Canon | i-SENSYS LBP852Cx | User manual | Canon i-SENSYS LBP852Cx User manual

Canon i-SENSYS LBP852Cx User manual
LBP852Cx
Podręcznik użytkownika
USRMA-4096-00 2019-09 pl
Copyright CANON INC. 2019
Spis treści
Ważne instrukcje dotyczące bezpieczeństwa ........................................................................
Instalacja
2
.................................................................................................................................................................. 3
Źródło zasilania
......................................................................................................................................................... 5
................................................................................................................................................... 6
Obsługa urządzenia
Konserwacja i przeglądy
............................................................................................................................................ 9
Materiały eksploatacyjne
........................................................................................................................................ 10
Podstawowe informacje na temat obsługi ............................................................................ 15
Główne funkcje
....................................................................................................................................................... 17
Części i ich funkcje
.................................................................................................................................................. 19
Strona przednia
.................................................................................................................................................. 20
Strona tylna
Wnętrze
....................................................................................................................................................... 22
............................................................................................................................................................. 24
Taca uniwersalna
................................................................................................................................................ 25
Szuflada na papier
Panel sterowania
Wyświetlacz
.............................................................................................................................................. 26
................................................................................................................................................ 27
................................................................................................................................................. 30
Korzystanie z panelu sterowania
Wprowadzanie tekstu
............................................................................................................................. 32
.......................................................................................................................................... 35
Włączanie/wyłączanie zasilania
............................................................................................................................... 37
......................................................................................................................... 39
Szybkie uruchamianie urządzenia
Ładowanie papieru
.................................................................................................................................................. 41
Umieszczanie papieru w szufladzie na papier
Ładowanie papieru na tacę wielofunkcyjną
Ładowanie kopert lub pocztówek
......................................................................................................... 43
............................................................................................................ 49
.......................................................................................................................... 52
Ładowanie uprzednio zadrukowanego papieru
Określanie formatu i typu papieru
...................................................................................................... 56
........................................................................................................................ 60
Określanie formatu i typu papieru załadowanego w szufladzie na papier
............................................................. 61
Określanie rozmiaru i typu papieru załadowanego na tacę wielofunkcyjną
Oszczędzanie energii
........................................................... 64
............................................................................................................................................... 67
Przechodzenie w tryb uśpienia
............................................................................................................................. 68
Ustawianie czasu automatycznego wyłączania
....................................................................................................... 71
Drukowanie dokumentu .......................................................................................................................
Drukowanie z komputera
75
........................................................................................................................................ 76
Anulowanie drukowania
...................................................................................................................................... 79
Różne metody drukowania
...................................................................................................................................... 81
Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB)
Zmiana ustawień domyślnych wydruku z urządzenia USB
........................................................................ 83
.................................................................................. 93
Drukowanie dokumentu zabezpieczonego kodem PIN (Zabezpieczone drukowanie)
Drukowanie szyfrowane
................................................... 95
................................................................................................................................ 99
I
Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)
Usuwanie dokumentu zapisanego w urządzeniu
Ustawianie nazwy lub kodu PIN dla sektora
............................................... 100
............................................................................................ 104
................................................................................................... 108
Drukowanie bez otwierania pliku (Wydruk bezpośredni)
........................................................................................ 110
Ustawienia drukowania dla funkcji drukowania bezpośredniego
Drukowanie odebranej wiadomości e-mail (Drukowanie e-maili)
...................................................................... 113
............................................................................. 125
Wygodna współpraca z urządzeniami przenośnymi .................................................... 132
Podłączanie do urządzenia mobilnego
................................................................................................................... 133
Eksploatacja urządzenia z poziomu aplikacji
Korzystanie z technologii AirPrint
.......................................................................................................... 134
....................................................................................................................... 136
Drukowanie z użyciem technologii AirPrint
.................................................................................................... 140
Jeśli nie można skorzystać z technologii AirPrint
Korzystanie z technologii Google Cloud Print
Zdalne zarządzanie urządzeniem
............................................................................................. 143
....................................................................................................... 144
........................................................................................................................... 148
Sieć ........................................................................................................................................................................
Podłączanie do sieci
150
.............................................................................................................................................. 151
Podłączanie do sieci przewodowej LAN
Konfiguracja adresu IP
................................................................................................................ 153
...................................................................................................................................... 155
Ustawianie adresu IPv4
............................................................................................................................... 156
Konfiguracja adresów IPv6
.......................................................................................................................... 161
Konfiguracja urządzenia w celu drukowania danych z komputera
Konfiguracja protokołów drukowania i funkcji protokołu WSD
Włączanie protokołu IPP/IPPS
Konfiguracja serwera wydruku
................................................................................ 166
...................................................................................................................... 172
........................................................................................................................... 179
Konfiguracja urządzenia w danym środowisku sieciowym
Konfiguracja ustawień sieci Ethernet
...................................................................................... 183
................................................................................................................... 184
Ustawianie czasu oczekiwania na połączenie z siecią
Konfiguracja usługi DNS
........................................................................... 165
............................................................................................. 186
.................................................................................................................................... 187
Konfiguracja usługi WINS
.................................................................................................................................. 193
Konfiguracja protokołu SNTP
............................................................................................................................. 196
Monitorowanie i kontrolowanie urządzenia za pomocą protokołu SNMP
Konfiguracja ustawień oprogramowania zarządzania urządzeniami
Konfiguracja protokołu SMB
................................................................. 199
........................................................................ 205
.............................................................................................................................. 209
Konfiguracja ustawień drukowania na komputerze
......................................................................................... 212
Zabezpieczenia ............................................................................................................................................
Ochrona urządzenia przed nieupoważnionym dostępem
Zapobieganie nieupoważnionemu dostępowi
Ustawienia uprawnień dostępu
216
........................................................................................ 217
...................................................................................................... 218
.......................................................................................................................... 220
Ustawianie hasła menedżera systemu
........................................................................................................... 221
Konfiguracja funkcji Zarządzanie identyfikatorami wydziałów
Ustawiania kodu PIN Zdalnego interfejsu użytkownika
Ograniczenie komunikacji za pomocą zapory
........................................................................... 224
.................................................................................... 232
....................................................................................................... 234
II
Określanie adresów IP dla zasad zapory
........................................................................................................ 235
Określanie adresów MAC dla zasad zapory
Ustawienia proxy
.................................................................................................... 241
.............................................................................................................................................. 245
Ograniczanie funkcji urządzenia
............................................................................................................................ 248
Ograniczanie funkcji drukowania
Ograniczenie funkcji USB
........................................................................................................................ 249
................................................................................................................................... 252
Ograniczanie funkcji panelu roboczego
............................................................................................................... 255
Wyłączanie komunikacji z użyciem protokołu HTTP
Wyłączanie Zdalnego interfejsu użytkownika
Wyłączanie portu LAN
............................................................................................... 258
........................................................................................................ 259
....................................................................................................................................... 260
Ukrywanie historii zadań drukowania
.................................................................................................................. 261
Wprowadzenie wydajnych funkcji zabezpieczeń
..................................................................................................... 263
Korzystanie z protokołu TLS do komunikacji szyfrowanej
Konfiguracja ustawień protokołu IPSec
....................................................................................... 265
................................................................................................................ 269
Konfiguracja uwierzytelniania zgodnego z IEEE 802.1X
.......................................................................................... 279
Konfiguracja ustawień dla par kluczy i certyfikatów cyfrowych
Generowanie par kluczy
................................................................................ 284
.............................................................................................................................. 285
Używanie wygenerowanych przez CA par kluczy i certyfikatów cyfrowych
Weryfikowanie par kluczy i certyfikatów cyfrowych
.......................................................... 293
......................................................................................... 296
Korzystanie ze Zdalnego interfejsu użytkownika .......................................................... 299
Uruchamianie Zdalnego interfejsu użytkownika
Ekrany zdalnego interfejsu użytkownika
.................................................................................................... 300
................................................................................................................ 303
Zarządzanie dokumentami i sprawdzanie stanu urządzenia
.................................................................................... 309
Umożliwianie użytkownikom końcowym obsługiwanie dokumentów
Konfiguracja opcji menu ze Zdalnego interfejsu użytkownika
Zapisywanie/ładowanie zarejestrowanych danych
Zapisywanie zarejestrowanych danych
Ładowanie zarejestrowanych danych
....................................................................... 315
................................................................................. 317
................................................................................................. 319
................................................................................................................ 320
.................................................................................................................. 322
Lista menu ustawień .............................................................................................................................. 325
Menu konfiguracji
................................................................................................................................................. 326
Menu sterowania
Źródło papieru
Sieć
.............................................................................................................................................. 327
................................................................................................................................................. 346
................................................................................................................................................................. 347
Układ
.............................................................................................................................................................. 369
Jakość wydruku
Interfejs
................................................................................................................................................ 373
.......................................................................................................................................................... 388
Konserw. użytkownika
....................................................................................................................................... 392
Priorytet pozycji menu ustawień
Tryb wydruku
................................................................................................................... 420
................................................................................................................................................... 421
Ustawienia specyficzne dla trybu drukowania
UFR II
PCL
...................................................................................................... 423
........................................................................................................................................................ 424
........................................................................................................................................................... 425
Przetwarzanie obrazu
................................................................................................................................. 431
III
XPS
........................................................................................................................................................... 442
PDF
........................................................................................................................................................... 453
PS
............................................................................................................................................................. 464
.............................................................................................................................................. 475
Ustawienia MEAP
Sprawdź licznik
................................................................................................................................................. 477
Zainicjuj menu
................................................................................................................................................. 479
Menu podręczne
Menu zadań
................................................................................................................................................... 480
.......................................................................................................................................................... 486
Menu resetowania
................................................................................................................................................ 488
Menu wyboru podajnika
........................................................................................................................................ 491
Rozwiązywanie problemów (FAQ) ...............................................................................................
501
Konserwacja urządzenia .....................................................................................................................
503
Czyszczenie urządzenia
Obudowa
......................................................................................................................................... 505
........................................................................................................................................................ 506
Moduł utrwalania
............................................................................................................................................. 507
.............................................................................................................................. 508
Obszar dostarczania papieru
Wymiana zasobników z tonerem
........................................................................................................................... 513
Sposób wymiany zasobników z tonerem
Wymiana zespołów bębna
.............................................................................................................. 517
..................................................................................................................................... 520
Wymiana zespołów bębna
................................................................................................................................. 524
Wymiana zasobnika na zużyty toner
...................................................................................................................... 526
Sposób wymiany zasobnika na zużyty toner
Przenoszenie urządzenia
......................................................................................................... 527
....................................................................................................................................... 529
Utrzymanie i poprawa jakości wydruku
................................................................................................................. 531
............................................................................................................................... 532
Regulacja gęstości wydruku
Korekcja niedopasowania kolorów i odcieni
Regulacja położenia wydruku
Drukowanie raportów i list
......................................................................................................... 534
............................................................................................................................. 536
.................................................................................................................................... 541
Wyświetlanie wartości licznika
.............................................................................................................................. 550
Sprawdzanie stanu materiałów eksploatacyjnych
Inicjowanie ustawień
Inicjowanie menu
.................................................................................................. 553
............................................................................................................................................ 556
............................................................................................................................................. 557
Resetowanie ustawień sieciowych
....................................................................................................................... 558
Dodatek ............................................................................................................................................................. 560
Oprogramowanie dostarczone przez strony trzecie
Wyróżnione funkcje
.............................................................................................................................................. 562
Ekologia i niższe koszty
Większa wydajność
...................................................................................................................................... 563
........................................................................................................................................... 564
Więcej funkcji dodatkowych
Dane techniczne
................................................................................................ 561
............................................................................................................................... 566
................................................................................................................................................... 568
Moduł główny
.................................................................................................................................................. 569
IV
Obsługiwane rodzaje papieru
Paper Feeder PF-G
............................................................................................................................................ 577
Cassette Feeding Unit-AU
Funkcje drukarki
.................................................................................................................................. 578
............................................................................................................................................... 579
Funkcje zarządzania
.......................................................................................................................................... 583
Środowisko systemowe
Środowisko sieciowe
..................................................................................................................................... 586
......................................................................................................................................... 587
Materiały eksploatacyjne
Opcje
............................................................................................................................. 571
...................................................................................................................................... 588
.................................................................................................................................................................... 592
Wyposażenie opcjonalne
Opcje systemu
................................................................................................................................... 593
................................................................................................................................................. 594
Instalacja pamięci ROM
............................................................................................................................... 596
Instalacja karty pamięci SD
.......................................................................................................................... 600
Instrukcje obsługi i ich zawartość
.......................................................................................................................... 605
Korzystanie z programu Podręcznik użytkownika
................................................................................................... 606
Układ ekranu programu Podręcznik użytkownika
................................................................................................. 607
Przeglądanie programu Podręcznik użytkownika
.................................................................................................. 610
Zarządzanie aplikacjami MEAP
Korzystanie z klientów FTP
............................................................................................................................... 612
.................................................................................................................................... 613
Przygotowanie do korzystania z serwera FTP
........................................................................................................ 614
Drukowanie za pośrednictwem klienta FTP (Wydruk z FTP)
Definiowanie ustawień za pośrednictwem klienta FTP
Inne
..................................................................................... 617
........................................................................................... 619
..................................................................................................................................................................... 626
Podstawowe operacje systemu Windows
Próbki czcionek
Uwaga
............................................................................................................. 627
................................................................................................................................................ 636
............................................................................................................................................................ 641
V
Ważne instrukcje dotyczące bezpieczeństwa
Ważne instrukcje dotyczące
bezpieczeństwa
Ważne instrukcje dotyczące bezpieczeństwa .................................................................................... 2
Instalacja ............................................................................................................................................................... 3
Źródło zasilania ...................................................................................................................................................... 5
Obsługa urządzenia ............................................................................................................................................... 6
Konserwacja i przeglądy ....................................................................................................................................... 9
Materiały eksploatacyjne .................................................................................................................................... 10
1
Ważne instrukcje dotyczące bezpieczeństwa
Ważne instrukcje dotyczące bezpieczeństwa
6869-000
Ostrzeżenia zawarte w tym rozdziale mają na celu zapobiec uszkodzeniu sprzętu oraz obrażeniom ciała użytkowników
urządzenia i innych osób. Przed rozpoczęciem pracy z urządzeniem zapoznaj się z tym rozdziałem i zastosuj się do
wskazówek, aby prawidłowo korzystać z urządzenia. Nie należy wykonywać żadnych czynności nieopisanych w tym
podręczniku. Firma Canon nie ponosi odpowiedzialności za jakiekolwiek szkody wynikłe z użytkowania innego niż
opisane w tym podręczniku, niewłaściwego użycia lub napraw/zmian wykonanych przez podmiot inny niż firma Canon
lub upoważniona do tego jednostka.
2
Ważne instrukcje dotyczące bezpieczeństwa
Instalacja
6869-001
Aby bezpiecznie i wygodnie korzystać z urządzenia, należy dokładnie zapoznać się z poniższymi środkami ostrożności i
zainstalować urządzenie w odpowiednim miejscu.
Nie należy instalować urządzenia w miejscach, w których może dojść do pożaru lub
porażenia prądem
● miejsca, w których otwory wentylacyjne będą zasłonięte
(zbyt blisko ścian, łóżek, sof, dywanów lub podobnych obiektów)
● miejsca wilgotne lub zakurzone
● miejsca wystawione na bezpośrednie działanie słońca lub na zewnątrz pomieszczeń
● miejsca, w których występują wysokie temperatury
● miejsca wystawione na działanie otwartego ognia
● w pobliżu alkoholi, rozcieńczalników lub innych substancji łatwopalnych
Inne ostrzeżenia
● Do urządzenia nie należy podłączać kabli nieposiadających odpowiednich aprobat. Może to doprowadzić do
pożaru lub porażenia prądem elektrycznym.
● Na urządzeniu nie należy umieszczać naszyjników ani żadnych innych elementów metalowych ani
pojemników wypełnionych płynami. W przypadku kontaktu ciał obcych z częściami elektrycznymi wewnątrz
urządzenia może dojść do pożaru lub porażenia prądem.
● Podczas instalacji i odłączania opcjonalnych akcesoriów należy pamiętać o wyłączeniu zasilania, odłączeniu
wtyczki zasilającej z gniazdka oraz wyjęciu z urządzenia wszystkich kabli interfejsu i zasilających. W
przeciwnym razie może dojść do uszkodzenia kabla zasilającego lub kabla interfejsu, co grozi pożarem lub
porażeniem prądem.
● Jeśli do urządzenia dostanie się ciało obce, należy wyjąć wtyczkę zasilającą z gniazda sieciowego i
skontaktować się z autoryzowanym sprzedawcą produktów firmy Canon.
Nie należy instalować urządzenia w następujących
miejscach
Urządzenie może przewrócić się, powodując obrażenia ciała.
● Miejsce niestabilne
● Miejsce narażone na wibracje
Pozostałe środki ostrożności
● Podczas przenoszenia urządzenia należy przestrzegać instrukcji zawartych w tym podręczniku.
Nieprawidłowo przenoszone urządzenie może upaść, powodując obrażenia.
3
Ważne instrukcje dotyczące bezpieczeństwa
● Podczas instalacji należy uważać, aby ręce nie dostały między urządzenie a podłogę lub ściany. Może to
spowodować obrażenia.
Należy unikać miejsc o słabej wentylacji
● To urządzenie wytwarza podczas normalnej pracy niewielką ilość ozonu i innych gazów. Emisje te nie są
szkodliwe dla zdrowia. Mogą jednak być zauważalne podczas długich cyklów produkcyjnych, zwłaszcza w
pomieszczeniach o słabej wentylacji. W celu utrzymania wygodnego środowiska pracy zaleca się, aby
pomieszczenie, w którym pracuje urządzenie było odpowiednio wentylowane. Ponadto nie należy wybierać
miejsc, w których użytkownicy byliby narażeni na emisje z urządzenia.
Nie należy instalować urządzenia w poniższych miejscach, gdyż grozi to uszkodzeniem
● pomieszczenie, w którym dochodzi do nagłych zmian
temperatury lub wilgotności
● pomieszczenie, w którym działa wyposażenie generujące fale
magnetyczne lub elektromagnetyczne
● laboratorium lub pomieszczenie, w którym przeprowadzane są
reakcje chemiczne
● miejsce narażone na działanie gazów toksycznych lub
powodujących korozję
● miejsce o podłożu, które może się odkształcać pod wpływem
ciężaru urządzenia lub w którym urządzenie może się zapadać
(np. dywan)
Nie należy instalować urządzenia w miejscu, gdzie występuje kondensacja
● Wewnątrz urządzenia mogą osadzać się kropelki wody (proces skraplania), kiedy w pomieszczeniu z
zainstalowanym urządzeniem zostanie gwałtownie podniesiona temperatura lub kiedy urządzenie zostanie
przeniesione z chłodnego bądź suchego pomieszczenia do gorącej albo wilgotnej lokalizacji. Używanie
urządzenia w takich warunkach może powodować zakleszczanie się papieru, obniżenie jakości druku lub
uszkodzenie urządzenia. Aby urządzenie mogło dostosować się do temperatury i wilgotności otoczenia,
przed jego uruchomieniem należy odczekać co najmniej 2 godziny.
Na wysokości 3000 m nad poziomem morza lub wyżej
● Urządzenia wyposażone w twardy dysk mogą działać nieprawidłowo podczas użytkowania na dużych
wysokościach, tj. 3000 metrów nad poziomem morza lub wyższych.
4
Ważne instrukcje dotyczące bezpieczeństwa
Źródło zasilania
6869-002
● Należy stosować wyłącznie zasilacz o parametrach napięcia zgodnych z określonymi wymaganiami.
Nieprzestrzeganie tego zalecenia może doprowadzić do pożaru lub porażenia prądem elektrycznym.
● Urządzenie należy podłączyć do gniazda elektrycznego z uziemieniem za pomocą dołączonego kabla
zasilającego.
● Należy używać wyłącznie przewodu dostarczonego wraz z urządzeniem — użycie innego przewodu może
doprowadzić do pożaru lub porażenia prądem.
● Dostarczony przewód zasilający jest przeznaczony do pracy wyłącznie z tym urządzeniem. Nie należy
podłączać przewodu do innych urządzeń.
● Nie należy przerabiać, mocno wyginać oraz ciągnąć przewodu ani wykonywać jakichkolwiek czynności, które
grożą jego uszkodzeniem. Nie należy kłaść ciężkich przedmiotów na przewodzie zasilania. Uszkodzenie
przewodu zasilania grozi pożarem lub porażeniem prądem elektrycznym.
● Nie podłączać ani nie odłączać wtyczki mokrymi rękami — może to doprowadzić do porażenia prądem.
● Do zasilania urządzenia nie należy używać przedłużaczy ani rozdzielaczy. Może to doprowadzić do pożaru lub
porażenia prądem elektrycznym.
● Nie należy zwijać ani związywać przewodu zasilającego — może to doprowadzić do pożaru lub porażenia
prądem elektrycznym.
● Wtyczkę zasilającą należy wsunąć do końca do gniazdka elektrycznego. W przeciwnym wypadku może dojść
do pożaru lub porażenia prądem elektrycznym.
● Podczas burzy z piorunami wtyczka zasilania powinna być wyjęta z gniazda sieciowego. W przeciwnym
wypadku może dojść do pożaru, porażenia prądem elektrycznym lub uszkodzenia sprzętu.
● Urządzenie należy zainstalować blisko gniazda zasilania, pozostawiający wystarczająco dużo miejsca, aby w
razie awarii można było bez przeszkód wyjąć wtyczkę z gniazda zasilania.
Podczas podłączania zasilania
● Nie wolno podłączać przewodu zasilającego do systemów zasilania bezprzerwowego. Może to spowodować
awarię bądź uszkodzenie urządzenia w przypadku wystąpienia przerwy w dopływie energii elektrycznej.
● W przypadku podłączenia urządzenia do źródła zasilania z kilkoma gniazdami nie wolno używać pozostałych
gniazd do zasilania innych urządzeń.
● Nie wolno podłączać przewodu zasilającego do gniazda zasilania w komputerze.
Pozostałe środki ostrożności
● Zakłócenia elektryczne mogą spowodować nieprawidłowe działanie urządzenia lub utratę danych.
5
Ważne instrukcje dotyczące bezpieczeństwa
Obsługa urządzenia
6869-003
● W przypadku stwierdzenia nietypowych odgłosów, zapachu lub
dymu wydobywającego się z urządzenia lub wytwarzania przez
nie nadmiernych ilości ciepła, należy natychmiast wyjąć
przewód zasilający z gniazda sieciowego i skontaktować się z
lokalnym przedstawicielem firmy Canon. Kontynuowanie
eksploatacji może doprowadzić do pożaru lub porażenia
prądem.
● Nie wolno demontować ani modyfikować urządzenia. Wewnątrz
urządzenia znajdują się podzespoły działające pod wysokim
napięciem i w wysokiej temperaturze, dlatego grozi to pożarem
lub porażeniem prądem.
● Miejsce instalacji urządzenia powinno być zabezpieczone przed dostępem dzieci do przewodu zasilającego i
innych przewodów oraz elementów elektrycznych i części wewnętrznych. W przeciwnym razie może dojść
do nieprzewidzianych wypadków.
● W pobliżu urządzenia nie korzystać z łatwopalnych aerozoli. W przypadku kontaktu substancji łatwopalnych
z częściami elektrycznymi wewnątrz urządzenia może dojść do pożaru lub porażenia prądem.
● Podczas przenoszenia urządzenia należy wyłączyć zasilanie urządzenia i komputera, a następnie odłączyć
przewód zasilający oraz kable interfejsu. Zaniedbanie tych czynności grozi uszkodzeniem przewodów
zasilających lub interfejsu, a w rezultacie pożarem lub porażeniem prądem elektrycznym.
● Podczas podłączania lub odłączania kabla USB po podłączeniu wtyczki zasilającej do gniazdka nie należy
dotykać metalowych części złącza, gdyż może to doprowadzić do porażenia prądem.
W przypadku osób korzystających z rozrusznika serca
● To urządzenie generuje pole magnetyczne o niskim natężeniu oraz fale ultradźwiękowe. Osoby korzystające
z rozrusznika serca i odczuwające dolegliwości w pobliżu urządzenia powinny się od niego oddalić i
zasięgnąć porady lekarskiej.
● Nie należy kłaść ciężkich przedmiotów na urządzeniu, gdyż mogą upaść, powodując obrażenia.
● Dla własnego bezpieczeństwa, jeśli urządzenie ma nie być używane przez dłuższy czas, należy odłączyć
przewód zasilania.
● Zachować ostrożność podczas otwierania i zamykania pokryw, aby uniknąć zranienia się w dłonie.
● Należy trzymać ręce i ubrania z dala od wałków znajdujących się w obszarze wyprowadzania papieru. Jeśli
wałki pochwycą dłonie lub odzież, może dojść do zranienia.
● Wewnątrz urządzenia i w obszarze wyjściowym papieru panują wysokie temperatury, zarówno podczas
używania urządzenia jak i bezpośrednio po jego zakończeniu. Należy unikać kontaktu z tymi miejscami, aby
zapobiec oparzeniom. Papier opuszczający urządzenie może być również gorący, zachowaj ostrożność. W
przeciwnym razie może dojść do poparzeń.
6
Ważne instrukcje dotyczące bezpieczeństwa
● Nie wolno przenosić urządzenia z zainstalowanym
opcjonalnym podajnikiem papieru lub dodatkowym
podajnikiem kasetowym Cassette Feeding Unit.
Mogą one wypaść, powodując obrażenia.
Promień lasera
● Nieosłonięty promień lasera może trafić w oczy i spowodować ich uszkodzenie.
W trakcie przenoszenia urządzenia
Aby zapobiec uszkodzeniu urządzenia w trakcie przenoszenia, należy wykonać następujące czynności.
● Należy wyjąć zasobniki z tonerem i zespoły bębna.
● Urządzenie należy zapakować w bezpieczny sposób do oryginalnego pudła z materiałami opakowaniowymi.
Jeżeli hałas pracującego urządzenia przeszkadza w pracy
● W zależności od środowiska i trybu pracy, jeżeli hałas pracującego urządzenia przeszkadza w pracy, zaleca się
zainstalowanie urządzenia w miejscu innym niż biuro.
Pozostałe środki ostrożności
● Należy przestrzegać ostrzeżeń umieszczonych na etykietach i tym podobnych elementach znajdujących się
na urządzeniu.
● Nie należy gwałtownie poruszać urządzenia ani nim potrząsać.
● Nie należy otwierać ani zamykać na siłę drzwi, osłon oraz innych części. Może to spowodować uszkodzenie
urządzenia.
● Nie należy dotykać styków (
) wewnątrz urządzenia. Może to spowodować uszkodzenie urządzenia.
7
Ważne instrukcje dotyczące bezpieczeństwa
● Aby zapobiec zakleszczeniu papieru, nie należy wyłączać zasilania, otwierać/zamykać pokryw ani ładować/
wyciągać papieru podczas drukowania.
8
Ważne instrukcje dotyczące bezpieczeństwa
Konserwacja i przeglądy
6869-004
Urządzenie należy czyścić co pewien czas. Nagromadzony kurz może spowodować nieprawidłowe działanie urządzenia.
Podczas czyszczenia należy przestrzegać poniższych zasad. Jeśli podczas pracy wystąpi problem, należy zapoznać się
z informacjami zawartymi w części „Rozwiązywanie problemów”.
● Przed przystąpieniem do czyszczenie należy wyłączyć zasilanie i wyjąć wtyczkę z gniazda sieciowego. W
przeciwnym wypadku może dojść do pożaru lub porażenia prądem elektrycznym.
● Co pewien czas należy wyjąć wtyczkę przewodu zasilającego i wyczyścić ją z kurzu i zanieczyszczeń za
pomocą suchej szmatki. Nagromadzony kurz może pochłaniać wilgoć z powietrza i spowodować pożar
podczas kontaktu z prądem elektrycznym.
● Do czyszczenia urządzenia należy używać wilgotnej, dobrze wykręconej szmatki. Szmatkę należy zwilżać
wyłącznie wodą. Nie wolno używać alkoholi, benzyn, rozcieńczalnik do farb i innych substancji łatwopalnych.
Nie należy używać chusteczek ani ręczników papierowych. Kontakt tych materiałów z częściami
elektrycznymi wewnątrz urządzenia może wytworzyć elektryczność statyczną i spowodować pożar lub
porażenie prądem.
● Przewód zasilający i wtyczkę należy okresowo sprawdzać pod kątem uszkodzeń. Należy sprawdzić, czy w
urządzeniu nie ma oznak rdzy, wżerów, rys, pęknięć lub przegrzewania. Dalsza eksploatacja urządzenia bez
odpowiedniej obsługi technicznej może doprowadzić do pożaru lub porażenia prądem.
● Wewnątrz urządzenia znajdują się podzespoły działające w wysokiej temperaturze i pod wysokim napięciem.
Dotknięcie tych podzespołów może spowodować oparzenia. Nie należy dotykać żadnej nieopisanej w
podręczniku części urządzenia.
● Podczas ładowania lub usuwania zakleszczonego papieru należy uważać, aby nie skaleczyć dłoni krawędzią
arkusza.
● Podczas usuwania papieru zakleszczonego wewnątrz urządzenia lub wymiany zasobników z tonerem itp.
należy uważać, aby nie rozsypać toneru na ręce lub odzież. W przypadku zabrudzenia odzieży lub rąk
tonerem należy je niezwłocznie umyć zimną wodą.
9
Ważne instrukcje dotyczące bezpieczeństwa
Materiały eksploatacyjne
6869-005
● Nie należy wrzucać do ognia zużytych zasobników z tonerem ani innych elementów. Nie należy
przechowywać zasobników z tonerem, zespołów bębna i papieru w pobliżu ognia. Może to spowodować
zapłon resztek toneru wewnątrz zasobnika i doprowadzić do poparzeń lub pożaru.
● W razie przypadkowego rozlania lub rozrzucenia toneru należy uważnie zebrać jego cząstki, lub zetrzeć je
miękką, wilgotną szmatką w sposób, który zapobiega ich wdychaniu. Nie wolno zbierać toneru odkurzaczem,
który nie ma zabezpieczenia przed eksplozją pyłu. Może to spowodować usterkę odkurzacza lub eksplozję
pyłu z powodu wyładowania statycznego.
● Należy uważać, aby nie wdychać toneru. Jeśli do tego dojdzie, należy natychmiast skontaktować się z
lekarzem.
● Nie należy dopuścić do kontaktu toneru z oczami lub ustami. W przypadku dostania się toneru do oczu lub
ust należy natychmiast przepłukać je zimną wodą i skonsultować się z lekarzem.
● Nie należy dopuścić do kontaktu toneru ze skórą. Jeśli do tego dojdzie, należy przemyć ją zimną wodą z
mydłem. W przypadku wystąpienia podrażnień na skórze konieczny jest natychmiastowy kontakt z lekarzem.
● Zasobniki z tonerem i inne materiały eksploatacyjne należy przechowywać z dala od dzieci. W przypadku
przedostania się toneru do organizmu należy niezwłocznie skontaktować się z lekarzem lub specjalistycznym
ośrodkiem leczenia zatruć.
● Nie należy demontować ani modyfikować zasobników z tonerem lub innych elementów. Może to
spowodować rozsypanie toneru.
Obsługa zasobnika z tonerem
● Kasetę z tonerem należy trzymać za uchwyt.
● Nie wolno dotykać obszaru podawania (
(
), styków elektrycznych (
).
10
) ani pamięci zasobnika z tonerem
Ważne instrukcje dotyczące bezpieczeństwa
● Z wyjątkiem sytuacji, w których jest to konieczne, nie należy wyjmować kasety z tonerem z opakowania lub z
urządzenia.
● Kaseta z tonerem stanowi produkt magnetyczny. Nie należy umieszczać jej w pobliżu produktów podatnych
na oddziaływanie pola magnetycznego, np. dyskietek i dysków, ponieważ może dojść do uszkodzenia
danych.
Obsługa zespołu bębna
● Zespół bębna należy trzymać za uchwyt.
● Nie należy dopuścić do zarysowania powierzchni bębna (
wolno dotykać styków elektrycznych (
) ani wystawiać jej na działanie światła. Nie
) ani pamięci zespołu bębna (
).
● Z wyjątkiem, gdy jest to konieczne, zespołu bębna nie należy wyjmować z opakowania ani z urządzenia.
Obsługa pojemnika na zużyty toner
● Nie wolno przechylać pojemnika na zużyty toner. W przeciwnym razie toner może się wysypać z wylotu
pojemnika (
).
11
Ważne instrukcje dotyczące bezpieczeństwa
Przechowywanie zasobników z tonerem i zespołów bębna
● Aby zapewnić bezpieczne i prawidłowe użytkowanie, zasobnik należy przechowywać w podanych warunkach.
Zakres temperatury przechowywania: 0°C do 35°C
Zakres wilgotności przechowywania: 35% do 85% wilgotności względnej (bez kondensacji)*
● Zasobnik z tonerem albo zespoły bębna należy przechowywać zamknięte do czasu ich użycia.
● Po wyjęciu z urządzenia zasobnika z tonerem albo zespołów bębna w celu ich przechowania należy umieścić
je w oryginalnym opakowaniu.
● Nie należy przechowywać zasobników w pozycji pionowej ani górą do dołu. Toner stwardnieje i może nie
powrócić do pierwotnego położenia nawet po wstrząśnięciu.
* Nawet w wypadku przechowywania w odpowiednim zakresie wilgotności wewnątrz zasobników z tonerem albo zespołów
bębna mogą tworzyć się krople wody, jeśli wewnątrz lub na zewnątrz zasobników lub zespołów wystąpi różnica temperatur.
Zjawisko kondensacji wewnątrz zasobników z tonerem albo zespołów bębna może mieć negatywny wpływ na jakość
wydruków wykonywanych z ich użyciem.
Zasobników z tonerem i zespołów bębna nie należy przechowywać w następujących
miejscach:
● miejsca wystawione na działanie otwartego ognia
● miejsca wystawione na działanie bezpośredniego światła słonecznego lub mocnego światła przez ponad pięć
minut
● miejsca, w których występuje duże stężenie soli
● miejsca, w których występują gazy powodujące korozję (np. aerozole, amoniak)
● miejsca wystawione na działanie wysokiej temperatury lub dużej wilgotności
● miejsca wystawione na gwałtowne zmiany temperatury lub wilgotności, które mogą wywoływać kondensację
● miejsca o dużym stężeniu pyłów
● miejsca dostępne dla dzieci
Należy uważać na podrabiane zasobniki z tonerem i zespoły bębna
● Należy mieć świadomość, że istnieją podrabiane zasobniki z tonerem firmy Canon oraz zespoły bębna firmy
Canon. Korzystanie z podrobionego zasobnika z tonerem lub zespołu bębna może być przyczyną słabej
jakości wydruków i nieoptymalnej wydajności urządzenia. Firma Canon nie ponosi żadnej odpowiedzialności
za nieprawidłowe działanie, wypadki lub szkody spowodowane użytkowaniem podrobionego zasobnika z
tonerem lub zespołu bębna.
Aby uzyskać więcej informacji, patrz global.canon/ctc.
Okres dostępności części zamiennych, zasobników z tonerem, zespołów bębna itp.
● Części zamienne, zasobniki z tonerem, zespoły bębna i inne części przeznaczone do tego urządzenia będą
dostępne w sprzedaży przez co najmniej siedem (7) lat po zakończeniu produkcji tego modelu urządzenia.
Opakowania na zasobniki z tonerem i zespoły bębna
● Opakowania na zasobniki z tonerem i zespoły bębna należy zachować. Są one wymagane podczas
transportu urządzenia.
12
Ważne instrukcje dotyczące bezpieczeństwa
● Elementy opakowania mogą zostać zmienione lub umieszczone w innym miejscu, a także dodane lub
usunięte bez uprzedzenia.
Utylizacja zużytych zasobników z tonerem, zespołów bębna i innych części
● Zużyte zasobniki z tonerem, zespoły bębna czy inne części należy umieszczać w oryginalnym opakowaniu,
aby zapobiec rozsypaniu się toneru na zewnątrz, a następnie zutylizować zgodnie z obowiązującymi
przepisami krajowymi.
13
Podstawowe informacje na temat obsługi
Podstawowe informacje na temat
obsługi
Podstawowe informacje na temat obsługi ....................................................................................... 15
Główne funkcje .................................................................................................................................................... 17
Części i ich funkcje ............................................................................................................................................... 19
Strona przednia .............................................................................................................................................. 20
Strona tylna .................................................................................................................................................... 22
Wnętrze .......................................................................................................................................................... 24
Taca uniwersalna ............................................................................................................................................ 25
Szuflada na papier .......................................................................................................................................... 26
Panel sterowania ............................................................................................................................................ 27
Wyświetlacz ............................................................................................................................................. 30
Korzystanie z panelu sterowania ....................................................................................................................... 32
Wprowadzanie tekstu ..................................................................................................................................... 35
Włączanie/wyłączanie zasilania .......................................................................................................................... 37
Szybkie uruchamianie urządzenia ................................................................................................................... 39
Ładowanie papieru .............................................................................................................................................. 41
Umieszczanie papieru w szufladzie na papier ................................................................................................. 43
Ładowanie papieru na tacę wielofunkcyjną .................................................................................................... 49
Ładowanie kopert lub pocztówek ................................................................................................................... 52
Ładowanie uprzednio zadrukowanego papieru .............................................................................................. 56
Określanie formatu i typu papieru .................................................................................................................. 60
Określanie formatu i typu papieru załadowanego w szufladzie na papier ............................................... 61
Określanie rozmiaru i typu papieru załadowanego na tacę wielofunkcyjną ............................................. 64
Oszczędzanie energii ........................................................................................................................................... 67
Przechodzenie w tryb uśpienia ....................................................................................................................... 68
Ustawianie czasu automatycznego wyłączania ............................................................................................... 71
14
Podstawowe informacje na temat obsługi
Podstawowe informacje na temat obsługi
6869-006
W tym rozdziale opisano podstawowe operacje wykonywane często w celu użycia funkcji urządzenia, np. korzystanie z
panelu sterowania oraz ładowanie papieru.
● Funkcje zainstalowane na urządzeniu różnią się w zależności od zakupionego modelu. Przed rozpoczęciem
korzystania z urządzenia należy zapoznać się z Główne funkcje(P. 17) i sprawdzić dostępne funkcje.
◼ Części i ich funkcje
W tej sekcji opisano zewnętrzne i wewnętrzne części urządzenia oraz ich funkcje, a także sposób korzystania z
przycisków na panelu sterowania i wyświetlania informacji na wyświetlaczu. Części i ich funkcje(P. 19)
◼ Korzystanie z panelu sterowania
W tej sekcji opisano sposób wykonywania różnych operacji, takich jak dostosowanie i sprawdzanie ustawień, za
pomocą klawiszy na panelu sterowania. Korzystanie z panelu sterowania(P. 32)
◼ Włączanie/wyłączanie zasilania
W tej sekcji opisano sposób włączania/wyłączania zasilania.
15
Włączanie/wyłączanie zasilania(P. 37)
Podstawowe informacje na temat obsługi
◼ Ładowanie papieru
W tej sekcji opisano, w jaki sposób należy umieszczać papier w szufladzie na papier oraz na tacy wielofunkcyjnej.
Ładowanie papieru(P. 41)
◼ Oszczędzanie energii
Ta sekcja opisuje sposoby zmniejszenia zużycia energii elektrycznej.
16
Oszczędzanie energii(P. 67)
Podstawowe informacje na temat obsługi
Główne funkcje
6869-007
Niniejsza instrukcja obejmuje wszystkie funkcje zakupionej serii modelu. Przed rozpoczęciem pracy należy sprawdzić,
które funkcje są dostępne w przypadku zakupionego modelu.
: Z funkcją
: Bez funkcji
Funkcja
LBP852Cx
Drukowanie
Drukowanie dwustronne
Zabezpieczony wydruk
Drukowanie bezpośrednie z USB
Drukowanie zadań przechowywanych
Połączenie z przewodową siecią LAN
Połączenie z bezprzewodową siecią LAN
Łączenie z urządzeniami mobilnymi
Zarządzanie identyfikatorami wydziałów
MEAP
Paper Feeder PF-G *
Cassette Feeding Unit-AU *
Zestaw drukowania kodów kreskowych *
PCL International Font Set *
KARTA SD *
*Jest
to opcjonalny element.
● Informacje na temat dostępnych typów sterowników zawiera dysk User Software CD-ROM/DVD-ROM (Dysk
CD-ROM/DVD-ROM z oprogramowaniem użytkownika) dostarczony wraz urządzeniem. Informacje te można
również znaleźć na stronie internetowej firmy Canon (https://global.canon).
ŁĄCZA
17
Podstawowe informacje na temat obsługi
Przeglądanie programu Podręcznik użytkownika(P. 610)
18
Podstawowe informacje na temat obsługi
Części i ich funkcje
6869-008
W tej sekcji opisano części urządzenia (zewnętrzne, przednie, tylne oraz wewnętrzne) i sposób ich funkcjonowania.
Oprócz prezentacji części urządzenia służących do wykonywania podstawowych czynności, takich jak ładowanie
papieru oraz wymiana kaset z tonerem, znajdują się tu także informacje na temat klawiszy na panelu sterowania oraz
na wyświetlaczu. Sekcja ta zawiera wskazówki dotyczące właściwego użytkowania urządzenia.
Strona przednia(P. 20)
Strona tylna(P. 22)
Wnętrze(P. 24)
Taca uniwersalna(P. 25)
Szuflada na papier(P. 26)
Panel sterowania(P. 27)
19
Podstawowe informacje na temat obsługi
Strona przednia
6869-009
Taca wyprowadzania papieru
Zadrukowane arkusze są umieszczane na tacy wyprowadzającej.
Panel sterowania
Panel sterowania składa się klawiszy numerycznych, wyświetlacza, wskaźników stanu itp. Za jego pomocą
można wykonać wszystkie operacje i skonfigurować ustawienia. Panel sterowania(P. 27)
Wyświetlacz(P. 30)
Przycisk zasilania
Nacisnąć przycisk zasilania w celu wyłączenia urządzenia. Przy wyłączaniu zasilania nie należy używać tego
przełącznika, ale postępować zgodnie z procedurami przedstawionymi w rozdziale Wyłączanie zasilania
(procedura wyłączania)(P. 37) .
Przednia pokrywa
Otwierana przy wymianie zasobników z tonerem albo zespołów bębna.
tonerem(P. 517)
Wymiana zespołów bębna(P. 524)
Sposób wymiany zasobników z
Szuflada na papier
Można w niej umieścić często używany rodzaj papieru.
papier(P. 43)
Umieszczanie papieru w szufladzie na
Port pamięci USB (do pamięci USB)
Możliwe jest podłączenie urządzenia pamięci USB do sprzętu i bezpośrednie wydrukowanie danych. Można
wydrukować dane bezpośrednio z pamięci USB bez użycia komputera. ( Wydruk z urządzenia pamięci
20
Podstawowe informacje na temat obsługi
USB (Drukowanie bezpośrednio z USB)(P. 83) ). Służy również do podłączenia urządzenia pamięci USB w
celu eksportowania lub importowania ustawień urządzenia ( Ust. impor./ekspor.(P. 414) ).
Prawa pokrywa
Prawą pokrywę otwiera się podczas usuwania zacięć papieru.
Uchwyty do podnoszenia
Urządzenie należy przenosić, trzymając je za uchwyty do podnoszenia.
Przenoszenie urządzenia(P. 529)
Taca wielofunkcyjna
Papier ładuje się do tacy wielofunkcyjnej, gdy tymczasowo używany będzie format papieru inny niż znajdujący
się w szufladzie na papier. Ładowanie papieru na tacę wielofunkcyjną(P. 49)
21
Podstawowe informacje na temat obsługi
Strona tylna
6869-00A
Tylna pokrywa
Tylną pokrywę otwiera się, aby zainstalować opcjonalną pamięć ROM.
Instalacja pamięci ROM(P. 596)
Otwór wentylacyjny
Przez otwory wentylacyjne wydostaje się powietrze z wnętrza urządzenia w celu jego ochłodzenia. Przedmioty
umieszczone przed tymi otworami mogą uniemożliwić wentylację. Instalacja(P. 3)
Gniazdo zasilania
Służy do podłączania przewodu zasilającego.
Lewa pokrywa
Lewą pokrywę otwiera się podczas wymiany pojemnika z zużytym tonerem.
na zużyty toner(P. 527)
Sposób wymiany zasobnika
Etykieta informacyjna
Na etykiecie znajduje się numer seryjny, który jest niezbędny do uzyskiwania informacji na temat urządzenia.
Więcej informacji znajduje się na stronie internetowej podręcznika w sekcji „Rozwiązywanie problemów
(FAQ)”.
Uchwyty do podnoszenia
Urządzenie należy przenosić, trzymając je za uchwyty do podnoszenia.
Przenoszenie urządzenia(P. 529)
Pokrywa gniazda karty SD
Pokrywę gniazda karty SD otwiera się podczas instalacji opcjonalnej karty pamięci SD.
pamięci SD(P. 600)
22
Instalacja karty
Podstawowe informacje na temat obsługi
Port USB (do podłączenia urządzenia USB)
Umożliwia podłączenie urządzenia USB używanego razem z aplikacjami MEAP. Służy również do podłączenia
urządzenia pamięci USB w celu eksportowania lub importowania ustawień urządzenia ( Ust. impor./
ekspor.(P. 414) ).
Port USB (połączenie z komputerem)
Umożliwia podłączenie kabla USB, za pośrednictwem którego nawiązane zostanie połączenie między
urządzeniem i komputerem.
Wskaźnik ACT
Wskaźnik ACT miga, gdy dane są wysyłane lub odbierane.
Wskaźnik LNK
Wskaźnik LNK miga na zielono, gdy urządzenie jest prawidłowo podłączone do sieci.
Port LAN
Umożliwia podłączenie urządzenia do routera przewodowego LAN lub innego sprzętu za pomocą kabla LAN.
Podłączanie do sieci przewodowej LAN(P. 153)
23
Podstawowe informacje na temat obsługi
Wnętrze
6869-00C
Gniazda zespołów bębna
Umożliwiają włożenie zespołów bębna.
Wymiana zespołów bębna(P. 524)
Gniazda zasobników z tonerem
Umożliwiają włożenie zasobników z tonerem o odpowiednim kolorze. Od lewej są to: Y (żółty), M
(amarantowy), C (cyjanowy) i K (czarny). Sposób wymiany zasobników z tonerem(P. 517)
24
Podstawowe informacje na temat obsługi
Taca uniwersalna
6869-00E
Prowadnice papieru
Prowadnice należy precyzyjnie dopasować do szerokości papieru, aby papier był podawany do urządzenia
prosto. Aby zwolnić blokady i przesunąć prowadnice papieru, należy przycisnąć dźwignię zwalniającą blokady,
która na ilustracji została oznaczona strzałką.
Przedłużenie tacy
Jego wyciągnięcie umożliwia załadowanie papieru o dużym rozmiarze.
ŁĄCZA
Ładowanie papieru na tacę wielofunkcyjną(P. 49)
25
Podstawowe informacje na temat obsługi
Szuflada na papier
6869-00F
Prowadnice papieru
Prowadnice należy precyzyjnie dopasować do formatu papieru, aby papier był podawany do urządzenia
prosto. Aby zwolnić blokady i przesunąć prowadnice papieru, należy przycisnąć dźwignie zwalniające blokady,
które na ilustracji zostały oznaczone strzałkami.
Wskaźnik poziomu papieru
Wskazuje pozostały poziom papieru. Znacznik przesuwa się w dół, gdy pozostała ilość papieru zmniejsza się.
ŁĄCZA
Umieszczanie papieru w szufladzie na papier(P. 43)
26
Podstawowe informacje na temat obsługi
Panel sterowania
6869-00H
Wyświetlacz
Wyświetla bieżący stan drukowania lub innej operacji, informacje o błędzie, stan zasobnika z tonerem itd.
Wyświetlacz(P. 30)
Stan zadania/Anuluj klawisz
Naciśnięcie tego klawisza, gdy miga wskaźnik [ ], spowoduje wyświetlenie listy zawierającej drukowany
dokument oraz dokumenty oczekujące na wydrukowanie. Można wybrać dokument z listy i anulować jego
drukowanie. Z poziomu panelu sterowania(P. 80)
Wstecz klawisz
Należy go nacisnąć, aby powrócić do poprzedniego ekranu. Naciśnięcie tego przycisku podczas konfiguracji
ustawień powoduje, że ustawienia nie są zastosowywane, a na wyświetlaczu pojawia się poprzedni ekran.
Przyciski numeryczne (przyciski [0]-[9])
Służą do wprowadzania tekstu i cyfr.
Wprowadzanie tekstu(P. 35)
Przycisk [*]
Jego naciśnięcie umożliwia przełączanie pomiędzy typami wprowadzanego tekstu.
27
Podstawowe informacje na temat obsługi
Gotowe wskaźnik
Świeci się, gdy urządzenie jest gotowe do drukowania, w innym przypadku miga.
Komunikat wskaźnik
● Włącza się w momencie wystąpienia problemu, aby zasygnalizować konieczność zatrzymania drukowania.
Więcej informacji znajduje się na stronie internetowej podręcznika w sekcji „Rozwiązywanie problemów
(FAQ)”.
● Zaświeca się, gdy urządzenie przechodzi w tryb uśpienia podczas pracy w trybie offline.
Zadanie wskaźnik
Świeci się, gdy urządzenie odbiera dane drukowania lub gdy dane drukowania są przechowywane w pamięci
urządzenia. Miga podczas przetwarzania danych drukowania.
Oszczędzanie energii klawisz
Naciśnięcie tego przycisku wprowadza urządzenie w stan uśpienia. Kiedy urządzenie znajduje się w trybie
uśpienia, przycisk świeci się na zielono. Ponowne naciśnięcie przycisku wyłącza stan uśpienia.
Przechodzenie w tryb uśpienia(P. 68)
Aplikacja klawisz
Naciskając ten przycisk, można przełączać funkcje w następującej kolejności: Ekran drukowania MEAP1
MEAP2 ... MEAP8 Drukuj bezpośrednio z USB Ekran drukowania. Należy wybrać żądaną funkcję. Jeśli
włączona jest funkcja zarządzania identyfikatorami wydziałów, a przycisk został naciśnięty bez uprzedniego
zalogowania, zostanie wyświetlony ekran uwierzytelniania.
Wybierz podajnik klawisz
Ten przycisk należy nacisnąć, aby wybrać źródło papieru lub określić rozmiar papieru.
podajnika(P. 491)
Menu wyboru
[ID] klawisz
Wyświetla ekran logowania umożliwiający użycie funkcji MEAP. Po zakończeniu korzystania z urządzenia,
należy ponownie nacisnąć przycisk, aby się wylogować.
Kasuj klawisz
Jego naciśnięcie pozwala usunąć wprowadzony tekst i cyfry.
Online klawisz
Przełącza między trybem online (zadania drukowania są przyjmowane) a trybem offline (zadania drukowania
nie są przyjmowane). Ten przycisk świeci na zielono, gdy urządzenie pracuje w trybie online i gaśnie po jego
przejściu w tryb offline. Zazwyczaj urządzenie powinno działać w trybie online, jednak należy przestawić je w
tryb offline podczas ustawiania opcji Konserw. użytkownika(P. 392) w menu ustawień.
● Jeśli przycisk nie zostanie użyty przez dłuższy czas, gdy urządzenie znajduje się w trybie offline i wyświetla
się Ekran główny(P. 30) , urządzenie automatycznie przechodzi w tryb online. Można wybrać opcję
<Czas autom. resetu>, aby zmienić wspomniany przedział czasowy ( Czas autom. resetu(P. 329) ).
28
Podstawowe informacje na temat obsługi
Przycisk [#]
Jego naciśnięcie umożliwia wprowadzanie symboli, takich jak „@” czy „/”.
Przycisk Utility / przycisk [
]
● Pozwala wyświetlić menu Narzędzie. Można wyświetlić całkowitą liczbę wydrukowanych stron oraz
informacje wewnętrzne o systemie drukowania na potrzeby kontroli. Menu podręczne(P. 480)
● Umożliwia powrót do poprzedniego ekranu podczas konfiguracji ustawień. Jego naciśnięcie podczas
wprowadzania wartości liczbowych przesuwa kursor w lewą stronę.
Przycisk Zadanie / przycisk [
]
● Pozwala wyświetlić menu Zadanie. Można sprawdzić dzienniki wydruków.
Menu zadań(P. 486)
● Umożliwia wybór elementu znajdującego się nad aktualnie zaznaczonym elementem podczas konfiguracji
ustawień. Jego naciśnięcie podczas zmiany wartości ustawień powoduje zwiększenie wartości.
Przycisk Ustawienia / przycisk [
● Wyświetla
menu
ustawień,
w
którym
]
można
sprecyzować
ustawienia
urządzenia.
Menu
konfiguracji(P. 326)
● Umożliwia przejście do następnego ekranu podczas konfiguracji ustawień. Jego naciśnięcie podczas
wprowadzania tekstu przesuwa kursor w prawą stronę.
Przycisk Resetuj / przycisk [
]
● Pozwala wyświetlić menu Reset. Można w nim anulować wszystkie procesy, usunąć dane z pamięci i
wyłączyć zasilanie. Menu resetowania(P. 488)
● Umożliwia wybór elementu znajdującego się poniżej aktualnie zaznaczonego elementu podczas
konfiguracji ustawień. Jego naciśnięcie podczas zmiany wartości ustawień powoduje zmniejszenie
wartości.
[OK] klawisz
Jego naciśnięcie powoduje zastosowanie ustawień lub określonych parametrów.
ŁĄCZA
Korzystanie z panelu sterowania(P. 32)
29
Podstawowe informacje na temat obsługi
Wyświetlacz
6869-00J
Na wyświetlaczu widać stan drukowania i ekrany umożliwiające definiowanie
ustawień. Wyświetlane są na nim także komunikaty błędów i informacje o stanie
zasobnika z tonerem.
Ekran główny
Wskaźnik stanu
Wyświetla bieżący stan lub tryb pracy urządzenia.
Wskaźnik rozmiaru papieru
Wyświetla aktualnie wybrany rozmiar papieru.
Następujące rozmiary papieru są wyświetlane w formie skrótów.
● Ledger: LD
● Kartka pocztowa zwrotna: P2
● Legal: LG
● Kartka pocztowa 4 na 1: P4
● Letter (orientacja pozioma): LTR
● Koperta KAKUGATA 2: K2
● Letter (orientacja pionowa): CIE
● Koperta NAGAGATA 3: N3
● Statement (orientacja pozioma): STR
● Koperta YOUGATANAGA 3: YN3
● Statement (orientacja pionowa): ST
● Koperta nr 10 (COM10): CO
● Executive (orientacja pozioma): EXR
● Koperta Monarch: MO
● Executive (orientacja pionowa): EX
● Koperta ISO-C5: EC5
● Foolscap: FC
● Koperta DL: DL
● 305x457 mm: TxE
● Rozmiar dowolny: FR
● Karta katalogowa: IC
● Niestandardowy format papieru, orientacja pozioma: 80R
● Indian Legal: ILG
● Niestandardowy format papieru, orientacja pionowa: 80
● Kartka pocztowa: PD
Wskaźnik stanu zasobnika z tonerem
Wyświetla stan zasobników z tonerem.
Ekran menu
Aby wyświetlić odpowiedni ekran menu, należy nacisnąć przycisk
(
),
( ),
(
lub
( ). Poniżej jako przykład przedstawiono ekran wyświetlany po naciśnięciu przycisku
30
),
(
(
).
)
Podstawowe informacje na temat obsługi
Lista menu ustawień(P. 325)
Gdy wystąpi błąd
W niektórych sytuacjach po wystąpieniu błędu wyświetlone zostają wskazówki podające, jak na niego
zareagować. Aby rozwiązać problem, należy postępować zgodnie z instrukcjami na ekranie. Poniżej jako
przykład pokazano ekran wyświetlany w przypadku zacięcia papieru. Więcej informacji o wyświetlanych
komunikatach znajduje się na stronie internetowej podręcznika w sekcji „Rozwiązywanie problemów (FAQ)”.
ŁĄCZA
Korzystanie z panelu sterowania(P. 32)
31
Podstawowe informacje na temat obsługi
Korzystanie z panelu sterowania
6869-00K
Za pomocą przedstawionych poniżej przycisków skonfiguruj ustawienia i dostosuj wartości.
Korzystanie z przycisków
/
Przewijanie ekranu
Gdy nie wszystkie elementy można wyświetlić naraz na jednym ekranie, po jego prawej stronie widoczny jest
pasek przewijania. Jeśli wyświetlony jest pasek przewijania, do poruszania się w górę lub w dół służą przyciski
/
. Zaznaczenie danego elementu powoduje odwrócenie kolorów tekstu oraz tła tego elementu.
Zmiana wartości ustawienia
Za pomocą przycisków
/
można wprowadzić wartości.
● Wartości w nawiasach, wyświetlane poniżej pola tekstowego, oznaczają dopuszczalny zakres wartości.
32
Podstawowe informacje na temat obsługi
Korzystanie z przycisków
/
Przechodzenie do kolejnego ekranu/powracanie do poprzedniego ekranu
Aby przejść do następnego ekranu, naciśnij przycisk
przycisk
.
. Aby powrócić do poprzedniego ekranu, naciśnij
● Do następnego ekranu można również przejść przez naciśnięcie przycisku
ekranu przez naciśnięcie przycisku
, a wrócić do poprzedniego
.
Przesuwanie kursora
Naciśnij przycisk
/
, aby wprowadzić tekst i wartości.
Wprowadzanie tekstu(P. 35)
Korzystanie z przycisku
Przycisk
służy do potwierdzania ustawienia.
Korzystanie z przycisku
(
)
Aby powrócić do głównego ekranu po zamknięciu menu ustawień, należy nacisnąć przycisk
(
).
Korzystanie z klawiszy numerycznych
Do wpisywania tekstu oraz wartości służą klawisze numeryczne.
Wprowadzanie tekstu(P. 35)
● Na niektórych ekranach nie można wprowadzać wartości liczbowych za pomocą klawiszy numerycznych. W
takim przypadku należy je wprowadzać za pomocą przycisków
33
/
.
Podstawowe informacje na temat obsługi
● Istnieje możliwość określenia wielu ustawień związanych ze sposobem wyświetlania, takich jak dostosowanie
ekranu i język wyświetlania. Można to zrobić za pomocą opcji <Menu sterowania> w menu ustawień na
panelu roboczym. Menu sterowania(P. 327)
34
Podstawowe informacje na temat obsługi
Wprowadzanie tekstu
6869-00L
Do wpisywania tekstu oraz wartości służą klawisze numeryczne.
Przełączanie rodzaju tekstu
Naciśnij przycisk
, aby umożliwić przełączanie pomiędzy typami wprowadzanego tekstu.
Dostępne rodzaje znaków
Poniżej przedstawiono możliwy do wprowadzenia tekst.
Klawisz
A
a
12
(Opcja niedostępna)
1
ABC
abc
2
DEF
def
3
GHI
ghi
4
JKL
jkl
5
MNO
mno
6
35
Podstawowe informacje na temat obsługi
PQRS
pqrs
7
TUV
tuv
8
WXYZ
wxyz
9
(Opcja niedostępna)
0
(spacja) @./-_!?&$%#()[]{}<>*+=",;:'^`|\ (Opcja niedostępna)
● Naciśnij przycisk
, jeśli typ wpisywanego tekstu to <A> lub <a>, aby wyświetlić na ekranie
dozwolone symbole. Za pomocą przycisków
naciśnij przycisk
/
/
/
wybierz symbol, który ma być wpisany i
.
Usuwanie tekstu
Każde naciśnięcie przycisku
powoduje usunięcie jednego znaku. Aby usunąć cały wprowadzony tekst,
należy nacisnąć i przytrzymać przycisk
.
Przesuwanie kursora
Naciśnij przycisk
lub
, aby przesunąć kursor.
Wprowadzanie spacji
Naciśnij przycisk
, następnie naciśnij przycisk
.
Przykład wprowadzania tekstu i cyfr
Przykład: „Canon 1”
1
Naciśnij kilkakrotnie przycisk
, aby wybrać ustawienie <A>.
2
Naciskaj kilkakrotnie przycisk
, aż pojawi się znak „C”.
3
Naciśnij kilkakrotnie przycisk
, aby wybrać ustawienie <a>.
4
Naciskaj kilkakrotnie przycisk
, aż pojawi się znak „a”.
5
Naciskaj kilkakrotnie przycisk
, aż pojawi się znak „n”.
6
Naciskaj kilkakrotnie przycisk
, aż pojawi się znak „o”.
7
Naciskaj kilkakrotnie przycisk
, aż pojawi się znak „n”.
8
Naciśnij przycisk
9
Naciśnij kilkakrotnie przycisk
10
Naciśnij przycisk
11
Naciśnij przycisk
, następnie naciśnij przycisk
.
, aby wybrać ustawienie <12>.
.
.
36
Podstawowe informacje na temat obsługi
Włączanie/wyłączanie zasilania
6869-00R
Główny wyłącznik zasilania służy do włączania urządzenia. Natomiast w przypadku wyłączania urządzenia należy
wykonać procedurę wyłączania z poziomu roboczego, bez używania tego przycisku. Procedura ta przebiega tak samo,
jak włączanie/wyłączanie komputera.
Włączanie urządzenia(P. 37)
Wyłączanie zasilania (procedura wyłączania)(P. 37)
Włączanie urządzenia
Naciśnij główny wyłącznik zasilania urządzenia. Po wyświetleniu ekranu głównego na wyświetlaczu panelu roboczego
zostanie przeprowadzona autodiagnostyka, a następnie urządzenia będzie gotowe do drukowania.
● Po przeprowadzeniu samodiagnostyki może pojawić się komunikat. Więcej informacji znajduje się na stronie
internetowej podręcznika w sekcji „Rozwiązywanie problemów (FAQ)”.
● Zdefiniowanie ustawień szybkiego uruchamiania pozwoli skrócić czas oczekiwania po włączeniu zasilania
urządzenia. Szybkie uruchamianie urządzenia(P. 39)
Wyłączanie zasilania (procedura wyłączania)
Aby wyłączyć urządzenie, należy wykonać procedurę wyłączania z poziomu panelu roboczego.
Wyłączanie urządzenia bez korzystania z głównego wyłącznika zasilania
● Wyłączenie urządzenia za pomocą głównego wyłącznika zasilania może spowodować wystąpienie
nieoczekiwanego błędu. Aby prawidłowo wyłączyć urządzenie, należy postępować zgodnie z poniższą
procedurą.
● Jeśli włączona jest funkcja szybkiego uruchamiania, urządzenie można wyłączyć za pomocą głównego
wyłącznika zasilania. Szybkie uruchamianie urządzenia(P. 39)
37
Podstawowe informacje na temat obsługi
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz opcję <Tak> i naciśnij przycisk
(
).
/
wybierz opcję <Wyłącz> i naciśnij przycisk
.
.
➠ Po wyświetleniu poniższego komunikatu zasilanie zostanie automatycznie wyłączone.
Wyświetla się komunikat <Nie można wykonać.>
● Pozostały jeszcze dane do wydrukowania. Należy usunąć dane (
ponowić operację. Aby anulować operację, należy nacisnąć przycisk
Menu resetowania(P. 488)
(
) i
).
● Całkowite wyłączenie się urządzenia może potrwać trochę czasu. Nie wolno odłączać przewodu
zasilającego do czasu wyłączenia się wyświetlacza.
Nie włączać zasilania tuż po jego wyłączeniu
● Należy odczekać no najmniej 10 sekund i ponownie włączyć zasilanie.
Zużycie energii po wyłączeniu
● Urządzenie pobiera nieco energii nawet po wyłączeniu zasilania. W celu całkowitego wyeliminowania zużycia
energii należy odłączyć przewód zasilający od gniazdka.
ŁĄCZA
Szybkie uruchamianie urządzenia(P. 39)
38
Podstawowe informacje na temat obsługi
Szybkie uruchamianie urządzenia
6869-00S
Zdefiniowanie ustawień szybkiego uruchamiania pozwala ograniczyć ilość czasu, jaki upływa o naciśnięcia głównego
wyłącznika zasilania do gotowości ekranów do pracy. Metodę wyłączania urządzenia w celu przeprowadzenia
szybkiego uruchamiania nazywa się „szybkim wyłączaniem”.
Konfiguracja ustawień szybkiego uruchamiania(P. 39)
Wyłączanie zasilania (procedura szybkiego wyłączania)(P. 40)
Jeśli użytkownik korzysta z sieci
● Jeśli dla któregokolwiek z wymienionych poniżej ustawień wybrano wartość <Włącz>, funkcja szybkiego
uruchamiania jest wyłączona.
-
Sieć(P. 150) RARP, BOOTP, IPv6
- IPSec
Konfiguracja ustawień protokołu IPSec(P. 269)
Gdy używana jest funkcja MEAP
● Należy sprawdzić, czy aktualnie zainstalowane aplikacje MEAP obsługują funkcję szybkiego uruchamiania.
Konfiguracja ustawień szybkiego uruchamiania
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz opcję <Szybk. wł. zasilania> i naciśnij przycisk
.
4
Wybierz opcję <Wyłącz> lub <Włącz> i naciśnij przycisk
.
(
).
/
wybierz opcję <Menu sterowania> i naciśnij przycisk
.
<Wyłącz>
Pozwala wyłączyć funkcję szybkiego uruchamiania.
<Włącz>
Pozwala włączyć funkcję szybkiego uruchamiania.
5
Pozwala wykonać reset sprzętowy.
Reset sprzętowy(P. 488)
39
Podstawowe informacje na temat obsługi
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Wyłączanie zasilania (procedura szybkiego wyłączania)
Jeśli funkcja szybkiego uruchamiania jest łączona, a użytkownik wyłączy urządzenie za pomocą głównego wyłącznika
zasilania, wówczas przy kolejnym włączeniu urządzenia zostanie przeprowadzone szybkie włączanie (szybkie
wyłączanie).
Po wykonaniu szybkiego wyłączania nie wolno wyjmować wtyczki urządzenia z
gniazdka sieciowego
● Po wyłączeniu urządzenia za pomocą szybkiego wyłączania nie wolno wyjmować wtyczki urządzenia z
gniazdka sieciowego. Mogłoby to spowodować uszkodzenie komponentów wewnętrznych urządzenia. W
przypadku zmiany położenia urządzenia należy przed wyjęciem wtyczki wyłączyć urządzenie, stosując
procedurę pełnego wyłączania. Wyłączanie zasilania (procedura wyłączania)(P. 37)
● Jeśli urządzenie jest w trakcie wykonywania zadania, zgłasza błąd lub właśnie dokonano zmiany ustawień z
poziomu panelu roboczego lub Zdalnego interfejsu użytkownika, naciśnięcie głównego wyłącznika zasilania
nie spowoduje wykonania procedury szybkiego wyłączania, tylko przeprowadzenie procedury pełnego
wyłączania.
● Jeśli urządzenie zostanie wyłączone w normalnym trybie, to nawet gdy funkcja szybkiego włączania jest
włączona, urządzenie uruchomi się w zwyczajowy sposób podczas kolejnego włączania.
● Użycie funkcji zegara automatycznego wyłączania, gdy funkcja szybkiego uruchamiania jest włączona,
spowoduje wykonanie procedury szybkiego wyłączania. Ustawianie czasu automatycznego
wyłączania(P. 71)
● W przypadku włączenia zasilania bezpośrednio po wykonaniu szybkiego wyłączenia rozruch urządzenia
może chwilę potrwać.
40
Podstawowe informacje na temat obsługi
Ładowanie papieru
6869-00U
Papier można umieścić w szufladzie na papier i na tacy wielofunkcyjnej. Powinno się w niej umieścić zwykle używany
rodzaj papieru. Szuflada na papier jest przydatna, gdy zużywa się duże ilości papieru. Tacę wielofunkcyjną można
wykorzystać, gdy tymczasowo stosuje się inny format lub rodzaj papieru niż ten, który znajduje się w szufladzie na
papier. Patrz Obsługiwane rodzaje papieru(P. 571) , aby uzyskać informacje o dostępnych formatach i typach
papieru.
Informacje na temat papieru
Środki ostrożności dotyczące papieru(P. 41)
Przechowywanie papieru wydrukowanego za pomocą urządzenia(P. 42)
Ładowanie papieru
Umieszczanie papieru w szufladzie na papier(P. 43)
Ładowanie papieru na tacę wielofunkcyjną(P. 49)
Ładowanie kopert lub pocztówek(P. 52)
Ładowanie uprzednio zadrukowanego papieru(P. 56)
Konfigurowanie ustawień dotyczących załadowanego papieru
Określanie formatu i typu papieru(P. 60)
Środki ostrożności dotyczące papieru
Nie wolno używać następujących typów papieru:
● Może dojść do zacięcia papieru lub błędu drukowania.
- Papieru pofałdowanego lub pomarszczonego
- Zwiniętego lub pogiętego papieru
- Papieru rozdartego
- Papieru wilgotnego
- Papieru bardzo cienkiego
- Papieru cienkiego szorstkiego
- Papieru wydrukowanego przez drukarkę termiczną
- Tylnej strony papieru wydrukowanego przez drukarkę termiczną
- Papieru z bardzo wyraźną fakturą
- Papieru błyszczącego
41
Podstawowe informacje na temat obsługi
Uwagi dotyczące używania papieru
● Należy używać wyłącznie papieru, którego warunki przechowywania w pełni odpowiadały środowisku, w
którym zainstalowane jest urządzenie. Używanie papieru, który był przechowywany w warunkach innej
temperatury lub wilgotności może spowodować zacięcia papieru lub obniżyć jakość druku.
Obsługa i przechowywanie papieru
● Zalecane jest użycie papieru możliwie najszybciej po jego rozpakowaniu. Papier, który pozostaje nieużyty,
należy przykryć za pomocą oryginalnego papieru do pakowania i przechowywać na płaskiej powierzchni.
● Aby zabezpieczyć papier przed wilgocią lub wysuszeniem, należy przechowywać go w oryginalnym
opakowaniu.
● Papier należy przechowywać w sposób uniemożliwiający jego zwinięcie lub zagięcie.
● Nie należy umieszczać papieru pionowo ani układać w zbyt duży stos.
● Należy unikać wystawiania papieru na bezpośrednie działanie promieni słonecznych, a także umieszczania w
lokalizacjach o wysokiej wilgotności, niezwykle suchych albo charakteryzujących się dużymi wahaniami
temperatury lub wilgotności.
Drukowanie na zawilgoconym papierze
● Z miejsca wyprowadzania papieru może wydobywać się para lub kropelki wody mogą tworzyć się wokół
miejsca wyprowadzania papieru. Nie są to zjawiska nietypowe — wilgoć jest wyparowywana z papieru pod
wpływem ciepła wytwarzanego podczas utrwalania toneru (dzieje się tak zazwyczaj przy niskiej temperaturze
pomieszczenia).
Przechowywanie papieru wydrukowanego za pomocą urządzenia
Podczas obsługi/przechowywania papieru wydrukowanego za pomocą urządzenia należy przestrzegać następujących
środków ostrożności.
◼ Jak przechowywać wydrukowany papier
● Papier przechowywać na płaskiej powierzchni.
● Papieru nie przechowywać razem z artykułami wykonanymi z PCW (polichlorek winylu), takimi jak przezroczyste
teczki. Toner może się stopić, co spowoduje przywarcie papieru do artykułów z PCW.
● Należy uważać, aby papier nie został pogięty ani pomarszczony. Toner może się złuszczyć.
● Jeśli papier nie będzie używany przez długi czas (dwa lata lub dłużej), należy go przechowywać na przykład w
segregatorach.
● Jeśli papier jest przechowywany przez długi czas, może się odbarwić, dlatego może wydawać się, że nastąpiła
zmiana koloru druku.
● Nie przechowywać w miejscu, gdzie panuje wysoka temperatura.
◼ Środki ostrożności podczas nakładania kleju
● Zawsze należy stosować klej nierozpuszczalny.
● Przed nałożeniem kleju należy wykonać test przy użyciu niepotrzebnego już wydruku.
● Podczas umieszczania arkuszy papieru z nałożonym klejem jeden na drugim należy upewnić się, że klej jest
całkowicie wysuszony.
42
Podstawowe informacje na temat obsługi
Umieszczanie papieru w szufladzie na papier
6869-00W
1660-02Y
Szuflada na papier służy do przechowywania zwykle używanego typu papieru. Gdy wydruk ma być wykonany na innym
typie papieru niż ten, który znajduje się w szufladzie na papier, należy go załadować na tacę wielofunkcyjną.
Ładowanie papieru na tacę wielofunkcyjną(P. 49)
Ładowanie papieru o standardowym formacie(P. 43)
Ładowanie papieru o niestandardowym rozmiarze(P. 46)
Orientacja papieru
Poniższa tabela zawiera informacje niezbędne do załadowania dostępnego papieru w odpowiedniej orientacji.
Papier
Orientacja
A3, B4, A4 (orientacja pozioma),
B5 (orientacja pozioma), A5 (orientacja pozioma),
Ledger, Legal, Letter (orientacja pozioma),
Executive (orientacja pozioma), Foolscap,
8K, 16K (orientacja pozioma), Indian Legal,
Niestandardowy (orientacja pozioma)
A4 (orientacja pionowa), B5 (orientacja pionowa),
A5 (orientacja pionowa), Letter (orientacja pionowa),
Executive (orientacja pionowa), 16K (orientacja pionowa),
Niestandardowy (orientacja pionowa)
● Podczas umieszczania papieru w dodatkowym podajniku papieru lub podajniku Cassette Feeding Unit należy
postępować zgodnie z poniższą procedurą.
Ładowanie papieru o standardowym formacie
Aby załadować papier, którego format jest wskazany na oznaczeniach szuflady na papier, należy wykonać opisaną
poniżej procedurę. W przypadku papieru, którego rozmiar nie jest oznaczony na szufladzie patrz punkt Ładowanie
papieru o niestandardowym rozmiarze(P. 46) .
1
2
Wysunąć szufladę na papier do oporu.
Ustaw prowadnice papieru w położeniach odpowiadających rozmiarowi używanego
papieru.
43
Podstawowe informacje na temat obsługi
● Naciśnij dźwignię zwalniania blokady (
), aby wyrównać rzutowanie (
) zgodnie z odpowiednim
oznaczeniem rozmiaru papieru.
W przypadku ładowania do opcjonalnego podajnika papieru lub podajnika Cassette Feeding Unit
● W przypadku ładowania papieru formatu A3 lub Ledger należy ustawić dźwignię (
) tak jak pokazano na
ilustracji.
3
Załadować papier tak, aby stos stykał się równo z prowadnicą na lewej ścianie
szuflady.
● Włóż papier zadrukowaną stroną skierowaną w górę.
● Dobrze przekartkuj stos papieru i wyrównaj brzegi na równej powierzchni.
Nie należy wkładać papieru w ilości wychodzącej poza linie ogranicznika stosu
● Należy upewnić się, że stos papieru nie wychodzi poza ogranicznik stosu papieru (
dużej ilości papieru może prowadzić do jego zakleszczenia.
44
). Załadowanie zbyt
Podstawowe informacje na temat obsługi
● Informacje na temat ładowania papieru z logo można znaleźć w rozdziale
zadrukowanego papieru(P. 56) .
4
Umieść szufladę z powrotem na miejscu.
»
Przejdź do rozdziału
Ładowanie uprzednio
Określanie formatu i typu papieru załadowanego w szufladzie
na papier(P. 61)
Zmiana rozmiaru i typu papieru
● Jeśli zmieniono format lub typ papieru, należy zawsze sprawdzić odpowiednie ustawienie. Jeśli parametry
załadowanego papieru nie zgadzają się ze skonfigurowanymi ustawieniami papieru, drukowanie nie jest
wykonywane poprawnie.
Automatyczne wykrywanie typu papieru
● Urządzenie jest wyposażone w funkcję automatycznego wykrywania typu papieru. Po włączeniu tej funkcji
nie ma potrzeby zmiany ustawień typu papieru w przypadku załadowania zwykłego lub grubego papieru.
Wykr. typ pap. autom(P. 495)
● Aby drukować w systemie operacyjnym niezapewniającym obsługi sterowników drukarki lub za pomocą
urządzenia przenośnego bądź innego sprzętu, który nie obsługuje ustawień formatu i typu papieru, należy
skonfigurować opcje <Stand. rozm. papieru> i <Domyślny typ papieru>. Menu wyboru podajnika(P. 491)
Drukowanie na tylnej stronie zadrukowanego arkusza (Ręczne drukowanie 2-stronne)
Istnieje możliwość wydruku na tylnej stronie zadrukowanego arkusza. Należy wygładzić zagięcia, które mogły
pojawić się na papierze i włożyć arkusz do tacy wielofunkcyjnej ( Ładowanie papieru na tacę
wielofunkcyjną(P. 49) ) tak, aby arkusz leżał stroną przeznaczoną do zadrukowania do góry (wcześniej
zadrukowana strona powinna znajdować się na dole).
● Aby drukować na odwrocie już zadrukowanego papieru, należy w menu ustawień na panelu roboczym
wybrać ustawienie <Ręczne 2-str. (MP)> dla opcji <2. strona>. Ręczne 2-str. (MP)(P. 498)
● Ładuj tylko jeden arkusz papieru na wydruk.
● Można używać jedynie papieru zadrukowanego za pomocą tego urządzenia.
● Nie można drukować na wcześniej zadrukowanej stronie arkusza.
45
Podstawowe informacje na temat obsługi
Ładowanie papieru o niestandardowym rozmiarze
Aby załadować papier o niestandardowym rozmiarze lub papier, którego format nie jest wskazany na oznaczeniach
szuflady na papier, należy wykonać opisaną poniżej procedurę.
1
Wysunąć szufladę na papier do oporu.
2
Rozsuń prowadnice papieru.
● Aby rozsunąć prowadnice, naciśnij dźwignię zwalniającą blokadę.
3
Załadować papier tak, aby stos stykał się równo z prawą ścianą szuflady.
● Włożyć ryzę papieru zadrukowaną stroną skierowaną w górę.
● Dobrze przekartkuj stos papieru i wyrównaj brzegi na równej powierzchni.
Nie należy wkładać papieru w ilości wychodzącej poza linie ogranicznika stosu
● Należy upewnić się, że stos papieru nie wychodzi poza ogranicznik stosu papieru (
dużej ilości papieru może prowadzić do jego zakleszczenia.
