXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHSURYLGHGWKDW\RXDOVRGRRQHRIWKHIROORZLQJ D $FFRPSDQ\ LW ZLWK WKH FRPSOHWH FRUUHVSRQGLQJ PDFKLQHUHDGDEOH VRXUFH FRGH ZKLFK PXVW EH
GLVWULEXWHG XQGHU WKH WHUPV RI 6HFWLRQV DQG DERYH RQ D PHGLXP FXVWRPDULO\ XVHG IRU VRIWZDUH
LQWHUFKDQJHRU E $FFRPSDQ\LWZLWKDZULWWHQRIIHUYDOLGIRUDWOHDVWWKUHH\HDUVWRJLYHDQ\WKLUGSDUW\IRUDFKDUJH
QRPRUHWKDQ\RXUFRVWRISK\VLFDOO\SHUIRUPLQJVRXUFHGLVWULEXWLRQDFRPSOHWHPDFKLQHUHDGDEOHFRS\
RIWKHFRUUHVSRQGLQJVRXUFHFRGHWREHGLVWULEXWHGXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHRQD
PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJHRU F $FFRPSDQ\ LW ZLWKWKH LQIRUPDWLRQ \RX UHFHLYHGDV WRWKHRIIHU WRGLVWULEXWH FRUUHVSRQGLQJ VRXUFH
FRGH 7KLV DOWHUQDWLYH LV DOORZHG RQO\ IRU QRQFRPPHUFLDO GLVWULEXWLRQ DQG RQO\ LI \RX UHFHLYHG WKH
SURJUDPLQREMHFWFRGHRUH[HFXWDEOHIRUPZLWKVXFKDQRIIHULQDFFRUGZLWK6XEVHFWLRQEDERYH - 34 -
7KHVRXUFHFRGHIRUDZRUNPHDQVWKHSUHIHUUHGIRUPRIWKHZRUNIRUPDNLQJPRGLILFDWLRQVWRLW)RUDQ
H[HFXWDEOHZRUNFRPSOHWHVRXUFHFRGHPHDQVDOOWKHVRXUFHFRGHIRUDOOPRGXOHVLWFRQWDLQVSOXVDQ\
DVVRFLDWHGLQWHUIDFHGHILQLWLRQILOHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQDQGLQVWDOODWLRQRIWKH
H[HFXWDEOH+RZHYHUDVDVSHFLDOH[FHSWLRQWKHVRXUFHFRGHGLVWULEXWHGQHHGQRWLQFOXGHDQ\WKLQJWKDWLV
QRUPDOO\GLVWULEXWHG LQHLWKHUVRXUFHRUELQDU\IRUP ZLWKWKHPDMRUFRPSRQHQWV FRPSLOHUNHUQHODQGVRRQ RIWKHRSHUDWLQJV\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQWLWVHOIDFFRPSDQLHVWKH
H[HFXWDEOH ,IGLVWULEXWLRQRIH[HFXWDEOHRUREMHFWFRGHLVPDGHE\RIIHULQJDFFHVVWRFRS\IURPDGHVLJQDWHGSODFHWKHQ
RIIHULQJHTXLYDOHQWDFFHVVWRFRS\WKHVRXUFHFRGHIURPWKHVDPHSODFHFRXQWVDVGLVWULEXWLRQRIWKHVRXUFH
FRGHHYHQWKRXJKWKLUGSDUWLHVDUHQRWFRPSHOOHGWRFRS\WKHVRXUFHDORQJZLWKWKHREMHFWFRGH <RXPD\QRWFRS\PRGLI\VXEOLFHQVHRUGLVWULEXWHWKH3URJUDPH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV
/LFHQVH$Q\DWWHPSWRWKHUZLVHWRFRS\PRGLI\VXEOLFHQVHRUGLVWULEXWHWKH3URJUDPLVYRLGDQGZLOO
DXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH+RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHVRUULJKWV
IURP\RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHVWHUPLQDWHGVRORQJDVVXFKSDUWLHVUHPDLQLQIXOO
FRPSOLDQFH <RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RX
SHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH3URJUDPRULWVGHULYDWLYHZRUNV7KHVHDFWLRQVDUHSURKLELWHGE\ODZLI
\RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRUGLVWULEXWLQJWKH3URJUDP RUDQ\ZRUNEDVHGRQWKH
3URJUDP \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQGDOOLWVWHUPVDQGFRQGLWLRQVIRUFRS\LQJ
GLVWULEXWLQJRUPRGLI\LQJWKH3URJUDPRUZRUNVEDVHGRQLW (DFKWLPH\RXUHGLVWULEXWHWKH3URJUDP RUDQ\ZRUNEDVHGRQWKH3URJUDP WKHUHFLSLHQWDXWRPDWLFDOO\
UHFHLYHVDOLFHQVHIURPWKHRULJLQDOOLFHQVRUWRFRS\GLVWULEXWHRUPRGLI\WKH3URJUDPVXEMHFWWRWKHVHWHUPV
DQGFRQGLWLRQV<RXPD\QRWLPSRVHDQ\IXUWKHUUHVWULFWLRQVRQWKHUHFLSLHQWV H[HUFLVHRIWKHULJKWVJUDQWHG
KHUHLQ<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVWRWKLV/LFHQVH ,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQRISDWHQWLQIULQJHPHQWRUIRUDQ\RWKHUUHDVRQ QRW
OLPLWHGWRSDWHQWLVVXHV FRQGLWLRQVDUHLPSRVHGRQ\RX ZKHWKHUE\FRXUWRUGHUDJUHHPHQWRURWKHUZLVH WKDW
FRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX
FDQQRWGLVWULEXWHVRDVWRVDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQGDQ\RWKHUSHUWLQHQW
REOLJDWLRQVWKHQDVDFRQVHTXHQFH\RXPD\QRWGLVWULEXWHWKH3URJUDPDWDOO)RUH[DPSOHLIDSDWHQWOLFHQVH
ZRXOGQRWSHUPLWUR\DOW\IUHHUHGLVWULEXWLRQRIWKH3URJUDPE\DOOWKRVHZKRUHFHLYHFRSLHVGLUHFWO\RULQGLUHFWO\
WKURXJK\RXWKHQWKHRQO\ZD\\RXFRXOGVDWLVI\ERWKLWDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP
GLVWULEXWLRQRIWKH3URJUDP - 35 -
,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOGLQYDOLGRUXQHQIRUFHDEOHXQGHUDQ\SDUWLFXODUFLUFXPVWDQFHWKHEDODQFHRI
WKHVHFWLRQLVLQWHQGHGWRDSSO\DQGWKHVHFWLRQDVDZKROHLVLQWHQGHGWRDSSO\LQRWKHUFLUFXPVWDQFHV ,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\SDWHQWVRURWKHUSURSHUW\ULJKWFODLPVRUWR
FRQWHVWYDOLGLW\RIDQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJWKHLQWHJULW\RIWKHIUHH
VRIWZDUHGLVWULEXWLRQV\VWHPZKLFKLVLPSOHPHQWHGE\SXEOLFOLFHQVHSUDFWLFHV0DQ\SHRSOHKDYHPDGH
JHQHURXVFRQWULEXWLRQVWRWKHZLGHUDQJHRIVRIWZDUHGLVWULEXWHGWKURXJKWKDWV\VWHPLQUHOLDQFHRQFRQVLVWHQW
DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWRGHFLGHLIKHRUVKHLVZLOOLQJWRGLVWULEXWHVRIWZDUH
WKURXJKDQ\RWKHUV\VWHPDQGDOLFHQVHHFDQQRWLPSRVHWKDWFKRLFH 7KLVVHFWLRQLVLQWHQGHGWRPDNHWKRURXJKO\FOHDUZKDWLVEHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV
/LFHQVH ,IWKHGLVWULEXWLRQDQGRUXVHRIWKH3URJUDPLVUHVWULFWHGLQFHUWDLQFRXQWULHVHLWKHUE\SDWHQWVRUE\
FRS\ULJKWHGLQWHUIDFHVWKHRULJLQDOFRS\ULJKWKROGHUZKRSODFHVWKH3URJUDPXQGHUWKLV/LFHQVHPD\DGGDQ
H[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQH[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\LQRU
DPRQJFRXQWULHVQRWWKXVH[FOXGHG,QVXFKFDVHWKLV/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKH
ERG\RIWKLV/LFHQVH 7KH)UHH6RIWZDUH)RXQGDWLRQPD\SXEOLVKUHYLVHGDQGRUQHZYHUVLRQVRIWKH*HQHUDO3XEOLF/LFHQVHIURP
WLPHWRWLPH6XFKQHZYHUVLRQVZLOOEHVLPLODULQVSLULWWRWKHSUHVHQWYHUVLRQEXWPD\GLIIHULQGHWDLOWR
DGGUHVVQHZSUREOHPVRUFRQFHUQV (DFKYHUVLRQLVJLYHQDGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH3URJUDPVSHFLILHVDYHUVLRQQXPEHURIWKLV
/LFHQVHZKLFKDSSOLHVWRLWDQGDQ\ODWHUYHUVLRQ\RXKDYHWKHRSWLRQRIIROORZLQJWKHWHUPVDQGFRQGLWLRQV
HLWKHURIWKDWYHUVLRQRURIDQ\ODWHUYHUVLRQSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH3URJUDPGRHV
QRWVSHFLI\DYHUVLRQQXPEHURIWKLV/LFHQVH\RXPD\FKRRVHDQ\YHUVLRQHYHUSXEOLVKHGE\WKH)UHH
6RIWZDUH)RXQGDWLRQ ,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH3URJUDPLQWRRWKHUIUHHSURJUDPVZKRVHGLVWULEXWLRQFRQGLWLRQVDUH
GLIIHUHQWZULWHWRWKHDXWKRUWRDVNIRUSHUPLVVLRQ)RUVRIWZDUHZKLFKLVFRS\ULJKWHGE\WKH)UHH6RIWZDUH
)RXQGDWLRQZULWHWRWKH)UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRUWKLV2XUGHFLVLRQZLOO
EHJXLGHGE\WKHWZRJRDOVRISUHVHUYLQJWKHIUHHVWDWXVRIDOOGHULYDWLYHVRIRXUIUHHVRIWZDUHDQGRISURPRWLQJ
WKHVKDULQJDQGUHXVHRIVRIWZDUHJHQHUDOO\ 12:$55$17<
- 36 -
%(&$86(7+(352*5$0,6/,&(16(')5((2)&+$5*(7+(5(,612:$55$17<)257+(
352*5$0727+((;7(173(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6(67$7('
,1:5,7,1*7+(&23<5,*+7+2/'(56$1'2527+(53$57,(63529,'(7+(352*5$0$6,6
:,7+287:$55$17<2)$1<.,1'(,7+(5(;35(66('25,03/,(',1&/8',1*%87127
/,0,7('727+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326(7+((17,5(5,6.$6727+(48$/,7<$1'3(5)250$1&(2)7+(352*5$0,6:,7+
<286+28/'7+(352*5$03529('()(&7,9(<28$6680(7+(&2672)$//1(&(66$5<
6(59,&,1*5(3$,525&255(&7,21 ,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25$*5(('72,1:5,7,1*:,//$1<
&23<5,*+7+2/'(525$1<27+(53$57<:+20$<02',)<$1'255(',675,%87(7+(
352*5$0$63(50,77('$%29(%(/,$%/(72<28)25'$0$*(6,1&/8',1*$1<*(1(5$/
63(&,$/,1&,'(17$/25&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25,1$%,/,7<72
86(7+(352*5$0 ,1&/8',1*%87127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5('
,1$&&85$7(25/266(66867$,1('%<<28257+,5'3$57,(625$)$,/85(2)7+(
352*5$07223(5$7(:,7+$1<27+(5352*5$06 (9(1,)68&++2/'(52527+(53$57<
+$6%((1$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(6 (1'2)7(506$1'&21',7,216
+RZWR$SSO\7KHVH7HUPVWR<RXU1HZ3URJUDPV
,I\RXGHYHORSDQHZSURJUDPDQG\RXZDQWLWWREHRIWKHJUHDWHVWSRVVLEOHXVHWRWKHSXEOLFWKHEHVWZD\WR
DFKLHYHWKLVLVWRPDNHLWIUHHVRIWZDUHZKLFKHYHU\RQHFDQUHGLVWULEXWHDQGFKDQJHXQGHUWKHVHWHUPV 7RGRVRDWWDFKWKHIROORZLQJQRWLFHVWRWKHSURJUDP,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFHILOH
WRPRVWHIIHFWLYHO\FRQYH\WKHH[FOXVLRQRIZDUUDQW\DQGHDFKILOHVKRXOGKDYHDWOHDVWWKHFRS\ULJKWOLQHDQG
DSRLQWHUWRZKHUHWKHIXOOQRWLFHLVIRXQG RQHOLQHWRJLYHWKHSURJUDP VQDPHDQGDQLGHDRIZKDWLWGRHV
&RS\ULJKW & \\\\ QDPHRIDXWKRU
7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18*HQHUDO3XEOLF/LFHQVH
DVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQ
RIWKH/LFHQVHRU DW\RXURSWLRQ DQ\ODWHUYHUVLRQ
7KLVSURJUDPLVGLVWULEXWHGLQWKHKRSHWKDWLWZLOOEHXVHIXO
EXW:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\RI
0(5&+$17$%,/,7<RU),71(66)25$3$57,&8/$5385326( 6HHWKH
- 37 -
*18*HQHUDO3XEOLF/LFHQVHIRUPRUHGHWDLOV
<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18*HQHUDO3XEOLF/LFHQVH
DORQJZLWKWKLVSURJUDPLIQRWZULWHWRWKH)UHH6RIWZDUH
)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
$OVRDGGLQIRUPDWLRQRQKRZWRFRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO ,IWKHSURJUDPLVLQWHUDFWLYHPDNHLWRXWSXWDVKRUWQRWLFHOLNHWKLVZKHQLWVWDUWVLQDQLQWHUDFWLYHPRGH *QRPRYLVLRQYHUVLRQ&RS\ULJKW & \HDUQDPHRIDXWKRU
*QRPRYLVLRQFRPHVZLWK$%62/87(/<12:$55$17<IRUGHWDLOV
W\SHCVKRZZ 7KLVLVIUHHVRIWZDUHDQG\RXDUHZHOFRPH
WRUHGLVWULEXWHLWXQGHUFHUWDLQFRQGLWLRQVW\SHCVKRZF IRUGHWDLOV
7KHK\SRWKHWLFDOFRPPDQGVCVKRZZ DQGCVKRZF VKRXOGVKRZWKHDSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF
/LFHQVH2IFRXUVHWKHFRPPDQGV\RXXVHPD\EHFDOOHGVRPHWKLQJRWKHUWKDQCVKRZZ DQGCVKRZF WKH\
FRXOGHYHQEHPRXVHFOLFNVRUPHQXLWHPVZKDWHYHUVXLWV\RXUSURJUDP <RXVKRXOGDOVRJHW\RXUHPSOR\HU LI\RXZRUNDVDSURJUDPPHU RU\RXUVFKRROLIDQ\WRVLJQDFRS\ULJKW
GLVFODLPHUIRUWKHSURJUDPLIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV <R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKW
LQWHUHVWLQWKHSURJUDPC*QRPRYLVLRQ ZKLFKPDNHVSDVVHVDWFRPSLOHUV ZULWWHQ E\-DPHV+DFNHU
VLJQDWXUHRI7\&RRQ$SULO
7\&RRQ3UHVLGHQWRI9LFH
7KLV*HQHUDO3XEOLF/LFHQVHGRHVQRWSHUPLWLQFRUSRUDWLQJ\RXUSURJUDPLQWRSURSULHWDU\SURJUDPV,I\RXU
SURJUDPLVDVXEURXWLQHOLEUDU\\RXPD\FRQVLGHULWPRUHXVHIXOWRSHUPLWOLQNLQJSURSULHWDU\DSSOLFDWLRQVZLWK
WKHOLEUDU\,IWKLVLVZKDW\RXZDQWWRGRXVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVH - 38 -
JOLEF
MVRQJOLE
*18/(66(5*(1(5$/38%/,&/,&(16(
9HUVLRQ)HEUXDU\ &RS\ULJKW & )UHH6RIWZDUH)RXQGDWLRQ,QF
)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWHYHUEDWLPFRSLHV
RIWKLVOLFHQVHGRFXPHQWEXWFKDQJLQJLWLVQRWDOORZHG
>7KLVLVWKHILUVWUHOHDVHGYHUVLRQRIWKH/HVVHU*3/ ,WDOVRFRXQWV
DVWKHVXFFHVVRURIWKH*18/LEUDU\3XEOLF/LFHQVHYHUVLRQKHQFH
WKHYHUVLRQQXPEHU@
3UHDPEOH
7KHOLFHQVHVIRUPRVWVRIWZDUHDUHGHVLJQHGWRWDNHDZD\\RXUIUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVW
WKH*18*HQHUDO3XEOLF/LFHQVHVDUHLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUHDQGFKDQJHIUHHVRIWZDUH
WRPDNHVXUHWKHVRIWZDUHLVIUHHIRUDOOLWVXVHUV 7KLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHDSSOLHVWRVRPHVSHFLDOO\GHVLJQDWHGVRIWZDUHSDFNDJHV
W\SLFDOO\OLEUDULHVRIWKH)UHH6RIWZDUH)RXQGDWLRQDQGRWKHUDXWKRUVZKRGHFLGHWRXVHLW<RXFDQXVHLWWRR
EXWZHVXJJHVW\RXILUVWWKLQNFDUHIXOO\DERXWZKHWKHUWKLVOLFHQVHRUWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVHLVWKH
EHWWHUVWUDWHJ\WRXVHLQDQ\SDUWLFXODUFDVHEDVHGRQWKHH[SODQDWLRQVEHORZ :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRPRIXVHQRWSULFH2XU*HQHUDO3XEOLF/LFHQVHV
DUHGHVLJQHGWRPDNHVXUHWKDW\RXKDYHWKHIUHHGRPWRGLVWULEXWHFRSLHVRIIUHHVRIWZDUH DQGFKDUJHIRUWKLV
VHUYLFHLI\RXZLVK WKDW\RXUHFHLYHVRXUFHFRGHRUFDQJHWLWLI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUH
DQGXVHSLHFHVRILWLQQHZIUHHSURJUDPVDQGWKDW\RXDUHLQIRUPHGWKDW\RXFDQGRWKHVHWKLQJV 7RSURWHFW\RXUULJKWVZHQHHGWRPDNHUHVWULFWLRQVWKDWIRUELGGLVWULEXWRUVWRGHQ\\RXWKHVHULJKWVRUWRDVN
\RXWRVXUUHQGHUWKHVHULJKWV7KHVHUHVWULFWLRQVWUDQVODWHWRFHUWDLQUHVSRQVLELOLWLHVIRU\RXLI\RXGLVWULEXWH
FRSLHVRIWKHOLEUDU\RULI\RXPRGLI\LW )RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\ZKHWKHUJUDWLVRUIRUDIHH\RXPXVWJLYHWKHUHFLSLHQWVDOO
WKHULJKWVWKDWZHJDYH\RX<RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKHVRXUFHFRGH,I\RXOLQN
RWKHUFRGHZLWKWKHOLEUDU\\RXPXVWSURYLGHFRPSOHWHREMHFWILOHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQUHOLQN
WKHPZLWKWKHOLEUDU\DIWHUPDNLQJFKDQJHVWRWKHOLEUDU\DQGUHFRPSLOLQJLW$QG\RXPXVWVKRZWKHPWKHVH
WHUPVVRWKH\NQRZWKHLUULJKWV :HSURWHFW\RXUULJKWVZLWKDWZRVWHSPHWKRG ZHFRS\ULJKWWKHOLEUDU\DQG ZHRIIHU\RXWKLVOLFHQVH
ZKLFKJLYHV\RXOHJDOSHUPLVVLRQWRFRS\GLVWULEXWHDQGRUPRGLI\WKHOLEUDU\ 7RSURWHFWHDFKGLVWULEXWRUZHZDQWWRPDNHLWYHU\FOHDUWKDWWKHUHLVQRZDUUDQW\IRUWKHIUHHOLEUDU\$OVRLI
WKHOLEUDU\LVPRGLILHGE\VRPHRQHHOVHDQGSDVVHGRQWKHUHFLSLHQWVVKRXOGNQRZWKDWZKDWWKH\KDYHLVQRW
- 39 -
WKHRULJLQDOYHUVLRQVRWKDWWKHRULJLQDODXWKRU VUHSXWDWLRQZLOOQRWEHDIIHFWHGE\SUREOHPVWKDWPLJKWEH
LQWURGXFHGE\RWKHUV )LQDOO\VRIWZDUHSDWHQWVSRVHDFRQVWDQWWKUHDWWRWKHH[LVWHQFHRIDQ\IUHHSURJUDP:HZLVKWRPDNHVXUH
WKDWDFRPSDQ\FDQQRWHIIHFWLYHO\UHVWULFWWKHXVHUVRIDIUHHSURJUDPE\REWDLQLQJDUHVWULFWLYHOLFHQVHIURPD
SDWHQWKROGHU7KHUHIRUHZHLQVLVWWKDWDQ\SDWHQWOLFHQVHREWDLQHGIRUDYHUVLRQRIWKHOLEUDU\PXVWEH