46
). Załadowanie zbyt
Podstawowe informacje na temat obsługi
● Informacje na temat ładowania papieru z logo można znaleźć w rozdziale
zadrukowanego papieru(P. 56) .
4
Ładowanie uprzednio
Upewnij się, że ustawienie prowadnic papieru odpowiada krawędziom papieru.
● Naciśnij dźwignię zwolnienia blokady i zsuń prowadnice papieru do momentu zrównania się z krawędziami
papieru.
Należy się upewnić, że ustawienie prowadnic papieru odpowiada krawędziom papieru
● Ustawienie prowadnic papieru za szeroko lub za wąsko może spowodować problemy z podawaniem lub
zakleszczenie papieru.
W przypadku ładowania do opcjonalnego podajnika papieru lub podajnika Cassette Feeding Unit
● Jeśli dźwignia (
) uniemożliwia właściwe załadowanie papieru, np. jeśli papier jest podniesiony lub
przechylony, należy wyjąć papier i dostosować położenie dźwigni do rozmiaru papieru. Następnie należy
załadować papier ponownie i wyregulować położenie prowadnic papieru.
47
Podstawowe informacje na temat obsługi
5
Umieść szufladę z powrotem na miejscu.
»
Przejdź do rozdziału
Określanie formatu i typu papieru załadowanego w szufladzie
na papier(P. 61)
Zmiana rozmiaru i typu papieru
● Jeśli do urządzenia zostanie załadowany papier innego rozmiaru lub typu, należy zmienić ustawienia. Jeśli
ustawienie typu lub rozmiaru zostanie zmienione, urządzenie nie będzie drukowało poprawnie.
Automatyczne wykrywanie typu papieru
● Urządzenie jest wyposażone w funkcję automatycznego wykrywania typu papieru. Po włączeniu tej funkcji
nie ma potrzeby zmiany ustawień typu papieru w przypadku załadowania zwykłego lub grubego papieru.
Wykr. typ pap. autom(P. 495)
● Aby drukować w systemie operacyjnym niezapewniającym obsługi sterowników drukarki lub za pomocą
urządzenia przenośnego bądź innego sprzętu, który nie obsługuje ustawień formatu i typu papieru, należy
skonfigurować opcje <Stand. rozm. papieru> i <Domyślny typ papieru>. Menu wyboru podajnika(P. 491)
Drukowanie na tylnej stronie zadrukowanego arkusza (Ręczne drukowanie 2-stronne)
Istnieje możliwość wydruku na tylnej stronie zadrukowanego arkusza. Należy wygładzić zagięcia, które mogły
pojawić się na papierze i włożyć arkusz do tacy wielofunkcyjnej ( Ładowanie papieru na tacę
wielofunkcyjną(P. 49) ) tak, aby arkusz leżał stroną przeznaczoną do zadrukowania do góry (wcześniej
zadrukowana strona powinna znajdować się na dole).
● Aby drukować na odwrocie już zadrukowanego papieru, należy w menu ustawień na panelu roboczym
wybrać ustawienie <Ręczne 2-str. (MP)> dla opcji <2. strona>. Ręczne 2-str. (MP)(P. 498)
● Ładuj tylko jeden arkusz papieru na wydruk.
● Można używać jedynie papieru zadrukowanego za pomocą tego urządzenia.
● Nie można drukować na wcześniej zadrukowanej stronie arkusza.
ŁĄCZA
Obsługiwane rodzaje papieru(P. 571)
48
Podstawowe informacje na temat obsługi
Ładowanie papieru na tacę wielofunkcyjną
6869-00X
1660-030
Gdy wydruk ma być wykonany na innym typie papieru niż ten, który znajduje się w szufladzie na papier, należy go
załadować na tacę wielofunkcyjną. Szuflada na papier służy do przechowywania zwykle używanego typu papieru.
Umieszczanie papieru w szufladzie na papier(P. 43)
Orientacja papieru
Poniższa tabela zawiera informacje niezbędne do załadowania dostępnego papieru w odpowiedniej orientacji.
Papier
Orientacja
A3, B4, A4 (orientacja pozioma),
B5 (orientacja pozioma), A5 (orientacja pozioma),
A6 (orientacja pozioma), Ledger, Legal,
Letter (orientacja pozioma),
Statement (orientacja pozioma),
Executive (orientacja pozioma),
Foolscap, 305x457 mm/12x18 in,
Indian Legal, 8K,
16K (orientacja pozioma), Karta katalogowa,
Kartka pocztowa, Kartka pocztowa zwrotna,
Koperta, Niestandardowy (orientacja pozioma)
A4 (orientacja pionowa), A5 (orientacja pionowa),
B5 (orientacja pionowa), Letter (orientacja pionowa),
Executive (orientacja pionowa),
Statement (orientacja pionowa),
16K (orientacja pionowa),
Kartka pocztowa 4 na 1, Niestandardowy (orientacja pionowa)
1
Otwórz pokrywę.
2
Wyciągnij tacę na papier.
3
Rozsuń prowadnice papieru.
● Aby rozsunąć prowadnice, naciśnij dźwignię zwalniającą blokadę.
49
Podstawowe informacje na temat obsługi
4
Wkładaj papier na tacę wielofunkcyjną, aż dalsze przesunięcie papieru nie będzie
możliwe.
● Włóż papier zadrukowaną stroną skierowaną w dół.
● Dobrze przekartkuj stos papieru i wyrównaj brzegi na równej powierzchni.
Nie należy wkładać stosu papieru przekraczającego wysokość znaku ogranicznika
● Należy upewnić się, że stos papieru nie wychodzi poza ogranicznik stosu papieru (
). Załadowanie zbyt
dużej ilości papieru może prowadzić do jego zakleszczenia.
● Informacje na temat ładowania kopert i papieru z logo znajdują się w rozdziale
pocztówek(P. 52) i Ładowanie uprzednio zadrukowanego papieru(P. 56) .
5
Ładowanie kopert lub
Upewnij się, że ustawienie prowadnic papieru odpowiada krawędziom papieru.
● Naciśnij dźwignię zwolnienia blokady i zsuń prowadnice papieru do momentu zrównania się z krawędziami
papieru.
50
Podstawowe informacje na temat obsługi
Należy się upewnić, że ustawienie prowadnic papieru odpowiada krawędziom papieru
● Ustawienie prowadnic papieru za szeroko lub za wąsko może spowodować problemy z podawaniem lub
zakleszczenie papieru.
»
Przejdź do rozdziału
Określanie rozmiaru i typu papieru załadowanego na tacę
wielofunkcyjną(P. 64)
Zmiana rozmiaru i typu papieru
● Domyślne ustawienia fabryczne rozmiaru i rodzaju papieru to odpowiednio <A4> i <Typy mieszane>. Jeśli
do urządzenia zostanie załadowany inny format lub typ papieru, należy zmienić ustawienia. Jeśli nie
zostaną one właściwie skonfigurowane, urządzenie nie będzie drukować poprawnie.
Automatyczne wykrywanie typu papieru
● Urządzenie jest wyposażone w funkcję automatycznego wykrywania typu papieru. Po włączeniu tej funkcji
nie ma potrzeby zmiany ustawień typu papieru w przypadku załadowania zwykłego lub grubego papieru.
Wykr. typ pap. autom(P. 495)
● Aby drukować w systemie operacyjnym niezapewniającym obsługi sterowników drukarki lub za pomocą
urządzenia przenośnego bądź innego sprzętu, który nie obsługuje ustawień formatu i typu papieru, należy
skonfigurować opcje <Stand. rozm. papieru> i <Domyślny typ papieru>. Menu wyboru podajnika(P. 491)
Drukowanie na tylnej stronie zadrukowanego arkusza (Ręczne drukowanie 2-stronne)
Istnieje możliwość wydruku na tylnej stronie zadrukowanego arkusza. Należy wygładzić zagięcia, które mogły
pojawić się na papierze i włożyć arkusz do tacy wielofunkcyjnej tak, aby arkusz leżał stroną przeznaczoną do
zadrukowania do dołu (wcześniej zadrukowana strona powinna znajdować się na górze).
● Aby drukować na odwrocie już zadrukowanego papieru, należy w menu ustawień na panelu roboczym
wybrać ustawienie <Ręczne 2-str. (MP)> dla opcji <2. strona>. Ręczne 2-str. (MP)(P. 498)
● Ładuj tylko jeden arkusz papieru na wydruk.
● Można używać jedynie papieru zadrukowanego za pomocą tego urządzenia.
● Nie można drukować na wcześniej zadrukowanej stronie arkusza.
ŁĄCZA
Obsługiwane rodzaje papieru(P. 571)
51
Podstawowe informacje na temat obsługi
Ładowanie kopert lub pocztówek
6869-00Y
Przed załadowaniem kopert lub pocztówek należy wygładzić możliwe zagięcia. Należy również zwrócić uwagę na
umieszczenie ich we właściwej orientacji i odpowiednią stroną do góry. Uwaga: kopert ani pocztówek nie wolno
ładować do szuflady na papier.
Ładowanie kopert(P. 52)
Ładowanie pocztówek(P. 54)
● W tej sekcji opisano sposób ładowania kopert lub pocztówek w wybranej orientacji oraz czynności do
wykonania przed ich załadowaniem. Informacje na temat ładowania kopert lub pocztówek na tacę
wielofunkcyjną zawiera sekcja Ładowanie papieru na tacę wielofunkcyjną(P. 49) .
Ładowanie kopert
◼ Przed załadowaniem kopert
Wykonanie poniższych czynności pozwoli przygotować koperty do załadowania.
1
2
3
Zamknij klapkę każdej koperty.
Dociśnij je, aby wypuścić z nich zbędne powietrze i upewnij się, że ich krawędzie
ściśle do siebie przylegają.
Wyprostuj zagięte rogi kopert i wygładź zagniecenia.
52
Podstawowe informacje na temat obsługi
4
Wyrównaj krawędzie kopert na płaskiej powierzchni.
◼ Ładowanie kopert na tacę wielofunkcyjną
Załaduj koperty w orientacji pionowej (krótsze krawędzie powinny być skierowane w stronę urządzenia) niezaklejoną
stroną (przednią) do dołu. Nie można drukować na tylnej stronie kopert.
Koperty YOUGATANAGA 3, ISO-C5, Monarch, nr 10 (COM10) lub DL
Kopertę należy wkładać tak, aby jej krawędź z zamknięciem znajdowała się po prawej stronie, zgodnie
ilustracją.
Koperty KAKUGATA 2 lub NAGAGATA 3
Włożyć kopertę tak, aby jej klapka była skierowana w stronę użytkownika.
53
Podstawowe informacje na temat obsługi
Ładowanie pocztówek
● W przypadku pocztówek nie jest możliwe automatyczne drukowanie dwustronne. Aby drukować na obu
stronach pocztówki, należy wykonać wydruk z jednej, a następnie drugiej jej strony.
● Przed załadowaniem pocztówek należy je wygładzić. W przypadku pozostawienia zagięć wydruku mogą być
krzywe, a obrazy być drukowane w postaci zniekształconej.
◼ Ładowanie pocztówek na tacę wielofunkcyjną
Włożyć pocztówkę stroną do drukowania skierowaną w dół, tak aby krótsza krawędź była skierowana w stronę
urządzenia.
Pocztówka
Włożyć pocztówkę tak, aby górna krawędź była skierowana w stronę urządzenia.
Pocztówka z odpowiedzią
Rozwinąć pocztówkę i włożyć ją tak, aby prawa strona była skierowana w stronę urządzenia.
54
Podstawowe informacje na temat obsługi
Pocztówka 4 na 1
Kartkę pocztową należy włożyć prawą stroną w kierunku urządzenia.
55
Podstawowe informacje na temat obsługi
Ładowanie uprzednio zadrukowanego papieru
6869-010
Używając uprzednio zadrukowanego papieru z logo, podczas ładowania papieru należy zwrócić uwagę na jego
ułożenie. Aby drukowanie zostało przeprowadzone na właściwej stronie arkusza z logo, papier należy załadować w
odpowiedni sposób.
Wykonywanie 1-stronnych wydruków na papierze z logo(P. 56)
Wykonywanie dwustronnych wydruków na papierze z logo(P. 57)
● W tej sekcji opisano sposób ładowania uprzednio zadrukowanego papieru odpowiednią stroną do góry i we
właściwej orientacji. Poniżej znajdują się ogólne informacje na temat ładowania papieru w szufladzie na
papier lub na tacy wielofunkcyjnej.
Umieszczanie papieru w szufladzie na papier(P. 43)
Ładowanie papieru na tacę wielofunkcyjną(P. 49)
Wykonywanie 1-stronnych wydruków na papierze z logo
Drukowanie na papierze z logo w orientacji pionowej
Ładowanie papieru w szufladzie na papier
Załaduj papier stroną z logo (przeznaczoną do wydruku dokumentu) do góry.
Ładowanie papieru na tacę wielofunkcyjną
Załaduj papier stroną z logo (przeznaczoną do wydruku dokumentu) skierowaną w dół.
56
Podstawowe informacje na temat obsługi
Drukowanie na papierze z logo w orientacji poziomej
Ładowanie papieru w szufladzie na papier
Załaduj papier stroną z logo (przeznaczoną do wydruku dokumentu) do góry.
Ładowanie papieru na tacę wielofunkcyjną
Załaduj papier stroną z logo (przeznaczoną do wydruku dokumentu) skierowaną w dół.
Wykonywanie dwustronnych wydruków na papierze z logo
Jeśli drukowany dokument składa się z nieparzystej liczby stron, należy w menu ustawień na panelu roboczym wybrać
ustawienie <Metoda alternatywna> dla opcji <Wyłącz>. Metoda alternatywna(P. 372)
57
Podstawowe informacje na temat obsługi
Drukowanie na papierze z logo w orientacji pionowej
Ładowanie papieru w szufladzie na papier
Załaduj papier przednią stroną z logo (przeznaczoną do wydruku pierwszej strony dokumentu) w dół.
Ładowanie papieru na tacę wielofunkcyjną
Załaduj papier przednią stroną z logo (przeznaczoną do wydruku pierwszej strony dokumentu) skierowaną w
górę.
Drukowanie na papierze z logo w orientacji poziomej
Ładowanie papieru w szufladzie na papier
Załaduj papier przednią stroną z logo (przeznaczoną do wydruku pierwszej strony dokumentu) w dół.
58
Podstawowe informacje na temat obsługi
Ładowanie papieru na tacę wielofunkcyjną
Załaduj papier przednią stroną z logo (przeznaczoną do wydruku pierwszej strony dokumentu) skierowaną w
górę.
Ustawienie <Metoda podaw. pap.>
● W przypadku drukowania na uprzednio zadrukowanym papierze konieczna jest zmiana kierunku ułożenia
strony za każdym razem, gdy wykonywane jest przełączanie pomiędzy drukowaniem jednostronnym i
dwustronnym. Jeśli jednak opcja Metoda podaw. pap.> jest ustawiona na Priorytet str. wydr.>, wybrany
kierunek ułożenia strony przy ładowaniu jednostronnie zadrukowanego papieru do wydruku dwustronnego
(strona z logo skierowana w dół w szufladzie z papierem lub do góry na tacy wielofunkcyjnej) może być
również używany w przypadku druku jednostronnego. Ustawienie to jest szczególnie przydatne, gdy wydruki
jednostronne są wykonywane tak samo często jak dwustronne. Metoda podaw. pap.(P. 408)
59
Podstawowe informacje na temat obsługi
Określanie formatu i typu papieru
6869-011
Niezbędne jest ustawienie rozmiaru i typu papieru zgodnego z rodzajem papieru załadowanego w szufladzie na
papier. Gdy ładowany rodzaj papieru jest inny niż ostatnio używany, należy zmienić ustawienia papieru.
● Jeśli ustawienia nie są zgodne z rozmiarem i typem załadowanego papieru, może wystąpić zacięcie papieru
lub błąd drukowania.
60
Podstawowe informacje na temat obsługi
Określanie formatu i typu papieru załadowanego w
szufladzie na papier
6869-012
W razie potrzeby określić rozmiar i typ papieru w zależności od rodzaju papieru załadowanego w szufladzie na papier.
1
Naciśnij przycisk
2
Za pomocą
/
( ).
wybierz jedno z ustawień: od <Rozm. pap. w szuf. 1> do <Rozm.
pap. w szuf. 5>, po czym naciśnij przycisk
.
● Opcje od <Rozm. pap. w szuf. 2> do <Rozm. pap. w szuf. 5> są wyświetlane, gdy jest zainstalowany
dodatkowy podajnik papieru lub podajnik Cassette Feeding Unit.
3
Wybierz format papieru i naciśnij przycisk
.
Informacje o opcji <Automatycznie>
● Dla następujących formatów papieru wybierz ustawienie <Automatycznie>.
- A3
- Ledger
- B4
- Legal
- A4
- Letter
- B5 (orientacja pionowa)
- Executive (orientacja pionowa)
- A5 (orientacja pionowa)
Formaty papieru, które można załadować w orientacji poziomej lub pionowej
● Papier następujących formatów można załadować w orientacji poziomej lub pionowej. Aby wybrać
ustawienie zgodnie z orientacją papieru, zapoznaj się z poniższą tabelą.
Format papieru
A4
Orientacja
Ustawienie
<Automatycznie>
<Automatycznie>
61
Podstawowe informacje na temat obsługi
Format papieru
Orientacja
A5
*1
Ustawienie
<
A5R>
<Automatycznie>
B5
<
B5R>
<Automatycznie>
Letter
<Automatycznie>
<Automatycznie>
Executive
<
EXECR>
<Automatycznie>
16K
Niestandardowy format papieru
*2
<
16KR>
<
16K>
<
Rozm. niest. R>
<
Rozm. niestan.>
*1 Gdy
używany jest sterownik drukarki Canon Generic Plus UFR II, przed rozpoczęciem drukowania należy zaznaczyć
pole wyboru [Pionowe podawanie standardowych formatów papieru] na karcie [Źródło papieru].
*2 Gdy
używany jest sterownik drukarki Canon Generic Plus UFR II, przed rozpoczęciem drukowania należy zaznaczyć
pole wyboru [Pionowe podawanie papieru niestandardowego] na karcie [Źródło papieru].
Informacje na temat <Dowolny rozm.>
● Jeśli użytkownik często zmienia format ładowanego papieru, można wybrać ustawienie <Dowolny rozm.>,
co eliminuje konieczność dostosowywania ustawienia formatu papieru przy każdym drukowaniu. Należy
jednak zwrócić uwagę na fakt, że ustawienie to powoduje, że urządzenie drukuje nawet wtedy, gdy
ustawienie formatu papieru w sterowniku drukarki nie zgadza się z formatem papieru załadowanego do
urządzenia.
● Po wyborze opcji <Dowolny rozm.> prędkość drukowania będzie mniejsza.
4
Wybierz jedno z ustawień: od <Typ pap. w szufl. 1> do <Typ pap. w szufl. 5>, po czym
naciśnij przycisk
.
● Opcje od <Typ pap. w szufl. 2> do <Typ pap. w szufl. 5> są wyświetlane, gdy jest zainstalowany dodatkowy
podajnik papieru lub podajnik Cassette Feeding Unit.
62
Podstawowe informacje na temat obsługi
5
Wybierz typ papieru i naciśnij przycisk
.
Informacje na temat <Typy mieszane>
● Jeśli użytkownik często zmienia typ ładowanego papieru, można wybrać ustawienie <Typy mieszane>, co
eliminuje konieczność dostosowywania ustawienia typu papieru przy każdym drukowaniu. Należy jednak
zwrócić uwagę na fakt, że ustawienie to powoduje, że urządzenie drukuje nawet wtedy, gdy ustawienie
typu papieru w sterowniku drukarki nie zgadza się z typem papieru załadowanego do urządzenia.
Automatyczne wykrywanie rodzaju papieru
● Urządzenie jest wyposażone w funkcję automatycznego wykrywania typu papieru. Po włączeniu tej funkcji
nie ma potrzeby zmiany ustawień typu papieru w przypadku załadowania zwykłego lub grubego papieru.
Wykr. typ pap. autom(P. 495)
ŁĄCZA
Umieszczanie papieru w szufladzie na papier(P. 43)
Obsługiwane rodzaje papieru(P. 571)
63
Podstawowe informacje na temat obsługi
Określanie rozmiaru i typu papieru załadowanego na
tacę wielofunkcyjną
6869-013
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz format papieru i naciśnij przycisk
( ).
/
wybierz opcję <Roz. pap. tacy wiel.> i naciśnij przycisk
.
.
Formaty papieru, które można załadować w orientacji poziomej lub pionowej
● Papier następujących formatów można załadować w orientacji poziomej lub pionowej. Aby wybrać
ustawienie zgodnie z orientacją papieru, zapoznaj się z poniższą tabelą.
Rozmiar papieru
Orientacja
A4
B5
A5
Letter
*1
Ustawienie
<
A4R>
<
A4>
<
B5R>
<
B5>
<
A5R>
<
A5>
<
LTRR>
64
Podstawowe informacje na temat obsługi
Rozmiar papieru
Orientacja
Executive
16K
Statement
Niestandardowy format papieru
*2
Ustawienie
<
LTR>
<
EXECR>
<
EXEC>
<
16KR>
<
16K>
<
STMTR>
<
STMT>
<
Rozm. niest. R>
<
Rozm. niestan.>
*1 Gdy
używany jest sterownik drukarki Canon Generic Plus UFR II, przed rozpoczęciem drukowania należy zaznaczyć
pole wyboru [Pionowe podawanie standardowych formatów papieru] na karcie [Źródło papieru].
*2 Gdy
używany jest sterownik drukarki Canon Generic Plus UFR II, przed rozpoczęciem drukowania należy zaznaczyć
pole wyboru [Pionowe podawanie papieru niestandardowego] na karcie [Źródło papieru].
Informacje na temat <Dowolny rozm.>
● Jeśli użytkownik często zmienia format ładowanego papieru, można wybrać ustawienie <Dowolny rozm.>,
co eliminuje konieczność dostosowywania ustawienia formatu papieru przy każdym drukowaniu. Należy
jednak zwrócić uwagę na fakt, że ustawienie to powoduje, że urządzenie drukuje nawet wtedy, gdy
ustawienie formatu papieru w sterowniku drukarki nie zgadza się z formatem papieru załadowanego do
urządzenia.
● Po wyborze opcji <Dowolny rozm.> prędkość drukowania będzie mniejsza.
4
Wybierz opcję <Typ pap. tacy wiel.> i naciśnij przycisk
5
Wybierz typ papieru i naciśnij przycisk
65
.
.
Podstawowe informacje na temat obsługi
Informacje na temat <Typy mieszane>
● Jeśli użytkownik często zmienia typ ładowanego papieru, można wybrać ustawienie <Typy mieszane>, co
eliminuje konieczność dostosowywania ustawienia typu papieru przy każdym drukowaniu. Należy jednak
zwrócić uwagę na fakt, że ustawienie to powoduje, że urządzenie drukuje nawet wtedy, gdy ustawienie
typu papieru w sterowniku drukarki nie zgadza się z typem papieru załadowanego do urządzenia.
Automatyczne wykrywanie rodzaju papieru
● Urządzenie jest wyposażone w funkcję automatycznego wykrywania typu papieru. Po włączeniu tej funkcji
nie ma potrzeby zmiany ustawień typu papieru w przypadku załadowania zwykłego lub grubego papieru.
Wykr. typ pap. autom(P. 495)
ŁĄCZA
Ładowanie papieru na tacę wielofunkcyjną(P. 49)
Obsługiwane rodzaje papieru(P. 571)
66
Podstawowe informacje na temat obsługi
Oszczędzanie energii
6869-014
Można zaoszczędzić energię poprzez skonfigurowanie urządzenia w taki sposób, aby automatycznie przechodziło w
stan oszczędzania energii (tryb uśpienia) lub wyłączało się, jeżeli urządzenie pozostaje bezczynne przez pewien okres
czasu lub w taki sposób, aby zasilanie było automatycznie wyłączane o konkretnej godzinie w każdy dzień tygodnia.
Przechodzenie w tryb uśpienia(P. 68)
Ustawianie czasu automatycznego wyłączania(P. 71)
67
Podstawowe informacje na temat obsługi
Przechodzenie w tryb uśpienia
6869-015
Funkcja przechodzenia w tryb uśpienia umożliwia zmniejszenie zużycia energii przez urządzenie poprzez odcięcie
dopływu energii do panelu sterowania. Jeśli przez jakiś czas za pomocą urządzenia nie będą wykonywane żadne
na panelu
operacje, na przykład podczas przerwy obiadowej, można zaoszczędzić energię, naciskając przycisk
sterowania. Możliwe jest także skorzystanie z ustawienia Czas automatycznego uśpienia, dzięki któremu urządzenie
zostaje automatycznie przełączone w stan uśpienia, jeśli pozostaje bezczynne przez określony czas. Poprzez określenie
ustawień można zmienić odstęp, z którym funkcja automatycznego uśpienia będzie wykonywana lub przestawić
urządzenie w tryb uśpienia o określonym czasie.
Tryb uśpienia
● Kiedy urządzenie pracuje w trybie uśpienia,
świeci się na zielono.
Sytuacje, w których urządzenie nie przechodzi w tryb uśpienia
● Urządzenie nie przechodzi w tryb uśpienia podczas odbierania danych z komputera lub wysyłania danych do
komputera, gdy którakolwiek z pokryw jest otwarta bądź gdy kaseta z tonerem nie jest zainstalowana.
Wybór poziomu trybu uśpienia
Stopień zmniejszenia zużycia energii w trybie uśpienia różni się zależnie od poziomu wybranego dla tego trybu
( Tryb uśpienia(P. 327) ). Aby zapewnić skuteczne oszczędzanie energii, zalecamy korzystanie z urządzenia z
domyślnym ustawieniem fabrycznym poziomu trybu uśpienia. Aby zmienić ustawienie, należy postępować
zgodnie z poniższą instrukcją.
(
)
<Menu sterowania>
<Tryb uśpienia>
<Wysoki (głęb. uśp.)> lub
<Śred. (uśp. drukar.)>
Zmiana czasu automatycznego ustawiania trybu uśpienia
Urządzenie automatycznie przechodzi w tryb uśpienia, gdy pozostaje bezczynne przez określony czas. Zalecane
jest korzystanie z ustawień fabrycznych ( Czas przes. uśpienia(P. 328) ) pozwalających zaoszczędzić najwięcej
energii. Aby zmienić czas, po upłynięciu którego następuje przejście w tryb uśpienia, należy wykonać czynności
opisane poniżej.
(
)
<Menu sterowania>
<Czas przes. uśpienia>
czasu
68
Wybierz wartość
Podstawowe informacje na temat obsługi
● Bezpośrednio po włączeniu urządzenia czas, jaki upływa, zanim urządzenie wejdzie w tryb uśpienia,
może być dłuższy niż określony w menu.
Automatyczne rozpoczynanie/zakańczanie trybu uśpienia o określonym czasie
Istnieje możliwość ustawienia włączania trybu uśpienia o określonym czasie. Można również ustawić zamykanie
trybu uśpienia o określonym czasie.
(
)
<Menu sterowania>
czasu uśpienia>
<Ustawienia zegara>
<Włącz>
<Budzik> lub <Zegar
<Pobudka> lub <Czas uśpienia>
Ustaw
godzinę
<Budzik>
Aby automatycznie wyłączyć tryb uśpienia o określonym czasie, wybierz opcję <Włącz>.
<Pobudka>
Ustaw czas automatycznego wyłączenia trybu uśpienia.
<Zegar czasu uśpienia>
Aby automatycznie włączyć tryb uśpienia o określonym czasie, wybierz opcję <Włącz>.
<Czas uśpienia>
Ustaw czas automatycznego włączenia trybu uśpienia.
Zapobieganie przechodzeniu urządzenia w tryb uśpienia w przypadku wystąpienia
błędu
Można skonfigurować ustawienia tak, aby urządzenie nie przechodziło w tryb uśpienia, jeśli wystąpi błąd.
mimo wyst. bł.(P. 328)
(
)
<Menu sterowania>
<Uśp. mimo wyst. bł.>
69
<Wyłącz>
Uśp.
Podstawowe informacje na temat obsługi
Kończenie trybu uśpienia
Naciśnij przycisk
.
70
Podstawowe informacje na temat obsługi
Ustawianie czasu automatycznego wyłączania
6869-016
Można skonfigurować urządzenie tak, aby było automatycznie wyłączane, gdy przez dłuższy czas pozostaje
nieużywane. Można również skonfigurować urządzenie tak, aby zostało wyłączone o określonej godzinie. Funkcje te
pozwalają uniknąć niepotrzebnego zużycia energii, które występuje z powodu niewyłączenia zasilania. Domyślnie ta
funkcja jest włączona.
● Ustawienie krótszego niż domyślny (4 godziny) automatycznego czasu wyłączenia może spowodować
skrócenie okresu eksploatacji zasobników z tonerem.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Menu sterowania]
4
Skonfiguruj ustawienia zegara automatycznego wyłączania.
[Edytuj].
71
Podstawowe informacje na temat obsługi
[Automatyczny czas wyłączenia]
Zaznaczenie tego pola wyboru umożliwia wyłączenie zasilania, gdy upłynie czas ustawiony w opcji [Czas
automatycznego wyłączenia].
[Czas automatycznego wyłączenia]
Pozwala określić, po ilu godzinach od czasu przejścia w tryb uśpienia urządzenie ma zostać wyłączone.
[Ustaw automatyczny tygodniowy czas wyłączenia]
Zaznaczenie pola wyboru pozwala na ustawienie czasu automatycznego wyłączania dla poszczególnych dni
tygodnia.
Od [Niedziela] do [Sobota]
Wprowadź czas wyłączenia zasilania. W przypadku niepodania czasu nie zostanie skonfigurowany czas
automatycznego wyłączenia w danym dniu tygodnia.
5
Kliknij [OK].
Procedura wyłączania się nie kończy
● Całkowite wyłączenie się urządzenia może potrwać trochę czasu. Nie wolno odłączać przewodu zasilającego
do czasu wyłączenia się wyświetlacza.
72
Podstawowe informacje na temat obsługi
Sytuacje, które mogą powodować brak automatycznego wyłączenia zasilania o
określonej godzinie
● Za pomocą urządzenia wykonywana jest jakaś operacja.
● Trwa drukowanie, czyszczenie lub inna operacja.
● Wyświetlany jest komunikat o błędzie.
Jeśli zasilanie nie może zostać wyłączone automatycznie w określonym czasie, zostanie przeprowadzona
ponowna próba do dziesięciu razy w odstępach jednominutowych. Jeśli zasilanie nie może zostać wyłączone
nawet po 10 próbach, użycie funkcji automatycznego wyłączania nie będzie możliwe w danym dniu.
73
Drukowanie dokumentu
Drukowanie dokumentu
Drukowanie dokumentu .............................................................................................................................. 75
Drukowanie z komputera ................................................................................................................................... 76
Anulowanie drukowania ................................................................................................................................. 79
Różne metody drukowania ................................................................................................................................. 81
Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB) ............................................................ 83
Zmiana ustawień domyślnych wydruku z urządzenia USB ....................................................................... 93
Drukowanie dokumentu zabezpieczonego kodem PIN (Zabezpieczone drukowanie) ..................................... 95
Drukowanie szyfrowane ........................................................................................................................... 99
Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania) ................................ 100
Usuwanie dokumentu zapisanego w urządzeniu ................................................................................... 104
Ustawianie nazwy lub kodu PIN dla sektora ........................................................................................... 108
Drukowanie bez otwierania pliku (Wydruk bezpośredni) .............................................................................. 110
Ustawienia drukowania dla funkcji drukowania bezpośredniego ........................................................... 113
Drukowanie odebranej wiadomości e-mail (Drukowanie e-maili) ................................................................. 125
74
Drukowanie dokumentu
Drukowanie dokumentu
6869-017
W tej sekcji opisano sposób drukowania dokumentów utworzonych na komputerze, plików do wydrukowania
zapisanych na urządzeniu pamięci USB i drukowania dokumentów poprzez wprowadzanie kodu PIN z panelu
roboczego.
◼ Drukowanie z komputera
Możliwe jest drukowanie dokumentu utworzonego za pomocą komputera przy użyciu sterownika drukarki.
Drukowanie z komputera(P. 76)
◼ Korzystanie z przydatnych funkcji drukowania
Za pomocą funkcji drukowania można drukować pliki zapisane na urządzeniu pamięci USB poprzez podłączenie takiej
pamięci bezpośrednio do urządzenia bez konieczności korzystania z komputera. Można również ustawić wymóg
wprowadzenia kodu PIN przed rozpoczęciem drukowania. Różne metody drukowania(P. 81)
75
Drukowanie dokumentu
Drukowanie z komputera
6869-018
Możliwe jest drukowanie dokumentów utworzonych za pomocą zainstalowanych na komputerze aplikacji przy użyciu
sterownika drukarki. Sterownik drukarki zapewnia dostęp do użytecznych ustawień, takich jak Powiększanie/
zmniejszanie i Drukowanie 2-stronne, pozwalających na drukowanie dokumentów na różne sposoby. Zanim możliwe
będzie korzystanie z tych funkcji, konieczne jest wykonanie pewnych czynności, takich jak instalacja sterownika
drukarki na komputerze. Aby uzyskać więcej informacji, zapoznaj się z instrukcjami obsługi odpowiednich sterowników
na stronie internetowej z podręcznikami online.
Informacje na temat Pomocy sterownika drukarki(P. 76)
Korzystanie z elementów opcjonalnych(P. 76)
Podstawowe operacje drukowania(P. 77)
Informacje na temat Pomocy sterownika drukarki
Do ekranu Pomoc można przejść, klikając pozycję [Pomoc] na ekranie sterownika drukarki. W oknie tym znajdują się
szczegółowe informacje, których nie ma w Podręcznik użytkownika.
Korzystanie z elementów opcjonalnych
Jeśli w urządzeniu zamontowany jest opcjonalny podajnik kasetowy lub podajnik Cassette Feeding Unit, należy
wykonać następujące czynności związane ze sterownikiem drukarki.
● Aby wykonać poniższą procedurę, należy zalogować się na komputerze przy użyciu konta administratora.
Otwórz folder drukarki ( Wyświetlanie folderu Drukarki(P. 627) ) Kliknij prawym przyciskiem
myszy ikonę drukarki danego urządzenia [Właściwości drukarki] lub kartę [Właściwości]
[Ustawienia urządzenia] [Źródło papieru] Wybierz źródło papieru [OK] [OK]
76
Drukowanie dokumentu
Podstawowe operacje drukowania
W tej sekcji opisano drukowanie dokumentów utworzonych za pomocą komputera przy użyciu sterownika drukarki.
Ustawienie papieru w urządzeniu
● Standardowo przed przystąpieniem do drukowania należy określić format i typ papieru załadowanego w
poszczególnych źródłach papieru.
1
Otwórz dokument w aplikacji oraz okno dialogowe drukowania.
2
Wybierz drukarkę, następnie kliknij opcję [Preferencje] lub [Właściwości].
3
Określ ustawienia drukowania według potrzeb i kliknij przycisk [OK].
● Przełącz kartę zgodnie z ustawieniami.
77
Drukowanie dokumentu
Po skonfigurowaniu ustawienia [Optymalizacja drukowania reklam] *
● Zaleca się określenie następujących ustawień urządzenia, które pozwalają uzyskać lepsze wyniki
drukowania.
- <Tryb ostrzeż. tonera> : <Wydruk z POP>
- <Prędkość drukow. POP> : <Tryb 2>
- <Autom. kalibrac. POP> : <Włącz>
Tryb ostrzeż. tonera(P. 413)
Prędkość drukow. POP(P. 412)
Autom. kalibrac. POP(P. 413)
● Istnieją ograniczenia dotyczące papieru, który może być używany z tą funkcją. Patrz Rodzaje papieru,
których można używać z funkcją Optymalizacja drukowania reklam(P. 574) , aby uzyskać więcej
informacji na temat dostępnych rozmiarów i formatów papieru.
● Gdy poziom napełnienia kasety z tonerem jest niski, można przeprowadzić automatyczną kalibrację.
Spowoduje to powolne rozpoczęcie drukowania.
● Jeśli ustawienie <Autom. kalibrac. POP> nie jest skonfigurowane, przed rozpoczęciem drukowania POP
Korekcja niedopasowania kolorów i
zaleca się wykonanie procedury <Kalibracja druk. POP>.
odcieni(P. 534)
*Aby
uzyskać więcej informacji na temat funkcji Optymalizacja drukowania reklam, zapoznaj się z instrukcjami obsługi
odpowiednich sterowników na stronie internetowej z podręcznikami online.
4
Kliknij pozycję [Drukuj] albo [OK].
➠ Drukowanie rozpocznie się.
● Aby anulować drukowanie, patrz
Anulowanie drukowania(P. 79) .
78
Drukowanie dokumentu
Anulowanie drukowania
6869-019
Drukowanie można anulować z poziomu komputera lub panelu sterowania urządzenia.
Z poziomu komputera(P. 79)
Z poziomu panelu sterowania(P. 80)
Z poziomu komputera
Zadanie drukowania można przerwać za pośrednictwem ikony drukarki wyświetlanej na pasku zadań na pulpicie.
1
Kliknij dwukrotnie ikonę drukarki.
Jeżeli ikona drukarki nie została wyświetlona
● Otwórz folder drukarki ( Wyświetlanie folderu Drukarki(P. 627) ), kliknij prawym przyciskiem myszy
ikonę drukarki i kliknij opcję [Zobacz, co jest drukowane] (lub kliknij dwukrotnie ikonę sterownika drukarki
urządzenia).
2
Wybierz dokument, który chcesz anulować, a następnie kliknij [Dokument]
3
Kliknij [Tak].
[Anuluj].
➠ Wydruk wybranych dokumentów zostaje anulowany.
● Po anulowaniu drukowania klika stron może zostać wyprowadzonych z urządzenia.
Anulowanie w zdalnym interfejsie użytkownika
● Wydruk można anulować na stronie [Stan zadania] w Zdalnym interfejsie użytkownika:
bieżącego stanu drukowanych dokumentów(P. 309)
79
Sprawdzanie
Drukowanie dokumentu
Anulowanie z poziomu aplikacji
● W niektórych aplikacjach wyświetlany jest ekran podobny do poniższego. Wydruk można anulować, klikając
przycisk [Anuluj].
Z poziomu panelu sterowania
Podczas wysyłania danych drukowania z komputera do urządzenia wskaźnik [
przypadku można anulować drukowanie z poziomu panelu roboczego.
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz opcję <Tak> i naciśnij przycisk
przycisk
(
] świeci się (lub miga). W takim
).
/
wybierz dokument, który chcesz anulować i naciśnij
.
.
➠ Wyświetli się komunikat <Trwa anulowanie zadań>, a wybrane zadanie drukowania zostanie anulowane.
● Po anulowaniu drukowania klika stron może zostać wyprowadzonych z urządzenia.
ŁĄCZA
Drukowanie z komputera(P. 76)
Zarządzanie dokumentami i sprawdzanie stanu urządzenia(P. 309)
80
Drukowanie dokumentu
Różne metody drukowania
6869-01A
Za pomocą sterownika drukarki można korzystać z wielu przydatnych funkcji drukowania oraz wykonywać
podstawowe operacje drukowania.
◼ Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB)
Bezpośrednie podłączenie urządzenia pamięci USB do sprzętu umożliwia wydruk plików PDF oraz plików obrazów
przechowywanych na tym urządzeniu. Funkcja ta pozwala drukować bez konieczności korzystania z komputera.
Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB)(P. 83)
◼ Drukowanie dokumentu zabezpieczonego kodem PIN (Zabezpieczone drukowanie)
Jeśli dla danych wysyłanych do urządzenia z komputera zostanie ustawiony kod PIN, dane zostaną wydrukowane
dopiero po wprowadzeniu poprawnego kodu PIN na panelu roboczym urządzenia. Funkcja ta jest przydatna podczas
drukowania dokumentów poufnych. Drukowanie dokumentu zabezpieczonego kodem PIN (Zabezpieczone
drukowanie)(P. 95)
◼ Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)
Dane do wydrukowania można przesłać z komputera na kartę SD. Wówczas będzie można wydrukować żądaną liczbę
egzemplarzy tych danych. Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)
(P. 100)
◼ Drukowanie bez otwierania pliku (Wydruk bezpośredni)
Pliki zapisane na komputerze (PDF, JPEG itp.) można drukować, wysyłając je do urządzenia za pośrednictwem
przeglądarki internetowej. Nie wymaga to instalowania żadnej dodatkowej aplikacji. Drukowanie bez otwierania
pliku (Wydruk bezpośredni)(P. 110)
81
Drukowanie dokumentu
◼ Drukowanie odebranej wiadomości e-mail (Drukowanie e-maili)
Wiadomości e-mail wraz z załącznikami można drukować bezpośrednio za pomocą urządzenia, bez korzystania z
komputera. Drukowanie odebranej wiadomości e-mail (Drukowanie e-maili)(P. 125)
82
Drukowanie dokumentu
Wydruk z urządzenia pamięci USB (Drukowanie
bezpośrednio z USB)
6869-01C
Pliki można drukować bezpośrednio, podłączając urządzenie pamięci USB do urządzenia. Funkcja ta pozwala drukować
bez konieczności korzystania z komputera.
Dostępne urządzenia pamięci USB
Można korzystać z urządzeń pamięci USB sformatowanych w systemie plików FAT32.
● Nie należy korzystać z niestandardowych urządzeń pamięci USB. Wydruk plików z niektórych urządzeń
pamięci USB może być niepoprawny.
● Do portu nie należy podłączać sprzętu innego niż urządzenia pamięci USB. Urządzeń pamięci USB nie
można podłączać za pomocą koncentratora USB lub kabla przedłużającego.
● Nie należy korzystać z urządzeń pamięci USB wyposażonych w funkcje specjalne np. wbudowane
funkcje zabezpieczeń.
1
Podłączyć urządzenie pamięci USB do portu USB służącego do podłączania urządzeń
USB z prawej strony urządzenia.
➠ Automatycznie wyświetlany jest poniższy komunikat.
● Jeśli ekran nie zostanie wyświetlony, naciśnij
(
).
● Nie wolno uderzać nośnika pamięci USB / urządzenia ani nimi wstrząsać, gdy nośnik jest podłączony do
urządzenia.
2
Za pomocą przycisków
/
wybierz opcję <Wybierz pliki> i naciśnij przycisk
83
.
Drukowanie dokumentu
3
Wybierz typ pliku do wydruku i naciśnij przycisk
4
Wybierz plik do wydruku i naciśnij przycisk
.
.
● Istnieje możliwość wyboru wielu plików.
● Aby usunąć zaznaczenie, zaznacz wybrany plik (oznaczony jako
), po czym naciśnij przycisk
usunąć wszystkie zaznaczenia, wybierz opcję <Wyczyść wszystkie> i naciśnij przycisk
● Aby wyświetlić zawartość folderu, zaznacz folder i naciśnij przycisk
wyższego poziomu, naciśnij przycisk
lub
lub
. Aby
.
. Aby powrócić do folderu
.
● Foldery i pliki na niższych poziomach lub o dłuższych nazwach mogą się nie wyświetlać.
● Przejście do innego folderu powoduje usunięcie poprzedniego wyboru plików.
5
Wybierz opcję <Zastosuj> i naciśnij przycisk
.
Drukowanie dokumentu XPS z zastosowaniem zgłoszenia drukowania
Jeśli dokument do wydrukowania jest w formacie XPS, można go wydrukować zgodnie ze zgłoszeniem
drukowania (ustawieniami drukowania) załączonym do pliku.
1
Wybierz opcję <Użyj biletu wydr.> i naciśnij przycisk
2
Wybierz opcję <Rozpocznij drukow.> i naciśnij przycisk
84
.
.
Drukowanie dokumentu
➠ Rozpocznie się drukowanie. Po zakończeniu drukowania należy wyjąć nośnik pamięci USB z urządzenia.
Odłącz urządzenie pamięci USB.(P. 92)
6
Określ ustawienia wydruku w zależności od potrzeb.
● Wybierz żądaną pozycję ustawień i naciśnij przycisk
, aby określić ustawienie.
Ikony* w opisie
Ustawienia drukowania plików PDF
Ustawienia drukowania plików XPS
Ustawienia drukowania plików JPEG
Ustawienia drukowania plików TIFF
* Dla
ustawień wyświetlanych niezależnie od formatu pliku ikony nie są wyświetlane.
<Liczba kopii>
Określanie liczby kopii. Użyj klawiszy numerycznych, aby wprowadzić liczbę, po czym naciśnij przycisk
<Zakres wydruku>/<Zakres wydr. (TIFF)>
Określ zakres (strony) drukowania. Za pomocą przycisków
/
i wybierz metodę wyznaczania zakresu drukowania
<Wszystko>
Wydruk wszystkich stron.
85
wybierz opcję <Metoda wskazywania>
.
.
Drukowanie dokumentu
<Wprowadź strony>
Wydruk wyłącznie określonych stron. Aby określić strony, należy wybrać opcję <Zakres stron>
i za
pomocą klawiszy numerycznych wprowadź wartość parametru <Pierwsza strona> i <Ostatnia strona>
następnie wybierz opcję <<Zastosuj>>
.
a
<Tryb koloru>
Określić, czy drukowanie ma być wykonywane w trybie kolorowym, czy czarno-białym. Używając opcji
wybrać ustawienie i nacisnąć przycisk
.
/
<Autom. (kol./czarny)>
Automatyczny wybór drukowania w trybie kolorowym lub czarno-białym w zależności od typu dokumentu.
<Czarny>
Drukowanie w trybie czarno-białym, nawet jeśli dokument jest w kolorze.
<Drukowanie dwustron.>
Wybierz druk jednostronny lub dwustronny. Za pomocą przycisków
naciśnij przycisk
.
/
wybierz ustawienie, a następnie
● <Drukowanie dwustron.> może być niedostępna w przypadku niektórych rozmiarów lub typów papierów.
Obsługiwane rodzaje papieru(P. 571)
<Miejsce zszycia>
W przypadku wydruków dwustronnych określ, czy dokument będzie zbindowany za pomocą takiego narzędzia,
jak zszywacz wzdłuż krótkiej czy długiej krawędzi. Za pomocą przycisków
/
wybierz położenie bindowania i
naciśnij przycisk
.
<Długa krawędź>
Bindowanie wydruków zostanie wykonane wzdłuż dłuższej krawędzi.
86
Drukowanie dokumentu
<Krótka krawędź>
Bindowanie wydruków zostanie wykonane wzdłuż krótszej krawędzi.
<Wybierz papier>
Wybierz źródło papieru z załadowanym papierem. Za pomocą przycisków
następnie naciśnij przycisk
.
/
wybierz źródło papieru, a
● Podczas drukowania plików PDF lub plików XPS, należy wybrać opcję <Automatycznie>, aby automatycznie
wybrane zostało optymalne źródło papieru.
● Nie można wybrać papieru w niestandardowym rozmiarze.
<Półtony>
Można wybrać metodę wydruku umożliwiającą odzwierciedlenie półtonów (zakres pośredni między jaśniejszymi
i ciemniejszymi obszarami obrazu).
Pliki PDF i XPS
Można wybrać opcję <Błąd dyfuzji> jako metodę odtwarzania półtonów lub definiować taką metodę oddzielnie
dla każdego typu danych obrazu. Aby zdefiniować opcję <Błąd dyfuzji>, należy za pomocą przycisków
/
wybrać opcję <Błąd dyfuzji> nacisnąć przycisk
<Włącz> , a następnie przycisk
. Aby zdefiniować
metodę odtwarzania oddzielnie dla każdego typu danych obrazu, należy za pomocą przycisków
opcję <Rozdzielcz./gradacja>
nacisnąć przycisk
wybrać metodę odtwarzania półtonów
wybrać typ danych obrazu
nacisnąć przycisk
/
wybrać
nacisnąć przycisk
.
<Błąd dyfuzji>
Tryb ten pozwala drukować dane z tekstem i cienkimi liniami oraz zakrzywionymi liniami danych CAD itp.
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku korzystania z <Błąd dyfuzji>.
87
Drukowanie dokumentu
<Rozdzielcz./gradacja>
Wybierz metodę odzwierciedlenia półtonów, gdy opcja <Błąd dyfuzji> jest ustawiona na <Wyłącz> Można
wprowadzić to ustawienie dla każdego typu obrazu zawartego w dokumencie.
Typ obrazu
Wybierz typ obrazu, dla którego chcesz zmienić ustawienie. <Tekst> oznacza litery i znaki, <Grafiki>
oznacza linie i rysunki, a <Obraz> oznacza zdjęcia i obrazy.
<Rozdzielczość>
Wydruk tekstu z wyraźnymi krawędziami w celu uzyskania precyzyjnego wydruku.
<Gradacja>
Umożliwia drukowanie gradacji i obrysów z płynnym wykończeniem. Ten typ drukowania jest odpowiedni
do drukowania rysunków lub wykresów zawierających gradacje.
● Gdy ustawienie opcji <Błąd dyfuzji> to <Włącz>, opcja <Rozdzielcz./gradacja> nie jest wyświetlana.
Pliki JPEG i pliki TIFF
Wybierz metodę odzwierciedlania półtonów za pomocą przycisków
/
, a następnie naciśnij przycisk
.
<Błąd dyfuzji>
Tryb ten pozwala drukować dane z tekstem i cienkimi liniami oraz zakrzywionymi liniami danych CAD itp.
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku korzystania z <Błąd dyfuzji>.
<Rozdzielczość>
Wydruk tekstu z wyraźnymi krawędziami w celu uzyskania precyzyjnego wydruku.
<Gradacja>
Umożliwia drukowanie gradacji i obrysów z płynnym wykończeniem. Ten typ drukowania jest odpowiedni do
drukowania rysunków lub wykresów zawierających gradacje.
<Dopas. rozm. papieru>
88
Drukowanie dokumentu
Pozwala automatycznie wykonywać pomniejszone lub powiększone wydruku zgodnie z ustawieniem parametru
Obszar wydruku(P. 575) papieru. Wydruki są zmniejszane lub powiększane z zachowaniem współczynnika
proporcji oryginalnego dokumentu. Wybierz ustawienie za pomocą przycisków
/
i naciśnij przycisk
.
● To ustawienie jest niedostępne, jeśli wybrano wariant <Automatycznie> dla opcji <Wybierz papier>.
<Powiększenie>
Włącza lub wyłącza powiększanie/zmniejszanie obrazów. Wydruki są powiększane lub zmniejszane z
zachowaniem współczynnika proporcji obrazu. Za pomocą przycisków
/
wybierz ustawienie i naciśnij
przycisk
.
<Wyłącz>
Obszar wydruku(P. 575) papieru, jest on
Gdy obraz mieści się w granicach wyznaczonych parametrem
drukowany w rzeczywistym rozmiarze. Jeśli jest większy niż obszar drukowania, wydruki zostaną zmniejszone.
<Automatycznie>
Pozwala wykonywać powiększone lub pomniejszone wydruki zgodnie z ustawieniem
wydruku(P. 575) .
Obszar
<Zwiększ obszar wydr.>
Określ, czy podczas drukowania Obszar wydruku(P. 575) ma zostać rozciągnięty do pełnego rozmiaru
/
, a następnie naciśnij przycisk
.
papieru. Wybierz ustawienie za pomocą przycisków
● Wybranie ustawienia <Włącz> może w zależności od oryginału sprawić, że niektóre części obrazu w pobliżu
krawędzi papieru mogą zostać utracone papier może zostać częściowo zabrudzony.
<N na 1>
89
Drukowanie dokumentu
Wybierz, czy na jednym arkuszu ma być drukowane wiele stron, przypisując je kolejno, począwszy od lewego
górnego rogu. Aby na przykład wydrukować cztery strony na jednym arkuszu, wybierz opcję <4 na 1>. Wybierz
ustawienie za pomocą przycisków
/
, a następnie naciśnij przycisk
.
● To ustawienie jest niedostępne, jeśli wybrano wariant <Automatycznie> dla opcji <Wybierz papier>.
<Wykańczanie>
Określ metodę sortowania wydruków podczas drukowania dokumentów wielostronicowych. Za pomocą
przycisków
/
wybierz, czy wydruki mają być sortowane, a następnie naciśnij przycisk
.
<Wyłącz>
Wydruki nie są sortowane. Drukowana jest określona liczba egzemplarzy każdej strony. Jeśli na przykład
wykonywane są trzy wydruki czterostronicowego dokumentu, wydruki zostaną ułożone w następującej
kolejności: 1, 1, 1, 2, 2, 2, 3, 3, 3, 4, 4, 4.
<Sortowanie>
Wydruki są grupowane tak, aby tworzyły komplety dokumentów ułożone według numerów stron. Jeśli na
przykład wykonywane są trzy wydruki czterostronicowego dokumentu, wydruki zostaną ułożone w
następującej kolejności: 1, 2, 3, 4, 1, 2, 3, 4, 1, 2, 3, 4.
<Orientacja obrazu>
Określ orientację drukowania obrazu. Wybierz orientację drukowania za pomocą przycisków
następnie naciśnij przycisk
.
90
/
,a
Drukowanie dokumentu
<Automatycznie>
Automatycznie wyznacza orientację drukowania na podstawie szerokości i wysokości obrazu.
<Pionowo>
Tę opcję należy wybrać podczas drukowania obrazów, których dłuższa krawędź występuje w pionie.
<Poziomo>
Tę opcję należy wybrać podczas drukowania obrazów, których dłuższa krawędź występuje w poziomie.
● Jeśli określone ustawienie opcji <Pionowo> lub <Poziomo> jest niezgodne z orientacją obrazu,
wydrukowany zostanie pomniejszony obraz.
<Pozycja wydruku>
Pozwala określić położenie do wydrukowania obrazu. Za pomocą przycisków
drukowania, a następnie naciśnij przycisk
.
/
wybierz położenie
<Automatycznie>
Jeśli dane TIFF zawierają informacje określające położenie wydruku, wówczas obraz zostanie wydrukowany
zgodnie z tymi informacjami. W innym przypadku zostanie on wydrukowany na środku papieru. Dane JPEG
zawsze są drukowane na środku papieru.
<Środek>
Obrazy są drukowane na środku papieru.
<Na górze na lewo>
Obrazy są drukowane z wyrównaniem do lewego, górnego rogu.
7
Wybierz opcję <Rozpocznij drukow.> i naciśnij przycisk
➠ Drukowanie rozpocznie się.
91
.
Drukowanie dokumentu
● Drukowanie można anulować z poziomu panelu roboczego.
8
Anulowanie drukowania(P. 79)
Odłącz urządzenie pamięci USB.
1
Wybierz opcję <Usuń pamięć USB> i naciśnij przycisk
2
Wybierz opcję <Tak> i naciśnij przycisk
.
.
➠ Poczekaj, aż wyświetlony zostanie komunikat poniższy komunikat.
3
Odłącz urządzenie pamięci USB.
● Jeśli w kroku 1 na ekranie została wybrana opcja <Sortuj pliki>, wówczas podczas wybierania plików do
drukowania można zmienić kolejność ich wyświetlania.
WSKAZÓWKI
Aby przeprowadzać drukowanie zawsze z tymi samymi ustawieniami:
wydruku z urządzenia USB(P. 93)
92
Zmiana ustawień domyślnych
Drukowanie dokumentu
Zmiana ustawień domyślnych wydruku z urządzenia
USB
6869-01E
Ustawienia wyświetlane początkowo celem określenia ustawień wydruku są nazywane ustawieniami domyślnymi.
Dopasowanie ustawień domyślnych do często wykonywanych operacji eliminuje konieczność określania tych samych
ustawień za każdym razem, gdy wykonywane są wydruki.
(
)
TIFF>
<Ustaw. wydruku USB>
Wybierz pozycję ustawień
PDF/XPS
<Ustaw. dom. PDF/XPS> lub <Ust. dom. JPEG/
Zmień wartość domyślną wybranej pozycji
JPEG/TIFF
Elementy ustawień
Należy wybrać element do konfiguracji i zmienić wartość domyślną.
◼ Ustawianie kolejności wyświetlania plików do drukowania
Można ustawić kolejność, w jakiej będą wyświetlane pliki do wydrukowania z urządzenia pamięci USB.
(
)
<Ustaw. wydruku USB>
<Ust. dom. sor. plik.>
kolejności wyświetlania plików
<Nazwa (rosnąco)>
Pozwala wyświetlić pliki w kolejności rosnącej według nazwy.
93
Wybierz standard
Drukowanie dokumentu
<Nazwa (malejąco)>
Pozwala wyświetlić pliki w kolejności malejącej według nazwy.
<Data/Czas (rosnąco)>
Pozwala wyświetlić pliki w kolejności rosnącej według daty/godziny.
<Data/Czas (malej.)>
Pozwala wyświetlić pliki w kolejności malejącej według daty/godziny.
ŁĄCZA
Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB)(P. 83)
94
Drukowanie dokumentu
Drukowanie dokumentu zabezpieczonego kodem PIN
(Zabezpieczone drukowanie)
6869-01F
Ustawienie kodu PIN dla dokumentu drukowanego z komputera powoduje, że dokument ten zostaje zapisany na
opcjonalnej karcie pamięci SD zainstalowanej w urządzeniu, a jego wydruk rozpoczyna się dopiero po wprowadzeniu
prawidłowego kodu PIN za pomocą panelu sterowania urządzenia. Funkcja ta nosi nazwę „Wydruk zabezpieczony”, a
dokument zabezpieczony kodem PIN jest nazywany „dokumentem chronionym”. Korzystanie z funkcji Wydruk
zabezpieczony zapobiega pozostawianiu poufnych dokumentów bez nadzoru. Aby można było korzystać z tej funkcji,
konieczne jest zainstalowanie opcjonalnej karty pamięci SD w urządzeniu ( Instalacja karty pamięci SD(P. 600) ).
Przesyłanie dokumentów chronionych z komputera do urządzenia(P. 95)
Drukowanie dokumentów chronionych(P. 96)
Zmiana czasu ważności dokumentów chronionych(P. 97)
Przesyłanie dokumentów chronionych z komputera do urządzenia
Za pomocą opisanej poniżej procedury można wysłać dokument zabezpieczony kodem PIN.
1
Otwórz dokument w aplikacji oraz okno dialogowe drukowania.
2
Wybierz to urządzenie i kliknij opcję [Preferencje] lub [Właściwości].
3
Wybierz [Drukowanie zabezpieczone] w sekcji [Metoda druku].
➠ Zostanie wyświetlony ekran [Informacje]. Sprawdź komunikat i kliknij [Tak] lub [Nie].
4
Określ ustawienia drukowania według potrzeb i kliknij przycisk [OK].
● Przełącz kartę zgodnie z ustawieniami.
95
Drukowanie dokumentu
5
Kliknij pozycję [Drukuj] albo [OK].
➠ Po przesłaniu chronionego dokumentu do urządzenia jest on przechowywany na karcie SD w oczekiwaniu
na wydruk.
● Można też skorzystać z funkcji drukowania szyfrowanego zapewniającej zwiększone bezpieczeństwo.
Drukowanie szyfrowane(P. 99)
Drukowanie dokumentów chronionych
Drukuje zabezpieczone dokumenty wysyłane do urządzenia. Po upływie okresu ważności ( Zmiana czasu ważności
dokumentów chronionych(P. 97) ) dokument zostanie usunięty z pamięci urządzenia i jego wydruk nie będzie już
możliwy.
1
Naciśnij przycisk
2
Za pomocą przycisków
3
przycisk
(
).
/
wybierz opcję <Zabezpieczony wydruk> i naciśnij
.
Wybierz dokument chroniony, który chcesz wydrukować i naciśnij przycisk
● Jeśli karta SD zawiera tylko jeden zabezpieczony dokument, ten ekran nie zostanie wyświetlony.
96
.
Drukowanie dokumentu
Wyświetla się nazwa użytkownika
● Jeśli na karcie SD przechowywane są dokumenty zabezpieczone, utworzone przez kilku użytkowników,
wówczas przed wyświetleniem powyższego ekranu zostanie wyświetlony ekran wyboru użytkownika.
Wybierz swoją nazwę użytkownika i naciśnij przycisk
4
Wprowadź kod PIN i kliknij przycisk
.
.
➠ Drukowanie rozpocznie się.
● Zadania drukowania można anulować z poziomu panelu roboczego.
Anulowanie drukowania(P. 79)
Zmiana czasu ważności dokumentów chronionych
Można zmienić okres ważności trwający od czasu, gdy dane chronionego dokumentu zostają wysłane do urządzenia aż
do czasu, gdy zostają usunięte w ciągu określonego czasu.
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz opcję <Czas us. zab. wydr.> i naciśnij przycisk
4
(
).
/
wybierz opcję <Menu sterowania> i naciśnij przycisk
.
.
Określ czas przechowywania dokumentów zabezpieczonych na karcie SD i naciśnij
przycisk
.
● Dokument zabezpieczony będzie usuwany z karty SD po upływie określonego tutaj czasu.
ŁĄCZA
97
Drukowanie dokumentu
Drukowanie szyfrowane(P. 99)
Instalacja karty pamięci SD(P. 600)
98
Drukowanie dokumentu
Drukowanie szyfrowane
6869-01H
Dane drukowania są szyfrowane przed przesłaniem do urządzenia, co zapewnia większy poziom bezpieczeństwa niż
funkcja standardowego wydruku zabezpieczonego.
◼ Włączanie funkcji drukowania szyfrowanego
Aby skorzystać z funkcji drukowania szyfrowanego, należy wcześniej wykonać następujące operacje.
Otwórz folder drukarki ( Wyświetlanie folderu Drukarki(P. 627) ) Kliknij prawym przyciskiem
myszy ikonę drukarki [Właściwości drukarki] lub kartę [Właściwości] [Ustawienia urządzenia]
[Szczegóły] [Inne ustawienia] Włącz ustawienie [Encrypted Secure Print] [OK] [OK]
◼ Przesyłanie zaszyfrowanych z komputera do urządzenia
Patrz Pomoc. Pomoc można wyświetlić z poziomu sterownika drukarki.
Otwórz folder drukarki (
myszy ikonę urządzenia
Wyświetlanie folderu Drukarki(P. 627) ) Kliknij prawym przyciskiem
[Właściwości drukarki] lub [Właściwości] karta [Encrypted-P] [Help]
◼ Drukowanie zaszyfrowanych dokumentów
Po przesłaniu do urządzenia dokumentu zaszyfrowanego należy go wydrukować. Zaszyfrowane dokumenty są
automatycznie usuwane po upływie czasu przechowywania ( Zmiana czasu ważności dokumentów
chronionych(P. 97) ) i nie można ich już wydrukować. Czas przechowywania ustawia się w taki sam sposób dla
dokumentów zabezpieczonych i zaszyfrowanych.
(
)
<Wydruk zaszyfrowany>
wydrukowania
Wybierz zaszyfrowany dokument do
Wprowadź kod PIN za pomocą klawiszy numerycznych
W przypadku używania znaków alfanumerycznych lub symboli w kodzie PIN
● Podczas określania kodu PIN w sterowniku drukarki na potrzeby funkcji drukowania szyfrowanego
można używać liter, symboli oraz cyfr. Jeśli jednak w kodzie PIN zostaną zawarte litery lub symbole,
wydrukowanie dokumentu z poziomu panelu roboczego urządzenia będzie niemożliwe. Do
wydrukowania zaszyfrowanego dokumentu należy użyć opcji [Stan zadania] zdalnego interfejsu
użytkownika. Sprawdzanie bieżącego stanu drukowanych dokumentów(P. 309)
99
Drukowanie dokumentu
Drukowanie dokumentu zapisanego w urządzeniu
(Drukowanie zapisanego zadania)
6869-01J
Dane drukowane za pomocą komputera można zapisać na karcie pamięci SD zainstalowanej w urządzeniu. Ponieważ
zapisane dane można wydrukować bezpośrednio za pomocą urządzenia, nie trzeba korzystać z komputera za każdym
razem, gdy wykonywane jest drukowanie. Wygodnie jest zapisać dokument, który będzie wielokrotnie drukowany, taki
jak strona tytułowa faksu. Instalacja karty pamięci SD(P. 600)
Zapisywanie dokumentu w urządzeniu(P. 100)
Drukowanie dokumentu zapisanego w urządzeniu(P. 102)
● Dane zapisane na karcie pamięci SD nie zostaną usunięte nawet po wyłączeniu zasilania, jednak gdy upłynie
ustawiony czas przechowywania, zostaną automatycznie wymazane i nie będzie można już ich wydrukować.
Aby zmienić czas przechowywania danych lub zapobiec automatycznemu usuwaniu danych, należy
dostosować odpowiednie ustawienia w Remote UI (Zdalny interfejs użytkownika) ( Zmiana okresu
przechowywania dokumentów(P. 104) ). Zapisane dane można również usunąć ręcznie ( Ręczne
usuwanie dokumentów(P. 105) ).
Zapisywanie dokumentu w urządzeniu
1
Otwórz dokument w aplikacji oraz okno dialogowe drukowania.
2
Wybierz to urządzenie i kliknij opcję [Preferencje] lub [Właściwości].
3
Wybierz [Zapisywanie] w sekcji [Metoda druku] i kliknij [Tak].
100
Drukowanie dokumentu
4
Określ ustawienia przechowywania dokumentów i kliknij [OK].
[Nazwa danych]
Nadaj nazwę danym drukowania, pod którą zostaną zapisane na karcie SD.
[Wprowadź nazwę]
[Użyj nazwy pliku]
Ręcznie ustaw nazwę. Określ przyjazną nazwę, którą będzie można łatwo rozpoznać na
wyświetlaczu urządzenia.
Nazwa zostanie ustawiona automatycznie na podstawie nazwy pliku do wydrukowania
oraz informacji na temat używanej aplikacji.
[Skrzynki pocztowe]
Miejsce zapisu danych drukowania na karcie SD jest nazywane sektorem. Należy wybrać numer sektora do
zapisu dokumentu. W celu ułatwienia identyfikacji sektora można do niego przypisać nazwę. Ustawianie
nazwy lub kodu PIN dla sektora(P. 108)
5
Określ ustawienia drukowania według potrzeb i kliknij przycisk [OK].
● Przełącz kartę zgodnie z ustawieniami.
● Wprowadzone w tym miejscu zmiany w ustawieniach są zapisywane wraz z dokumentem. Kolejne
drukowanie dokumentu będzie przebiegało zgodnie z zapisanymi ustawieniami.
101
Drukowanie dokumentu
6
Kliknij pozycję [Drukuj] albo [OK].
➠ Dokument jest wysyłany do urządzenia i zapisywany w określonym sektorze.
Drukowanie dokumentu zapisanego w urządzeniu
1
Naciśnij przycisk
(
).
● Gdy urządzenie pracuje w trybie offline, nie zadziała nawet po naciśnięciu przycisku
przestawić w tryb online.
(
). Należy je
Online klawisz(P. 28)
2
Za pomocą przycisków
3
Wybierz numer sektora dokumentu, który chcesz wydrukować i naciśnij przycisk
/
wybierz opcję <Wydruk zapis. zad.> i naciśnij przycisk
.
.
Sektor zabezpieczony kodem PIN
● Po wyświetleniu ekranu wprowadzania kodu PIN wprowadź kod PIN i naciśnij przycisk
kodu PIN, skontaktuj się z administratorem urządzenia.
102
. Jeśli nie znasz
Drukowanie dokumentu
4
Wybierz dokument, który chcesz wydrukować i naciśnij przycisk
.
➠ Drukowanie rozpocznie się.
● Drukowanie można anulować z poziomu panelu roboczego.
Anulowanie drukowania(P. 79)
● Dokumenty zapisane na karcie SD można również drukować ze strony [Skrzynka] zdalnego interfejsu
użytkownika ( Strona [Skrzynka](P. 307) ). W tym celu należy otworzyć sektor, w którym dokumenty są
zapisane, zaznaczyć pole wyboru obok dokumentu do wydrukowania i kliknąć [Drukuj].
ŁĄCZA
Usuwanie dokumentu zapisanego w urządzeniu(P. 104)
Ustawianie nazwy lub kodu PIN dla sektora(P. 108)
Instalacja karty pamięci SD(P. 600)
103
Drukowanie dokumentu
Usuwanie dokumentu zapisanego w urządzeniu
6869-01K
Zgodnie z ustawieniem domyślnym dane zapisane na karcie pamięci SD zostaną automatycznie usunięte po upływie
określonego czasu i nie będzie można już ich wydrukować. Aby zmienić czas, przez jaki dokumenty pozostają na karcie
pamięci SD lub zapobiec ich automatycznemu usuwaniu, należy dostosować ustawienia w Remote UI (Zdalny interfejs
użytkownika). Zapisane dokumenty można również usunąć ręcznie.
Zmiana okresu przechowywania dokumentów(P. 104)
Ręczne usuwanie dokumentów(P. 105)
Zmiana okresu przechowywania dokumentów
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Menu sterowania]
4
Zmień okres przechowywania.
[Edytuj].
● Aby zapobiec automatycznemu usuwaniu dokumentów, wybierz opcję [Wyłącz].
104
Drukowanie dokumentu
5
Kliknij [OK].
Ręczne usuwanie dokumentów
1
Uruchom Zdalny interfejs użytkownika i się zaloguj.
Uruchamianie Zdalnego
interfejsu użytkownika(P. 300)
Logowanie w trybie użytkownika ogólnego
● Domyślnie urządzenie jest skonfigurowane w taki sposób, że żaden użytkownik (ogólny) inny niż
administrator nie może usuwać dokumentów. Aby umożliwić użytkownikom końcowym obsługę
dokumentów, należy zmienić ustawienia.
Umożliwianie użytkownikom końcowym obsługiwanie
dokumentów(P. 315)
● Można usunąć tylko taki dokument, którego nazwa użytkownika jest zgodna z nazwą użytkownika użytą
przy logowaniu do Zdalnego interfejsu użytkownika.
2
Kliknij [Skrzynka].
105
Drukowanie dokumentu
3
Kliknij numer sektora, w którym zapisany jest dokument do usunięcia.
Sektor zabezpieczony kodem PIN
● Po wyświetleniu poniższego ekranu wprowadź kod PIN i kliknij [OK].
4
Zaznacz pole wyboru przy dokumencie do usunięcia i kliknij [Usuń].
➠ Wybrany dokument zostanie usunięty.
● Aby sprawdzić informacje szczegółowe na temat dokumentu, należy kliknąć łącze tekstowe dostępne w
opcji [Nazwa pliku].
106
Drukowanie dokumentu
● Może potrwać chwilę, zanim przestrzeń na karcie SD zostanie zwiększona, ponieważ zapisane dane są
kasowane w tle.
107
Drukowanie dokumentu
Ustawianie nazwy lub kodu PIN dla sektora
6869-01L
Można ustawić nazwę sektora oraz kod PIN wymagany do jego otwarcia. Nadanie przyjaznej nazwy ułatwia
identyfikację sektora podczas wyboru miejsca zapisu dokumentów za pomocą sterownika drukarki. Po ustawieniu
kodu PIN dostęp do zapisanych dokumentów będzie ograniczony do określonej grupy użytkowników, co zwiększy
bezpieczeństwo.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Skrzynka].
3
Kliknij numer sektora, dla którego chcesz zdefiniować ustawienia.
Sektor zabezpieczony kodem PIN
● Po wyświetleniu poniższego ekranu wprowadź kod PIN i kliknij [OK].
4
[Ustawienia].
108
Drukowanie dokumentu
5
Ustaw nazwę oraz kod PIN.
[Nazwa skrzynki]
Aby ustawić nazwę skrzynki, należy wprowadzić wymaganą liczbę odpowiednich znaków.
[Ustaw PIN]
Aby ustawić kod PIN, należy zaznaczyć pole wyboru [Ustaw PIN] i wprowadzić złożony z cyfr kod w polu
tekstowym [PIN]. W celu potwierdzenia należy wprowadzić ten sam numer w polu tekstowym [Potwierdź].
● Pierwszą cyfrą kodu PIN nie może być „0”. W przypadku ustawienia cyfry „0” na pierwszej pozycji, zostanie
ona usunięta, a kod PIN zostanie skonfigurowany bez jej użycia.
6
Kliknij [OK].
109
Drukowanie dokumentu
Drukowanie bez otwierania pliku (Wydruk bezpośredni)
6869-01R
Istnieje możliwość wydrukowania pliku z poziomu przeglądarki internetowej (Zdalnego interfejsu użytkownika) bez
jego otwierania. Ponadto można również wydrukować plik PDF zamieszczony w sieci poprzez podanie wyłącznie jego
adresu URL.
1
Uruchom Zdalny interfejs użytkownika i się zaloguj.
interfejsu użytkownika(P. 300)
2
Kliknij [Bezpośredni wydruk].
3
Kliknij typ pliku do wydrukowania.
[Plik PDF]
Kliknij, aby wydrukować plik PDF.
110
Uruchamianie Zdalnego
Drukowanie dokumentu
[Plik PS]
Kliknij, aby wydrukować plik PS lub EPS.
[Plik obrazu]
Kliknij, aby wydrukować plik JPEG lub TIFF.
[Plik XPS]
Kliknij, aby wydrukować plik XPS.
4
Kliknij [Przeglądaj].
● Po wyświetleniu okna dialogowego wyboru pliku wybierz plik do wydrukowania i kliknij opcję [Otwórz].
● W przypadku drukowania pliku PDF wybierz opcję [Ścieżka do pliku].
Drukowanie pliku PDF z sieci
● Wybierz opcję [URL] i wprowadź adres URL pliku PDF. Jeśli konieczne jest uwierzytelnianie użytkownika,
wprowadź nazwę użytkownika i hasło.
Plik PDF zabezpieczony hasłem
● Wprowadź hasło w polu [Hasło do dokumentu].
Drukowanie pliku PDF powiązanego z serwerem zasad
● Określ ustawienia [Nazwa użytkownika serwera polityki] i [Hasło serwera polityki].
5
6
Określ ustawienia wydruku w zależności od potrzeb.
Ustawienia drukowania dla
funkcji drukowania bezpośredniego(P. 113)
Kliknij [Rozpocznij drukowanie].
➠ Zostanie wyświetlony ekran przedstawiony poniżej i rozpocznie się drukowanie.
111
Drukowanie dokumentu
● Kliknięcie opcji [Do listy zadań] spowoduje wyświetlenie strony [Stan zadania] ze stanem drukowania.
Sprawdzanie bieżącego stanu drukowanych dokumentów(P. 309)
● Może potrwać chwilę, zanim drukowanie się rozpocznie.
ŁĄCZA
Korzystanie ze Zdalnego interfejsu użytkownika(P. 299)
112
Drukowanie dokumentu
Ustawienia drukowania dla funkcji drukowania
bezpośredniego
6869-01S
Aby zmienić ustawienia funkcji drukowania bezpośredniego zgodnie z dokumentem do wydrukowania, należy
wprowadzić poniższe ustawienia.
Określanie ustawień drukowania dla plików XPS
● Usuń zaznaczenie pola wyboru [Prioryteryzuj bilet wydruku]. Jeśli to pole będzie zaznaczone, niektóre
pozycje będą niedostępne.
Ikony* w opisie
Ustawienia drukowania plików PDF
Ustawienia drukowania plików PS/EPS
Ustawienia drukowania plików JPEG
Ustawienia drukowania plików TIFF
Ustawienia drukowania plików XPS
* Dla
ustawień wyświetlanych niezależnie od formatu pliku ikony nie są wyświetlane.
113
Drukowanie dokumentu
[Podaj zakres wydruku]
[Zakres wydruku]
Określ zakres (strony) do wydrukowania.
[Wszystko]
Pozwala wydrukować wszystkie strony.
[Wprowadź strony]
Pozwala określić zakres stron do wydrukowania. Ustawienie do jest niedostępne dla
plików JPEG.
[Ustawienia jakości]
[Gradacja]
Ustawienie gradacji do przetwarzania danych drukowania.
[Wysoki 1]
Ten tryb drukowania nadaje się do drukowania zdjęć lub podobnych obiektów w
średniej jakości.
[Wysoki 2]
To ustawienie należy wybrać, aby drukować zdjęcia lub podobne obiekty w wysokiej
jakości.
[Półtony]
Dostępny jest wybór metody wydruku umożliwiającej odzwierciedlenie półtonów (zakres pośredni między
jaśniejszymi i ciemniejszymi obszarami obrazu). W przypadku plików PDF i XPS można ustawić opcje
[Rozdzielczość] lub [Gradacja] dla każdego typu obrazów zawartego w jednym dokumencie: [Tekst], [Grafiki] i
[Obraz].
[Błąd dyfuzji]
Zaznaczenie tego pola wyboru umożliwia drukowanie w trybie odpowiednim do
drukowania danych z tekstem i cienkimi liniami oraz zakrzywionymi liniami danych
CAD itp. Dotyczy to wszystkich typów danych obrazu, więc nie można wybrać opcji
[Rozdzielczość] ani [Gradacja].
114
Drukowanie dokumentu
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku
korzystania z funkcji [Błąd dyfuzji].
[Rozdzielczość]
Wydruk tekstu z wyraźnymi krawędziami w celu uzyskania precyzyjnego wydruku.
[Gradacja]
Umożliwia drukowanie gradacji i obrysów z płynnym wykończeniem. Ten typ
drukowania jest odpowiedni do drukowania rysunków lub wykresów zawierających
gradacje.
[Błąd dyfuzji]
Tryb ten pozwala drukować dane z tekstem i cienkimi liniami oraz zakrzywionymi
liniami danych CAD itp.
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku
korzystania z funkcji [Błąd dyfuzji].
[Zaawansowane wygładzanie]
Wprowadzanie ustawień trybu wygładzania, który umożliwia drukowanie gładkich krawędzi linii, rysunków i
tekstu.
[Wyłącz]
Bez wygładzania.
[Wygładzanie 1]
Drukowanie wygładzonych krawędzi linii, rysunków i tekstu.
[Wygładzanie 2]
Krawędzie będą gładsze niż w przypadku opcji [Wygładzanie 1].
[Grafiki]
W przypadku zaznaczenia tego pola wyboru tryb wygładzania zostanie zastosowany
do linii i rysunków po zdefiniowaniu ustawienia [Wygładzanie 1] lub [Wygładzanie 2].
[Tekst]
W przypadku zaznaczenia tego pola wyboru tryb wygładzania zostanie zastosowany
do tekstu po zdefiniowaniu ustawienia [Wygładzanie 1] lub [Wygładzanie 2].
115
Drukowanie dokumentu
[Ustawienia koloru]
[Tryb koloru]
Ustawianie drukowania w trybie kolorowym lub czarno-białym.
[Automatyczny (Kolorowy/Czarno-biały)] Automatyczny wybór drukowania w trybie kolorowym lub czarno-białym w
zależności od typu dokumentu.
[Czarno-biały]
Drukowanie w trybie czarno-białym, nawet jeśli dokument jest w kolorze.
[Kolorowy]
Drukowanie w kolorze.
116
Drukowanie dokumentu
[Tryb dopasowywania]
Wybór trybu przetwarzania do drukowania w kolorze.
[Profil ICC]
Użyj profilu, aby dopasować kolor.
[Gamma]
Wykonaj korekcję koloru poprzez ustawienie wartości gamma przy regulacji jasności.
[Profil źródła RGB]
Wybór odpowiedniego profilu danych RGB zgodnego z używanym monitorem. W przypadku plików XPS
można ustawić tę pozycję dla każdego typu obrazów zawartego w jednym dokumencie: [Tekst], [Grafiki] i
[Obraz].
[sRGB v3.0 (Canon)]
Używany jest profil RGB podobny do średniego profilu większości monitorów
stosowanych z komputerami z systemem Windows. Podczas korzystania z
monitora obsługującego standard sRGB można drukować kolory zbliżone do
kolorów wyświetlanych na monitorze.
[Canon HDTV gamma 1.5 to 2.4
Monitor]
W tym miejscu można wprowadzić ustawienia konieczne do wyregulowania
jasności po dokonaniu porównania kolorów wydruku z kolorami
wyświetlanymi na monitorze. Im wyższa wartość, tym ciemniejsze kolory
wydruków.
[Brak]
Oddzielenie koloru od danych RGB do CMYK bez stosowania profilu
źródłowego RGB.
● W przypadku plików XPS ta pozycja jest dostępna, gdy ustawienie opcji [Tryb dopasowywania] to [Profil
ICC].
[Profil symulacji CMYK]
Podczas drukowania danych CMYK można wybrać docelowy rodzaj symulacji. Urządzenie konwertuje dane
CMYK do modelu kolorów CMYK zależnego od urządzenia w oparciu o wybrany docelowy rodzaj symulacji.
[JapanColor(Canon)]
Pozwala użyć profilu JapanColor. Podczas drukowania stosowane są kolory zbliżone
do japońskich norm drukowania.
[U.S. Web Coated v1.00 (Canon)] Pozwala użyć profilu U.S. Web Coated. Podczas drukowania stosowane są kolory
zbliżone do amerykańskich norm drukowania.
[Euro Standard v1.00 (Canon)]
Pozwala użyć profilu Euro Standard. Podczas drukowania stosowane są kolory
zbliżone do europejskich norm drukowania.
[Brak]
Pozwala drukować dane CMYK z zastosowaniem modelu kolorów CMYK zależnego
od urządzenia bez stosowania jakiegokolwiek profilu symulacji CMYK.
● Po wybraniu dla tej opcji ustawienia [Brak] ciemnokolorowa gradacja może się rozpaść, w zależności od
rodzaju danych.
117
Drukowanie dokumentu
[Profil wyjściowy]
Wybór odpowiedniego profilu danych do wydrukowania. W przypadku plików PDF i XPS można ustawić tę
pozycję dla każdego typu obrazów zawartego w jednym dokumencie: [Tekst], [Grafiki] i [Obraz].
[Normal]
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach
zbliżonych do kolorów wyświetlanych na monitorze.
[Photo]
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał
fotografię.
[TR Normal]
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach
zbliżonych do kolorów wyświetlanych na monitorze, a ilość tonera zużywana na tekst i
precyzyjne linie była dobrze kontrolowana.
[TR Photo]
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał
fotografię, a ilość tonera zużywana na tekst i precyzyjne linie była dobrze
kontrolowana.
● W przypadku plików XPS ta pozycja jest dostępna, gdy ustawienie opcji [Tryb dopasowywania] to [Profil
ICC].
[Metoda dopasowania]
Za pomocą opcji [Profil źródła RGB] można zdefiniować element mający pierwszeństwo nad innymi podczas
dopasowywania kolorów. W przypadku plików XPS można ustawić tę pozycję dla każdego typu obrazów
zawartego w jednym dokumencie: [Tekst], [Grafiki] i [Obraz].
[Percepcyjnie]
Dopasowanie wykonywane jest z priorytetem percepcyjnej.
[Saturacja]
Dopasowanie wykonywane jest z priorytetem nasycenia.
[Kolorometryczny]
Dopasowanie wykonywane jest w taki sposób, aby zminimalizować różnicę kolorów
między oryginałami a wydrukami.
[Użyj profilu skali szarości]
Po zaznaczeniu tego pola wyboru dane w szarości zostaną skonwertowane do danych CMYK zgodnie z
profilem skali szarości urządzenia.
● W zależności od ustawienia opcji [Profil wyjściowy] lub [Użyj tekstu w czystej czerni] można drukować za
pomocą wyłącznie tonera K (czarnego).
[Użyj tekstu w czystej czerni]
Po zaznaczeniu tego pola wyboru czarny tekst będzie drukowany wyłącznie przy użyciu tonera K (czarnego).
W przeciwieństwie do drukowania za pomocą tonera kolorowego (CMY), nie będą występowały rozmycia
wokół krawędzi. Zaleca się korzystanie z tego ustawienia w normalnym toku pracy.
[Czarny nadruk]
Zaznaczenie opcji [Użyj tekstu w czystej czerni] umożliwia określenie sposobu drukowania czarnego tekstu na
kolorowym tle lub kolorowym rysunku. Po zaznaczeniu tego pola wyboru najpierw zostanie wydrukowane
kolorowe tło lub rysunek, a następnie na tym tle lub rysunku zostanie wydrukowany tekst przy użyciu
118
Drukowanie dokumentu
wyłącznie tonera K (czarnego). Jeśli to pole wyboru nie będzie zaznaczone, najpierw zostaną wydrukowane
dane po uprzednim wycięciu czarnego tekstu z kolorowego tła lub rysunku, a następnie czarny tekst zostanie
nadrukowany na pustą przestrzeń pozostałą po jego wycięciu.
● Gdy to pole wyboru nie jest zaznaczone, druk może być bledszy, a krawędzie tekstu mogą mieć białą
obwódkę.
[Wykonaj nadruk kompozytowy]
W przypadku zaznaczenia tego pola wyboru dane CMYK, dla których ustawiany jest nadruk, będą
zadrukowywane jako dane kompozytowe.
● W przypadku wybrania dla opcji [Profil symulacji CMYK] ustawienia innego niż [Brak] nadruk nie będzie
wykonywany nawet w przypadku zaznaczenia tego pola wyboru.
[Jasność]
Można wyregulować jasność całego obrazu skokowo co 5%. Im mniejsza wartość, tym jaśniejszy obraz.
[Korekcja Gamma]
Dostosowywanie jasności, które pozwala utrzymać jasność najjaśniejszych i najciemniejszych części oryginału
na wydruku wynikowym. [1.4] to ustawienie standardowe (bez korekcji), a im wyższa wartość ustawienia, tym
ciemniejszy będzie wydruk. Tę pozycję można ustawić dla każdego typu obrazów zawartego w jednym
dokumencie: [Tekst], [Grafiki], i [Obraz].
● Ta pozycja jest dostępna, gdy ustawienie opcji [Tryb dopasowywania] to [Gamma].
[Photo Optimizer PRO]
Po zaznaczeniu tego pola wyboru podczas drukowania będzie wykonywana automatyczna korekcja
kontrastu, zestawienia kolorów, nasycenia i gradacji obrazu.
[Korekcja czerwonych oczu]
„Czerwone oczy” to zjawisko polegające na uzyskiwaniu nienaturalnie czerwonego koloru oczu ludzkich na
zdjęciach wykonanych przy użyciu lampy błyskowej lub stroboskopu. Ta opcja określa, czy czerwone oczy
mają być automatycznie wykrywane na obrazie i korygowane, tak aby były wyświetlane w naturalnym
kolorze. Po zaznaczeniu tego pola wyboru należy wybrać poziom korekcji w opcji [Poziom korekcji
czerwonych oczu].
[Rozjaśniacz twarzy]
W przypadku zdjęć twarzy ludzkich, które są nienaturalnie ciemne z powodu światła padającego z tyłu lub
niedoświetlenia można ustawić, czy obraz będzie drukowany z zastosowaniem korekcji całej jasności, tak aby
twarze osób na zdjęciu nabrały naturalnej jasności. Po zaznaczeniu tego pola wyboru należy wybrać poziom
korekcji w opcji [Poziom rozjaśnienia twarzy].
[Konwersja skali szarości]
Można wybrać metodę konwersji danych drukowania w kolorze na dane czarno-białe. W przypadku plików
XPS można określić metodę konwersji dla każdego typu danych obrazu: [Tekst], [Grafiki] i [Obraz].
[sRGB]
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać płynną
gradację z uwzględnieniem kolorów.
119
Drukowanie dokumentu
[NTSC]
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać efekt
odpowiadający obrazom telewizyjnym (NTSC).
[Uniform RGB]
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby wszystkie poziomy
RGB zostały wyrównane wyłącznie na bazie jasności.
● Ta pozycja jest dostępna, gdy ustawienie opcji [Tryb koloru] to [Czarno-biały].
[Kompensacja szarości]
W przypadku danych w czerni lub szarości zawierających informację o kolorze z definicją R=G=B można
wybrać drukowanie przy użyciu wyłącznie czarnego tonera (K). Można ustawić tę pozycję dla każdego typu
obrazów zawartego w jednym dokumencie: [Tekst], [Grafiki] i [Obraz].
● Po wybraniu dla tej pozycji ustawienia [Wyłącz] drukowanie będzie się odbywać z zastosowaniem czterech
kolorowych tonerów CMYK.
[Ustawienia wydruku]
[Kopii]
Określanie liczby kopii.
[Rozmiar papieru]
Pozwala określić rozmiar papieru do drukowania.
120
Drukowanie dokumentu
● Aby wydrukować plik PDF lub plik XPS, należy wybrać opcję [Automatycznie], aby optymalny rozmiar
papieru został dobrany automatycznie. Jeśli optymalny rozmiar papieru nie zostanie znaleziony, system
Stand. rozm.
zastosuje rozmiar papieru ustawiony w opcji <Standardowy rozmiar papieru> (
papieru(P. 493) ).
[Typ papieru]
Pozwala określić typ papieru do drukowania.
[Podawanie ręczne]
Zaznaczenie tego pola wyboru spowoduje, że dokument będzie drukowany wyłącznie na papierze
załadowanym na tacy wielofunkcyjnej.
[Zwiększ/zmniejsz aby dopasować do rozmiaru papieru]
Po zaznaczeniu tego pola wyboru wydruki będą pomniejszane lub powiększane zgodnie z ustawieniem
parametru Obszar wydruku(P. 575) papieru. Wydruki będą zmniejszane lub powiększane z zachowaniem
współczynnika proporcji.
● Jeśli dla opcji [Rozmiar papieru] wybrano ustawienie [Automatycznie], ta pozycja będzie niedostępna.
[Orienacja obrazu]
Pozwala określić orientację wydruku obrazu.
[Automatycznie]
Automatycznie wyznacza orientację drukowania na podstawie szerokości i wysokości
obrazu.
[Pionowo]
Tę opcję należy wybrać podczas drukowania obrazów, których dłuższa krawędź
występuje w pionie.
[Poziomo]
Tę opcję należy wybrać podczas drukowania obrazów, których dłuższa krawędź
występuje w poziomie.
● Jeśli określone ustawienie opcji [Pionowo] lub [Poziomo] jest niezgodne z orientacją obrazu, wydrukowany
zostanie pomniejszony obraz.
[Pozycja wydruku]
Pozwala określić miejsce, w którym zostanie umieszczony drukowany obraz.
[Automatycznie]
Jeśli dane TIFF zawierają informacje określające położenie wydruku, wówczas obraz
zostanie wydrukowany zgodnie z tymi informacjami. W innym przypadku zostanie on
wydrukowany na środku papieru. Dane JPEG zawsze są drukowane na środku papieru.
[Środek]
Obrazy są drukowane na środku papieru.
[Na górze na lewo]
Obrazy są drukowane z wyrównaniem do lewego, górnego rogu.
121
Drukowanie dokumentu
[Powiększenie]
Włącza lub wyłącza powiększanie/zmniejszanie obrazów. Wydruki są powiększane lub zmniejszane z
zachowaniem współczynnika proporcji obrazu.
[Wyłącz]
Gdy obraz mieści się w granicach wyznaczonych parametrem
Obszar
wydruku(P. 575) papieru, jest on drukowany w rzeczywistym rozmiarze. Jeśli jest
większy niż obszar drukowania, wydruki zostaną zmniejszone.
[Automatycznie]
Pozwala wykonywać powiększone lub pomniejszone wydruki zgodnie z ustawieniem
obszaru drukowania papieru.
[Zwiększ obszar wydruku]
Zaznaczenie tego pola wyboru spowoduje, że obraz będzie drukowany poprzez pełne rozciągnięcie Obszar
wydruku(P. 575) do rozmiaru papieru. Niektóre części obrazu w pobliżu krawędzi papieru mogą zostać
utracone papier może zostać częściowo zabrudzony.
[Drukuj dwustronnie]
Zaznaczenie tego pola wyboru pozwala drukować po obu stronach papieru.
[Miejsce zszycia]
Określ, czy wydrukowane dokumenty zostaną zbindowane (np. za pomocą zszywacza) wzdłuż dłuższej czy
krótszej krawędzi. Orientacja wydruku zostanie zmieniona w zależności od zdefiniowanego położenia
bindowania. Można również określić margines bindowania ( Margines na oprawę(P. 371) ).
[Długa krawędź]
Bindowanie wydruków zostanie wykonane wzdłuż dłuższej krawędzi.
[Krótka krawędź]
Bindowanie wydruków zostanie wykonane wzdłuż krótszej krawędzi.
[Pokaż ostrzeżenia]
Można określić sposób zachowania się maszyny w przypadku wystąpienia błędu.
[Drukuj]
Informacja o błędzie zostanie wydrukowana, a żaden obraz nie.
[Panel]
Żaden obraz nie zostanie wydrukowany, a komunikat o błędzie zostanie wyświetlony
na panelu roboczym.
[Wyłącz]
Żaden obraz nie zostanie wydrukowany i żaden błąd nie będzie wyświetlany.
122
Drukowanie dokumentu
[N na 1]
Pozwala określić, czy na jednym arkuszu ma być drukowane wiele stron, poprzez kolejne ich przypisanie. Aby
na przykład wydrukować cztery strony na jednym arkuszu, wybierz opcję [4 na 1].
● Jeśli dla opcji [Rozmiar papieru] wybrano ustawienie [Automatycznie], ta pozycja będzie niedostępna.
[Porządek stron]
Pozwala wybrać rozkład stron na arkuszu.
[Wykańczanie]
Pozwala określić metodę sortowania wydruków podczas drukowania dokumentów wielostronicowych. Ta
opcja jest wyświetlana po zainstalowaniu karty SD.
[Wyłącz]
Wydruki nie są sortowane. Drukowana jest określona liczba egzemplarzy każdej
strony. Jeśli na przykład wykonywane są trzy wydruki czterostronicowego dokumentu,
wydruki zostaną ułożone w następującej kolejności: 1, 1, 1, 2, 2, 2, 3, 3, 3, 4, 4, 4.
[Sortowanie]
Wydruki są grupowane tak, aby tworzyły komplety dokumentów ułożone według
numerów stron. Jeśli na przykład wykonywane są trzy wydruki czterostronicowego
dokumentu, wydruki zostaną ułożone w następującej kolejności: 1, 2, 3, 4, 1, 2, 3, 4, 1,
2, 3, 4.
[Wydruk komentarza]
Pozwala określić, czy komentarze mają być drukowane.
[Automatycznie]
Drukuje komentarze w pliku PDF.
[Wyłącz]
Komentarze nie zostaną wydrukowane.
[Zapisz w skrzynce]
Dokument można zapisać na karcie SD zainstalowanej w urządzeniu bez wykonywania wydruków. Aby
zapisać dokument w sektorze zdefiniowanym w opcji [Numer skrzynki (00-99)], należy zaznaczyć to pole
wyboru. Dokumenty zapisane w sektorze można wielokrotnie drukować z poziomu panelu roboczego.
123
Drukowanie dokumentu
Informacje na temat drukowania dokumentu zawiera sekcja Drukowanie dokumentu zapisanego w
urządzeniu(P. 102) . Ta opcja jest wyświetlana, gdy karta SD jest zainstalowane.
ŁĄCZA
Drukowanie bez otwierania pliku (Wydruk bezpośredni)(P. 110)
124
Drukowanie dokumentu
Drukowanie odebranej wiadomości e-mail (Drukowanie
e-maili)
6869-01U
Funkcja drukowania e-maili umożliwia wydrukowanie wiadomości i dołączonych do niej plików obrazu odebranych z
serwera poczty POP3 bez konieczności korzystania z komputera. Wiadomości e-mail można odbierać ręcznie lub
ustawić ich automatyczne odbieranie z wybraną częstotliwością. Gdy używany jest protokół SMTP, drukowane są
wiadomości e-mail przesłane bezpośrednio na urządzenie bez udziału serwera poczty.
Konfiguracja ustawień funkcji Drukowanie e-maili(P. 125)
Ręczne odbieranie wiadomości e-mail(P. 129)
● Wybranie dla opcji <TIFF Spooler> w menu Konfiguracja ustawienia <Włącz> spowoduje tymczasowe
zapisanie odebranych danych w urządzeniu lub na karcie SD przed wydrukowaniem. To ogranicza
występowanie błędów. TIFF Spooler(P. 433)
Konfiguracja ustawień funkcji Drukowanie e-maili
W tej sekcji opisano sposób definiowania ustawień odbierania i drukowania wiadomości e-mail za pomocą urządzenia.
Za pomocą komputera należy określić ustawienia odbierania wiadomości e-mail, a z poziomu panelu roboczego
urządzenia ustawienia drukowania wiadomości e-mail.
Z poziomu komputera
1
2
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
125
Drukowanie dokumentu
3
Kliknij [Sieć]
4
Kliknij [Edytuj].
5
Określ ustawienia funkcji Drukowanie e-maili.
[Ustawienia wydruku E-Mail].
Drukowanie wiadomości e-mail z serwera pocztowego POP3
Gdy rozpocznie się pobieranie wiadomości e-mail, wydrukowane zostaną wszystkie wiadomości e-mail zapisane
w skrzynce odbiorczej serwera pocztowego. Jeśli wiadomości e-mail do wydrukowania zostaną wysłane do
urządzenia z wyprzedzeniem, można automatycznie drukować je w regularnych odstępach czasu lub
wydrukować wszystkie zapisane wiadomości e-mail o wyznaczonym czasie.
● Zaleca się założenie adresu e-mail wyłącznie na potrzeby funkcji Drukowanie e-maili, ponieważ wszystkie
wiadomości e-mail pobrane na urządzenie są usuwane z serwera pocztowego.
126
Drukowanie dokumentu
Warunki korzystania z protokołu POP3
● Serwer pocztowy POP3 musi obsługiwać polecenie UIDL. Szczegółowe informacje można uzyskać u
administratora sieci lub administratora serwera.
[Nazwa serwera POP3]
W tym miejscu należy wpisać nazwę serwera pocztowego lub adres IP do odbierania wiadomości e-mail.
[Nazwa użytkownika POP3]
Należy wprowadzić złożoną ze znaków alfanumerycznych nazwę użytkownika, która jest używana do
nawiązywania połączenia z serwerem poczty.
[Ustaw/Zmień hasło]
Aby ustawić hasło na potrzeby połączenia z serwerem poczty, należy zaznaczyć pole wyboru i wprowadzić
złożone ze znaków alfanumerycznych hasło w polu tekstowym [Hasło]. W celu potwierdzenia należy
wprowadzić to samo hasło w polu tekstowym [Potwierdź].
[Interwał RX POP3]
W tym miejscu należy określić odstęp w minutach między kolejnymi automatycznymi połączeniami z
serwerem pocztowym. Nowe wiadomości e-mail w skrzynce odbiorczej serwera pocztowego będą
automatycznie pobierane i drukowane w określonych odstępach czasu. Ustawienie to można zdefiniować
również za pomocą opcji <Interwał odb. POP3> w menu ustawień panelu roboczego ( Interwał odb.
POP3(P. 366) ).
Wyłączanie automatycznego odbierania wiadomości e-mail
● Należy dla opcji [Interwał RX POP3] ustawić wartość [0]. Po ustawieniu wartości [0] wiadomości e-mail
trzeba będzie pobierać ręcznie. Ręczne odbieranie wiadomości e-mail(P. 129)
[POP3 RX]
To pole wyboru należy zaznaczyć, aby włączyć funkcję Drukowanie e-maili z serwera pocztowego POP3.
Ustawienie to można zdefiniować również za pomocą opcji <POP3 RX> w menu ustawień panelu roboczego
( POP3 RX(P. 366) ).
[Numer portu serwera POP3]
Pozwala określić numer portu serwera pocztowego do odbierania wiadomości e-mail.
Drukowanie wiadomości e-mail za pomocą protokołu SMTP
Jeśli wiadomości e-mail są wysyłane do urządzenia przez SMTP, urządzenie drukuje je natychmiast po ich
otrzymaniu. Włącz tę funkcję, jeśli chcesz przesłać faksy z drukarek wielofunkcyjnych firmy Canon do tego
urządzenia i wydrukować je na nim ( Przekazywanie faksów za pomocą drukarek wielofunkcyjnych firmy
Canon(P. 130) ).
127
Drukowanie dokumentu
[SMTP RX]
To pole wyboru należy zaznaczyć, aby włączyć funkcję Drukowanie e-maili z użyciem protokołu SMTP.
Ustawienie to można zdefiniować również za pomocą opcji <SMTP RX> w menu ustawień panelu roboczego
( SMTP RX(P. 367) ).
[Numer portu serwera SMTP]
Pozwala określić numer portu serwera SMTP do odbierania wiadomości e-mail.
6
Kliknij [OK].
7
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Z poziomu panelu sterowania
8
Zdefiniuj inne ustawienia funkcji Drukowanie e-maili według potrzeb.
Określ, czy wiadomość e-mail ma być drukowana.
Wydr. treść e-maila(P. 434)
Można ograniczyć liczbę stron przy drukowaniu wiadomości e-mail.
Ogran. druk. e-maili(P. 435)
128
Drukowanie dokumentu
Można określić ustawienia drukowania plików obrazów załączonych do wiadomości.
Orientacja obrazu(P. 431)
Powiększenie(P. 432)
Pozycja wydruku(P. 432)
TIFF Spooler(P. 433)
Pokaż ostrzeżenia(P. 434)
Zwiększ obszar wydr.(P. 435)
Profil źródła RGB(P. 435)
Profil symul. CMYK(P. 436)
Profil wyjściowy(P. 437)
Metoda dopasowania(P. 437)
Półtony(P. 438)
Kor. foto (tylko CL)(P. 439)
Konwers. skali szar.(P. 440)
Określ, czy błąd funkcji Drukowanie e-maili ma być wyświetlany.
Pokaż ostrzeżenia(P. 332)
Ręczne odbieranie wiadomości e-mail
Jeśli włączone zostało drukowanie wiadomości e-mail z serwera poczty POP3, możliwe jest również ręczne odbieranie
takich wiadomości. Aby połączyć się z serwerem pocztowym przed automatycznym odebraniem wiadomości e-mail lub
jeśli automatyczne odbieranie wiadomości e-mail przez urządzenie jest wyłączone, należy postępować zgodnie z
poniższą procedurą w celu ręcznego odebrania wiadomości e-mail.
1
Naciśnij przycisk
(
).
● Gdy urządzenie pracuje w trybie offline, nie zadziała nawet po naciśnięciu przycisku
przestawić w tryb online.
(
). Należy je
Online klawisz(P. 28)
2
Za pomocą przycisków
3
Wybierz opcję <Otrzymany E-Mail> i naciśnij przycisk
4
Wybierz opcję <Tak> i naciśnij przycisk
/
wybierz opcję <Narz. do dr. e-maili> i naciśnij przycisk
.
129
.
.
Drukowanie dokumentu
➠ Urządzenie połączy się z serwerem pocztowym. Jeśli w skrzynce odbiorczej na serwerze poczty są nowe
wiadomości e-mail, zostanie dla nich uruchomiona funkcja Drukowanie e-maili.
Przekazywanie faksów za pomocą drukarek wielofunkcyjnych firmy Canon
Należy włączyć na urządzeniu opcję SMTP RX, a następnie podać adres IP urządzenia jako adres faksu
internetowego (I-faks) z poziomu źródłowej drukarki wielofunkcyjnej. Przekazane faksy są drukowane
natychmiast po odebraniu.
● Dołączone pliki można wydrukować wyłącznie wtedy, gdy mają format TIFF. Dla każdego z faksów można
wydrukować tylko jeden plik TIFF.
● Gdy zasobnik z tonerem jest prawie pusty, nie można odbierać faksów. Faksy, których nie może odebrać to
urządzenie, są drukowane za pomocą źródłowej drukarki wielofunkcyjnej.
● Gdy w urządzeniu zainstalowano opcjonalną kartę pamięci SD, maksymalny rozmiar pliku TIFF, który można
wydrukować, podlega ograniczeniu wynoszącemu 100 MB.
ŁĄCZA
Sprawdzanie historii dokumentów(P. 310)
Lista rejestru e-mail RX(P. 543)
130
Wygodna współpraca z urządzeniami przenośnymi
Wygodna współpraca z
urządzeniami przenośnymi
Wygodna współpraca z urządzeniami przenośnymi .................................................................. 132
Podłączanie do urządzenia mobilnego ............................................................................................................. 133
Eksploatacja urządzenia z poziomu aplikacji ................................................................................................... 134
Korzystanie z technologii AirPrint ................................................................................................................. 136
Drukowanie z użyciem technologii AirPrint ............................................................................................ 140
Jeśli nie można skorzystać z technologii AirPrint .................................................................................... 143
Korzystanie z technologii Google Cloud Print ............................................................................................... 144
Zdalne zarządzanie urządzeniem ..................................................................................................................... 148
131
Wygodna współpraca z urządzeniami przenośnymi
Wygodna współpraca z urządzeniami przenośnymi
6869-01W
Połączenie urządzenia z urządzeniem przenośnym, takim jak smartfon lub tablet, umożliwia użycie odpowiedniej
aplikacji ułatwiającej drukowanie. Można także użyć urządzenia przenośnego, aby sterować urządzeniem na odległość,
sprawdzić status drukowania i zmienić ustawienia urządzenia.
Podłączanie do urządzenia mobilnego(P. 133)
Eksploatacja urządzenia z poziomu aplikacji(P. 134)
Zdalne zarządzanie urządzeniem(P. 148)
132
Wygodna współpraca z urządzeniami przenośnymi
Podłączanie do urządzenia mobilnego
6869-01X
Urządzenie mobilne należy połączyć z tym urządzeniem za pośrednictwem routera bezprzewodowej sieci LAN.
Informacje na temat konfiguracji i obsługi routera bezprzewodowej sieci LAN i urządzeń mobilnych można znaleźć w
podręcznikach do tych urządzeń lub uzyskać od ich producentów.
● Urządzenie jest dostarczane bez routera bezprzewodowej sieci LAN. W razie konieczności należy zaopatrzyć
się w router.
133
Wygodna współpraca z urządzeniami przenośnymi
Eksploatacja urządzenia z poziomu aplikacji
6869-01Y
Za pomocą aplikacji na urządzeniu mobilnym połączonym z urządzeniem można drukować i wykonywać inne operacje.
Obsługiwane są różne aplikacje wraz z dedykowanymi aplikacjami Canon. Należy wybrać rozwiązanie odpowiednie dla
siebie, biorąc pod uwagę model urządzenia, możliwości aplikacji i okoliczności.
◼ Korzystanie z programu Canon PRINT Business (Aplikacja Canon PRINT Business)
Aplikacji tej można używać na urządzeniach mobilnych z systemem iOS/Android do drukowania i wykonywania innych
operacji. Podczas drukowania nie jest konieczne wykonanie operacji na urządzeniu. Więcej informacji na temat
obsługiwanych systemów operacyjnych, szczegółowych metod konfiguracji, a także możliwych operacji znajduje się w
sekcji pomocy aplikacji i na stronie internetowej firmy Canon (https://global.canon/gomp/).
● Aplikację Canon PRINT Business (Aplikacja Canon PRINT Business) można pobrać za darmo. Zostanie
pobrana jedynie opłata za pobrane dane.
◼ Drukowanie za pomocą aplikacji Canon Print Service (Aplikacja Canon Print Service)
Można łatwo drukować, korzystając z menu aplikacji, które obsługują podsystem druku z systemem Android. Więcej
informacji na temat obsługiwanych systemów operacyjnych oraz szczegółowych ustawień i procedur znajduje się na
stronie internetowej firmy Canon (https://global.canon).
◼ Drukowanie z użyciem technologii Mopria®
Urządzenie jest kompatybilne także z technologią Mopria®. Korzystanie z technologii Mopria® umożliwia drukowanie
za pomocą urządzeń mobilnych z systemem Android przy użyciu takich samych czynności i ustawień, nawet jeżeli
producenci i modele poszczególnych urządzeń różnią się od siebie. Jeżeli przykładowo korzystasz z drukarek zgodnych
z technologią Mopria® różnych producentów bądź drukarka kompatybilna z technologią Mopria® jest dostępna w
odwiedzanym przez Ciebie miejscu, możesz drukować bez konieczności instalowania aplikacji przeznaczonej dla
danego producenta czy modelu urządzenia. Aby uzyskać więcej informacji na temat obsługiwanych modeli lub
środowisk roboczych, odwiedź stronę internetową http://www.mopria.org.
Potwierdzanie ustawień technologii Mopria®
Zaloguj się w Zdalnym interfejsie użytkownika w trybie zarządzania ( Uruchamianie Zdalnego
interfejsu użytkownika(P. 300) ) [Ustawienia/Rejestracja] [Sieć] [Ustawienia Mopria]
[Edytuj] Sprawdź, czy pole wyboru [Użyj usługi Mopria] jest zaznaczone [OK]
134
Wygodna współpraca z urządzeniami przenośnymi
◼ Drukowanie za pomocą technologii Google Cloud Print
Możesz wykorzystać aplikacje i usługi zgodne z technologią Google Cloud Print do drukowania za pomocą komputera
albo urządzenia mobilnego bez konieczności używania sterownika drukarki. Korzystanie z technologii Google
Cloud Print(P. 144)
135
Wygodna współpraca z urządzeniami przenośnymi
Korzystanie z technologii AirPrint
6869-020
Istnieje możliwość drukowania bez sterownika drukarki poprzez wysłanie danych drukowania z urządzeń firmy Apple.
Ustawienia technologii AirPrint
Konfiguracja ustawień AirPrint(P. 136)
Wyświetlanie ekranu AirPrint(P. 138)
Funkcje technologii AirPrint
Drukowanie z użyciem technologii AirPrint(P. 140)
Rozwiązywanie problemów
Jeśli nie można skorzystać z technologii AirPrint(P. 143)
Konfiguracja ustawień AirPrint
Możliwa jest rejestracja informacji, takich jak nazwa urządzenia oraz lokalizacja instalacji, które posłużą do identyfikacji
urządzenia. Można również wyłączyć obsługę technologii AirPrint przez urządzenie. Aby zmienić te ustawienia, należy
użyć Zdalnego interfejsu użytkownika.
1
2
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
● Jeśli korzystasz z urządzenia przenośnego, takiego jak iPad, iPhone lub iPod touch, w tej sekcji polecenie
„kliknij” jest równoznaczne z „naciśnij”.
3
Kliknij [Sieć]
[Ustawienia AirPrint].
136
Wygodna współpraca z urządzeniami przenośnymi
4
Kliknij [Edytuj].
5
Podaj wymagane ustawienia i kliknij przycisk [OK].
[Użyj usługi AirPrint]
Zaznaczenie tego pola wyboru umożliwi korzystanie z technologii AirPrint. Aby wyłączyć technologię AirPrint,
należy usunąć zaznaczenie pola wyboru.
137
Wygodna współpraca z urządzeniami przenośnymi
[Nazwa drukarki]/[Położenie]/[Szerokość geograficzna]/[Długość geograficzna]
Wprowadzanie nazwy oraz lokalizacji instalacji, które ułatwia identyfikację urządzenia podczas korzystania z
produktu firmy Apple. Informacje te są użyteczne w przypadku posiadania kliku drukarek obsługujących
technologię AirPrint.
Jeśli zaznaczysz pole wyboru [Użyj usługi AirPrint]
Następujące elementy są także automatycznie ustawione na wartość <Włącz>.
● <Ustawienia mDNS> w IPv4 i IPv6
● <HTTP>
Konfiguracja usługi DNS(P. 187)
Wyłączanie komunikacji z użyciem protokołu HTTP(P. 258)
Konfiguracja protokołów drukowania i funkcji protokołu WSD(P. 166)
● <Wydruk IPP>
Zmiana ustawienia [Nazwa drukarki]
● W przypadku zmiany ustawienia [Nazwa drukarki], które zostało już raz określone, drukowanie z
komputera Mac używanego wcześniej do drukowania może nie być możliwe. Zjawisko to występuje z
Konfiguracja usługi DNS(P. 187) )
powodu automatycznej zmiany ustawienia <Nazwa mDNS> (
protokołu IPv4. W takim przypadku należy ponownie dodać urządzenie na komputerze Mac.
Korzystanie z panelu sterowania
● Technologię AirPrint można również włączać z poziomu menu ustawień na panelu roboczym.
(
)
<Sieć>
Sprawdź komunikat
<AirPrint>
<Wyłącz> lub
<Włącz>
Wyświetlanie ekranu AirPrint
Wyświetlenie okna technologii AirPrint umożliwia dostęp nie tylko do ustawień technologii AirPrint, ale pozwala
również na wyświetlenie informacji dotyczących materiałów eksploatacyjnych, takich jak papier i kaseta z tonerem. Co
więcej, pozwala na konfigurację ustawień funkcji bezpieczeństwa ( Korzystanie z protokołu TLS do komunikacji
szyfrowanej(P. 265) ).
1
Kliknij element [Preferencje systemowe] w Docku na pulpicie
2
Wybierz swoją drukarkę i kliknij element [Opcje i materiały].
3
Kliknij [Pokaż witrynę drukarki].
4
Zaloguj się w interfejsie Zdalny interfejs użytkownika.
● Aby zmienić ustawienia technologii AirPrint, zaloguj się w trybie zarządzania.
➠ Zostanie wyświetlona strona dedykowana technologii AirPrint.
138
[Drukarki i skanery].
Wygodna współpraca z urządzeniami przenośnymi
Znaki towarowe
Apple, Bonjour, iPad, iPhone, iPod touch, Mac, macOS, OS X i Safari są znakami towarowymi firmy Apple Inc.
zarejestrowanymi w USA i innych krajach. AirPrint i logo AirPrint są znakami towarowymi firmy Apple Inc.
139
Wygodna współpraca z urządzeniami przenośnymi
Drukowanie z użyciem technologii AirPrint
6869-021
Komputer nie jest niezbędny do drukowania wiadomości e-mail, zdjęć, stron internetowych oraz innych dokumentów.
Technologia AirPrint umożliwia drukowanie bezpośrednio z urządzeń firmy Apple, takich jak iPad, iPhone i iPod touch.
Drukowanie za pomocą urządzeń iPad, iPhone lub iPod touch(P. 140)
Drukowanie z komputera Mac(P. 141)
Wymagania systemowe
Aby drukować z wykorzystaniem technologii AirPrint, należy korzystać z jednego z wymienionych urządzeń firmy
Apple.
● iPad (wszystkie modele)
● iPhone (model 3GS lub nowszy)
● iPod touch (3 generacja lub nowsza)
● Mac (wersja Mac OS X 10.7 lub nowsza)*
* System
OS X 10.9 lub nowszy w przypadku korzystania z połączenia USB.
Środowisko sieciowe
Wymagane jest korzystanie z jednego z wymienionych środowisk.
● Urządzenie firmy Apple i urządzenie są podłączonego do tej samej sieci LAN.
● Komputer Mac i urządzenie są połączone kablem USB.
Gdy korzystasz z łącza USB
● Ustaw wartość opcji <System operacyjny> na <Mac OS>.
System operacyjny(P. 340)
Drukowanie za pomocą urządzeń iPad, iPhone lub iPod touch
1
Upewnij się, że urządzenie jest włączone i połączone z urządzeniem firmy Apple.
● Informacje dotyczące sposobu sprawdzania można znaleźć w podręczniku „Pierwsze kroki”.
Instrukcje
obsługi i ich zawartość(P. 605)
2
W aplikacji zainstalowanej na urządzeniu firmy Apple dotknij przycisku
wyświetlić opcje menu.
140
, aby
Wygodna współpraca z urządzeniami przenośnymi
3
Na liście rozwijanej naciśnij opcję [Drukuj].
4
Wybierz urządzenie z listy [Drukarka] w menu [Opcje drukarki].
● Wyświetlone zostaną drukarki podłączone do sieci. W tym kroku należy wybrać niniejsze urządzenie.
● Okno [Opcje drukarki] nie jest wyświetlane w aplikacjach, które nie obsługują technologii AirPrint. Wydruk
za pomocą tych aplikacji nie jest możliwy.
5
Określ ustawienia wydruku w zależności od potrzeb.
● Dostępne ustawienia i formaty papieru różnią się w zależności od używanej aplikacji.
6
Dotknij przycisku [Drukuj].
➠ Drukowanie rozpocznie się.
Sprawdzanie statusu drukowania
● Podczas drukowania dwukrotnie naciśnij przycisk Początek urządzenia Apple
dotknij pozycji [Drukuj].
Drukowanie z komputera Mac
1
Upewnij się, że urządzenie jest włączone i połączone z komputerem Mac.
● Informacje dotyczące sposobu sprawdzania można znaleźć w podręczniku „Pierwsze kroki”.
Instrukcje
obsługi i ich zawartość(P. 605)
2
3
Dodaj urządzenie w komputerze Mac, wybierając kolejno opcje [Preferencje
systemowe] [Drukarki i skanery].
Otwórz dokument w aplikacji oraz okno dialogowe drukowania.
● Sposób otwierania okna dialogowego drukowania różni się w zależności od aplikacji. Więcej informacji
znajduje się w podręczniku użytkownika stosowanej aplikacji.
4
Zaznacz urządzenie w oknie dialogowym drukowania.
● Wyświetlone zostaną drukarki podłączone do komputera Mac. W tym kroku należy wybrać niniejsze
urządzenie.
5
Określ ustawienia wydruku w zależności od potrzeb.
141
Wygodna współpraca z urządzeniami przenośnymi
● Dostępne ustawienia i formaty papieru różnią się w zależności od używanej aplikacji.
6
Kliknij [Drukuj].
➠ Drukowanie rozpocznie się.
142
Wygodna współpraca z urządzeniami przenośnymi
Jeśli nie można skorzystać z technologii AirPrint
6869-022
Jeśli nie można skorzystać z technologii AirPrint, wypróbuj poniższe rozwiązania.
● Upewnij się, że urządzenie jest włączone. Jeśli urządzenie jest włączone, najpierw je wyłącz, następnie odczekaj co
najmniej 10 sekund i włącz ponownie, po czym sprawdź, czy problem został rozwiązany.
● Upewnij się, że na urządzeniu nie został wyświetlony komunikat o błędzie.
● Upewnij się, że urządzenia firmy Apple i urządzenie są podłączone do tej samej sieci LAN. Po włączeniu urządzenia
może upłynąć kilka minut, zanim będzie ono gotowe do nawiązania łączności.
● Upewnij się, że na urządzeniu firmy Apple włączona jest technologia Bonjour.
● Upewnij się, czy urządzenie zostało skonfigurowane tak, aby wydruk z komputera był możliwy także bez
Blokowanie zadań w przypadku nieznanego identyfikatora
wprowadzenia identyfikatora wydziału i hasła.
wydziału(P. 230)
● Należy się upewnić, że do urządzenia załadowano papier oraz że w kasecie z tonerem jest wystarczająca ilość
toneru. Wyświetlanie ekranu AirPrint(P. 138)
143
Wygodna współpraca z urządzeniami przenośnymi
Korzystanie z technologii Google Cloud Print
6869-023
Technologia Google Cloud Print to usługa umożliwiająca użytkownikowi posiadającemu konto Google wydruk z
aplikacji zgodnych z usługą Google Cloud Print za pośrednictwem smartfona, tabletu albo komputera podłączonego
do Internetu. W przeciwieństwie do standardowego drukowania za pomocą komputera, technologia ta nie wymaga
użycia sterownika drukarki.
Sprawdzanie ustawień urządzenia(P. 144)
Zmiana ustawień Google Cloud Print(P. 144)
Rejestrowanie urządzenia w usłudze Google Cloud Print(P. 145)
● Podczas rejestrowania urządzenia lub korzystania z technologii Google Cloud Print do wydruku dokumentów
konieczne jest podłączenie urządzenia do Internetu. Użytkownik jest również odpowiedzialny za wszelkie
opłaty związane z tego typu połączeniem.
● W niektórych krajach i regionach korzystanie z tej funkcji może być niemożliwe.
● Usługa Google Cloud Print nie obsługuje drukowania z adresów IPv6.
● Do korzystania z technologii Google Cloud Print wymagane jest posiadanie konta Google. Użytkownicy
niemający konta Google, mogą utworzyć je na stronie internetowej firmy Google.
Sprawdzanie ustawień urządzenia
Przed konfiguracją technologii Google Cloud Print:
● Należy upewnić się, że urządzeniu został przypisany adres IPv4 oraz że zostało ono podłączone do komputera za
pośrednictwem sieci. Podłączanie do sieci przewodowej LAN(P. 153)
● Sprawdź, czy ustawienia daty i godziny są prawidłowe.
Ustaw. daty/czasu(P. 337)
● Jeśli włączone jest Zarządzanie identyfikatorami wydziałów, należy upewnić się, czy urządzenie zostało
skonfigurowane tak, aby wydruk z komputera był możliwy także bez wprowadzenia identyfikatora wydziału i kodu
PIN. Blokowanie zadań w przypadku nieznanego identyfikatora wydziału(P. 230)
Zmiana ustawień Google Cloud Print
Włącz funkcję Google Cloud Print w urządzeniu. Funkcję Google Cloud Print można również wyłączyć.
1
Naciśnij przycisk
(
).
144
Wygodna współpraca z urządzeniami przenośnymi
2
Za pomocą przycisków
/
wybierz opcję <Sieć> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
.
.
3
Wybierz opcję <Google Cloud Print> i naciśnij przycisk
4
Wybierz opcję <Użyj Cloud Print> i naciśnij przycisk
5
Wybierz opcję <Wyłącz> lub <Włącz>, a następnie naciśnij przycisk
.
.
.
Rejestrowanie urządzenia w usłudze Google Cloud Print
Zarejestrowanie urządzenia w usłudze Google Cloud Print pozwala drukować z dowolnego miejsca.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
[Ustawienia Google Cloud Print].
145
Wygodna współpraca z urządzeniami przenośnymi
4
Kliknij element [Zarejestruj] znajdujący się w sekcji [Stan rejestracji].
Jeśli [Zarejestruj] jest niedostępny
● Należy uaktywnić technologię Google Cloud Print. Kliknij przycisk [Edytuj], zaznacz pole wyboru [Użyj
usługi Google Cloud Print], a następnie kliknij przycisk [OK].
Ponowna rejestracja urządzenia
● Aby ponownie zarejestrować urządzenie, jeśli zmienił się jego właściciel lub z innego powodu, wyrejestruj
urządzenie, a następnie zarejestruj je ponownie.
5
Kliknij adres URL wyświetlony w formie łącza oznaczonego jako [Adres URL strony
rejestracji].
146
Wygodna współpraca z urządzeniami przenośnymi
6
Aby zarejestrować urządzenie, należy postępować zgodnie ze wskazówkami
wyświetlanymi na ekranie.
➠ Teraz drukowanie z poziomu aplikacji zgodnych z usługą Google Cloud Print, takich jak np. Google
Chrome™, jest już możliwe.
● Przejdź do strony internetowej poświęconej technologii Google Cloud Print, aby uzyskać najnowsze
informacje na temat aplikacji, które ją obsługują.
Rejestrowanie z urządzenia przenośnego lub przeglądarki Google Chrome
Urządzenie można zarejestrować również z urządzenia przenośnego lub z przeglądarki Google Chrome. Przed
zakończeniem rejestracji na wyświetlaczu urządzenia zostanie wyświetlony poniższy ekran z potwierdzeniem.
Naciśnij przycisk
<Tak>
aby zakończyć rejestrację.
● Aby przeprowadzić rejestrację, trzeba wyświetlić ekran główny. Naciśnij przycisk
(
), aby
wyświetlić ekran główny, a następnie przystąp do rejestracji.
● Procedurę rejestracji można znaleźć w podręczniku użytkownika urządzenia przenośnego lub na stronie
internetowej usługi Google Cloud Print.
147
Wygodna współpraca z urządzeniami przenośnymi
Zdalne zarządzanie urządzeniem
6869-024
Ze Zdalnego interfejsu użytkownika można korzystać za pośrednictwem przeglądarki internetowej zainstalowanej na
urządzeniu przenośnym. Pozwala to sprawdzić stan urządzenia i określić jego ustawienia z urządzenia przenośnego.
Uwaga: ekran Zdalnego interfejsu użytkownika może nie być prawidłowo wyświetlany na niektórych urządzeniach i w
niektórych środowiskach.
Uruchamianie Zdalnego interfejsu użytkownika na urządzeniu przenośnym
Wpisz adres IP urządzenia w przeglądarce internetowej i uruchom Zdalny interfejs użytkownika. Najpierw sprawdź, czy
adres IP urządzenia został ustawiony ( Wydruk stanu sieci(P. 541) ). W przypadku wątpliwości skontaktuj się z
administratorem sieci.
1
Uruchom przeglądarkę internetową na swoim urządzeniu przenośnym.
2
Wprowadź adres „http://(adres IP urządzenia)/” w polu adresu.
● Jeśli chcesz użyć adresu IPv6, zamknij go w nawiasach (przykład: http://[fe80::2e9e:fcff:fe4e:dbce]/).
ŁĄCZA
Korzystanie ze Zdalnego interfejsu użytkownika(P. 299)
148
Sieć
Sieć
Sieć ......................................................................................................................................................................... 150
Podłączanie do sieci .......................................................................................................................................... 151
Podłączanie do sieci przewodowej LAN ........................................................................................................ 153
Konfiguracja adresu IP ................................................................................................................................. 155
Ustawianie adresu IPv4 ......................................................................................................................... 156
Konfiguracja adresów IPv6 .................................................................................................................... 161
Konfiguracja urządzenia w celu drukowania danych z komputera ............................................................... 165
Konfiguracja protokołów drukowania i funkcji protokołu WSD ..................................................................... 166
Włączanie protokołu IPP/IPPS ................................................................................................................ 172
Konfiguracja serwera wydruku ..................................................................................................................... 179
Konfiguracja urządzenia w danym środowisku sieciowym ............................................................................ 183
Konfiguracja ustawień sieci Ethernet ............................................................................................................ 184
Ustawianie czasu oczekiwania na połączenie z siecią ................................................................................... 186
Konfiguracja usługi DNS ............................................................................................................................... 187
Konfiguracja usługi WINS ............................................................................................................................. 193
Konfiguracja protokołu SNTP ........................................................................................................................ 196
Monitorowanie i kontrolowanie urządzenia za pomocą protokołu SNMP ..................................................... 199
Konfiguracja ustawień oprogramowania zarządzania urządzeniami ............................................................ 205
Konfiguracja protokołu SMB ......................................................................................................................... 209
Konfiguracja ustawień drukowania na komputerze ............................................................................... 212
149
Sieć
Sieć
6869-025
Niniejsze urządzenie oferuje możliwość użytkowania w wielu różnych środowiskach, a oprócz podstawowych funkcji
związanych z siecią jest także wyposażone w zaawansowane rozwiązania technologiczne. Użytkownicy, którzy nie są
ekspertami w zakresie sieci, nie mają żadnych powodów do niepokoju, gdyż urządzenie to zostało zaprojektowane z
myślą o prostocie i wygodzie obsługi. Bez obaw można rozpocząć wykonywanie kolejnych kroków konfiguracji sieci.
◼ Podłączanie do komputera/wyświetlanie ustawień sieciowych urządzenia
Podłączanie do sieci(P. 151)
◼ Konfiguracja drukowania
Konfiguracja urządzenia w celu drukowania danych z komputera(P. 165)
◼ Dostosowywanie urządzenia do wygodnej pracy w środowisku sieciowym
Konfiguracja urządzenia w danym środowisku sieciowym(P. 183)
150
Sieć
Podłączanie do sieci
6869-026
Urządzenie można podłączyć do sieci za pomocą przewodowego łącza LAN. Wymaga to użycia niepowtarzalnego
adresu IP w sieci. Konkretne ustawienia adresu IP można uzyskać u dostawcy usług internetowych lub administratora
sieci.
● Jeśli urządzenie jest podłączone do niezabezpieczonej sieci, informacje osobiste mogą zostać przechwycone
przez osoby niepowołane.
● Urządzenie jest dostarczane bez kabla LAN i routera. W razie konieczności należy zaopatrzyć się w te
akcesoria.
◼ Przed rozpoczęciem
Aby podłączyć urządzenie do sieci, należy postępować zgodnie z podanymi poniżej instrukcjami.
Sprawdź ustawienia komputera.
● Upewnij się, że komputer został poprawnie podłączony do sieci. Aby uzyskać więcej
informacji, zapoznaj się z instrukcjami obsługi dołączonymi do urządzeń lub skontaktuj
się z ich producentami.
● Sprawdź, czy proces konfiguracji ustawień sieciowych na komputerze został
zakończony. W przypadku nieodpowiedniej konfiguracji sieci korzystanie z urządzenia
w środowisku sieciowym nie jest możliwe nawet po przeprowadzeniu dalszej części
procedury.
● W zależności od sieci potrzebna może być zmiana ustawień metody komunikacji
(półdupleks lub dupleks pełny) albo typu sieci Ethernet (10BASE-T/100BASE-TX/
Konfiguracja ustawień sieci Ethernet(P. 184) ). Aby uzyskać
1000BASE-T) (
szczegółowe informacje, należy skontaktować się z dostawcą Internetu lub
administratorem sieci.
● Sprawdzanie adresu MAC urządzenia.
Adres MAC(P. 366)
151
Sieć
● Informacje na temat podłączania do sieci IEEE 802.1X znajdują się w sekcji
Konfiguracja uwierzytelniania zgodnego z IEEE 802.1X(P. 279) .
Połącz z przewodową siecią LAN.
Podłączanie do sieci przewodowej LAN(P. 153)
Skonfiguruj adres IP.
● W momencie zakupu funkcja Automatyczne przydzielanie adresu IP jest włączona,
dzięki czemu urządzenie automatycznie uzyskuje adres IP. Mimo to opcja to może nie
być używana zależnie od środowiska sieciowego. W takiej sytuacji należy ręcznie
ustawić adres IP lub skonfigurować automatyczne uzyskiwanie adresu IP za pomocą
protokołu DHCP lub innego.
Konfiguracja adresu IP(P. 155)
152
Sieć
Podłączanie do sieci przewodowej LAN
6869-027
Urządzenie należy podłączyć do komputera za pośrednictwem routera. Podłącz urządzenie do routera za pomocą
kabla sieciowego LAN.
1
Podłącz kabel LAN.
● Podłącz urządzenie do routera za pomocą kabla sieci LAN.
● Wsuń złącze do gniazda, aby zatrzasnęło się we właściwym położeniu.
2
Sprawdź, czy wskaźnik LNK (
) się świeci.
● Jeśli wskaźnik LNK nie świecie się, mógł wystąpić problem z połączeniem z przewodową siecią LAN. Więcej
informacji znajduje się na stronie internetowej podręcznika w sekcji „Rozwiązywanie problemów (FAQ)”.
3
Ustawianie adresu IP.
Konfiguracja adresu IP(P. 155)
● W momencie zakupu funkcja Automatyczne przydzielanie adresu IP jest włączona, dzięki czemu urządzenie
automatycznie uzyskuje adres IP. Mimo to opcja to może nie być używana zależnie od środowiska sieciowego.
153
Sieć
W takiej sytuacji należy ręcznie ustawić adres IP lub skonfigurować automatyczne uzyskiwanie adresu IP za
pomocą protokołu DHCP lub innego.
ŁĄCZA
Podłączanie do sieci(P. 151)
154
Sieć
Konfiguracja adresu IP
6869-028
Połączenie urządzenia z siecią wymaga unikatowego sieciowego adresu IP. Dostępne są dwie wersje adresów IP: IPv4
oraz IPv6. Należy skonfigurować te ustawienia w zależności od środowiska sieciowego. Aby korzystać z adresów IPv6,
należy prawidłowo skonfigurować ustawienia adresu IPv4.
155
Sieć
Ustawianie adresu IPv4
6869-029
1660-00W
Adres IPv4 może być przypisywany automatycznie za pośrednictwem protokołu
dynamicznego przydzielania adresu IP, takiego jak DHCP, lub można wprowadzić go
ręcznie. W przypadku podłączania urządzenia do przewodowej sieci LAN należy
upewnić się, że złącza kabla LAN zostały poprawnie umieszczone w portach (
Podłączanie do sieci przewodowej LAN(P. 153) ).
Ustawianie adresu IPv4
1
Naciśnij przycisk
2
Za pomocą przycisków
(
).
/
wybierz opcję <Sieć> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
3
Wybierz kolejno <Ustawienia TCP/IP>
4
Skonfiguruj ustawienia adresu IP.
.
.
<Ustawienia IPv4>
<Tryb IP>.
<Automatycznie>
Opcję należy wybrać, aby włączyć automatyczne przypisywanie adresu IP za pośrednictwem protokołu,
takiego jak DHCP.
<Ręcznie>
Ustawienie to umożliwia konfigurację ustawień adresu IP poprzez ręczne wprowadzenie adresu IP.
Automatyczne przypisywanie adresu IP
1
Wybierz opcję <Automatycznie> i naciśnij przycisk
2
Wybierz opcję <Protokół> i naciśnij przycisk
156
.
.
Sieć
3
Wybierz opcję <Użyj DHCP>, <Użyj BOOTP> lub <Użyj RARP> i naciśnij przycisk
.
● Można użyć tylko jednego z protokołów: DHCP, BOOTP i RARP. Jeśli ustawienie wybranego protokołu to
<Włącz>, ustawienie dla pozostałych dwóch protokołów zostanie zmienione na <Wyłącz>.
4
Wybierz opcję <Włącz> i naciśnij przycisk
5
Naciśnij przycisk
6
Wybierz opcję <Automatycz. adres IP> i naciśnij przycisk
7
Wybierz opcję <Włącz> i naciśnij przycisk
.
.
.
.
Korzystanie z serwera DHCP
Po wyłączeniu i ponownym włączeniu zasilania zostanie przypisany inny adres IP niż bieżący. To może
spowodować wyłączenie drukowania. Aby skorzystać z serwera DHCP, należy określić jedno z podanych
poniżej ustawień po uprzedniej konsultacji z administratorem sieci.
● Skonfigurowanie funkcji dynamicznej aktualizacji DNS
Konfiguracja usługi DNS(P. 187)
● Określenie ustawień serwera DHCP w celu stałego przypisywania tego samego adresu IP
Przypisywanie adresu IP bez użycia protokołu DHCP/BOOTP/RARP
● Ustaw wszystkie protokoły na <Wyłącz>. Jeśli dla opcji <Użyj DHCP>, <Użyj BOOTP> lub <Użyj RARP>
zostanie wybrane ustawienie <Włącz>, w przypadku gdy usługi są niedostępne, urządzenie będzie traciło
czas i zasoby komunikacyjne na wyszukiwanie tych usług w sieci.
Adresy IP mające pierwszeństwo
● Adresy IP przypisywane za pośrednictwem protokołów DHCP/BOOTP/RARP są nadrzędne w stosunku do
adresów uzyskiwanych za pomocą protokołu Auto IP.
Ręczne wprowadzanie adresu IP
1
Wybierz opcję <Ręcznie> i naciśnij przycisk
157
.
Sieć
2
Wybierz opcję <Ustawienia adresu IP> i naciśnij przycisk
3
Określ adres IP, maskę podsieci oraz adres bramy (lub bramę domyślną).
● Wybierz opcję do ustawienia, naciśnij przycisk
.
, wprowadź adres i naciśnij
.
Wprowadzanie adresów
● Za pomocą przycisków
/
przejdź do pola docelowego (pole wprowadzania danych
oddzielonych kropką) i zmniejsz/zwiększ wartość za pomocą klawiszy numerycznych.
Nie ma pewności, czy adres IP do wprowadzenia jest znany
● Adres IP można wyznaczyć na podstawie ustawień routera sieci.
przypisania do urządzenia(P. 158)
5
Pozwala wykonać reset sprzętowy.
Wyznaczanie adresu IP do
Reset sprzętowy(P. 488)
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Sprawdzanie poprawności ustawień
● Upewnij się, że na komputerze możliwe jest wyświetlenie okna Zdalnego interfejsu użytkownika.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Po zainstalowaniu sterownika drukarki nastąpiła zmiana adresu IP
● Należy ponownie określić port, który ma być używany. Aby uzyskać informacje o procedurze zmiany portu,
zapoznaj się z instrukcjami obsługi odpowiednich sterowników na stronie internetowej z podręcznikami
online.
Wyznaczanie adresu IP do przypisania do urządzenia
Aby używać stałego adresu IP dla urządzenia, można skonfigurować adres IP w opisany poniżej sposób.
158
Sieć
◼ Konfiguracja adresu IP
Adres IP składa się z czterech liczb oddzielonych kropką (.) (przykład: 192.168.1.45). Każda liczba musi mieścić się
w przedziale z zakresu od 0 do 255. Zasadniczo pierwsze trzy liczby powinny być takie same, jak dla routera,
ponieważ są one wspólne w sieci. Ostatnia liczba (na przykład 45 w adresie 192.168.1.45) powinna być różna od
liczby innych urządzeń.
◼ Sprawdzanie ustawień routera
Aby użyć stałego adresu IP, należy sprawdzić ustawienia serwera DHCP, który automatycznie przypisuje adresy
IP w sieci. To pozwoli uniknąć powielania adresu IP. Należy ustawić adres poza zakresem puli adresów IP
przypisywanych przez serwer DHCP. Często funkcję serwera DHCP pełni router, dlatego należy sprawdzić jego
ustawienia.
● Informacje na temat wyświetlania ekranu ustawień routera zawiera jego instrukcja obsługi.
1
Wyświetl ekran ustawień routera.
2
Sprawdź zakres puli adresów IP przypisywanych przez serwer DHCP.
● Zakres adresów IP przypisywanych przez serwer DHCP zależy od routera.
Przykładowy ekran ustawień DHCP routera:
3
Skonfiguruj adres IP urządzenia.
● Biorąc pod uwagę przykładowy ekran zaprezentowany w kroku 2, do urządzenia należałoby przypisać adres
IP z zakresu od 192.168.11.66 do 192.168.11.254, ponieważ router za pomocą DHCP przydziela adresy z puli
od 192.168.11.2 do 192.168.11.65.
ŁĄCZA
Konfiguracja adresów IPv6(P. 161)
159
Sieć
Wydruk stanu sieci(P. 541)
Konfiguracja usługi WINS(P. 193)
160
Sieć
Konfiguracja adresów IPv6
6869-02A
Adresy IPv6 urządzenia można skonfigurować za pomocą Remote UI (Zdalny interfejs
użytkownika). Przed rozpoczęciem konfiguracji adresów IPv6 należy sprawdzić
ustawienia adresu IPv4 ( Ustawianie adresu IPv4(P. 156) ). Aby korzystać z
adresów IPv6, należy poprawnie skonfigurować ustawienia adresu IPv4. Urządzenie
może korzystać z następujących wielu adresów IPv6:
Typ
Adres lokalny łącza
Opis
Adres ważny tylko w obrębie podsieci lub dla łącza, który nie może zostać użyty do komunikacji z
urządzeniami innymi niż router. Adres lokalny łącza jest ustawiany automatycznie, gdy włączona
jest funkcja obsługi protokołu IPv6.
Adres ręczny
Adres wprowadzany ręcznie. W przypadku korzystania z tego adresu należy określić długość
prefiksu i domyślny adres routera.
Adres bezstanowy
Adres generowany automatycznie za pomocą adresu MAC urządzenia oraz prefiksu sieci z routera.
Po ponownym uruchomieniu urządzenia (lub po jego włączeniu) adresy bezstanowe zostają
usunięte.
Adres stanowy
1
Adres uzyskiwany z serwera DHCP przy użyciu protokołu DHCPv6.
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
[Ustawienia TCP/IP].
161
Sieć
4
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia IPv6].
5
Zaznacz pole wyboru [Użyj IPv6], a następnie skonfiguruj wymagane ustawienia.
162
Sieć
[Użyj IPv6]
Zaznaczenie tego pola wyboru powoduje włączenie obsługi protokołu IPv6 przez urządzenie. Jeśli protokół
IPv6 nie jest używany, należy usunąć zaznaczenie pola wyboru.
[Użyj adresu bezstanowego]
To pole wyboru należy zaznaczyć w przypadku korzystania z adresu bezstanowego. Jeśli adres bezstanowy nie
jest używany, należy usunąć zaznaczenie pola wyboru.
[Użyj adresu wprowadzanego ręcznie]
Aby ręcznie wprowadzić adres IPv6, należy zaznaczyć to pole wyboru i wprowadzić adres IP, określić długość
prefiksu oraz podać domyślny adres routera w odpowiednich polach tekstowych.
[Adres IP]
W tym miejscu należy wprowadzić adres IPv6. Nie można wprowadzić adresu rozpoczynającego się od „ff”
(ani adresu multicast), adresu „0000::0000” (składającego się z samych zer) ani adresu rozpoczynającego się
od „0:0:0:0:0:ffff” lub „0:0:0:0:0:0”.
[Długość prefiksu]
Należy tu wprowadzić liczbę oznaczającą liczbę bitów przeznaczoną na adresy sieciowe.
[Domyślny adres rutera]
W razie potrzeby w tym miejscu należy zdefiniować adres IPv6 domyślnego routera. Nie można wprowadzić
adresu rozpoczynającego się od „ff” (ani adresu multicast), adresu „0000::0000” (składającego się z samych
zer) ani adresu rozpoczynającego się od „0:0:0:0:0:ffff” lub „0:0:0:0:0:0”.
[Użyj DHCPv6]
To pole wyboru należy zaznaczyć w przypadku korzystania z adresu stanowego. Jeśli protokół DHCPv6 nie jest
używany, należy usunąć zaznaczenie pola wyboru.
6
Kliknij [OK].
7
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
163
Sieć
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Sprawdzanie poprawności ustawień
● Sprawdź, czy można wyświetlić ekran Zdalnego interfejsu użytkownika w komputerze z wykorzystaniem
adresu IPv6 urządzenia. Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Wybieranie ustawień z panelu sterowania
● Adresy IPv6 można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
Ustawienia IPv6(P. 350)
Gdy zmienił się adres IP po zainstalowaniu sterownika drukarki
● Należy ponownie określić port, który ma być używany. Aby uzyskać informacje o procedurze zmiany portu,
zapoznaj się z instrukcjami obsługi odpowiednich sterowników na stronie internetowej z podręcznikami
online.
ŁĄCZA
Ustawianie adresu IPv4(P. 156)
Wydruk stanu sieci(P. 541)
164
Sieć
Konfiguracja urządzenia w celu drukowania danych z
komputera
6869-02C
W przypadku użytkowania urządzenia w roli drukarki sieciowej można skonfigurować protokoły i porty używane do
drukowania, a także utworzyć serwer wydruku dla urządzenia. Przed konfiguracją urządzenia w celu drukowania z
danych komputera należy wykonać podstawowe procedury konfiguracyjne, takie jak instalacja sterownika drukarki.
Aby uzyskać więcej informacji, zapoznaj się z instrukcjami obsługi odpowiednich sterowników na stronie internetowej z
podręcznikami online.
● Protokoły drukowania są zasadami definiującymi sposób dostarczania danych dokumentu utworzonego na
komputerze do urządzenia, które można dostosować do rodzaju drukowania lub środowiska sieciowego.
● Porty to bramy umożliwiające przekazywanie danych dokumentu z komputera do drukarki. Nieprawidłowa
konfiguracja portów często jest przyczyną niemożności wydruku dokumentów z podłączonego do sieci
komputera.
165
Sieć
Konfiguracja protokołów drukowania i funkcji
protokołu WSD
6869-02E
Należy skonfigurować protokoły używane do drukowania dokumentów z podłączonego do sieci komputera. Aby
uzyskać informacje o protokołach drukowania obsługiwanych przez urządzenie, patrz Środowisko
sieciowe(P. 587) . W tej sekcji opisano ustawienia protokołów LPD, RAW, IPP/IPPS i WSD.
Korzystanie z FTP
● Informacje na temat konfiguracji ustawień znajdują się w części wskazanej poniżej.
Korzystanie z klientów FTP(P. 613)
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
4
Skonfiguruj protokoły drukowania.
[Ustawienia TCP/IP].
166
Sieć
Konfiguracja ustawień LPD
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia LPD].
2
Skonfiguruj odpowiednio ustawienia.
[Użyj drukowania LPD]
Korzystając z protokołu LPD do drukowania, należy zaznaczyć to pole wyboru. Jeśli nie jest on używany,
należy usunąć zaznaczenie tego pola.
[Drukuj stronę separatora wydruków LPD]
To pole wyboru należy zaznaczyć, aby uwzględnić takie informacje, jak nazwy użytkowników i nazwy
plików na wydrukach. Aby te dane nie były drukowane, należy usunąć zaznaczenie tego pola wyboru.
[Przekroczenie czasu oczekiwania na odbiór]
Ustaw czas, po którym zadanie drukowania zostanie automatycznie zakończone, jeśli urządzenie nie
będzie mogło odebrać danych drukowania z powodu problemów z komunikacją lub wystąpienia innych
problemów.
3
Kliknij [OK].
Konfiguracja ustawień RAW
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia RAW].
167
Sieć
2
Skonfiguruj odpowiednio ustawienia.
[Użyj drukowania RAW]
Zaznacz to pole wyboru w przypadku drukowania w trybie RAW. Jeśli funkcja ta nie jest używana,
zaznaczenie tego pola wyboru należy usunąć.
[Użyj komunikacji dwukierunkowej]
To pole wyboru należy zaznaczyć, aby móc korzystać z komunikacji dwukierunkowej do powiadamiania
komputera o stanie urządzenia i ukończeniu drukowania. Jeśli ta funkcja nie jest używana, należy usunąć
zaznaczenie tego pola.
[Przekroczenie czasu oczekiwania na odbiór]
Ustaw czas, po którym zadanie drukowania zostanie automatycznie zakończone, jeśli urządzenie nie
będzie mogło odebrać danych drukowania z powodu problemów z komunikacją lub wystąpienia innych
problemów.
3
Kliknij [OK].
Konfiguracja ustawień IPP/IPPS
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia wydruku IPP].
168
Sieć
2
Skonfiguruj odpowiednio ustawienia.
[Użyj drukowania IPP]
Korzystając z protokołu IPP/IPPS do drukowania, należy zaznaczyć to pole wyboru. Jeśli nie jest on
używany, należy usunąć zaznaczenie tego pola.
[Użyj TLS]
Korzystając z protokołu IPP/IPPS (drukowanie IPP z zaszyfrowaną komunikacją TLS) przy drukowaniu,
należy zaznaczyć to pole wyboru. Jeśli nie jest on używany, należy usunąć zaznaczenie tego pola.
Gdy używany jest protokół IPPS, należy włączyć funkcję komunikacji szyfrowanej TLS.
protokołu TLS do komunikacji szyfrowanej(P. 265)
Korzystanie z
Jeśli podczas generowania klucza używanego na potrzeby komunikacji sieciowej wybrane zostanie
ustawienie [RSA] dla opcji [Algorytm klucza], jako długość klucza należy skonfigurować co najmniej
wartość [1024 bity]. Zależnie od używanego systemu operacyjnego drukowanie IPPS może nie zostać
przeprowadzone poprawnie, jeśli jako długość klucza zostanie podana wartość [512 bitów].
[Użyj uwierzytelniania IPP]
Aby skorzystać z funkcji uwierzytelniania użytkownika na potrzeby drukowania IPP, należy zaznaczyć to
pole wyboru i ustawić nazwę użytkownika oraz hasło. Jeśli nie jest ona używana, należy usunąć
zaznaczenie tego pola.
[Nazwa użytkownika]
Należy wprowadzić złożoną ze znaków alfanumerycznych nazwę użytkownika używaną do
uwierzytelniania IPP.
[Ustaw/Zmień hasło]
Aby określić lub zmienić hasło, należy zaznaczyć pole wyboru i wprowadzić złożone ze znaków
alfanumerycznych hasło w polu tekstowym [Hasło]. W celu potwierdzenia należy wprowadzić to samo
hasło w polu tekstowym [Potwierdź].
3
Kliknij [OK].
Konfiguracja ustawień WSD
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia wydruku WSD].
169
Sieć
2
Skonfiguruj odpowiednio ustawienia.
[Użyj wydruku WSD]
Korzystając z protokołu WSD do drukowania, należy zaznaczyć to pole wyboru. Jeśli nie jest on używany,
należy usunąć zaznaczenie tego pola.
[Użyj przeglądania WSD]
Zaznaczenie tego pola wyboru umożliwia uzyskanie informacji o urządzeniu przez komputer za pomocą
interfejsu WSD. To pole wyboru jest zaznaczane automatycznie po zaznaczeniu pola wyboru [Użyj
wydruku WSD].
[Użyj Multicast Discovery]
Zaznaczenie tego pola wyboru umożliwia skonfigurowanie urządzenia tak, aby odpowiadało na
komunikaty Multicast Discovery. Gdy pole wyboru nie jest zaznaczone, urządzenie pozostaje w trybie
uśpienia nawet pomimo przepływu w sieci komunikatów Multicast Discovery.
3
5
Kliknij [OK].
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
170
Sieć
Korzystanie z panelu sterowania
● Drukowanie LPD, drukowanie RAW i drukowanie IPP można również włączać lub wyłączać z poziomu menu
ustawień panelu roboczego.
Ustawienia LPD(P. 352)
Ustawienia RAW(P. 352)
Wydruk IPP(P. 353)
● Do ustawień WSD można przejść również z poziomu menu ustawień panelu roboczego.
WSD(P. 353)
Procedury konfiguracji za pomocą komputera
Po zakończeniu konfiguracji urządzenia konieczne może być skonfigurowanie ustawień lub zainstalowanie
aplikacji także na komputerze. W razie potrzeby należy również skonfigurować ustawienia na komputerze.
● Konfiguracja portów drukarki
Po zmianie adresu IP urządzenia lub dodaniu drukarki za pomocą folderu drukarki w systemie Windows
mogą wystąpić błędy drukowania. Błędy te są zwykle spowodowane nieprawidłową konfiguracją portu
drukarki. Przyczyną może być na przykład określenie niewłaściwego numeru lub typu portu na komputerze.
W takiej sytuacji należy skonfigurować porty drukarki. Aby uzyskać informacje o procedurze zmiany portu,
zapoznaj się z instrukcjami obsługi odpowiednich sterowników na stronie internetowej z podręcznikami
online.
● Konfigurowanie urządzeń sieciowych WSD w systemie Windows Vista/7/8/10
Użyj portu WSD, aby zainstalować sterownik drukarki. Aby uzyskać więcej informacji, zapoznaj się z
instrukcjami obsługi odpowiednich sterowników na stronie internetowej z podręcznikami online.
● Włączanie protokołu IPP/IPPS
Należy zainstalować sterowniki drukarki, określając port IPP.
ŁĄCZA
Konfiguracja serwera wydruku(P. 179)
171
Włączanie protokołu IPP/IPPS(P. 172)
Sieć
Włączanie protokołu IPP/IPPS
6869-02F
Aby ustawić protokół drukowania IPP lub IPPS, należy zainstalować sterownik drukarki, wykonując opisane poniżej
czynności odpowiednio do systemu operacyjnego zainstalowanego na komputerze. Sterownik drukarki znajduje się na
dysku User Software CD-ROM/DVD-ROM (Dysk CD-ROM/DVD-ROM z oprogramowaniem użytkownika) dołączonym do
urządzenia. Przed rozpoczęciem wykonywania opisanych czynności, należy umieścić dysk User Software CD-ROM/DVDROM (Dysk CD-ROM/DVD-ROM z oprogramowaniem użytkownika) w stacji komputera.
● Aby wykonać poniższą procedurę, należy zalogować się na komputerze na konto administratora.
● Przed przystąpieniem do wykonania tej procedury należy skonfigurować ustawienia drukowania IPP za
pomocą Zdalnego interfejsu użytkownika.
Konfiguracja protokołów drukowania i funkcji protokołu WSD(P. 166)
● Po włożeniu dysku CD-ROM/DVD-ROM należy zamknąć ekran konfiguracji, który zostanie wyświetlony.
1
Otwórz folder drukarki.
2
Kliknij [Dodaj drukarkę].
3
4
Wyświetlanie folderu Drukarki(P. 627)
W przypadku korzystania z systemu operacyjnego Windows Vista/7/Server 2008
kliknij [Dodaj drukarkę sieciową, bezprzewodową lub Bluetooth].
Kliknij [Żądana drukarka nie znajduje się na liście].
172
Sieć
5
Wybierz opcję [Wybierz drukarkę udostępnioną według nazwy], wybierz miejsce
docelowe połączenia i kliknij przycisk [Dalej].
● Aby użyć protokołu IPP, wprowadź wartość „http://<adres IP urządzenia>/ipp” dla lokalizacji docelowej
połączenia.
Przykład: http://192.168.1.81/ipp
● Aby użyć protokołu IPPS, wprowadź wartość „https://<adres IP urządzenia>/ipp” dla lokalizacji docelowej
połączenia.
Przykład: https://192.168.1.81/ipp
● W przypadku korzystania z serwera DNS zamiast wartości „Adres IP urządzenia” należy wprowadzić
„<nazwa hosta urządzenia>.<nazwa domeny>” (przykład: https://moja_drukarka.przyklad.com/ipp).
6
Kliknij [Z dysku].
173
Sieć
7
Kliknij [Przeglądaj].
8
Odszukaj folder, w którym znajdują się sterowniki drukarki, wybierz plik INF,
a następnie kliknij przycisk [Otwórz].
● Określ folder, jak pokazano poniżej, w zależności od systemu operacyjnego zainstalowanego na komputerze.
Jeśli nie wiesz, czy używany system operacyjny Windows jest w wersji 32- czy 64-bitowej, przejdź do sekcji
Sprawdzanie architektury bitowej(P. 630) .
32-bitowe systemy operacyjne
Wybierz folder [UFR II]-język systemu-[32BIT]-[Driver] na User Software CD-ROM/DVD-ROM (Dysk CD-ROM/
DVD-ROM z oprogramowaniem użytkownika).
64-bitowe systemy operacyjne
Wybierz folder [UFR II]-język systemu-[x64]-[Driver] na User Software CD-ROM/DVD-ROM (Dysk CD-ROM/
DVD-ROM z oprogramowaniem użytkownika).
Korzystanie z funkcji uwierzytelniania IPP
● Po wyświetleniu monitu z prośbą o wprowadzenie hasła, wpisz nazwę użytkownika i hasło, a następnie
kliknij przycisk [OK]. Konfiguracja protokołów drukowania i funkcji protokołu WSD(P. 166)
9
Postępuj zgodnie z procedurą konfiguracji wyświetlaną na ekranie.
➠ Sterownik drukarki został zainstalowany. Aby użyć protokołu IPPS, należy zainstalować klucze publiczne
urządzenia na komputerze.
◼ Instalowanie kluczy publicznych urządzenia
Aby móc korzystać z protokołu IPPS, należy dodatkowo zainstalować klucze publiczne urządzenia na komputerze.
174
Sieć
● Pary kluczy: [Wspólna nazwa] muszą być z góry ustawione jako parametry „Adres IP” lub „<nazwa
hosta>.<nazwa domeny>” używane podczas łączenia z urządzeniem. Generowanie par kluczy(P. 285)
1
Uruchom przeglądarkę internetową.
2
Wprowadź adres „https://<adres IP urządzenia>/” w polu adresu przeglądarki i
naciśnij klawisz [ENTER].
● Przykład: https://192.168.1.81/
● W przypadku korzystania z serwera DNS zamiast wartości „Adres IP urządzenia” należy wprowadzić
„<nazwa hosta urządzenia>.<nazwa domeny>” (przykład: https://moja_drukarka.przyklad.com/).
3
Kliknij [Kontynuuj przeglądanie tej witryny sieci Web (niezalecane).].
➠ Zostanie wyświetlona strona logowania.
4
Kliknij [Narzędzia]
5
Wybierz opcję [Zaufane witryny] na karcie [Zabezpieczenia] i kliknij opcję [Witryny].
[Opcje internetowe].
175
Sieć
6
7
8
Upewnij się, że wyświetlana jest treść „https://<Adres IP urządzenia> lub <nazwa
hosta urządzenia>.<nazwa domeny>/”, i kliknij kolejno opcje [Dodaj]
[Zamknij].
Jeśli pole wyboru [Włącz tryb chroniony (wymaga ponownego uruchomienia
programu Internet Explorer)] jest zaznaczone, usuń jego zaznaczenie.
Kliknij [OK].
➠ Nastąpi powrót do ekranu Zdalnego interfejsu użytkownika.
176
Sieć
9
Zamknij przeglądarkę internetową.
10
Powtórz kroki od 1 do 3, aby uruchomić Zdalny interfejs użytkownika.
11
Kliknij opcje [Błąd certyfikatu]
stronie pola adresu.
12
Kliknij [Zainstaluj certyfikat].
13
Kliknij [Dalej].
14
15
[Wyświetl certyfikaty] znajdujące się po prawej
Wybierz pozycję [Umieść wszystkie certyfikaty w następującym magazynie] i kliknij
przycisk [Przeglądaj].
Wybierz opcję [Zaufane główne urzędy certyfikacji] i postępuj zgodnie z instrukcjami
wyświetlanymi na ekranie, aby zakończyć pracę kreatora importowania
certyfikatów.