FRQVLVWHQWZLWKWKHIXOOIUHHGRPRIXVHVSHFLILHGLQWKLVOLFHQVH 0RVW*18VRIWZDUHLQFOXGLQJVRPHOLEUDULHVLVFRYHUHGE\WKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVH7KLV
OLFHQVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHDSSOLHVWRFHUWDLQGHVLJQDWHGOLEUDULHVDQGLVTXLWHGLIIHUHQW
IURPWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH:HXVHWKLVOLFHQVHIRUFHUWDLQOLEUDULHVLQRUGHUWRSHUPLWOLQNLQJ
WKRVHOLEUDULHVLQWRQRQIUHHSURJUDPV :KHQDSURJUDPLVOLQNHGZLWKDOLEUDU\ZKHWKHUVWDWLFDOO\RUXVLQJDVKDUHGOLEUDU\WKHFRPELQDWLRQRIWKHWZR
LVOHJDOO\VSHDNLQJDFRPELQHGZRUNDGHULYDWLYHRIWKHRULJLQDOOLEUDU\7KHRUGLQDU\*HQHUDO3XEOLF/LFHQVH
WKHUHIRUHSHUPLWVVXFKOLQNLQJRQO\LIWKHHQWLUHFRPELQDWLRQILWVLWVFULWHULDRIIUHHGRP7KH/HVVHU*HQHUDO
3XEOLF/LFHQVHSHUPLWVPRUHOD[FULWHULDIRUOLQNLQJRWKHUFRGHZLWKWKHOLEUDU\ :HFDOOWKLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHEHFDXVHLWGRHV/HVVWRSURWHFWWKHXVHU VIUHHGRP
WKDQWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH,WDOVRSURYLGHVRWKHUIUHHVRIWZDUHGHYHORSHUV/HVVRIDQ
DGYDQWDJHRYHUFRPSHWLQJQRQIUHHSURJUDPV7KHVHGLVDGYDQWDJHVDUHWKHUHDVRQZHXVHWKHRUGLQDU\
*HQHUDO3XEOLF/LFHQVHIRUPDQ\OLEUDULHV+RZHYHUWKH/HVVHUOLFHQVHSURYLGHVDGYDQWDJHVLQFHUWDLQVSHFLDO
FLUFXPVWDQFHV )RUH[DPSOHRQUDUHRFFDVLRQVWKHUHPD\EHDVSHFLDOQHHGWRHQFRXUDJHWKHZLGHVWSRVVLEOHXVHRID
FHUWDLQOLEUDU\VRWKDWLWEHFRPHVDGHIDFWRVWDQGDUG7RDFKLHYHWKLVQRQIUHHSURJUDPVPXVWEHDOORZHGWR
XVHWKHOLEUDU\$PRUHIUHTXHQWFDVHLVWKDWDIUHHOLEUDU\GRHVWKHVDPHMREDVZLGHO\XVHGQRQIUHHOLEUDULHV
,QWKLVFDVHWKHUHLVOLWWOHWRJDLQE\OLPLWLQJWKHIUHHOLEUDU\WRIUHHVRIWZDUHRQO\VRZHXVHWKH/HVVHU
*HQHUDO3XEOLF/LFHQVH ,QRWKHUFDVHVSHUPLVVLRQWRXVHDSDUWLFXODUOLEUDU\LQQRQIUHHSURJUDPVHQDEOHVDJUHDWHUQXPEHURISHRSOH
WRXVHDODUJHERG\RIIUHHVRIWZDUH)RUH[DPSOHSHUPLVVLRQWRXVHWKH*18&/LEUDU\LQQRQIUHHSURJUDPV
HQDEOHVPDQ\PRUHSHRSOHWRXVHWKHZKROH*18RSHUDWLQJV\VWHPDVZHOODVLWVYDULDQWWKH*18/LQX[
RSHUDWLQJV\VWHP $OWKRXJKWKH/HVVHU*HQHUDO3XEOLF/LFHQVHLV/HVVSURWHFWLYHRIWKHXVHUV IUHHGRPLWGRHVHQVXUHWKDWWKH
XVHURIDSURJUDPWKDWLVOLQNHGZLWKWKH/LEUDU\KDVWKHIUHHGRPDQGWKHZKHUHZLWKDOWRUXQWKDWSURJUDP
XVLQJDPRGLILHGYHUVLRQRIWKH/LEUDU\ 7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQIROORZ3D\FORVHDWWHQWLRQWRWKH
GLIIHUHQFHEHWZHHQDZRUNEDVHGRQWKHOLEUDU\DQGDZRUNWKDWXVHVWKHOLEUDU\7KHIRUPHUFRQWDLQVFRGH
GHULYHGIURPWKHOLEUDU\ZKHUHDVWKHODWWHUPXVWEHFRPELQHGZLWKWKHOLEUDU\LQRUGHUWRUXQ 7(506$1'&21',7,216)25&23<,1*',675,%87,21$1'02',),&$7,21
7KLV/LFHQVH$JUHHPHQWDSSOLHVWRDQ\VRIWZDUHOLEUDU\RURWKHUSURJUDPZKLFKFRQWDLQVDQRWLFHSODFHGE\
WKHFRS\ULJKWKROGHURURWKHUDXWKRUL]HGSDUW\VD\LQJLWPD\EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV/HVVHU
*HQHUDO3XEOLF/LFHQVH DOVRFDOOHGWKLV/LFHQVH (DFKOLFHQVHHLVDGGUHVVHGDV\RX - 40 -
$OLEUDU\PHDQVDFROOHFWLRQRIVRIWZDUHIXQFWLRQVDQGRUGDWDSUHSDUHGVRDVWREHFRQYHQLHQWO\OLQNHGZLWK
DSSOLFDWLRQSURJUDPV ZKLFKXVHVRPHRIWKRVHIXQFWLRQVDQGGDWD WRIRUPH[HFXWDEOHV 7KH/LEUDU\EHORZUHIHUVWRDQ\VXFKVRIWZDUHOLEUDU\RUZRUNZKLFKKDVEHHQGLVWULEXWHGXQGHUWKHVH
WHUPV$ZRUNEDVHGRQWKH/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\GHULYDWLYHZRUNXQGHUFRS\ULJKWODZWKDW
LVWRVD\DZRUNFRQWDLQLQJWKH/LEUDU\RUDSRUWLRQRILWHLWKHUYHUEDWLPRUZLWKPRGLILFDWLRQVDQGRUWUDQVODWHG
VWUDLJKWIRUZDUGO\LQWRDQRWKHUODQJXDJH +HUHLQDIWHUWUDQVODWLRQLVLQFOXGHGZLWKRXWOLPLWDWLRQLQWKHWHUP
PRGLILFDWLRQ 6RXUFHFRGHIRUDZRUNPHDQVWKHSUHIHUUHGIRUPRIWKHZRUNIRUPDNLQJPRGLILFDWLRQVWRLW)RUDOLEUDU\
FRPSOHWHVRXUFHFRGHPHDQVDOOWKHVRXUFHFRGHIRUDOOPRGXOHVLWFRQWDLQVSOXVDQ\DVVRFLDWHGLQWHUIDFH
GHILQLWLRQILOHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQDQGLQVWDOODWLRQRIWKHOLEUDU\ $FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWV
VFRSH7KHDFWRIUXQQLQJDSURJUDPXVLQJWKH/LEUDU\LVQRWUHVWULFWHGDQGRXWSXWIURPVXFKDSURJUDPLV
FRYHUHGRQO\LILWVFRQWHQWVFRQVWLWXWHDZRUNEDVHGRQWKH/LEUDU\ LQGHSHQGHQWRIWKHXVHRIWKH/LEUDU\LQD
WRROIRUZULWLQJLW :KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH/LEUDU\GRHVDQGZKDWWKHSURJUDPWKDWXVHVWKH
/LEUDU\GRHV <RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH/LEUDU\ VFRPSOHWHVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\
PHGLXPSURYLGHGWKDW\RXFRQVSLFXRXVO\DQGDSSURSULDWHO\SXEOLVKRQHDFKFRS\DQDSSURSULDWHFRS\ULJKW
QRWLFHDQGGLVFODLPHURIZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRI
DQ\ZDUUDQW\DQGGLVWULEXWHDFRS\RIWKLV/LFHQVHDORQJZLWKWKH/LEUDU\ <RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\DQG\RXPD\DW\RXURSWLRQRIIHUZDUUDQW\
SURWHFWLRQLQH[FKDQJHIRUDIHH <RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RUDQ\SRUWLRQRILWWKXVIRUPLQJDZRUNEDVHGRQWKH
/LEUDU\DQGFRS\DQGGLVWULEXWHVXFKPRGLILFDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQDERYHSURYLGHGWKDW
\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV x
D 7KHPRGLILHGZRUNPXVWLWVHOIEHDVRIWZDUHOLEUDU\ x
E <RXPXVWFDXVHWKHILOHVPRGLILHGWRFDUU\SURPLQHQWQRWLFHVVWDWLQJWKDW\RXFKDQJHGWKHILOHVDQG
WKHGDWHRIDQ\FKDQJH x
F <RXPXVWFDXVHWKHZKROHRIWKHZRUNWREHOLFHQVHGDWQRFKDUJHWRDOOWKLUGSDUWLHVXQGHUWKHWHUPV
RIWKLV/LFHQVH x
G ,IDIDFLOLW\LQWKHPRGLILHG/LEUDU\UHIHUVWRDIXQFWLRQRUDWDEOHRIGDWDWREHVXSSOLHGE\DQDSSOLFDWLRQ
SURJUDPWKDWXVHVWKHIDFLOLW\RWKHUWKDQDVDQDUJXPHQWSDVVHGZKHQWKHIDFLOLW\LVLQYRNHGWKHQ\RX
PXVWPDNHDJRRGIDLWKHIIRUWWRHQVXUHWKDWLQWKHHYHQWDQDSSOLFDWLRQGRHVQRWVXSSO\VXFKIXQFWLRQ
RUWDEOHWKHIDFLOLW\VWLOORSHUDWHVDQGSHUIRUPVZKDWHYHUSDUWRILWVSXUSRVHUHPDLQVPHDQLQJIXO )RUH[DPSOHDIXQFWLRQLQDOLEUDU\WRFRPSXWHVTXDUHURRWVKDVDSXUSRVHWKDWLVHQWLUHO\ZHOO
GHILQHGLQGHSHQGHQWRIWKHDSSOLFDWLRQ7KHUHIRUH6XEVHFWLRQGUHTXLUHVWKDWDQ\DSSOLFDWLRQ
VXSSOLHGIXQFWLRQRUWDEOHXVHGE\WKLVIXQFWLRQPXVWEHRSWLRQDOLIWKHDSSOLFDWLRQGRHVQRWVXSSO\LW
WKHVTXDUHURRWIXQFWLRQPXVWVWLOOFRPSXWHVTXDUHURRWV - 41 -
7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGLILHGZRUNDVDZKROH,ILGHQWLILDEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHG
IURPWKH/LEUDU\DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQGVHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV
/LFHQVHDQGLWVWHUPVGRQRWDSSO\WRWKRVHVHFWLRQVZKHQ\RXGLVWULEXWHWKHPDVVHSDUDWHZRUNV%XWZKHQ
\RXGLVWULEXWHWKHVDPHVHFWLRQVDVSDUWRIDZKROHZKLFKLVDZRUNEDVHGRQWKH/LEUDU\WKHGLVWULEXWLRQRI
WKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQGWRWKHHQWLUH
ZKROHDQGWKXVWRHDFKDQGHYHU\SDUWUHJDUGOHVVRIZKRZURWHLW 7KXVLWLVQRWWKHLQWHQWRIWKLVVHFWLRQWRFODLPULJKWVRUFRQWHVW\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RX
UDWKHUWKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRUFROOHFWLYHZRUNVEDVHGRQWKH
/LEUDU\ ,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRWEDVHGRQWKH/LEUDU\ZLWKWKH/LEUDU\ RUZLWKDZRUNEDVHG
RQWKH/LEUDU\ RQDYROXPHRIDVWRUDJHRUGLVWULEXWLRQPHGLXPGRHVQRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSH
RIWKLV/LFHQVH <RXPD\RSWWRDSSO\WKHWHUPVRIWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVHWRD
JLYHQFRS\RIWKH/LEUDU\7RGRWKLV\RXPXVWDOWHUDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHVRWKDWWKH\UHIHU
WRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQLQVWHDGRIWRWKLV/LFHQVH ,IDQHZHUYHUVLRQWKDQ
YHUVLRQRIWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHKDVDSSHDUHGWKHQ\RXFDQVSHFLI\WKDWYHUVLRQ
LQVWHDGLI\RXZLVK 'RQRWPDNHDQ\RWKHUFKDQJHLQWKHVHQRWLFHV 2QFHWKLVFKDQJHLVPDGHLQDJLYHQFRS\LWLVLUUHYHUVLEOHIRUWKDWFRS\VRWKHRUGLQDU\*18*HQHUDO3XEOLF
/LFHQVHDSSOLHVWRDOOVXEVHTXHQWFRSLHVDQGGHULYDWLYHZRUNVPDGHIURPWKDWFRS\ 7KLVRSWLRQLVXVHIXOZKHQ\RXZLVKWRFRS\SDUWRIWKHFRGHRIWKH/LEUDU\LQWRDSURJUDPWKDWLVQRWDOLEUDU\ <RXPD\FRS\DQGGLVWULEXWHWKH/LEUDU\ RUDSRUWLRQRUGHULYDWLYHRILWXQGHU6HFWLRQ LQREMHFWFRGHRU
H[HFXWDEOHIRUPXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHSURYLGHGWKDW\RXDFFRPSDQ\LWZLWKWKHFRPSOHWH
FRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHZKLFKPXVWEHGLVWULEXWHGXQGHUWKHWHUPVRI6HFWLRQVDQG
DERYHRQDPHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJH ,IGLVWULEXWLRQRIREMHFWFRGHLVPDGHE\RIIHULQJDFFHVVWRFRS\IURPDGHVLJQDWHGSODFHWKHQRIIHULQJ
HTXLYDOHQWDFFHVVWRFRS\WKHVRXUFHFRGHIURPWKHVDPHSODFHVDWLVILHVWKHUHTXLUHPHQWWRGLVWULEXWHWKH
VRXUFHFRGHHYHQWKRXJKWKLUGSDUWLHVDUHQRWFRPSHOOHGWRFRS\WKHVRXUFHDORQJZLWKWKHREMHFWFRGH $SURJUDPWKDWFRQWDLQVQRGHULYDWLYHRIDQ\SRUWLRQRIWKH/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\
E\EHLQJFRPSLOHGRUOLQNHGZLWKLWLVFDOOHGDZRUNWKDWXVHVWKH/LEUDU\6XFKDZRUNLQLVRODWLRQLVQRWD
GHULYDWLYHZRUNRIWKH/LEUDU\DQGWKHUHIRUHIDOOVRXWVLGHWKHVFRSHRIWKLV/LFHQVH +RZHYHUOLQNLQJDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH/LEUDU\FUHDWHVDQH[HFXWDEOHWKDWLVDGHULYDWLYHRI
WKH/LEUDU\ EHFDXVHLWFRQWDLQVSRUWLRQVRIWKH/LEUDU\ UDWKHUWKDQDZRUNWKDWXVHVWKHOLEUDU\7KH
H[HFXWDEOHLVWKHUHIRUHFRYHUHGE\WKLV/LFHQVH6HFWLRQVWDWHVWHUPVIRUGLVWULEXWLRQRIVXFKH[HFXWDEOHV :KHQDZRUNWKDWXVHVWKH/LEUDU\XVHVPDWHULDOIURPDKHDGHUILOHWKDWLVSDUWRIWKH/LEUDU\WKHREMHFWFRGH
IRUWKHZRUNPD\EHDGHULYDWLYHZRUNRIWKH/LEUDU\HYHQWKRXJKWKHVRXUFHFRGHLVQRW:KHWKHUWKLVLVWUXHLV
HVSHFLDOO\VLJQLILFDQWLIWKHZRUNFDQEHOLQNHGZLWKRXWWKH/LEUDU\RULIWKHZRUNLVLWVHOIDOLEUDU\7KHWKUHVKROG
IRUWKLVWREHWUXHLVQRWSUHFLVHO\GHILQHGE\ODZ - 42 -
,IVXFKDQREMHFWILOHXVHVRQO\QXPHULFDOSDUDPHWHUVGDWDVWUXFWXUHOD\RXWVDQGDFFHVVRUVDQGVPDOOPDFURV
DQGVPDOOLQOLQHIXQFWLRQV WHQOLQHVRUOHVVLQOHQJWK WKHQWKHXVHRIWKHREMHFWILOHLVXQUHVWULFWHGUHJDUGOHVV
RIZKHWKHULWLVOHJDOO\DGHULYDWLYHZRUN ([HFXWDEOHVFRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRIWKH/LEUDU\
ZLOOVWLOOIDOOXQGHU6HFWLRQ 2WKHUZLVHLIWKHZRUNLVDGHULYDWLYHRIWKH/LEUDU\\RXPD\GLVWULEXWHWKHREMHFWFRGHIRUWKHZRUNXQGHUWKH
WHUPVRI6HFWLRQ$Q\H[HFXWDEOHVFRQWDLQLQJWKDWZRUNDOVRIDOOXQGHU6HFWLRQZKHWKHURUQRWWKH\DUH
OLQNHGGLUHFWO\ZLWKWKH/LEUDU\LWVHOI $VDQH[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\DOVRFRPELQHRUOLQNDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH
/LEUDU\WRSURGXFHDZRUNFRQWDLQLQJSRUWLRQVRIWKH/LEUDU\DQGGLVWULEXWHWKDWZRUNXQGHUWHUPVRI\RXU
FKRLFHSURYLGHGWKDWWKHWHUPVSHUPLWPRGLILFDWLRQRIWKHZRUNIRUWKHFXVWRPHU VRZQXVHDQGUHYHUVH
HQJLQHHULQJIRUGHEXJJLQJVXFKPRGLILFDWLRQV <RXPXVWJLYHSURPLQHQWQRWLFHZLWKHDFKFRS\RIWKHZRUNWKDWWKH/LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\
DQGLWVXVHDUHFRYHUHGE\WKLV/LFHQVH<RXPXVWVXSSO\DFRS\RIWKLV/LFHQVH,IWKHZRUNGXULQJH[HFXWLRQ
GLVSOD\VFRS\ULJKWQRWLFHV\RXPXVWLQFOXGHWKHFRS\ULJKWQRWLFHIRUWKH/LEUDU\DPRQJWKHPDVZHOODVD
UHIHUHQFHGLUHFWLQJWKHXVHUWRWKHFRS\RIWKLV/LFHQVH$OVR\RXPXVWGRRQHRIWKHVHWKLQJV x
D $FFRPSDQ\WKHZRUNZLWKWKHFRPSOHWHFRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHIRUWKH/LEUDU\
LQFOXGLQJZKDWHYHUFKDQJHVZHUHXVHGLQWKHZRUN ZKLFKPXVWEHGLVWULEXWHGXQGHU6HFWLRQVDQG
DERYH DQGLIWKHZRUNLVDQH[HFXWDEOHOLQNHGZLWKWKH/LEUDU\ZLWKWKHFRPSOHWHPDFKLQHUHDGDEOH
ZRUNWKDWXVHVWKH/LEUDU\DVREMHFWFRGHDQGRUVRXUFHFRGHVRWKDWWKHXVHUFDQPRGLI\WKH/LEUDU\
DQGWKHQUHOLQNWRSURGXFHDPRGLILHGH[HFXWDEOHFRQWDLQLQJWKHPRGLILHG/LEUDU\ ,WLVXQGHUVWRRGWKDW
WKH XVHU ZKR FKDQJHV WKH FRQWHQWV RI GHILQLWLRQV ILOHV LQ WKH /LEUDU\ ZLOO QRW QHFHVVDULO\ EH DEOH WR
UHFRPSLOHWKHDSSOLFDWLRQWRXVHWKHPRGLILHGGHILQLWLRQV x
E 8VHDVXLWDEOHVKDUHGOLEUDU\PHFKDQLVPIRUOLQNLQJZLWKWKH/LEUDU\$VXLWDEOHPHFKDQLVPLVRQH
WKDW XVHVDWUXQWLPHDFRS\RIWKHOLEUDU\DOUHDG\SUHVHQWRQWKHXVHU VFRPSXWHUV\VWHPUDWKHU
WKDQFRS\LQJOLEUDU\IXQFWLRQVLQWRWKHH[HFXWDEOHDQG ZLOORSHUDWHSURSHUO\ZLWKDPRGLILHGYHUVLRQ
RIWKHOLEUDU\LIWKHXVHULQVWDOOVRQHDVORQJDVWKHPRGLILHGYHUVLRQLVLQWHUIDFHFRPSDWLEOHZLWKWKH
YHUVLRQWKDWWKHZRUNZDVPDGHZLWK x
F $FFRPSDQ\WKH ZRUN ZLWK D ZULWWHQRIIHU YDOLGIRU DW OHDVWWKUHH \HDUV WR JLYH WKH VDPH XVHUWKH
PDWHULDOV VSHFLILHG LQ 6XEVHFWLRQ D DERYH IRU D FKDUJH QR PRUH WKDQ WKH FRVW RI SHUIRUPLQJ WKLV
GLVWULEXWLRQ x
G ,IGLVWULEXWLRQRIWKHZRUNLVPDGHE\RIIHULQJDFFHVVWRFRS\IURPDGHVLJQDWHGSODFHRIIHUHTXLYDOHQW
DFFHVVWRFRS\WKHDERYHVSHFLILHGPDWHULDOVIURPWKHVDPHSODFH x
H 9HULI\WKDWWKHXVHUKDVDOUHDG\UHFHLYHGDFRS\RIWKHVHPDWHULDOVRUWKDW\RXKDYHDOUHDG\VHQWWKLV
XVHUDFRS\ )RUDQH[HFXWDEOHWKHUHTXLUHGIRUPRIWKHZRUNWKDWXVHVWKH/LEUDU\PXVWLQFOXGHDQ\GDWDDQGXWLOLW\
SURJUDPVQHHGHGIRUUHSURGXFLQJWKHH[HFXWDEOHIURPLW+RZHYHUDVDVSHFLDOH[FHSWLRQWKHPDWHULDOVWREH
GLVWULEXWHGQHHGQRWLQFOXGHDQ\WKLQJWKDWLVQRUPDOO\GLVWULEXWHG LQHLWKHUVRXUFHRUELQDU\IRUP ZLWKWKH
- 43 -
PDMRUFRPSRQHQWV FRPSLOHUNHUQHODQGVRRQ RIWKHRSHUDWLQJV\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVV
WKDWFRPSRQHQWLWVHOIDFFRPSDQLHVWKHH[HFXWDEOH ,WPD\KDSSHQWKDWWKLVUHTXLUHPHQWFRQWUDGLFWVWKHOLFHQVHUHVWULFWLRQVRIRWKHUSURSULHWDU\OLEUDULHVWKDWGRQRW
QRUPDOO\DFFRPSDQ\WKHRSHUDWLQJV\VWHP6XFKDFRQWUDGLFWLRQPHDQV\RXFDQQRWXVHERWKWKHPDQGWKH
/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RXGLVWULEXWH <RXPD\SODFHOLEUDU\IDFLOLWLHVWKDWDUHDZRUNEDVHGRQWKH/LEUDU\VLGHE\VLGHLQDVLQJOHOLEUDU\WRJHWKHU