16
Jeśli w punkcie 7 usunięto zaznaczenie pola wyboru [Włącz tryb chroniony (wymaga
ponownego uruchomienia programu Internet Explorer)], zaznacz je.
177
Sieć
ŁĄCZA
Konfiguracja serwera wydruku(P. 179)
178
Sieć
Konfiguracja serwera wydruku
6869-02H
Użycie serwera wydruku pozwala na zmniejszenie obciążenia komputera, z którego wykonywany jest wydruk. Serwer
wydruku zapewnia możliwość instalacji sterowników za pomocą sieci na każdym komputerze, co oznacza, że nie ma
potrzeby instalowania ich na każdym z komputerów przy użyciu dysku CD-ROM/DVD-ROM. Aby skonfigurować
komputer podłączony do sieci jako serwer wydruku, należy określić ustawienia udostępniania drukarki.
● Aby wykonać poniższą procedurę, należy zalogować się na komputerze na konto administratora.
● Może wystąpić problem z instalacją sterowników drukarki przez sieć w zależności od systemu operacyjnego
oraz architektury bitowej (32- lub 64-bity) serwera drukowania i komputerów klienta.
● Wdrażając serwer drukowania w środowisku domenowym, skontaktuj się z administratorem sieci.
Zarządzanie identyfikatorami wydziałów w przypadku korzystania z serwera wydruku
● Podczas instalacji sterowników drukarki wymagane jest dodanie usługi Canon Driver Information Assist
Service (Usługa Canon Driver Information Assist Service). Aby uzyskać więcej informacji, zapoznaj się z
instrukcjami obsługi odpowiednich sterowników na stronie internetowej z podręcznikami online.
1
2
3
Otwórz folder drukarki.
Wyświetlanie folderu Drukarki(P. 627)
Kliknij prawym przyciskiem myszy ikonę drukarki, a następnie kliknij pozycję
[Właściwości drukarki] lub [Właściwości].
Kliknij kartę [Udostępnianie], wybierz opcję [Udostępnij tę drukarkę] i wprowadź
nazwę udziału urządzenia.
179
Sieć
Jeżeli wyświetlany jest komunikat [Zmień opcje udostępniania]
● Kliknij [Zmień opcje udostępniania].
4
W razie potrzeby zainstaluj dodatkowe sterowniki.
● Wykonanie tej operacji jest wymagane, jeśli sterowniki drukarki będą instalowane na innych komputerach o
innej architekturze bitowej za pośrednictwem serwera wydruku.
1
Kliknij [Dodatkowe sterowniki].
2
Zaznacz pole wyboru przy architekturze bitowej używanej przez inne komputery i kliknij przycisk [OK].
● Dodatkowe sterowniki należy wybrać spośród następujących opcji według systemu operacyjnego
serwera wydruku.
Serwer wydruku
Zaznacz pole wyboru
32-bitowe systemy operacyjne [x64]
180
Sieć
64-bitowe systemy operacyjne [x86] w kolumnie [Procesor]
● Jeśli nie wiesz, czy używany system operacyjny Windows jest w wersji 32- czy 64-bitowej, przejdź do
sekcji Sprawdzanie architektury bitowej(P. 630) .
3
Umieść dysk User Software CD-ROM/DVD-ROM (Dysk CD-ROM/DVD-ROM z oprogramowaniem
użytkownika) w stacji komputera i kliknij przycisk [Przeglądaj].
4
Odszukaj folder z dodatkowymi sterownikami, wybierz plik INF, a następnie kliknij przycisk [Otwórz].
● Wybierz folder z zastosowaniem poniższej procedury zgodnie z systemem operacyjnym serwera
drukowania.
Jeśli drukarka ma 32-bitowy system operacyjny
Wybierz folder [UFR II]-język systemu-[x64]-[Driver] na User Software CD-ROM/DVD-ROM (Dysk CD-ROM/
DVD-ROM z oprogramowaniem użytkownika).
Serwer wydruku korzysta z 64-bitowej wersji systemu
Wybierz folder [UFR II]-język systemu-[32BIT]-[Driver] na User Software CD-ROM/DVD-ROM (Dysk CDROM/DVD-ROM z oprogramowaniem użytkownika).
5
Kliknij [OK].
➠ Rozpocznie się instalacja dodatkowych sterowników. Poczekaj, aż ponownie pojawi się karta
[Udostępnianie].
Jeżeli wyświetlany jest komunikat [Kontrola konta użytkownika]
● Kliknij [Tak].
5
Kliknij [OK].
◼ Instalacja sterowników drukarki na komputerze za pośrednictwem serwera wydruku
1
Znajdź udostępnioną drukarkę na serwerze wydruku. Wyświetlanie
udostępnionych drukarek w serwerze drukowania(P. 628)
181
Sieć
2
Kliknij dwukrotnie drukarkę udostępnioną.
3
Postępuj według instrukcji wyświetlanych na ekranie, aby zainstalować sterowniki
drukarki.
ŁĄCZA
Drukowanie z komputera(P. 76)
182
Sieć
Konfiguracja urządzenia w danym środowisku
sieciowym
6869-02J
Konfiguracja sieci różni się w zależności od jej przeznaczenia. Urządzenie zostało zaprojektowane tak, aby było
kompatybilne z możliwie najszerszą gamą konfiguracji sieciowych, a ponadto wyposażono je w szeroki wachlarz
rozwiązań technologicznych. Należy skontaktować się z administratorem sieci i skonfigurować urządzenie w sposób
odpowiedni do danego środowiska sieciowego.
183
Sieć
Konfiguracja ustawień sieci Ethernet
6869-02K
Ethernet jest standardem komunikacji danych w obrębie sieci lokalnej (LAN). Możliwe jest
określenie trybu komunikacji i rodzaju sieci Ethernet. Na ogół z urządzenia można
korzystać bez zmiany ustawień domyślnych ( Sterownik Ethernet(P. 364) ), można to
jednak zrobić, aby dostosować je do środowiska sieciowego.
1
Naciśnij przycisk
2
Za pomocą przycisków
(
).
/
wybierz opcję <Sieć> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
.
.
3
Wybierz kolejno opcje <Sterownik Ethernet>
4
Zdecyduj, czy ustawienia sieci Ethernet zostaną skonfigurowane automatycznie czy
<Automat. wykrywanie>.
ręcznie.
Automatyczna konfiguracja ustawień sieci Ethernet
Zaznacz opcję <Włącz> i naciśnij przycisk
. Urządzenie automatycznie wykryje i skonfiguruje tryb
komunikacji oraz rodzaj sieci Ethernet, których można użyć.
Ręczna konfiguracja ustawień sieci Ethernet
1
Wybierz opcję <Wyłącz> i naciśnij przycisk
2
Wybierz tryb komunikacji.
● Wybierz opcję <Tryb połączenia>
.
Wybierz opcję <Półdupleks> lub <Pełen dupleks>
<Półdupleks>
Naprzemiennie wysyła i pobiera dane komunikacyjne. Opcję tę należy wybrać, gdy urządzenie jest
podłączone do urządzenia sieciowego w trybie półdupleks.
<Pełen dupleks>
Jednocześnie wysyła i pobiera dane komunikacyjne. Ustawienie odpowiednie dla większości
środowisk.
184
Sieć
3
Wybierz rodzaj sieci Ethernet.
● Wybierz opcję <Typ sieci Ethernet>
Wybierz typ sieci Ethernet.
● W przypadku wybrania opcji <1000 Base-T>, ustawienie parametru <Tryb połączenia> zostanie
zmienione na <Pełen dupleks>.
5
Pozwala wykonać reset sprzętowy.
Reset sprzętowy(P. 488)
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
ŁĄCZA
Ustawianie czasu oczekiwania na połączenie z siecią(P. 186)
185
Sieć
Ustawianie czasu oczekiwania na połączenie z siecią
6869-02L
Jeśli sieć została zaprojektowana z myślą o komunikacji redundancyjnej i składa się z wielu koncentratorów
przełączających lub mostów, niezbędny jest mechanizm zapobiegający zapętlaniu pakietów. Skutecznym rozwiązaniem
jest na przykład określenie roli każdego portu przełącznika. Komunikacja może jednak nadal być zakłócana na kilka
sekund zaraz po zmianie sposobu połączenia ze sobą urządzeń sieciowych lub dodaniu nowego urządzenia. W razie
wystąpienia problemu tego typu ustaw czas oczekiwania na połączenie z siecią.
1
Naciśnij przycisk
2
Za pomocą przycisków
(
).
/
wybierz opcję <Sieć> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
.
3
Wybierz opcję <Czas ocz. przy rozr.> i naciśnij przycisk
4
Wprowadź czas oczekiwania w sekundach i naciśnij przycisk
.
● Za pomocą klawiszy numerycznych wprowadź czas.
5
Pozwala wykonać reset sprzętowy.
Reset sprzętowy(P. 488)
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
ŁĄCZA
Konfiguracja ustawień sieci Ethernet(P. 184)
186
.
.
Sieć
Konfiguracja usługi DNS
6869-02R
System DNS (Domain Name System) jest usługą rozpoznawania nazw, który kojarzy nazwę hosta (lub domeny) z
adresem IP. Należy odpowiednio skonfigurować opcje ustawień DNS, mDNS lub DHCP. Procedury konfiguracji DNS dla
protokołów IPv4 i IPv6 są inne.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
4
Skonfiguruj ustawienia usługi DNS.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
[Ustawienia TCP/IP].
Konfiguracja usługi DNS dla protokołu IPv4
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia IPv4].
187
Sieć
2
Skonfiguruj ustawienia usługi DNS dla protokołu IPv4.
[Ustawienia DNS]
[Adres głównego serwera DNS]
W tym miejscu należy wprowadzić adres IP serwera DNS. Adres IP można ustawić również z
poziomu panelu roboczego ( Ustawienia IPv4(P. 347) ).
[Adres podrzędnego serwera DNS]
W tym miejscu należy wprowadzić adres IP pomocniczego serwera DNS, jeśli jest używany. Adres IP
można ustawić również z poziomu panelu roboczego ( Ustawienia IPv4(P. 347) ).
[Nazwa hosta]
Należy tu wprowadzić złożoną ze znaków alfanumerycznych nazwę hosta urządzenia, które ma
zostać zarejestrowane na serwerze DNS.
[Nazwa domeny]
Należy tu wprowadzić złożoną ze znaków alfanumerycznych nazwę domeny, do której należy
urządzenie, taką jak „przyklad.com”.
[Dynamiczna aktualizacja DNS]
To pole wyboru należy zaznaczyć, aby rekordy DNS były dynamicznie aktualizowane po każdej
zmianie adresu IP urządzenia.
[Ustawienia mDNS]
[Użyj mDNS]
Wprowadzony w programie Bonjour protokół mDNS (system DNS w trybie multiemisji) kojarzy
nazwę hosta z adresem IP bez korzystania z usługi DNS. Aby włączyć protokół mDNS, należy
188
Sieć
zaznaczyć odpowiednie pole wyboru i wprowadzić nazwę mDNS w polu tekstowym [Nazwa mDNS].
To pole wyboru może być zaznaczane wyłącznie po zaznaczeniu pola wyboru [Użyj IPv4].
[Ustawienia opcji DHCP]
[Uzyskaj nazwę hosta]
To pole wyboru należy zaznaczyć w celu włączenia Opcji 12 i pobrania nazwy hosta z serwera DHCP.
Pobieranie nazwy hosta można określić również z poziomu panelu roboczego ( Ustawienia
IPv4(P. 347) ).
[Dynamiczna aktualizacja DNS]
To pole wyboru należy zaznaczyć w celu włączenia Opcji 81, aby dynamicznie aktualizować rekordy
DNS za pośrednictwem serwera DHCP. Dynamiczną aktualizację rekordów DNS można zdefiniować
również z poziomu panelu roboczego ( Ustawienia IPv4(P. 347) ).
[Uzyskaj adres serwera DNS]
To pole wyboru należy zaznaczyć w celu włączenia Opcji 6 i pobrania adresu serwera DNS z serwera
DHCP.
[Uzyskaj nazwę domeny]
To pole wyboru należy zaznaczyć w celu włączenia Opcji 15 i pobrania nazwy domeny z serwera
DHCP.
[Uzyskaj adres serwera WINS]
To pole wyboru należy zaznaczyć w celu włączenia Opcji 44 i pobrania adresu serwera WINS z
serwera DHCP.
3
Kliknij [OK].
Konfiguracja usługi DNS dla protokołu IPv6
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia IPv6].
189
Sieć
2
Skonfiguruj ustawienia usługi DNS dla protokołu IPv6.
● Zaznaczenie pola wyboru [Użyj IPv6] jest wymagane do konfiguracji ustawień.
adresów IPv6(P. 161)
[Ustawienia DNS]
190
Konfiguracja
Sieć
[Adres głównego serwera DNS]
W tym miejscu należy wprowadzić adres IP serwera DNS. Nie można wprowadzić adresu
rozpoczynającego się od „ff” (ani adresu multicast), adresu „0000::0000” (składającego się z samych
zer) ani adresu rozpoczynającego się od „0:0:0:0:0:ffff” lub „0:0:0:0:0:0”.
[Adres podrzędnego serwera DNS]
W tym miejscu należy wprowadzić adres IP pomocniczego serwera DNS, jeśli jest on używany. Nie
można wprowadzić adresu rozpoczynającego się od „ff” (ani adresu multicast), adresu „0000::0000”
(składającego się z samych zer) ani adresu rozpoczynającego się od „0:0:0:0:0:ffff” lub „0:0:0:0:0:0”.
[Użyj nazw IPv4 hosta/domeny]
To pole wyboru należy zaznaczyć w celu korzystania z tych samych nazw hosta i domeny jak w
przypadku protokołu IPv4.
[Nazwa hosta]
Należy tu wprowadzić złożoną ze znaków alfanumerycznych nazwę hosta urządzenia, które ma
zostać zarejestrowane na serwerze DNS.
[Nazwa domeny]
Należy tu wprowadzić złożoną ze znaków alfanumerycznych nazwę domeny, do której należy
urządzenie, taką jak „przyklad.com”.
[Dynamiczna aktualizacja DNS]
To pole wyboru należy zaznaczyć, aby rekordy DNS były dynamicznie aktualizowane po każdej
zmianie adresu IP urządzenia. Aby określić, jakie rodzaje adresów będą rejestrowane na serwerze
DNS, należy zaznaczyć pole wyboru obok opcji [Zapisz adres wprowadzony ręcznie], [Zapisz adres
stanowy] lub [Zapisz adres bezstanowy].
[Ustawienia mDNS]
[Użyj mDNS]
Wprowadzony w programie Bonjour protokół mDNS (system DNS w trybie multiemisji) kojarzy
nazwę hosta z adresem IP bez korzystania z usługi DNS. To pole wyboru można zaznaczyć jedynie
wówczas, gdy zaznaczone jest pole [Użyj IPv6].
[Użyj tej samej nazwy mDNS jak dla IPv4]
To pole wyboru należy zaznaczyć, aby korzystać z takiej samej nazwy mDNS jak w przypadku
protokołu IPv4. Aby ustalić inną nazwę, należy usunąć zaznaczenie tego pola i wprowadzić nazwę
mDNS w polu tekstowym [Nazwa mDNS].
[Ustawienia opcji DHCP]
[Uzyskaj adres serwera DNS]
To pole wyboru należy zaznaczyć w celu włączenia Opcji 23 i pobrania adresu serwera DNS z
serwera DHCP.
[Uzyskaj nazwę domeny]
To pole wyboru należy zaznaczyć w celu włączenia Opcji 24 i pobrania nazwy domeny z serwera
DHCP.
3
5
Kliknij [OK].
Wykonaj reset sprzętowy.
191
Sieć
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
ŁĄCZA
Ustawianie adresu IPv4(P. 156)
Konfiguracja adresów IPv6(P. 161)
Wydruk stanu sieci(P. 541)
192
Sieć
Konfiguracja usługi WINS
6869-02S
Windows Internet Name Service (WINS) jest usługą rozpoznawania nazw, za pomocą której do nazwy NetBIOS (nazwa
komputera lub drukarki w sieci SMB) jest przypisywany adres IP. Aby włączyć usługę WINS, należy określić serwer
WINS.
● W sieciach IPv6 funkcja ta jest niedostępna.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
4
Kliknij element [Edytuj] znajdujący się w sekcji [Konfiguracja WINS].
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
[Ustawienia TCP/IP].
193
Sieć
5
Zaznacz pole wyboru [Rozpoznawanie WINS], skonfiguruj wymagane ustawienia i
kliknij przycisk [OK].
[Rozpoznawanie WINS]
To pole wyboru należy zaznaczyć w celu korzystania z usługi WINS do rozpoznawania nazw. Jeśli usługa WINS
nie jest używana, należy usunąć zaznaczenie pola wyboru.
[Adres serwera WINS]
Należy tu wprowadzić adres IP serwera WINS.
● Jeśli adres IP serwera WINS jest uzyskiwany z serwera DHCP, jest on nadrzędny w stosunku do adresu IP
wprowadzonego w polu tekstowym [Adres serwera WINS].
[Zakres ID]
Jeśli podzielono sieć na kilka grup za pomocą identyfikatorów zakresu (czyli identyfikatorów grup urządzeń
znajdujących się w sieci), należy podać identyfikator zakresu dla komputera. Jeśli nie skonfigurowano
identyfikatora zakresu dla komputera, należy pozostawić to pole puste.
[Nazwa serwera SMB]
Podczas rejestracji urządzenia na serwerze WINS należy określić nazwę serwera, która ma być używana w
sieci SMB.
● Nie wolno używać spacji.
● Nazwa serwera ustawiona w opcji [Nazwa serwera] dostępnej pod pozycją [Ustawienia SMB] zostanie
automatycznie użyta jako [Nazwa serwera SMB], jeśli jest ona dostępna. Zmiana nazwy serwera
wprowadzona w opcji [Nazwa serwera SMB] zostanie zastosowana również do ustawienia [Nazwa serwera]
dostępnego pod pozycją [Ustawienia SMB].
[Nazwa grupy roboczej SMB ]
Podczas rejestracji urządzenia na serwerze WINS należy określić nazwę grupy roboczej, do której należy
urządzenie w sieci SMB.
194
Sieć
● Nie wolno używać spacji.
● Nazwa grupy roboczej ustawiona w opcji [Nazwa grupy roboczej] pod pozycją [Ustawienia SMB] zostanie
automatycznie zastosowana jako [Nazwa grupy roboczej SMB], jeśli jest dostępna. Zmiana nazwy grupy
roboczej wprowadzona w opcji [Nazwa grupy roboczej SMB] zostanie zastosowana również do ustawienia
[Nazwa grupy roboczej] pod pozycją [Ustawienia SMB].
6
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Wybieranie ustawień z panelu sterowania
● Ustawienia WINS można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
Rozpoznawanie WINS(P. 351)
ŁĄCZA
Konfiguracja protokołu SMB(P. 209)
195
Sieć
Konfiguracja protokołu SNTP
6869-02U
Protokół Simple Network Time Protocol (SNTP) umożliwia regulację zegara systemowego
za pomocą serwera czasu znajdującego się w sieci. W przypadku używania protokołu
SNTP system sprawdza okresowo serwer czasu, więc zegar systemowy jest zawsze
dokładny.
● Zastosowany dla urządzenia protokół SNTP obsługuje serwery NTP (wersja 3) i SNTP (wersje 3 i 4).
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
4
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia SNTP].
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
[Ustawienia TCP/IP].
196
Sieć
5
Zaznacz pole wyboru [Użyj SNTP] i podaj wymagane ustawienia.
[Użyj SNTP]
Należy zaznaczyć to pole, aby protokół SNTP był używany do synchronizacji. Aby protokół SNTP nie był
używany, należy usunąć zaznaczenie tego pola wyboru.
[Nazwa serwera NTP]
Należy tu wprowadzić adres IP serwera NTP lub SNTP. Jeśli w sieci włączono usługę DNS, zamiast tego można
wprowadzić wartość „<nazwa hosta>.<nazwa domeny>” składającą się ze znaków alfanumerycznych
(przykład: ntp.przyklad.com).
[Interwał odpytywania]
Umożliwia określenie odstępu czasu między jedną synchronizacją a kolejną.
6
Kliknij [OK].
7
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
197
Sieć
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Sprawdzanie komunikacji z serwerem NTP/SNTP
● Status komunikacji z zarejestrowanym serwerem można wyświetlić, klikając [Ustawienia/Rejestracja]
[Sieć] [Ustawienia TCP/IP], a następnie klikając przycisk [Sprawdź połączenie serwera NTP] w wyświetlonej
sekcji [Ustawienia SNTP]. W przypadku prawidłowego połączenia wyświetlony wynik będzie podobny do
przedstawionego poniżej. Należy pamiętać, że ta czynność nie zmienia ustawień zegara systemowego.
Wybieranie ustawień z panelu sterowania
● Ustawienia SNTP można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
SNTP(P. 356)
198
Sieć
Monitorowanie i kontrolowanie urządzenia za pomocą
protokołu SNMP
6869-02W
Protokół Simple Network Management Protocol (SNMP) umożliwia monitorowanie i kontrolowanie urządzeń
komunikacyjnych znajdujących się w sieci za pomocą bazy informacji zarządzania (MIB). Urządzenie obsługuje protokół
SNMPv1 i protokół SNMPv3 z rozszerzeniami zabezpieczeń. Stan urządzenia można sprawdzić z poziomu komputera
podczas drukowania dokumentów lub za pomocą Zdalnego interfejsu użytkownika. Możliwe jest włączenie protokołu
SNMPv1 lub SNMPv3 albo obu tych protokołów naraz. Należy określić ustawienia każdej wersji zgodnie ze
środowiskiem sieciowym i przeznaczeniem.
SNMPv1
Protokół SNMPv1 korzysta z informacji nazywanych „społecznością” w celu określenia zakresu komunikacji
SNMP. Ponieważ informacje te są przekazywane do sieci w formie zwykłego tekstu, sieć będzie podatna na ataki.
Aby zapewnić bezpieczeństwo sieci, należy wyłączyć protokół SNMPv1 i korzystać z protokołu SNMPv3.
SNMPv3
Protokół SNMPv3 umożliwia wdrożenie zarządzania urządzeniami sieciowymi chronionego wydajnymi funkcjami
zabezpieczeń. Przed konfiguracją protokołu SNMPv3 należy włączyć szyfrowanie PLS dla Zdalnego interfejsu
użytkownika ( Korzystanie z protokołu TLS do komunikacji szyfrowanej(P. 265) ).
● Urządzenie nie obsługuje funkcji powiadamiania pułapki SNMP.
● Zainstalowanie na komputerze lub w sieci oprogramowania do zarządzania SNMP umożliwia zdalną
konfigurację, monitorowanie i kontrolę urządzenia z poziomu komputera. Więcej informacji znajduje się w
podręcznikach użytkownika oprogramowania do zarządzania.
1
2
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
199
Sieć
3
Kliknij [Sieć]
4
Kliknij [Edytuj].
5
Określ ustawienia protokołu SNMPv1.
[Ustawienia SNMP].
● Jeśli nie trzeba zmieniać ustawień SNMPv1, przejdź do kolejnego kroku.
200
Sieć
[Użyj SNMPv1]
Zaznaczenie tego pola wyboru umożliwi włączenie protokołu SNMPv1. Pozostałe ustawienia protokołu
SNMPv1 można skonfigurować tylko po zaznaczeniu tego pola wyboru.
[Użyj nazwy społeczności 1]/[Użyj nazwy społeczności 2]
Zaznaczenie tego pola umożliwia określenie nazwy społeczności. Jeśli podanie nazwy społeczności nie jest
konieczne, należy usunąć zaznaczenie tego pola wyboru.
[Nazwa społeczności 1]/[Nazwa społeczności 2]
Należy wpisać nazwę społeczności składającą się ze znaków alfanumerycznych.
[Prawa dostępu do MIB]
Dla każdej społeczności wybierz opcję [Odczyt/Zapis] lub [Tylko do odczytu] określającą przywileje dostępu do
obiektów menedżera MIB.
[Odczyt/Zapis]
Zezwolenie na wyświetlanie i zmienianie wartości obiektów menedżera MIB.
[Tylko do odczytu]
Zezwolenie tylko na wyświetlanie wartości obiektów menedżera MIB.
[Społeczność dedykowana]
Społeczność dedykowana jest wstępnie ustawioną społecznością przeznaczoną tylko do użytku przez
administratorów korzystających z oprogramowania firmy Canon, takiego jak iW Management Console.
Wybierz opcję [Wyłącz], [Odczyt/Zapis] lub [Tylko do odczytu] określającą uprawienia dostępu do obiektów
menedżera MIB.
6
[Wyłącz]
Społeczność dedykowana nie będzie używana.
[Odczyt/Zapis]
Zezwolenie na wyświetlanie i zmienianie wartości obiektów menedżera MIB za
pomocą społeczności dedykowanej.
[Tylko do odczytu]
Zezwolenie tylko na wyświetlanie wartości obiektów menedżera MIB za pomocą
społeczności dedykowanej.
Określ ustawienia protokołu SNMPv3.
● Jeśli nie trzeba zmieniać ustawień SNMPv3, przejdź do kolejnego kroku.
201
Sieć
[Użyj SNMPv3]
Zaznaczenie tego pola wyboru umożliwi włączenie protokołu SNMPv3. Skonfigurowanie pozostałych ustawień
protokołu SNMPv3 jest możliwe tylko po zaznaczeniu tego pola wyboru.
[Odblokuj użytkownika]
Zaznacz to pole wyboru, aby włączyć ustawienia od [Ustawienia użytkownika 1] do [Ustawienia użytkownika
5]. Aby wyłączyć ustawienia użytkownika, wyczyść odpowiadające im pole wyboru.
[Nazwa użytkownika]
Wprowadź nazwę użytkownika składającą się ze znaków alfanumerycznych.
[Prawa dostępu do MIB]
Wybierz opcję [Odczyt/Zapis] lub [Tylko do odczytu] określającą uprawnienia dostępu do obiektów
menedżera MIB.
[Odczyt/Zapis]
Zezwolenie na wyświetlanie i zmienianie wartości obiektów menedżera MIB.
[Tylko do odczytu]
Zezwolenie tylko na wyświetlanie wartości obiektów menedżera MIB.
[Ustawienia zabezpieczeń]
Należy wybrać opcję [Uwierzytelnianie tak/Szyfrowanie tak], [Uwierzytelnianie tak/Szyfrowanie nie] lub
[Uwierzytelnianie nie/Szyfrowanie nie] określającą wybraną kombinację ustawień uwierzytelniania i
szyfrowania.
[Algorytm uwierzytelniania]
Należy kliknąć pozycję [Uwierzytelnianie tak/Szyfrowanie tak] lub [Uwierzytelnianie tak/Szyfrowanie nie] dla
ustawienia [Ustawienia zabezpieczeń], odpowiednio do algorytmu zastosowanego w środowisku sieciowym.
[Algorytm szyfrowania]
Należy kliknąć pozycję [Uwierzytelnianie tak/Szyfrowanie tak] dla ustawienia [Ustawienia zabezpieczeń],
odpowiednio do algorytmu zastosowanego w środowisku sieciowym.
[Ustaw/Zmień hasło]
Aby określić lub zmienić hasło, należy zaznaczyć pole wyboru i wprowadzić hasło złożone ze znaków
alfanumerycznych w polu tekstowym [Hasło uwierzytelniania] lub [Hasło szyfrowania]. W celu potwierdzenia
należy wprowadzić to samo hasło w polu tekstowym [Potwierdź]. Możliwe jest ustalenie różnych haseł dla
algorytmów uwierzytelniania i szyfrowania.
202
Sieć
[Nazwa kontekstu 1] do [Nazwa kontekstu 5]
Należy tu wprowadzić nazwę kontekstu składającą się ze znaków alfanumerycznych.
7
Określ ustawienia pozyskiwania informacji o zarządzaniu drukarką.
● Dzięki protokołowi SNMP informacje o zarządzaniu drukarką, takie jak protokoły drukowania oraz porty
drukarki, można monitorować i regularnie pozyskiwać z komputera podłączonego do sieci.
[Pozyskaj informacje o zarządzaniu drukarką z hosta]
Zaznaczenie tego pola wyboru umożliwia włączenie monitorowania informacji o zarządzaniu drukarką na
urządzeniu za pośrednictwem protokołu SNMP. Aby wyłączyć monitorowanie informacji o zarządzaniu
drukarką, należy usunąć zaznaczenie tego pola wyboru.
[Odrzuć pakiety SNMP w trybie uśpienia]
Należy zaznaczyć to pole wyboru, aby w trybie uśpienia odebrane pakiety SNMP były odrzucane. Aby nie
odrzucać pakietów, należy usunąć zaznaczenie tego pola.
● Zaznaczenie tego pola wyboru spowoduje, że aplikacje korzystające z protokołu SNMP, takie jak aplikacje z
serii oprogramowania imageWARE firmy Canon, mogą być wyłączone w celu umożliwienia dostępu do
urządzenia.
8
Kliknij [OK].
9
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
203
Sieć
Wyłączanie protokołu SNMPv1
● Jeśli zostanie wyłączona obsługa protokołu SNMPv1, niektóre funkcje urządzenia, takie jak uzyskiwanie
informacji o urządzeniu za pośrednictwem sterownika drukarki, nie będą dostępne.
Korzystanie z panelu sterowania
● Do ustawień SNMP można przejść również z poziomu menu ustawień panelu roboczego.
SNMP(P. 360)
Ustawienia
Włączanie zarówno protokołu SNMPv1, jak i SNMPv3
● Jeśli włączone są obie wersje protokołu SNMP, zalecane jest wybranie w ustawieniach uprawnień dostępu do
obiektów menedżera MIB dla protokołu SNMPv1 opcji [Tylko do odczytu]. Uprawnienia dostępu do obiektów
menedżera MIB dla protokołów SNMPv1 i SNMPv3 można ustalać oddzielnie (a także osobno dla każdego
użytkownika w przypadku protokołu SNMPv3). Wybranie opcji [Odczyt/Zapis] (uprawnienie pełnego dostępu)
dla protokołu SNMPv1 anuluje wydajne funkcje zabezpieczeń protokołu SNMPv3, ponieważ większością
ustawień urządzenia można wtedy zarządzać za pomocą protokołu SNMPv1.
ŁĄCZA
Korzystanie z protokołu TLS do komunikacji szyfrowanej(P. 265)
204
Sieć
Konfiguracja ustawień oprogramowania zarządzania
urządzeniami
6869-02X
Można usprawnić proces pozyskiwania różnych informacji o urządzeniach sieciowych i zarządzania nimi dzięki
wykorzystaniu w sieci oprogramowania do zarządzania urządzeniami, np. iW Management Console. Informacje takie
jak ustawienia urządzeń oraz dzienniki błędów są pobierane i rozpowszechniane za pośrednictwem serwera. Jeśli
urządzenie jest podłączone do tego typu sieci, program iW Management Console przeszukuje sieć w poszukiwaniu
urządzenia za pomocą protokołów, takich jak Service Location Protocol (SLP), w celu pobrania od niego informacji np. o
stanie zasilania. Konfigurację ustawień protokołu SLP można przeprowadzić za pomocą zdalnego interfejsu
użytkownika.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
4
Określ ustawienia protokołu SLP.
[Ustawienia TCP/IP].
Konfiguracja odnajdowania urządzeń z multiemisją
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia Multicast Discovery].
205
Sieć
2
Zaznacz pole wyboru [Odpowiedz do discovery] i podaj wymagane ustawienia.
[Odpowiedz do discovery]
Zaznaczenie tego pola wyboru umożliwia skonfigurowanie urządzenia tak, aby odpowiadało na pakiety
wyszukiwania metodą multiemisji programu do zarządzania urządzeniami oraz włączenie monitorowania
za pomocą programu do zarządzania urządzeniami. Aby urządzenie nie odpowiadało, należy usunąć
zaznaczenie tego pola wyboru.
[Nazwa zakresu]
Aby uwzględnić urządzenie w określonym zakresie, należy wprowadzić w tym polu nazwę zakresu.
3
Kliknij [OK].
Powiadamianie oprogramowania do zarządzania urządzeniami o stanie zasilania
urządzenia
1
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia powiadomienia trybu uśpienia].
2
Zaznacz pole wyboru [Powiadom] i podaj wymagane ustawienia.
206
Sieć
[Powiadom]
Zaznaczenie tego pola wyboru umożliwia powiadamianie oprogramowania do zarządzania urządzeniami
o stanie zasilania urządzenia. Zaznaczenie opcji [Powiadom] pozwala na uniknięcie nawiązywania przez
urządzenie zbędnej komunikacji w trybie uśpienia i zmniejszenie całkowitego zużycia energii.
[Numer portu]
Numer portu tej funkcji należy zmienić w zależności od środowiska sieciowego.
[Liczba ruterów do przejścia]
Należy określić liczbę routerów, przez które mogą przejść pakiety powiadomień.
[Interwał powiadomienia]
Pozwala na określenie, jak często urządzenie ma powiadamiać oprogramowanie do zarządzania
urządzeniami o stanie zasilania.
3
5
Kliknij [OK].
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Korzystanie z panelu sterowania
● Odpowiedź wyszukiwania można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
Odpowiedź Discovery(P. 357)
● Do ustawień powiadomień o stanie zasilania można przejść również z poziomu menu ustawień panelu
roboczego. Ust. powiad. o uśp.(P. 357)
ŁĄCZA
207
Sieć
Przechodzenie w tryb uśpienia(P. 68)
208
Sieć
Konfiguracja protokołu SMB
6869-02Y
Blok komunikatów serwera (SMB) to protokół umożliwiający udostępnianie zasobów, takich jak pliki i drukarki, kilku
urządzeniom w sieci. Jest on używany także do rejestrowania urządzenia jako drukarki udostępnionej w sieci SMB.
● Protokół SMB obsługuje wyłącznie szyfrowanie NetBIOS na TCP/IP i nie obsługuje NetBEUI. Przed
skonfigurowaniem ustawień protokołu SMB należy skonfigurować adres IP. Konfiguracja adresu
IP(P. 155)
● Protokół SMB jest włączony tylko wówczas, gdy w urządzeniu zainstalowana jest opcjonalna karta SD.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
[Ustawienia SMB].
209
Sieć
4
Kliknij [Edytuj].
5
Zaznacz pole wyboru [Użyj serwera SMB] i podaj wymagane ustawienia.
[Użyj serwera SMB]
Zaznaczenie tego pola wyboru spowoduje, że komputer będzie wskazany jako serwer SMB w sieci SMB.
[Nazwa serwera]
Należy tu określić nazwę serwera, która będzie wyświetlana w sieci SMB. Nazwa ta musi być inna niż nazwy
pozostałych komputerów i drukarek w sieci.
● Nie wolno używać spacji.
● Nazwa serwera ustawiona w opcji [Nazwa serwera SMB] dostępnej pod pozycją [Konfiguracja WINS]
zostanie automatycznie użyta jako [Nazwa serwera], jeśli jest ona dostępna. Zmiana nazwy serwera
wprowadzona w opcji [Nazwa serwera] zostanie zastosowana również do ustawienia [Nazwa serwera SMB]
dostępnego pod pozycją [Konfiguracja WINS].
[Nazwa grupy roboczej]
Należy tu wprowadzić nazwę grupy roboczej, do której należy urządzenie. Jeśli w środowisku sieciowym nie
ma żadnej grupy roboczej, należy utworzyć grupę roboczą w systemie Windows i wprowadź jej nazwę.
● Nie wolno używać spacji.
● Nazwa grupy roboczej ustawiona w opcji [Nazwa grupy roboczej SMB] dostępnej pod pozycją [Konfiguracja
WINS] zostanie automatycznie użyta jako [Nazwa grupy roboczej], jeśli jest ona dostępna. Zmiana nazwy
210
Sieć
serwera wprowadzona w opcji [Nazwa grupy roboczej] zostanie zastosowana również do ustawienia
[Nazwa grupy roboczej SMB] dostępnego pod pozycją [Konfiguracja WINS].
[Komentarze]
Umożliwia wprowadzenie komentarzy dotyczących urządzenia stosownie do potrzeb.
[Użyj LM Announce]
To pole wyboru należy zaznaczyć, aby powiadomić menedżera sieci LAN o istnieniu urządzenia. Jeśli nie ma
potrzeb powiadamiania, zależy usunąć zaznaczenie tego pola, aby ograniczyć obciążenie sieci.
[Użyj wydruku SMB]
To pole wyboru należy zaznaczyć w przypadku korzystania z drukowania SMB na urządzeniu.
[Nazwa drukarki]
Należy tu wprowadzić nazwę urządzenia.
● Nie wolno używać spacji.
6
Kliknij [OK].
7
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
»
Przejdź do rozdziału
Konfiguracja ustawień drukowania na komputerze(P. 212) .
Korzystanie z panelu sterowania
● Sewer SMB można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
SMB(P. 359)
● Drukowanie SMB można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
SMB(P. 359)
ŁĄCZA
Konfiguracja usługi WINS(P. 193)
211
Sieć
Konfiguracja ustawień drukowania na komputerze
6869-030
Na komputerze należy skonfigurować ustawienia połączenia i zainstalować sterownik drukarki, aby umożliwić
drukowanie z komputera za pomocą urządzenia poprzez sieć SMB.
Łączenie z siecią SMB(P. 212)
Instalowanie sterownika drukarki(P. 213)
Łączenie z siecią SMB
1
Wyświetl okno [Właściwości połączenia sieci lokalnej].
2
Zaznacz pole wyboru [Klient sieci Microsoft Networks].
3
4
Zaznacz pole wyboru [Protokół internetowy w wersji 4 (TCP/IPv4)] lub [Protokół
internetowy] i kliknij przycisk [Właściwości].
Kliknij kartę [Ogólne]
[Zaawansowane].
212
Sieć
5
Kliknij kartę [WINS], wybierz opcję [Włącz system NetBIOS przez TCP/IP], a następnie
6
Klikaj przycisk [OK], aż zamkniesz wszystkie okna dialogowe.
kliknij przycisk [OK].
● Jeśli zostanie wyświetlony monit o ponowne uruchomienie komputera, uruchom go ponownie.
Instalowanie sterownika drukarki
Więcej informacji na temat instalacji znajduje się w instrukcjach obsługi odpowiednich sterowników dostępnych na
stronie z podręcznikami internetowymi.
W trakcie instalacji wyświetla się ekran wyboru portu
● Należy wykonać poniższą procedurę.
1
Kliknij [Dodaj port].
2
Wybierz pozycję [Sieć] i kliknij przycisk [OK].
213
Sieć
3
Wybierz z listy nazwę grupy roboczej, nazwę serwera oraz nazwę drukarki zdefiniowane
uprzednio w ustawieniach protokołu SMB. Konfiguracja protokołu SMB(P. 209)
214
Zabezpieczenia
Zabezpieczenia
Zabezpieczenia ................................................................................................................................................ 216
Ochrona urządzenia przed nieupoważnionym dostępem .............................................................................. 217
Zapobieganie nieupoważnionemu dostępowi .............................................................................................. 218
Ustawienia uprawnień dostępu .................................................................................................................... 220
Ustawianie hasła menedżera systemu ................................................................................................... 221
Konfiguracja funkcji Zarządzanie identyfikatorami wydziałów ............................................................... 224
Ustawiania kodu PIN Zdalnego interfejsu użytkownika ......................................................................... 232
Ograniczenie komunikacji za pomocą zapory ............................................................................................... 234
Określanie adresów IP dla zasad zapory ................................................................................................ 235
Określanie adresów MAC dla zasad zapory ............................................................................................ 241
Ustawienia proxy .......................................................................................................................................... 245
Ograniczanie funkcji urządzenia ...................................................................................................................... 248
Ograniczanie funkcji drukowania ................................................................................................................. 249
Ograniczenie funkcji USB .............................................................................................................................. 252
Ograniczanie funkcji panelu roboczego ........................................................................................................ 255
Wyłączanie komunikacji z użyciem protokołu HTTP ...................................................................................... 258
Wyłączanie Zdalnego interfejsu użytkownika ............................................................................................... 259
Wyłączanie portu LAN ................................................................................................................................... 260
Ukrywanie historii zadań drukowania ........................................................................................................... 261
Wprowadzenie wydajnych funkcji zabezpieczeń ............................................................................................. 263
Korzystanie z protokołu TLS do komunikacji szyfrowanej ............................................................................. 265
Konfiguracja ustawień protokołu IPSec ........................................................................................................ 269
Konfiguracja uwierzytelniania zgodnego z IEEE 802.1X ................................................................................ 279
Konfiguracja ustawień dla par kluczy i certyfikatów cyfrowych ..................................................................... 284
Generowanie par kluczy ......................................................................................................................... 285
Używanie wygenerowanych przez CA par kluczy i certyfikatów cyfrowych ............................................. 293
Weryfikowanie par kluczy i certyfikatów cyfrowych ................................................................................ 296
215
Zabezpieczenia
Zabezpieczenia
6869-031
Urządzenia informatyczne, w tym komputery i drukarki, obsługują szeroki zakres informacji poufnych. Mogą one w
każdej chwili stać się celem szkodliwych działań osób trzecich. W ten sposób osoby te mogą bezpośrednio uzyskać
nieupoważniony dostęp do urządzeń lub pośrednio wykorzystywać zaniedbania i nieprawidłowe użytkowanie.
Niezależnie od metody takie działania mogą prowadzić do powstania nieoczekiwanych szkód w momencie wycieku
informacji poufnych. Aby przeciwdziałać takim zagrożeniom, urządzanie zostało wyposażone w różne funkcje
zabezpieczające. Niezbędne ustawienia należy skonfigurować w zależności od środowiska sieciowego.
● Aby zapewnić jak największe bezpieczeństwo systemu, należy stworzyć środowisko z zablokowanym
dostępem z Internetu do drukarek w sieci wewnętrznej. Taką konfigurację środowiska należy połączyć z
zabezpieczeniami urządzenia. Zapobieganie nieupoważnionemu dostępowi(P. 218)
◼ Ustanowienie podstawowych zabezpieczeń informacji
Ochrona urządzenia przed nieupoważnionym dostępem(P. 217)
◼ Przygotowanie na zagrożenia wynikające z zaniedbania lub nieprawidłowego użytkowania
Ograniczanie funkcji urządzenia(P. 248)
Drukowanie dokumentu zabezpieczonego kodem PIN
(Zabezpieczone drukowanie)(P. 95)
◼ Wprowadzenie wydajnych funkcji zabezpieczeń
Wprowadzenie wydajnych funkcji zabezpieczeń(P. 263)
216
Zabezpieczenia
Ochrona urządzenia przed nieupoważnionym dostępem
6869-032
Urządzenie należy zabezpieczyć przed użytkowaniem i dostępem nieupoważnionych osób trzecich. Dostępne są różne
środki zabezpieczające, takie jak zarządzanie uprawnieniami dostępu użytkowników i stosowanie zapór.
217
Zabezpieczenia
Zapobieganie nieupoważnionemu dostępowi
6869-033
W tej części opisano środki bezpieczeństwa mające na celu zapobieganie nieupoważnionemu dostępowi z sieci
zewnętrznej. Z informacjami tymi powinni zapoznać się wszyscy użytkownicy i administratorzy przed rozpoczęciem
korzystania z tego urządzenia, innych drukarek i urządzeń wielofunkcyjnych podłączonych do sieci. W ostatnich latach
drukarki i urządzenia wielofunkcyjne podłączone do sieci zaczęły oferować coraz więcej funkcji, w tym drukowanie z
komputera, zdalną obsługę urządzenia z komputera czy wysyłanie zeskanowanych dokumentów za pośrednictwem
Internetu. Z drugiej strony konieczne jest zabezpieczenie urządzenia, aby zminimalizować zagrożenia związane z
wyciekiem informacji — drukarki i urządzenia wielofunkcyjne podłączone do sieci są źródłem zagrożeń, takich jak
nieupoważniony dostęp i kradzież danych. W tej części opisano ustawienia, które należy skonfigurować przed
rozpoczęciem korzystania z drukarki/urządzenia wielofunkcyjnego podłączonego do sieci, aby zapobiec
nieupoważnionemu dostępowi.
Środki bezpieczeństwa mające na celu zapobieganie nieupoważnionemu dostępowi z
sieci zewnętrznej
Przypisywanie prywatnego adresu IP(P. 218)
Ograniczania transmisji danych przy użyciu zapory(P. 219)
Wybór komunikacji szyfrowanej TLS (P. 219)
Konfiguracja kodu PIN do zarządzania danymi przechowanymi w pamięci urządzenia
wielofunkcyjnego(P. 219)
Przypisywanie prywatnego adresu IP
Adres IP to numeryczny opis przypisany do każdego urządzenia podłączonego do sieci komputerowej. „Globalny adres
IP” jest wykorzystywany do komunikacji z Internetem, „prywatny adres IP” jest wykorzystywany do komunikacji w
ramach lokalnej sieci, na przykład sieci LAN w firmie. Jeśli drukarka/urządzenie wielofunkcyjne ma przypisany globalny
adres IP, oznacza to, że do urządzenia można uzyskać dostęp poprzez Internet z dowolnego miejsca. W efekcie rośnie
ryzyko wycieku informacji w wyniku nieupoważnionego dostępu z zewnętrznej sieci. Z drugiej strony przypisanie
prywatnego adresu IP do drukarki/urządzenia wielofunkcyjnego ogranicza powoduje ograniczenie dostępu do sieci
lokalnej — dostęp do urządzenia mają tylko użytkownicy z sieci lokalnej, na przykład sieci LAN w firmie.
Globalny adres IP
Prywatny adres IP
Dostęp do niego mają użytkownicy z sieci lokalnej Dostęp do niego mają użytkownicy z sieci lokalnej
Upraszczając — przypisz prywatny adres IP do drukarki/urządzenia wielofunkcyjnego. Upewnij się, że przypisywany
adres IP jest adresem prywatnym. Prywatne adresy IP znajdują się w jednym z następujących zakresów.
Zakresy prywatnych adresów IP
● Od 10.0.0.0 do 10.255.255.255
● Od 172.16.0.0 do 172.31.255.255
● Od 192.168.0.0 do 192.168.255.255
Aby uzyskać więcej informacji na temat potwierdzania adresu IP, patrz
218
Konfiguracja adresu IP(P. 155) .
Zabezpieczenia
● Jeśli drukarce/urządzeniu wielofunkcyjnemu przypisano globalny adres IP, można utworzyć środowisko
sieciowe o zmniejszonym ryzyku nieupoważnionego dostępu poprzez zainstalowanie oprogramowania
zabezpieczającego (na przykład zapory), które zapobiega dostępowi z sieci zewnętrznych. Aby przypisać do
drukarki/urządzenia wielofunkcyjnego globalny adres IP i móc z niej korzystać, należy skontaktować się z
administratorem sieci.
Ograniczania transmisji danych przy użyciu zapory
Zapora to system, który zapobiega nieupoważnionemu dostępowi z sieci zewnętrznych i chroni przed atakami i
włamaniami do sieci lokalnej. Dzięki zaporze w środowisku sieciowym można blokować dostęp z sieci z potencjalnie
niebezpiecznych sieci zewnętrznych, ograniczając komunikację pochodzącą z określonego adresu IP sieci zewnętrznej.
Funkcje dostępne w drukarce/urządzeniu wielofunkcyjnym firmy Canon pozwalają skonfigurować filtr adresów IP.
Informacje dotyczące sposobu konfiguracji filtra adresów IP można znaleźć w części Określanie adresów IP dla
zasad zapory(P. 235) .
Wybór komunikacji szyfrowanej TLS
Informacje dotyczące komunikacji szyfrowanej z użyciem protokołu TLS można znaleźć w części Wprowadzenie
wydajnych funkcji zabezpieczeń(P. 263) , informacje dotyczące procedur — w części Korzystanie z protokołu TLS
do komunikacji szyfrowanej(P. 265) .
Konfiguracja kodu PIN do zarządzania danymi przechowanymi w pamięci
urządzenia wielofunkcyjnego
Ustawienie kodu PIN dla informacji przechowywanych w urządzeniu pozwala ograniczyć ryzyko wycieku informacji w
przypadku uzyskania dostępu do drukarki/urządzenia wielofunkcyjnego przez nieautoryzowanego złośliwego
użytkownika.
Ustawianie kodu PIN dla każdej z funkcji
● Ustawianie kodu PIN dostępu do Zdalnego interfejsu użytkownika
Więcej informacji znajduje się w rozdziale Ustawiania kodu PIN Zdalnego interfejsu
użytkownika(P. 232) .
● Ustawianie kodu PIN dostępu do ustawień menedżera systemu
Więcej informacji znajduje się w rozdziale
Ustawianie hasła menedżera systemu(P. 221) .
Wymienione powyżej środki bezpieczeństwa to tylko przykłady zabezpieczeń przed nieupoważnionym dostępem.
Więcej informacji dotyczących innych środków bezpieczeństwa można znaleźć w części
Zabezpieczenia(P. 216) .
Należy zapoznać się z tymi informacjami i podjąć odpowiednie kroki, zależnie od środowiska.
219
Zabezpieczenia
Ustawienia uprawnień dostępu
6869-034
Urządzenie można zabezpieczać przed nieupoważnionych dostępem, zezwalając na obsługę wyłącznie przez
użytkowników z uprawnieniami dostępu. Uprawnienia dostępu można ustawiać osobno menedżera systemu, konta o
nazwie „Identyfikator wydziału” i Zdalnego interfejsu użytkownika. Po ustawieniu uprawnień użytkownik musi podać
identyfikator i kod PIN, aby móc drukować lub zmieniać ustawienia.
Hasło menedżera systemu jest przeznaczone wyłącznie dla administratorów, natomiast hasło Identyfikator wydziału
dla użytkowników. Wykorzystanie zdalnego interfejsu użytkownika można ograniczyć przez ustawienie kodu dostępu
PIN do zdalnego interfejsu użytkownika.
Hasło menedżera systemu
Do określenia ustawień urządzenia za pomocą Zdalnego interfejsu użytkownika konieczne jest hasło menedżera
systemu. Hasło domyślne to „7654321” i można je zmienić, tak aby ustawienia mogli zmieniać wyłącznie
konkretni administratorzy.
Ustawianie hasła menedżera systemu(P. 221)
Identyfikator wydziału (Zarządzanie ID wydziału)
Identyfikator wydziału to konto przeznaczone do zarządzania zadaniami drukowania. Można zarejestrować
wiele identyfikatorów wydziałów, aby określić różne uprawnienia dostępu dla użytkowników (lub grup
użytkowników). Jeśli użytkownik podejmie próbę wydrukowania dokumentu, gdy Identyfikator wydziału jest
aktywny, wówczas zostanie wyświetlony ekran wprowadzania identyfikatora wydziału, a użytkownik będzie
musiał wprowadzić swój identyfikator wydziału. Istnieje możliwość przeglądania informacji związanych z
identyfikatorem wydziału, takich jak liczba wydrukowanych stron.
Konfiguracja funkcji Zarządzanie identyfikatorami wydziałów(P. 224)
Kod PIN Zdalnego interfejsu użytkownika (Kod PIN dostępu do Zdalnego interfejsu
użytkownika)
Ten kod PIN pozwala korzystać ze Zdalnego interfejsu użytkownika. Tylko użytkownicy znający kod PIN mogą
uzyskać dostęp do Zdalnego interfejsu użytkownika.
Ustawiania kodu PIN Zdalnego interfejsu użytkownika(P. 232)
220
Zabezpieczenia
Ustawianie hasła menedżera systemu
6869-035
Do zmiany ustawień skonfigurowanych dla urządzenia z poziomu Zdalnego interfejsu użytkownika konieczne są
uprawnienia administratora. Aby zmienić hasło menedżera systemu, należy wykonać opisaną poniżej procedurę.
Informacje dotyczące ustawiania hasła menedżera systemu mają krytyczne znaczenie dla bezpieczeństwa urządzenia,
dlatego należy się upewnić, że hasło menedżera systemu znają wyłącznie administratorzy.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij [Edytuj].
[Ustawienia zarządzania].
221
Zabezpieczenia
5
Wprowadź bieżące hasło w polu [Aktualne hasło menedżera systemu].
● Hasło domyślne to „7654321”.
6
Wprowadź nowe hasło.
[Ustaw/Zmień hasło]
Aby określić lub zmienić hasło, należy zaznaczyć pole wyboru i wprowadzić złożone ze znaków
alfanumerycznych hasło w polu tekstowym [Hasło]. W celu potwierdzenia należy wprowadzić to samo hasło w
polu tekstowym [Potwierdź].
● Kliknięcie opcji [OK], gdy to pole wyboru jest zaznaczone, a pola wyboru [Hasło] i [Potwierdź] są puste,
spowoduje usunięcie aktualnie ustawionego hasła.
7
Wprowadź nazwę i dane kontaktowe menedżera systemu według potrzeb i kliknij
[OK].
222
Zabezpieczenia
[Menadżer systemu]
Należy tu wprowadzić nazwę administratora.
[Informacje kontaktowe]
Należy tu wprowadzić dane kontaktowe administratora.
[Adres E-Mail]
Należy tu wprowadzić adres e-mail administratora złożony ze znaków alfanumerycznych.
[Uwagi menadżera systemu]
Należy tu wprowadzić uwagi od administratora.
● Należy zapamiętać hasło, które zostało ustawione. W przypadku zapomnienia hasła należy skontaktować się
z autoryzowanym sprzedawcą produktów firmy Canon lub z działem telefonicznej pomocy technicznej firmy
Canon.
ŁĄCZA
Ustawienia uprawnień dostępu(P. 220)
Sprawdzanie informacji o menedżerze systemu(P. 312)
223
Zabezpieczenia
Konfiguracja funkcji Zarządzanie identyfikatorami
wydziałów
6869-036
W przypadku wielu użytkowników lub grup istnieje możliwość kontroli dostępu do urządzenia przy użyciu wielu
identyfikatorów. Gdy użytkownik przystępuje do obsługi urządzenia z włączoną funkcją Zarządzanie identyfikatorami
wydziałów, wyświetla się ekran logowania, na którym należy wprowadzić odpowiedni identyfikator wydziału oraz kod
PIN, aby móc korzystać z urządzenia. Funkcja Zarządzanie identyfikatorami wydziałów umożliwia rejestrowanie
wykorzystywanych funkcji urządzenia dla każdego identyfikatora wydziału. Aby skonfigurować funkcję Zarządzanie
identyfikatorami wydziałów, należy zarejestrować identyfikatory zgodnie z wymaganiami, a następnie włączyć funkcję
Zarządzanie identyfikatorami wydziałów. Aby włączyć tę funkcję w przypadku drukowania z komputera, konieczna jest
konfiguracja dodatkowych ustawień.
Rejestrowanie/edytowanie identyfikatora wydziału i kodu PIN(P. 224)
Włączanie funkcji Zarządzanie identyfikatorami wydziałów(P. 226)
Ustawianie funkcji Zarządzanie identyfikatorami wydziałów do drukowania z komputera(P. 228)
Blokowanie zadań w przypadku nieznanego identyfikatora wydziału(P. 230)
Zarządzanie stanem wydruku dla każdego wydziału
Sprawdzanie liczby wydrukowanych stron dla każdego wydziału(P. 551)
Rejestrowanie/edytowanie identyfikatora wydziału i kodu PIN
Rejestrowanie identyfikatora wydziału i ustawienie dla niego kodu PIN. Zarejestruj wszystkie identyfikatory wydziału,
którymi chcesz zarządzać.
1
2
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
224
Zabezpieczenia
3
Kliknij przycisk [Zarządzanie ID wydziału] i zarejestruj identyfikatory wydziałów lub
przeprowadź ich edycję.
Rejestracja identyfikatora wydziału
1
Kliknij [Zarejestruj nowy wydział].
2
Podaj wymagane ustawienia i kliknij przycisk [OK].
[ID wydziału]
Wprowadź identyfikator wydziału (cyfry), który ma zostać zarejestrowany.
[Ustaw PIN]
Aby ustawić kod PIN, zaznacz odpowiednie pole wyboru i wprowadź ten sam ciąg cyfr w polach
tekstowych [PIN] i [Potwierdź].
225
Zabezpieczenia
Edycja ustawień zarejestrowanego identyfikatora wydziału
1
Aby dokonać edycji, kliknij odpowiednie łącze tekstowe pod pozycją [ID wydziału].
2
Zmień ustawienia według potrzeb i kliknij przycisk [OK].
Usuwanie identyfikatora wydziału
● Kliknij przycisk [Usuń] znajdujący się po prawej stronie identyfikatora wydziału, który chcesz
usunąć kliknij przycisk [OK].
Włączanie funkcji Zarządzanie identyfikatorami wydziałów
Po zarejestrowaniu wymaganej liczby identyfikatorów wydziału włącz funkcję Zarządzanie identyfikatorami wydziałów.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zarządzanie ID wydziału]
4
Zaznacz pole [Odbloku zarządzanie ID wydziału] i kliknij przycisk [OK].
[Ustawienia].
226
Zabezpieczenia
[Odbloku zarządzanie ID wydziału]
Zaznacz pole wyboru, aby włączyć funkcję Zarządzanie identyfikatorami wydziałów. Jeśli nie chcesz korzystać z
funkcji Zarządzenie ID Wydziału, pole wyboru powinno pozostać puste.
● Informacje na temat pola wyboru [Akceptuj wydruk zadań z nieznanym ID] można znaleźć w sekcji
Blokowanie zadań w przypadku nieznanego identyfikatora wydziału(P. 230) .
Jeśli funkcja Zarządzanie identyfikatorami wydziałów jest włączona
● Gdy użytkownicy podejmują próbę wydrukowania pliku zapisanego na
urządzeniu pamięci USB lub dokumentu zapisanego na karcie SD z poziomu
panelu roboczego, zostaje wyświetlony ekran uwierzytelniania. Wówczas
należy wprowadzić Identyfikator wydziału oraz kod PIN, wybrać opcję <Zaloguj
się> i nacisnąć
.
● Aby zalogować się do Zdalnego interfejsu użytkownika w trybie użytkownika ogólnego, należy wprowadzić
Identyfikator wydziału oraz kod PIN. Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
◼ W przypadku korzystania ze sterownika drukarki XPS
Aby móc używać funkcji zarządzania identyfikatorami wydziałów podczas korzystania ze sterownika drukarki
XPS, należy ustawić pary kluczy dla komunikacji szyfrowanej TLS ( Korzystanie z protokołu TLS do
komunikacji szyfrowanej(P. 265) ). Po wprowadzeniu ustawień par kluczy, należy skonfigurować ustawienia
zaprezentowane poniżej.
Zaloguj się w Zdalnym interfejsie użytkownika w trybie zarządzania ( Uruchamianie Zdalnego
interfejsu użytkownika(P. 300) ) [Ustawienia/Rejestracja] [Sieć] [Ustawienia TCP/IP]
[Edytuj] w [Ustawienia potwierdzenia PIN zarządzania ID wydziału] Zaznacz pole wyboru [Użyj
potwierdzenia PIN zarządzania ID wydziału] [OK]
227
Zabezpieczenia
[Użyj potwierdzenia PIN zarządzania ID wydziału]
Po zaznaczeniu tego pola wyboru zarządzanie identyfikatorami wydziałów będzie włączone dla drukowania
za pomocą sterownika drukarki XPS. Aby nie korzystać z funkcji zarządzania identyfikatorami wydziałów,
należy usunąć zaznaczenie tego pola.
● Jeśli w urządzeniu nie ustawiono którejś z par kluczy, nie będzie można włączyć funkcji [Użyj potwierdzenia
PIN zarządzania ID wydziału]. Konfiguracja ustawień dla par kluczy i certyfikatów cyfrowych(P. 284)
Ustawianie funkcji Zarządzanie identyfikatorami wydziałów do drukowania z
komputera
Aby włączyć funkcję Zarządzanie identyfikatorami wydziałów do drukowania z komputera, należy określić ustawienia
przy użyciu sterownika drukarki, który został już zainstalowany na komputerze. Identyfikator wydziału i kod PIN należy
podać zgodnie z wymaganiami.
● Aby wykonać poniższą procedurę, należy zalogować się na komputerze na konto administratora.
1
2
Otwórz folder drukarki.
Wyświetlanie folderu Drukarki(P. 627)
Kliknij prawym przyciskiem myszy ikonę drukarki, a następnie kliknij pozycję
[Właściwości drukarki] lub [Właściwości].
228
Zabezpieczenia
3
Kliknij zakładkę [Ustawienia urządzenia] i określ wymagane ustawienia.
1
Wybierz opcję [Zarządzanie ID wydziału] w menu [Zarządzanie użytkownikami], a następnie kliknij opcję
[Ustawienia] znajdującą się poniżej.
2
Określ ustawienia według potrzeb i kliknij przycisk [OK].
[Zezwól na ustawienie kodu PIN]
Zaznacz to pole wyboru, aby włączyć funkcję kodu PIN.
[Identyfikator wydziału]
Wprowadź identyfikator wydziału (cyfry).
[PIN]
Wprowadź kod PIN odpowiadający identyfikatorowi wydziału.
[Sprawdź]
Kliknij tę pozycję, aby sprawdzić, czy wprowadzono prawidłowy identyfikator i kod PIN. Ta funkcja jest
niedostępna, jeżeli urządzenie jest podłączone do komputera za pośrednictwem portu USB lub WSD
(Web Services on Devices).
[Potwierdź identyfikator wydziału/kod PIN przy drukowaniu]
Zaznacz to pole wyboru, aby ekran podręczny [Potwierdź identyfikator wydziału/kod PIN] był
wyświetlany przy każdym drukowaniu z komputera.
[Uwierzytelnij identyfikator wydziału/kod PIN w urządzeniu]
Zaznacz to pole wyboru, jeżeli urządzenie jest połączone z komputerem za pośrednictwem portu USB
lub WSD.
3
Kliknij [OK].
229
Zabezpieczenia
Logowanie się na urządzeniu
● Jeżeli funkcja Zarządzanie identyfikatorem wydziału została włączona
podczas próby drukowania z komputera, zostanie wyświetlony
następujący ekran podręczny (chyba że pole wyboru [Potwierdź
identyfikator wydziału/kod PIN przy drukowaniu] jest niezaznaczone):
Blokowanie zadań w przypadku nieznanego identyfikatora wydziału
Domyślne ustawienia fabryczne są ustawione w taki sposób, że nawet gdy włączona jest funkcja Zarządzanie
identyfikatorami wydziałów, można drukować z komputera bez wprowadzania identyfikatora użytkownika i kodu PIN.
Aby to zmienić i umożliwić drukowanie tylko przy wprowadzeniu identyfikatora użytkownika i kodu PIN, należy
skorzystać z następującej procedury.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zarządzanie ID wydziału]
4
[Ustawienia].
Usuń zaznaczenie pola wyboru [Akceptuj wydruk zadań z nieznanym ID] i kliknij
przycisk [OK].
230
Zabezpieczenia
● Usunięcie zaznaczenia tego pola wyboru spowoduje, że użytkownicy nie będą mogli korzystać z metody
drukowania nieobsługiwanej przez funkcję zarządzania identyfikatorami wydziałów, ani wykonywać
wydruków bezpośrednich ze Zdalnego interfejsu użytkownika, do którego użytkownicy zalogują się w
trybie zarządzania.
ŁĄCZA
Ustawienia uprawnień dostępu(P. 220)
Ustawianie hasła menedżera systemu(P. 221)
231
Zabezpieczenia
Ustawiania kodu PIN Zdalnego interfejsu użytkownika
6869-037
Dostęp do Zdalnego interfejsu użytkownika można ograniczyć kodem PIN. Wszyscy użytkownicy korzystają z tego
samego kodu PIN.
● Jeśli włączono funkcję Zarządzanie identyfikatorami wydziałów, powyższe ustawienie nie jest wymagane.
Konfiguracja funkcji Zarządzanie identyfikatorami wydziałów(P. 224)
1
Naciśnij przycisk
2
Za pomocą przycisków
(
).
/
wybierz opcję <Sieć> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
3
Wybierz kolejno opcje <Ust. zdal. int. uż.>
4
Wybierz opcję <Włącz> i naciśnij przycisk
5
Ustaw kod PIN.
.
.
<Ust. bezp. zd. int.>.
.
● Wprowadź składający się z cyfr kod PIN i naciśnij przycisk
.
● Po wyświetleniu okna <Potwierdź kod PIN> w celu potwierdzenia wprowadź ponownie te same cyfry kodu
PIN.
W przypadku inicjowania ustawień Zdalnego interfejsu użytkownika
● W takim przypadku inicjowany jest również kod PIN Zdalnego interfejsu użytkownika. Po zakończeniu należy
ponownie ustawić kod PIN. Inicjowanie menu(P. 557)
ŁĄCZA
232
Zabezpieczenia
Ustawienia uprawnień dostępu(P. 220)
Ustawianie hasła menedżera systemu(P. 221)
233
Zabezpieczenia
Ograniczenie komunikacji za pomocą zapory
6869-038
Bez odpowiednich zabezpieczeń złośliwe oprogramowanie może uzyskać dostęp do komputerów oraz innych urządzeń
komunikacyjnych podłączonych do sieci. Aby temu zapobiec, należy określić ustawienia filtru pakietowego, funkcji,
która ogranicza komunikację do urządzeń z określonymi adresami IP lub MAC.
234
Zabezpieczenia
Określanie adresów IP dla zasad zapory
6869-039
Komunikację można ograniczyć na dwa sposoby: zezwalając na komunikację wyłącznie z określonymi adresami IP lub
blokując poszczególne adresy IP i zezwalając na pozostałą komunikację. Można określić jeden lub wiele adresów IP.
Adresy IP do odbierania danych można określić poprzez zdefiniowanie numerów portów.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij pozycję [Edytuj] dla typu filtra, który chcesz użyć.
[Filtr adresu IP].
235
Zabezpieczenia
[Adres IPv4: Filtr TX]
Wybór filtra ogranicza przesył danych z urządzenia na komputer przez określenie adresów IPv4.
[Adres IPv4: Filtr RX]
Wybór filtra ogranicza odbiór danych z urządzenia na komputer przez określenie adresów IPv4 oraz numeru
portu.
[Adres IPv6: Filtr TX]
Wybór filtra ogranicza przesył danych z urządzenia na komputer przez określenie adresów IPv6.
[Adres IPv6: Filtr RX]
Wybór filtra ogranicza odbiór danych z urządzenia na komputer przez określenie adresów IPv6 oraz numeru
portu.
5
Określ ustawienia filtrowania pakietów.
Dla filtra typu TX
W pierwszej kolejności należy ustalić domyślny zestaw zasad dotyczący zezwoleń lub braku zezwoleń na
komunikację innych urządzeń z tym urządzeniem, a następnie określić, które adresy IP zaliczyć do wyjątków.
1
Zaznacz pole wyboru [Użyj filtra] i kliknij przycisk radiowy [Odrzuć] lub [Zezwól], aby określić zasady
[Polityka domyślna].
[Użyj filtra]
Zaznaczenie tego pola wyboru umożliwi ograniczenie komunikacji. Usunięcie zaznaczenia pola wyboru
wyłącza to ograniczenie.
236
Zabezpieczenia
[Polityka domyślna]
Wybór warunku wstępnego w celu udzielenia zezwoleń lub braku zezwoleń na komunikację innych
urządzeń z tym urządzeniem.
2
[Zezwól]
Wybierz tę opcję, aby blokować pakiety komunikacyjne z urządzeń o adresach IP
wprowadzonych w polu [Wyjątki adresów] lub do takich urządzeń przesyłane.
Komunikacja z innymi urządzeniami jest dozwolona.
[Odrzuć]
Wybierz tę opcję, aby przepuszczać pakiety komunikacyjne jedynie z urządzeń o
adresach IP wprowadzonych w polu [Wyjątki adresów] lub do takich urządzeń
przesyłane. Komunikacja z innymi urządzeniami jest zabroniona.
Określ wyjątki adresów.
● Wprowadź adres IP (lub zakres adresów IP) w polu [Zarejestruj adres] i kliknij przycisk [Dodaj].
Sprawdzanie poprawności wpisów
● Nieprawidłowo wprowadzone adresy IP uniemożliwić dostęp do urządzenia z poziomu Zdalnego
interfejsu użytkownika. Konieczne będzie wtedy ustawienie filtra <Filtr adresów> na wartość <Wyłącz>.
Filtr adresów(P. 365)
W przypadku wybrania ustawienia [Odrzuć] w opcji [Polityka domyślna]
● Pakiety loopback, multiemisji i rozgłaszania nie mogą być filtrowane.
Usuwanie adresu IP z listy wyjątków
● Zaznacz adres IP i kliknij przycisk [Usuń].
3
Kliknij [OK].
Dla filtra typu RX
W przypadku wybrania opcji [Zezwól] w ustawieniu [Polityka domyślna] należy określić adresy IP urządzeń,
których komunikacja z tym urządzeniem ma być zablokowana. Wybierając opcję [Odrzuć] w ustawieniu [Polityka
domyślna], należy określić adresy IP urządzeń, które powinny się komunikować z tym urządzeniem.
237
Zabezpieczenia
1
Kliknij [Zarejestruj nowy].
2
Określ wyjątki adresów.
● Wprowadź adres IP (lub zakres adresów IP) w polu [Zarejestruj adres].
● Aby określić numer portu, zaznacz pole wyboru [Podaj numer portu], wpisz numer portu w polu
[Numer portu] i kliknij przycisk [Dodaj].
Sprawdzanie poprawności wpisów
● Nieprawidłowo wprowadzone adresy IP lub numery portów mogą uniemożliwić dostęp do urządzenia
z poziomu Zdalnego interfejsu użytkownika. Konieczne będzie wtedy ustawienie filtra <Filtr adresów>
na wartość <Wyłącz>. Filtr adresów(P. 365)
Usuwanie ustawionego numeru portu
● Wybierz numer portu do usunięcia i kliknij [Usuń].
3
Kliknij [OK].
4
Zaznacz pole wyboru [Użyj filtra] i kliknij przycisk radiowy [Odrzuć] lub [Zezwól], aby określić zasady
[Polityka domyślna].
238
Zabezpieczenia
[Użyj filtra]
Zaznaczenie tego pola wyboru umożliwi ograniczenie komunikacji. Usunięcie zaznaczenia pola wyboru
wyłącza to ograniczenie.
[Polityka domyślna]
Wybór warunku wstępnego w celu udzielenia zezwoleń lub braku zezwoleń na komunikację innych
urządzeń z tym urządzeniem.
[Zezwól]
Wybierz tę opcję, aby blokować pakiety komunikacyjne z urządzeń o adresach IP
wprowadzonych w polu [Wyjątki adresów] lub do takich urządzeń przesyłane.
Komunikacja z innymi urządzeniami jest dozwolona.
[Odrzuć]
Wybierz tę opcję, aby przepuszczać pakiety komunikacyjne jedynie z urządzeń o
adresach IP wprowadzonych w polu [Wyjątki adresów] lub do takich urządzeń
przesyłane. Komunikacja z innymi urządzeniami jest zabroniona.
Edytowanie ustawionego adresu IP w wyjątkach
● Kliknij odpowiednie łącze tekstowe dostępne pod pozycją [Wyjątki adresów]. Zostanie wyświetlone
okno, w którym w razie potrzeby możesz zmienić ustawienia, a następnie kliknij [OK].
Usuwanie adresu IP z listy wyjątków
● Wybierz adres IP do usunięcia i kliknij [Usuń].
5
6
Kliknij [OK].
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
239
Zabezpieczenia
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Korzystanie z panelu sterowania
● Filtrowanie adresów IP można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
Filtr adresów(P. 365)
ŁĄCZA
Określanie adresów MAC dla zasad zapory(P. 241)
240
Zabezpieczenia
Określanie adresów MAC dla zasad zapory
6869-03A
Komunikację można ograniczyć na dwa sposoby: zezwalając na komunikację wyłącznie z określonymi adresami MAC
lub blokując określone adresy MAC i zezwalając na pozostałą komunikację.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij opcję [Edytuj] dla odpowiedniego typu filtra.
[Filtr adresu MAC].
241
Zabezpieczenia
[Filtr TX]
Wybór filtra ogranicza przesył danych z urządzenia na komputer przez określenie adresów MAC.
[Filtr RX]
Wybór filtra ogranicza odbiór danych z urządzenia na komputer przez określenie adresów MAC.
5
Określ ustawienia filtrowania pakietów.
● W pierwszej kolejności należy ustalić warunek wstępny (domyślny zestaw zasad) dotyczący zezwoleń lub
braku zezwoleń na komunikację innych urządzeń z tym urządzeniem, a następnie określić, które adresy MAC
zaliczyć do wyjątków.
1
Zaznacz pole wyboru [Użyj filtra] i kliknij przycisk radiowy [Zezwól] lub [Odrzuć], aby określić zasady
[Polityka domyślna].
[Użyj filtra]
Zaznaczenie tego pola wyboru umożliwi ograniczenie komunikacji. Usunięcie zaznaczenia pola wyboru
wyłącza to ograniczenie.
[Polityka domyślna]
Wybór warunku wstępnego w celu udzielenia innym urządzeniom zezwoleń lub braku zezwoleń na
komunikację z tym urządzeniem.
[Zezwól]
Wybierz tę opcję, aby blokować pakiety komunikacyjne z urządzeń o adresach MAC
wprowadzonych w pozycji [Wyjątki adresów] lub do takich urządzeń przesyłane.
Komunikacja z innymi urządzeniami jest dozwolona.
242
Zabezpieczenia
[Odrzuć]
Wybierz tę opcję, aby przepuszczać pakiety komunikacyjne tylko z urządzeń o
adresach MAC wprowadzonych w pozycji [Wyjątki adresów] lub do takich urządzeń
przesyłane. Komunikacja z innymi urządzeniami jest zabroniona.
2
Określ wyjątki adresów.
● Wprowadź adres MAC w polu tekstowym [Zarejestruj adres], a następnie kliknij przycisk [Dodaj].
● Nie ma konieczności oddzielania adresów myślnikami lub dwukropkami.
Sprawdzanie poprawności wpisów
● Nieprawidłowo wprowadzone adresy MAC mogą uniemożliwić dostęp do urządzenia z poziomu
Zdalnego interfejsu użytkownika. Konieczne będzie wtedy ustawienie filtra <Filtr adresów> na wartość
<Wyłącz>. Filtr adresów(P. 365)
Po wybraniu opcji [Odrzuć] w obszarze [Polityka domyślna]
● Pakiety wychodzące multiemisji i rozgłaszania nie mogą zostać przefiltrowane.
Usuwanie adresu MAC z listy wyjątków
● Zaznacz adres MAC i kliknij przycisk [Usuń].
3
6
Kliknij [OK].
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Korzystanie z panelu sterowania
● Filtrowanie adresów MAC można również włączać lub wyłączać z poziomu menu ustawień panelu roboczego.
Filtr adresów(P. 365)
243
Zabezpieczenia
ŁĄCZA
Określanie adresów IP dla zasad zapory(P. 235)
244
Zabezpieczenia
Ustawienia proxy
6869-03C
Proxy (inaczej serwer proxy z protokołem HTTP) odnosi się do komputera lub oprogramowania przeprowadzającego
komunikację z użyciem protokołu HTTP dla innych urządzeń, zwłaszcza w przypadku komunikacji z zasobami spoza
sieci np. podczas przeglądania stron internetowych. Urządzenia klienckie łączą się z siecią zewnętrzną za
pośrednictwem serwera proxy, a nie komunikują się bezpośrednio z zewnętrznymi zasobami. Ustawienie proxy nie
tylko ułatwia zarządzanie ruchem między siecią lokalną i zewnętrzną, ale również blokuje nieupoważniony dostęp i
wzmacnia ochronę antywirusową, zwiększając poziom zabezpieczeń. W przypadku korzystania z technologii Google
Cloud Print do drukowania za pośrednictwem Internetu można zwiększyć poziom zabezpieczeń, ustawiając serwer
proxy. Przed rozpoczęciem konfiguracji upewnij się, że dysponujesz niezbędnymi informacjami na temat ustawień
proxy, w tym adresem IP, numerem portu oraz nazwą użytkownika i hasłem potwierdzającym uprawnienia.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
4
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia proxy].
[Ustawienia TCP/IP].
245
Zabezpieczenia
5
Zaznacz pole wyboru [Użyj proxy] i podaj wymagane ustawienia.
[Użyj proxy]
Zaznacz to pole wyboru, aby użyć serwera proxy podczas komunikacji z serwerem HTTP.
[Adres HTTP serwera Proxy]
Wprowadź adres serwera proxy. Określ adres IP lub nazwę hosta w zależności od środowiska.
[Numer portu HTTP serwera Proxy]
Zmień numer portu urządzenia odpowiednio do potrzeb.
[Użyj proxy w tej samej domenie]
Zaznacz to pole wyboru, aby użyć serwera proxy również podczas komunikacji z urządzeniami w tej samej
domenie.
[Użyj uwierzytelniania Proxy]
Aby włączyć funkcję uwierzytelnienia przez serwer proxy, zaznacz to pole wyboru i wprowadź nazwę
użytkownika składającą się ze znaków alfanumerycznych w polu tekstowym [Nazwa użytkownika].
[Ustaw/Zmień hasło]
Aby ustawić lub zmienić hasło dla uwierzytelnienia proxy, gdy funkcja ta jest włączona, zaznacz pole wyboru i
wprowadź nowe hasło składające się ze znaków alfanumerycznych w polu tekstowym [Hasło]. W celu
potwierdzenia należy wprowadzić to samo hasło w polu tekstowym [Potwierdź].
6
Kliknij [OK].
7
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
246
Zabezpieczenia
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Korzystanie z panelu sterowania
● Do ustawień serwera proxy można przejść również z poziomu menu ustawień panelu roboczego.
Ustawienia proxy(P. 355)
ŁĄCZA
Korzystanie z technologii Google Cloud Print(P. 144)
247
Zabezpieczenia
Ograniczanie funkcji urządzenia
6869-03E
Niektóre funkcje urządzenia mogą być rzadko używane lub stwarzać ryzyko niewłaściwego użytkowania. Ze względów
bezpieczeństwa można ograniczyć zakres możliwości urządzenia, całkowicie lub częściowo wyłączając te funkcje.