ZLWKRWKHUOLEUDU\IDFLOLWLHVQRWFRYHUHGE\WKLV/LFHQVHDQGGLVWULEXWHVXFKDFRPELQHGOLEUDU\SURYLGHGWKDW
WKHVHSDUDWHGLVWULEXWLRQRIWKHZRUNEDVHGRQWKH/LEUDU\DQGRIWKHRWKHUOLEUDU\IDFLOLWLHVLVRWKHUZLVH
SHUPLWWHGDQGSURYLGHGWKDW\RXGRWKHVHWZRWKLQJV x
D $FFRPSDQ\WKHFRPELQHGOLEUDU\ZLWKDFRS\RIWKHVDPHZRUNEDVHGRQWKH/LEUDU\XQFRPELQHG
ZLWKDQ\RWKHUOLEUDU\IDFLOLWLHV7KLVPXVWEHGLVWULEXWHGXQGHUWKHWHUPVRIWKH6HFWLRQVDERYH x
E *LYH SURPLQHQW QRWLFH ZLWK WKH FRPELQHG OLEUDU\RI WKHIDFW WKDW SDUWRI LW LVDZRUN EDVHGRQ WKH
/LEUDU\DQGH[SODLQLQJZKHUHWRILQGWKHDFFRPSDQ\LQJXQFRPELQHGIRUPRIWKHVDPHZRUN <RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWHWKH/LEUDU\H[FHSWDVH[SUHVVO\SURYLGHG
XQGHUWKLV/LFHQVH$Q\DWWHPSWRWKHUZLVHWRFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWHWKH/LEUDU\LV
YRLGDQGZLOODXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH+RZHYHUSDUWLHVZKRKDYHUHFHLYHG
FRSLHVRUULJKWVIURP\RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHVWHUPLQDWHGVRORQJDVVXFKSDUWLHV
UHPDLQLQIXOOFRPSOLDQFH <RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RX
SHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH/LEUDU\RULWVGHULYDWLYHZRUNV7KHVHDFWLRQVDUHSURKLELWHGE\ODZLI\RX
GRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRUGLVWULEXWLQJWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH
/LEUDU\ \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQGDOOLWVWHUPVDQGFRQGLWLRQVIRUFRS\LQJ
GLVWULEXWLQJRUPRGLI\LQJWKH/LEUDU\RUZRUNVEDVHGRQLW (DFKWLPH\RXUHGLVWULEXWHWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH/LEUDU\ WKHUHFLSLHQWDXWRPDWLFDOO\
UHFHLYHVDOLFHQVHIURPWKHRULJLQDOOLFHQVRUWRFRS\GLVWULEXWHOLQNZLWKRUPRGLI\WKH/LEUDU\VXEMHFWWRWKHVH
WHUPVDQGFRQGLWLRQV<RXPD\QRWLPSRVHDQ\IXUWKHUUHVWULFWLRQVRQWKHUHFLSLHQWV H[HUFLVHRIWKHULJKWV
JUDQWHGKHUHLQ<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVZLWKWKLV/LFHQVH ,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQRISDWHQWLQIULQJHPHQWRUIRUDQ\RWKHUUHDVRQ QRW
OLPLWHGWRSDWHQWLVVXHV FRQGLWLRQVDUHLPSRVHGRQ\RX ZKHWKHUE\FRXUWRUGHUDJUHHPHQWRURWKHUZLVH WKDW
FRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX
FDQQRWGLVWULEXWHVRDVWRVDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQGDQ\RWKHUSHUWLQHQW
REOLJDWLRQVWKHQDVDFRQVHTXHQFH\RXPD\QRWGLVWULEXWHWKH/LEUDU\DWDOO)RUH[DPSOHLIDSDWHQWOLFHQVH
ZRXOGQRWSHUPLWUR\DOW\IUHHUHGLVWULEXWLRQRIWKH/LEUDU\E\DOOWKRVHZKRUHFHLYHFRSLHVGLUHFWO\RULQGLUHFWO\
WKURXJK\RXWKHQWKHRQO\ZD\\RXFRXOGVDWLVI\ERWKLWDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP
GLVWULEXWLRQRIWKH/LEUDU\ ,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOGLQYDOLGRUXQHQIRUFHDEOHXQGHUDQ\SDUWLFXODUFLUFXPVWDQFHWKHEDODQFHRI
WKHVHFWLRQLVLQWHQGHGWRDSSO\DQGWKHVHFWLRQDVDZKROHLVLQWHQGHGWRDSSO\LQRWKHUFLUFXPVWDQFHV - 44 -
,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\SDWHQWVRURWKHUSURSHUW\ULJKWFODLPVRUWR
FRQWHVWYDOLGLW\RIDQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJWKHLQWHJULW\RIWKHIUHH
VRIWZDUHGLVWULEXWLRQV\VWHPZKLFKLVLPSOHPHQWHGE\SXEOLFOLFHQVHSUDFWLFHV0DQ\SHRSOHKDYHPDGH
JHQHURXVFRQWULEXWLRQVWRWKHZLGHUDQJHRIVRIWZDUHGLVWULEXWHGWKURXJKWKDWV\VWHPLQUHOLDQFHRQFRQVLVWHQW
DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWRGHFLGHLIKHRUVKHLVZLOOLQJWRGLVWULEXWHVRIWZDUH
WKURXJKDQ\RWKHUV\VWHPDQGDOLFHQVHHFDQQRWLPSRVHWKDWFKRLFH 7KLVVHFWLRQLVLQWHQGHGWRPDNHWKRURXJKO\FOHDUZKDWLVEHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV
/LFHQVH ,IWKHGLVWULEXWLRQDQGRUXVHRIWKH/LEUDU\LVUHVWULFWHGLQFHUWDLQFRXQWULHVHLWKHUE\SDWHQWVRUE\
FRS\ULJKWHGLQWHUIDFHVWKHRULJLQDOFRS\ULJKWKROGHUZKRSODFHVWKH/LEUDU\XQGHUWKLV/LFHQVHPD\DGGDQ
H[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQH[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\LQRU
DPRQJFRXQWULHVQRWWKXVH[FOXGHG,QVXFKFDVHWKLV/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKH
ERG\RIWKLV/LFHQVH 7KH)UHH6RIWZDUH)RXQGDWLRQPD\SXEOLVKUHYLVHGDQGRUQHZYHUVLRQVRIWKH/HVVHU*HQHUDO3XEOLF
/LFHQVHIURPWLPHWRWLPH6XFKQHZYHUVLRQVZLOOEHVLPLODULQVSLULWWRWKHSUHVHQWYHUVLRQEXWPD\GLIIHULQ
GHWDLOWRDGGUHVVQHZSUREOHPVRUFRQFHUQV (DFKYHUVLRQLVJLYHQDGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH/LEUDU\VSHFLILHVDYHUVLRQQXPEHURIWKLV
/LFHQVHZKLFKDSSOLHVWRLWDQGDQ\ODWHUYHUVLRQ\RXKDYHWKHRSWLRQRIIROORZLQJWKHWHUPVDQGFRQGLWLRQV
HLWKHURIWKDWYHUVLRQRURIDQ\ODWHUYHUVLRQSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH/LEUDU\GRHVQRW
VSHFLI\DOLFHQVHYHUVLRQQXPEHU\RXPD\FKRRVHDQ\YHUVLRQHYHUSXEOLVKHGE\WKH)UHH6RIWZDUH
)RXQGDWLRQ ,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH/LEUDU\LQWRRWKHUIUHHSURJUDPVZKRVHGLVWULEXWLRQFRQGLWLRQVDUH
LQFRPSDWLEOHZLWKWKHVHZULWHWRWKHDXWKRUWRDVNIRUSHUPLVVLRQ)RUVRIWZDUHZKLFKLVFRS\ULJKWHGE\WKH
)UHH6RIWZDUH)RXQGDWLRQZULWHWRWKH)UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRUWKLV
2XUGHFLVLRQZLOOEHJXLGHGE\WKHWZRJRDOVRISUHVHUYLQJWKHIUHHVWDWXVRIDOOGHULYDWLYHVRIRXUIUHHVRIWZDUH
DQGRISURPRWLQJWKHVKDULQJDQGUHXVHRIVRIWZDUHJHQHUDOO\ 12:$55$17< %(&$86(7+(/,%5$5<,6/,&(16(')5((2)&+$5*(7+(5(,612:$55$17<)257+(
/,%5$5<727+((;7(173(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6(67$7('
,1:5,7,1*7+(&23<5,*+7+2/'(56$1'2527+(53$57,(63529,'(7+(/,%5$5<$6,6
:,7+287:$55$17<2)$1<.,1'(,7+(5(;35(66('25,03/,(',1&/8',1*%87127
/,0,7('727+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326(7+((17,5(5,6.$6727+(48$/,7<$1'3(5)250$1&(2)7+(/,%5$5<,6:,7+
<286+28/'7+(/,%5$5<3529('()(&7,9(<28$6680(7+(&2672)$//1(&(66$5<
6(59,&,1*5(3$,525&255(&7,21 ,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25$*5(('72,1:5,7,1*:,//$1<
&23<5,*+7+2/'(525$1<27+(53$57<:+20$<02',)<$1'255(',675,%87(7+(
/,%5$5<$63(50,77('$%29(%(/,$%/(72<28)25'$0$*(6,1&/8',1*$1<*(1(5$/
- 45 -
63(&,$/,1&,'(17$/25&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25,1$%,/,7<72
86(7+(/,%5$5< ,1&/8',1*%87127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5('
,1$&&85$7(25/266(66867$,1('%<<28257+,5'3$57,(625$)$,/85(2)7+(/,%5$5<
7223(5$7(:,7+$1<27+(562)7:$5( (9(1,)68&++2/'(52527+(53$57<+$6%((1
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(6 (1'2)7(506$1'&21',7,216
+RZWR$SSO\7KHVH7HUPVWR<RXU1HZ/LEUDULHV