Ograniczanie funkcji drukowania
Ograniczanie funkcji drukowania(P. 249)
Ograniczenie funkcji USB
Ograniczenie funkcji USB(P. 252)
Ograniczanie funkcji panelu roboczego
Ograniczanie funkcji panelu roboczego(P. 255)
Ograniczanie funkcji sieci, w tym komunikacji HTTP
Wyłączanie komunikacji z użyciem protokołu HTTP(P. 258)
Wyłączanie Zdalnego interfejsu użytkownika(P. 259)
Wyłączanie portu LAN(P. 260)
Ukrywanie historii zadań drukowania
Ukrywanie historii zadań drukowania(P. 261)
248
Zabezpieczenia
Ograniczanie funkcji drukowania
6869-03F
Można skonfigurować ustawienia zapobiegające automatycznemu drukowaniu odebranych danych i dzięki temu
zmniejszyć zużycie papieru oraz uniemożliwić osobom trzecim korzystanie z urządzenia. Aby użyć tej funkcji, należy
zainstalować opcjonalną kartę pamięci SD. Instalacja karty pamięci SD(P. 600)
● Nawet jeśli operacje drukowania są ograniczone, można drukować raporty i listy ustawień.
raportów i list(P. 541)
1
Drukowanie
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
[Ustawienia zarządzania].
249
Zabezpieczenia
4
Kliknij [Edytuj].
5
Wprowadź hasło menedżera systemu w polu [Aktualne hasło menedżera systemu].
6
Zaznacz pole [Ogranicz zadania drukarki] i kliknij przycisk [OK].
[Ogranicz zadania drukarki]
Zaznaczenie tego pola wyboru umożliwi ograniczenie operacji drukowania na urządzeniu. Usunięcie
zaznaczenia pola wyboru wyłącza to ograniczenie.
250
Zabezpieczenia
7
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Praca przy ograniczeniu operacji drukowania
● Z poziomu sterowników drukarki można wykonywać wyłącznie drukowanie zapisanych zadań.
Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)(P. 100)
● Z poziomu Zdalnego interfejsu użytkownika można drukować wyłącznie pliki PDF, PS, EPS i XPS zapisane w
sektorach. Drukowanie bez otwierania pliku (Wydruk bezpośredni)(P. 110)
● Funkcje Wydruk bezpośredni z USB oraz Drukowanie e-maili będą niedostępne.
ŁĄCZA
Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)(P. 100)
251
Zabezpieczenia
Ograniczenie funkcji USB
6869-03H
USB to wygodny sposób podłączania urządzeń zewnętrznych i przechowywania lub przenoszenia danych. USB może
jednak również stanowić źródło wycieku informacji w przypadku niewłaściwego zarządzania. Szczególnie uważać
należy, korzystając z urządzeń pamięci USB. Sekcja ta opisuje sposoby ograniczania połączeń przez port USB
urządzenia oraz przeprowadzania blokady możliwości korzystania z urządzeń pamięci USB.
Ograniczenie połączenia USB z komputerem(P. 252)
Ograniczenie funkcji drukowania bezpośredniego z nośnika pamięci USB(P. 253)
Ograniczenie połączenia USB z komputerem
Istnieje możliwość wyłączenia portu USB do podłączania komputera znajdującego się z lewej strony urządzenia.
Spowoduje to wyłączenie możliwości połączenia z komputerem za pośrednictwem USB, ale urządzenie pamięci USB
będzie można podłączyć do portu USB z prawej strony urządzenia.
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz opcję <Wybór interfejsu> i naciśnij przycisk
(
).
/
wybierz opcję <Interfejs> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
4
Wybierz opcję <USB> i naciśnij przycisk
5
Wybierz opcję <Wyłącz> i naciśnij przycisk
.
.
.
<Wyłącz>
Wyłącza port USB umieszczony z lewej strony urządzenia.
<Włącz>
Włącza port USB umieszczony z lewej strony urządzenia.
252
.
.
Zabezpieczenia
6
Pozwala wykonać reset sprzętowy.
Reset sprzętowy(P. 488)
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Ograniczenie funkcji drukowania bezpośredniego z nośnika pamięci USB
Istnieje opcja, która blokuje możliwość drukowania danych z urządzenia pamięci USB. Uniemożliwia ona drukowanie
danych zapisanych na urządzeniu pamięci USB.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij [Edytuj].
[Ustawienia zarządzania].
253
Zabezpieczenia
5
Wprowadź hasło menedżera systemu w polu [Aktualne hasło menedżera systemu].
6
Usuń zaznaczenie pola wyboru [Bezpośredni wydruk USB] i kliknij przycisk [OK].
[Bezpośredni wydruk USB]
Aby wyłączyć funkcję drukowania z urządzenia pamięci USB, należy usunąć zaznaczenie tego pola wyboru.
Aby umożliwić drukowanie z urządzenia pamięci USB, należy zaznaczyć to pole wyboru. Jeśli dodatkowo
zaznaczone zostanie pole wyboru [Automatyczne wyświetlanie ekranu bezpośredniego wydruku USB], po
podłączeniu urządzenia pamięci USB do urządzenia automatycznie będzie wyświetlany ekran drukowania
bezpośrednio z nośnika pamięci USB.
ŁĄCZA
Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB)(P. 83)
254
Zabezpieczenia
Ograniczanie funkcji panelu roboczego
6869-03J
Istnieje możliwość ograniczenia możliwości korzystania z przycisków na panelu roboczym, aby uniemożliwić
nieprzemyślane zmiany ustawień.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij [Edytuj].
[Ustawienia zarządzania].
255
Zabezpieczenia
5
6
Wprowadź hasło menedżera systemu w polu [Aktualne hasło menedżera systemu].
Aby wprowadzić ograniczenie funkcji przycisków, zaznacz to pole wyboru i kliknij
[OK].
[Przyciski do zablokowania]
Zaznaczenie tego pola wyboru pozwala zablokować dany przycisk, nawet jeśli zostanie on naciśnięty na
panelu roboczym. Aby odblokować klawisz, należy usunąć zaznaczenie pola wyboru. Można również
zablokować przycisk Konfiguracja z poziomu panelu roboczego ( Ustaw. zarządzania(P. 341) ).
256
Zabezpieczenia
● Funkcje przycisków
Panel sterowania(P. 27)
257
Zabezpieczenia
Wyłączanie komunikacji z użyciem protokołu HTTP
6869-03K
Protokół HTTP jest używany do komunikacji poprzez sieć, np. takiej jak podczas uzyskiwania dostępu do urządzenia za
pośrednictwem Zdalnego interfejsu użytkownika. W przypadku korzystania z połączenia USB lub nieużywania
protokołu HTTP funkcja HTTP może zostać wyłączona, aby blokować złośliwe ataki z zewnątrz przez nieużywany port
HTTP.
● Wyłączenie komunikacji HTTP wyłącza niektóre funkcje sieciowe, takie jak Zdalny interfejs użytkownika,
drukowanie WSD i drukowanie z Google Cloud Print.
1
Naciśnij przycisk
2
Za pomocą przycisków
(
).
/
wybierz opcję <Sieć> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
.
3
Wybierz kolejno opcje <Ustawienia TCP/IP>
<HTTP>.
4
Wybierz opcję <Wyłącz> i naciśnij przycisk
.
<Wyłącz>
Wyłącza funkcję komunikacji z użyciem protokołu HTTP.
<Włącz>
Włącza funkcję komunikacji z użyciem protokołu HTTP.
5
Pozwala wykonać reset sprzętowy.
Reset sprzętowy(P. 488)
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
ŁĄCZA
Korzystanie ze Zdalnego interfejsu użytkownika(P. 299)
Konfiguracja protokołów drukowania i funkcji protokołu WSD(P. 166)
Korzystanie z technologii Google Cloud Print(P. 144)
W przypadku korzystania ze sterownika drukarki XPS(P. 227)
258
.
Zabezpieczenia
Wyłączanie Zdalnego interfejsu użytkownika
6869-03L
Zdalny interfejs użytkownika to przydatne narzędzie pozwalające określić ustawienia urządzenia za pomocą
przeglądarki internetowej na komputerze. Aby móc korzystać ze Zdalnego interfejsu użytkownika, urządzenie powinno
być podłączone do komputera za pośrednictwem sieci. Jeśli urządzenie jest podłączone do komputera przez kabel USB
lub jeżeli nie ma potrzeby korzystania ze Zdalnego interfejsu użytkownika, korzystne może być wyłączenie funkcji
Zdalnego interfejsu użytkownika. Zmniejsza się wtedy niebezpieczeństwo niepożądanej kontroli urządzenia przez
osoby trzecie za pośrednictwem sieci.
1
Naciśnij przycisk
2
Za pomocą przycisków
(
).
/
wybierz opcję <Sieć> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
3
Wybierz kolejno opcje <Ust. zdal. int. uż.>
4
Wybierz opcję <Wyłącz> i naciśnij przycisk
.
<Zdal. interf. użytk.>.
.
<Wyłącz>
Wyłącza Zdalny interfejs użytkownika.
<Włącz>
Włącza Zdalny interfejs użytkownika.
5
Pozwala wykonać reset sprzętowy.
Reset sprzętowy(P. 488)
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
ŁĄCZA
Korzystanie ze Zdalnego interfejsu użytkownika(P. 299)
Wyłączanie komunikacji z użyciem protokołu HTTP(P. 258)
259
.
Zabezpieczenia
Wyłączanie portu LAN
6869-03R
Port LAN stanowi interfejs łączący kabel LAN w celu użycia sieci. W przypadku korzystania z urządzenia za
pośrednictwem portu USB można całkowicie wyłączyć port LAN, co spowoduje wyłączenie sieci i zablokowanie
złośliwych ataków zewnętrznych za pośrednictwem portu LAN.
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz opcję <Wybór interfejsu> i naciśnij przycisk
(
).
/
wybierz opcję <Interfejs> i naciśnij przycisk
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
4
Wybierz opcję <Sieć> i naciśnij przycisk
5
Wybierz opcję <Wyłącz> i naciśnij przycisk
.
.
.
.
<Wyłącz>
Wyłączenie portu LAN.
<Włącz>
Włączenie portu LAN.
6
Pozwala wykonać reset sprzętowy.
Reset sprzętowy(P. 488)
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
260
.
Zabezpieczenia
Ukrywanie historii zadań drukowania
6869-03S
W celu ochrony prywatności użytkowników można wyłączyć wyświetlanie historii zadań drukowania na ekranie
Zdalnego interfejsu użytkownika oraz drukowanie listy historii wydruków. Historia zadań drukowania będzie
aktualizowana i utrzymywana, nawet jeśli zostanie ukryta, tak aby administratorzy mogli ją w razie potrzeby przejrzeć.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij [Edytuj].
[Wyświetl rejestr zadań].
261
Zabezpieczenia
5
Usuń zaznaczenie pola wyboru [Wyświetl rejestr zadań] i kliknij przycisk [OK].
[Wyświetl rejestr zadań]
Jeśli to pole wyboru nie zostanie zaznaczone, historia zadań drukowania nie będzie wyświetlana na ekranie
Zdalnego interfejsu użytkownika ani nie będzie można wydrukować listy historii wydruków. Aby wyświetlać
historię zadań, należy zaznaczyć to pole wyboru.
[Zezwól na pozyskanie rejestru zadań z oprogramowania zarządzania]
Jeśli to pole wyboru zostanie zaznaczone, historię zadań drukowania będzie można uzyskać za pomocą
oprogramowania do zarządzania urządzeniami, takiego jak iW Management Console. Aby wyłączyć
możliwość uzyskiwania historii zadań drukowania przez oprogramowanie do zarządzania, należy usunąć
zaznaczenie tego pola wyboru. Ta funkcja jest automatycznie włączona, gdy zaznaczone jest pole wyboru
[Wyświetl rejestr zadań].
ŁĄCZA
Sprawdzanie historii dokumentów(P. 310)
Menu zadań(P. 486)
262
Zabezpieczenia
Wprowadzenie wydajnych funkcji zabezpieczeń
6869-03U
Uprawnieni użytkownicy mogą ponieść nieoczekiwane straty na skutek szkodliwych ataków z zewnątrz np. spoofingu,
fałszowania czy przechwytywania danych podczas ich transferu w sieci. Poniższe funkcje zwiększające poziom
bezpieczeństwa i poufności są obsługiwane przez urządzenie oraz chronią ważne i wartościowe informacje przed
takimi atakami:
Komunikacja szyfrowana TLS
TLS to protokół szyfrowania danych wysyłanych do sieci, stosowany często do komunikacji za pośrednictwem
przeglądarki internetowej lub aplikacji pocztowej. Protokół TLS zapewnia bezpieczeństwo komunikacji podczas
obsługi urządzenia z komputera przy użyciu Zdalnego interfejsu użytkownika. Korzystanie z protokołu TLS
do komunikacji szyfrowanej(P. 265)
Komunikacja szyfrowana z użyciem protokołu IPSec
Podczas gdy protokół TLS szyfruje tylko dane używane w poszczególnych aplikacjach, np. przeglądarce
internetowej lub aplikacji pocztowej, protokół IPSec szyfruje całe pakiety IP (lub ich ładunki). W ten sposób
protokół IPSec zapewnia bardziej kompleksowy system zabezpieczeń niż TLS. Konfiguracja ustawień
protokołu IPSec(P. 269)
Uwierzytelnianie zgodne ze standardem IEEE 802.1X
IEEE 802.1X to standard i mechanizm blokujący nieupoważniony dostęp do sieci dzięki zbiorowemu zarządzaniu
informacjami dotyczącymi uwierzytelniania użytkowników. Każde urządzenie, które próbuje nawiązać
połączenie z siecią 802.1X, zostaje poddane procesowi uwierzytelnienia, aby potwierdzić uprawnienia
użytkownika. Informacje uwierzytelniające są wysyłane na serwer RADIUS i tam sprawdzane. Serwer zezwala na
nawiązanie komunikacji lub odrzuca próbę w zależności od wyniku procesu uwierzytelniania. Jeśli
uwierzytelnianie zostanie zakończone niepowodzeniem, przełącznik sieci LAN blokuje dostęp spoza sieci.
Urządzenie można podłączyć do sieci 802.1X jako urządzenie klienckie. Konfiguracja uwierzytelniania
zgodnego z IEEE 802.1X(P. 279)
263
Zabezpieczenia
ŁĄCZA
Konfiguracja ustawień dla par kluczy i certyfikatów cyfrowych(P. 284)
264
Zabezpieczenia
Korzystanie z protokołu TLS do komunikacji
szyfrowanej
6869-03W
Dostępna jest funkcja szyfrowania komunikacji między urządzeniem a przeglądarką internetową na komputerze oraz
drukowania danych drukowania IPP przez internet za pomocą mechanizmu TLS (Transport Layer Security). TLS to
mechanizm szyfrowania danych wysyłanych lub odbieranych za pośrednictwem sieci. Funkcja szyfrowania TLS musi
być włączona, gdy Zdalny interfejs użytkownika jest używany do konfiguracji ustawień IPSec (metody klucza
współdzielonego), uwierzytelniania zgodnego ze standardem IEEE 802.1X (TTLS/PEAP) lub SNMPv3. Aby użyć TLS do
komunikacji szyfrowanej, trzeba ustawić parę kluczy i włączyć funkcję TLS. Dostępna jest gotowa para kluczy (
Konfiguracja ustawień dla par kluczy i certyfikatów cyfrowych(P. 284) ).
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
[Ustawienia TCP/IP].
265
Zabezpieczenia
4
Kliknij [Edytuj] w [Ustawienia TLS].
5
Zmień ustawienia TLS.
[Ustawienia klucza i certyfikatu]
Opcja ta umożliwia wybranie klucza z listy kluczy i certyfikatów.
● Należy wybrać klucz z listy kluczy i certyfikatów, a następnie kliknąć opcję [Ustawienia klucza domyślnego].
Wyświetlanie informacji na temat certyfikatu
● Certyfikat można zweryfikować lub sprawdzić jego szczegóły, klikając odpowiednie łącze umieszczone pod
pozycją [Nazwa klucza] lub ikonę certyfikatu.
Weryfikowanie par kluczy i certyfikatów
cyfrowych(P. 296)
Pozycja [Ustawienia klucza domyślnego] się nie wyświetla
266
Zabezpieczenia
● Jeśli mechanizm TLS został już włączony za pomocą opcji [Ustawienia zdalnego interfejsu użytkownika] lub
[Ustawienia wydruku IPP], [Ustawienia klucza domyślnego], nie będzie on wyświetlany. Aby zmienić
używany klucz, przejdź do kroku 6 i usuń zaznaczenie pól wyboru [Użyj TLS] w ustawieniach [Ustawienia
zdalnego interfejsu użytkownika] lub [Ustawienia wydruku IPP].
[Dozwolone wersje]
Umożliwia wybranie dozwolonych wersji protokołu TLS.
[Algorytmy szyfrowania do ograniczenia]
Umożliwia wybór algorytmów szyfrowania, których nie można używać z protokołem TLS. Aby nie stosować
ograniczeń, należy wybrać opcję [Brak].
6
Włącz szyfrowanie TLS dla Zdalnego interfejsu użytkownika.
Szyfrowanie TLS dla Zdalnego interfejsu użytkownika
1
Kliknij [Zabezpieczenia]
2
Kliknij [Edytuj].
3
Zaznacz pole [Użyj TLS] i kliknij przycisk [OK].
[Ustawienia zdalnego interfejsu użytkownika].
267
Zabezpieczenia
[Użyj TLS]
Korzystając z protokołu TLS na potrzeby komunikacji Zdalnego interfejsu użytkownika, należy zaznaczyć
to pole wyboru. Jeśli nie jest on używany, należy usunąć zaznaczenie tego pola.
Szyfrowanie TLS na potrzeby funkcji zgodne z komunikacją szyfrowaną
Korzystanie z protokołu TLS do drukowania IPP
Aby wykonać drukowanie IPP z zastosowaniem protokołu TLS, należy wprowadzić następujące ustawienia. Aby
uzyskać informacje na temat innych ustawień drukowania IPP, patrz Konfiguracja protokołów drukowania i
funkcji protokołu WSD(P. 166) .
[Sieć] [Ustawienia TCP/IP]
TLS] [OK]
7
[Edytuj] w [Ustawienia wydruku IPP]
Zaznacz pole wyboru [Użyj
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Korzystanie z panelu sterowania
● Komunikację szyfrowaną TLS można również włączać lub wyłączać z poziomu menu ustawień panelu
roboczego. Ust. zdal. int. uż.(P. 363)
Uruchamianie Zdalnego interfejsu użytkownika przy użyciu protokołu TLS
● Próba uruchomienia Zdalnego interfejsu użytkownika, gdy protokół TLS jest aktywny, może spowodować
wyświetlenie alarmu zabezpieczeń dotyczącego certyfikatu zabezpieczeń. W takim przypadku sprawdź, czy w
polu adresu jest wprowadzony prawidłowy adres URL, a następnie kontynuuj, aby wyświetlić ekran Zdalnego
interfejsu użytkownika. Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
ŁĄCZA
Generowanie par kluczy(P. 285)
Używanie wygenerowanych przez CA par kluczy i certyfikatów cyfrowych(P. 293)
Konfiguracja ustawień protokołu IPSec(P. 269)
Konfiguracja uwierzytelniania zgodnego z IEEE 802.1X(P. 279)
Monitorowanie i kontrolowanie urządzenia za pomocą protokołu SNMP(P. 199)
268
Zabezpieczenia
Konfiguracja ustawień protokołu IPSec
6869-03X
Internet Protocol Security (IPSec lub IPsec) to pakiet protokołów do szyfrowania danych transportowanych w sieci, w
tym w sieciach internetowych. Podczas gdy protokół TLS szyfruje tylko dane używane w poszczególnych aplikacjach,
np. przeglądarce internetowej lub aplikacji pocztowej, protokół IPSec szyfruje całe pakiety IP lub ich ładunki,
zapewniając bardziej kompleksowy system zabezpieczeń. Protokół IPSec urządzenia pracuje w trybie transportu, w
którym szyfrowane są ładunki pakietów IP. Dzięki tej funkcji urządzenie może bezpośrednio łączyć się z komputerem
znajdującym się w tej samej wirtualnej sieci prywatnej (VPN). Przed przystąpieniem do konfiguracji urządzenia
skonfiguruj odpowiednio komputer.
Rejestrowanie polityk bezpieczeństwa(P. 269)
Włączanie komunikacji z użyciem protokołu IPSec(P. 276)
Używanie protokołu IPSec z filtrem adresów IP
● Podczas odbioru pakietów ustawienia IPSec są stosowane przed ustawieniami filtra adresów IP, natomiast
podczas nadawania pakietów odwrotnie. Określanie adresów IP dla zasad zapory(P. 235)
Rejestrowanie polityk bezpieczeństwa
Aby korzystać z protokołu IPSec na potrzeby komunikacji szyfrowanej, konieczne jest zarejestrowanie zasad
bezpieczeństwa (SP) przed włączeniem ustawień IPSec ( Włączanie komunikacji z użyciem protokołu
IPSec(P. 276) ). Zasada bezpieczeństwa składa się z grupy ustawień opisanych poniżej. Można zarejestrować wiele
zasad stosownie do używanego adresu IP i numeru portu. Po zakończeniu rejestracji zasad należy określić kolejność
ich stosowania.
Selektor
Selektor określa warunki dla pakietów IP w celu zastosowania komunikacji z szyfrowaniem IPSec. Dostępne
warunki to m.in. adresy IP i numery portów urządzenia oraz urządzeń, z którymi chcesz nawiązać komunikację.
IKE
Protokół IKE służy do konfiguracji wersji IKEv1 używanej do protokołowania wymiany kluczy. Należy zauważyć,
że instrukcje różnią się w zależności od wybranej metody uwierzytelniania.
[Metoda klucza współdzielonego]
Klucz składający się ze znaków alfanumerycznych można udostępniać innym urządzeniom. Należy wcześniej
włączyć szyfrowanie TLS dla Zdalnego interfejsu użytkownika ( Korzystanie z protokołu TLS do komunikacji
szyfrowanej(P. 265) ).
[Metoda podpisu cyfrowego]
To i inne urządzenia uwierzytelniają się wzajemnie poprzez wzajemne weryfikowanie podpisów cyfrowych.
Przygotuj parę kluczy ( Używanie wygenerowanych przez CA par kluczy i certyfikatów
cyfrowych(P. 293) ).
269
Zabezpieczenia
Ustawianie protokołów i opcji
Określ ustawienia protokołu ESP i AH, który jest dodawany do pakietów w trakcie trwania komunikacji z użyciem
protokołu IPSec. Protokołów ESP i AH można używać równolegle. Można także włączyć protokół PFS w celu
zwiększenia zabezpieczeń.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij [Lista polityk IPSec].
5
Kliknij [Rejestruj politykę IPSec].
[Ustawienia IPSec].
270
Zabezpieczenia
6
Wprowadź nazwę polityki w obszarze [Nazwa polityki] i zaznacz pole wyboru [Włącz
politykę].
[Nazwa polityki]
Należy wprowadzić nazwę składającą się ze znaków alfanumerycznych, która służy do identyfikacji zasady.
[Włącz politykę]
Zaznacz to pole wyboru, aby włączyć politykę. Jeśli polityka nie jest używana, usuń zaznaczenie tego pola
wyboru.
7
Określ ustawienia selektora.
[Adres lokalny]
Z poniższej listy należy wybrać typ adresu IP urządzenia, który ma być zastosowany w polityce.
271
Zabezpieczenia
[Wszystkie adresy IP]
Wybierz tę opcję, aby używać protokołu IPSec dla wszystkich pakietów IP.
[Adres IPv4]
Wybierz tę opcję, aby używać protokołu IPSec w przypadku wszystkich pakietów IP
wysyłanych na adres IPv4 urządzenia lub z tego adresu.
[Adres IPv6]
Wybierz tę opcję, aby używać protokołu IPSec w przypadku wszystkich pakietów IP
wysyłanych na adres IPv6 urządzenia lub z tego adresu.
[Ustawienia ręczne IPv4]
Wybierz tę opcję, aby określić pojedynczy adres IPv4 lub zakres adresów IPv4, dla
których chcesz zastosować protokół IPSec. Wprowadź adres IPv4 (lub zakres) w polu
tekstowym [Adres ustawiany ręcznie].
[Ustawienia ręczne IPv6]
Wybierz tę opcję, aby określić pojedynczy adres IPv6 lub zakres adresów IPv6, dla
których chcesz zastosować protokół IPSec. Wprowadź adres IPv6 (lub zakres) w polu
tekstowym [Adres ustawiany ręcznie].
[Adres ustawiany ręcznie]
Jeśli wybrano opcję [Ustawienia ręczne IPv4] albo [Ustawienia ręczne IPv6] dla pozycji [Adres lokalny],
wprowadź adres IP, aby zastosować zasady.
[Ustawienia podsieci]
W przypadku ręcznego wprowadzania adresów IPv4 można określić zakres, używając maski podsieci.
Wprowadź maskę podsieci, oddzielając numery kropkami (przykład: „255.255.255.240”).
[Zdalny adres]
Z poniższej listy należy wybrać typ adresu IP urządzenia, który ma być zastosowany w polityce.
[Wszystkie adresy IP]
Wybierz tę opcję, aby używać protokołu IPSec dla wszystkich pakietów IP.
[Wszystkie adresy IPv4]
Wybierz tę opcję, aby używać protokołu IPSec w przypadku wszystkich pakietów IP
wysyłanych do lub z adresu IPv4.
[Wszystkie adresy IPv6]
Wybierz tę opcję, aby używać protokołu IPSec w przypadku wszystkich pakietów IP
wysyłanych do lub z adresu IPv6.
[Ustawienia ręczne IPv4]
Wybierz tę opcję, aby określić pojedynczy adres IPv4 lub zakres adresów IPv4, dla
których chcesz zastosować protokół IPSec. Wprowadź adres IPv4 (lub zakres) w polu
tekstowym [Adres ustawiany ręcznie].
[Ustawienia ręczne IPv6]
Wybierz tę opcję, aby określić pojedynczy adres IPv6 lub zakres adresów IPv6, dla
których chcesz zastosować protokół IPSec. Wprowadź adres IPv6 (lub zakres) w polu
tekstowym [Adres ustawiany ręcznie].
[Adres ustawiany ręcznie]
Jeśli wybrano opcję [Ustawienia ręczne IPv4] albo [Ustawienia ręczne IPv6] dla pozycji [Zdalny adres],
wprowadź adres IP, aby zastosować zasady.
[Ustawienia podsieci]
W przypadku ręcznego wprowadzania adresów IPv4 można określić zakres, używając maski podsieci.
Wprowadź maskę podsieci, oddzielając numery kropkami (przykład: „255.255.255.240”).
[Port lokalny]/[Port zdalny]
Aby utworzyć osobne zasady dla każdego protokołu, np. HTTP czy SMTP, wprowadź odpowiedni numer portu
dla protokołu, aby zdecydować o stosowaniu lub niestosowaniu protokołu IPSec.
● Protokół IPSec nie jest stosowany do pakietów, które mają określony adres multiemisji lub adres
rozsyłania.
8
Określ ustawienia protokołu IKE.
272
Zabezpieczenia
[Tryb IKE]
Wyświetlony jest tryb używany do protokołu wymiany kluczy. Standardowo należy wybrać tryb główny.
● Tryb agresywny należy wybrać, gdy adres IP nie jest stały. Warto pamiętać, że zabezpieczenia w trybie
agresywnym są niższe niż w trybie głównym.
[Metoda AUTH]
Wybierz [Metoda klucza współdzielonego] lub [Metoda podpisu cyfrowego], wybierając metodę stosowaną
podczas uwierzytelniania urządzenia.
● Po wybraniu trybu agresywnego w obszarze [Tryb IKE], ustawienie [Metoda klucza współdzielonego] nie
szyfruje klucza dzielonego.
[Algorytm uwierzytelniania/szyfrowania]
Aby automatycznie ustawić algorytm wymiany kluczy, należy zaznaczyć pole wyboru [Automatycznie]. Po
zaznaczeniu pola wyboru algorytm jest ustawiany w sposób przedstawiony poniżej.
[Uwierzytelnienie]
[SHA1 i MD5]
[Szyfrowanie]
[3DES-CBC i AES-CBC]
[Grupa DH]
[Grupa 2 (1024)]
Aby ręcznie ustawić algorytm, należy usunąć zaznaczenie tego pola wyboru i wybrać algorytm.
[Uwierzytelnienie]
Wybór algorytmu hashowania.
[Szyfrowanie]
Wybór algorytmu szyfrowania.
[Grupa DH]
Wybór grupy Diffie-Hellman, która określa siłę klucza.
Używanie funkcji [Metoda klucza współdzielonego] do uwierzytelniania
1
Wybierz ustawienie [Metoda klucza współdzielonego] dla opcji [Metoda AUTH] i kliknij pozycję
[Ustawienia klucza dzielonego].
2
Wprowadź klucz współdzielony, używając znaków alfanumerycznych i kliknij przycisk [OK].
273
Zabezpieczenia
Używanie funkcji [Metoda podpisu cyfrowego] do uwierzytelniania
1
Wybierz ustawienie [Metoda podpisu cyfrowego] dla opcji [Metoda AUTH] i kliknij pozycję [Klucz i
certyfikat].
2
Wybierz parę kluczy, której chcesz użyć, a następnie kliknij [Ustawienia klucza domyślnego].
Wyświetlanie informacji na temat pary kluczy lub certyfikatu
● Certyfikat można zweryfikować lub sprawdzić jego szczegóły, klikając odpowiednie łącze umieszczone
pod pozycją [Nazwa klucza] albo ikonę certyfikatu. Weryfikowanie par kluczy i certyfikatów
cyfrowych(P. 296)
9
Określ ustawienia sieci z protokołem IPSec.
[Użyj PFS]
Zaznacz to pole wyboru, aby włączyć protokół Doskonałe utajnienie przekazywania (PFS) w odniesieniu do
kluczy sesji IPSec. Protokół PFS zwiększa poziom zabezpieczeń oraz ilość komunikowanych danych. Upewnij
się, że protokół PFS jest włączony dla innych urządzeń. Jeśli usługa PFS nie jest używana, należy usunąć
zaznaczenie tego pola wyboru.
[Ważność]
274
Zabezpieczenia
Określ sposób używania SA jako tunelu komunikacyjnego. Zaznacz pole wyboru [Wyświetl wedłóg czasu] lub
[Wyświetl wedłóg rozmiaru]. W przypadku zaznaczenia dwóch pól wyboru sesja kojarzenia zabezpieczeń
IPSec SA zostaje zakończona, gdy spełniony zostanie jeden z warunków.
[Wyświetl wedłóg czasu]
Wprowadź czas w minutach, aby określić długość trwania sesji. Wprowadzony czas
zostaje zastosowany zarówno w przypadku kojarzenia zabezpieczeń IPSec, jak i IKE.
[Wyświetl wedłóg rozmiaru]
Wprowadź rozmiar w megabajtach, aby określić maksymalną ilość danych
transportowanych w trakcie jednej sesji. Wprowadzony rozmiar jest stosowany tylko w
przypadku kojarzenia zabezpieczeń IPSec.
Jeśli zaznaczysz tylko pole wyboru [Wyświetl wedłóg rozmiaru]
● Prawidłowość kojarzenia zabezpieczeń IKE nie może być określona wielkością, dlatego stosuje się wartość
początkową (480 minut) [Wyświetl wedłóg czasu].
[Algorytm uwierzytelniania/szyfrowania]
Wybierz protokół i algorytm do wykorzystania w komunikacji IPSec.
Automatyczna konfiguracja połączenia
Wybierz [Automatycznie].
[Uwierzytelnienie ESP]
ESP jest włączone, a algorytm uwierzytelniania jest ustawiony na [SHA1 i MD5].
[Szyfrowanie ESP]
ESP jest włączone, a algorytm szyfrowania jest ustawiony na [3DES-CBC i AES-CBC].
Używanie ESP
Wybierz [ESP] oraz algorytm uwierzytelniania i szyfrowania.
[Uwierzytelnienie ESP]
Wybór algorytmu hashowania do użycia w uwierzytelnianiu ESP.
[Szyfrowanie ESP]
Wybór algorytmu szyfrowania z użyciem protokołu ESP.
Używanie AH
Wybierz [AH], oraz algorytm hashowania do użycia w uwierzytelnianiu AH w obszarze [Uwierzytelnianie
AH].
[Tryb podłączenia]
Opcja pozwala wyświetlić tryb połączenia protokołu IPSec. Urządzenie obsługuje tryb transportu, w którym
ładunki pakietów IP są szyfrowane. Tryb tunelu, w którym zawarte są całe pakiety IP (nagłówki i ładunki), nie
jest dostępny.
10
Kliknij [OK].
● Aby zarejestrować dodatkową zasadę bezpieczeństwa, wróć do kroku 5.
11
Ustaw kolejność zasad wyszczególnionych na liście w pozycji [Lista polityk IPSec].
● Zasady są stosowane w kolejności od pozycji na górze listy do pozycji znajdującej się na samym dole. Klikaj
przyciski [Podnieś priorytet] i [Obniż priorytet], aby przesuwać zasady w górę lub w dół i tym samym zmieniać
kolejność ich stosowania.
275
Zabezpieczenia
Edytowanie zasady
● W celu edycji ustawień można kliknąć łącze w obszarze [Nazwa polityki].
Usuwanie zasady
● Kliknij przycisk [Usuń] znajdujący się po prawej stronie nazwy zasady, którą chcesz usunąć.
12
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz [Twardy reset], a następnie kliknij przycisk [Wykonaj].
➠ Ustawienia są aktywowane po wykonaniu resetu sprzętowego.
Włączanie komunikacji z użyciem protokołu IPSec
Po zakończeniu rejestrowania polityk bezpieczeństwa należy włączyć komunikację z użyciem protokołu IPSec.
1
2
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
276
Zabezpieczenia
3
Kliknij [Zabezpieczenia]
4
Kliknij [Edytuj].
5
Zaznacz pole wyboru [Użyj IPSec] i kliknij przycisk [OK].
[Ustawienia IPSec].
[Użyj IPSec]
Zaznacz to pole wyboru w przypadku używania protokołu IPSec w urządzeniu. Jeśli funkcja ta nie jest
używana, zaznaczenie tego pola wyboru należy usunąć.
[Zezwól na odbiór pakietów bez polityki]
Jeśli zaznaczysz to pole wyboru podczas używania IPSec, pakiety, które nie są dostępne dla zarejestrowanych
polityk, będą również wysyłane/odbierane. Aby wyłączyć wysyłanie/odbieranie pakietów, które nie są
dostępne dla polityk, zaznaczenie tego pola wyboru należy usunąć.
6
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz [Twardy reset], a następnie kliknij przycisk [Wykonaj].
277
Zabezpieczenia
➠ Ustawienia są aktywowane po wykonaniu resetu sprzętowego.
Korzystanie z panelu sterowania
● Ustawienia komunikacji z użyciem protokołu IPSec można także włączyć lub wyłączyć za pomocą menu
ustawień na panelu sterowania. IPSec(P. 357)
ŁĄCZA
Konfiguracja ustawień dla par kluczy i certyfikatów cyfrowych(P. 284)
Lista polityk IPSec(P. 481)
278
Zabezpieczenia
Konfiguracja uwierzytelniania zgodnego z IEEE 802.1X
6869-03Y
Urządzenie można podłączyć do sieci 802.1X jako urządzenie klienckie. Standardowa sieć 802.1X składa się z serwera
RADIUS (serwera uwierzytelniania), przełącznika sieci LAN (wystawcy uwierzytelnienia) oraz urządzeń klienckich z
oprogramowaniem uwierzytelniającym (suplikantów). Każde urządzenie, które próbuje nawiązać połączenie z siecią
802.1X, zostaje poddane procesowi uwierzytelnienia, aby potwierdzić uprawnienia użytkownika. Informacje
uwierzytelniające są wysyłane na serwer RADIUS i tam sprawdzane. Serwer zezwala na nawiązanie komunikacji lub
odrzuca próbę w zależności od wyniku procesu uwierzytelniania. Jeśli uwierzytelnianie zostanie zakończone
niepowodzeniem, przełącznik sieci LAN (lub punkt dostępowy) blokuje dostęp spoza sieci.
Wybierz metodę uwierzytelniania z poniższej listy. W razie potrzeby zainstaluj lub zarejestruj parę kluczy lub certyfikat
CA, zanim przeprowadzisz konfigurację uwierzytelniania zgodnego ze standardem IEEE 802.1X ( Używanie
wygenerowanych przez CA par kluczy i certyfikatów cyfrowych(P. 293) ).
TLS
Urządzenie i serwer uwierzytelniania uwierzytelniają się wzajemnie, sprawdzając poprawność swoich
certyfikatów. Para kluczy wystawiona przez urząd certyfikacji (CA) jest wymagana do uwierzytelnienia klienta
(podczas uwierzytelniania urządzenia). W przypadku uwierzytelniania serwera oprócz certyfikatu fabrycznie
zainstalowanego na urządzeniu można użyć certyfikatu CA zainstalowanego za pośrednictwem Zdalnego
interfejsu użytkownika.
TTLS
W tej metodzie uwierzytelniania korzysta się z nazwy użytkownika i hasła do uwierzytelniania urządzenia
klienckiego, jak również certyfikatu CA do uwierzytelniania serwera. Protokół MSCHAPv2 lub PAP można wybrać
jako protokół wewnętrzny. Protokołów TTLS i PEAP można używać równolegle. Przed określeniem metody
uwierzytelniania włącz szyfrowanie TLS dla Zdalnego interfejsu użytkownika ( Korzystanie z protokołu TLS do
komunikacji szyfrowanej(P. 265) ).
PEAP
Wymagane ustawienia niemal pokrywają się z ustawieniami dla protokołu TTLS. MS-CHAPv2 pełni funkcję
protokołu wewnętrznego. Przed określeniem metody uwierzytelniania włącz szyfrowanie TLS dla Zdalnego
interfejsu użytkownika ( Korzystanie z protokołu TLS do komunikacji szyfrowanej(P. 265) ).
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
2
Kliknij [Ustawienia/Rejestracja].
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
279
Zabezpieczenia
3
Kliknij [Sieć]
4
Kliknij [Edytuj].
5
[Ustawienia IEEE 802.1X].
Zaznacz pole wyboru [Użyj IEEE 802.1X], wprowadź nazwę logowania w polu
tekstowym [Nazwa login] i wybierz odpowiednie ustawienia.
280
Zabezpieczenia
[Użyj IEEE 802.1X]
Zaznaczenie tego pola wyboru włącza funkcję uwierzytelniania zgodnego ze standardem IEEE 802.1X.
[Nazwa login]
Wprowadź nazwę (tożsamość protokołu EAP) składającą się ze znaków alfanumerycznych, która służy do
identyfikacji użytkownika.
Ustawianie protokołu TLS
1
Zaznacz pole [Użyj TLS] i kliknij przycisk [Klucz i certyfikat].
● Nie można używać protokołu TLS z TTLS ani PEAP.
2
Wybierz klucz z listy kluczy i certyfikatów i kliknij przycisk [Ustawienia klucza domyślnego].
Wyświetlanie informacji na temat pary kluczy lub certyfikatu
● Certyfikat można zweryfikować lub sprawdzić jego szczegóły, klikając odpowiednie łącze umieszczone
pod pozycją [Nazwa klucza] lub ikonę certyfikatu. Weryfikowanie par kluczy i certyfikatów
cyfrowych(P. 296)
Konfiguracja protokołu TTLS/PEAP
1
Zaznacz pole wyboru [Użyj TTLS] lub [Użyj PEAP].
281
Zabezpieczenia
Wewnętrzny protokół TTLS
● Dostępne są opcje MSCHAPv2 lub PAP. Aby wybrać opcję PAP, kliknij przycisk radiowy [PAP].
2
Kliknij [Zmień nazwę/hasło użytkownika].
● Aby podać nazwę użytkownika inną niż nazwę logowania, usuń zaznaczenie pola wyboru [Użyj nazwy
login jako nazwy użytkownika]. Zaznacz to pole wyboru, jeśli chcesz użyć nazwy logowania jako nazwy
użytkownika.
3
Wprowadź nazwę użytkownika/hasło i kliknij przycisk [OK].
282
Zabezpieczenia
[Nazwa użytkownika]
Wprowadź nazwę użytkownika składającą się ze znaków alfanumerycznych.
[Zmień hasło]
Aby wprowadzić lub zmienić hasło, należy zaznaczyć to pole wyboru i wprowadzić nowe hasło za pomocą
znaków alfanumerycznych w polach tekstowych [Hasło] oraz [Potwierdź].
6
Kliknij [OK].
7
Wykonaj reset sprzętowy.
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Korzystanie z panelu sterowania
● Uwierzytelnianie zgodne ze standardem IEEE 802.1X można również włączać lub wyłączać z poziomu menu
ustawień panelu roboczego. IEEE802.1X(P. 365)
ŁĄCZA
Konfiguracja ustawień dla par kluczy i certyfikatów cyfrowych(P. 284)
283
Zabezpieczenia
Konfiguracja ustawień dla par kluczy i certyfikatów
cyfrowych
6869-040
Aby zaszyfrować komunikację ze zdalnym urządzeniem, należy najpierw przesłać oraz odebrać za pośrednictwem
niezabezpieczonej sieci klucz szyfrujący. Problem ten rozwiązuje szyfrowanie kluczem publicznym. Szyfrowanie
kluczem publicznym zapewnia bezpieczną komunikację przez zabezpieczenie ważnych i cennych danych przed
atakami, takimi jak fałszowanie, naruszanie integralności czy przechwytywanie danych podczas ich transferu w sieci.
Para kluczy
Para kluczy składa się z klucza publicznego i tajnego. Oba klucze są wymagane do szyfrowania i
odszyfrowywania danych. Danych zaszyfrowanych przy użyciu jednego klucza z pary nie można
przywrócić do pierwotnej formy bez użycia drugiego klucza. Dzięki temu szyfrowanie kluczem
publicznym zapewnia bezpieczne przesyłanie danych w sieci. Maksymalnie można
zarejestrować osiem par kluczy, w tym pary fabrycznie zainstalowanych kluczy ( Używanie
wygenerowanych przez CA par kluczy i certyfikatów cyfrowych(P. 293) ). W przypadku
komunikacji szyfrowanej TLS dla urządzenia może zostać wygenerowana para kluczy (
Generowanie par kluczy(P. 285) ).
Certyfikat CA
Certyfikaty cyfrowe, takie jak certyfikaty CA, są podobne do innych form identyfikacji np. licencji
sterowników. Certyfikat cyfrowy zawiera cyfrowy podpis, który pozwala urządzeniu wykryć
wszelkie próby fałszowania czy naruszania integralności danych. Naruszenie certyfikatów
cyfrowych z zewnątrz jest więc niesłychanie trudne. Certyfikat cyfrowy z kluczem publicznym
urzędu certyfikacji (CA) nazywa się certyfikatem CA. Certyfikaty CA służą do weryfikacji
urządzeń, z którymi nawiązana jest komunikacja, i są wykorzystywane w funkcjach takich jak
drukowanie za pomocą technologii Google Cloud Print lub uwierzytelnianie zgodne ze
standardem IEEE 802.1X. Maksymalna liczba certyfikatów CA, które można zarejestrować to
150, z czego 72 to certyfikaty fabrycznie zainstalowane na urządzeniu ( Używanie
wygenerowanych przez CA par kluczy i certyfikatów cyfrowych(P. 293) ).
284
Zabezpieczenia
Generowanie par kluczy
6869-041
Parę kluczy można wygenerować za pomocą urządzenia, jeżeli wymaga tego komunikacja szyfrowana z użyciem
protokołu TLS (Transport Layer Security). Z protokołu TLS można korzystać podczas udzielania dostępu do urządzenia
przez zdalny interfejs użytkownika lub drukowania IPP. Można zarejestrować maksymalnie osiem par kluczy, w tym
kluczy zainstalowanych fabrycznie. Wraz z parami kluczy wygenerowanymi dla łączności sieciowej używane są
certyfikaty z podpisem własnym. Wraz z kluczem i żądaniem podpisania certyfikatu (CSR) można wysłać wniosek o
certyfikat cyfrowy CA dla pary kluczy wygenerowanej przez urządzenie.
Generowanie klucza łączności sieciowej(P. 285)
Generowanie klucza i żądania podpisania certyfikatu (CSR)(P. 287)
Generowanie klucza łączności sieciowej
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij [Generowanie klucza].
[Ustawienia klucza i certyfikatu].
285
Zabezpieczenia
Usuwanie zarejestrowanej pary kluczy
● Kliknij przycisk [Usuń] znajdujący się po prawej stronie pary kluczy, którą chcesz usunąć
[OK].
kliknij przycisk
● Nie można usunąć pary kluczy, która jest obecnie używana do innych celów, np. gdy elementy „TLS” lub
„IEEE 802.1X” są wyświetlane w pozycji [Zastosowanie klucza]. W takiej sytuacji należy wyłączyć daną
funkcję lub zamienić parę kluczy przed jej usunięciem.
5
Wybierz [Komunikacja sieciowa] i kliknij [OK].
6
Określ ustawienia klucza i certyfikatu.
[Ustawienia klucza]
[Nazwa klucza]
286
Zabezpieczenia
Należy tu wprowadzić znaki alfanumeryczne, aby nadać nazwę parze kluczy. Wybierz nazwę, którą z
łatwością zidentyfikujesz później na liście.
[Algorytm podpisu]
Wybierz algorytm podpisu z rozwijanej listy.
[Algorytm klucza]
W celu wygenerowania pary kluczy stosuje się algorytm RSA lub ECDSA. Długość klucza należy wybrać z
listy rozwijanej. Im dłuższy jest klucz, tym wolniej odbywa się komunikacja. Jednocześnie jednak poziom
bezpieczeństwa wzrasta.
● Przy ustawianiu wartości długości klucza nie można wybrać opcji [512 bitów], jeżeli wybrano
opcję [SHA384] lub [SHA512] dla ustawienia [Algorytm podpisu].
[Ustawienia certyfikatu]
[Data początkowa ważności (dd/mm rrrr)]
Należy tu podać datę początku ważności certyfikatu.
[Data końcowa ważności (dd/mm rrrr)]
Należy tu podać datę końca ważności certyfikatu. Ustawienie daty wcześniejszej niż [Data początkowa
ważności (dd/mm rrrr)] nie jest możliwe.
[Kraj/region]
Należy tu wpisać internetowy kod kraju.
[Stan]/[Miasto]
Wprowadź znaki alfanumeryczne w polach lokalizacji.
[Organizacja]/[Jednostka organizacyjna]
Wprowadź znaki alfanumeryczne w nazwy organizacji.
[Wspólna nazwa]
Wprowadź pospolitą nazwę certyfikatu składająca się ze znaków alfanumerycznych. „Nazwa pospolita”
jest często skrótowo oznaczana jako „CN”.
Aby wykonać drukowanie IPPS, należy w polu [Wspólna nazwa] wpisać „adres IP” lub „<nazwa
hosta>.<nazwa domeny>”, używane do łączenia się przez IPPS.
● Adres IP należy wprowadzać, gdy jest on stały.
● W przypadku korzystania z serwera DNS należy wprowadzić wartości „<nazwa hosta>.<nazwa
domeny>”. Włączanie protokołu IPP/IPPS(P. 172)
7
Kliknij [OK].
● Generowanie kluczy łączności sieciowej może trwać około 10–15 minut.
● Po zakończeniu generowania klucz zostaje automatycznie zarejestrowany dla urządzenia.
Generowanie klucza i żądania podpisania certyfikatu (CSR)
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
2
Kliknij [Ustawienia/Rejestracja].
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
287
Zabezpieczenia
3
Kliknij [Zabezpieczenia]
4
Kliknij [Generowanie klucza].
[Ustawienia klucza i certyfikatu].
Usuwanie zarejestrowanej pary kluczy
● Kliknij przycisk [Usuń] znajdujący się po prawej stronie pary kluczy, którą chcesz usunąć
[OK].
kliknij przycisk
● Nie można usunąć pary kluczy, która jest obecnie używana do innych celów, np. gdy elementy „TLS” lub
„IEEE 802.1X” są wyświetlane w pozycji [Zastosowanie klucza]. W takiej sytuacji należy wyłączyć daną
funkcję lub zamienić parę kluczy przed jej usunięciem.
5
Wybierz [Klucz i żądanie podpisania certyfikatu] i kliknij [OK].
288
Zabezpieczenia
6
Określ ustawienia klucza i certyfikatu.
[Ustawienia klucza]
[Nazwa klucza]
Należy tu wprowadzić znaki alfanumeryczne, aby nadać nazwę parze kluczy. Wybierz nazwę, którą z
łatwością zidentyfikujesz później na liście.
[Algorytm podpisu]
Wybierz algorytm podpisu z rozwijanej listy.
[Algorytm klucza]
Do wygenerowania pary kluczy stosuje się algorytm RSA lub ECDSA. Długość klucza należy wybrać z listy
rozwijanej. Im dłuższy jest klucz, tym wolniej odbywa się komunikacja. Jednocześnie jednak poziom
bezpieczeństwa wzrasta.
● Przy ustawianiu wartości długości klucza nie można wybrać opcji [512 bitów], jeżeli wybrano
opcję [SHA384] lub [SHA512] dla ustawienia [Algorytm podpisu].
[Ustawienia żądania podpisania certyfikatu]
[Kraj/region]
Należy tu wpisać internetowy kod kraju.
[Stan]/[Miasto]
Wprowadź znaki alfanumeryczne w polach lokalizacji.
[Organizacja]/[Jednostka organizacyjna]
Wprowadź znaki alfanumeryczne w nazwy organizacji.
[Wspólna nazwa]
289
Zabezpieczenia
Wprowadź pospolitą nazwę certyfikatu składająca się ze znaków alfanumerycznych. „Nazwa pospolita”
jest często skrótowo oznaczana jako „CN”.
Aby wykonać drukowanie IPPS, należy w polu [Wspólna nazwa] wpisać „adres IP” lub „<nazwa
hosta>.<nazwa domeny>”, używane do łączenia się przez IPPS.
● Adres IP należy wprowadzać, gdy jest on stały.
● W przypadku korzystania z serwera DNS należy wprowadzić wartości „<nazwa hosta>.<nazwa
domeny>”. Włączanie protokołu IPP/IPPS(P. 172)
7
Kliknij [OK].
● Generowanie klucza i żądania podpisania certyfikatu (CSR) może trwać około 10–15 minut.
8
Kliknij [Zapisz w pliku].
● Zostanie wyświetlone okno dialogowe zapisywania pliku. Wybierz, gdzie chcesz zapisać plik i kliknij przycisk
[Zapisz].
➠ Klucz i żądanie podpisania certyfikatu (CSR) są przechowywane na komputerze.
9
Dołącz zapisany plik i wyślij wniosek do urzędu certyfikacji.
◼ Rejestrowanie certyfikatu cyfrowego wydanego przez urząd certyfikacji.
Z pary kluczy wygenerowanych przez żądanie podpisania certyfikatu (CSR) nie można korzystać do momentu
zarejestrowania certyfikatu. Certyfikat cyfrowy wydany przez urząd certyfikacji należy zarejestrować, korzystając z
poniższej procedury.
1
2
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
290
Zabezpieczenia
3
Kliknij [Zabezpieczenia]
4
Kliknij [Nazwa klucza] lub [Certyfikat], aby zarejestrować certyfikat.
5
Kliknij [Zarejestruj certyfikat].
6
[Ustawienia klucza i certyfikatu].
Kliknij przycisk [Przeglądaj] w oknie [Ścieżka do pliku], wybierz plik żądania
podpisania certyfikatu, a następnie kliknij przycisk [Zarejestruj].
ŁĄCZA
Używanie wygenerowanych przez CA par kluczy i certyfikatów cyfrowych(P. 293)
Weryfikowanie par kluczy i certyfikatów cyfrowych(P. 296)
291
Zabezpieczenia
Korzystanie z protokołu TLS do komunikacji szyfrowanej(P. 265)
Konfiguracja ustawień protokołu IPSec(P. 269)
292
Zabezpieczenia
Używanie wygenerowanych przez CA par kluczy i
certyfikatów cyfrowych
6869-042
Pary kluczy i certyfikaty cyfrowe do użytku z urządzeniem można uzyskać od urzędu certyfikacji (CA). Pliki te można
przechowywać i zarejestrować je później za pomocą Zdalnego interfejsu użytkownika. Należy dopilnować, aby para
kluczy i certyfikat były zgodne z wymaganiami urządzenia ( Rejestracja kluczy i certyfikatów(P. 583) ). Można
zarejestrować maksymalnie 8 par kluczy (łącznie z tymi fabrycznie zainstalowanymi) i do 150 certyfikatów urzędu
certyfikacji (łącznie z fabrycznie zainstalowanymi 72 certyfikatami).
1
2
3
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
Kliknij kolejno [Zabezpieczenia]
certyfikatu CA].
[Ustawienia klucza i certyfikatu] lub [Ustawienia
● Kliknij [Ustawienia klucza i certyfikatu], aby zainstalować parę kluczy lub [Ustawienia certyfikatu CA], aby
zainstalować certyfikat CA.
293
Zabezpieczenia
4
Kliknij pozycję [Rejestrowanie klucza i certyfikatu] lub [Zarejestruj certyfikat CA].
Usuwanie zarejestrowanej pary kluczy lub certyfikatu CA
● Kliknij przycisk [Usuń] umieszczony po prawej stronie pary kluczy lub certyfikatu CA, które chcesz usunąć
kliknij przycisk [OK].
● Nie można usunąć pary kluczy, która jest obecnie używana do innych celów, np. gdy elementy „[TLS]” lub
„[IEEE 802.1X]” są wyświetlane w pozycji [Zastosowanie klucza]. W takiej sytuacji należy wyłączyć daną
funkcję lub zamienić parę kluczy przed jej usunięciem. Nie można usunąć fabrycznie zainstalowanych
certyfikatów CA.
5
Kliknij [Instaluj].
Usuwanie pary kluczy lub certyfikatu CA
● Kliknij przycisk [Usuń] znajdujący się po prawej stronie pliku, który chcesz usunąć, a następnie kliknij
przycisk [OK].
6
Kliknij przycisk [Przeglądaj], wybierz plik, który chcesz zainstalować i kliknij opcję
[Rozpocznij instalację].
294
Zabezpieczenia
● Na urządzeniu zainstalowano parę kluczy lub certyfikat CA.
7
Zarejestruj parę kluczy lub certyfikat CA.
Rejestrowanie pary kluczy
1
Kliknij opcję [Zarejestruj] po prawej stronie pary kluczy, którą chcesz zarejestrować.
2
Wprowadź kolejno nazwę pary kluczy i hasło, a następnie kliknij przycisk [OK].
[Nazwa klucza]
Używając znaków alfanumerycznych, należy w tym polu wprowadzić nazwę rejestrowanej pary kluczy.
[Hasło]
Używając znaków alfanumerycznych, należy w tym polu wprowadzić hasło prywatnego klucza dla
rejestrowanego pliku.
Rejestrowanie certyfikatu CA
Kliknij opcję [Zarejestruj] po prawej stronie certyfikatu CA, który chcesz zarejestrować.
ŁĄCZA
Generowanie par kluczy(P. 285)
Weryfikowanie par kluczy i certyfikatów cyfrowych(P. 296)
Korzystanie z protokołu TLS do komunikacji szyfrowanej(P. 265)
Konfiguracja ustawień protokołu IPSec(P. 269)
Konfiguracja uwierzytelniania zgodnego z IEEE 802.1X(P. 279)
295
Zabezpieczenia
Weryfikowanie par kluczy i certyfikatów cyfrowych
6869-043
Po zakończeniu rejestracji par kluczy i certyfikatów CA można wyświetlić szczegółowe informacje lub zweryfikować je
pod kątem ważności i podpisu.
1
2
3
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Kliknij [Ustawienia/Rejestracja].
Kliknij kolejno [Zabezpieczenia]
certyfikatu CA].
[Ustawienia klucza i certyfikatu] lub [Ustawienia
● Kliknij [Ustawienia klucza i certyfikatu], aby zweryfikować parę kluczy lub [Ustawienia certyfikatu CA], aby
zweryfikować certyfikat CA.
4
Kliknij ikonę odpowiadającą parze kluczy lub certyfikatowi, dla którego chcesz
przeprowadzić weryfikację.
296
Zabezpieczenia
● Na tym ekranie można przeglądać szczegóły dotyczące certyfikatu.
5
Sprawdź szczegóły certyfikatu i kliknij przycisk [Weryfikacja certyfikatu].
● Wyniki weryfikacji certyfikatu są wyświetlane w sposób przedstawiony poniżej.
ŁĄCZA
Generowanie par kluczy(P. 285)
Używanie wygenerowanych przez CA par kluczy i certyfikatów cyfrowych(P. 293)
297
Korzystanie ze Zdalnego interfejsu użytkownika
Korzystanie ze Zdalnego interfejsu
użytkownika
Korzystanie ze Zdalnego interfejsu użytkownika ....................................................................... 299
Uruchamianie Zdalnego interfejsu użytkownika ............................................................................................ 300
Ekrany zdalnego interfejsu użytkownika ........................................................................................................ 303
Zarządzanie dokumentami i sprawdzanie stanu urządzenia ......................................................................... 309
Umożliwianie użytkownikom końcowym obsługiwanie dokumentów ........................................................... 315
Konfiguracja opcji menu ze Zdalnego interfejsu użytkownika ...................................................................... 317
Zapisywanie/ładowanie zarejestrowanych danych ........................................................................................ 319
Zapisywanie zarejestrowanych danych ......................................................................................................... 320
Ładowanie zarejestrowanych danych ........................................................................................................... 322
298
Korzystanie ze Zdalnego interfejsu użytkownika
Korzystanie ze Zdalnego interfejsu użytkownika
6869-044
Istnieje możliwość sprawdzenia kolejki drukowania lub stanu urządzenia poprzez zdalną obsługę urządzenia z
poziomu przeglądarki internetowej. Można również konfigurować niektóre z ustawień urządzenia. Dzięki temu zadania
związane z zarządzaniem systemem można łatwo wykonywać, nie wstając od biurka. Więcej informacji na temat
wymagań systemu dotyczących Zdalnego interfejsu użytkownika, patrz Środowisko systemowe(P. 586) .
Funkcje zdalnego interfejsu użytkownika
Zarządzanie dokumentami i sprawdzanie stanu urządzenia(P. 309)
Konfiguracja opcji menu ze Zdalnego interfejsu użytkownika(P. 317)
Zapisywanie/ładowanie zarejestrowanych danych(P. 319)
Podstawowe informacje o zdalnym interfejsie użytkownika
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
Ekrany zdalnego interfejsu użytkownika(P. 303)
299
Korzystanie ze Zdalnego interfejsu użytkownika
Uruchamianie Zdalnego interfejsu użytkownika
6869-045
Do zdalnej obsługi niezbędne jest wpisanie adresu IP urządzenia w przeglądarce internetowej i uruchomienie
Zdalnego interfejsu użytkownika. W pierwszej kolejności należy sprawdzić, czy został ustawiony adres IP urządzenia
( Wydruk stanu sieci(P. 481) ). W przypadku wątpliwości należy skontaktować się z administratorem sieci.
1
2
Uruchom przeglądarkę internetową.
Wprowadź adres „http://(adres IP urządzenia)/” w polu adresu przeglądarki i naciśnij
klawisz [ENTER].
● Jeśli chcesz użyć adresu IPv6, zamknij go w nawiasach (przykład: http://[fe80::2e9e:fcff:fe4e:dbce]/).
Korzystanie z serwera DNS
● Zamiast wartości „Adres IP urządzenia” należy wprowadzić ciąg „<nazwa hosta urządzenia>.<nazwa
domeny>” (przykład: https://moja_drukarka.przyklad.com/).
Jeżeli zostanie wyświetlony alarm zabezpieczeń
● Jeżeli komunikacja ze Zdalnym interfejsem użytkownika jest szyfrowana, może zostać wyświetlony alert
zabezpieczeń. ( Korzystanie z protokołu TLS do komunikacji szyfrowanej(P. 265) ). Jeżeli ustawienia
certyfikatu oraz ustawienia TLS nie zawierają błędów, można kontynuować przeglądanie witryny.
3
Zaloguj się w interfejsie Zdalny interfejs użytkownika.
Kiedy funkcja Zarządzanie identyfikatorami wydziałów jest wyłączona
Wybierz opcję [Tryb zarządzania] lub [Tryb użytkownika ogólnego].
[Tryb zarządzania]
Pozwala wykonywać wszystkie operacje i konfigurować wszystkie ustawienia w Zdalnym interfejsie
użytkownika. Wprowadź hasło menedżera systemu w polu [Hasło].
300
Korzystanie ze Zdalnego interfejsu użytkownika
● Domyślne hasło menedżera systemu to „7654321”.
Ustawianie hasła menedżera systemu(P. 221)
[Tryb użytkownika ogólnego]
Można sprawdzić status dokumentów lub urządzenia, a także zmienić niektóre ustawienia. Jeśli chcesz
usunąć drukowane dokumenty, wprowadź nazwę użytkownika dokumentów w polu [Nazwa użytkownika].
Nazwa użytkownika jest automatycznie ustawiana w celu drukowania dokumentów w oparciu o informacje
takie, jak nazwa komputera czy nazwa logowania na komputerze.
Informacje na temat opcji [Nazwa użytkownika]
● Domyślnie opcja [Nazwa użytkownika] nie jest wyświetlana, aby uniemożliwić użytkownikom obsługę
dokumentów. Aby włączyć możliwość obsługi dokumentów w trybie użytkownika ogólnego, należy
zalogować się w trybie zarządzania i włączyć opcję [Zezwól na wykonanie zadania użytkownika
ogólnego]. Umożliwianie użytkownikom końcowym obsługiwanie dokumentów(P. 315)
[Kod PIN dostępu do zdalnego interfejsu użytkownika]
Jeżeli wyświetla się element [Kod PIN dostępu do zdalnego interfejsu użytkownika], należy wprowadzić kod
PIN ( Ustawiania kodu PIN Zdalnego interfejsu użytkownika(P. 232) ).
Kiedy funkcja Zarządzanie identyfikatorami wydziałów jest włączona
Wprowadź poprawny identyfikator w [ID wydziału] oraz PIN w [PIN] (
identyfikatorami wydziałów(P. 224) ).
4
Konfiguracja funkcji Zarządzanie
Kliknij [Zaloguj się].
➠ Zostanie wyświetlona strona portalu (strona główna).
301
Ekrany zdalnego interfejsu użytkownika(P. 303)
Korzystanie ze Zdalnego interfejsu użytkownika
302
Korzystanie ze Zdalnego interfejsu użytkownika
Ekrany zdalnego interfejsu użytkownika
6869-046
W tej części opisano typowe ekrany Zdalnego interfejsu użytkownika.
Strona portalu (strona główna)(P. 303)
Strona [Monitor stanu/Anuluj](P. 305)
Strona [Ustawienia/Rejestracja](P. 306)
Strona [Skrzynka](P. 307)
Strona [Bezpośredni wydruk](P. 308)
Strona portalu (strona główna)
[Wyloguj się]
Wylogowanie ze Zdalnego interfejsu użytkownika. Zostanie wyświetlona strona logowania.
[E-mail do menadżera systemu]
Wyświetla okno do utworzenia adresu e-mail dla menedżera systemu określonego w [Ustawienia
zarządzania] podlegającego pod [Zabezpieczenia].
Ikona odświeżania
Odświeża stronę wyświetlaną w danym momencie.
303
Korzystanie ze Zdalnego interfejsu użytkownika
Podstawowe informacje o urządzeniu
Wyświetla bieżący stan urządzenia i informacje o błędach. W przypadku wystąpienia błędu wyświetlana jest
strona Informacje o błędzie.
Informacje o materiałach eksploatacyjnych
Są tu wyświetlane informacje o papierze (liczba pozostałych arkuszy, format itd.) oraz stanie zasobników z
tonerem i innych materiałów eksploatacyjnych.
Forum
Wyświetla komunikat od menedżera systemu zdefiniowany w ustawieniu [Forum/link obsługi] w opcji
[Ustawienia/Rejestracja] [Licencja/Inne].
Link obsługi
Wyświetla łącze tekstowe do obsługi informacji o urządzeniu zdefiniowanych w ustawieniu [Forum/link
obsługi] w opcji [Ustawienia/Rejestracja] [Licencja/Inne].
[Monitor stanu/Anuluj]
Wyświetla stronę [Monitor stanu/Anuluj]. Możesz użyć tej strony aby sprawdzić aktualny status drukowania,
anulować przetwarzanie drukowania i wyświetlić historię zadań drukowania.
[Ustawienia/Rejestracja]
Wyświetla stronę [Ustawienia/Rejestracja]. Po zalogowaniu się w trybie zarządzania można zmienić elementy
ustawień i zapisać lub załadować zarejestrowane dane. Konfiguracja opcji menu ze Zdalnego interfejsu
użytkownika(P. 317)
[Skrzynka] (tylko wówczas, gdy zainstalowana jest opcjonalna karta SD)
Wyświetla stronę [Skrzynka]. Umożliwia to drukowanie i usuwanie dokumentów zapisanych w urządzeniu.
Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)(P. 100)
[Bezpośredni wydruk]
Można wydrukować plik zapisany na komputerze bez otwierania go.
(Wydruk bezpośredni)(P. 110)
Drukowanie bez otwierania pliku
[Service Management Service]
Uruchamia usługę Service Management Service (SMS) używaną do zarządzania aplikacjami MEAP
(oprogramowania poprawiającego wydajność funkcji). Przewodnik po funkcji MEAP Application
Management
304
Korzystanie ze Zdalnego interfejsu użytkownika
Strona [Monitor stanu/Anuluj]
[Do portalu]
Powrót do strony portalu (strony głównej).
Menu
Po kliknięciu danego elementu zawartość zostaje wyświetlona na właściwej stronie.
dokumentami i sprawdzanie stanu urządzenia(P. 309)
Zarządzanie
Nawigacja krok po kroku
Wyświetla ciąg stron, które należy otworzyć, aby wyświetlić aktualną stronę. Można sprawdzić, która strona
jest aktualnie wyświetlana.
Ikona odświeżania
Odświeża stronę wyświetlaną w danym momencie.
Ikona Do góry
Powoduje przewinięcie zawartości okna do góry strony, jeśli jest przewinięta do dołu.
305
Korzystanie ze Zdalnego interfejsu użytkownika
Strona [Ustawienia/Rejestracja]
[Do portalu]
Powrót do strony portalu (strony głównej).
Menu
Po kliknięciu danego elementu zawartość zostaje wyświetlona na właściwej stronie.
menu ze Zdalnego interfejsu użytkownika(P. 317)
Konfiguracja opcji
Nawigacja krok po kroku
Wyświetla ciąg stron, które należy otworzyć, aby wyświetlić aktualną stronę. Można sprawdzić, która strona
jest aktualnie wyświetlana.
Ikona Do góry
Powoduje przewinięcie zawartości okna do góry strony, jeśli jest przewinięta do dołu.
Menu na stronie [Ustawienia/Rejestracja]
● Ustawienia na stronie [Ustawienia/Rejestracja] można zmienić dopiero po zalogowaniu się w trybie
zarządzania.
● Jeśli użytkownik zaloguje się w trybie użytkownika ogólnego, opcje [Menu podręczne], [Kalibracja],
[Sterowanie urządzeniem], [Zarządzanie ID wydziału] i [Import/eksport] nie są wyświetlane.
306
Korzystanie ze Zdalnego interfejsu użytkownika
Strona [Skrzynka]
[Do portalu]
Powrót do strony portalu (strony głównej).
[Skrzynka]
Wyświetla listę sektorów. Można otworzyć sektor, aby sprawdzić szczegółowe informacje na temat zapisanych
w nim dokumentów, wydrukować lub usunąć dokumenty. Drukowanie dokumentu zapisanego w
urządzeniu (Drukowanie zapisanego zadania)(P. 100)
Nawigacja krok po kroku
Wyświetla ciąg stron, które należy otworzyć, aby wyświetlić aktualną stronę. Można sprawdzić, która strona
jest aktualnie wyświetlana.
Ikona odświeżania
Odświeża stronę wyświetlaną w danym momencie.
Numer sektora
Można tu wprowadzić numer sektora i kliknąć [Otwórz], aby otworzyć sektor o wybranym numerze.
Lista sektorów
Aby otworzyć odpowiedni sektor, należy kliknąć łącze tekstowe dostępne w opcji [Numer skrzynki].
Ikona Do góry
Powoduje przewinięcie zawartości okna do góry strony, jeśli jest przewinięta do dołu.
307
Korzystanie ze Zdalnego interfejsu użytkownika
Strona [Bezpośredni wydruk]
[Do portalu]
Powrót do strony portalu (strony głównej).
Menu
Wyświetla stronę, na której można określić format pliku do wydrukowania za pomocą funkcji Wydruk
bezpośredni. Drukowanie bez otwierania pliku (Wydruk bezpośredni)(P. 110)
Nawigacja krok po kroku
Wyświetla ciąg stron, które należy otworzyć, aby wyświetlić aktualną stronę. Można sprawdzić, która strona
jest aktualnie wyświetlana.
Ikona Do góry
Powoduje przewinięcie zawartości okna do góry strony, jeśli jest przewinięta do dołu.
308
Korzystanie ze Zdalnego interfejsu użytkownika
Zarządzanie dokumentami i sprawdzanie stanu
urządzenia
6869-047
Sprawdzanie bieżącego stanu drukowanych dokumentów(P. 309)
Sprawdzanie historii dokumentów(P. 310)
Sprawdzanie informacji o błędzie(P. 311)
Sprawdzanie parametrów urządzenia(P. 311)
Sprawdzanie informacji o menedżerze systemu(P. 312)
Sprawdzanie łącznego licznika wydruków(P. 313)
Sprawdzanie historii zasobników z tonerem/zespołów bębna(P. 313)
● Nazwa pliku dokumentu może nie być wyświetlana w całości. Do nazwy pliku może zostać dopisana nazwa
aplikacji używanej do drukowania.
Sprawdzanie bieżącego stanu drukowanych dokumentów
Istnieje możliwość sprawdzenia stanu drukowania (w trakcie drukowania lub oczekujące na drukowanie) dokumentów
wskazanych do wydrukowania za pomocą komputera, a także usunięcia lub przerwania dokumentów.
Zaloguj się w Zdalnym interfejsie użytkownika ( Uruchamianie Zdalnego interfejsu
użytkownika(P. 300) ) [Monitor stanu/Anuluj] [Stan zadania]
[Anuluj]
Można usuwać dokumenty, które są w danym momencie drukowane lub oczekują na wydrukowanie.
[Przerwanie] *
Tymczasowo zatrzymuje zadanie drukowania, które jest aktualnie w toku i uruchamia określone zadanie
drukowania. W przypadku przerwanego zadania drukowania drukowanie pozostałych stron rozpocznie się
natychmiast po zakończeniu przerwania zadania drukowania.
309
Korzystanie ze Zdalnego interfejsu użytkownika
[Wydruk priorytetowy] *
Przesuwa dokument oczekujący w kolejne na wydrukowanie o jedno miejsce w górę.
[Pauza] */[Wznów] *
Naciśnięcie przycisku [Pauza] pozwala tymczasowo zatrzymać bieżące zadanie drukowania. Naciśnięcie
przycisku [Wznów] uruchamia ponownie zatrzymane zadanie drukowania.
● W przypadku dokumentu zabezpieczonego lub zaszyfrowanego kliknięcie przycisku [Wznów] powoduje
wyświetlenie ekranu z prośbą o wprowadzenie kodu PIN. Wprowadź kod PIN i kliknij przycisk [OK].
*
(
Opcja nie jest wyświetlana, gdy ustawienie opcji <Przerwij wydruk> w menu ustawień panelu roboczego to <Wyłącz>
Przerwij wydruk(P. 339) ).
● Stan wszystkich zadań drukowania jest wyświetlany niezależnie od ustawień zarządzania
identyfikatorami wydziałów.
● Domyślne ustawienia fabryczne uniemożliwiają wykonywanie niektórych operacji, takich jak usuwanie
dokumentu do wydrukowania lub przerywanie zadania drukowania, w trybie użytkownika ogólnego.
Aby włączyć możliwość obsługi dokumentów w trybie użytkownika ogólnego, należy zalogować się w
trybie zarządzania i włączyć opcję [Zezwól na wykonanie zadania użytkownika ogólnego].
Umożliwianie użytkownikom końcowym obsługiwanie dokumentów(P. 315)
● Jeśli podczas logowania w trybie zwykłego użytkownika użytkownik poda swoją nazwę, nazwa
użytkownika pojawi się jedynie na wydrukowanych dokumentach.
● Kliknij opcję [Nr zadania] na dokumentach o wstrzymanym statusie drukowania oraz dokumentach
chronionych w celu uzyskania szczegółowych informacji. Można sprawdzić nazwę użytkownika i liczbę
stron drukowanego dokumentu.
Sprawdzanie historii dokumentów
Historia drukowania i historia odbierania wiadomości e-mail są wyświetlane w formie listy.
Zaloguj się w Zdalnym interfejsie użytkownika ( Uruchamianie Zdalnego interfejsu
użytkownika(P. 300) ) [Monitor stanu/Anuluj] [Rejestr zadania]
310
Korzystanie ze Zdalnego interfejsu użytkownika
[Rejestr zadania] (Wydruk)
Historię drukowania można wyświetlić dla każdego rodzaju wydruku.
[Rejestr zadania] (E-mail RX)
Umożliwia wyświetlenie historii odbioru wiadomości e-mail. Jeśli podczas odbioru wiadomości e-mail wystąpi
błąd, odpowiedni kod błędu jest wyświetlany w sekcji [Wyniki RX]. Kody błędów odbioru
wiadomości(P. 584)
[Wyświetl] (tylko historia drukowania)
Po wybraniu typu wydruku z listy rozwijanej i kliknięciu opcji [Wyświetl] historia wybranego typu wydruku
zostanie wyświetlona w formie listy.
● Jeśli opcjonalna karta SD nie jest zainstalowana w urządzeniu, historia zostanie skasowana po wyłączeniu
urządzenia lub wykonaniu resetu sprzętowego.
● Jeśli użytkownik zaloguje się na urządzeniu w trybie użytkownika ogólnego, gdy opcja [Zezwól na wykonanie
zadania użytkownika ogólnego] jest włączona, nazwy dokumentów, które do niego nie należą, nie są
wyświetlane i zamiast nich widać gwiazdki, np. „********”. Umożliwianie użytkownikom końcowym
obsługiwanie dokumentów(P. 315)
Sprawdzanie informacji o błędzie
Jeśli wystąpi błąd, po kliknięciu komunikatu wyświetlonego w części [Informacje o błędzie] na stronie portalu (stronie
głównej) zostanie wyświetlona ta strona. Strona portalu (strona główna)(P. 303)
Zaloguj się w Zdalnym interfejsie użytkownika ( Uruchamianie Zdalnego interfejsu
użytkownika(P. 300) ) [Monitor stanu/Anuluj] [Informacje o błędzie]
Sprawdzanie parametrów urządzenia
Można wyświetlić informacje z uwzględnieniem maksymalnej prędkości drukowania i funkcji urządzenia.
311
Korzystanie ze Zdalnego interfejsu użytkownika
Zaloguj się w Zdalnym interfejsie użytkownika ( Uruchamianie Zdalnego interfejsu
użytkownika(P. 300) ) [Monitor stanu/Anuluj] [Opcje urządzenia]
Sprawdzanie informacji o menedżerze systemu
Wyświetlane są informacje o urządzeniu oraz menedżerze systemu. Informacje te odpowiadają informacjom
ustawionym w części [Zabezpieczenia] [Ustawienia zarządzania] na stronie [Ustawienia/Rejestracja] ( Ustawianie
hasła menedżera systemu(P. 221) ).
Zaloguj się w Zdalnym interfejsie użytkownika ( Uruchamianie Zdalnego interfejsu
użytkownika(P. 300) ) [Monitor stanu/Anuluj] [Informacje o urządzeniu]
312
Korzystanie ze Zdalnego interfejsu użytkownika
Sprawdzanie łącznego licznika wydruków
Wyświetlana jest łączna liczba wydrukowanych stron.
Zaloguj się w Zdalnym interfejsie użytkownika ( Uruchamianie Zdalnego interfejsu
użytkownika(P. 300) ) [Monitor stanu/Anuluj] [Sprawdź licznik]
Sprawdzanie historii zasobników z tonerem/zespołów bębna
Można sprawdzić dzienniki użycia zasobników z tonerem i zespołów bębna.
Zaloguj się w Zdalnym interfejsie użytkownika ( Uruchamianie Zdalnego interfejsu
użytkownika(P. 300) ) [Monitor stanu/Anuluj] [Rejestr pojemników]
313
Korzystanie ze Zdalnego interfejsu użytkownika
ŁĄCZA
Ekrany zdalnego interfejsu użytkownika(P. 303)
314
Korzystanie ze Zdalnego interfejsu użytkownika
Umożliwianie użytkownikom końcowym obsługiwanie
dokumentów
6869-048
Ustawienia można skonfigurować w taki sposób, aby można było usuwać lub przerywać dokumenty, nawet po
zalogowaniu się do Zdalnego interfejsu użytkownika w trybie użytkownika ogólnego.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zabezpieczenia]
4
Kliknij [Edytuj].
[Ustawienia zarządzania].
315
Korzystanie ze Zdalnego interfejsu użytkownika
5
6
Wprowadź hasło menedżera systemu w polu [Aktualne hasło menedżera systemu].
Zaznacz pole [Zezwól na wykonanie zadania użytkownika ogólnego] i kliknij przycisk
[OK].
[Zezwól na wykonanie zadania użytkownika ogólnego]
Po zaznaczeniu tego pola wyboru użytkownicy ogólni będą mogli obsługiwać te dokumenty, których nazwa
użytkownika jest zgodna z nazwą użytkownika użytą do logowania. Aby nie zezwalać użytkownikom ogólnym
na obsługę dokumentów, należy usunąć zaznaczenie tego pola.
ŁĄCZA
Ekrany zdalnego interfejsu użytkownika(P. 303)
316
Korzystanie ze Zdalnego interfejsu użytkownika
Konfiguracja opcji menu ze Zdalnego interfejsu
użytkownika
6869-049
Za pomocą Zdalnego interfejsu użytkownika można zmieniać różne ustawienia urządzenia. Większość ustawień można
konfigurować także w urządzeniu, ale niektóre z nich mogą zostać zmienione tylko za pomocą Zdalnego interfejsu
użytkownika.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknąć element menu do ustawienia, a następnie kliknąć opcję [Edytuj].