,I\RXGHYHORSDQHZOLEUDU\DQG\RXZDQWLWWREHRIWKHJUHDWHVWSRVVLEOHXVHWRWKHSXEOLFZHUHFRPPHQG
PDNLQJLWIUHHVRIWZDUHWKDWHYHU\RQHFDQUHGLVWULEXWHDQGFKDQJH<RXFDQGRVRE\SHUPLWWLQJUHGLVWULEXWLRQ
XQGHUWKHVHWHUPV RUDOWHUQDWLYHO\XQGHUWKHWHUPVRIWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH 7RDSSO\WKHVHWHUPVDWWDFKWKHIROORZLQJQRWLFHVWRWKHOLEUDU\,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFK
VRXUFHILOHWRPRVWHIIHFWLYHO\FRQYH\WKHH[FOXVLRQRIZDUUDQW\DQGHDFKILOHVKRXOGKDYHDWOHDVWWKH
FRS\ULJKWOLQHDQGDSRLQWHUWRZKHUHWKHIXOOQRWLFHLVIRXQG RQHOLQHWRJLYHWKHOLEUDU\ VQDPHDQGDQLGHDRIZKDWLWGRHV
&RS\ULJKW & \HDU QDPHRIDXWKRU
7KLVOLEUDU\LVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18/HVVHU*HQHUDO3XEOLF
/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHU
YHUVLRQRIWKH/LFHQVHRU DW\RXURSWLRQ DQ\ODWHUYHUVLRQ
7KLVOLEUDU\LVGLVWULEXWHGLQWKHKRSHWKDWLWZLOOEHXVHIXO
EXW:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\RI
0(5&+$17$%,/,7<RU),71(66)25$3$57,&8/$5385326( 6HHWKH*18
/HVVHU*HQHUDO3XEOLF/LFHQVHIRUPRUHGHWDLOV
<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18/HVVHU*HQHUDO3XEOLF
/LFHQVHDORQJZLWKWKLVOLEUDU\LIQRWZULWHWRWKH)UHH6RIWZDUH
)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
$OVRDGGLQIRUPDWLRQRQKRZWRFRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO <RXVKRXOGDOVRJHW\RXUHPSOR\HU LI\RXZRUNDVDSURJUDPPHU RU\RXUVFKRROLIDQ\WRVLJQDFRS\ULJKW
GLVFODLPHUIRUWKHOLEUDU\LIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV <R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQ
WKHOLEUDU\C)URE DOLEUDU\IRUWZHDNLQJNQREV ZULWWHQ
E\-DPHV5DQGRP+DFNHU
VLJQDWXUHRI7\&RRQ$SULO
7\&RRQ3UHVLGHQWRI9LFH
- 46 -
7KDW VDOOWKHUHLVWRLW
- 47 -
JOLE
*18/,%5$5<*(1(5$/38%/,&/,&(16(
9HUVLRQ-XQH
&RS\ULJKW & )UHH6RIWZDUH)RXQGDWLRQ,QF
7HPSOH3ODFH6XLWH%RVWRQ0$ 86$
(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWHYHUEDWLPFRSLHV
RIWKLVOLFHQVHGRFXPHQWEXWFKDQJLQJLWLVQRWDOORZHG
>7KLVLVWKHILUVWUHOHDVHGYHUVLRQRIWKHOLEUDU\*3/ ,WLV
QXPEHUHGEHFDXVHLWJRHVZLWKYHUVLRQRIWKHRUGLQDU\*3/@
3UHDPEOH
7KHOLFHQVHVIRUPRVWVRIWZDUHDUHGHVLJQHGWRWDNHDZD\\RXU
IUHHGRPWRVKDUHDQGFKDQJHLW %\FRQWUDVWWKH*18*HQHUDO3XEOLF
/LFHQVHVDUHLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUHDQGFKDQJH
IUHHVRIWZDUHWRPDNHVXUHWKHVRIWZDUHLVIUHHIRUDOOLWVXVHUV
7KLVOLFHQVHWKH/LEUDU\*HQHUDO3XEOLF/LFHQVHDSSOLHVWRVRPH
VSHFLDOO\GHVLJQDWHG)UHH6RIWZDUH)RXQGDWLRQVRIWZDUHDQGWRDQ\
RWKHUOLEUDULHVZKRVHDXWKRUVGHFLGHWRXVHLW <RXFDQXVHLWIRU
\RXUOLEUDULHVWRR
:KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRPQRW
SULFH 2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWRPDNHVXUHWKDW\RX
KDYHWKHIUHHGRPWRGLVWULEXWHFRSLHVRIIUHHVRIWZDUH DQGFKDUJHIRU
WKLVVHUYLFHLI\RXZLVK WKDW\RXUHFHLYHVRXUFHFRGHRUFDQJHWLW
LI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUHRUXVHSLHFHVRILW
LQQHZIUHHSURJUDPVDQGWKDW\RXNQRZ\RXFDQGRWKHVHWKLQJV
7RSURWHFW\RXUULJKWVZHQHHGWRPDNHUHVWULFWLRQVWKDWIRUELG
DQ\RQHWRGHQ\\RXWKHVHULJKWVRUWRDVN\RXWRVXUUHQGHUWKHULJKWV
7KHVHUHVWULFWLRQVWUDQVODWHWRFHUWDLQUHVSRQVLELOLWLHVIRU\RXLI
\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\RULI\RXPRGLI\LW
)RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\ZKHWKHUJUDWLV
- 48 -
RUIRUDIHH\RXPXVWJLYHWKHUHFLSLHQWVDOOWKHULJKWVWKDWZHJDYH
\RX <RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKHVRXUFH
FRGH ,I\RXOLQNDSURJUDPZLWKWKHOLEUDU\\RXPXVWSURYLGH
FRPSOHWHREMHFWILOHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQUHOLQNWKHP
ZLWKWKHOLEUDU\DIWHUPDNLQJFKDQJHVWRWKHOLEUDU\DQGUHFRPSLOLQJ
LW $QG\RXPXVWVKRZWKHPWKHVHWHUPVVRWKH\NQRZWKHLUULJKWV
2XUPHWKRGRISURWHFWLQJ\RXUULJKWVKDVWZRVWHSV FRS\ULJKW
WKHOLEUDU\DQG RIIHU\RXWKLVOLFHQVHZKLFKJLYHV\RXOHJDO
SHUPLVVLRQWRFRS\GLVWULEXWHDQGRUPRGLI\WKHOLEUDU\
$OVRIRUHDFKGLVWULEXWRU VSURWHFWLRQZHZDQWWRPDNHFHUWDLQ
WKDWHYHU\RQHXQGHUVWDQGVWKDWWKHUHLVQRZDUUDQW\IRUWKLVIUHH
OLEUDU\ ,IWKHOLEUDU\LVPRGLILHGE\VRPHRQHHOVHDQGSDVVHGRQZH
ZDQWLWVUHFLSLHQWVWRNQRZWKDWZKDWWKH\KDYHLVQRWWKHRULJLQDO
YHUVLRQVRWKDWDQ\SUREOHPVLQWURGXFHGE\RWKHUVZLOOQRWUHIOHFWRQ
WKHRULJLQDODXWKRUV UHSXWDWLRQV
)LQDOO\DQ\IUHHSURJUDPLVWKUHDWHQHGFRQVWDQWO\E\VRIWZDUH
SDWHQWV :HZLVKWRDYRLGWKHGDQJHUWKDWFRPSDQLHVGLVWULEXWLQJIUHH
VRIWZDUHZLOOLQGLYLGXDOO\REWDLQSDWHQWOLFHQVHVWKXVLQHIIHFW
WUDQVIRUPLQJWKHSURJUDPLQWRSURSULHWDU\VRIWZDUH 7RSUHYHQWWKLV
ZHKDYHPDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH V
IUHHXVHRUQRWOLFHQVHGDWDOO
0RVW*18VRIWZDUHLQFOXGLQJVRPHOLEUDULHVLVFRYHUHGE\WKHRUGLQDU\
*18*HQHUDO3XEOLF/LFHQVHZKLFKZDVGHVLJQHGIRUXWLOLW\SURJUDPV 7KLV
OLFHQVHWKH*18/LEUDU\*HQHUDO3XEOLF/LFHQVHDSSOLHVWRFHUWDLQ
GHVLJQDWHGOLEUDULHV 7KLVOLFHQVHLVTXLWHGLIIHUHQWIURPWKHRUGLQDU\
RQHEHVXUHWRUHDGLWLQIXOODQGGRQ WDVVXPHWKDWDQ\WKLQJLQLWLV
WKHVDPHDVLQWKHRUGLQDU\OLFHQVH
7KHUHDVRQZHKDYHDVHSDUDWHSXEOLFOLFHQVHIRUVRPHOLEUDULHVLVWKDW
WKH\EOXUWKHGLVWLQFWLRQZHXVXDOO\PDNHEHWZHHQPRGLI\LQJRUDGGLQJWRD
SURJUDPDQGVLPSO\XVLQJLW /LQNLQJDSURJUDPZLWKDOLEUDU\ZLWKRXW
FKDQJLQJWKHOLEUDU\LVLQVRPHVHQVHVLPSO\XVLQJWKHOLEUDU\DQGLV
DQDORJRXVWRUXQQLQJDXWLOLW\SURJUDPRUDSSOLFDWLRQSURJUDP +RZHYHULQ
DWH[WXDODQGOHJDOVHQVHWKHOLQNHGH[HFXWDEOHLVDFRPELQHGZRUND
- 49 -
GHULYDWLYHRIWKHRULJLQDOOLEUDU\DQGWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH
WUHDWVLWDVVXFK
%HFDXVHRIWKLVEOXUUHGGLVWLQFWLRQXVLQJWKHRUGLQDU\*HQHUDO
3XEOLF/LFHQVHIRUOLEUDULHVGLGQRWHIIHFWLYHO\SURPRWHVRIWZDUH
VKDULQJEHFDXVHPRVWGHYHORSHUVGLGQRWXVHWKHOLEUDULHV :H
FRQFOXGHGWKDWZHDNHUFRQGLWLRQVPLJKWSURPRWHVKDULQJEHWWHU
+RZHYHUXQUHVWULFWHGOLQNLQJRIQRQIUHHSURJUDPVZRXOGGHSULYHWKH
XVHUVRIWKRVHSURJUDPVRIDOOEHQHILWIURPWKHIUHHVWDWXVRIWKH
OLEUDULHVWKHPVHOYHV 7KLV/LEUDU\*HQHUDO3XEOLF/LFHQVHLVLQWHQGHGWR
SHUPLWGHYHORSHUVRIQRQIUHHSURJUDPVWRXVHIUHHOLEUDULHVZKLOH
SUHVHUYLQJ\RXUIUHHGRPDVDXVHURIVXFKSURJUDPVWRFKDQJHWKHIUHH
OLEUDULHVWKDWDUHLQFRUSRUDWHGLQWKHP :HKDYHQRWVHHQKRZWRDFKLHYH
WKLVDVUHJDUGVFKDQJHVLQKHDGHUILOHVEXWZHKDYHDFKLHYHGLWDVUHJDUGV
FKDQJHVLQWKHDFWXDOIXQFWLRQVRIWKH/LEUDU\ 7KHKRSHLVWKDWWKLV
ZLOOOHDGWRIDVWHUGHYHORSPHQWRIIUHHOLEUDULHV
7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLRQDQG
PRGLILFDWLRQIROORZ 3D\FORVHDWWHQWLRQWRWKHGLIIHUHQFHEHWZHHQD
ZRUNEDVHGRQWKHOLEUDU\DQGDZRUNWKDWXVHVWKHOLEUDU\ 7KH
IRUPHUFRQWDLQVFRGHGHULYHGIURPWKHOLEUDU\ZKLOHWKHODWWHURQO\
ZRUNVWRJHWKHUZLWKWKHOLEUDU\