● Więcej informacji na temat menu ustawień można znaleźć w wyszczególnionych poniżej sekcjach
Pozycje menu
Odnośniki
Właściwości
Menu sterowania
Menu sterowania(P. 327)
Ustawienia źródła papieru
Menu wyboru podajnika(P. 491)
Sieć
Sieć(P. 347)
317
Korzystanie ze Zdalnego interfejsu użytkownika
Pozycje menu
Odnośniki
Układ
Układ(P. 369)
Jakość wydruku
Jakość wydruku(P. 373)
Konserwacja użytkownika
Konserw. użytkownika(P. 392)
Dane wyjściowe / sterowanie
Menu narzędzi
Drukowanie raportów i list(P. 541)
Menu zadań(P. 486)
Kalibracja
Korekcja niedopasowania kolorów i odcieni(P. 534)
Sterowanie urządzeniem
Nie można sterować stanem urządzenia.
Online klawisz(P. 28)
Miękki reset(P. 488)
Przechodzenie w tryb uśpienia(P. 68)
Ustawienia zarządzania
Zarządzanie identyfikatorami wydziałów
Konfiguracja funkcji Zarządzanie identyfikatorami
wydziałów(P. 224)
Zabezpieczenia
Zabezpieczenia(P. 216)
Import/Export
Zapisywanie/ładowanie zarejestrowanych danych(P. 319)
Licencja/inne
● Umożliwia zmianę komunikatów wyświetlanych na panelu
komunikatów oraz odnośnika do strony pomocy wyświetlanych na
stronie portalu (stronie głównej).
● Pozwala zarejestrować lub zaktualizować oprogramowanie
( Przewodnik po funkcjach rejestracji i aktualizacji
oprogramowania ).
● W niektórych krajach i regionach korzystanie z tej funkcji może być
niemożliwe.
ŁĄCZA
Ekrany zdalnego interfejsu użytkownika(P. 303)
Lista menu ustawień(P. 325)
318
Korzystanie ze Zdalnego interfejsu użytkownika
Zapisywanie/ładowanie zarejestrowanych danych
6869-04A
Dane opcji menu zarejestrowane w urządzeniu można zapisać na komputerze (eksportować). Dane zapisane na
komputerze można zarejestrować w urządzeniu (importować). Dane eksportowane z tego urządzenia można
importować do innego urządzenia o tym samym modelu. Można z łatwością kopiować różne dane ustawień na wiele
urządzeń. Użycie tych funkcji wymaga zalogowania się w trybie zarządzania.
Zapisywanie zarejestrowanych danych(P. 320)
Ładowanie zarejestrowanych danych(P. 322)
Nie należy wyłączać urządzenia do momentu ukończenia eksportu/importu
● Ukończenie tego procesu może zająć kilka minut. Wyłączenie urządzenia podczas wykonywania procesu
może spowodować uszkodzenie danych lub urządzenia.
Podczas procesu importu lub eksportu nie należy używać urządzenia
● Przed przystąpieniem do importu/eksportu danych należy upewnić się, że żadne zadania drukowania
dokumentów nie są aktualnie przetwarzane.
Importowanie/eksportowanie przy użyciu panelu sterowania
● Można również zapisać/wczytać dane ustawień za pośrednictwem urządzenia pamięci USB z poziomu panelu
roboczego urządzenia. Ust. impor./ekspor.(P. 414)
319
Korzystanie ze Zdalnego interfejsu użytkownika
Zapisywanie zarejestrowanych danych
6869-04C
Dane ustawień urządzenia można wyeksportować i zapisać na swoim komputerze. Zalecane jest regularne tworzenie
kopii zapasowej ważnych ustawień.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Import/eksport]
4
Wybierz ustawienia do wyeksportowania i ustaw hasło szyfrowania.
[Eksport].
320
Korzystanie ze Zdalnego interfejsu użytkownika
[Podstawowe informacje o ustawieniach/rejestracji]
Aby wyeksportować dane ustawień, które można ustawić z poziomu [Ustawienia/Rejestracja] na stronie
portalu, należy zaznaczyć to pole wyboru.
[Informacja o ustawieniach aplikacji MEAP]
Aby wyeksportować dane ustawień aplikacji MEAP, należy zaznaczyć to pole wyboru.
[Wszystkie informacje o konfigurowaniu PDL]
Aby wyeksportować dane ustawień, które można określić w oknie
drukowania(P. 423) , zaznacz to pole wyboru.
Ustawienia specyficzne dla trybu
[Hasło szyfrowania]
Należy wpisać tu hasło (znaki) dla szyfrowania danych do wyeksportowania. Wprowadź to samo hasło w polu
[Potwierdź]. Jeśli hasło nie zostanie ustawione, nie można eksportować danych.
● Podanie hasła jest wymagane
zarejestrowanych danych(P. 322)
5
6
przy
importowaniu
wyeksportowanych
danych.
Kliknij [Rozpocznij eksportowanie].
Wykonaj polecenia wyświetlane na ekranie, aby podać lokalizację zapisu
eksportowanych danych ustawień.
➠ Dane ustawień zostaną zapisane.
ŁĄCZA
Ekrany zdalnego interfejsu użytkownika(P. 303)
Lista menu ustawień(P. 325)
321
Ładowanie
Korzystanie ze Zdalnego interfejsu użytkownika
Ładowanie zarejestrowanych danych
6869-04E
Ładuje (importuje) dane, które zostały wyeksportowane z urządzenia. Można również zaimportować ustawienia z
innego urządzenia, o ile jest to taki sam model urządzenia.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Import/eksport]
4
Wskaż importowany plik ustawień, a następnie wprowadź hasło.
[Import].
322
Korzystanie ze Zdalnego interfejsu użytkownika
[Ścieżka do pliku]
Kliknij opcję [Przeglądaj] i wybierz plik.
[Hasło deszyfrowania]
Wprowadź hasło, z którym ustawienia zostały wyeksportowane.
5
Kliknij [Rozpocznij importowanie].
6
Kliknij [OK].
➠ Wskazane dane ustawień zostaną zaimportowane do urządzenia.
7
Kliknij [Uruchom ponownie].
➠ Po ponownym uruchomieniu urządzenia ustawienia zostaną aktywowane.
ŁĄCZA
Ekrany zdalnego interfejsu użytkownika(P. 303)
Lista menu ustawień(P. 325)
323
Lista menu ustawień
Lista menu ustawień
Lista menu ustawień .................................................................................................................................... 325
Menu konfiguracji ............................................................................................................................................. 326
Menu sterowania .......................................................................................................................................... 327
Źródło papieru .............................................................................................................................................. 346
Sieć ............................................................................................................................................................... 347
Układ ............................................................................................................................................................ 369
Jakość wydruku ............................................................................................................................................. 373
Interfejs ........................................................................................................................................................ 388
Konserw. użytkownika .................................................................................................................................. 392
Priorytet pozycji menu ustawień ............................................................................................................ 420
Tryb wydruku ............................................................................................................................................... 421
Ustawienia specyficzne dla trybu drukowania .............................................................................................. 423
UFR II ..................................................................................................................................................... 424
PCL ........................................................................................................................................................ 425
Przetwarzanie obrazu ............................................................................................................................ 431
XPS ........................................................................................................................................................ 442
PDF ........................................................................................................................................................ 453
PS .......................................................................................................................................................... 464
Ustawienia MEAP .......................................................................................................................................... 475
Sprawdź licznik ............................................................................................................................................. 477
Zainicjuj menu .............................................................................................................................................. 479
Menu podręczne ................................................................................................................................................ 480
Menu zadań ....................................................................................................................................................... 486
Menu resetowania ............................................................................................................................................ 488
Menu wyboru podajnika ................................................................................................................................... 491
324
Lista menu ustawień
Lista menu ustawień
6869-04F
To urządzenie oferuje różne zestawy ustawień. Istnieje możliwość ich precyzyjnej konfiguracji. Można je zdefiniować z
poziomu ekranów menu na panelu roboczym.
UWAGA
Priorytet ustawień
● Ustawienia skonfigurowane w sterowniku drukarki są
nadrzędne w stosunku do tych określonych na poziomie
panelu sterowania.
● W przypadku wykonywania drukowania bezpośredniego
przez USB lub drukowania bezpośredniego ustawienia
określone dla drukowania lub przechowywane w danych
TIFF są nadrzędne w stosunku do tych określonych na
poziomie panelu sterowania.
● Ustawienia można wydrukować w formie listy, co pozwala na sprawdzenie ich bieżącego stanu:
Strona konfiguracji(P. 481)
Wydruk stanu sieci(P. 481)
325
Lista menu ustawień
Menu konfiguracji
6869-04H
Można zdefiniować ustawienia środowiska roboczego urządzenia oraz drukowania.
(
) na panelu roboczym zostanie wyświetlone
Po naciśnięciu przycisku
menu Konfiguracja, w którym dla każdej funkcji zostaną wyświetlone pozycje
ustawień.
Menu sterowania(P. 327)
Źródło papieru(P. 346)
Sieć(P. 347)
Układ(P. 369)
Jakość wydruku(P. 373)
Interfejs(P. 388)
Konserw. użytkownika(P. 392)
Tryb wydruku(P. 421)
Ustawienia specyficzne dla trybu drukowania(P. 423)
Ustawienia MEAP(P. 475)
Sprawdź licznik(P. 477)
Zainicjuj menu(P. 479)
326
Lista menu ustawień
Menu sterowania
6869-04J
Lista ustawień dotyczących trybu uśpienia i zachowania urządzenia w przypadku
wystąpienia błędu zawiera krótkie opisy. Ustawienia domyślne oznaczone są przy
pomocy znaku ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w przypadku niektórych używanych
opcji lub innych ustawień.
Tryb uśpienia(P. 327)
Uśp. mimo wyst. bł.(P. 328)
Gł. uśp. prior. eko(P. 328)
Czas przes. uśpienia(P. 328)
Uśpienie z USB(P. 329)
Ustawienia zegara(P. 329)
Autom. pomij. błędu(P. 331)
Język(P. 331)
Alarm(P. 331)
Pokaż ostrzeżenia(P. 332)
Czynn. przy ostrzeż.(P. 335)
Ustaw. daty/czasu(P. 337)
Szybk. wł. zasilania(P. 339)
Karta SD(P. 339)
Przerwij wydruk(P. 339)
Czas us. zab. wydr.(P. 340)
Rejestr zabez. zadań(P. 340)
System operacyjny(P. 340)
Wybór PDL (PnP)(P. 341)
Ustaw. zarządzania(P. 341)
RMT-SW(P. 342)
Regulacja ekranu(P. 342)
Animowane instrukcje(P. 343)
Pokaż wskaź. tonera(P. 343)
Pow. o wprow. ustaw.(P. 343)
Spr. ustaw. papieru(P. 344)
Prędkość przewijania(P. 344)
Canon Genuine Mode(P. 344)
Tryb uśpienia
Funkcja trybu uśpienia pozwala ograniczyć pobór energii przez urządzenie poprzez tymczasowe zatrzymanie operacji
wewnętrznych. Należy określić poziom trybu uśpienia. Przechodzenie w tryb uśpienia(P. 68)
Wysoki (głęb. uśp.)
Śred. (uśp. drukar.)
Poziomy tryb uśpienia
● Zastosowanie ustawienia <Śred. (uśp. drukar.)> pozwala zmniejszyć zużycie energii w mniejszym stopniu, a
wybranie ustawienia <Wysoki (głęb. uśp.)> w większym.
Używanie oprogramowania narzędziowego związanego z siecią
● Wybranie ustawienia <Wysoki (głęb. uśp.)> może uniemożliwić komunikację z oprogramowaniem
narzędziowym.
327
Lista menu ustawień
Uśp. mimo wyst. bł.
Pozwala określić, czy w przypadku wystąpienia błędu tryb uśpienia ma być włączany automatycznie.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Uśp. mimo wyst. bł.>
<Wyłącz> lub <Włącz>
Gł. uśp. prior. eko
Wybierz, czy pobór mocy ma być w dalszym stopniu ograniczany, gdy urządzenie i komputer są podłączone za
pośrednictwem USB.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Gł. uśp. prior. eko>
<Wyłącz> lub
<Włącz>
● Może się zdarzyć, że podczas wykonywania czynności drukowania, gdy ustawienie tej pozycji to
<Włącz>, urządzenie nie będzie wychodziło z trybu uśpienia. W takim przypadku należy nacisnąć
przycisk
, aby zakończyć tryb uśpienia.
Czas przes. uśpienia
Jeżeli przez określony przedział czasu urządzenie nie było używane lub nie były drukowane żadne dane, urządzenie
przechodzi w tryb uśpienia w celu zmniejszenia zużycia energii (automatyczne uśpienie). Możliwe jest ustawienie
przedziału czasu, po upływie którego urządzenie automatycznie przechodzi w tryb uśpienia. Zalecane jest korzystanie z
ustawień fabrycznych pozwalających zaoszczędzić najwięcej energii. Przechodzenie w tryb uśpienia(P. 68)
1 min
5 min
10 min
15 min
30 min
60 min
328
Lista menu ustawień
Uśpienie z USB *
Pozwala wybrać, czy urządzenie ma przechodzić w tryb uśpienia podczas korzystania z szyfrowania USB na NW w celu
uzyskania dostępu do urządzenia USB przy użyciu komputera i za pośrednictwem sieci. Ustaw. zaawan. funk.
(P. 388)
Nie zezwalaj
Zezwól
(
)
<Menu sterowania>
<Uśpienie z USB>
<Nie zezwalaj> lub <Zezwól>
Ustawienia zegara
Można zdefiniować ustawienia dla operacji urządzenia oraz czasu związane z trybem uśpienia, a także ustawienia dla
funkcji automatycznego resetowania, która polega na wyświetlaniu ekranu głównego, gdy przez określony odcinek
czasu nie zostanie naciśnięty żaden przycisk.
Budzik
Pozwala wybrać, czy urządzenie ma automatycznie wychodzić z trybu uśpienia o określonym czasie.
Przechodzenie w tryb uśpienia(P. 68)
Wyłącz
Włącz
Pobudka
Jeśli ustawienie opcji <Budzik> to <Włącz>, należy ustawić czas wyjścia z trybu uśpienia.
tryb uśpienia(P. 68)
00:00 do 12:00
Przechodzenie w
do 23:59
Czas autom. resetu
Jeśli przez określony okres czasu nie zostanie naciśnięty żaden przycisk, nastąpi automatyczny powrót z
bieżącego ekranu menu do ekranu głównego, a urządzenie powrócić do trybu online (Automatyczny reset).
Należy określić częstotliwość automatycznego resetowania. Aby wyłączyć funkcję automatycznego resetowania,
należy wybrać opcję <Wyłącz>.
Wyłącz
10 s
20 s
30 s
40 s
50 s
1 min
2 min
3 min
4 min
5 min
6 min
329
Lista menu ustawień
7 min
8 min
9 min
(
)
<Menu sterowania>
resetu>
<Ustawienia zegara>
<Czas autom.
Wybierz wartość czasu
Zegar czasu uśpienia
Pozwala wybrać, czy urządzenie ma automatycznie przechodzić w tryb uśpienia o określonym czasie.
Przechodzenie w tryb uśpienia(P. 68)
Wyłącz
Włącz
Czas uśpienia
Jeśli ustawienie opcji <Zegar czasu uśpienia> to <Włącz>, należy ustawić czas przejścia w tryb uśpienia.
Przechodzenie w tryb uśpienia(P. 68)
00:00 do 12:00
do 23:59
Zegar kalibracji
Można wybrać automatyczne przeprowadzanie kalibracji o określonym czasie.
Wyłącz
Włącz
(
)
kalibracji>
<Menu sterowania>
<Ustawienia zegara>
<Zegar
<Wyłącz> lub <Włącz>
Czas kalibracji
Jeśli ustawienie opcji <Zegar kalibracji> to <Włącz>, należy ustawić czas wykonywania kalibracji.
00:00 do 12:00
do 23:59
(
kalibracji>
)
<Menu sterowania>
<Ustawienia zegara>
Ustaw godzinę
330
<Czas
Lista menu ustawień
Autom. pomij. błędu
Jeśli podczas drukowania wystąpi błąd, drukowanie jest zatrzymywane. Aby kontynuować drukowanie nawet po
wystąpieniu błędu, należy wybrać ustawienie <Włącz>. Listę błędów, po których wystąpieniu można kontynuować
drukowanie bieżącego zadania, gdy wybrano wspomniane ustawienie, można znaleźć w części „Rozwiązywanie
problemów (FAQ)” na stronie internetowej podręcznika.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Autom. pomij. błędu>
<Wyłącz> lub <Włącz>
Język
Pozwala zmienić język wyświetlany na ekranie panelu roboczego, na ekranie logowania Zdalnego interfejsu
użytkownika i na listach ustawień.
Čeština
Dansk
Deutsch
English
Español
Français
Italiano
Magyar
Nederlands
Norsk
Polski
Português
Русский
Suomi
Svenska
Türkçe
中文(简体)
한국어
(
)
<Menu sterowania>
<Język>
Wybierz język
Alarm
Pozwala określić, czy urządzenie ma emitować sygnał dźwiękowy w przypadku wystąpienia problemu, takiego jak
zakleszczenie papieru lub błąd obsługi.
331
Lista menu ustawień
Wyłącz
Włącz
(
)
<Menu sterowania>
<Alarm>
<Wyłącz> lub <Włącz>
Pokaż ostrzeżenia
Wybierz, czy informacje o ostrzeżeniach mają być wyświetlane w formie komunikatów, gdy urządzenie przejdzie w stan
ostrzeżenia.
Spr./wy. poj. z ton.
Wybierz, czy ma być wyświetlany komunikat, gdy zbliża się czas wymiany zasobnika z tonerem.
Wyłącz
Włącz
(
)
ton.>
<Menu sterowania>
<Pokaż ostrzeżenia>
<Spr./wy. poj. z
<Wyłącz> lub <Włącz>
Ter. waż.poj. z ton.
Wybierz, czy ma być wyświetlany komunikat, gdy upłynie termin ważności zasobnika z tonerem.
Wyłącz
Włącz
(
)
ton.>
<Menu sterowania>
<Pokaż ostrzeżenia>
<Ter. waż.poj. z
<Wyłącz> lub <Włącz>
Spr./wy. kas. bęb.
Wybierz, czy ma być wyświetlany komunikat, gdy zbliża się czas wymiany zespołu bębna.
Wyłącz
Włącz
(
bęb.>
)
<Menu sterowania>
<Pokaż ostrzeżenia>
<Wyłącz> lub <Włącz>
332
<Spr./wy. kas.
Lista menu ustawień
Ter. ważn. kas. bęb.
Wybierz, czy ma być wyświetlany komunikat, gdy upłynie termin ważności zespołu bębna.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Pokaż ostrzeżenia>
<Ter. ważn. kas.
<Wyłącz> lub <Włącz>
bęb.>
Spr./wy. zes.utrwal.
Wybierz, czy ma być wyświetlany komunikat, gdy zbliża się czas wymiany zespołu utrwalacza.
Wyłącz
Włącz
(
)
zes.utrwal.>
<Menu sterowania>
<Pokaż ostrzeżenia>
<Spr./wy.
<Wyłącz> lub <Włącz>
Spr./wy. zespół ITB
Wybierz, czy ma być wyświetlany komunikat, gdy zbliża się czas wymiany zespołu ITB.
Wyłącz
Włącz
(
)
ITB>
<Menu sterowania>
<Pokaż ostrzeżenia>
<Spr./wy. zespół
<Wyłącz> lub <Włącz>
Spr./wy. poj.zuż.ton
Wybierz, czy ma być wyświetlany komunikat, gdy zbliża się czas wymiany pojemnika z zużytym tonerem.
Wyłącz
Włącz
(
)
poj.zuż.ton>
<Menu sterowania>
<Pokaż ostrzeżenia>
<Wyłącz> lub <Włącz>
333
<Spr./wy.
Lista menu ustawień
Spr./wym. 2. w. tr.
Wybierz, czy ma być wyświetlany komunikat, gdy zbliża się czas wymiany drugiej rolki transferowej zewnętrznej.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Pokaż ostrzeżenia>
<Spr./wym. 2. w.
<Wyłącz> lub <Włącz>
tr.>
Spr./wym. w. od./p.
Wybierz, czy ma być wyświetlany komunikat, gdy zbliża się czas wymiany rolki podajnika.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Pokaż ostrzeżenia>
<Spr./wym. w. od./
<Wyłącz> lub <Włącz>
p.>
Ter. waż. zesp. utr.
Wybierz, czy ma być wyświetlany komunikat, gdy upłynie termin ważności zespołu utrwalacza.
Wyłącz
Włącz
(
)
utr.>
<Menu sterowania>
<Pokaż ostrzeżenia>
<Ter. waż. zesp.
<Wyłącz> lub <Włącz>
Ter. waż. zesp. ITB
Wybierz, czy ma być wyświetlany komunikat, gdy upłynie termin ważności zespołu ITB.
Wyłącz
Włącz
(
ITB>
)
<Menu sterowania>
<Pokaż ostrzeżenia>
<Wyłącz> lub <Włącz>
334
<Ter. waż. zesp.
Lista menu ustawień
Pusta szuflada
Możliwość wyboru wyświetlania stosownego komunikatu, gdy zabraknie papieru w szufladzie na papier.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Pokaż ostrzeżenia>
<Pusta
<Wyłącz> lub <Włącz>
szuflada>
Błąd przes. e-maila
Pozwala określić, czy błąd komunikacji podczas drukowania wiadomości e-mail ma być sygnalizowany
wyświetleniem stosownego komunikatu.
Wyłącz
Włącz
(
)
maila>
<Menu sterowania>
<Pokaż ostrzeżenia>
<Błąd przes. e-
<Wyłącz> lub <Włącz>
Czynn. przy ostrzeż.
Umożliwia określenie sposobu zachowania urządzenia, gdy pojawia się komunikat o terminie ważności materiałów
eksploatacyjnych.
Spr./wy. poj. z ton.
Umożliwia określenie, czy drukowanie ma być zatrzymywane automatycznie, gdy zbliża się koniec ważności
zasobnika z tonerem.
Kontynuuj drukowanie
Zatrzymaj drukowanie
(
ton.>
)
<Menu sterowania>
<Czynn. przy ostrzeż.>
<Kontynuuj drukowanie> lub <Zatrzymaj drukowanie>
335
<Spr./wy. poj. z
Lista menu ustawień
<Kontynuuj drukowanie>
Gdy zbliża się termin wymiany zasobnika z tonerem, wyświetlany jest komunikat <Wkrótce minie termin
ważn. poj. z toner. X.>, jednak drukowanie jest kontynuowane.
<Zatrzymaj drukowanie>
Gdy zbliża się termin wymiany zasobnika z tonerem, wyświetlany jest komunikat <Wkrótce minie termin
ważności kas. bębna X.>, a drukowanie zostaje tymczasowo zatrzymane. Aby wznowić drukowanie, naciśnij
(
).
przycisk
● „X” w powyższym komunikacie oznacza kolor CMYK.
Ostrz. kasety bębna
Wybierz, czy drukowanie ma być automatycznie zatrzymywane, gdy zbliża się czas wymiany zespołu bębna.
Kontynuuj drukowanie
Zatrzymaj drukowanie
(
)
bębna>
<Menu sterowania>
<Czynn. przy ostrzeż.>
<Ostrz. kasety
<Kontynuuj drukowanie> lub <Zatrzymaj drukowanie>
<Kontynuuj drukowanie>
Gdy zbliża się termin wymiany zespołu bębna, wyświetlany jest komunikat <Wkrótce minie termin ważności
kasety bębna N.>, jednak drukowanie jest kontynuowane.
<Zatrzymaj drukowanie>
Gdy zbliża się termin wymiany zespołu bębna, wyświetlany jest komunikat <Wkrótce minie termin ważności
kasety bębna N.>, a drukowanie zostaje tymczasowo zatrzymane. Aby wznowić drukowanie, naciśnij przycisk
(
).
● „N” w powyższym komunikacie oznacza liczbę od 1 do 4.
Spr./wy. poj.zuż.ton
Wybierz, czy drukowanie ma być automatycznie zatrzymywane, gdy zbliża się czas wymiany pojemnika z
zużytym tonerem.
Kontynuuj drukowanie
Zatrzymaj drukowanie
336
Lista menu ustawień
(
)
<Menu sterowania>
poj.zuż.ton>
<Czynn. przy ostrzeż.>
<Spr./wy.
<Kontynuuj drukowanie> lub <Zatrzymaj drukowanie>
<Kontynuuj drukowanie>
Gdy zbliża się termin wymiany pojemnika na zużyty toner, wyświetlany jest komunikat <Wymień wkrótce poj.
na zużyty toner.>, jednak drukowanie jest kontynuowane.
<Zatrzymaj drukowanie>
Gdy zbliża się termin wymiany pojemnika na zużyty toner, wyświetlany jest komunikat <Wymień wkrótce poj.
na zużyty toner.>, a drukowanie zostaje tymczasowo zatrzymane. Aby wznowić drukowanie, naciśnij przycisk
(
).
Ustaw. daty/czasu
Pozwala określić aktualną datę i godzinę.
Data
Ustaw aktualną datę w formacie rok, miesiąc i dzień. Za pomocą przycisków
wprowadzając datę przy użyciu klawiszy numerycznych.
/
przesuwaj kursor,
01/01 2001 do 31/12 2030
(
)
<Menu sterowania>
<Ustaw. daty/czasu>
<Data>
Ustaw
datę
Godzina (24-godz.)
Określ bieżącą godzinę w formacie 24-godzinnym. Przesuń kursor przyciskami
pomocą przycisków numerycznych.
/
i ustaw godzinę za
00:00:00 do 23:59:59
(
godz.)>
)
<Menu sterowania>
<Ustaw. daty/czasu>
Ustaw godzinę
337
<Godzina (24-
Lista menu ustawień
Czas letni
Określ ustawienia godziny dla czasu letniego.
Ust. czasu letniego
Określ, czy czas letni ma być ustawiany.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Ustaw. daty/czasu>
Sprawdź komunikat
letni>
<Włącz>
<Ust. czasu letniego>
Wykonaj reset sprzętowy (
<Czas
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Data/Czas rozpocz.
Określa początkową datę i godzinę przejścia na czas letni.
Miesiąc
Tydzień
Dzień
Godzina (24-godz.)
(
)
letni>
<Menu sterowania>
<Ustaw. daty/czasu>
Sprawdź komunikat
godzinę
<Data/Czas rozpocz.>
Wykonaj reset sprzętowy (
<Czas
Ustaw datę i
Reset sprzętowy(P. 488) )
Data/Czas zakoń.
Określa końcową datę i godzinę przejścia na czas letni.
Miesiąc
Tydzień
Dzień
Godzina (24-godz.)
(
letni>
godzinę
)
<Menu sterowania>
<Ustaw. daty/czasu>
Sprawdź komunikat
<Data/Czas zakoń.>
Wykonaj reset sprzętowy (
Reset sprzętowy(P. 488) )
Strefa czasowa
Określa strefę czasową zgodnie z regionem, w którym urządzenie jest użytkowane.
338
<Czas
Ustaw datę i
Lista menu ustawień
GMT-12:00 do GMT-0 GODZ
(
)
do GMT+12:00
<Menu sterowania>
Sprawdź komunikat
<Ustaw. daty/czasu>
<Strefa czasowa>
Ustaw strefę czasową
Wykonaj reset sprzętowy (
Reset sprzętowy(P. 488) )
Szybk. wł. zasilania
Zdefiniowanie ustawień szybkiego uruchamiania umożliwia zredukowanie czasu, jaki upływa od naciśnięcia głównego
wyłącznika zasilania do uzyskania pełnej funkcjonalności ekranów. Szybkie uruchamianie urządzenia(P. 39)
Wyłącz
Włącz
Karta SD *
Włączenie lub wyłączenie karty SD.
Wyłącz
Włącz
(
)
<Menu sterowania>
komunikat
<Karta SD>
<Wyłącz> lub <Włącz>
Sprawdź
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Przerwij wydruk *
Umożliwia wybranie, czy dozwolone ma być korzystanie z funkcji Przerwij drukowanie.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Przerwij wydruk>
339
<Wyłącz> lub <Włącz>
Lista menu ustawień
Czas us. zab. wydr. *
Pozwala zdefiniować czas, po którym zabezpieczone dokumenty zapisane w urządzeniu zostaną usunięte.
czasu ważności dokumentów chronionych(P. 97)
Zmiana
1 godz.
2 godz.
3 godz.
6 godz.
12 godz.
24 godz.
Rejestr zabez. zadań *
Zależnie od czasu wyłączenia może nie zostać wygenerowany rejestr druku, w wyniku czego łączna liczba
wydrukowanych stron może nie zostać policzona. Wybranie dla tej funkcji ustawienia <Włącz> gwarantuje, że
urządzenie na pewno wygeneruje rejestr druku i obliczy łączną liczbę stron. Jednak zmniejszyć może się szybkość
drukowania.
Wyłącz
Włącz
(
)
<Menu sterowania>
komunikat
<Rejestr zabez. zadań>
<Wyłącz> lub <Włącz>
Sprawdź
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
System operacyjny
Należy wybrać system operacyjny komputera podłączonego do urządzenia za pośrednictwem portu USB.
Mac OS
Windows
Inny
● Należy upewnić się, że ustawienia urządzenia odpowiadają systemowi operacyjnemu komputera. W
przeciwnym wypadku komputer może błędnie rozpoznać urządzenie.
● Jeśli system operacyjny komputera to OS X 10.10 lub starszy i chcesz drukować przez sterownik
drukarki i port USB, ustaw ten element na <Inny>.
340
Lista menu ustawień
(
)
<Menu sterowania>
<System operacyjny>
Sprawdź komunikat
Wybierz system operacyjny komputera podłączonego do urządzenia
sprzętowy (
Reset
Reset sprzętowy(P. 488) )
Wybór PDL (PnP)
Pozwala określić sterownik drukarki do zainstalowania, gdy urządzenie jest podłączone do komputera za
pośrednictwem USB lub zostało wyszukane w sieci WSD.
UFR II
UFR II (V4)
PCL6
PCL6 (V4)
PS3
XPS (Bezpośrednio)
(
)
<Menu sterowania>
<Wybór PDL (PnP)>
Wybierz język opisu strony
Wykonaj reset sprzętowy (
Sprawdź komunikat
Reset
sprzętowy(P. 488) )
Ustaw. zarządzania
Pozwala ustawić ograniczenie użycia przycisku
zmianom ustawień.
(
) na panelu roboczym, aby zapobiec nieprzemyślanym
Blok. prz. ustawień
W przypadku wybrania ustawienia <Włącz> menu Konfiguracja będzie nieaktywne nawet po naciśnięciu
przycisku
(
).
Wyłącz
Włącz
(
ustawień>
)
<Menu sterowania>
<Ustaw. zarządzania>
Sprawdź komunikat
341
<Wyłącz> lub <Włącz>
<Blok. prz.
Lista menu ustawień
● W przypadku wybrania opcji <Włącz> przycisk Ustawienia będzie można odblokować wyłącznie z
poziomu Zdalnego interfejsu użytkownika. Ograniczanie funkcji panelu roboczego(P. 255)
RMT-SW
Należy korzystać z urządzenia, pozostawiając dla tego elementu ustawienie <Off>. Może pojawić się prośba o zmianę
ustawienia na <On> w celu umożliwienia wykonywania zdalnej diagnostyki urządzenia przez przedstawicieli serwisu
firmy Canon.
Off
On
(
)
<Menu sterowania>
<RMT-SW>
<Off> lub <On>
Regulacja ekranu
Pozwala dostosować kontrast i jasność wyświetlacza.
Kontrast
Regulacja kontrastu (różnica w jasności pomiędzy obszarami jasnymi i ciemnymi) wyświetlacza w zależności od
miejsca instalacji urządzenia.
-3 do 0
do +3
(
)
<Menu sterowania>
<Regulacja ekranu>
dostosować kontrast, należy użyć przycisków
<Kontrast>
Aby
/
Regulacja kontrastu
Aby rozjaśnić ekran, należy ustawić wartość dodatnią. Aby przyciemnić ekran, należy ustawić wartość ujemną.
Jasność podświetl.
Regulacja jasności podświetlenia wyświetlacza odbywa się poprzez wybranie jednego z trzech poziomów. Aby
wyłączyć podświetlenie, należy wybrać opcję <Wyłącz>.
Wyłącz
Poziom 1
Poziom 2
Poziom 3
342
Lista menu ustawień
(
)
<Menu sterowania>
podświetl.>
<Regulacja ekranu>
<Jasność
Wybierz poziom jasności
Animowane instrukcje
Pozwala określić, czy w przypadku zakleszczenia papieru lub wymiany kaset z tonerem itp. na wyświetlaczu mają się
pojawiać animowane instrukcje.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Animowane instrukcje>
<Wyłącz> lub <Włącz>
Pokaż wskaź. tonera
Umożliwia wybranie, czy w prawym dolnym rogu ekranu ma być wyświetlana ikona wskaźnika stanu zasobnika z
tonerem.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Pokaż wskaź. tonera>
Pow. o wprow. ustaw.
Pozwala określić długość komunikatu wyświetlania komunikatu podczas zmiany
ustawienia w sekundach. Wybranie opcji <Wyłącz> spowoduje, że komunikat nie
będzie więcej wyświetlany.
Wyłącz
1s
2s
3s
343
<Wyłącz> lub <Włącz>
Lista menu ustawień
(
)
<Menu sterowania>
<Pow. o wprow. ustaw.>
Wybierz liczbę
sekund
Spr. ustaw. papieru
Umożliwia określenie, czy po skonfigurowaniu szuflady na papier ma być wyświetlany komunikat z prośbą o
sprawdzenie ustawień papieru.
Wyłącz
Włącz
(
)
<Menu sterowania>
<Spr. ustaw. papieru>
<Wyłącz> lub <Włącz>
Prędkość przewijania
Pozwala dostosować prędkość przewijania znaków na wyświetlaczu od prawej do lewej poprzez wybranie jednego
spośród trzech poziomów.
Mała
Normalna
Duża
(
)
<Menu sterowania>
<Prędkość przewijania>
prędkość
Canon Genuine Mode
Tryb dostępny w przypadku używania oryginalnych zasobników z tonerem Canon.
Wyłącz
Włącz
344
Wybierz
Lista menu ustawień
(
)
<Menu sterowania>
<Canon Genuine Mode>
<Wyłącz> lub
<Włącz>
● Jeśli zajdzie taka potrzeba, przedstawiciel serwisu może zmienić to ustawienie. Jeśli element nie jest
wyświetlany, skontaktuj się z administratorem urządzenia.
345
Lista menu ustawień
Źródło papieru
6869-04K
Patrz
Menu wyboru podajnika(P. 491) .
346
Lista menu ustawień
Sieć
6869-04L
Wszystkie ustawienia z listy związane z siecią są opatrzone krótkim opisem.
Ustawienia domyślne oznaczone są przy pomocy znaku ( ).
Pozycja <Sieć> się nie wyświetla
● Jeśli w opcji <Sieć> dostępnej pod pozycją <Wybór interfejsu> wybrano ustawienie <Wyłącz>, wówczas opcja
<Sieć> nie wyświetla się w menu Konfiguracja. Wybór interfejsu(P. 388)
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w przypadku niektórych używanych
opcji lub innych ustawień.
Ustawienia TCP/IP(P. 347)
Mopria(P. 359)
Google Cloud Print(P. 359)
SMB(P. 359)
Ustawienia SNMP(P. 360)
Bufor wydruku(P. 362)
Odbieraj równolegle(P. 362)
Czas ocz. przy rozr.(P. 362)
Ust. zdal. int. uż.(P. 363)
Rej./aktual. oprogr.(P. 363)
Sterownik Ethernet(P. 364)
Prior. tr. uśpienia(P. 364)
IEEE802.1X(P. 365)
Filtr adresów(P. 365)
Adres MAC(P. 366)
Ust. wydruku e-mail(P. 366)
Usługa monitorowania(P. 367)
Inic. ustawień sieci(P. 368)
Ustawienia TCP/IP
Są to ustawienia związane z używaniem urządzenia w obrębie sieci TCP/IP, takie jak ustawienia adresu IP.
Ustawienia IPv4
Ustawienia związane z korzystaniem z urządzenia w sieci IPv4.
IPv4
Włącza lub wyłącza protokół IPv4 w urządzeniu.
Wyłącz
Włącz
(
IP>
)
<Sieć>
Sprawdź komunikat
<Ustawienia IPv4>
reset sprzętowy (
<IPv4>
Reset sprzętowy(P. 488) )
347
<Ustawienia TCP/
<Wyłącz> lub <Włącz>
Wykonaj
Lista menu ustawień
Tryb IP
Wybierz sposób konfiguracji adresu IP.
Ustawianie adresu IPv4(P. 156)
Automatycznie
Ręcznie
Protokół *
Pozwala wybrać używany protokół, jeśli dla opcji <Tryb IP> wybrano ustawienie <Automatycznie>. Jeśli
ustawienie wybranego protokołu to <Włącz>, ustawienie dla pozostałych dwóch protokołów zostanie
zmienione na <Wyłącz>. Ustawianie adresu IPv4(P. 156)
Użyj DHCP
Wyłącz
Włącz
Użyj BOOTP
Wyłącz
Włącz
Użyj RARP
Wyłącz
Włącz
Automatycz. adres IP *
Pozwala określić, czy adres IP ma być automatycznie pozyskiwany. Ustawienie <Włącz> jest odpowiednie, gdy
wartość ustawienia <Tryb IP> to <Automatycznie>. Ustawianie adresu IPv4(P. 156)
Wyłącz
Włącz
Ustawienia adresu IP
Konfiguracja adresu IP, który służy do identyfikacji urządzeń, takich jak komputery i drukarki, w obrębie sieci
TCP/IP. Ustawianie adresu IPv4(P. 156)
Adres IP
0.0.0.0
do 255.255.255.255
Maska podsieci
0.0.0.0
do 255.255.255.255
Adres bramy
0.0.0.0
do 255.255.255.255
DNS
Istnieje możliwość zdefiniowania ustawień adresu serwera systemu nazw domen (DNS), który dostarcza
/
należy przesunąć kursor i
nazwę hosta dla rozwiązań adresów IP. Za pomocą przycisków
wprowadzić adres przy użyciu klawiszy numerycznych. Zdalny interfejs użytkownika umożliwi zdefiniowanie
innych ustawień serwera DNS. Konfiguracja usługi DNS(P. 187)
Adres podstawowy
0.0.0.0
do 255.255.255.255
348
Lista menu ustawień
Adres pomocniczy
0.0.0.0
do 255.255.255.255
(
)
<Sieć>
Sprawdź komunikat
<Ustawienia IPv4>
IP>
skonfigurowania
<DNS>
Skonfiguruj adres
<Ustawienia TCP/
Wybierz serwer do
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Ustawienia mDNS *
Konfiguracja ustawień związanych z użytkowaniem funkcji usługi DNS bez korzystania z serwerów DNS.
Konfiguracja usługi DNS(P. 187)
mDNS
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia IPv4>
lub <Włącz>
<Ustawienia TCP/
<Ustawienia mDNS>
Wykonaj reset sprzętowy (
<mDNS>
<Wyłącz>
Reset sprzętowy(P. 488) )
Nazwa mDNS *
Tę pozycję należy ustawić, gdy dla opcji <mDNS> wybrano ustawienie <Włącz>.
(
IP>
)
<Sieć>
Sprawdź komunikat
<Ustawienia IPv4>
mDNS>
Ustaw nazwę
<Ustawienia TCP/
<Ustawienia mDNS>
Wykonaj reset sprzętowy (
<Nazwa
Reset sprzętowy(P. 488) )
Opcja DHCP
Jeśli serwer DHCP jest włączony, należy za pomocą opcji serwera DHCP określić, czy ma być pobierana nazwa
hosta oraz czy mają być przeprowadzane dynamiczne aktualizacje.
Uzyskaj nazwę hosta
Wyłącz
Włącz
Dynam. aktual. DNS
Wyłącz
Włącz
349
Lista menu ustawień
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia IPv4>
<Ustawienia TCP/
<Opcja DHCP>
<Uzyskaj nazwę hosta> lub
<Wyłącz> lub <Włącz>
<Dynam. aktual. DNS>
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Ustawienia IPv6
Pozwala określić, czy urządzenie ma być używane w sieci IPv6. Ustawienia adresu w sieci IPv6 należy
wprowadzić z poziomu Zdalnego interfejsu użytkownika. Konfiguracja adresów IPv6(P. 161)
IPv6
Włączanie lub wyłączanie obsługi protokołu IPv6 na urządzeniu.
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia IPv6>
reset sprzętowy (
<IPv6>
<Ustawienia TCP/
<Wyłącz> lub <Włącz>
Wykonaj
Reset sprzętowy(P. 488) )
Ustawienia mDNS *
Konfiguracja ustawień związanych z użytkowaniem funkcji usługi DNS bez korzystania z serwerów DNS.
Konfiguracja usługi DNS(P. 187)
mDNS
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia IPv6>
<Ustawienia mDNS>
Wykonaj reset sprzętowy (
lub <Włącz>
<Ustawienia TCP/
<mDNS>
Reset sprzętowy(P. 488) )
Użyj nazwy IPv4/mDNS *
Wyłącz
Włącz
(
IP>
)
<Sieć>
Sprawdź komunikat
<Ustawienia IPv6>
<Ustawienia TCP/
<Ustawienia mDNS>
350
<Użyj nazwy IPv4/
<Wyłącz>
Lista menu ustawień
mDNS>
<Wyłącz> lub <Włącz>
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Nazwa mDNS *
Tę pozycję należy ustawić, gdy dla opcji <Użyj nazwy IPv4/mDNS> wybrano ustawienie <Wyłącz>.
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia IPv6>
mDNS>
Ustaw nazwę
<Ustawienia TCP/
<Ustawienia mDNS>
Wykonaj reset sprzętowy (
<Nazwa
Reset sprzętowy(P. 488) )
Rozpoznawanie WINS
Wybór korzystania z usługi Windows Internet Name Service (WINS), która zapewnia nazwę NetBIOS używaną do
rozpoznawania adresu IP w mieszanym środowisku sieciowym łączącym model NetBIOS i TCP/IP. Aby
zdefiniować szczegółowe ustawienia, które zostaną zastosowane po włączeniu usługi WINS, należy użyć
Zdalnego interfejsu użytkownika. Konfiguracja usługi WINS(P. 193)
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Rozpoznawanie WINS>
sprzętowy (
<Ustawienia TCP/
<Wyłącz> lub <Włącz>
Wykonaj reset
Reset sprzętowy(P. 488) )
FTP
Pozwala określić możliwość zmiany ustawień drukowania oraz ustawień skonfigurowanych na poziomie
urządzenia z poziomu serwera FTP.
Wydruk z FTP
Pozwala określić możliwość drukowania z serwera FTP. Za pomocą Zdalnego interfejsu użytkownika należy
ustawić nazwę użytkownika i hasło używane do drukowania z serwera FTP. Przygotowanie do korzystania
z serwera FTP(P. 614)
Wyłącz
Włącz
(
)
IP>
sprzętowy (
<Sieć>
<FTP>
Sprawdź komunikat
<Wydruk z FTP>
Reset sprzętowy(P. 488) )
351
<Ustawienia TCP/
<Wyłącz> lub <Włącz>
Wykonaj reset
Lista menu ustawień
Zezw. na ust. p. FTP
Pozwala określić możliwość zmiany ustawień skonfigurowanych na poziomie urządzenia z poziomu serwera
FTP.
Wyłącz
Włącz
(
)
IP>
<Sieć>
<FTP>
<Włącz>
Sprawdź komunikat
<Zezw. na ust. p. FTP>
Wykonaj reset sprzętowy (
<Ustawienia TCP/
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Ustawienia LPD
Pozwala włączać lub wyłączać LPD, protokół drukowania, którego można używać na dowolnej platformie
sprzętowej lub w dowolnym systemem operacyjnym. Należy również zdefiniować okres czasu, po którym
zadanie drukowania zostanie automatycznie zakończone, jeśli urządzenie nie będzie mogło odebrać danych
drukowania z powodu problemów z komunikacją lub wystąpienia innych problemów. Za pomocą Zdalnego
interfejsu użytkownika można określić ustawienia drukowania strony baneru, gdy protokół LPD jest włączony.
Konfiguracja protokołów drukowania i funkcji protokołu WSD(P. 166)
Wydruk LPD
Wyłącz
Włącz
(
)
<Sieć>
Sprawdź komunikat
<Ustawienia LPD>
IP>
<Włącz>
<Ustawienia TCP/
<Wydruk LPD>
Wykonaj reset sprzętowy (
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Prz.cz. ocz. na odb. *
1 do 60
(min)
(
IP>
)
<Sieć>
Sprawdź komunikat
<Ustawienia LPD>
przekroczenia czasu
<Ustawienia TCP/
<Prz.cz. ocz. na odb.>
Wykonaj reset sprzętowy (
Ustaw wartość
Reset sprzętowy(P. 488) )
Ustawienia RAW
Istnieje możliwość włączania lub wyłączania RAW, protokołu drukowania specyficznego dla systemu Windows.
Należy również ustawić czas, po którym zadanie drukowania zostanie automatycznie zakończone, jeśli
urządzenie nie będzie mogło odebrać danych drukowania z powodu problemów z komunikacją lub wystąpienia
352
Lista menu ustawień
innych problemów. Za pomocą Zdalnego interfejsu użytkownika można określić ustawienia komunikacji
dwukierunkowej. Konfiguracja protokołów drukowania i funkcji protokołu WSD(P. 166)
Wydruk RAW
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia RAW>
<Wydruk RAW>
Wykonaj reset sprzętowy (
<Włącz>
<Ustawienia TCP/
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Prz.cz. ocz. na odb. *
1 do 60
(min)
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia RAW>
przekroczenia czasu
<Ustawienia TCP/
<Prz.cz. ocz. na odb.>
Wykonaj reset sprzętowy (
Ustaw wartość
Reset sprzętowy(P. 488) )
Wydruk IPP
Włączanie lub wyłączanie protokołu IPP umożliwiającego drukowanie z sieci zewnętrznej przez internet. Za
pomocą Zdalnego interfejsu użytkownika można określić ustawienia szyfrowania danych TLS na potrzeby
wysyłania i uwierzytelniania użytkowników. Konfiguracja protokołów drukowania i funkcji protokołu
WSD(P. 166)
Wyłącz
Włącz
(
IPP>
)
<Sieć>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<Ustawienia TCP/IP>
Wykonaj reset sprzętowy (
<Wydruk
Reset
sprzętowy(P. 488) )
WSD
Włączanie lub wyłączanie funkcji automatycznego przeglądania oraz uzyskiwania informacji na potrzeby
urządzenia za pomocą protokołu WSD. Konfiguracja protokołów drukowania i funkcji protokołu
WSD(P. 166)
Wydruk WSD
Pozwala określić możliwość drukowania za pomocą urządzenia z zastosowaniem funkcji WSD.
Wyłącz
353
Lista menu ustawień
Włącz
(
)
IP>
<Sieć>
<WSD>
reset sprzętowy (
Sprawdź komunikat
<Wydruk WSD>
<Ustawienia TCP/
<Wyłącz> lub <Włącz>
Wykonaj
Reset sprzętowy(P. 488) )
Przeglądanie WSD *
Pozwala zdefiniować możliwość pobierania informacji o urządzeniu z komputera przy użyciu funkcji WSD. W
przypadku wybrania dla opcji <Wydruk WSD> ustawienia <Włącz>, dla opcji <Przeglądanie WSD> zostanie
wybrane stałe ustawienia <Włącz> i nie będzie ona wyświetlana w menu ustawień.
Wyłącz
Włącz
(
)
IP>
<Sieć>
<WSD>
<Włącz>
Sprawdź komunikat
<Przeglądanie WSD>
Wykonaj reset sprzętowy (
<Ustawienia TCP/
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Multicast Discovery
Pozwala określić, czy urządzenie będzie odpowiadało na komunikaty odkrywania metodą multiemisji.
Wyłącz
Włącz
(
IP>
<Włącz>
)
<Sieć>
<WSD>
Sprawdź komunikat
<Multicast Discovery>
Wykonaj reset sprzętowy (
<Ustawienia TCP/
<Wyłącz> lub
Reset sprzętowy(P. 488) )
● Jeśli dla opcji <Multicast Discovery> wybrano ustawienie <Wyłącz>, urządzenie pozostaje w trybie
uśpienia nawet pomimo przepływu w sieci komunikatów Multicast Discovery.
HTTP
Włączanie lub wyłączanie protokołu HTTP. Protokół HTTP jest niezbędny do komunikacji z komputerem na
przykład w przypadku korzystania ze Zdalnego interfejsu użytkownika czy drukowania WSD. Wyłączanie
komunikacji z użyciem protokołu HTTP(P. 258)
Wyłącz
Włącz
354
Lista menu ustawień
Ustawienia proxy
Pozwala określić ustawienia korzystania z serwera proxy, który pełni funkcję przekaźnika w komunikacji z
zastosowaniem protokołu HTTP. Ustawienia proxy(P. 245)
Proxy
Włączanie lub wyłączanie serwera proxy, gdy urządzenie komunikuje się z zastosowaniem protokołu HTTP.
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia proxy>
reset sprzętowy (
<Proxy>
<Ustawienia TCP/
<Wyłącz> lub <Włącz>
Wykonaj
Reset sprzętowy(P. 488) )
Adres serwera *
Pozwala ustawić adres serwera proxy, który będzie używany. Należy zdefiniować adres IP, nazwę domeny
oraz inne niezbędne informacje zgodnie ze środowiskiem roboczym. Za pomocą przycisków
/
można
przesuwać kursor, a klawisze numeryczne umożliwią wprowadzenie adresu ( Wprowadzanie
tekstu(P. 35) ).
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia proxy>
serwera
<Adres serwera>
Wykonaj reset sprzętowy (
<Ustawienia TCP/
Wprowadź adres
Reset sprzętowy(P. 488) )
Numer portu *
Pozwala określić numer portu serwera proxy, który ma być użyty.
1 do 80
do 65535
(
)
IP>
portu
<Sieć>
Sprawdź komunikat
<Ustawienia proxy>
<Numer portu>
Wykonaj reset sprzętowy (
<Ustawienia TCP/
Wprowadź numer
Reset sprzętowy(P. 488) )
Ta sama domena *
Włączanie lub wyłączanie serwera proxy nawet w przypadku komunikacji z zastosowaniem protokołu HTTP z
urządzeniami w obrębie tej samej domeny.
Użyj proxy
Nie używaj proxy
355
Lista menu ustawień
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia proxy>
<Ta sama domena>
Wykonaj reset sprzętowy (
używaj proxy>
<Ustawienia TCP/
<Użyj proxy> lub <Nie
Reset sprzętowy(P. 488) )
Uwierzytel. proxy *
Włączanie lub wyłączanie funkcji uwierzytelniania serwera proxy.
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia proxy>
<Włącz>
<Ustawienia TCP/
<Uwierzytel. proxy>
Wykonaj reset sprzętowy (
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Nazwa użytkownika *
Aby włączyć uwierzytelnianie serwera proxy, należy wprowadzić nazwę użytkownika do uwierzytelniania
składającą się z maksymalnie 24 znaków alfanumerycznych. Nazwę użytkownika należy wprowadzić za
pomocą klawiszy numerycznych. ( Wprowadzanie tekstu(P. 35) )
(
)
IP>
<Sieć>
Sprawdź komunikat
<Ustawienia proxy>
użytkownika
<Ustawienia TCP/
<Nazwa użytkownika>
Wykonaj reset sprzętowy (
Wprowadź nazwę
Reset sprzętowy(P. 488) )
Hasło *
Hasło do uwierzytelniania serwera proxy może się składać z maksymalnie 24 znaków alfanumerycznych.
Hasło należy wprowadzić za pomocą klawiszy numerycznych. ( Wprowadzanie tekstu(P. 35) )
(
IP>
)
<Sieć>
Sprawdź komunikat
<Ustawienia proxy>
reset sprzętowy (
<Hasło>
<Ustawienia TCP/
Wprowadź hasło
Wykonaj
Reset sprzętowy(P. 488) )
SNTP
Pozwala określić pobieranie godziny z serwera czasu sieci. Ustawienia adresu serwera należy określić z poziomu
Z. Konfiguracja protokołu SNTP(P. 196)
Wyłącz
Włącz
356
Lista menu ustawień
(
)
IP>
<Sieć>
<SNTP>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<Ustawienia TCP/
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Odpowiedź Discovery
Pozwala wybrać, czy urządzenie będzie odpowiadało na pakiety odkrywania metodą multiemisji w sieci. Za
pomocą Zdalnego interfejsu użytkownika należy określić nazwę zakresu używaną do włączenia urządzenia w
określony zakres. Konfiguracja ustawień oprogramowania zarządzania urządzeniami(P. 205)
Wyłącz
Włącz
(
)
IP>
<Sieć>
Sprawdź komunikat
<Odpowiedź Discovery>
sprzętowy (
<Ustawienia TCP/
<Wyłącz> lub <Włącz>
Wykonaj reset
Reset sprzętowy(P. 488) )
IPSec
Ustawienie umożliwiające określenie, czy komunikacja ma być szyfrowana poprzez ustanowienie wirtualnej sieci
prywatnej (VPN) korzystającej z protokołu IPSec. Za pomocą Zdalnego interfejsu użytkownika należy
zarejestrować i zdefiniować zasady bezpieczeństwa. Konfiguracja ustawień protokołu IPSec(P. 269)
Wyłącz
Włącz
(
)
IP>
<Sieć>
<IPSec>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<Ustawienia TCP/
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Ust. powiad. o uśp.
Pozwala określić ustawienia komunikacji SLP do powiadamiania oprogramowania imageWARE o stanie zasilania
urządzenia. Ustawienie dla opcji <Powiad. o tryb. uśp.> ustawienia <Włącz> pozwala na uniknięcie nawiązywania
przez urządzenie zbędnej komunikacji w trybie uśpienia i zmniejszenie całkowitego zużycia energii.
Konfiguracja ustawień oprogramowania zarządzania urządzeniami(P. 205)
Powiad. o tryb. uśp.
Włączanie lub wyłączanie komunikacji SLP. Wybranie opcji <Włącz> spowoduje, że informacja o stanie
zasilania urządzenia będzie przesyłana do oprogramowania imageWARE.
Wyłącz
Włącz
357
Lista menu ustawień
(
)
<Sieć>
powiad. o uśp.>
reset sprzętowy (
Sprawdź komunikat
<Powiad. o tryb. uśp.>
<Ustawienia TCP/IP>
<Wyłącz> lub <Włącz>
<Ust.
Wykonaj
Reset sprzętowy(P. 488) )
Numer portu *
W tym miejscu należy wprowadzić numer portu do komunikacji SLP z oprogramowaniem do zarządzania.
1 do 11427
do 65535
(
)
<Sieć>
powiad. o uśp.>
numerycznych
Sprawdź komunikat
<Numer portu>
<Ustawienia TCP/IP>
<Ust.
Wprowadź numer portu za pomocą klawiszy
Wykonaj reset sprzętowy (
Reset sprzętowy(P. 488) )
Rutery do przejścia *
Umożliwia określenie liczby routerów, przez które przechodzą pakiety powiadomień.
0 do 3
do 254
(
)
<Sieć>
powiad. o uśp.>
Sprawdź komunikat
<Rutery do przejścia>
pomocą klawiszy numerycznych
<Ustawienia TCP/IP>
<Ust.
Wprowadź liczbę routerów przejściowy za
Wykonaj reset sprzętowy (
Reset sprzętowy(P. 488) )
Interwał powiadom. *
Określenie, jak często urządzenie ma powiadamiać program imageWARE o stanie zasilania.
do 65535
60 do 600
(
)
<Sieć>
powiad. o uśp.>
Sprawdź komunikat
<Interwał powiadom.>
pomocą klawiszy numerycznych
<Ustawienia TCP/IP>
Wprowadź interwał powiadomień za
Wykonaj reset sprzętowy (
358
<Ust.
Reset sprzętowy(P. 488) )
Lista menu ustawień
Mopria
Umożliwia wybranie, czy ma być używana aplikacja Mopria®.
Drukowanie z użyciem technologii Mopria®(P. 134)
Wyłącz
Włącz
(
)
<Włącz>
<Sieć>
Sprawdź komunikat
Wykonaj reset sprzętowy (
<Mopria>
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Google Cloud Print
Włącz lub wyłącz obsługę technologii Google Cloud Print.
Zmiana ustawień Google Cloud Print(P. 144)
Użyj Cloud Print
Wyłącz
Włącz
Stan rejestracji
SMB *
Pozwala wybrać, czy urządzenie będzie używane jako drukarka współdzielona w sieci SMB. Za pomocą Zdalnego
interfejsu użytkownika należy określić ustawienia SMB, w tym nazwę serwera i nazwę grupy roboczej. Konfiguracja
protokołu SMB(P. 209)
SMB Server
Pozwala wybrać, czy urządzenie będzie wyświetlane jako serwer SMB na ekranie konfiguracji sieci SMB.
Wyłącz
Włącz
(
Server>
)
<Sieć>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
sprzętowy(P. 488) )
Wydruk SMB *
Włączanie lub wyłączanie drukowania SMB.
Wyłącz
Włącz
359
<SMB>
Wykonaj reset sprzętowy (
<SMB
Reset
Lista menu ustawień
(
)
SMB>
<Sieć>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<SMB>
<Wydruk
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Ustawienia SNMP
Konfiguracja ustawień związanych z monitorowaniem i kontrolowaniem urządzenia z poziomu komputera z
zainstalowanym oprogramowaniem kompatybilnym z protokołem SNMP. Monitorowanie i kontrolowanie
urządzenia za pomocą protokołu SNMP(P. 199)
Ustawienia SNMPv1
Pozwala określić ustawienia korzystania z protokołu SNMPv1. Za pomocą Zdalnego interfejsu użytkownika
należy zdefiniować nazwę społeczności i przywileje dostępu do obiektów menedżera MIB.
SNMPv1
Włączanie lub wyłączanie SNMPv1.
Wyłącz
Włącz
(
)
<Sieć>
Sprawdź komunikat
<Ustawienia SNMPv1>
SNMP>
<Włącz>
Wykonaj reset sprzętowy (
<SNMPv1>
<Ustawienia
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Ust. społecz. dedyk.
Społeczność dedykowana jest wstępnie ustawioną społecznością przeznaczoną tylko do użytku przez
administratorów korzystających z oprogramowania firmy Canon, takiego jak iW Management Console. Należy
wybrać uprawnienia dostępu do obiektów menedżera MIB.
Społeczność dedykow.
Wyłącz
Odczyt/Zapis
Tylko do odczytu
(
SNMP>
)
<Sieć>
Sprawdź komunikat
<Ustawienia SNMPv1>
dedykow.>
<Ust. społecz. dedyk.>
Wybierz uprawnienia dostępu
sprzętowy(P. 488) )
360
<Ustawienia
<Społeczność
Wykonaj reset sprzętowy (
Reset
Lista menu ustawień
Ustawienia SNMPv3
Pozwala zdefiniować ustawienia korzystania z protokołu SNMPv3. Za pomocą Zdalnego interfejsu użytkownika
należy określić szczegółowe ustawienia, które zostaną zastosowane po aktywacji protokołu SNMPv3.
SNMPv3
Włączanie lub wyłączanie SNMPv3.
Wyłącz
Włącz
(
)
<Sieć>
SNMP>
Sprawdź komunikat
<Ustawienia SNMPv3>
<Włącz>
<Ustawienia
<SNMPv3>
Wykonaj reset sprzętowy (
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Ustaw. użytkownika N (N = 1, 2, 3, 4, 5) *
Pozwala zdefiniować hasło uwierzytelniania i hasło szyfrowania jako informację o użytkowniku używaną przez
protokół SNMPv3. Informacje o użytkowniku należy zarejestrować za pomocą Zdalnego interfejsu
użytkownika. Monitorowanie i kontrolowanie urządzenia za pomocą protokołu SNMP(P. 199)
Hasło uwierzytel. /Hasło szyfrowania
Każde hasło musi się składać z minimalnie 6 i maksymalnie 16 znaków alfanumerycznych.
(
)
<Sieć>
SNMP>
Sprawdź komunikat
<Ustawienia SNMPv3>
użytkownika
Wybierz liczbę ustawień
Sprawdź nazwę użytkownika
szyfrowania>
Wpisz hasło
<Ustawienia
<Hasło uwierzytel.> lub <Hasło
Wykonaj reset sprzętowy (
Reset sprzętowy(P. 488) )
Odrzuć pakiet w uśp.
Wybór odrzucania pakietów SNMP odbieranych w trybie uśpienia.
Wyłącz
Włącz
(
)
<Sieć>
pakiet w uśp.>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
sprzętowy(P. 488) )
361
<Ustawienia SNMP>
Wykonaj reset sprzętowy (
<Odrzuć
Reset
Lista menu ustawień
● Zaznaczenie pola wyboru <Włącz> spowoduje, że aplikacje korzystające z protokołu SNMP, takie jak
aplikacje z serii oprogramowania imageWARE firmy Canon, mogą być wyłączone w celu umożliwienia
dostępu do urządzenia.
Bufor wydruku *
Wybór uwzględniania karty SD w lokalizacjach przechowywania odbieranych danych drukowania. W przypadku
wybrania opcji <Włącz> pojemność odbioru danych drukowania urządzenia zostanie zwiększona.
Wyłącz
Włącz
(
)
<Włącz>
<Sieć>
Sprawdź komunikat
Wykonaj reset sprzętowy (
<Bufor wydruku>
<Wyłącz> lub
Reset sprzętowy(P. 488) )
Odbieraj równolegle
Umożliwia określenie, czy zadania będą drukowane w kolejności odebrania, gdy z jednego komputera do drukarki
zostaną wysłane dane drukowania dla kilku zadań. Gdy wybrane jest ustawienie <Wyłącz>, zadania są drukowane w
kolejności odebrania, ale prędkość drukowania może być niższa.
Wyłącz
Włącz
(
)
<Sieć>
równolegle>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<Odbieraj
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
● Nawet jeśli wybrano ustawienie <Wyłącz>, w niektórych sytuacjach zadania mogą nie być zapisywane
w kolejności odebrania, np. gdy wykonywana jest funkcja drukowania zadań przechowywanych.
Czas ocz. przy rozr.
Określanie czasu oczekiwania na połączenie z siecią. Ustawienie to należy dobrać do środowiska sieciowego.
Ustawianie czasu oczekiwania na połączenie z siecią(P. 186)
0
do 300 (s)
362
Lista menu ustawień
Ust. zdal. int. uż.
Pozwala określić ustawienia korzystania ze Zdalnego interfejsu użytkownika. Za pomocą Zdalnego interfejsu
użytkownika można określić ustawienia urządzenia z poziomu przeglądarki internetowej.
Zdal. interf. użytk.
Włączanie lub wyłączanie Zdalnego interfejsu użytkownika.
użytkownika(P. 259)
Wyłączanie Zdalnego interfejsu
Wyłącz
Włącz
Ust. bezp. zd. int.
Pozwala wybrać zabezpieczenie dostępu do Zdalnego interfejsu użytkownika kodem PIN.
PIN Zdalnego interfejsu użytkownika(P. 232)
Ustawiania kodu
Wyłącz
Włącz
TLS *
Włączanie lub wyłączanie szyfrowania TLS dla komunikacji Zdalnego interfejsu użytkownika. Aby używać
protokołu TLS do komunikacji szyfrowanej, należy ustawić pary kluczy za pomocą Zdalnego interfejsu
użytkownika ( Korzystanie z protokołu TLS do komunikacji szyfrowanej(P. 265) ).
Wyłącz
Włącz
(
)
uż.>
<Sieć>
Sprawdź komunikat
<TLS>
<Ust. zdal. int.
<Wyłącz> lub <Włącz>
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Rej./aktual. oprogr. *
Gdy użytkownik rejestruje lub aktualizuje aplikację MEAP, można sprawdzić status komunikacji z serwerem dystrybucji,
z którym nawiązywane jest połączenie.
Ust. oprog. zarządz.
Test połączenia
(
)
<Sieć>
oprog. zarządz.>
Sprawdź komunikat
<Test połączenia>
Sprawdź komunikat
363
<Rej./aktual. oprogr.>
<Tak>
Sprawdź komunikat
<Ust.
Lista menu ustawień
Sterownik Ethernet
Pozwala określić tryb komunikacji Ethernet (półdupleks / pełny dupleks) oraz typ Ethernet (10 Base-T/100 Base-TX/1000
Base-T). Konfiguracja ustawień sieci Ethernet(P. 184)
Automat. wykrywanie
Ustawienie to umożliwia określenie, czy tryb komunikacji i typ sieci Ethernet mają zostać wykryte automatycznie
czy skonfigurowane ręcznie.
Wyłącz
Włącz
Tryb połączenia *
Jeśli ustawienie opcji <Automat. wykrywanie> to <Wyłącz>, należy wybrać tryb komunikacji Ethernet.
Półdupleks
Pełen dupleks
Typ sieci Ethernet *
Jeśli ustawienie opcji <Automat. wykrywanie> to <Wyłącz>, należy wybrać typ Ethernet.
10 Base-T
100 Base-TX
1000 Base-T
Prior. tr. uśpienia
Pozwala wybrać między szybszym przywracaniem z trybu uśpienia a większą oszczędnością energii w trybie uśpienia.
Balans optymalny
Szybkość wychodzenia
Oszczędzanie energii
(
)
<Sieć>
pozycję ustawień
Sprawdź komunikat
<Prior. tr. uśpienia>
Wykonaj reset sprzętowy (
Reset sprzętowy(P. 488) )
Wybierz
Balans optymalny
Urządzenie jest szybciej przywracane z trybu uśpienia. Jeśli urządzenia podłączone bezpośrednio do tego
urządzenia obsługują technologię EEE (energooszczędny Ethernet), wówczas można ograniczyć pobór mocy
w jeszcze większym stopniu. Normalnie należy używać tego ustawienia.
364
Lista menu ustawień
Szybkość wychodzenia
Przywracanie urządzenia z trybu uśpienia przebiega szybciej.
Oszczędzanie energii
Prędkość komunikacji w trybie uśpienia zostanie ograniczona, aby zapewnić jak najniższy pobór mocy.
● Ta pozycja jest dostępna, gdy ustawienie opcji <Tryb uśpienia> to <Wysoki (głęb. uśp.)>.
Przechodzenie w tryb uśpienia(P. 68)
IEEE802.1X
Włączanie lub wyłączanie uwierzytelniania zgodnego z IEEE 802.1X. Do konfiguracji szczegółowych ustawień
stosowanych, gdy włączone jest uwierzytelnianie zgodne z IEEE 802.1X, służy Zdalny interfejs użytkownika.
Konfiguracja uwierzytelniania zgodnego z IEEE 802.1X(P. 279)
Wyłącz
Włącz
(
)
<Sieć>
komunikat
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<IEEE802.1X>
Wykonaj reset sprzętowy (
Sprawdź
Reset
sprzętowy(P. 488) )
Filtr adresów
Umożliwia włączenie lub wyłączenie ograniczenia komunikacji z określonymi adresami IP i MAC. Adresy, które mają
zostać objęte ograniczeniem, można zdefiniować za pomocą Zdalnego interfejsu użytkownika. Podstawowe
operacje drukowania(P. 77)
Wyłącz
Włącz
(
<Włącz>
)
<Sieć>
Sprawdź komunikat
Wykonaj reset sprzętowy (
365
<Filtr adresów>
Reset sprzętowy(P. 488) )
<Wyłącz> lub
Lista menu ustawień
Adres MAC
Pozwala sprawdzić adres MAC urządzenia, który jest numerem niepowtarzalnym dla każdego urządzenia
komunikacyjnego.
(Tylko do wyświetlenia)
(
)
<Sieć>
Sprawdź komunikat
<Adres MAC>
Ust. wydruku e-mail
Pozwala określić ustawienia funkcji Drukowanie e-maili. Inne ustawienia tej funkcji, łącznie z ustawieniami serwera
pocztowego, należy określić za pomocą Zdalnego interfejsu użytkownika. Drukowanie odebranej wiadomości email (Drukowanie e-maili)(P. 125)
Interwał odb. POP3
W tym miejscu należy określić odstęp w minutach między kolejnymi automatycznymi połączeniami z serwerem
pocztowym. Nowe wiadomości e-mail w skrzynce odbiorczej serwera pocztowego będą automatycznie
pobierane i drukowane w określonych odstępach czasu.
0
do 90 (min)
(
mail>
)
<Sieć>
Sprawdź komunikat
<Interwał odb. POP3>
<Ust. wydruku e-
Wprowadź interwał automatycznego odbioru
wiadomości e-mail za pomocą klawiszy numerycznych
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
● W przypadku wybrania wartości „0” wiadomości e-mail nie będą automatycznie odbierane. Wówczas
należy odbierać je ręcznie. Ręczne odbieranie wiadomości e-mail(P. 129)
POP3 RX
Włączanie lub wyłączanie funkcji Drukowanie e-maili dla serwera poczty POP3.
Wyłącz
Włącz
366
Lista menu ustawień
(
)
RX>
<Sieć>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<Ust. wydruku e-mail>
Wykonaj reset sprzętowy (
<POP3
Reset
sprzętowy(P. 488) )
SMTP RX
Włączanie lub wyłączanie funkcji Drukowanie e-maili dla protokołu SMTP.
Wyłącz
Włącz
(
)
RX>
<Sieć>
Sprawdź komunikat
<Wyłącz> lub <Włącz>
<Ust. wydruku e-mail>
Wykonaj reset sprzętowy (
<SMTP
Reset
sprzętowy(P. 488) )
Usługa monitorowania
Opcja umożliwia komunikację z serwerem do zdalnego monitorowania i wyświetlenie dzienników przesyłania danych.
Test połączenia
Opcja umożliwia komunikację z serwerem do zdalnego monitorowania. Jej włączenie sprawia, że od czasu do
czasu do serwera połączonego z urządzeniem są wysyłane informacje na temat urządzenia.
(
)
<Sieć>
monitorowania>
Sprawdź komunikat
<Test połączenia>
<Usługa
Sprawdź komunikat
<Tak>
Rejestr połączeń
Umożliwia wyświetlenie dzienników przesyłania danych wraz z informacjami o błędach wygenerowanymi przez
funkcję <Test połączenia>.
(Tylko wyświetlacz)
(
)
<Sieć>
monitorowania>
Sprawdź komunikat
<Rejestr połączeń>
godzinę
367
<Usługa
Wybierz dziennik
Wybierz
Lista menu ustawień
Inic. ustawień sieci
Wybór tej opcji umożliwia przywrócenie ustawieniom sieciowym fabrycznych wartości domyślnych.
ustawień sieciowych(P. 558)
368
Resetowanie
Lista menu ustawień
Układ
6869-04R
Zawiera listę ustawień dotyczących wyglądu wydruku, takich jak marginesy na
oprawę i położenia wydruku, wraz z krótkimi opisami. Ustawienia domyślne są
oznaczone znakiem ( ).
Liczba kopii(P. 369)
Przesunięcie Y/Przesunięcie X(P. 369)
Miejsce zszycia(P. 370)
Margines na oprawę(P. 371)
Metoda alternatywna(P. 372)
Liczba kopii
Określanie liczby kopii.
1
do 9999
(
)
<Układ>
<Liczba kopii>
Wprowadź liczbę kopii za pomocą klawiszy
numerycznych
Przesunięcie Y/Przesunięcie X
Istnieje możliwość określenia ustawień przesunięcia położenia wydruku dla wszystkich typów wydruków w krokach po
0,5 mm, bez względu na źródło papieru.
-50,0 do 0,0
do +50,0 (mm)
(
)
<Układ>
<Przesunięcie Y> lub <Przesunięcie X>
odsunięcia za pomocą przycisków
/
<Przesunięcie Y>
Przesuwa położenie wydruku w pionie.
369
Wprowadź wartość
Lista menu ustawień
<Przesunięcie X>
Przesuwa położenie wydruku w poziomie.
Wartości przesunięcia
Dla parametru <Przesunięcie Y> należy ustawić wartość dodatnią, aby przesunąć położenie wydruku w dół.
Dla parametru <Przesunięcie X> należy ustawić wartość dodatnią, aby przesunąć położenie wydruku w
prawo. Ustawienie wartości ujemnej pozwala przesunąć położenie wydruku w przeciwnym kierunku.
<Przesunięcie X>
<Przesunięcie Y>
Definiowanie ustawień precyzyjnych położenia wydruku
W celu precyzyjnego określenia położenia wydruku dla poszczególnych źródeł papieru można wybrać opcję
<Dost. pozyc. wydruku> pod pozycją <Konserw. użytkownika>. Zakres dostępnych wartości odsunięcia wynosi
od -5,0 mm do +5,0 mm w kierunku pionowym i od -3,5 mm do +3,5 mm w kierunku poziomym. Regulacja
położenia wydruku(P. 536)
Miejsce zszycia
Określ, czy wydrukowane dokumenty zostaną zbindowane (np. za pomocą zszywacza) wzdłuż dłuższej czy krótszej
krawędzi. W takim przypadku należy określić ustawienia parametru <Margines na oprawę>, aby wyregulować także
margines do bindowania.
Długa krawędź
Krótka krawędź
(
)
<Układ>
<Miejsce zszycia>
<Długa krawędź>
Bindowanie wydruków zostanie wykonane wzdłuż dłuższej krawędzi.
370
<Długa krawędź> lub <Krótka krawędź>
Lista menu ustawień
<Krótka krawędź>
Bindowanie wydruków zostanie wykonane wzdłuż krótszej krawędzi.
Margines na oprawę
Dostosuj szerokość marginesu krawędzi określonej w polu <Miejsce zszycia>, przesuwając miejsce drukowania danych
drukowania. W przypadku wybrania „0,0” margines nie zostanie zmieniony.
-50,0 do 0,0
do +50,0 (mm)
(
)
<Układ>
pomocą przycisków
<Margines na oprawę>
Wprowadź wartość odsunięcia za
/
Wartości marginesów
Istnieje możliwość zdefiniowania kierunku i szerokości przesunięcia położenia wydruku dla drukowanych
danych. Krawędź, przy której będą zmieniane marginesy, będzie się zmieniać zgodnie z wprowadzoną
wartością dodatnią lub ujemną. Szerokość marginesu można regulować w krokach po 0,5 mm.
Dokument w orientacji pionowej
Wartość ustawienia
Bindowanie wzdłuż dłuższej krawędzi
Bindowanie wzdłuż krótszej krawędzi
Wartość dodatnia
Lewa krawędź papieru
(w przypadku bindowania z lewej strony)
Wartość ujemna
Prawa krawędź papieru
Dolna krawędź papieru
(w przypadku bindowania z prawej strony) (w przypadku bindowania od dołu)
Dokument w orientacji poziomej
371
Górna krawędź papieru
(w przypadku bindowania od góry)
Lista menu ustawień
Wartość ustawienia
Bindowanie wzdłuż dłuższej krawędzi
Bindowanie wzdłuż krótszej krawędzi
Wartość dodatnia
Lewa krawędź papieru
(w przypadku bindowania od góry)
Górna krawędź papieru
(w przypadku bindowania z prawej strony)
Wartość ujemna
Prawa krawędź papieru
(w przypadku bindowania od dołu)
Górna krawędź papieru
(w przypadku bindowania z prawej strony)
Metoda alternatywna
Podczas wykonywania dwustronnych wydruków dokumentu składającego się z nieparzystej liczby stron można wybrać,
czy ostatnia strona ma być przetwarzana w trybie jednostronnym. W przypadku wybrania opcji <Włącz> drukowanie
zostanie zakończone szybciej niż w przypadku standardowego drukowania dwustronnego.
Wyłącz
Włącz
(
)
<Układ>
<Metoda alternatywna>
<Wyłącz> lub <Włącz>
Drukowanie dokumentu składającego się z parzystej liczby stron kończy się w trybie
drukowania jednostronnego
W opisanych poniżej przypadkach ostatnia strona jest przetwarzana w trybie jednostronnym, nawet jeśli
dokument składa się z parzystej liczby stron.
● Ostatnia strona jest pusta.
● Nie można wydrukować ostatniej strony na przykład dlatego, że wybrany rozmiar papieru nie pozwala na
drukowanie dwustronne.
Korzystanie z papieru z nadrukowanym logo
● Jeśli ostatnia strona jest przetwarzana w trybie drukowania jednostronnego, gdy ustawienie opcji <Metoda
alternatywna> to <Włącz>, wówczas orientacja lub strona wydruku ostatniej strony może być niezgodna z
innymi stronami. W takim przypadku należy przestawić opcję <Metoda alternatywna> na <Wyłącz>.
372
Lista menu ustawień
Jakość wydruku
6869-04S
Tutaj znajduje się lista ustawień związanych z jakością drukowania, takich jak
gradacja i gęstość tonera, wraz z krótkim opisem. Ustawienia domyślne oznaczone
są przy pomocy znaku ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w zależności od innych elementów
ustawień.
Gradacja(P. 373)
Oszczędzanie tonera(P. 374)
Gęstość: X (X=C, M, Y, K)(P. 374)
Gęstość X (dokładna regulacja) (X=C, M, Y, K)(P. 374)
Tryb koloru(P. 374)
Półtony(P. 375)
Kompensacja szarości(P. 376)
CMS(P. 377)
Ustawienia gradacji(P. 382)
Zaawans. wygładzanie(P. 383)
Korek. objęt. tonera(P. 384)
Kontrola linii(P. 385)
Ogranicz jakość(P. 385)
Tryb spec. wygładz.(P. 386)
Gradacja
Pozwala wybrać gradację do przetwarzania danych drukowania.
Wysoki 1
Wysoki 2
(
)
<Jakość wydruku>
<Gradacja>
<Wysoki 1> lub <Wysoki 2>
<Wysoki 1>
Ten tryb drukowania nadaje się do drukowania zdjęć lub podobnych obiektów w średniej jakości.
<Wysoki 2>
To ustawienie należy wybrać, aby drukować zdjęcia lub podobne obiekty w wysokiej jakości.
373
Lista menu ustawień
Oszczędzanie tonera
To ustawienie należy zdefiniować, aby na przykład przed wydrukowaniem dużego zadania sprawdzić wykończenie,
takie jak układ. W tym trybie drukowania oszczędza się toner, dlatego precyzyjne linie i jaśniejsze części wydruku mogą
być zamazane.
Wyłącz
Włącz
(
)
<Jakość wydruku>
<Oszczędzanie tonera>
<Wyłącz> lub <Włącz>
Gęstość: X (X=C, M, Y, K) *
Dostosowanie gęstości tonera do drukowania dla każdego koloru CMYK. Ta pozycja nie jest wyświetlana, jeśli
ustawienie parametru <Oszczędzanie tonera> to <Włącz>. Regulacja gęstości wydruku(P. 532)
-8 do 0
do +8
Gęstość X (dokładna regulacja) (X=C, M, Y, K) *
Dla każdego koloru CMYK można precyzyjnie dostosować gęstość tonera stosowaną podczas drukowania z podziałem
na trzy różne obszary gęstości. Ta pozycja nie jest wyświetlana, jeśli ustawienie parametru <Oszczędzanie tonera> to
<Włącz>. Regulacja gęstości wydruku(P. 532)
Duży
-8 do 0
do +8
Średnia
-8 do 0
do +8
Mały
-8 do 0
do +8
Tryb koloru
Ustawianie drukowania w trybie kolorowym lub czarno-białym.
Autom. (kol./czarny)
Kolorowy
Czarny
(
)
<Jakość wydruku>
<Tryb koloru>
374
Wybierz tryb kolorowy
Lista menu ustawień
<Autom. (kol./czarny)>
Automatyczny wybór drukowania w trybie kolorowym lub czarno-białym w zależności od typu dokumentu.
<Kolorowy>
Drukowanie w kolorze.
<Czarny>
Drukowanie w trybie czarno-białym, nawet jeśli dokument jest w kolorze.
Półtony
Istnieje możliwość wybrania metody drukowania z odzwierciedlaniem półtonów (zakres pośredni między jaśniejszymi i
ciemniejszymi obszarami obrazu).
Błąd dyfuzji
Tryb ten pozwala drukować dane z tekstem i cienkimi liniami oraz zakrzywionymi liniami danych CAD itp.
Wyłącz
Włącz
(
)
<Jakość wydruku>
<Półtony>
<Błąd dyfuzji>
<Wyłącz> lub
<Włącz>
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku korzystania z <Błąd dyfuzji>.
Rozdzielcz./gradacja *
Jeśli ustawienie opcji <Błąd dyfuzji> to <Wyłącz>, wybierz metodę odtwarzania półtonów. Tę pozycję można
ustawiać dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
Rozdzielczość
Gradacja
Grafiki
Rozdzielczość
Gradacja
Obraz
Rozdzielczość
375
Lista menu ustawień
Gradacja
(
)
<Jakość wydruku>
gradacja>
<Półtony>
Wybierz typ danych obrazu
<Rozdzielcz./
<Rozdzielczość> lub <Gradacja>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Rozdzielczość>
Umożliwia precyzyjne drukowanie poprzez ostre odzwierciedlanie krawędzi znaków. Ten tryb drukowania jest
odpowiedni do drukowania danych składających się ze znaków i cienkich linii z wyraźnym wykończeniem.
<Gradacja>
Umożliwia drukowanie gradacji i linii z płynnym wykończeniem. Ten typ drukowania jest odpowiedni do
drukowania rysunków lub tabel zawierających gradacje.
Kompensacja szarości
W przypadku danych w czerni lub szarości zawierających informację o kolorze z definicją R=G=B można wybrać
drukowanie przy użyciu wyłącznie czarnego tonera (K). Można ustawić tę pozycję dla każdego typu obrazów zawartego
w jednym dokumencie.
Tekst
Wyłącz
Włącz
Grafiki
Wyłącz
Włącz
Obraz
Wyłącz
Włącz
(
obrazu
)
<Jakość wydruku>
<Kompensacja szarości>
<Wyłącz> lub <Włącz>
376
Wybierz typ danych
Lista menu ustawień
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Wyłącz>
Drukowanie przy użyciu 4-kolorowego tonera CMYK. Odtwarzalność gradacji ciemnych kolorów jest lepsza niż
w przypadku opcji <Włącz>.
<Włącz>
Drukowanie przy użyciu wyłącznie czarnego tonera (K). Pozwala uniknąć niedopasowania kolorów, które
może wystąpić w przypadku kolorowego tonera (CMY).
CMS
Ustawianie metod przetwarzania dla korekcji kolorów. Istnieje możliwość wprowadzenia różnych ustawień dla różnych
typów danych zawartych w jednym dokumencie.
Wybór CMS
Ustawienie przeprowadzania korekcji kolorów po stronie drukarki lub po stronie hosta (sterownika drukarki).
Drukarka
Host
(
)
<Jakość wydruku>
<CMS>
<Wybór CMS>
<Drukarka> lub
<Host>
CMS/Gamma
Wybór trybu przetwarzania do drukowania w kolorze. Tę pozycję można ustawić dla każdego typu obrazu
zawartego w jednym dokumencie.
Tekst
CMS
Gamma
Grafiki
CMS
Gamma
Obraz
CMS
377
Lista menu ustawień
Gamma
(
)
<Jakość wydruku>
danych obrazu
<CMS>
<CMS/Gamma>
Wybierz typ
<CMS> lub <Gamma>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<CMS>
Użyj profilu, aby dopasować kolor.
<Gamma>
Wykonaj korekcję koloru poprzez ustawienie wartości gamma przy regulacji jasności.
Profil źródła RGB
Wybór odpowiedniego profilu danych RGB zgodnego z używanym monitorem. Tę pozycję można ustawić dla
każdego typu obrazu zawartego w jednym dokumencie.
Tekst
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
Grafiki
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
Obraz
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
378
Lista menu ustawień
(
)
<Jakość wydruku>
danych obrazu
<CMS>
<Profil źródła RGB>
Wybierz typ
Wybierz profil
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<sRGB v3.0 (Canon)>
Używany jest profil RGB podobny do średniego profilu większości monitorów stosowanych z komputerami z
systemem Windows. Podczas korzystania z monitora obsługującego standard sRGB można drukować kolory
zbliżone do kolorów wyświetlanych na monitorze.
Tryby z zakresu od <Canon HDTV gamma 1.5> do <Canon HDTV gamma 2.4>
W tym miejscu można wprowadzić ustawienia konieczne do wyregulowania jasności po dokonaniu
porównania kolorów wydruku z kolorami wyświetlanymi na monitorze. Im wyższa wartość, tym ciemniejsze
kolory wydruków.
● Ta pozycja jest dostępna, gdy ustawieniem opcji <CMS/Gamma> jest <CMS>.
Profil wyjściowy
Wybór odpowiedniego profilu danych do wydrukowania. Tę pozycję można ustawić dla każdego typu obrazu
zawartego w jednym dokumencie.
Tekst
Normal
Photo
Grafiki
Normal
Photo
Obraz
Normal
Photo
379
Lista menu ustawień
(
)
<Jakość wydruku>
danych obrazu
<CMS>
<Profil wyjściowy>
Wybierz typ
<Normal> lub <Photo>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Normal>
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach zbliżonych do kolorów
wyświetlanych na monitorze.
<Photo>
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał fotografię.
● Ta pozycja jest dostępna, gdy ustawieniem opcji <CMS/Gamma> jest <CMS>.
Metoda dopasowania
Za pomocą opcji <Profil źródła RGB> można zdefiniować element mający pierwszeństwo nad innymi podczas
dopasowywania kolorów. Tę pozycję można ustawić dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
Percepcyjnie
Saturacja
Kolorometryczny
Grafiki
Percepcyjnie
Saturacja
Kolorometryczny
Obraz
Percepcyjnie
Saturacja
Kolorometryczny
380
Lista menu ustawień
(
)
<Jakość wydruku>
dopasowania>
<CMS>
Wybierz typ danych obrazu
<Metoda
Wybierz metodę dopasowania
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Percepcyjnie>
Dopasowanie wykonywane jest z priorytetem percepcji koloru.
<Saturacja>
Dopasowanie wykonywane jest z priorytetem nasycenia.
<Kolorometryczny>
Dopasowanie wykonywane jest w taki sposób, aby zminimalizować różnicę kolorów między oryginałami a
wydrukami.
Korekcja Gamma
Można dostosować jasność, tak aby w wydruk nie wpłynął na najjaśniejsze i najciemniejsze części. Tę pozycję
można ustawić dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
1.0
1.4
1.8
2.2
Grafiki
1.0
1.4
1.8
2.2
Obraz
1.0
1.4
1.8
2.2
381
Lista menu ustawień
(
)
<Jakość wydruku>
danych obrazu
<CMS>
<Korekcja Gamma>
Wybierz typ
Wybierz wartość ustawienia
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
Tryby z zakresu od <1.0> do <2.2>
Ten element należy ustawić, jeżeli ma być dostosowywana jasność wydruków. <1.4> to ustawienie
standardowe (bez korekcji), a im wyższa wartość ustawienia, tym ciemniejszy będzie wydruk.
● Ta pozycja jest dostępna, gdy ustawieniem opcji <CMS/Gamma> jest <Gamma>.
Ustawienia gradacji
Wprowadzanie ustawień trybu wygładzania, który umożliwia płynne drukowanie gradacji linii, rysunków lub obrazów,
takich jak zdjęcia.
Gradacja
Pozwala włączyć lub wyłączyć tryb wygładzania. Wydruk gradacji jest bardziej płynny w przypadku wybrania
opcji <Wygładzanie 2> zamiast opcji <Wygładzanie 1>.
Wyłącz
Wygładzanie 1
Wygładzanie 2
(
gradacji>
)
<Jakość wydruku>
<Gradacja>
<Ustawienia
Wybierz metodę przetwarzania
Grafiki *
Wybór zastosowania trybu wygładzania do linii i rysunków, gdy ustawienie opcji <Gradacja> to <Wygładzanie 1>
lub <Wygładzanie 2>.
382
Lista menu ustawień
Wyłącz
Włącz
(
)
<Jakość wydruku>
<Ustawienia
<Grafiki>
<Wyłącz> lub <Włącz>
gradacji>
Obraz *
Wybór zastosowania trybu wygładzania do danych obrazu, takich jak zdjęcia, gdy ustawienie opcji <Gradacja> to
<Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
(
)
<Jakość wydruku>
<Ustawienia
<Obraz>
<Wyłącz> lub <Włącz>
gradacji>
Zaawans. wygładzanie
Wprowadzanie ustawień trybu wygładzania, który umożliwia płynne drukowanie krawędzi linii, rysunków i tekstu.
Zaawans. wygładzanie
Włączanie lub wyłączanie trybu wygładzania. Krawędzie będą bardziej wygładzone w przypadku opcji
<Wygładzanie 2> niż opcji <Wygładzanie 1>.
Wyłącz
Wygładzanie 1
Wygładzanie 2
(
)
wygładzanie>
<Jakość wydruku>
<Zaawans. wygładzanie>
<Zaawans.
Wybierz metodę przetwarzania
Grafiki *
Wybór zastosowania trybu wygładzania do linii i rysunków, gdy ustawienie opcji <Zaawans. wygładzanie> to
<Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
383
Lista menu ustawień
(
)
<Jakość wydruku>
wygładzanie>
<Zaawans.
<Grafiki>
<Wyłącz> lub <Włącz>
Tekst *
Określenie, czy tryb wygładzania ma być zastosowany do tekstu, gdy ustawienie opcji <Zaawans. wygładzanie>
to <Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
(
)
<Jakość wydruku>
wygładzanie>
<Tekst>
<Zaawans.
<Wyłącz> lub <Włącz>
Korek. objęt. tonera
Ustawienie sposobu dostosowania ilości tonera podczas drukowania obszarów o dużej gęstości.
Normalna
Priorytet gradacji
Priorytet tekstu
(
)
<Jakość wydruku>
<Korek. objęt. tonera>
Wybierz poprawną
metodę
<Normalna>
Drukowanie tekstu oraz linii z zastosowaniem ilości tonera pozwalającej zachować rozdzielczość, a także
drukowanie innych typów danych z zastosowaniem ilości tonera pozwalającej zachować odcień.
<Priorytet gradacji>
Drukowanie wszystkich typów danych z zastosowaniem ilości tonera pozwalającej zachować odcień.
<Priorytet tekstu>
Drukowanie wszystkich typów danych z zastosowaniem ilości tonera pozwalającej zachować rozdzielczość.
384
Lista menu ustawień
Kontrola linii
Ustawianie metody przetwarzania obrazu dla linii.
Priorytet rozdziel.
Priorytet gradacji
(
)
<Jakość wydruku>
<Kontrola linii>
<Priorytet rozdziel.> lub
<Priorytet gradacji>
<Priorytet rozdziel.>
Przetwarzanie linii w taki sposób, aby rozdzielczość została zachowana w takim samym stopniu, jak przy
przetwarzaniu tekstu.
<Priorytet gradacji>
Przetwarzanie linii w taki sposób, aby odcień i gradacja zostały zachowane w takim samym stopniu, jak przy
przetwarzaniu rysunków.
Ogranicz jakość
Pozwala określić, czy w przypadku niedostatecznej ilości pamięci do przetwarzania drukowanie ma być kontynuowane
automatycznie z niższą jakością.
Kontynuuj drukowanie
Zatrzymaj drukowanie
(
)
<Jakość wydruku>
<Ogranicz jakość>
<Kontynuuj drukowanie> lub
<Zatrzymaj drukowanie>
● W przypadku wybrania opcji <Zatrzymaj drukowanie> będzie wyświetlany komunikat o błędzie i drukowanie
zostanie zatrzymane, gdy w urządzeniu zabraknie pamięci. Aby przywrócić drukowanie z niższą jakością,
należy nacisnąć przycisk
(
).
385
Lista menu ustawień
Tryb spec. wygładz.
Jeśli gęstość wydruku wynikowego jest nierównomierna lub wykończenie druku nie jest wygładzone, należy zmienić
ustawienia.
Tryb 1
Tryb 2
Tryb 3
Tryb 4
Tryb 5
Tryb 6
(
)
<Jakość wydruku>
<Tryb spec. wygładz.>
Wybierz tryb
<Tryb 1>
Ustawienie odpowiednie dla większości środowisk.
<Tryb 2>
To ustawienie należy zdefiniować jeśli nie można wydrukować obszaru wewnętrznego rysunków o wysokiej
gęstości, dużych znaków lub grubych linii z gładkim wykończeniem.
<Tryb 3>
To ustawienie należy zdefiniować, jeśli jednocześnie zostaną zaobserwowane poniższe objawy.
● Nie można wydrukować obszaru wewnętrznego rysunków o wysokiej gęstości, dużych znaków lub grubych
linii z gładkim wykończeniem.
● Nie można wydrukować obwodu linii, znaków lub rysunków o niskiej gęstości z gładkim wykończeniem.
386
Lista menu ustawień
● Nie można wydrukować znaków oraz linii na jednolitym tle z gładkim wykończeniem.
<Tryb 4>
To ustawienie należy zdefiniować, jeśli nie można wydrukować obwodu linii, znaków lub rysunków o niskiej
gęstości z gładkim wykończeniem.
<Tryb 5>
To ustawienie należy zdefiniować, gdy na obrazach, takich jak zdjęcia, rysunki, gradacje lub cieniowane
wzory, pojawiają się paski, skutkiem czego wydruki są nierówne.
<Tryb 6>
To ustawienie należy zdefiniować, jeśli wydruk ogólnie nie jest gładki.
● W przypadku wybrania opcji <Tryb 2> lub <Tryb 4> obszary o niskiej gęstości mogą być nierównomiernie
pokryte kolorem.
● W przypadku wybrania opcji <Tryb 3> obszary o niewielkiej gęstości lub cieniowane wzory mogą być
nierównomiernie pokryte kolorem.
● W przypadku wybrania opcji <Tryb 5> obwód znaków, linii lub rysunków może nie być wygładzony na
wydruku.
● W przypadku wybrania opcji <Tryb 6> mogą wystąpić nierówności koloru.
387
Lista menu ustawień
Interfejs
6869-04U
Wszystkie ustawienia z listy dotyczące interfejsów komunikacji z komputerem i
urządzeniem USB są opatrzone krótkim opisem. Ustawienia domyślne oznaczone są
przy pomocy znaku ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w przypadku niektórych używanych
opcji lub innych ustawień.
Wybór interfejsu(P. 388)
Limit czasu(P. 389)
Rozpoz. połączenia(P. 390)
Powiększ. bufor odb.(P. 390)
Wybór interfejsu
Wybór interfejsu do użycia przez urządzenie.
USB
Włączanie lub wyłączanie portu USB.
Ograniczenie połączenia USB z komputerem(P. 252)
Wyłącz
Włącz
Sieć
Włączenie lub wyłączenie portu LAN.
Wyłączanie portu LAN(P. 260)
Wyłącz
Włącz
Zaawans. funkcje USB
Pozwala określić ustawienia wyboru funkcji do użycia w przypadku urządzenia USB lub wyboru sterownika
urządzenia do użycia.
Ustaw. zaawan. funk.
Pozwala wybrać, czy w przypadku podłączenia urządzenia USB do urządzenia pierwszeństwo będą miały
aplikacje MEAP czy USB na NW.
Priorytet Meap
Priorytet USB nad NW
388
Lista menu ustawień
(
)
<Interfejs>
komunikat
<Wybór interfejsu>
<Zaawans. funkcje USB>
Sprawdź
<Ustaw. zaawan. funk.>
Wykonaj reset sprzętowy (
Meap> lub <Priorytet USB nad NW>
<Priorytet
Reset
sprzętowy(P. 488) )
<Priorytet Meap>
To ustawienie należy wybrać, aby pierwszeństwo miały aplikacje MEAP.
<Priorytet USB nad NW>
To ustawienie należy wybrać, aby nadać pierwszeństwo opcji USB na NW. Ta funkcja umożliwia korzystanie z
poziomu komputera z urządzenia USB podłączonego do portu USB tego urządzenia.
Urz. pam. masow. USB
Pozwala określić ustawienia sterownika urządzenia umożliwiające korzystanie z urządzenia pamięci USB.
Sterownik MEAP
Włączanie lub wyłączanie sterownika urządzenia specyficznego dla MEAP po podłączeniu urządzenia
pamięci USB do tego urządzenia. Aby drukować bezpośrednio z urządzenia pamięci USB (Drukowanie
bezpośrednio z USB) bez użycia komputera, należy wybrać opcję <Wyłącz>.
Wyłącz
Włącz
(
)
komunikat
USB>
(
<Interfejs>
<Wybór interfejsu>
<Zaawans. funkcje USB>
<Sterownik MEAP>
Sprawdź
<Urz. pam. masow.
<Wyłącz> lub <Włącz>
Wykonaj reset sprzętowy
Reset sprzętowy(P. 488) )
Limit czasu
Określa sposób zachowania się urządzenia w przypadku przerwania odbierania danych.
Limit czasu
W przypadku tej opcji drukowanie zostanie anulowane, jeśli przez określony okres czasu.
Wyłącz
Włącz
389
Lista menu ustawień
(
)
<Interfejs>
<Limit czasu>
<Limit czasu>
<Wyłącz> lub
<Włącz>
Długość limitu czasu *
Należy ustawić okres czasu, po upływie którego wystąpi błąd upływu czasu.
5 do 15
do 300 (sekund)
(
)
<Interfejs>
<Limit czasu>
<Długość limitu czasu>
Ustaw
okres czasu za pomocą klawiszy numerycznych
Rozpoz. połączenia
Podczas drukowania za pośrednictwem przewodowego połączenia LAN może wystąpić problem, taki jak
nieprawidłowe drukowanie warstwa na warstwie lub nieczytelne znaki. W takim przypadku należy dla opcji <Rozpoz.
połączenia> wybrać ustawienie <Wyłącz>.
Wyłącz
Włącz
(
)
<Interfejs>
komunikat
<Rozpoz. połączenia>
<Wyłącz> lub <Włącz>
Sprawdź
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
Powiększ. bufor odb.
Pozwala wybrać możliwość zwiększenia przestrzeni pamięci wbudowanej w urządzenie na potrzeby odbierania danych
drukowania z komputera. W przypadku wybrania opcji <Włącz> może skrócić się czas transmisji lub przetwarzania
danych drukowania na komputerze podczas wysyłania dużych objętości danych lub danych o złożonej strukturze.
Wyłącz
Włącz
390
Lista menu ustawień
(
)
<Interfejs>
komunikat
<Powiększ. bufor odb.>
<Wyłącz> lub <Włącz>
sprzętowy(P. 488) )
391
Sprawdź
Wykonaj reset sprzętowy (
Reset
Lista menu ustawień
Konserw. użytkownika
6869-04W
Zawiera listę ustawień dotyczących wyglądu regulacji urządzenia, takich jak korekta
położenia wydruku dla poszczególnych źródeł papieru i poprawa jakości wydruku,
wraz z krótkimi opisami. Ustawienia domyślne są oznaczone znakiem ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w przypadku niektórych używanych
opcji lub innych ustawień.
Dost. pozyc. wydruku(P. 392)
Odzyskane drukowanie(P. 393)
Zainicjuj zliczanie(P. 393)
Sprawdź rozmiar pap.(P. 394)
Pr. uniew. dr. sukc.(P. 395)
Rozmiar zastępczy(P. 395)
Wykr. typ pap. autom(P. 395)
Prior. p. kr. kraw.(P. 396)
Tryb specjal. obrazu(P. 396)
Tryb spec. transferu(P. 397)
Korekcja marszczenia(P. 397)
Tryb spec. 4 utrwal.(P. 398)
Popraw utrw. toner.(P. 398)
Tryb przeł. kol/cz-b(P. 398)
Czysz. wałka obciąż.(P. 399)
Korekcja linii bębna(P. 399)
Tryb spec. gęstości(P. 400)
Konserwacja karty SD(P. 400)
Tryb spec. wydruku(P. 401)
Tryb spec. wydruku E(P. 407)
Aktual. opr. układ.(P. 407)
Pierwsza kalibracja(P. 408)
Metoda podaw. pap.(P. 408)
Reg. temp. w st.ocz.(P. 409)
Pokaż listę zadań(P. 410)
Reg. podaw. papieru(P. 410)
Red. niezg.kol. gr.3(P. 411)
Korek. niezgod. kol.(P. 411)
Praw. gęs.wyd.cz.-b.(P. 411)
Prędkość drukow. POP(P. 412)
Kor. kol. druk. POP(P. 412)
Tryb ostrzeż. tonera(P. 413)
Autom. kalibrac. POP(P. 413)
Ust. impor./ekspor.(P. 414)
Częstot. kalibracji(P. 415)
Powiad. do czyszcz.(P. 415)
Czas czyszcz. powiad(P. 415)
Częst. spraw. tonera(P. 416)
Okr.częst.spr.tonera(P. 416)
Częst. spraw. bębna(P. 416)
Częst. sp. spr. bęb.(P. 417)
Czynn. przy br. ton.(P. 417)
Red. tła dla nis.pr.(P. 418)
Zmn. plam na margin.(P. 418)
Kontrola kondensacji(P. 418)
Dost. pozyc. wydruku
Położenie wydruku można dostosować dla każdego źródła papieru.
Regulacja położenia wydruku(P. 536)
Przes. Y (2-str.)
W trybie drukowania dwustronnego można regulować położenie wydruku w pionie w celu drukowania na
pierwszej stronie (stronie przedniej). Położenie wydruku na drugiej stronie (z tyłu) odpowiada ustawieniom
źródła papieru dostępnego w momencie rozpoczęcia drukowania.
-5,0 do 0,0
do +5,0 (mm)
392
Lista menu ustawień
Przes. X (2-str.)
W trybie drukowania dwustronnego można regulować położenie wydruku w poziomie w celu drukowania na
pierwszej stronie (stronie przedniej). Położenie wydruku na drugiej stronie (z tyłu) odpowiada ustawieniom
źródła papieru dostępnego w momencie rozpoczęcia drukowania.
Taca wielofunkcyjna
-3,5 do 0,00 do +3,5 (mm)
Szuflada 1 do 5 *
-3,5 do 0,00 do +3,5 (mm)
Przesunięcie Y (MP)
Można wyregulować położenie wydruku w pionie na papierze z tacy wielofunkcyjnej.
-5,0 do 0,0
do +5,0 (mm)
Przesunięcie X (MP)
Można wyregulować położenie wydruku w poziomie na papierze z tacy wielofunkcyjnej.
-3,5 do 0,00
do +3,5 (mm)
Przes. Y (szufl. 1 do 5) *
Można wyregulować położenie wydruku w pionie na papierze podawanym z szuflady na papier.
-5,0 do 0,0
do +5,0 (mm)
Przes. X (szufl. 1 do 5) *
Można wyregulować położenie wydruku w poziomie na papierze podawanym z szuflady na papier.
-3,5 do 0,00
do +3,5 (mm)
Odzyskane drukowanie
Pozwala określić, czy strona, przy której wystąpił błąd lub nastąpiło zakleszczenie papieru, ma być wydrukowana
ponownie.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Odzyskane drukowanie>
<Włącz>
Zainicjuj zliczanie
Inicjowanie licznika wydrukowanych stron dla każdej części eksploatacyjnej.
393
<Wyłącz> lub
Lista menu ustawień
2. zewn. wał. trans.
Inicjowanie licznika wydrukowanych stron wydrukowanych za pomocą tej samej drugiej rolki transferowej
zewnętrznej. Operację tę należy wykonać w przypadku wymiany drugiej rolki transferowej zewnętrznej.
(
)
<Konserw. użytkownika>
<Zainicjuj zliczanie>
<2. zewn. wał.
<Tak>
trans.>
W. odb. tacy wielof.
Inicjowanie licznika wydrukowanych stron wydrukowanych za pomocą tego samego wałka odbierającego tacy
uniwersalnej. Operację tę należy wykonać w przypadku wymiany wałka odbierającego tacy uniwersalnej.
(
)
<Konserw. użytkownika>
wielof.>
<Zainicjuj zliczanie>
<W. odb. tacy
<Tak>
Wałek pod. kasety 1. do Wałek pod. kasety 5 *
Inicjowanie licznika wydrukowanych stron wydrukowanych za pomocą tej samej rolki podajnika. Operację tę
należy wykonać w przypadku wymiany rolki podajnika.
(
)
<Konserw. użytkownika>
do Wałek pod. kasety 5>
<Zainicjuj zliczanie>
<Wałek pod. kasety 1.
<Tak>
Sprawdź rozmiar pap.
Pozwala wybrać sprawdzanie rozmiaru papieru podawanego ze źródła papieru z rozmiarem papieru ustawionym w
opcji <Dowolny rozm.>. W przypadku wybrania opcji <Włącz>, a jeśli rozmiar papieru podawanego ze źródła papieru
będzie niezgodna z danymi drukowania, zostanie wyświetlony komunikat z potwierdzeniem rozmiaru papieru.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Włącz>
394
<Sprawdź rozmiar pap.>
<Wyłącz> lub
Lista menu ustawień
● Jeśli różnica rozmiaru między podawanym papierem a danymi drukowania nie jest duża, jest możliwe, że nie
zostanie wyświetlony żaden komunikat, a drukowanie będzie kontynuowane pomimo wybrania ustawienia
<Włącz>.
Pr. uniew. dr. sukc.
Druk ciągły może powodować nierównomierną gęstość druku. W takim wypadku wybór dla omawianej opcji
ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Pr. uniew. dr. sukc.>
<Wyłącz> lub
<Włącz>
Rozmiar zastępczy
Pozwala wybrać możliwość drukowania zamiennego na papierze w rozmiarach A4 i Letter. W przypadku wybrania opcji
<Włącz>, jeśli użytkownik załaduje papier w formacie Letter, a z poziomu komputera zdefiniuje rozmiar papieru A4,
który nie jest załadowany do urządzenia, wówczas dokument zostanie wydrukowany na papierze w formacie Letter.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Rozmiar zastępczy>
<Wyłącz> lub
<Włącz>
Wykr. typ pap. autom
Można zoptymalizować funkcję automatycznego wykrywania rodzaju papieru ( Wykr. typ pap. autom(P. 495) ) w
zależności od rozmiaru papieru, którego używasz najczęściej. Zaleca się, aby dla tej funkcji stosować normalnie
domyślne ustawienia fabryczne.
Tryb 1
Tryb 2
Tryb 3
(
)
<Konserw. użytkownika>
tryb
395
<Wykr. typ pap. autom>
Wybierz
Lista menu ustawień
<Tryb 1>
Ustawienie to należy określić w przypadku częstego używania papieru <Zwykły L> lub <Zwykły L2> w formacie
A4 lub A3.
<Tryb 2>
Ustawienie to należy określić w przypadku częstego używania papieru<Zwykły> w formacie A4 lub A3.
<Tryb 3>
Ustawienie to należy określić w przypadku częstego używania papieru<Zwykły> w formacie Letter lub Ledger.
● Ta opcja jest włączona, gdy dla opcji <Wykr. typ pap. autom> w polu
ustawiona wartość inna niż <Nie używaj>.
Menu wyboru podajnika(P. 491) jest
● Jeżeli domyślne ustawienia fabryczne zostanie zmienione w jakikolwiek sposób, automatyczne wykrywanie
typu papieru może być nieprawidłowe.
Prior. p. kr. kraw.
Podczas drukowania na papierze w rozmiarze umożliwiającym ładowanie papieru zarówno w orientacji pionowej, jak i
poziomej, należy wybrać dla tej pozycji ustawienie <Włącz>, aby preferowane było podawanie papieru w orientacji
poziomej. To ustawienie ma zastosowanie jedynie wówczas, gdy ustawienie opcji <Źródło papieru> to
<Automatycznie>.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Prior. p. kr. kraw.>
<Wyłącz> lub <Włącz>
Tryb specjal. obrazu
Tę opcję należy ustawić, jeśli nie można wydrukować środkowego obszaru znaków lub linii o dużej gęstości. Efekt
poprawy będzie silniejszy w przypadku opcji <Poziom 2> niż opcji <Poziom 1>.
Wyłącz
Poziom 1
Poziom 2
396
Lista menu ustawień
(
)
<Konserw. użytkownika>
<Tryb specjal. obrazu>
Wybierz
poziom
● Wybór opcji dającej największy efekt poprawy zmniejsza gęstość druku.
Tryb spec. transferu
Jeśli korzysta się z urządzenia w środowisku o niskiej wilgotności, na wydrukowanych obrazach lub tekście mogą być
widoczne smugi. W tym przypadku ustawienie tego elementu na wartość <Włącz> może rozwiązać problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Tryb spec. transferu>
<Wyłącz> lub
<Włącz>
● Jeśli zostanie wybrane ustawienie <Włącz>, gdy urządzenie jest eksploatowane w warunkach wysokiej
wilgotności, gęstość druku może być lżejsza lub nierówna.
Korekcja marszczenia
Drukowanie na zwykłym lub cienkim papierze może spowodować pomarszczenie wydruku. W takim wypadku wybór
dla omawianej opcji ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Włącz>
397
<Korekcja marszczenia>
<Wyłącz> lub
Lista menu ustawień
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
Tryb spec. 4 utrwal.
W przypadku korzystania z urządzenia w środowisku o niskiej wilgotności w pustych miejscach mogą pojawić się
odbicia druku. W takim wypadku wybór dla omawianej opcji ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Tryb spec. 4 utrwal.>
<Wyłącz> lub
<Włącz>
Popraw utrw. toner.
W przypadku wykonywania druku dwustronnego po dłuższym okresie nieużywania urządzenia, na drukowanych
obrazach mogą wystąpić puste miejsca. W takim wypadku użycie omawianej opcji może rozwiązać ten problem. Efekt
poprawy jest lepiej widoczny w przypadku wyboru ustawienia <Tryb 2> aniżeli <Tryb 1>.
Wyłącz
Tryb 1
Tryb 2
(
)
<Konserw. użytkownika>
<Popraw utrw. toner.>
Wybierz tryb
W przypadku drukowania dwustronnego z tą pozycją ustawioną na inną niż <Wyłącz> rozpoczęcie drukowania
może trwać dłużej.
Tryb przeł. kol/cz-b
Jeżeli drukowanie dane zawierają zarówno dane czarno-białe, jak i dane kolorowe, można określić, czy priorytetem ma
być wyższa prędkość drukowania czy rzadsze używanie kasety z tonerami kolorowymi (CMY).
Tryb 1
Tryb 2
398
Lista menu ustawień
(
)
<Konserw. użytkownika>
<Tryb przeł. kol/cz-b>
Wybierz tryb
<Tryb 1>
Nadanie priorytetu prędkości drukowania.
<Tryb 2>
Można drukować, wykorzystując rzadziej kasety z tonerami kolorowymi CMY.
● Jeżeli zostanie wybrane ustawienie <Tryb 2>, prędkość drukowania może być niższa.
Czysz. wałka obciąż.
Czasami białe obszary mogą stać się lekko kolorowe. W takim wypadku wybór dla omawianej opcji ustawienia <Włącz>
może rozwiązać ten problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Czysz. wałka obciąż.>
<Włącz>
Jeśli wybrane zostanie ustawienie <Włącz>, poziom zabarwienia może być mniejszy.
Korekcja linii bębna
Jeżeli na wydrukach są widoczne smugi, wybór ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
399
<Wyłącz> lub
Lista menu ustawień
(
)
<Konserw. użytkownika>
<Korekcja linii bębna>
<Wyłącz> lub
<Włącz>
Tryb spec. gęstości
Jeśli urządzenie jest eksploatowane w warunkach wysokiej wilgotności, gęstość druku może być lżejsza lub nierówna.
W takim przypadku ustawienie dla tej pozycji wartości <Włącz> może rozwiązać problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Tryb spec. gęstości>
<Wyłącz> lub
<Włącz>
● Jeśli zostanie wybrane ustawienie <Włącz>, a urządzenie jest eksploatowane w warunkach niskiej
wilgotności, na wydrukowanych obrazach lub tekście mogą być widoczne smugi.
Konserwacja karty SD *
W przypadku wystąpienia błędu na karcie SD lub w razie potrzeby zaprzestania korzystania z karty SD można usunąć
wszystkie dane zapisane na takiej karcie.
Formatowanie
Przeprowadza inicjalizację karty SD. Wszystkie dane zostaną skasowane z karty.
(
)
SD>
<Konserw. użytkownika>
<Formatowanie>
<Konserwacja karty
<Tak>
Pełne usuw. danych
Powoduje usunięcie wszystkich danych przechowywanych na karcie pamięci SD. Operację tę należy
przeprowadzać stosownie do potrzeb, np. wtedy, gdy użytkownik zamierza pozbyć się karty pamięci SD i
wymagane jest usunięcie wszystkich przechowywanych danych, również tych, których nie da się wymazać w
standardowy sposób. Usuwanie wszystkich danych z karty pamięci SD(P. 603)
400
Lista menu ustawień
Tryb spec. wydruku
Opcje do wyboru w przypadku niemożności prawidłowego drukowania.
Korekcja zwijania
Drukowanie na zwykłym lub cienkim papierze może spowodować zwijanie się wydruku. W tym przypadku
problem można rozwiązać, ustawiając tę pozycję na <Włącz> dla źródła papieru używanego do podawania
papieru, który się zwija.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
zwijania>
<Tryb spec. wydruku>
Wybierz źródło papieru
<Korekcja
<Wyłącz> lub <Włącz>
Wybór źródła papieru
Wybór źródła papieru, dla którego ma być zmienione ustawienie korekcji zwijania.
Zmiana ustawień
Aby wykonać korekcję zwijania, należy wybrać opcję <Włącz>.
● W przypadku wybrania opcji <Włącz> rozpoczęcie drukowania może trwać dłużej. Ponadto może
zmniejszyć się szybkość drukowania.
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
Korekcja zwijania 2
Jeśli włączenie opcji <Korekcja zwijania> nie wyeliminuje problemu zwijania się papieru, problem może
rozwiązać wybranie dla tej opcji ustawienia <Włącz>.
Wyłącz
Włącz
401
Lista menu ustawień
(
)
2>
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Korekcja zwijania
<Wyłącz> lub <Włącz>
● Po wybraniu opcji <Włącz> prędkość drukowania może się zmniejszyć. Wydruki mogą być też blade.
Tryb sp. pap. powl.
W przypadku niektórych rodzajów papieru i warunków otoczenia część nadruku może zostać usunięta. W takim
wypadku wybór dla omawianej opcji ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
powl.>
<Tryb spec. wydruku>
<Tryb sp. pap.
<Wyłącz> lub <Włącz>
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
Regul. pap. chropow.
W przypadku drukowania na grubym surowym papierze w zależności od warunków otoczenia mogą wystąpić
następujące zjawiska. W takim wypadku wybór dla omawianej opcji ustawienia <Włącz> może rozwiązać ten
problem.
● Część nadruku zostaje usunięta
● Niski poziom zabarwienia wydruku
● Zwijanie się wydruków
Wyłącz
Włącz
(
chropow.>
)
<Konserw. użytkownika>
<Wyłącz> lub <Włącz>
402
<Tryb spec. wydruku>
<Regul. pap.
Lista menu ustawień
● Po wyborze opcji <Włącz> prędkość drukowania będzie mniejsza.
Tryb specjal. kopert
Jeśli wskutek wchłonięcia wilgoci krawędź z klejem koperty przykleja się do papieru, należy wybrać dla tej pozycji
ustawienie <Włącz>.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Tryb specjal.
<Wyłącz> lub <Włącz>
kopert>
● Jeśli zostanie wybrane ustawienie <Włącz>, wydruki mogą być wyblakłe.
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
Zmień tryb zapobieg.
Jeśli dojdzie do sklejenia arkuszy, problem może rozwiązać wybranie dla tej opcji ustawienia <Włącz>.
Wyłącz
Włącz
(
)
zapobieg.>
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Zmień tryb
<Wyłącz> lub <Włącz>
● Po wybraniu opcji <Włącz> prędkość drukowania może się zmniejszyć.
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
Cien. pap. spec. H/H
Jeśli cienki papier jest używany w środowisku o wysokiej temperaturze lub wysokiej wilgotności, papier może się
zaciąć w zespole utrwalacza. W takim wypadku wybór dla omawianej opcji ustawienia <Włącz> może rozwiązać
ten problem.
Wyłącz
403
Lista menu ustawień
Włącz
(
)
H/H>
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Cien. pap. spec.
<Wyłącz> lub <Włącz>
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
Popr. separ. papieru
Jeśli podczas drukowania dojdzie do zacięcia się papieru, problem może rozwiązać wybranie dla tej opcji
ustawienia <Włącz>.
Wyłącz
Włącz
(
)
papieru>
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Popr. separ.
<Wyłącz> lub <Włącz>
Tryb spec. połysku
Gdy urządzenie jest używane w środowisku o dużej wilgotności, białe obszary mogą stać się lekko kolorowe. W
takim wypadku wybór dla omawianej opcji ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
połysku>
)
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Tryb spec.
<Wyłącz> lub <Włącz>
● Jeśli wybrane zostanie ustawienie <Włącz>, poziom zabarwienia może być mniejszy.
Korek. białej linii
Na wydrukach obrazów mogą pojawiać się białe smugi (linie). W takim przypadku zmiana tego ustawienia na
<Włącz> może rozwiązać problem.
Wyłącz
404
Lista menu ustawień
Włącz
(
)
<Konserw. użytkownika>
linii>
<Tryb spec. wydruku>
<Korek. białej
<Wyłącz> lub <Włącz>
● W przypadku wybrania opcji <Włącz> mogą pojawić się odbicia druku.
Praw. sm.wyd. cz.-b.
Gdy na wydrukach pojawiają się smugi, wyczyszczenie zespołu utrwalacza może nie wystarczyć do rozwiązania
problemu. W takim wypadku wybór dla omawianej opcji ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
)
b.>
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Praw. sm.wyd. cz.-
<Wyłącz> lub <Włącz>
● Po wybraniu opcji <Włącz> prędkość drukowania może się zmniejszyć. Mogą pojawić się także odbicia
druku.
Kor. kol. zw. pap. 2
Jeśli na wydrukach występuje nierównomierny połysk, problem może rozwiązać wybranie dla tej opcji
ustawienia <Włącz>.
Wyłącz
Włącz
(
2>
)
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Kor. kol. zw. pap.
<Wyłącz> lub <Włącz>
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
405
Lista menu ustawień
Ogran. cieniowanie 3
Jeżeli na wydruku widoczne jest odbicie obrazu znajdującego się na tej samej stronie, wybór dla tej opcji
ustawienia <Włącz> może rozwiązać problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
cieniowanie 3>
<Tryb spec. wydruku>
<Ogran.
<Wyłącz> lub <Włącz>
● Wybranie opcji <Włącz> może powodować nierównomierny druk.
Tryb spec. 2 utrwal.
W zależności warunków część nadruku może zostać usunięta. W takim wypadku wybór dla omawianej opcji
ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
)
utrwal.>
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Tryb spec. 2
<Wyłącz> lub <Włącz>
● To ustawienie może nie być włączone, jeśli dla pewnych elementów ustawień wybrano opcję <Włącz>.
Priorytet pozycji menu ustawień(P. 420)
Ogranicz wzór kropli
Jeśli poziom zabarwienia drukowanych obrazów jest nierówny tak, że wydruk przywodzi na myśl widok kropli
deszczu na szybie, problem może rozwiązać wybranie dla tej opcji ustawienia <Włącz>.
Wyłącz
Włącz
406
Lista menu ustawień
(
)
kropli>
<Konserw. użytkownika>
<Tryb spec. wydruku>
<Ogranicz wzór
<Wyłącz> lub <Włącz>
● Jeśli wybrane zostanie ustawienie <Włącz>, może to negatywnie odbić się na jakości drukowania.
Tryb spec. wydruku E
Jeśli odbicia obrazów powstają podczas drukowania ciągłego, problem może rozwiązać wybranie dla bieżącej
opcji ustawienia innego niż <Wyłącz>. Efekt poprawy jest lepiej widoczny w przypadku wyboru ustawienia <Tryb
2> aniżeli <Tryb 1>.
Wyłącz
Tryb 1
Tryb 2
(
)
<Konserw. użytkownika>
<Tryb spec. wydruku E>
Wybierz
tryb
● Wybranie opcji <Tryb 1> lub <Tryb 2> może powodować nierównomierną gęstość druku.
Aktual. opr. układ.
Pozwala przeprowadzić uaktualnienie oprogramowania sprzętowego urządzenia.
(
łączenia
)
<Konserw. użytkownika>
<Tak>
407
<Aktual. opr. układ.>
Wybierz metodę
Lista menu ustawień
Wybór metody łączenia
Należy wybrać metodę łączenia z komputerem, za pośrednictwem którego zostanie wykonane uaktualnienie
oprogramowania.
Pierwsza kalibracja
Określ czas automatycznego wykonania kalibracji po włączeniu zasilania.
Po zadaniach
Natychmiast
(
)
<Konserw. użytkownika>
<Pierwsza kalibracja>
<Po zadaniach> lub
<Natychmiast>
<Po zadaniach>
Automatyczne uruchamianie kalibracji po zakończeniu pierwszego zadania od włączenia zasilania.
<Natychmiast>
Automatyczne uruchamianie kalibracji bezpośrednio po włączeniu zasilania.
● Jeśli zostanie wybrane ustawienie <Natychmiast>, osiągnięcie przez urządzenie stanu gotowości do
drukowania może nastąpić dopiero po upływie pewnego czasu.
Metoda podaw. pap.
Ustawienie należy skonfigurować w przypadku druku dokumentów na papierze z logo. Aby drukować na papierze z
logo, należy zmienić sposób ułożenia papieru w źródle w zależności czy druk jest jedno- czy dwustronny. Jednak jeśli
zmienisz ustawienie na <Priorytet str. wydr.>, możesz załadować papier stroną z logo do dołu zarówno w przypadku
druku jedno-, jak i dwustronnego. Więcej informacji znajduje się w rozdziale Ładowanie uprzednio zadrukowanego
papieru(P. 56) .
Priorytet prędkości
Priorytet str. wydr.
408
Lista menu ustawień
(
)
papieru
<Konserw. użytkownika>
<Metoda podaw. pap.>
Wybierz źródło
<Priorytet prędkości> lub <Priorytet str. wydr.>
Wybór źródła papieru
Należy wybrać źródło papieru, dla którego ma być zmienione ustawienie Tryb podawania papieru.
<Priorytet prędkości>
Używając uprzednio zadrukowanego papieru z logo konieczna jest zmiana kierunku ułożenia strony, w
zależności od tego, czy wykonywane jest drukowanie jednostronne czy dwustronne.
● Zalecany jest wybór opcji <Priorytet prędkości>, jeśli strona, która zostanie zadrukowana nie jest istotna.
<Priorytet str. wydr.>
Przewrócenie arkusza na odpowiednią stronę nie jest konieczne, aby wykonać wydruk na określonej stronie
arkusza, bez względu na tryb drukowania: jednostronny lub dwustronny.
● Nawet w przypadku wybrania opcji <Priorytet str. wydr.> dla źródła papieru ( Obsługiwane rodzaje
papieru(P. 571) ) będzie ona nieaktywna, a urządzenie będzie działało w taki sam sposób, jak przy
ustawieniu <Priorytet prędkości>. W takim przypadku papier należy załadować tak samo, jak w przypadku
wybrania opcji <Priorytet prędkości> ( Ładowanie uprzednio zadrukowanego papieru(P. 56) ).
● Po wyborze opcji <Priorytet str. wydr.> prędkość drukowania jednostronnego będzie wolniejsza.
Reg. temp. w st.ocz.
Wybierz, czy chcesz dostosować temperaturę zespołu utrwalacza. W przypadku wybrania opcji <Włącz> drukowanie
może rozpocząć się szybciej.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Włącz>
409
<Reg. temp. w st.ocz.>
<Wyłącz> lub
Lista menu ustawień
● Wybranie ustawienia <Włącz> zwiększa pobór mocy podczas uruchamiania urządzenia.
Pokaż listę zadań
Pozwala wybrać możliwość wyświetlenia listy danych, które są drukowane lub oczekują na wydrukowanie, poprzez
naciśnięcie przycisku
(
) na panelu roboczym.
Wyłącz
Włącz
(
)
● Naciśnięcie przycisku
<Konserw. użytkownika>
(
<Pokaż listę zadań>
<Wyłącz> lub <Włącz>
), gdy wybrano opcję <Wyłącz>, spowoduje anulowanie aktualnie
trwającego zadania drukowania.
Reg. podaw. papieru
Jeśli podczas używania tacy uniwersalnej często dochodzi do zacięcia się papieru, problem może rozwiązać wybranie
dla tej opcji ustawienia <Włącz>.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Reg. podaw. papieru>
<Włącz>
● Po wybraniu opcji <Włącz> prędkość drukowania może się zmniejszyć.
410
<Wyłącz> lub
Lista menu ustawień
Red. niezg.kol. gr.3
Jeśli podczas drukowania na grubym papierze występuje niedopasowanie kolorów, problem może rozwiązać zmiana
tego ustawienia.
Tryb 1
Tryb 2
(
)
<Konserw. użytkownika>
<Red. niezg.kol. gr.3>
<Tryb 1> lub <Tryb
2>
● Stopień poprawy może się różnić w zależności od papieru używanego do drukowania. Jeśli wyniki
drukowania są niezgodne z oczekiwaniami, spróbuj wydrukować, przełączając ustawienie między <Tryb 1> i
<Tryb 2>.
Korek. niezgod. kol.
Jeśli występuje niedopasowanie kolorów, problem może rozwiązać wybranie ustawienia <Włącz> dla tej opcji.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Korek. niezgod. kol.>
<Wyłącz> lub
<Włącz>
● Po wybraniu opcji <Włącz> prędkość drukowania może się zmniejszyć.
Praw. gęs.wyd.cz.-b.
W przypadku wybrania dla opcji <Tryb koloru> ( Tryb koloru(P. 374) ) w obszarze <Jakość wydruku> lub <Tryb
koloru> ( Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB)(P. 83) ) w ustawieniach druku dla
funkcji drukowania bezpośredniego z USB ustawienia <Autom. (kol./czarny)> lub <Czarny>, poziom zabarwienia może
być nierównomierny lub mogą pojawić się poziome smugi na wydruku. W takim wypadku zmiana ustawienia
omawianej opcji może rozwiązać ten problem.
Wyłącz
411
Lista menu ustawień
Tryb 1
Tryb 2
(
)
<Konserw. użytkownika>
<Praw. gęs.wyd.cz.-b.>
Wybierz tryb
● W przypadku wybrania opcji <Tryb 1> ustaw <Wykr. typ pap. autom> na <Nie używaj> dla źródła papieru,
które ma być używane. Wykr. typ pap. autom(P. 495)
● W przypadku niektórych rodzajów używanego papieru po określeniu ustawienia <Tryb 1> lub <Tryb 2>
tonery CMYK zużywają się nawet w druku czarno-białym. Szybkość drukowania może też zostać spowolniona.
● Po określeniu ustawienia <Wyłącz> druk czarno-biały może powodować nierównomierne zabarwienie druku.
Prędkość drukow. POP
Jeśli jakość wydruku jest nie do przyjęcia podczas drukowania z użyciem funkcji [Optymalizacja drukowania reklam]
skonfigurowanej w sterowniku drukarki, zaleca się wybranie opcji <Tryb 2>. Spowoduje to, że wydruki POP będą miały
żywsze odcienie kolorów. Aby uzyskać więcej informacji na temat funkcji [Optymalizacja drukowania reklam], zapoznaj
się z instrukcjami obsługi odpowiednich sterowników na stronie internetowej z podręcznikami online.
Tryb 1
Tryb 2
(
)
<Konserw. użytkownika>
<Prędkość drukow. POP>
<Tryb 1> lub
<Tryb 2>
● Po wyborze opcji <Tryb 2> prędkość drukowania będzie mniejsza.
● W przypadku konfigurowania funkcji [Optymalizacja drukowania reklam] zaleca się skonfigurowanie także
następujących elementów.
- <Tryb ostrzeż. tonera>
- <Autom. kalibrac. POP>
Kor. kol. druk. POP
Jeśli podczas drukowania POP występuje nierównomierny poziom zabarwienia, kiedy funkcja [Optymalizacja
drukowania reklam] jest skonfigurowana, określ ustawienie <Włącz>.
Wyłącz
Włącz
412
Lista menu ustawień
(
)
<Konserw. użytkownika>
<Kor. kol. druk. POP>
<Wyłącz> lub
<Włącz>
● Jeśli wybrane zostanie ustawienie <Włącz>, poziom zabarwienia może być mniejszy.
● W przypadku konfigurowania funkcji [Optymalizacja drukowania reklam] zaleca się skonfigurowanie także
następujących elementów.
- <Tryb ostrzeż. tonera>
- <Autom. kalibrac. POP>
Tryb ostrzeż. tonera
Można zmienić czas wyświetlania komunikatu, gdy ilość pozostałego toneru jest mała. W przypadku ustawienia
<Wydruk z POP> komunikat wyświetlany jest wcześniej niż w przypadku <Wydruk standardowy>. Kiedy opcja
[Optymalizacja drukowania reklam] jest skonfigurowana w sterowniku drukarki, jakość wydruku może być
nieakceptowalna, jeśli pozostała ilość toneru będzie niska. Dlatego zaleca się wybranie ustawienia <Wydruk z POP>.
Aby uzyskać więcej informacji na temat funkcji [Optymalizacja drukowania reklam], zapoznaj się z instrukcjami obsługi
odpowiednich sterowników na stronie internetowej z podręcznikami online.
Wydruk standardowy
Wydruk z POP
(
)
<Konserw. użytkownika>
<Tryb ostrzeż. tonera>
<Wydruk
standardowy> lub <Wydruk z POP>
● Po wybraniu opcji <Wydruk z POP> ustawienia następujących elementów przestają być aktywne.
- <Częst. spraw. tonera>
Częst. spraw. tonera(P. 416)
- <Okr.częst.spr.tonera>
Okr.częst.spr.tonera(P. 416)
● W przypadku wybrania opcji <Wydruk z POP> zaleca się skonfigurowanie także następujących elementów.
- <Prędkość drukow. POP>
- <Autom. kalibrac. POP>
Autom. kalibrac. POP
Można zmienić typ kalibracji, która będzie wykonywana automatycznie. Oprócz zwykłej kalibracji dostępna jest
kalibracja umożliwiająca skorygowanie niedopasowania odcieni, które wystąpiło w druku POP. Po skonfigurowaniu
funkcji [Optymalizacja drukowania reklam] w sterowniku drukarki zaleca się wybranie ustawienia <Włącz>. Aby uzyskać
413
Lista menu ustawień
więcej informacji na temat funkcji [Optymalizacja drukowania reklam], zapoznaj się z instrukcjami obsługi
odpowiednich sterowników na stronie internetowej z podręcznikami online.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Autom. kalibrac. POP>
<Wyłącz> lub
<Włącz>
● Po wybraniu opcji <Włącz> kalibracja zajmuje więcej czasu. Skróceniu może ulec także termin ważności
zasobników z tonerem.
● W przypadku konfigurowania funkcji [Optymalizacja drukowania reklam] zaleca się skonfigurowanie także
następujących elementów.
- <Tryb ostrzeż. tonera>
Ust. impor./ekspor.
Dane ustawień opcji menu zarejestrowane w urządzeniu można przesyłać do urządzenia pamięci USB podłączonego
do tego urządzenia i tam je zapisywać. Wyeksportowane dane można zaimportować. Inne urządzenia odpowiadające
modelem temu urządzeniu mogą importować dane wyeksportowane z tego urządzenia i odwrotnie.
IMPORT
Istnieje możliwość zaimportowania danych, które zostały pobrane z urządzenia i zapisane na nośniku pamięci
USB.
(
)
<Konserw. użytkownika>
ekspor.>
<IMPORT>
zaimportowania
<Ust. impor./
<Tak>
Wprowadź hasło
Wybierz plik do
Sprawdź komunikat
EKSPORT
Na urządzeniu pamięci USB można zapisać dane zarejestrowane w urządzeniu i dane ustawień opcji menu.
(
)
<Konserw. użytkownika>
ekspor.>
(potwierdzenie)
<EKSPORT>
<Ust. impor./
Wprowadź hasło
Sprawdź komunikat
414
Hasło
Lista menu ustawień
● W tym celu można skorzystać z jednego z portów USB znajdujących się po lewej i prawej stronie urządzenia.
Gdy urządzenia pamięci USB są podłączone do obu tych portów USB, dane są importowane lub
eksportowane przez prawy port boczny.
● Jeżeli okno <Gotowe do drukowania plików z pamięci USB.> jest wyświetlane po podłączeniu pamięci USB,
(
naciśnij przycisk
).
● Szczegółowe informacje o importowaniu/eksportowaniu ustawień zawiera sekcja
zarejestrowanych danych(P. 319) .
Zapisywanie/ładowanie
Częstot. kalibracji
Określ częstotliwość automatycznej kalibracji. Jeśli niedopasowanie kolorów występuje często, wybierz dla tej opcji
ustawienie <Duża> lub <Bardzo wysokie>.
Standardowy
Duża
Bardzo wysokie
(
)
<Konserw. użytkownika>
<Częstot. kalibracji>
Ustaw
częstotliwość
Powiad. do czyszcz.
Pozwala wybrać możliwość wyświetlania komunikatów z monitami o wyczyszczenie modułu utrwalającego.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Powiad. do czyszcz.>
<Wyłącz> lub
<Włącz>
Czas czyszcz. powiad *
Jeśli dla opcji <Powiad. do czyszcz.> zostało wybrane ustawienie <Włącz>, można zdefiniować parametry czasu
związane z wyświetlaniem komunikatów z monitami o czyszczenie modułu utrwalającego, takie jak liczba
wydrukowanych stron w jednostkach po 1000. Na Stronie konfiguracji można sprawdzić, ile stron można wydrukować,
dopóki nie zostanie wyświetlony komunikat. ( Strona konfiguracji(P. 541) )
1000
do 50 000
415
Lista menu ustawień
(
)
<Konserw. użytkownika>
wydrukowanych stron za pomocą przycisku
<Czas czyszcz. powiad>
Wprowadź liczbę
lub
Częst. spraw. tonera
Aby zmienić ustawienia czasu wyświetlania komunikatu o ilości pozostałego tonera, należy wybrać opcję
<Niestandardowe>.
Domyślne
Niestandardowe
(
)
<Konserw. użytkownika>
<Częst. spraw. tonera>
<Domyślne> lub
<Niestandardowe>
Okr.częst.spr.tonera *
Jeśli dla opcji <Częst. spraw. tonera> wybrano ustawienie <Niestandardowe>, można określić ustawienia czasu
wyświetlania komunikatu.
1 do 20
do 99 (%)
(
)
<Konserw. użytkownika>
<Okr.częst.spr.tonera>
Za pomocą
klawiszy numerycznych wprowadź pozostałą ilość tonera w kasecie
Częst. spraw. bębna
Aby zmienić, kiedy ma być wyświetlany komunikat, gdy zbliża się czas wymiany zespołu bębna, wybierz opcję
<Niestandardowe>.
Domyślne
Niestandardowe
(
)
<Konserw. użytkownika>
<Niestandardowe>
416
<Częst. spraw. bębna>
<Domyślne> lub
Lista menu ustawień
Częst. sp. spr. bęb. *
Jeśli dla opcji <Częst. spraw. bębna> wybrano ustawienie <Niestandardowe>, określ czas wyświetlenia komunikatu.
1 do 20
do 99 (%)
(
)
<Konserw. użytkownika>
<Częst. sp. spr. bęb.>
Wprowadź za
pomocą przycisków numerycznych ilość toneru pozostałego w zespołach bębna
Czynn. przy br. ton.
Określ, czy drukowanie ma być kontynuowane, gdy upłynie termin ważności zasobnika z tonerem.
Kontynuuj drukowanie
Wstrzymaj drukowanie
Zatrzymaj drukowanie
(
)
<Konserw. użytkownika>
<Czynn. przy br. ton.>
Wybierz operację
drukowania
<Kontynuuj drukowanie>
Gdy upływa termin wymiany zasobnika z tonerem, wyświetlany jest komunikat <Zalecana jest wymiana
pojemnika z tonerem X.>, jednak drukowanie jest kontynuowane.
<Wstrzymaj drukowanie>
Gdy upływa termin wymiany zasobnika z tonerem, wyświetlany jest komunikat <Minął termin ważności.
Zalecana jest wymiana pojemnika z tonerem X.>, ale drukowanie jest tymczasowo wstrzymywane. Aby
wznowić drukowanie, naciśnij przycisk
(
).
<Zatrzymaj drukowanie>
Gdy upływa termin wymiany zasobnika z tonerem, wyświetlany jest komunikat <Zalecana jest wymiana
pojemnika z tonerem X.>, ale drukowanie jest wstrzymywane. Gdy widoczny jest ten komunikat, nie można
kontynuować drukowania.
417
Lista menu ustawień
● „X” w powyższym komunikacie oznacza kolor CMYK.
● W przypadku kontynuacji drukowania jakość druku może być niższa.
Red. tła dla nis.pr.
W przypadku niektórych typów papieru i ustawień urządzenia na wydrukach mogą pojawić się poziome smugi. W
takim wypadku wybór dla omawianej opcji ustawienia <Włącz> może rozwiązać ten problem.
Wyłącz
Włącz
(
)
<Konserw. użytkownika>
<Red. tła dla nis.pr.>
<Wyłącz> lub
<Włącz>
Zmn. plam na margin.
Jeśli na marginesie na dolnej krawędzi wydruków pojawią się smugi, problem może rozwiązać zmiana tego ustawienia.
Wyłącz
Tryb 1
Tryb 2
(
)
<Konserw. użytkownika>
<Zmn. plam na margin.>
Wybierz tryb
● W przypadku drukowania ciągłego z wybranym ustawieniem <Tryb 1> lub <Tryb 2> drukowanie większej
liczby stron niż określona liczba powoduje automatyczne czyszczenie, co skutkuje mniejszą prędkością
drukowania.
Kontrola kondensacji
Druk może być blady z powodu kondensacji wewnątrz jednostki głównej. W takim wypadku wybór dla omawianej opcji
ustawienia <Automatycznie> może rozwiązać ten problem.
418
Lista menu ustawień
Wyłącz
Automatycznie
(
)
<Konserw. użytkownika>
<Automatycznie>
419
<Kontrola kondensacji>
<Wyłącz> lub
Lista menu ustawień
Priorytet pozycji menu ustawień
6869-04X
Poniższe pozycje menu ustawień są uporządkowane pod względem ważności. W przypadku wybrania opcji <Włącz> dla
kilku pozycji, aktywna jest tylko najwyższa z nich. Priorytet obniża się wraz ze wzrostem wartości, a najwyższy jest
priorytet o numerze 1.
Priorytet
Ustawienia
1
Tryb spec. 2 utrwal.
Tryb spec. 2 utrwal.(P. 406)
2
Tryb sp. pap. powl.
Tryb sp. pap. powl.(P. 402)
3
Korekcja zwijania
4
Cien. pap. spec. H/H
5
Korekcja marszczenia
6
Tryb specjal. kopert
7
Zmień tryb zapobieg.
8
Kor. kol. zw. pap. 2
Korekcja zwijania(P. 401)
Cien. pap. spec. H/H(P. 403)
Korekcja marszczenia(P. 397)
Tryb specjal. kopert(P. 403)
Zmień tryb zapobieg.(P. 403)
Kor. kol. zw. pap. 2(P. 405)
420
Lista menu ustawień
Tryb wydruku
6869-04Y
Zawiera listę wszystkich ustawień związanych ze zmianą trybu drukowania wraz z
krótkim opisem. Ustawienia domyślne są oznaczone znakiem ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w przypadku niektórych używanych
opcji lub innych ustawień.
Autom. wybór trybu(P. 421)
Wybór automatyczny(P. 422)
Priorytet trybu(P. 422)
◼ Tryb trybu drukowania
Tryb automatycznego wyboru Urządzenie przechodzi w tryb automatycznego wyboru po wybraniu ustawienia <Wybór
automatyczny> dla opcji <Autom. wybór trybu>. Urządzenie automatycznie odrzuca dane
przesyłane z komputera i automatycznie wybiera tryb drukowania. Zazwyczaj tego trybu
drukowania używa się podczas drukowania z aplikacji.
<PCL>
Tryb drukowania pliku PCL przesłanego z komputera.
<PS>
Tryb drukowania pliku PS przesłanego z komputera.
<PDF>
Tryb drukowania pliku PDF za pomocą funkcji drukowania bezpośredniego lub drukowania
bezpośredniego z USB.
<XPS>
Tryb drukowania pliku XPS za pomocą funkcji drukowania bezpośredniego lub drukowania
bezpośredniego z USB.
Autom. wybór trybu
Pozwala określić tryb drukowania, w którym będzie pracować urządzenie.
Wybór automatyczny
PCL
PS
PDF
XPS
421
Lista menu ustawień
(
)
<Tryb wydruku>
<Autom. wybór trybu>
Wybierz
tryb drukowania
Wybór automatyczny
Włączanie lub wyłączanie funkcji automatycznego trybu wyboru dla trybów drukowania, gdy ustawiony jest
automatyczny wybór trybu.
Wyłącz
Włącz
(
)
drukowania
<Tryb wydruku>
<Wybór automatyczny>
Wybierz tryb
<Wyłącz> lub <Włącz>
● Jeśli dla wszystkich trybów wybrano ustawienie <Wyłącz>, wówczas urządzenie będzie pracowało w trybie
drukowania zdefiniowanym dla opcji <Priorytet trybu>.
Priorytet trybu
Pozwala określić tryb drukowania wybierany automatycznie, gdy urządzenie nie może zidentyfikować polecenia
sterującego przy automatycznym wyborze trybu.
Brak
PCL
PS
PDF
XPS
(
)
<Tryb wydruku>
<Priorytet trybu>
Wybierz preferowany tryb
drukowania
● W przypadku wybrania opcji <Brak> urządzenie automatycznie wyznaczy tryb drukowania, jeśli nie będzie
można zidentyfikować polecenia sterowania.
422
Lista menu ustawień
Ustawienia specyficzne dla trybu drukowania
6869-050
Za pomocą menu Konfiguracja można określić ustawienia specyficzne dla każdego
trybu drukowania. Ustawienia specyficzne dla trybu drukowania zostały opisane dla
każdego z trybów.
UFR II(P. 424)
PCL(P. 425)
Przetwarzanie obrazu(P. 431)
XPS(P. 442)
PDF(P. 453)
PS(P. 464)
423
Lista menu ustawień
UFR II
6869-051
Ta sekcja zawiera opis ustawień dostępnych podczas korzystania ze sterownika UFR
II z poleceniami sterującymi. Ustawienia domyślne są oznaczone znakiem ( ).
Oszczędzanie papieru
Pozwala wybrać, czy puste strony zawarte w dokumentach do wydrukowania mają być wyprowadzane.
Wyłącz
Włącz
(
)
<UFR II>
<Oszczędzanie papieru>
424
<Wyłącz> lub <Włącz>
Lista menu ustawień
PCL
6869-052
Wszystkie ustawienia z listy dotyczące poleceń sterowania PCL są opatrzone krótkim
opisem. Ustawienia domyślne oznaczone są przy pomocy znaku ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w zależności od innych elementów
ustawień lub tego, czy w urządzeniu zainstalowana jest opcjonalna pamięć ROM.
Oszczędzanie papieru(P. 425)
Orientacja(P. 425)
Numer czcionki(P. 426)
Rozmiar punktu(P. 426)
Gęstość pozioma(P. 426)
Linie formularzy(P. 427)
Kod znaków(P. 427)
Rozmiar niestand.(P. 428)
Jednostka miary(P. 428)
Wymiar X(P. 428)
Wymiar Y(P. 428)
Dołącz znak CR do LF(P. 429)
Zwięk. szer. wyd. A4(P. 429)
BarDIMM(P. 429)
FreeScape(P. 430)
Oszczędzanie papieru
Określa, czy urządzenie ma wyrzucać pustą stronę, która może powstać, gdy między dwoma kodami podawania
formularza wysyłanymi z aplikacji nie ma żadnych danych.
Wyłącz
Włącz
(
)
<PCL>
<Oszczędzanie papieru>
Orientacja
Pozwala ustawić orientację papieru.
Pionowa
Pozioma
425
<Wyłącz> lub <Włącz>
Lista menu ustawień
(
)
<PCL>
<Orientacja>
<Pionowa> lub <Pozioma>
Numer czcionki
Umożliwia ustawienie domyślnej czcionki urządzenia za pomocą odpowiednich numerów czcionek. Prawidłowe
numery czcionek mieszczą się w zakresie od 0 do 104.
0
do 104
(
)
<PCL>
<Numer czcionki>
Wprowadź numer portu za pomocą
klawiszy numerycznych
Rozmiar punktu *
Jeśli numer wybrany w opcji <Numer czcionki> ma proporcjonalnie rozstawioną skalowalną czcionkę, wówczas ta opcja
będzie widoczna w opcjach <PCL>. Umożliwia to określenie wielkości punktu dla czcionki domyślnej. Wielkość punktu
można regulować w krokach po 0,25 pkt.
Od 4,00 do 12,00
do 999,75 (punkt)
(
)
<PCL>
<Rozmiar punktu>
Wprowadź wartość ustawienia za
pomocą klawiszy numerycznych
Gęstość pozioma *
Jeśli numer wprowadzony w opcji <Numer czcionki> odpowiada skalowalnej czcionce o stałej szerokości, wówczas
opcja <Gęstość pozioma> zostanie wyświetlona w opcjach <PCL>. Dzięki temu można określić szerokość dla czcionki
domyślnej. Czcionkę można regulować w krokach po 0,01 cpi (znaków na cal).
Od 0,44 do 10,00
(
do 99,99 (cpi)
)
<PCL>
<Gęstość pozioma>
pomocą klawiszy numerycznych
426
Wprowadź wartość ustawienia za
Lista menu ustawień
Linie formularzy
Pozwala określić liczbę wierszy do wydrukowania na stronie. Można wybrać od 5 do 128 wierszy.
Od 5 do 64
do 128 (linie)
(
)
<PCL>
<Linie formularzy>
Wprowadź wartość ustawienia za
pomocą klawiszy numerycznych
Kod znaków
Umożliwia wybranie zestawu symboli najlepiej dostosowanego do potrzeb komputera hostującego.
PC8
ROMAN8
ROMAN9
ISOL1
ISOL2
ISOL5
ISOL6
ISOL9
PC775
PC8DN
PC850
PC852
PC858
PC8TK
PC1004
WINL1
WINL2
WINL5
WINBALT
DESKTOP
PSTEXT
LEGAL
ISO4
ISO6
ISO11
ISO15
ISO17
ISO21
ISO60
ISO69
WIN 30
MCTEXT
PC864
ARABIC8
WINARB
PC866
ISOCYR
WINCYR
PC851
GREEK8
ISOGRK
PC8GRK
WINGRK
PC862
HEBREW7
HEBREW8
ISOHEB
(
)
<PCL>
<Kod znaków>
427
Wybierz kodowanie znaków
Lista menu ustawień
Rozmiar niestand.
Pozwala zdefiniować niestandardowy rozmiar papieru. Po wybraniu opcji <Ustaw> można wprowadzić niestandardowy
rozmiar.
Nie ustawiaj
Ustaw
(
)
<PCL>
<Rozmiar niestand.>
<Ustaw> lub <Nie ustawiaj>
Jednostka miary *
Pozwala określić jednostkę miary używaną przy definiowaniu niestandardowego rozmiaru papieru.
Milimetry
Cale
(
)
<PCL>
<Jednostka miary>
<Milimetry> lub <Cale>
Wymiar X *
Umożliwia określenie wymiaru X papieru niestandardowego. Wymiar X można regulować w zakresie od 64,0 mm do
320,0 mm w krokach po 0,1 mm.
Od 64,0 do 304,8
(
do 320,0 (mm)
)
<PCL>
<Wymiar X>
Użyj przycisków
/
do wprowadzenia
wartości ustawienia
Wymiar Y *
Umożliwia określenie wymiaru Y papieru niestandardowego. Wymiar Y można regulować w zakresie od 120 mm do
1200 mm w krokach po 0,1 mm.
Od 120 do 457,2
do 1200 (mm)
428
Lista menu ustawień
(
)
<PCL>
<Wymiar Y>
Użyj przycisków
/
do wprowadzenia
wartości ustawienia
Dołącz znak CR do LF
Określa, czy po odebraniu polecenia nowego wiersza (LF), ma być wstawiany znak karetki (CR).
Tak
Nie
(
)
<PCL>
<Dołącz znak CR do LF>
<Tak> lub <Nie>
Zwięk. szer. wyd. A4
Określa, czy szerokość obszaru drukowania papieru A4 ma być zwiększona do szerokości rozmiaru Letter.
Wyłącz
Włącz
(
)
<PCL>
<Zwięk. szer. wyd. A4>
BarDIMM *
Pozwala włączyć lub wyłączyć funkcję drukowania kodów kreskowych urządzenia.
Odblokuj
Wyłącz
429
<Wyłącz> lub <Włącz>
Lista menu ustawień
(
)
<PCL>
<BarDIMM>
<Odblokuj> lub <Wyłącz>
FreeScape *
Pozwala określić kod AEC (Alternate Escape Code, alternatywny kod specjalny), który ma zostać użyty do przesyłania
poleceń kodów kreskowych, jeśli komputer hosta nie obsługuje standardowego kodu specjalnego.
Wyłącz
~
"
#
$
/
\
?
{
}
|
(
)
<PCL>
<FreeScape>
430
Wybierz kod Escape
Lista menu ustawień
Przetwarzanie obrazu
6869-053
Zawiera listę wszystkich ustawień związanych z plikami obrazów (JPEG i TIFF)
dostępnych dla funkcji Drukowanie bezpośrednio z USB, Drukowanie bezpośrednie i
Drukowanie e-maili, wraz z krótkimi opisami. Ustawienia domyślne są oznaczone
znakiem ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w przypadku niektórych używanych
opcji lub innych ustawień.
Orientacja obrazu(P. 431)
Powiększenie(P. 432)
Pozycja wydruku(P. 432)
TIFF Spooler(P. 433)
Pokaż ostrzeżenia(P. 434)
Wydr. treść e-maila(P. 434)
Ogran. druk. e-maili(P. 435)
Zwiększ obszar wydr.(P. 435)
Profil źródła RGB(P. 435)
Profil symul. CMYK(P. 436)
Profil wyjściowy(P. 437)
Metoda dopasowania(P. 437)
Półtony(P. 438)
Kor. foto (tylko CL)(P. 439)
Konwers. skali szar.(P. 440)
Orientacja obrazu
Pozwala określić orientację wydruku obrazu.
Automatycznie
Pionowo
Poziomo
(
)
<Przetwarzanie obrazu>
<Orientacja obrazu>
Wybierz
orientację
<Automatycznie>
Automatycznie wyznacza orientację drukowania na podstawie szerokości i wysokości obrazu.
431
Lista menu ustawień
<Pionowo>
Tę opcję należy wybrać podczas drukowania obrazów, których dłuższa krawędź występuje w pionie.
<Poziomo>
Tę opcję należy wybrać podczas drukowania obrazów, których dłuższa krawędź występuje w poziomie.
● Jeśli określone ostawienie (<Pionowo> lub <Poziomo>) jest niezgodne z orientacją obrazu, obraz zostanie
wydrukowany w zmniejszonym rozmiarze.
Powiększenie
Włącza lub wyłącza powiększanie/zmniejszanie obrazów. Wydruki są powiększane lub zmniejszane z zachowaniem
współczynnika proporcji obrazu.
Wyłącz
Automatycznie
(
)
<Przetwarzanie obrazu>
<Powiększenie>
<Wyłącz> lub
<Automatycznie>
<Wyłącz>
Jeśli Obszar wydruku(P. 575) obejmuje obraz, wówczas obraz jest drukowany w oryginalnym rozmiarze.
Jeśli wielkość obrazu przekracza rozmiar obszaru drukowania druki są zmniejszane.
<Automatycznie>
Pozwala wykonywać powiększone lub pomniejszone wydruki zgodnie z ustawieniem obszaru drukowania
papieru.
Pozycja wydruku
Pozwala określić miejsce, w którym zostanie umieszczony drukowany obraz.
Automatycznie
Środek
Na górze na lewo
432
Lista menu ustawień
(
)
<Przetwarzanie obrazu>
<Pozycja wydruku>
Wybierz opcję
<Automatycznie> lub położenie
<Automatycznie>
Jeśli dane TIFF zawierają informacje określające położenie wydruku, wówczas obraz zostanie wydrukowany
zgodnie z tymi informacjami. W innym przypadku zostanie on wydrukowany na środku papieru. Dane JPEG
zawsze są drukowane na środku papieru.
<Środek>
Obrazy są drukowane na środku papieru.
<Na górze na lewo>
Obrazy są drukowane z wyrównaniem do lewego, górnego rogu.
TIFF Spooler
Pozwala wybrać, czy dane TIFF mają być zapisywane na karcie SD przed ich przetworzeniem w celu wydrukowania. Jeśli
podczas drukowania występuje błąd, należy wybrać dla tego ustawienia opcję <Włącz>.
Wyłącz
Włącz
(
)
<Przetwarzanie obrazu>
komunikat
<Wyłącz> lub <Włącz>
<TIFF Spooler>
Sprawdź
Wykonaj reset sprzętowy (
Reset
sprzętowy(P. 488) )
<Wyłącz>
Dane TIFF są przetwarzane w trybie ciągłym natychmiast po odebraniu.
<Włącz>
Wszystkie odebrane dane TIFF są przetwarzane jednocześnie, co redukuje częstość występowania błędów.
433
Lista menu ustawień
● Jeśli karta SD nie została zainstalowana, nie można drukować plików o rozmiarze przekraczającym 40 MB.
Pokaż ostrzeżenia
Można określić sposób zachowania się maszyny w przypadku wystąpienia błędu.
Wyłącz
Drukuj
Panel
(
)
<Przetwarzanie obrazu>
<Pokaż ostrzeżenia>
Wybierz sposób
zachowania się urządzenia
<Wyłącz>
Żaden obraz nie zostanie wydrukowany i żaden błąd nie będzie wyświetlany.
<Drukuj>
Informacja o błędzie zostanie wydrukowana, a żaden obraz nie.
<Panel>
Żaden obraz nie zostanie wydrukowany, a komunikat o błędzie zostanie wyświetlony na panelu roboczym.
Wydr. treść e-maila
Pozwala wybrać, czy wiadomości e-mail mają być drukowane podczas realizacji funkcji Drukowanie e-maili. W
przypadku wybrania opcji <Wyłącz> drukowany będzie jedynie obraz załączony do wiadomości e-mail.
Wyłącz
Włącz
(
)
<Przetwarzanie obrazu>
<Włącz>
434
<Wydr. treść e-maila>
<Wyłącz> lub
Lista menu ustawień
Ogran. druk. e-maili *
Pozwala ustawić ograniczenie liczby stron wiadomości e-mail do wydrukowania, gdy ustawienie opcji <Wydr. treść emaila> to <Włącz>. W przypadku wybrania opcji <Włącz> liczba stron wiadomości e-mail do wydrukowania zostanie
ograniczona do 5.
Wyłącz
Włącz
(
)
<Przetwarzanie obrazu>
<Ogran. druk. e-maili>
<Wyłącz> lub
<Włącz>
Zwiększ obszar wydr.
Pozwala określić, czy podczas drukowania
papieru.
Obszar wydruku(P. 575) ma zostać rozciągnięty do pełnego rozmiaru
Wyłącz
Włącz
(
)
<Przetwarzanie obrazu>
<Zwiększ obszar wydr.>
<Wyłącz> lub
<Włącz>
● Wybranie ustawienia <Włącz> może w zależności od oryginału sprawić, że niektóre części obrazu w pobliżu
krawędzi papieru mogą zostać utracone papier może zostać częściowo zabrudzony.
Profil źródła RGB
Wybór odpowiedniego profilu danych RGB zgodnego z używanym monitorem.
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
435
Lista menu ustawień
(
)
<Przetwarzanie obrazu>
<Profil źródła RGB>
Wybierz profil
<sRGB v3.0 (Canon)>
Używany jest profil RGB podobny do średniego profilu większości monitorów stosowanych z komputerami z
systemem Windows. Podczas korzystania z monitora obsługującego standard sRGB można drukować kolory
zbliżone do kolorów wyświetlanych na monitorze.
Tryby z zakresu od <Canon HDTV gamma 1.5> do <Canon HDTV gamma 2.4>
W tym miejscu można wprowadzić ustawienia konieczne do wyregulowania jasności po dokonaniu
porównania kolorów wydruku z kolorami wyświetlanymi na monitorze. Im wyższa wartość, tym ciemniejsze
kolory wydruków.
Profil symul. CMYK
Podczas drukowania danych CMYK można wybrać docelowy rodzaj symulacji. Urządzenie konwertuje dane CMYK do
modelu kolorów CMYK zależnego od urządzenia w oparciu o wybrany docelowy rodzaj symulacji.