1RWHWKDWLWLVSRVVLEOHIRUDOLEUDU\WREHFRYHUHGE\WKHRUGLQDU\
*HQHUDO3XEOLF/LFHQVHUDWKHUWKDQE\WKLVVSHFLDORQH
*18/,%5$5<*(1(5$/38%/,&/,&(16(
7(506$1'&21',7,216)25&23<,1*',675,%87,21$1'02',),&$7,21
7KLV/LFHQVH$JUHHPHQWDSSOLHVWRDQ\VRIWZDUHOLEUDU\ZKLFK
FRQWDLQVDQRWLFHSODFHGE\WKHFRS\ULJKWKROGHURURWKHUDXWKRUL]HG
SDUW\VD\LQJLWPD\EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV/LEUDU\
*HQHUDO3XEOLF/LFHQVH DOVRFDOOHGWKLV/LFHQVH (DFKOLFHQVHHLV
DGGUHVVHGDV\RX
$OLEUDU\PHDQVDFROOHFWLRQRIVRIWZDUHIXQFWLRQVDQGRUGDWD
SUHSDUHGVRDVWREHFRQYHQLHQWO\OLQNHGZLWKDSSOLFDWLRQSURJUDPV
- 50 -
ZKLFKXVHVRPHRIWKRVHIXQFWLRQVDQGGDWD WRIRUPH[HFXWDEOHV
7KH/LEUDU\EHORZUHIHUVWRDQ\VXFKVRIWZDUHOLEUDU\RUZRUN
ZKLFKKDVEHHQGLVWULEXWHGXQGHUWKHVHWHUPV $ZRUNEDVHGRQWKH
/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\GHULYDWLYHZRUNXQGHU
FRS\ULJKWODZWKDWLVWRVD\DZRUNFRQWDLQLQJWKH/LEUDU\RUD
SRUWLRQRILWHLWKHUYHUEDWLPRUZLWKPRGLILFDWLRQVDQGRUWUDQVODWHG
VWUDLJKWIRUZDUGO\LQWRDQRWKHUODQJXDJH +HUHLQDIWHUWUDQVODWLRQLV
LQFOXGHGZLWKRXWOLPLWDWLRQLQWKHWHUPPRGLILFDWLRQ 6RXUFHFRGHIRUDZRUNPHDQVWKHSUHIHUUHGIRUPRIWKHZRUNIRU
PDNLQJPRGLILFDWLRQVWRLW )RUDOLEUDU\FRPSOHWHVRXUFHFRGHPHDQV
DOOWKHVRXUFHFRGHIRUDOOPRGXOHVLWFRQWDLQVSOXVDQ\DVVRFLDWHG
LQWHUIDFHGHILQLWLRQILOHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQ
DQGLQVWDOODWLRQRIWKHOLEUDU\
$FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQDUHQRW
FRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWVVFRSH 7KHDFWRI
UXQQLQJDSURJUDPXVLQJWKH/LEUDU\LVQRWUHVWULFWHGDQGRXWSXWIURP
VXFKDSURJUDPLVFRYHUHGRQO\LILWVFRQWHQWVFRQVWLWXWHDZRUNEDVHG
RQWKH/LEUDU\ LQGHSHQGHQWRIWKHXVHRIWKH/LEUDU\LQDWRROIRU
ZULWLQJLW :KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH/LEUDU\GRHV
DQGZKDWWKHSURJUDPWKDWXVHVWKH/LEUDU\GRHV
<RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH/LEUDU\ V
FRPSOHWHVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\PHGLXPSURYLGHGWKDW
\RXFRQVSLFXRXVO\DQGDSSURSULDWHO\SXEOLVKRQHDFKFRS\DQ
DSSURSULDWHFRS\ULJKWQRWLFHDQGGLVFODLPHURIZDUUDQW\NHHSLQWDFW
DOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRIDQ\
ZDUUDQW\DQGGLVWULEXWHDFRS\RIWKLV/LFHQVHDORQJZLWKWKH
/LEUDU\
<RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\
DQG\RXPD\DW\RXURSWLRQRIIHUZDUUDQW\SURWHFWLRQLQH[FKDQJHIRUD
IHH
<RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RUDQ\SRUWLRQ
RILWWKXVIRUPLQJDZRUNEDVHGRQWKH/LEUDU\DQGFRS\DQG
- 51 -
GLVWULEXWHVXFKPRGLILFDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQ
DERYHSURYLGHGWKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV
D 7KHPRGLILHGZRUNPXVWLWVHOIEHDVRIWZDUHOLEUDU\
E <RXPXVWFDXVHWKHILOHVPRGLILHGWRFDUU\SURPLQHQWQRWLFHV
VWDWLQJWKDW\RXFKDQJHGWKHILOHVDQGWKHGDWHRIDQ\FKDQJH
F <RXPXVWFDXVHWKHZKROHRIWKHZRUNWREHOLFHQVHGDWQR
FKDUJHWRDOOWKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH
G ,IDIDFLOLW\LQWKHPRGLILHG/LEUDU\UHIHUVWRDIXQFWLRQRUD
WDEOHRIGDWDWREHVXSSOLHGE\DQDSSOLFDWLRQSURJUDPWKDWXVHV
WKHIDFLOLW\RWKHUWKDQDVDQDUJXPHQWSDVVHGZKHQWKHIDFLOLW\
LVLQYRNHGWKHQ\RXPXVWPDNHDJRRGIDLWKHIIRUWWRHQVXUHWKDW
LQWKHHYHQWDQDSSOLFDWLRQGRHVQRWVXSSO\VXFKIXQFWLRQRU
WDEOHWKHIDFLOLW\VWLOORSHUDWHVDQGSHUIRUPVZKDWHYHUSDUWRI
LWVSXUSRVHUHPDLQVPHDQLQJIXO
)RUH[DPSOHDIXQFWLRQLQDOLEUDU\WRFRPSXWHVTXDUHURRWVKDV
DSXUSRVHWKDWLVHQWLUHO\ZHOOGHILQHGLQGHSHQGHQWRIWKH
DSSOLFDWLRQ 7KHUHIRUH6XEVHFWLRQGUHTXLUHVWKDWDQ\
DSSOLFDWLRQVXSSOLHGIXQFWLRQRUWDEOHXVHGE\WKLVIXQFWLRQPXVW
EHRSWLRQDOLIWKHDSSOLFDWLRQGRHVQRWVXSSO\LWWKHVTXDUH
URRWIXQFWLRQPXVWVWLOOFRPSXWHVTXDUHURRWV 7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGLILHGZRUNDVDZKROH ,I
LGHQWLILDEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHGIURPWKH/LEUDU\
DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQGVHSDUDWHZRUNVLQ
WKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPVGRQRWDSSO\WRWKRVH
VHFWLRQVZKHQ\RXGLVWULEXWHWKHPDVVHSDUDWHZRUNV %XWZKHQ\RX
GLVWULEXWHWKHVDPHVHFWLRQVDVSDUWRIDZKROHZKLFKLVDZRUNEDVHG
RQWKH/LEUDU\WKHGLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRI
WKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQGWRWKH
HQWLUHZKROHDQGWKXVWRHDFKDQGHYHU\SDUWUHJDUGOHVVRIZKRZURWH
LW
7KXVLWLVQRWWKHLQWHQWRIWKLVVHFWLRQWRFODLPULJKWVRUFRQWHVW
- 52 -
\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHUWKHLQWHQWLVWR
H[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRU
FROOHFWLYHZRUNVEDVHGRQWKH/LEUDU\
,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRWEDVHGRQWKH/LEUDU\
ZLWKWKH/LEUDU\ RUZLWKDZRUNEDVHGRQWKH/LEUDU\ RQDYROXPHRI
DVWRUDJHRUGLVWULEXWLRQPHGLXPGRHVQRWEULQJWKHRWKHUZRUNXQGHU
WKHVFRSHRIWKLV/LFHQVH
<RXPD\RSWWRDSSO\WKHWHUPVRIWKHRUGLQDU\*18*HQHUDO3XEOLF
/LFHQVHLQVWHDGRIWKLV/LFHQVHWRDJLYHQFRS\RIWKH/LEUDU\ 7RGR
WKLV\RXPXVWDOWHUDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHVR
WKDWWKH\UHIHUWRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQ
LQVWHDGRIWRWKLV/LFHQVH ,IDQHZHUYHUVLRQWKDQYHUVLRQRIWKH
RUGLQDU\*18*HQHUDO3XEOLF/LFHQVHKDVDSSHDUHGWKHQ\RXFDQVSHFLI\
WKDWYHUVLRQLQVWHDGLI\RXZLVK 'RQRWPDNHDQ\RWKHUFKDQJHLQ
WKHVHQRWLFHV
2QFHWKLVFKDQJHLVPDGHLQDJLYHQFRS\LWLVLUUHYHUVLEOHIRU
WKDWFRS\VRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHDSSOLHVWRDOO
VXEVHTXHQWFRSLHVDQGGHULYDWLYHZRUNVPDGHIURPWKDWFRS\
7KLVRSWLRQLVXVHIXOZKHQ\RXZLVKWRFRS\SDUWRIWKHFRGHRI
WKH/LEUDU\LQWRDSURJUDPWKDWLVQRWDOLEUDU\
<RXPD\FRS\DQGGLVWULEXWHWKH/LEUDU\ RUDSRUWLRQRU
GHULYDWLYHRILWXQGHU6HFWLRQ LQREMHFWFRGHRUH[HFXWDEOHIRUP
XQGHUWKHWHUPVRI6HFWLRQVDQGDERYHSURYLGHGWKDW\RXDFFRPSDQ\
LWZLWKWKHFRPSOHWHFRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHZKLFK
PXVWEHGLVWULEXWHGXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHRQD
PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJH
,IGLVWULEXWLRQRIREMHFWFRGHLVPDGHE\RIIHULQJDFFHVVWRFRS\
IURPDGHVLJQDWHGSODFHWKHQRIIHULQJHTXLYDOHQWDFFHVVWRFRS\WKH
VRXUFHFRGHIURPWKHVDPHSODFHVDWLVILHVWKHUHTXLUHPHQWWR
GLVWULEXWHWKHVRXUFHFRGHHYHQWKRXJKWKLUGSDUWLHVDUHQRW
FRPSHOOHGWRFRS\WKHVRXUFHDORQJZLWKWKHREMHFWFRGH
- 53 -
$SURJUDPWKDWFRQWDLQVQRGHULYDWLYHRIDQ\SRUWLRQRIWKH
/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\E\EHLQJFRPSLOHGRU
OLQNHGZLWKLWLVFDOOHGDZRUNWKDWXVHVWKH/LEUDU\ 6XFKD
ZRUNLQLVRODWLRQLVQRWDGHULYDWLYHZRUNRIWKH/LEUDU\DQG
WKHUHIRUHIDOOVRXWVLGHWKHVFRSHRIWKLV/LFHQVH
+RZHYHUOLQNLQJDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH/LEUDU\
FUHDWHVDQH[HFXWDEOHWKDWLVDGHULYDWLYHRIWKH/LEUDU\ EHFDXVHLW
FRQWDLQVSRUWLRQVRIWKH/LEUDU\ UDWKHUWKDQDZRUNWKDWXVHVWKH
OLEUDU\ 7KHH[HFXWDEOHLVWKHUHIRUHFRYHUHGE\WKLV/LFHQVH
6HFWLRQVWDWHVWHUPVIRUGLVWULEXWLRQRIVXFKH[HFXWDEOHV
:KHQDZRUNWKDWXVHVWKH/LEUDU\XVHVPDWHULDOIURPDKHDGHUILOH
WKDWLVSDUWRIWKH/LEUDU\WKHREMHFWFRGHIRUWKHZRUNPD\EHD
GHULYDWLYHZRUNRIWKH/LEUDU\HYHQWKRXJKWKHVRXUFHFRGHLVQRW
:KHWKHUWKLVLVWUXHLVHVSHFLDOO\VLJQLILFDQWLIWKHZRUNFDQEH
OLQNHGZLWKRXWWKH/LEUDU\RULIWKHZRUNLVLWVHOIDOLEUDU\ 7KH
WKUHVKROGIRUWKLVWREHWUXHLVQRWSUHFLVHO\GHILQHGE\ODZ
,IVXFKDQREMHFWILOHXVHVRQO\QXPHULFDOSDUDPHWHUVGDWD
VWUXFWXUHOD\RXWVDQGDFFHVVRUVDQGVPDOOPDFURVDQGVPDOOLQOLQH
IXQFWLRQV WHQOLQHVRUOHVVLQOHQJWK WKHQWKHXVHRIWKHREMHFW
ILOHLVXQUHVWULFWHGUHJDUGOHVVRIZKHWKHULWLVOHJDOO\DGHULYDWLYH
ZRUN ([HFXWDEOHVFRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRIWKH
/LEUDU\ZLOOVWLOOIDOOXQGHU6HFWLRQ 2WKHUZLVHLIWKHZRUNLVDGHULYDWLYHRIWKH/LEUDU\\RXPD\
GLVWULEXWHWKHREMHFWFRGHIRUWKHZRUNXQGHUWKHWHUPVRI6HFWLRQ
$Q\H[HFXWDEOHVFRQWDLQLQJWKDWZRUNDOVRIDOOXQGHU6HFWLRQ
ZKHWKHURUQRWWKH\DUHOLQNHGGLUHFWO\ZLWKWKH/LEUDU\LWVHOI
$VDQH[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\DOVRFRPSLOHRU
OLQNDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH/LEUDU\WRSURGXFHD
ZRUNFRQWDLQLQJSRUWLRQVRIWKH/LEUDU\DQGGLVWULEXWHWKDWZRUN
XQGHUWHUPVRI\RXUFKRLFHSURYLGHGWKDWWKHWHUPVSHUPLW
PRGLILFDWLRQRIWKHZRUNIRUWKHFXVWRPHU VRZQXVHDQGUHYHUVH
HQJLQHHULQJIRUGHEXJJLQJVXFKPRGLILFDWLRQV
- 54 -
<RXPXVWJLYHSURPLQHQWQRWLFHZLWKHDFKFRS\RIWKHZRUNWKDWWKH
/LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\DQGLWVXVHDUHFRYHUHGE\
WKLV/LFHQVH <RXPXVWVXSSO\DFRS\RIWKLV/LFHQVH ,IWKHZRUN
GXULQJH[HFXWLRQGLVSOD\VFRS\ULJKWQRWLFHV\RXPXVWLQFOXGHWKH
FRS\ULJKWQRWLFHIRUWKH/LEUDU\DPRQJWKHPDVZHOODVDUHIHUHQFH
GLUHFWLQJWKHXVHUWRWKHFRS\RIWKLV/LFHQVH $OVR\RXPXVWGRRQH
RIWKHVHWKLQJV
D $FFRPSDQ\WKHZRUNZLWKWKHFRPSOHWHFRUUHVSRQGLQJ
PDFKLQHUHDGDEOHVRXUFHFRGHIRUWKH/LEUDU\LQFOXGLQJZKDWHYHU
FKDQJHVZHUHXVHGLQWKHZRUN ZKLFKPXVWEHGLVWULEXWHGXQGHU
6HFWLRQVDQGDERYH DQGLIWKHZRUNLVDQH[HFXWDEOHOLQNHG
ZLWKWKH/LEUDU\ZLWKWKHFRPSOHWHPDFKLQHUHDGDEOHZRUNWKDW
XVHVWKH/LEUDU\DVREMHFWFRGHDQGRUVRXUFHFRGHVRWKDWWKH
XVHUFDQPRGLI\WKH/LEUDU\DQGWKHQUHOLQNWRSURGXFHDPRGLILHG
H[HFXWDEOHFRQWDLQLQJWKHPRGLILHG/LEUDU\ ,WLVXQGHUVWRRG
WKDWWKHXVHUZKRFKDQJHVWKHFRQWHQWVRIGHILQLWLRQVILOHVLQWKH
/LEUDU\ZLOOQRWQHFHVVDULO\EHDEOHWRUHFRPSLOHWKHDSSOLFDWLRQ
WRXVHWKHPRGLILHGGHILQLWLRQV E $FFRPSDQ\WKHZRUNZLWKDZULWWHQRIIHUYDOLGIRUDW
OHDVWWKUHH\HDUVWRJLYHWKHVDPHXVHUWKHPDWHULDOV
VSHFLILHGLQ6XEVHFWLRQDDERYHIRUDFKDUJHQRPRUH
WKDQWKHFRVWRISHUIRUPLQJWKLVGLVWULEXWLRQ
F ,IGLVWULEXWLRQRIWKHZRUNLVPDGHE\RIIHULQJDFFHVVWRFRS\
IURPDGHVLJQDWHGSODFHRIIHUHTXLYDOHQWDFFHVVWRFRS\WKHDERYH
VSHFLILHGPDWHULDOVIURPWKHVDPHSODFH
G 9HULI\WKDWWKHXVHUKDVDOUHDG\UHFHLYHGDFRS\RIWKHVH
PDWHULDOVRUWKDW\RXKDYHDOUHDG\VHQWWKLVXVHUDFRS\
)RUDQH[HFXWDEOHWKHUHTXLUHGIRUPRIWKHZRUNWKDWXVHVWKH
/LEUDU\PXVWLQFOXGHDQ\GDWDDQGXWLOLW\SURJUDPVQHHGHGIRU
UHSURGXFLQJWKHH[HFXWDEOHIURPLW +RZHYHUDVDVSHFLDOH[FHSWLRQ
WKHVRXUFHFRGHGLVWULEXWHGQHHGQRWLQFOXGHDQ\WKLQJWKDWLVQRUPDOO\
GLVWULEXWHG LQHLWKHUVRXUFHRUELQDU\IRUP ZLWKWKHPDMRU
FRPSRQHQWV FRPSLOHUNHUQHODQGVRRQ RIWKHRSHUDWLQJV\VWHPRQ
- 55 -
ZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQWLWVHOIDFFRPSDQLHV
WKHH[HFXWDEOH
,WPD\KDSSHQWKDWWKLVUHTXLUHPHQWFRQWUDGLFWVWKHOLFHQVH
UHVWULFWLRQVRIRWKHUSURSULHWDU\OLEUDULHVWKDWGRQRWQRUPDOO\
DFFRPSDQ\WKHRSHUDWLQJV\VWHP 6XFKDFRQWUDGLFWLRQPHDQV\RXFDQQRW
XVHERWKWKHPDQGWKH/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RX
GLVWULEXWH
<RXPD\SODFHOLEUDU\IDFLOLWLHVWKDWDUHDZRUNEDVHGRQWKH
/LEUDU\VLGHE\VLGHLQDVLQJOHOLEUDU\WRJHWKHUZLWKRWKHUOLEUDU\
IDFLOLWLHVQRWFRYHUHGE\WKLV/LFHQVHDQGGLVWULEXWHVXFKDFRPELQHG
OLEUDU\SURYLGHGWKDWWKHVHSDUDWHGLVWULEXWLRQRIWKHZRUNEDVHGRQ
WKH/LEUDU\DQGRIWKHRWKHUOLEUDU\IDFLOLWLHVLVRWKHUZLVH
SHUPLWWHGDQGSURYLGHGWKDW\RXGRWKHVHWZRWKLQJV
D $FFRPSDQ\WKHFRPELQHGOLEUDU\ZLWKDFRS\RIWKHVDPHZRUN
EDVHGRQWKH/LEUDU\XQFRPELQHGZLWKDQ\RWKHUOLEUDU\
IDFLOLWLHV 7KLVPXVWEHGLVWULEXWHGXQGHUWKHWHUPVRIWKH
6HFWLRQVDERYH
E *LYHSURPLQHQWQRWLFHZLWKWKHFRPELQHGOLEUDU\RIWKHIDFW
WKDWSDUWRILWLVDZRUNEDVHGRQWKH/LEUDU\DQGH[SODLQLQJ
ZKHUHWRILQGWKHDFFRPSDQ\LQJXQFRPELQHGIRUPRIWKHVDPHZRUN
<RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWH
WKH/LEUDU\H[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH $Q\
DWWHPSWRWKHUZLVHWRFRS\PRGLI\VXEOLFHQVHOLQNZLWKRU
GLVWULEXWHWKH/LEUDU\LVYRLGDQGZLOODXWRPDWLFDOO\WHUPLQDWH\RXU
ULJKWVXQGHUWKLV/LFHQVH +RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHV
RUULJKWVIURP\RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHV
WHUPLQDWHGVRORQJDVVXFKSDUWLHVUHPDLQLQIXOOFRPSOLDQFH
<RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYHQRW
VLJQHGLW +RZHYHUQRWKLQJHOVHJUDQWV\RXSHUPLVVLRQWRPRGLI\RU
GLVWULEXWHWKH/LEUDU\RULWVGHULYDWLYHZRUNV 7KHVHDFWLRQVDUH
SURKLELWHGE\ODZLI\RXGRQRWDFFHSWWKLV/LFHQVH 7KHUHIRUHE\
PRGLI\LQJRUGLVWULEXWLQJWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH
- 56 -
/LEUDU\ \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQG
DOOLWVWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLQJRUPRGLI\LQJ
WKH/LEUDU\RUZRUNVEDVHGRQLW
(DFKWLPH\RXUHGLVWULEXWHWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH
/LEUDU\ WKHUHFLSLHQWDXWRPDWLFDOO\UHFHLYHVDOLFHQVHIURPWKH
RULJLQDOOLFHQVRUWRFRS\GLVWULEXWHOLQNZLWKRUPRGLI\WKH/LEUDU\
VXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV <RXPD\QRWLPSRVHDQ\IXUWKHU
UHVWULFWLRQVRQWKHUHFLSLHQWV H[HUFLVHRIWKHULJKWVJUDQWHGKHUHLQ
<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVWR
WKLV/LFHQVH
,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQRISDWHQW
LQIULQJHPHQWRUIRUDQ\RWKHUUHDVRQ QRWOLPLWHGWRSDWHQWLVVXHV FRQGLWLRQVDUHLPSRVHGRQ\RX ZKHWKHUE\FRXUWRUGHUDJUHHPHQWRU
RWKHUZLVH WKDWFRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRW
H[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH ,I\RXFDQQRW
GLVWULEXWHVRDVWRVDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV
/LFHQVHDQGDQ\RWKHUSHUWLQHQWREOLJDWLRQVWKHQDVDFRQVHTXHQFH\RX
PD\QRWGLVWULEXWHWKH/LEUDU\DWDOO )RUH[DPSOHLIDSDWHQW
OLFHQVHZRX