Euro Standard v1.00
JapanColor(Canon)
U.S. Web Coated v1.0
(
)
<Przetwarzanie obrazu>
<Profil symul. CMYK>
Wybierz profil
<Euro Standard v1.00>
Pozwala użyć profilu Euro Standard. Podczas drukowania stosowane są kolory zbliżone do europejskich norm
drukowania.
<JapanColor(Canon)>
Pozwala użyć profilu JapanColor. Podczas drukowania stosowane są kolory zbliżone do japońskich norm
drukowania.
436
Lista menu ustawień
<U.S. Web Coated v1.0>
Pozwala użyć profilu U.S. Web Coated. Podczas drukowania stosowane są kolory zbliżone do amerykańskich
norm drukowania.
Profil wyjściowy
Wybór odpowiedniego profilu danych do wydrukowania.
Normal
Photo
(
)
<Przetwarzanie obrazu>
<Profil wyjściowy>
Wybierz profil
<Normal>
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach zbliżonych do kolorów
wyświetlanych na monitorze.
<Photo>
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał fotografię.
Metoda dopasowania
Za pomocą opcji <Profil źródła RGB> można określić, który element będzie miał pierwszeństwo na innymi podczas
dopasowywania kolorów.
Percepcyjnie
Saturacja
Kolorometryczny
(
)
<Przetwarzanie obrazu>
dopasowania
437
<Metoda dopasowania>
Wybierz metodę
Lista menu ustawień
<Percepcyjnie>
Dopasowanie wykonywane jest z priorytetem percepcyjnej.
<Saturacja>
Dopasowanie wykonywane jest z priorytetem nasycenia.
<Kolorometryczny>
Dopasowywanie jest wykonywane w taki sposób, że wartości barw RGB są odtwarzane możliwie jak
najdokładniej.
Półtony
Istnieje możliwość wybrania metody drukowania z odzwierciedlaniem półtonów (zakres pośredni między jaśniejszymi i
ciemniejszymi obszarami obrazu).
Rozdzielczość
Gradacja
Błąd dyfuzji
(
)
<Przetwarzanie obrazu>
<Półtony>
Wybierz metodę
odzwierciedlania półtonów
<Rozdzielczość>
Umożliwia precyzyjne drukowanie poprzez ostre odzwierciedlanie krawędzi znaków. Ten tryb drukowania jest
odpowiedni do drukowania danych składających się ze znaków i cienkich linii z wyraźnym wykończeniem.
<Gradacja>
Umożliwia drukowanie gradacji i linii z płynnym wykończeniem. Ten typ drukowania jest odpowiedni do
drukowania rysunków lub tabel zawierających gradacje.
<Błąd dyfuzji>
Tryb ten pozwala drukować dane z tekstem i cienkimi liniami oraz zakrzywionymi liniami danych CAD itp.
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku korzystania z <Błąd dyfuzji>.
438
Lista menu ustawień
Kor. foto (tylko CL) *
Wprowadzanie ustawień funkcji korekcji zdjęć lub innych podobnych danych obrazu. Ten element jest wyświetlany w
przypadku zainstalowania kardy SD.
Photo Optimizer PRO
Wybór przeprowadzania automatycznej korekcji kontrastu, zestawienia kolorów, nasycenia i gradacji obrazu.
Wyłącz
Włącz
(
)
<Przetwarzanie obrazu>
PRO>
<Kor. foto (tylko CL)>
<Photo Optimizer
<Wyłącz> lub <Włącz>
Korekcja czerw. oczu
„Czerwone oczy” to zjawisko polegające na uzyskiwaniu nienaturalnie czerwonego koloru oczu ludzkich na
zdjęciach wykonanych przy użyciu lampy błyskowej lub stroboskopu. Ta opcja określa, czy czerwone oczy mają
być automatycznie wykrywane na obrazie i korygowane, tak aby były wyświetlane w naturalnym kolorze. Można
wybrać jeden z trzech poziomów nasilenia korekcji.
Korekcja czerw. oczu
Określenie, czy korekcja czerwonych oczu będzie wykonywana.
Wyłącz
Włącz
(
)
oczu>
<Przetwarzanie obrazu>
<Korekcja czerw. oczu>
<Kor. foto (tylko CL)>
<Korekcja czerw.
<Wyłącz> lub <Włącz>
Poz. kor. czer. oczu *
Określenie poziomu nasilenia korekcji, gdy ustawienie opcji <Korekcja czerw. oczu> to <Włącz>.
Słaby
Standardowy
Silny
(
oczu>
)
<Przetwarzanie obrazu>
<Poz. kor. czer. oczu>
<Kor. foto (tylko CL)>
Wybierz poziom
439
<Korekcja czerw.
Lista menu ustawień
Rozjaśniacz twarzy
W przypadku zdjęć twarzy ludzkich, które są nienaturalnie ciemne z powodu światła padającego z tyłu lub
niedoświetlenia można ustawić, czy obraz będzie drukowany z zastosowaniem korekcji całej jasności, tak aby
twarze osób na zdjęciu nabrały naturalnej jasności. Można wybrać jeden z trzeci poziomów nasilenia korekcji.
Rozjaśniacz twarzy
Wybór przeprowadzania korekcji w celu rozjaśnienia twarzy osób na zdjęciach.
Wyłącz
Włącz
(
)
<Przetwarzanie obrazu>
<Rozjaśniacz twarzy>
twarzy>
<Kor. foto (tylko CL)>
<Rozjaśniacz
<Wyłącz> lub <Włącz>
Poz. rozjaś. twarzy *
Określenie poziomu nasilenia korekcji, gdy ustawienie opcji <Rozjaśniacz twarzy> to <Włącz>.
Słaby
Standardowy
Silny
(
)
<Przetwarzanie obrazu>
twarzy>
<Poz. rozjaś. twarzy>
<Kor. foto (tylko CL)>
<Rozjaśniacz
Wybierz poziom
Konwers. skali szar. *
Pozwala wybrać metodę konwersji danych drukowania w kolorze na dane czarno-białe.
sRGB
NTSC
Uniform RGB
(
)
<Przetwarzanie obrazu>
konwersji
440
<Konwers. skali szar.>
Wybierz metodę
Lista menu ustawień
<sRGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać płynną gradację z
uwzględnieniem kolorów.
<NTSC>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać efekt odpowiadający obrazom
telewizyjnym (NTSC).
<Uniform RGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby wszystkie poziomy RGB zostały
wyrównane wyłącznie na bazie jasności.
● Ta pozycja jest dostępna, gdy ustawieniem opcji <Tryb koloru> (
wydruku> jest <Czarny>.
441
Tryb koloru(P. 374) ) w polu <Jakość
Lista menu ustawień
XPS
6869-054
Zawiera listę wszystkich ustawień dotyczących plików XPS dostępnych dla funkcji
Drukowanie bezpośrednio z USB i Drukowanie bezpośrednie wraz z krótkimi
opisami. Ustawienia domyślne są oznaczone znakiem ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w zależności od innych elementów
ustawień.
Tryb dopasowywania(P. 442)
Ustaw. profilu ICC(P. 443)
Ustawienia gamma(P. 446)
Kor. foto (tylko CL)(P. 447)
Półtony(P. 448)
Kompensacja szarości(P. 449)
Zaawans. wygładzanie(P. 450)
Konwers. skali szar.(P. 451)
Tryb dopasowywania
Wybór trybu przetwarzania do drukowania w kolorze.
Profil ICC
Gamma
(
)
<XPS>
<Tryb dopasowywania>
<Profil ICC> lub <Gamma>
<Profil ICC>
Użyj profilu, aby dopasować kolor.
<Gamma>
Wykonaj korekcję koloru poprzez ustawienie wartości gamma przy regulacji jasności.
442
Lista menu ustawień
Ustaw. profilu ICC
Ustawienie profilu używanego podczas dopasowywania kolorów i określenie elementu, który będzie miał
pierwszeństwo nad innymi. Tę pozycję można ustawić dla każdego typu obrazu zawartego w jednym dokumencie.
Profil źródła RGB
Wybór odpowiedniego profilu danych RGB zgodnego z używanym monitorem.
Tekst
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
Grafiki
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
Obraz
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
(
)
<XPS>
typ danych obrazu
<Ustaw. profilu ICC>
<Profil źródła RGB>
Wybierz
Wybierz profil
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<sRGB v3.0 (Canon)>
Używany jest profil RGB podobny do średniego profilu większości monitorów stosowanych z komputerami z
systemem Windows. Podczas korzystania z monitora obsługującego standard sRGB można drukować kolory
zbliżone do kolorów wyświetlanych na monitorze.
443
Lista menu ustawień
Tryby z zakresu od <Canon HDTV gamma 1.5> do <Canon HDTV gamma 2.4>
W tym miejscu można wprowadzić ustawienia konieczne do wyregulowania jasności po dokonaniu
porównania kolorów wydruku z kolorami wyświetlanymi na monitorze. Im wyższa wartość, tym ciemniejsze
kolory wydruków.
● Ta pozycja jest dostępna, gdy ustawieniem opcji <Tryb dopasowywania> jest <Profil ICC>.
Profil wyjściowy
Wybór odpowiedniego profilu danych do wydrukowania.
Tekst
Normal
Photo
Grafiki
Normal
Photo
Obraz
Normal
Photo
(
)
<XPS>
danych obrazu
<Ustaw. profilu ICC>
<Profil wyjściowy>
Wybierz typ
<Normal> lub <Photo>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Normal>
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach zbliżonych do kolorów
wyświetlanych na monitorze.
<Photo>
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał fotografię.
444
Lista menu ustawień
● Ta pozycja jest dostępna, gdy ustawieniem opcji <Tryb dopasowywania> jest <Profil ICC>.
Metoda dopasowania
Za pomocą opcji <Profil źródła RGB> można zdefiniować element mający pierwszeństwo nad innymi podczas
dopasowywania kolorów. Tę pozycję można ustawić dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
Percepcyjnie
Saturacja
Kolorometryczny
Grafiki
Percepcyjnie
Saturacja
Kolorometryczny
Obraz
Percepcyjnie
Saturacja
Kolorometryczny
(
)
<XPS>
dopasowania>
<Ustaw. profilu ICC>
Wybierz typ danych obrazu
<Metoda
Wybierz metodę dopasowania
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Percepcyjnie>
Dopasowanie wykonywane jest z priorytetem percepcyjnej.
<Saturacja>
Dopasowanie wykonywane jest z priorytetem nasycenia.
<Kolorometryczny>
Dopasowywanie jest wykonywane w taki sposób, że wartości barw RGB są odtwarzane możliwie jak
najdokładniej.
445
Lista menu ustawień
Ustawienia gamma
Wybór wykonywania korekcji koloru poprzez ustawienie wartości gamma przy regulacji jasności.
Korekcja Gamma
Można dostosować jasność, tak aby w wydruk nie wpłynął na najjaśniejsze i najciemniejsze części. Tę pozycję
można ustawić dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
1.0
1.4
1.8
2.2
Grafiki
1.0
1.4
1.8
2.2
Obraz
1.0
1.4
1.8
2.2
(
)
<XPS>
typ danych obrazu
<Ustawienia gamma>
<Korekcja Gamma>
Wybierz
Wybierz wartość ustawienia
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
Tryby z zakresu od <1.0> do <2.2>
Ten element należy ustawić, jeżeli ma być dostosowywana jasność wydruków. <1.4> to ustawienie
standardowe (bez korekcji), a im wyższa wartość ustawienia, tym ciemniejszy będzie wydruk.
446
Lista menu ustawień
● Ta pozycja jest dostępna, gdy ustawieniem opcji <Tryb dopasowywania> jest <Gamma>.
Kor. foto (tylko CL)
Wprowadzanie ustawień funkcji korekcji zdjęć lub innych podobnych danych obrazu.
Photo Optimizer PRO
Wybór przeprowadzania automatycznej korekcji kontrastu, zestawienia kolorów, nasycenia i gradacji obrazu.
Wyłącz
Włącz
(
)
<XPS>
<Kor. foto (tylko CL)>
<Photo Optimizer
<Wyłącz> lub <Włącz>
PRO>
Korekcja czerw. oczu
„Czerwone oczy” to zjawisko polegające na uzyskiwaniu nienaturalnie czerwonego koloru oczu ludzkich na
zdjęciach wykonanych przy użyciu lampy błyskowej lub stroboskopu. Ta opcja określa, czy czerwone oczy mają
być automatycznie wykrywane na obrazie i korygowane, tak aby były wyświetlane w naturalnym kolorze. Można
wybrać jeden z trzech poziomów nasilenia korekcji.
Korekcja czerw. oczu
Określenie, czy korekcja czerwonych oczu będzie wykonywana.
Wyłącz
Włącz
(
)
<XPS>
oczu>
<Kor. foto (tylko CL)>
<Korekcja czerw. oczu>
<Korekcja czerw.
<Wyłącz> lub <Włącz>
Poz. kor. czer. oczu *
Określenie poziomu nasilenia korekcji, gdy ustawienie opcji <Korekcja czerw. oczu> to <Włącz>.
Słaby
Standardowy
Silny
(
)
<XPS>
kor. czer. oczu>
<Kor. foto (tylko CL)>
Wybierz poziom
447
<Korekcja czerw. oczu>
<Poz.
Lista menu ustawień
Rozjaśniacz twarzy
W przypadku zdjęć twarzy ludzkich, które są nienaturalnie ciemne z powodu światła padającego z tyłu lub
niedoświetlenia można ustawić, czy obraz będzie drukowany z zastosowaniem korekcji całej jasności, tak aby
twarze osób na zdjęciu nabrały naturalnej jasności. Można wybrać jeden z trzeci poziomów nasilenia korekcji.
Rozjaśniacz twarzy
Wybór przeprowadzania korekcji w celu rozjaśnienia twarzy osób na zdjęciach.
Wyłącz
Włącz
(
)
<XPS>
<Kor. foto (tylko CL)>
<Rozjaśniacz twarzy>
twarzy>
<Rozjaśniacz
<Wyłącz> lub <Włącz>
Poz. rozjaś. twarzy *
Określenie poziomu nasilenia korekcji, gdy ustawienie opcji <Rozjaśniacz twarzy> to <Włącz>.
Słaby
Standardowy
Silny
(
)
<XPS>
rozjaś. twarzy>
<Kor. foto (tylko CL)>
<Rozjaśniacz twarzy>
<Poz.
Wybierz poziom
Półtony
Istnieje możliwość wybrania metody drukowania z odzwierciedlaniem półtonów (zakres pośredni między jaśniejszymi i
ciemniejszymi obszarami obrazu).
Błąd dyfuzji
Tryb ten pozwala drukować dane z tekstem i cienkimi liniami oraz zakrzywionymi liniami danych CAD itp.
Wyłącz
Włącz
(
)
<XPS>
<Półtony>
<Włącz>
448
<Błąd dyfuzji>
<Wyłącz> lub
Lista menu ustawień
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku korzystania z <Błąd dyfuzji>.
Rozdzielcz./gradacja *
Jeśli ustawienie opcji <Błąd dyfuzji> to <Wyłącz>, wybierz metodę odtwarzania półtonów. Tę pozycję można
ustawiać dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
Rozdzielczość
Gradacja
Grafiki
Rozdzielczość
Gradacja
Obraz
Rozdzielczość
Gradacja
(
)
<XPS>
danych obrazu
<Półtony>
<Rozdzielcz./gradacja>
Wybierz typ
<Rozdzielczość> lub <Gradacja>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Rozdzielczość>
Umożliwia precyzyjne drukowanie poprzez ostre odzwierciedlanie krawędzi znaków. Ten tryb drukowania jest
odpowiedni do drukowania danych składających się ze znaków i cienkich linii z wyraźnym wykończeniem.
<Gradacja>
Umożliwia drukowanie gradacji i linii z płynnym wykończeniem. Ten typ drukowania jest odpowiedni do
drukowania rysunków lub tabel zawierających gradacje.
Kompensacja szarości
W przypadku danych w czerni lub szarości zawierających informację o kolorze z definicją R=G=B można wybrać
drukowanie przy użyciu wyłącznie czarnego tonera (K). Można ustawić tę pozycję dla każdego typu obrazów zawartego
w jednym dokumencie.
449
Lista menu ustawień
Tekst
Wyłącz
Włącz
Grafiki
Wyłącz
Włącz
Obraz
Wyłącz
Włącz
(
)
<XPS>
<Kompensacja szarości>
Wybierz typ danych obrazu
<Wyłącz> lub <Włącz>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Wyłącz>
Drukowanie przy użyciu 4-kolorowego tonera CMYK. Odtwarzalność gradacji ciemnych kolorów jest lepsza niż
w przypadku opcji <Włącz>.
<Włącz>
Drukowanie przy użyciu wyłącznie czarnego tonera (K). Pozwala uniknąć niedopasowania kolorów, które
może wystąpić w przypadku kolorowego tonera (CMY).
Zaawans. wygładzanie
Wprowadzanie ustawień trybu wygładzania, który umożliwia płynne drukowanie krawędzi linii, rysunków i tekstu.
Zaawans. wygładzanie
Włączanie lub wyłączanie trybu wygładzania. Krawędzie będą bardziej wygładzone w przypadku opcji
<Wygładzanie 2> niż opcji <Wygładzanie 1>.
Wyłącz
Wygładzanie 1
Wygładzanie 2
450
Lista menu ustawień
(
)
<XPS>
wygładzanie>
<Zaawans. wygładzanie>
<Zaawans.
Wybierz metodę przetwarzania
Grafiki *
Wybór zastosowania trybu wygładzania do linii i rysunków, gdy ustawienie opcji <Zaawans. wygładzanie> to
<Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
(
)
<XPS>
<Zaawans. wygładzanie>
<Grafiki>
<Wyłącz> lub
<Włącz>
Tekst *
Określenie, czy tryb wygładzania ma być zastosowany do tekstu, gdy ustawienie opcji <Zaawans. wygładzanie>
to <Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
(
)
<XPS>
<Zaawans. wygładzanie>
<Tekst>
<Włącz>
Konwers. skali szar.
Pozwala wybrać metodę konwersji danych drukowania w kolorze na dane czarno-białe.
Tekst
sRGB
NTSC
Uniform RGB
Grafiki
sRGB
NTSC
Uniform RGB
Obraz
sRGB
NTSC
Uniform RGB
451
<Wyłącz> lub
Lista menu ustawień
(
)
<XPS>
obrazów
<Konwers. skali szar.>
Wybierz typ danych
Wybierz metodę konwersji
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<sRGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać płynną gradację z
uwzględnieniem kolorów.
<NTSC>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać efekt odpowiadający obrazom
telewizyjnym (NTSC).
<Uniform RGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby wszystkie poziomy RGB zostały
wyrównane wyłącznie na bazie jasności.
● Ta pozycja jest dostępna, gdy ustawieniem opcji <Tryb koloru> (
wydruku> jest <Czarny>.
452
Tryb koloru(P. 374) ) w polu <Jakość
Lista menu ustawień
PDF
6869-055
Wszystkie ustawienia plików PDF dostępnych do drukowania bezpośredniego z USB
oraz drukowania bezpośredniego zostały zamieszczone na liście i są opatrzone
krótkim opisem. Ustawienia domyślne oznaczone są przy pomocy znaku ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w zależności od innych elementów
ustawień.
Dopas. do rozm. pap.(P. 453)
Zwiększ obszar wydr.(P. 453)
N na 1(P. 454)
Wydruk komentarza(P. 454)
Ustaw. profilu ICC(P. 454)
Tekst w czyst. czer.(P. 459)
Czarny nadruk(P. 459)
Jasność(P. 460)
Półtony(P. 460)
Nadruk kompozytowy(P. 461)
Zaawans. wygładzanie(P. 462)
Konwers. skali szar.(P. 463)
Dopas. do rozm. pap.
Pozwala określić, czy wydruki mają być pomniejszane lub powiększane zgodnie z ustawieniem parametru
Obszar
wydruku(P. 575) papieru. Wydruki będą zmniejszane lub powiększane z zachowaniem współczynnika proporcji.
Wyłącz
Włącz
(
)
<PDF>
<Dopas. do rozm. pap.>
<Wyłącz> lub <Włącz>
Zwiększ obszar wydr.
Pozwala określić, czy podczas drukowania
papieru.
Obszar wydruku(P. 575) ma zostać rozciągnięty do pełnego rozmiaru
Wyłącz
Włącz
(
)
<PDF>
<Zwiększ obszar wydr.>
453
<Wyłącz> lub <Włącz>
Lista menu ustawień
● Wybranie ustawienia <Włącz> może w zależności od oryginału sprawić, że niektóre części obrazu w pobliżu
krawędzi papieru mogą zostać utracone papier może zostać częściowo zabrudzony.
N na 1
Wybierz, czy na jednym arkuszu ma być drukowane wiele stron w zmniejszonym rozmiarze, przypisując je kolejno,
począwszy od lewego górnego rogu. Aby na przykład wydrukować cztery strony na jednym arkuszu, wybierz opcję <4
na 1>. .
Wyłącz
2 na 1
4 na 1
6 na 1
8 na 1
9 na 1
16 na 1
(
)
<PDF>
<N na 1>
Wybierz metodę agregacji
Wydruk komentarza
Wybór możliwości drukowania komentarzy. Po wybraniu opcji <Automatycznie> komentarze w pliku PDF będą
drukowane.
Wyłącz
Automatycznie
(
)
<PDF>
<Wydruk komentarza>
<Wyłącz> lub <Automatycznie>
Ustaw. profilu ICC
Ustawienie profilu używanego podczas dopasowywania kolorów i określenie elementu, który będzie miał
pierwszeństwo nad innymi.
Profil źródła RGB
Wybór odpowiedniego profilu danych RGB zgodnego z używanym monitorem.
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
454
Lista menu ustawień
Canon HDTV gamma 2.4
Brak
(
)
<PDF>
<Ustaw. profilu ICC>
<Profil źródła RGB>
Wybierz
profil
<sRGB v3.0 (Canon)>
Używany jest profil RGB podobny do średniego profilu większości monitorów stosowanych z komputerami z
systemem Windows. Podczas korzystania z monitora obsługującego standard sRGB można drukować kolory
zbliżone do kolorów wyświetlanych na monitorze.
Tryby z zakresu od <Canon HDTV gamma 1.5> do <Canon HDTV gamma 2.4>
W tym miejscu można wprowadzić ustawienia konieczne do wyregulowania jasności po dokonaniu
porównania kolorów wydruku z kolorami wyświetlanymi na monitorze. Im wyższa wartość, tym ciemniejsze
kolory wydruków.
<Brak>
Oddzielenie koloru od danych RGB do CMYK bez stosowania profilu źródłowego RGB.
Profil symul. CMYK
Podczas drukowania danych CMYK można wybrać docelowy rodzaj symulacji. Urządzenie konwertuje dane
CMYK do modelu kolorów CMYK zależnego od urządzenia w oparciu o wybrany docelowy rodzaj symulacji.
Euro Standard v1.00
JapanColor(Canon)
U.S. Web Coated v1.0
Brak
(
)
<PDF>
<Ustaw. profilu ICC>
profil
455
<Profil symul. CMYK>
Wybierz
Lista menu ustawień
<Euro Standard v1.00>
Pozwala użyć profilu Euro Standard. Podczas drukowania stosowane są kolory zbliżone do europejskich norm
drukowania.
<JapanColor(Canon)>
Pozwala użyć profilu JapanColor. Podczas drukowania stosowane są kolory zbliżone do japońskich norm
drukowania.
<U.S. Web Coated v1.0>
Pozwala użyć profilu U.S. Web Coated. Podczas drukowania stosowane są kolory zbliżone do amerykańskich
norm drukowania.
<Brak>
Pozwala drukować dane CMYK z zastosowaniem modelu kolorów CMYK zależnego od urządzenia bez
stosowania jakiegokolwiek profilu symulacji CMYK.
● Po wybraniu dla tej opcji ustawienia <Brak> w zależności od danych gradacja ciemnych kolorów może
być obsługiwana nieprawidłowo.
Profil skali szar.
Wybór konwersji danych w skali szarości na dane CMYK przy użyciu profilu skali szarości urządzenia.
Wyłącz
Włącz
(
)
<PDF>
<Ustaw. profilu ICC>
<Profil skali szar.>
<Wyłącz>
lub <Włącz>
<Wyłącz>
Drukowanie przy użyciu wyłącznie tonera K (czarnego) bez konwersji danych na dane CMYK.
<Włącz>
Konwersja danych na dane CMYK z zastosowaniem profilu skali szarości urządzenia. Jednak w zależności od
ustawienia opcji <Profil wyjściowy> lub <Tekst w czyst. czer.> drukowanie może się odbywać wyłącznie przy
użyciu tonera K (czarnego).
456
Lista menu ustawień
Profil wyjściowy
Wybór odpowiedniego profilu danych do wydrukowania. Tę pozycję można ustawić dla każdego typu obrazu
zawartego w jednym dokumencie.
Tekst
PS Normal
PS Photo
PS TR Normal
PS TR Photo
Grafiki
PS Normal
PS Photo
PS TR Normal
PS TR Photo
Obraz
PS Normal
PS Photo
PS TR Normal
PS TR Photo
(
)
<PDF>
typ danych obrazu
<Ustaw. profilu ICC>
<Profil wyjściowy>
Wybierz
Wybierz profil
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<PS Normal>
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach zbliżonych do kolorów
wyświetlanych na monitorze.
<PS Photo>
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał fotografię.
<PS TR Normal>
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach zbliżonych do kolorów
wyświetlanych na monitorze, a ilość tonera zużywana na tekst i precyzyjne linie była dobrze kontrolowana.
457
Lista menu ustawień
<PS TR Photo>
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał fotografię, a ilość tonera
zużywana na tekst i precyzyjne linie była dobrze kontrolowana.
Ta pozycja nie będzie aktywna po wybraniu jednego z poniższych ustawień.
● <Profil źródła RGB> — ustawienie <Brak>.
● <Profil symul. CMYK> — ustawienie <Brak>.
● <Profil skali szar.> — ustawienie <Wyłącz>.
Metoda dopasowania
Za pomocą opcji <Profil źródła RGB> można określić, który element będzie miał pierwszeństwo na innymi
podczas dopasowywania kolorów.
Percepcyjnie
Saturacja
Kolorometryczny
(
)
<PDF>
dopasowania>
<Ustaw. profilu ICC>
<Metoda
Wybierz metodę dopasowania
<Percepcyjnie>
Dopasowanie wykonywane jest z priorytetem percepcyjnej.
<Saturacja>
Dopasowanie wykonywane jest z priorytetem nasycenia.
<Kolorometryczny>
Dopasowanie wykonywane jest w taki sposób, aby zminimalizować różnicę kolorów między oryginałami a
wydrukami.
● Ta pozycja jest nieaktywna, gdy ustawienie opcji <Profil źródła RGB> to <Brak>.
458
Lista menu ustawień
Tekst w czyst. czer.
W przypadku czarnego tekstu, dla którego definicja danych koloru to „R=G=B=0%”, „C=M=Y=100%” lub „C=M=Y=0%/
K=100%”, należy wybrać, czy wydruk ma być wykonywany tylko za pomocą tonera K (czarnego) czy też zgodnie z
ustawieniem opcji <Profil wyjściowy>.
Wyłącz
Włącz
(
)
<PDF>
<Tekst w czyst. czer.>
<Wyłącz> lub <Włącz>
<Wyłącz>
Drukowanie zgodnie z ustawieniem <Profil wyjściowy>. W zależności od danych drukowania wynik
drukowania może być lepszy niż w przypadku opcji <Włącz>.
<Włącz>
Drukowanie czarnego tekstu wyłącznie za pomocą tonera K (czarnego). W przeciwieństwie do drukowania
przy użyciu kolorowego tonera (CMY) rozmycia tonera wokół krawędzi nie będą występować. Zaleca się
używanie tego ustawienia w normalnym trybie pracy.
Czarny nadruk *
Ustawienie sposobu drukowania, gdy czarny tekst znajduje się na kolorowym tle lub kolorowym rysunku. Pa pozycja
nie będzie wyświetlana, gdy ustawienie opcji <Tekst w czyst. czer.> to <Wyłącz>.
Wyłącz
Włącz
(
)
<PDF>
<Czarny nadruk>
459
<Wyłącz> lub <Włącz>
Lista menu ustawień
<Wyłącz>
Najpierw zostaną wydrukowane dane po uprzednim wycięciu czarnego tekstu z kolorowego tła lub rysunku, a
następnie czarny tekst zostanie nadrukowany na pustą przestrzeń pozostałą po jego wycięciu. Druk może być
jaśniejszy niż w przypadku ustawienia <Włącz>, a krawędzie tekstu mogą mieć białą obwódkę.
<Włącz>
Najpierw wydrukowane zostanie jedynie kolorowe tło lub rysunek, a następnie na tym tle lub rysunku
zostanie nadrukowany czarny tekst.
Jasność
Można wyregulować jasność całego obrazu skokowo co 5%. Im mniejsza wartość, tym jaśniejszy obraz.
85 do 100
do 115 (%)
(
)
<PDF>
<Jasność>
Za pomocą przycisków
/
wprowadź
wartość ustawienia
Półtony
Istnieje możliwość wybrania metody drukowania z odzwierciedlaniem półtonów (zakres pośredni między jaśniejszymi i
ciemniejszymi obszarami obrazu).
Błąd dyfuzji
Tryb ten pozwala drukować dane z tekstem i cienkimi liniami oraz zakrzywionymi liniami danych CAD itp.
Wyłącz
Włącz
(
)
<PDF>
<Półtony>
<Włącz>
460
<Błąd dyfuzji>
<Wyłącz> lub
Lista menu ustawień
● Stabilność tekstury i trwały toner mogą zostać ograniczone w przypadku korzystania z <Błąd dyfuzji>.
Rozdzielcz./gradacja *
Jeśli ustawienie opcji <Błąd dyfuzji> to <Wyłącz>, wybierz metodę odtwarzania półtonów. Tę pozycję można
ustawiać dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
Rozdzielczość
Gradacja
Grafiki
Rozdzielczość
Gradacja
Obraz
Rozdzielczość
Gradacja
(
)
<PDF>
danych obrazu
<Półtony>
<Rozdzielcz./gradacja>
Wybierz typ
<Rozdzielczość> lub <Gradacja>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Rozdzielczość>
Umożliwia precyzyjne drukowanie poprzez ostre odzwierciedlanie krawędzi znaków. Ten tryb drukowania jest
odpowiedni do drukowania danych składających się ze znaków i cienkich linii z wyraźnym wykończeniem.
<Gradacja>
Umożliwia drukowanie gradacji i linii z płynnym wykończeniem. Ten typ drukowania jest odpowiedni do
drukowania rysunków lub tabel zawierających gradacje.
Nadruk kompozytowy
Ustawienie, czy dane CMYK, dla których ustawiany jest nadruk, będą zadrukowywane jako dane kompozytowe.
Wyłącz
461
Lista menu ustawień
Włącz
(
)
<PDF>
<Nadruk kompozytowy>
<Wyłącz> lub <Włącz>
● Wybranie ustawienia dla tej pozycji opcji <Włącz> nie pozwoli na wykonanie nadruku, jeśli ustawienie opcji
<Profil symul. CMYK> jest inne niż <Brak>.
Zaawans. wygładzanie
Wprowadzanie ustawień trybu wygładzania, który umożliwia płynne drukowanie krawędzi linii, rysunków i tekstu.
Zaawans. wygładzanie
Włączanie lub wyłączanie trybu wygładzania. Krawędzie będą bardziej wygładzone w przypadku opcji
<Wygładzanie 2> niż opcji <Wygładzanie 1>.
Wyłącz
Wygładzanie 1
Wygładzanie 2
(
)
<PDF>
<Zaawans. wygładzanie>
<Zaawans.
Wybierz metodę przetwarzania
wygładzanie>
Grafiki *
Wybór zastosowania trybu wygładzania do linii i rysunków, gdy ustawienie opcji <Zaawans. wygładzanie> to
<Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
(
)
<PDF>
<Zaawans. wygładzanie>
<Grafiki>
<Wyłącz> lub
<Włącz>
Tekst *
Określenie, czy tryb wygładzania ma być zastosowany do tekstu, gdy ustawienie opcji <Zaawans. wygładzanie>
to <Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
462
Lista menu ustawień
Włącz
(
)
<PDF>
<Zaawans. wygładzanie>
<Tekst>
<Wyłącz> lub
<Włącz>
Konwers. skali szar. *
Pozwala wybrać metodę konwersji danych drukowania w kolorze na dane czarno-białe.
sRGB
NTSC
Uniform RGB
(
)
<PDF>
<Konwers. skali szar.>
Wybierz metodę konwersji
<sRGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać płynną gradację z
uwzględnieniem kolorów.
<NTSC>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać efekt odpowiadający obrazom
telewizyjnym (NTSC).
<Uniform RGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby wszystkie poziomy RGB zostały
wyrównane wyłącznie na bazie jasności.
● Ta pozycja jest dostępna, gdy ustawieniem opcji <Tryb koloru> (
wydruku> jest <Czarny>.
463
Tryb koloru(P. 374) ) w polu <Jakość
Lista menu ustawień
PS
6869-056
Wszystkie ustawienia z listy dotyczące poleceń sterowania PS są opatrzone krótkim
opisem. Ustawienia domyślne oznaczone są przy pomocy znaku ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w zależności od innych elementów
ustawień.
Limit czasu zadania(P. 464)
Drukuj błędy PS(P. 464)
Jasność(P. 470)
Półtony(P. 470)
Ustaw. profilu ICC(P. 465)
Tekst w czyst. czer.(P. 469)
Czarny nadruk(P. 469)
Nadruk kompozytowy(P. 472)
Zaawans. wygładzanie(P. 472)
Konwers. skali szar.(P. 473)
Limit czasu zadania
Jeśli od momentu rozpoczęcia przetwarzania zadania upłynie czas zdefiniowany w tej pozycji, urządzenie
automatycznie zakończy zadanie i odbierze kolejne zadanie.
Aby nie definiować limitu czasu, należy tutaj ustawić „0 sekund”.
Od 0
do 3600 (s)
(
)
<PS>
<Limit czasu zadania>
Wprowadź wartość ustawienia za
pomocą klawiszy numerycznych
Drukuj błędy PS
Pozwala określić, czy w razie wystąpienia błędu Post Script, ma być drukowana strona błędu.
Wyłącz
Włącz
(
)
<PS>
<Drukuj błędy PS>
464
<Wyłącz> lub <Włącz>
Lista menu ustawień
Ustaw. profilu ICC
Ustawienie profilu używanego podczas dopasowywania kolorów i określenie elementu, który będzie miał
pierwszeństwo nad innymi.
Profil źródła RGB
Wybór odpowiedniego profilu danych RGB zgodnego z używanym monitorem.
sRGB v3.0 (Canon)
Canon HDTV gamma 1.5
Canon HDTV gamma 1.8
Canon HDTV gamma 2.4
Brak
(
)
<PS>
<Ustaw. profilu ICC>
<Profil źródła RGB>
Wybierz
profil
<sRGB v3.0 (Canon)>
Używany jest profil RGB podobny do średniego profilu większości monitorów stosowanych z komputerami z
systemem Windows. Podczas korzystania z monitora obsługującego standard sRGB można drukować kolory
zbliżone do kolorów wyświetlanych na monitorze.
Tryby z zakresu od <Canon HDTV gamma 1.5> do <Canon HDTV gamma 2.4>
W tym miejscu można wprowadzić ustawienia konieczne do wyregulowania jasności po dokonaniu
porównania kolorów wydruku z kolorami wyświetlanymi na monitorze. Im wyższa wartość, tym ciemniejsze
kolory wydruków.
<Brak>
Oddzielenie koloru od danych RGB do CMYK bez stosowania profilu źródłowego RGB.
Profil symul. CMYK
Podczas drukowania danych CMYK można wybrać docelowy rodzaj symulacji. Urządzenie konwertuje dane
CMYK do modelu kolorów CMYK zależnego od urządzenia w oparciu o wybrany docelowy rodzaj symulacji.
Euro Standard v1.00
JapanColor(Canon)
U.S. Web Coated v1.0
Brak
465
Lista menu ustawień
(
)
<PS>
<Ustaw. profilu ICC>
<Profil symul. CMYK>
Wybierz
profil
<Euro Standard v1.00>
Pozwala użyć profilu Euro Standard. Podczas drukowania stosowane są kolory zbliżone do europejskich norm
drukowania.
<JapanColor(Canon)>
Pozwala użyć profilu JapanColor. Podczas drukowania stosowane są kolory zbliżone do japońskich norm
drukowania.
<U.S. Web Coated v1.0>
Pozwala użyć profilu U.S. Web Coated. Podczas drukowania stosowane są kolory zbliżone do amerykańskich
norm drukowania.
<Brak>
Pozwala drukować dane CMYK z zastosowaniem modelu kolorów CMYK zależnego od urządzenia bez
stosowania jakiegokolwiek profilu symulacji CMYK.
● Po wybraniu dla tej opcji ustawienia <Brak> w zależności od danych gradacja ciemnych kolorów może
być obsługiwana nieprawidłowo.
Profil skali szar.
Wybór konwersji danych w skali szarości na dane CMYK przy użyciu profilu skali szarości urządzenia.
Wyłącz
Włącz
(
)
<PS>
<Ustaw. profilu ICC>
<Włącz>
466
<Profil skali szar.>
<Wyłącz> lub
Lista menu ustawień
<Wyłącz>
Drukowanie przy użyciu wyłącznie tonera K (czarnego) bez konwersji danych na dane CMYK.
<Włącz>
Konwersja danych na dane CMYK z zastosowaniem profilu skali szarości urządzenia. Jednak w zależności od
ustawienia opcji <Profil wyjściowy> lub <Tekst w czyst. czer.> drukowanie może się odbywać wyłącznie przy
użyciu tonera K (czarnego).
Profil wyjściowy
Wybór odpowiedniego profilu danych do wydrukowania. Tę pozycję można ustawić dla każdego typu obrazu
zawartego w jednym dokumencie.
Tekst
PS Normal
PS Photo
PS TR Normal
PS TR Photo
Grafiki
PS Normal
PS Photo
PS TR Normal
PS TR Photo
Obraz
PS Normal
PS Photo
PS TR Normal
PS TR Photo
(
)
<PS>
danych obrazu
<Ustaw. profilu ICC>
<Profil wyjściowy>
Wybierz typ
Wybierz profil
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
467
Lista menu ustawień
<PS Normal>
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach zbliżonych do kolorów
wyświetlanych na monitorze.
<PS Photo>
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał fotografię.
<PS TR Normal>
Wykonane zostanie dopasowanie kolorów, tak aby dane były drukowane w kolorach zbliżonych do kolorów
wyświetlanych na monitorze, a ilość tonera zużywana na tekst i precyzyjne linie była dobrze kontrolowana.
<PS TR Photo>
Wykonane zostanie dopasowanie kolorów, tak aby efekt drukowania przypominał fotografię, a ilość tonera
zużywana na tekst i precyzyjne linie była dobrze kontrolowana.
Ta pozycja nie będzie aktywna po wybraniu jednego z poniższych ustawień.
● <Profil źródła RGB> — ustawienie <Brak>.
● <Profil symul. CMYK> — ustawienie <Brak>.
● <Profil skali szar.> — ustawienie <Wyłącz>.
Metoda dopasowania
Za pomocą opcji <Profil źródła RGB> można określić, który element będzie miał pierwszeństwo na innymi
podczas dopasowywania kolorów.
Percepcyjnie
Saturacja
Kolorometryczny
(
)
<PS>
dopasowania>
<Ustaw. profilu ICC>
Wybierz metodę dopasowania
<Percepcyjnie>
Dopasowanie wykonywane jest z priorytetem percepcyjnej.
468
<Metoda
Lista menu ustawień
<Saturacja>
Dopasowanie wykonywane jest z priorytetem nasycenia.
<Kolorometryczny>
Dopasowanie wykonywane jest w taki sposób, aby zminimalizować różnicę kolorów między oryginałami a
wydrukami.
● Ta pozycja jest nieaktywna, gdy ustawienie opcji <Profil źródła RGB> to <Brak>.
Tekst w czyst. czer.
W przypadku czarnego tekstu, dla którego definicja danych koloru to „R=G=B=0%”, „C=M=Y=100%” lub „C=M=Y=0%/
K=100%”, należy wybrać, czy wydruk ma być wykonywany tylko za pomocą tonera K (czarnego) czy też zgodnie z
ustawieniem opcji <Profil wyjściowy>.
Wyłącz
Włącz
(
)
<PS>
<Tekst w czyst. czer.>
<Wyłącz> lub <Włącz>
<Wyłącz>
Drukowanie zgodnie z ustawieniem <Profil wyjściowy>. W zależności od danych drukowania wynik
drukowania może być lepszy niż w przypadku opcji <Włącz>.
<Włącz>
Drukowanie czarnego tekstu wyłącznie za pomocą tonera K (czarnego). W przeciwieństwie do drukowania
przy użyciu kolorowego tonera (CMY) rozmycia tonera wokół krawędzi nie będą występować. Zaleca się
używanie tego ustawienia w normalnym trybie pracy.
Czarny nadruk *
Ustawienie sposobu drukowania, gdy czarny tekst znajduje się na kolorowym tle lub kolorowym rysunku. Pa pozycja
nie będzie wyświetlana, gdy ustawienie opcji <Tekst w czyst. czer.> to <Wyłącz>.
Wyłącz
Włącz
469
Lista menu ustawień
(
)
<PS>
<Czarny nadruk>
<Wyłącz> lub <Włącz>
<Wyłącz>
Najpierw zostaną wydrukowane dane po uprzednim wycięciu czarnego tekstu z kolorowego tła lub rysunku, a
następnie czarny tekst zostanie nadrukowany na pustą przestrzeń pozostałą po jego wycięciu. Druk może być
jaśniejszy niż w przypadku ustawienia <Włącz>, a krawędzie tekstu mogą mieć białą obwódkę.
<Włącz>
Najpierw wydrukowane zostanie jedynie kolorowe tło lub rysunek, a następnie na tym tle lub rysunku
zostanie nadrukowany czarny tekst.
Jasność
Można wyregulować jasność całego obrazu skokowo co 5%. Im mniejsza wartość, tym jaśniejszy obraz.
85 do 100
do 115 (%)
(
)
<PS>
<Jasność>
Za pomocą przycisków
/
wprowadź wartość
ustawienia
Półtony
Istnieje możliwość wybrania metody drukowania z odzwierciedlaniem półtonów (zakres pośredni między jaśniejszymi i
ciemniejszymi obszarami obrazu).
Błąd dyfuzji
Drukowanie z większą precyzją niż w przypadku opcji <Rozdzielcz./gradacja>. Ten tryb drukowania nadaje się do
drukowania ostrych krawędzi danych o dużej szczegółowości, takich jak znaki lub cienkie linie.
Wyłącz
470
Lista menu ustawień
Włącz
(
)
<PS>
<Półtony>
<Błąd dyfuzji>
<Wyłącz> lub
<Włącz>
Rozdzielcz./gradacja *
Jeśli ustawienie opcji <Błąd dyfuzji> to <Wyłącz>, wybierz metodę odtwarzania półtonów. Tę pozycję można
ustawiać dla każdego typu obrazu zawartego w jednym dokumencie.
Tekst
Rozdzielczość
Gradacja
Grafiki
Rozdzielczość
Gradacja
Obraz
Rozdzielczość
Gradacja
(
)
<PS>
danych obrazu
<Półtony>
<Rozdzielcz./gradacja>
Wybierz typ
<Rozdzielczość> lub <Gradacja>
Typ danych obrazu
Można wybrać typ danych obrazowych, dla których ustawienia zostaną zmienione. W przypadku znaków
należy wybrać opcję <Tekst>, w przypadku linii i rysunków opcję <Grafiki>, a w przypadku obrazów, takich jak
zdjęcia, opcję <Obraz>.
<Rozdzielczość>
Umożliwia precyzyjne drukowanie poprzez ostre odzwierciedlanie krawędzi znaków. Ten tryb drukowania jest
odpowiedni do drukowania danych składających się ze znaków i cienkich linii z wyraźnym wykończeniem.
<Gradacja>
Umożliwia drukowanie gradacji i linii z płynnym wykończeniem. Ten typ drukowania jest odpowiedni do
drukowania rysunków lub tabel zawierających gradacje.
471
Lista menu ustawień
Nadruk kompozytowy
Ustawienie, czy dane CMYK, dla których ustawiany jest nadruk, będą zadrukowywane jako dane kompozytowe.
Wyłącz
Włącz
(
)
<PS>
<Nadruk kompozytowy>
<Wyłącz> lub <Włącz>
● Wybranie ustawienia dla tej pozycji opcji <Włącz> nie pozwoli na wykonanie nadruku, jeśli ustawienie opcji
<Profil symul. CMYK> jest inne niż <Brak>.
Zaawans. wygładzanie
Wprowadzanie ustawień trybu wygładzania, który umożliwia płynne drukowanie krawędzi linii, rysunków i tekstu.
Zaawans. wygładzanie
Włączanie lub wyłączanie trybu wygładzania. Krawędzie będą bardziej wygładzone w przypadku opcji
<Wygładzanie 2> niż opcji <Wygładzanie 1>.
Wyłącz
Wygładzanie 1
Wygładzanie 2
(
)
wygładzanie>
<PS>
<Zaawans. wygładzanie>
<Zaawans.
Wybierz metodę przetwarzania
Grafiki *
Wybór zastosowania trybu wygładzania do linii i rysunków, gdy ustawienie opcji <Zaawans. wygładzanie> to
<Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
472
Lista menu ustawień
(
)
<PS>
<Zaawans. wygładzanie>
<Grafiki>
<Wyłącz> lub
<Włącz>
Tekst *
Określenie, czy tryb wygładzania ma być zastosowany do tekstu, gdy ustawienie opcji <Zaawans. wygładzanie>
to <Wygładzanie 1> lub <Wygładzanie 2>.
Wyłącz
Włącz
(
)
<PS>
<Zaawans. wygładzanie>
<Tekst>
<Wyłącz> lub
<Włącz>
Konwers. skali szar. *
Pozwala wybrać metodę konwersji danych drukowania w kolorze na dane czarno-białe.
sRGB
NTSC
Uniform RGB
(
)
<PS>
<Konwers. skali szar.>
Wybierz metodę konwersji
<sRGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać płynną gradację z
uwzględnieniem kolorów.
<NTSC>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby uzyskać efekt odpowiadający obrazom
telewizyjnym (NTSC).
<Uniform RGB>
Dane koloru zostaną skonwertowane na dane czarno-białe, tak aby wszystkie poziomy RGB zostały
wyrównane wyłącznie na bazie jasności.
473
Lista menu ustawień
● Ta pozycja jest dostępna, gdy ustawieniem opcji <Tryb koloru> (
wydruku> jest <Czarny>.
474
Tryb koloru(P. 374) ) w polu <Jakość
Lista menu ustawień
Ustawienia MEAP
6869-057
Wszystkie ustawienia z listy dotyczące ekranu głównego funkcji MEAP są opatrzone
krótkim opisem. Ustawienia domyślne oznaczone są przy pomocy znaku ( ).
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w zależności od innych elementów
ustawień.
Wybierz ekran domyś.(P. 475)
Zap. w pam.podr. DNS(P. 476)
Okres ważności(P. 476)
Dod. X-FRAME-OPTIONS(P. 476)
Wybierz ekran domyś.
Pozwala zdefiniować ekran, który będzie wyświetlany na panelu roboczym podczas rozruchu urządzenia.
Ekran wydruku
MEAP
(
)
<Ustawienia MEAP>
<Wybierz ekran domyś.>
<Ekran wydruku> lub
<MEAP>
<Ekran wydruku>
Zostanie wyświetlony ekran oczekiwania na drukowanie (ekran główny).
<MEAP>
Zostanie wyświetlony ekran zainstalowanej aplikacji MEAP, jeśli jakaś aplikacja tego typu została
zainstalowana.
475
Lista menu ustawień
● Ekrany na wyświetlaczu można zmieniać za pomocą przycisku
(
).
Zap. w pam.podr. DNS
Umożliwia zdecydowanie, czy informacje o DNS, które zapewniły pomyślne wyszukiwanie za pomocą aplikacji MEAP,
mają być przechowywane w pamięci. Gdy wybrano ustawienie <Wł. (określ okres)>, dane są zapisywane tymczasowo i
można określić czas trwania przechowywania ( Okres ważności(P. 476) ).
Wyłącz
Wł. (nieogr. użycie)
Wł. (określ okres)
(
)
<Ustawienia MEAP>
<Zap. w pam.podr. DNS>
Wybierz wartość
ustawienia
Okres ważności *
Gdy dla opcji <Zap. w pam.podr. DNS> wybrano ustawienie <Wł. (określ okres)>, należy określić czas, przez jaki
informacje o DNS mają być przechowywane w pamięci.
Od 1 do 60
do 120 (s)
(
)
<Ustawienia MEAP>
<Okres ważności>
Ustaw przedział czasu,
używając przycisków numerycznych
Dod. X-FRAME-OPTIONS
Umożliwia zdecydowanie, czy rozwiązanie X-FRAME-OPTIONS ma być dodawane do nagłówka, gdy serwer HTTP zwróci
odpowiedź. Dodanie rozwiązania X-FRAME-OPTIONS zapobiega nakładaniu informacji na zawartość wygenerowaną
przez inne serwery.
Wyłącz
Włącz
(
)
<Ustawienia MEAP>
<Dod. X-FRAME-OPTIONS>
<Włącz>
476
<Wyłącz> lub
Lista menu ustawień
Sprawdź licznik
6869-058
Pozwala sprawdzić całkowitą liczbę wydrukowanych stron.
● Wartość licznika można sprawdzić również poprzez wybranie opcji <Sprawdź licznik> w
podręczne(P. 480) .
Menu
101: Suma 1
Można sprawdzić całkowitą liczbę wydrukowanych stron.
(Tylko wyświetlacz)
108: Suma (cz.-b. 1)
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli.
(Tylko wyświetlacz)
112: Suma (cz./duże)
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli na papierze o formacie większym niż B4.
(Tylko wyświetlacz)
113: Suma (cz-b/mał)
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli na papierze o formacie nie większym niż B4.
(Tylko wyświetlacz)
114: Suma 1 (2-str.)
Można sprawdzić liczbę stron wydrukowanych w trybie drukowania dwustronnego.
(Tylko wyświetlacz)
477
Lista menu ustawień
122: Suma(peł.+1C/L)
Można sprawdzić liczbę stron wydrukowanych na papierze o formacie większym niż B4 (nie licząc drukowania
wiadomości e-mail).
(Tylko wyświetlacz)
123: Suma(peł.+1C/S)
Można sprawdzić liczbę stron wydrukowanych na papierze o formacie nie większym niż B4 (nie licząc drukowania
wiadomości e-mail).
(Tylko wyświetlacz)
478
Lista menu ustawień
Zainicjuj menu
6869-059
Wybór tej opcji spowoduje przywrócenie fabrycznych ustawień domyślnych
wymienionych poniżej menu konfiguracji. Inicjowanie menu(P. 557)
Ustawienia które nie mogą zostać zresetowane
● Nie można resetować ustawień zdefiniowanych dla opcji <Sieć> i <Dost. pozyc. wydruku>. Informacje na
temat resetowania ustawień opcji <Sieć> zawiera sekcja Resetowanie ustawień sieciowych(P. 558) . Aby
zainicjować ustawienia <Dost. pozyc. wydruku>, należy ręcznie przywrócić dla nich domyślne ustawienia
fabryczne ( Dost. pozyc. wydruku(P. 392) ).
479
Lista menu ustawień
Menu podręczne
6869-05A
Pozwala wyświetlić całkowitą liczbę wydrukowanych stron oraz informacje
wewnętrzne o systemie drukowania. Naciśnięcie przycisku
(
) na panelu
roboczym spowoduje wyświetlenie menu Narzędzie. Wówczas będzie można
zdefiniować opisane poniżej ustawienia, gdy urządzenie będzie pracowało w trybie
offline.
Sprawdź licznik(P. 480)
Strona konfiguracji(P. 481)
Wydruk stanu sieci(P. 481)
Dr. stan mat. ekspl.(P. 481)
Lista polityk IPSec(P. 481)
Kalibracja(P. 481)
Narzędzie PCL(P. 482)
Narzędzie PS(P. 482)
Czyszczenie(P. 482)
Zapob. roz. się ton.(P. 482)
Czyszczenie ITB(P. 482)
Reg. po wym. pojemn.(P. 482)
Narz. do dr. e-maili(P. 483)
Wydr. do regul. poz.(P. 483)
Lista zliczania str.(P. 483)
Raport licznika(P. 483)
Druk. inf. sys. MEAP(P. 483)
Wydr. rejest. pojem.(P. 483)
Numer seryjny(P. 483)
Inf. o mater. ekspl.(P. 483)
Sprawdź licznik
Pozwala sprawdzić całkowitą liczbę wydrukowanych stron.
stron(P. 550)
Sprawdzanie całkowitej liczby wydrukowanych
● Wartość licznika można sprawdzić również poprzez wybranie opcji <Sprawdź licznik> w
konfiguracji(P. 326) .
Menu
101: Suma 1
Można sprawdzić całkowitą liczbę wydrukowanych stron.
(Tylko wyświetlacz)
108: Suma (cz.-b. 1)
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli.
(Tylko wyświetlacz)
112: Suma (cz./duże)
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli na papierze o formacie większym niż B4.
(Tylko wyświetlacz)
113: Suma (cz-b/mał)
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli na papierze o formacie nie większym niż B4.
(Tylko wyświetlacz)
480
Lista menu ustawień
114: Suma 1 (2-str.)
Można sprawdzić liczbę stron wydrukowanych w trybie drukowania dwustronnego.
(Tylko wyświetlacz)
122: Suma(peł.+1C/L)
Można sprawdzić liczbę stron wydrukowanych na papierze o formacie większym niż B4 (nie licząc drukowania
wiadomości e-mail).
(Tylko wyświetlacz)
123: Suma(peł.+1C/S)
Można sprawdzić liczbę stron wydrukowanych na papierze o formacie nie większym niż B4 (nie licząc
drukowania wiadomości e-mail).
(Tylko wyświetlacz)
Strona konfiguracji
Pozwala sprawdzić ustawienia urządzenia skonfigurowane ( Menu konfiguracji(P. 326) ) na urządzeniu. Można też
sprawdzić inne informacje, takie jak stan zasobnika z tonerem, liczba wydrukowanych stron i pojemność pamięci (RAM)
Strona konfiguracji(P. 541)
zainstalowanej w urządzeniu.
Wydruk stanu sieci
Wybór tej opcji umożliwia wydrukowanie listy ustawień ( Sieć(P. 347) ) dotyczących sieci skonfigurowanej w
urządzeniu. Można również sprawdzić informacje na temat bezpieczeństwa, łącznie z ustawieniami filtra adresu i
ustawieniami IPSec. Wydruk stanu sieci(P. 541)
Dr. stan mat. ekspl.
Można wydrukować informacje, takie jak stan zasobnika z tonerem, komunikaty ostrzegawcze i informacje o tym,
gdzie można zakupić nowe zasobniki z tonerem. Wyd. stanu mat. eksploatacyjnych(P. 542)
Lista polityk IPSec
Pozwala wydrukować listę ustawień ( Konfiguracja ustawień protokołu IPSec(P. 269) ) i nazw zasad IPSec
skonfigurowanych w urządzeniu. Lista zasad IPSec(P. 542)
Kalibracja
W przypadku wystąpienia niezgodności kolorów lub jeśli kolory uległy zmianie, a dane nie są drukowane we
właściwych (określonych) kolorach, można wykonać kalibrację. Korekcja niedopasowania kolorów i odcieni(P. 534)
Kalibracja druk. POP
Za pomocą tej funkcji można skorygować niedopasowanie kolorów i różnice w odcieniach, jeśli występują one w
druku POP.
Pełna kalibracja
Za pomocą tej funkcji można skorygować niedopasowanie kolorów i różnice w odcieniach.
481
Lista menu ustawień
Narzędzie PCL
Pozwala wydrukować listę elementów informacji wewnętrznych zarejestrowanych w urządzeniu na potrzeby trybu PCL.
Lista czcionek
Pozwala wydrukować listę czcionek do użycia w trybie PCL.
Lista czcionek PCL(P. 545)
Narzędzie PS
Pozwala wydrukować listę ustawień na potrzeby trybu PS oraz listę elementów informacji wewnętrznych
zarejestrowanych w urządzeniu. Lista trybu PS(P. 546)
Strona konfiguracji
Pozwala wydrukować listę ustawień urządzenia (
PS(P. 464) ).
Lista czcionek
Pozwala wydrukować listę czcionek do użycia w trybie PS.
Czyszczenie
Pozwala wyczyścić moduł utrwalający, jeśli na wydrukach pojawiają się czarne kropki lub smugi.
utrwalania(P. 507)
Moduł
Zapob. roz. się ton.
Zapobiega rozsypaniu się toneru podczas transportu urządzenia na duże odległości.
urządzenia(P. 529)
Przenoszenie
Czyszczenie ITB
Jeśli jakość druku nie jest dobra, można wykonać czyszczenie zespołu ITB.
(
)
<Czyszczenie ITB>
<Tak>
Reg. po wym. pojemn.
Pozwala na dostosowanie gęstości toneru, gdy drukowanie metodą POP nie jest możliwe przy oczekiwanej gęstości.
(
)
<Reg. po wym. pojemn.>
482
<Tak>
Lista menu ustawień
Narz. do dr. e-maili
Pozwala ręcznie odebrać wiadomości e-mail i wydrukować rejestr odebranych wiadomości e-mail w formie listy.
Otrzymany E-Mail
Pozwala ręcznie odebrać wiadomości e-mail z serwera poczty POP3, a następnie je wydrukować.
odbieranie wiadomości e-mail(P. 129)
Ręczne
Lis. rej.odb.e-maili
Pozwala wydrukować rejestr zawierający tematy i daty/godziny odbioru wiadomości e-mail odebranych na
urządzeniu w formie listy. Rejestr wydruków e-maili(P. 549)
Wydr. do regul. poz.
Pozwala wydrukować znaczniki wskazujące bieżące położenie wydruku.
Regulacja położenia wydruku(P. 536)
Lista zliczania str.
Pozwala wydrukować raport dotyczący liczby wydrukowanych stron dla poszczególnych wydziałów, jeśli włączona jest
funkcja zarządzania identyfikatorami wydziałów. Lista liczników stron(P. 543)
Raport licznika
Wyświetla raport pokazujący całkowitą liczbę stron wydrukowanych do tej pory.
Raport o licznikach(P. 544)
Druk. inf. sys. MEAP
Pozwala wydrukować listę informacji na temat aplikacji MEAP zainstalowanych w urządzeniu oraz aplikacji
systemowych MEAP, jeśli włączona jest funkcja MEAP. Drukuj informacje o systemie MEAP(P. 544)
Wydr. rejest. pojem.
Umożliwia wydrukowanie dzienników użycia zasobników z tonerem/zespołów bębna w formie listy.
dziennika zasobników z tonerem(P. 545)
Numer seryjny
Pozwala wyświetlić numer seryjny urządzenia.
(
)
<Numer seryjny>
Inf. o mater. ekspl.
Wybór wyświetlania informacji o takich elementach, jak papier i kaseta z tonerem.
483
Drukowanie
Lista menu ustawień
Inform. o papierze
Pozwala wyświetlić aktualnie zdefiniowany rozmiar i typ papieru, a także poziom papieru w poszczególnych
źródłach papieru. Sprawdzanie stanu papieru(P. 553)
Model pojem. z ton.
Pozwala wyświetlić numer modelu kasety z tonerem do urządzenia.
tonerem(P. 553)
Sprawdzanie modelu kasety z
Pozostało tonera
Wyświetla stan zasobnika z tonerem.
Sprawdzanie stanu zasobnika z tonerem(P. 554)
● Wyświetlony stan zasobnika z tonerem jest jedynie wskazówką i może różnić się od stanu
rzeczywistego.
Model kasety bębna
Wybierz wyświetlenie numeru modelu zespołu bębna dla urządzenia.
bębna(P. 554)
Sprawdzanie modelu zespołu
Pozostało bębna
Wyświetla stan zespołu bębna.
Sprawdzanie stanu zespołu bębna(P. 554)
484
Lista menu ustawień
● Wyświetlony stan zespołu bębna jest jedynie wskazówką i może różnić się od stanu rzeczywistego.
Poj. na zużyty toner
Pozwala wyświetlić numer modelu zasobnika na zużyty toner.
zużyty toner(P. 555)
Sprawdzanie numerów modelu zasobnika na
Stan zużytego tonera
Pozwala wyświetlić stan zasobnika na zużyty toner.
Sprawdzanie stanu zasobnika na zużyty toner(P. 555)
485
Lista menu ustawień
Menu zadań
6869-05C
Możliwe jest drukowanie dokumentów zapisanych na karcie SD i w rejestrze
drukowania. Naciśnięcie przycisku
( ) na panelu roboczym spowoduje
wyświetlenie menu Narzędzie. Wówczas będzie można zdefiniować opisane poniżej
ustawienia, gdy urządzenie będzie pracowało w trybie offline.
Gwiazdka (*)
● Ustawienia oznaczone symbolem „*1” mogą nie być wyświetlane w przypadku niektórych używanych opcji
lub innych ustawień.
● Ustawienia oznaczone symbolem „*2” mogą nie być wyświetlane, gdy nie zaznaczono pole wyboru [Wyświetl
rejestr zadań] w Remote UI (Zdalny interfejs użytkownika). Ukrywanie historii zadań drukowania(P. 261)
Wydruk zaszyfrowany(P. 486)
Zabezpieczony wydruk(P. 486)
Lista zapis. zadań(P. 486)
Wydruk zapis. zad.(P. 486)
Rejestr wydr. zadań(P. 487)
Rej. wydr. zap. zad.(P. 487)
Rejestr wydr. rapor.(P. 487)
Rej. wydr. e-maili(P. 487)
Wydruk zaszyfrowany *1
Wybierz, aby drukować zaszyfrowane dokumenty wysyłane do urządzenia z komputera.
chronionych(P. 96)
Drukowanie dokumentów
Zabezpieczony wydruk *1
Pozwala drukować dokumenty zabezpieczone przesłane do urządzenia z komputera.
chronionych(P. 96)
Drukowanie dokumentów
Lista zapis. zadań *1
Pozwala wydrukować listę dokumentów zapisanych na karcie SD zainstalowanej w urządzeniu.
zadań(P. 547)
Lista zapisanych
Wydruk zapis. zad. *1
Pozwala wydrukować dokumenty zapisane na karcie SD zainstalowanej w urządzeniu.
zapisanego w urządzeniu(P. 102)
486
Drukowanie dokumentu
Lista menu ustawień
Rejestr wydr. zadań *2
Pozwala wydrukować w formie listy rejestr dokumentów wydrukowanych z komputera.
Rejestr wydruków(P. 547)
Rej. wydr. zap. zad. *1*2
Pozwala wydrukować w formie listy rejestr dokumentów zapisanych na karcie SD zainstalowanej w urządzeniu.
Rejestr zapisanych wydruków(P. 548)
Rejestr wydr. rapor. *2
Pozwala wydrukować ustawienia i rejestr wydruków raportów w formie listy.
Rejestr wydruków raportów(P. 548)
Rej. wydr. e-maili *2
Pozwala wydrukować rejestr odebranych wiadomości e-mail w formie listy.
487
Rejestr wydruków e-maili(P. 549)
Lista menu ustawień
Menu resetowania
6869-05E
Pozwala anulować wszystkie procesy, usunąć dane z pamięci i wyłączyć zasilanie. Po
naciśnięciu przycisku
( ) na panelu roboczym zostanie wyświetlone menu
Reset.
Miękki reset(P. 488)
Wysunięcie strony(P. 489)
Wyłącz(P. 490)
● Po wyświetleniu komunikatu Ennn-nnnn (gdzie n oznacza liczbę) będzie można wykonać jedynie operację
<Wyłącz>.
Miękki reset
Pozwala wykasować wszystkie dane na temat zadań drukowania, które nie zostały jeszcze ukończone (miękki reset).
Opcja ta pozwala również wykonać reset sprzętowy w celu zastosowania zmian wprowadzonych w ustawieniach.
● Przed wykonaniem miękkiego lub sprzętowego resetu należy się upewnić, że inne osoby nie korzystają z
urządzenia, w przeciwnym razie wszystkie dane drukowania zostaną skasowane przed wydrukowaniem.
◼ Miękkie resetowanie
Miękki reset należy wykonać, aby skasować wszystkie dane drukowania, które są aktualnie drukowane, oczekują na
wydrukowanie lub są odbierane.
(
)
<Miękki reset>
<Tak>
◼ Reset sprzętowy
Reset sprzętowy wykonuje się w celu aktywowania zmian wprowadzonych w ustawieniach urządzenia lub skasowania
danych zapisanych w pamięci urządzenia.
1
Naciśnij przycisk
(
).
488
Lista menu ustawień
● Jeśli wyświetlane jest menu ustawień, należy najpierw nacisnąć przycisk
(
), aby powrócić do
ekranu głównego, a następnie wykonać ten krok 1.
2
Za pomocą przycisków
przytrzymaj przycisk
/
wybierz opcję <Miękki reset>. Potem naciśnij i
przez co najmniej 5 sekund, a następnie go zwolnij.
➠ Wyświetlony zostanie komunikat <Wykonać twardy reset?>.
3
Wybierz opcję <Tak> i naciśnij przycisk
.
➠ Po wykonaniu resetu sprzętowego nastąpi ponowne uruchomienie urządzenia.
● Wykonanie resetu miękkiego lub sprzętowego spowoduje skasowanie również dokumentów
zabezpieczonych zapisanych na opcjonalnej karcie SD.
Wysunięcie strony
Jeśli drukowanie zostanie anulowane z poziomu komputera lub komunikacja zostanie przerwana podczas odbierania
danych, dane mogą pozostać w pamięci urządzenia, uniemożliwiając ukończenie drukowania. Pozostawienie tych
danych uniemożliwi wydrukowanie kolejnych danych. W takim przypadku należy wybrać opcję <Wysunięcie strony>,
aby wymusić wydrukowanie danych pozostałych w pamięci.
(
)
<Wysunięcie strony>
<Tak>
● Jeśli pozostałe dane nie zostaną wydrukowane, należy wykonać miękki reset.
● Jeśli po podaniu formularza dane nadal pozostają w pamięci urządzenia (świeci się wskaźnik [
urządzeniu), należy wykonać miękki reset.
489
] na
Lista menu ustawień
Wyłącz
Aby wyłączyć urządzenie, należy wykonać procedurę wyłączania z poziomu panelu roboczego bez korzystania z
głównego wyłącznika zasilania. Wyłączanie zasilania (procedura wyłączania)(P. 37)
490
Lista menu ustawień
Menu wyboru podajnika
6869-05F
Lista ustawień dotyczących źródła papieru i rozmiaru papieru załadowanego do
urządzenia wraz z krótkimi opisami. Po naciśnięciu przycisku
( ) na panelu
roboczym zostaje wyświetlone menu Wybierz podajnik. Ustawienia domyślne są
oznaczone znakiem ( ).
Wspólne ustawienia
● Ustawienia są takie same, jak dla opcji <Źródło papieru> w
Menu konfiguracji(P. 326) . Wprowadzone
tutaj ustawienia zostaną również zastosowane do ustawień <Źródło papieru>.
Gwiazdka (*)
● Ustawienia oznaczone symbolem gwiazdki (*) mogą nie być wyświetlane w przypadku niektórych używanych
opcji lub innych ustawień.
Źródło papieru(P. 491)
Roz. pap. tacy wiel.(P. 492)
Rozm. pap. w szuf. N (N=1, 2, 3, 4, 5)(P. 492)
Stand. rozm. papieru(P. 493)
Priorytet tacy wiel.(P. 494)
Wielof. dla miesz.(P. 494)
Autom. wybór szufl.(P. 495)
Wykr. typ pap. autom(P. 495)
Domyślny typ papieru(P. 497)
Typ pap. tacy wiel.(P. 498)
Typ pap. w szufl. N (N=1, 2, 3, 4, 5)(P. 498)
Ręczne 2-str. (MP)(P. 498)
Drukowanie dwustron.(P. 499)
Źródło papieru
Wybierz źródło papieru, z którego będzie podawany papier. Aby źródło papieru było zmieniane automatycznie w
zależności od rozmiaru i typu papieru, należy wybrać opcję <Automatycznie>.
Automatycznie
Taca wielofunkcyjna
Szuflada 1
Szuflada 2 *
Szuflada 3 *
Szuflada 4 *
Szuflada 5 *
(
)
<Źródło papieru>
Wybierz źródło papieru
491
Lista menu ustawień
Roz. pap. tacy wiel.
Pozwala określić rozmiar papieru załadowanego na tacę wielofunkcyjną.
załadowanego na tacę wielofunkcyjną(P. 64)
Określanie rozmiaru i typu papieru
A6
A5
A5R
B5
B5R
A4
A4R
B4
A3
LTR
LTRR
LGL
11x17
EXEC
EXECR
305x457 mm
Dowolny rozm.
Rozm. niestan.
Rozm. niest. R
Postcard
Reply Postcard
4on1 Postcard
Env. Kakugata2
Env. Nagagata3
Env. Younaga 3
Koperta ISO-C5
Koper. Monarch
Koperta nr 10
Koperta DL
India-LGL
Fiszka
STMT
STMTR
FLSC
8K
16K
16KR
Rozm. pap. w szuf. N (N=1, 2, 3, 4, 5) *
Ustaw rozmiar papieru ładowanego do szuflady na papier, opcjonalnego podajnika papieru lub podajnika Cassette
Feeding Unit ( Określanie formatu i typu papieru załadowanego w szufladzie na papier(P. 61) ).
Szuflada na papier urządzenia
A5R
492
Lista menu ustawień
B5R
EXECR
Dowolny rozm.
Automatycznie
Rozm. niestan.
Rozm. niest. R
India-LGL
FLSC
8K
16K
16KR
Szuflada podajnika papieru lub podajnika Cassette Feeding Unit
A5R
B5R
EXECR
Dowolny rozm.
Automatycznie
Rozm. niestan.
Rozm. niest. R
India-LGL
FLSC
8K
16K
16KR
Stand. rozm. papieru
Umożliwia ustawienie domyślnego formatu papieru. Drukowanie będzie przeprowadzane z użyciem papieru, którego
format jest zgodny ze skonfigurowanym tutaj parametrem, w przypadku drukowania w systemie operacyjnym
nieobsługującym sterowników drukarek lub przy użyciu urządzenia przenośnego bądź innego sprzętu
niezapewniającego obsługi ustawień formatu papieru.
A6
A5
B5
A4
B4
A3
LTR
LGL
11x17
EXEC
305x457 mm
Postcard
Reply Postcard
4on1 Postcard
Env. Kakugata2
Env. Nagagata3
Env. Younaga 3
Koperta ISO-C5
Koper. Monarch
493
Lista menu ustawień
Koperta nr 10
Koperta DL
India-LGL
Fiszka
STMT
FLSC
8K
16K
(
)
<Stand. rozm. papieru>
Wybierz rozmiar papieru
Wybór rozmiaru papieru
To ustawienie należy zdefiniować zgodnie z rozmiarem papieru, na którym będzie wykonywany wydruk.
Priorytet tacy wiel.
Pozwala wybrać, czy w przypadku wybrania dla opcji <Źródło papieru> ustawienia <Automatycznie> podawanie
papieru z tacy wielofunkcyjnej będzie miało pierwszeństwo. W przypadku wybrania opcji <Włącz> papier będzie
podawany z tacy wielofunkcyjnej, jeśli na tacy wielofunkcyjnej i w szufladzie na papier będzie załadowany papier o
takim samym rozmiarze.
Wyłącz
Włącz
(
)
<Priorytet tacy wiel.>
<Wyłącz> lub <Włącz>
● W przypadku wybrania dla opcji <Wielof. dla miesz.> ustawienia <Włącz> pierwszeństwo ma papier
podawany z szuflady na papier, nawet jeśli ustawienie opcji <Priorytet tacy wiel.> to <Włącz>.
Wielof. dla miesz.
Wybranie opcji <Włącz>, gdy ustawienie opcji <Źródło papieru> to <Automatycznie>, spowoduje automatyczne
wybranie tacy wielofunkcyjnej, gdy papier w odpowiednim rozmiarze zostanie załadowany do dowolnej szuflady na
papier.
Wyłącz
494
Lista menu ustawień
Włącz
(
)
<Wielof. dla miesz.>
<Wyłącz> lub <Włącz>
Autom. wybór szufl.
Wybranie opcji <Użyj>, gdy ustawienie opcji <Źródło papieru> to <Automatycznie> spowoduje automatyczne wybranie
źródła papieru po załadowaniu papieru we właściwym rozmiarze. Ponadto w przypadku braku papieru ustawienie to
zapewnia ciągłość drukowania poprzez przełączenie z jednego źródła papieru na inne, zawierające papier o takim
samym rozmiarze.
Nie używaj
Użyj
(
)
<Autom. wybór szufl.>
Wybierz źródło papieru
<Nie używaj> lub
<Użyj>
Wybór źródła papieru
Wybór źródła papieru, dla którego ma zostać włączona funkcja Automatycznie wybierz szufladę.
Zmiana ustawień
Aby wyłączyć automatyczny wybór szuflady źródła papieru wybranego na poprzednim ekranie (
wartość <Włącz>.
), wybierz
Wykr. typ pap. autom
Określ, czy typ papieru ma być automatycznie wykrywany podczas ładowania zwykłego lub grubego papieru. Aby użyć
tej funkcji, ustaw typ papieru dla źródła papieru na <Typy mieszane>. Ustaw także opcję [Typ papieru] w sterowniku
drukarki na [Ustawienia domyślne drukarki].
Obsługiwane rodzaje papieru(P. 571)
Typ pap. tacy wiel.(P. 498)
Typ pap. w szufl. N (N=1, 2, 3, 4, 5)(P. 498)
Podstawowe operacje drukowania(P. 77)
Taca wielofunkcyjna
Nie używaj
Tylko pierwszy ark.
Każdy arkusz
495
Lista menu ustawień
Szuflada 1
Nie używaj
Użyj
Szuflada 2 *
Nie używaj
Użyj
Szuflada 3 *
Nie używaj
Użyj
Szuflada 4 *
Nie używaj
Użyj
Szuflada 5 *
Nie używaj
Użyj
(
papieru
)
<Wykr. typ pap. autom>
Sprawdź komunikat
Wybierz źródło
Wybierz wartość ustawienia
Wybór źródła papieru
Wybór źródła papieru, dla którego ma być wprowadzone ustawienie dotyczące automatycznego wykrywania
typu papieru.
Zmiana ustawień (Taca wielofunkcyjna)
W przypadku zdefiniowania opcji <Tylko pierwszy ark.> typ papieru będzie wykrywany tylko dla pierwszego
arkusza. W przypadku zdefiniowania opcji <Każdy arkusz> typ papieru będzie wykrywany dla każdego
podawanego arkusza.
Zmiana ustawień (Szuflada 1 do 5*)
W przypadku zdefiniowania opcji <Użyj> typ papieru będzie wykrywany tylko dla pierwszego arkusza.
● Gdy ta funkcja jest włączona, prędkość drukowania może się zmniejszyć. W przypadku zdefiniowania opcji
<Każdy arkusz> prędkość drukowania będzie niższa.
496
Lista menu ustawień
● Gdy ta funkcja jest włączona, urządzenie może ni być w stanie drukować prawidłowo. Jeżeli urządzenie nie
może drukować poprawnie, ustaw dla tej funkcji wartość <Nie używaj> i określ typ papieru w sterowniku
drukarki przed ponowną próbą drukowania.
Domyślny typ papieru
Umożliwia ustawienie domyślnego typu papieru. Drukowanie będzie przeprowadzane z użyciem papieru, którego typ
jest zgodny ze skonfigurowanym tutaj parametrem, w przypadku drukowania w systemie operacyjnym
nieobsługującym sterowników drukarek lub przy użyciu urządzenia przenośnego bądź innego sprzętu
niezapewniającego obsługi ustawień typu papieru.
Zwykły
Zwykły L
Zwykły L2
Gruby 1
Gruby 2
Gruby 3
Gruby 4
Gruby 5
Postcard
Koperta
Powlekany 1
Powlekany 2
Powlekany 3
Etykiety
Chropowaty 1
Chropowaty 2
(
)
<Domyślny typ papieru>
Wybierz typ papieru
Wybór typu papieru
Ustawienia należy konfigurować w taki sam sposób, jak ustawienia papieru w sterowniku drukarki, zgodnie z
typem papieru używanym do drukowania. Ładowanie papieru(P. 41)
● Drukowanie zostanie przeprowadzone z użyciem określonego tutaj typu papieru, jeśli dla opcji [Typ papieru]
wybrano ustawienie [Ustawienia domyślne drukarki] z poziomu sterownika drukarki, a dla typu papieru
załadowanego do źródła papieru wybrano ustawienie <Typy mieszane> z poziomu urządzenia.
497
Lista menu ustawień
Typ pap. tacy wiel.
Pozwala ustawić typ papieru załadowanego na tacę wielofunkcyjną.
załadowanego na tacę wielofunkcyjną(P. 64)
Określanie rozmiaru i typu papieru
Zwykły
Zwykły L
Zwykły L2
Gruby 1
Gruby 2
Gruby 3
Gruby 4
Gruby 5
Postcard
Koperta
Powlekany 1
Powlekany 2
Powlekany 3
Etykiety
Chropowaty 1
Chropowaty 2
Typy mieszane
Typ pap. w szufl. N (N=1, 2, 3, 4, 5) *
Ustawianie typu papieru załadowanego do szuflady na papier.
w szufladzie na papier(P. 61)
Określanie formatu i typu papieru załadowanego
Zwykły
Zwykły L
Zwykły L2
Gruby 1
Gruby 2
Gruby 3
Gruby 4
Etykiety
Chropowaty 1
Chropowaty 2
Typy mieszane
Ręczne 2-str. (MP)
Pozwala wybrać, na której stronie papieru ma być drukowana treść, gdy użytkownik wykonuje wydruk wielostronny w
sposób ręczny, za pomocą tacy wielofunkcyjnej.
1. strona
2. strona
498
Lista menu ustawień
(
)
<Ręczne 2-str. (MP)>
<1. strona> lub <2. strona>
<1. strona>
Wydruk na tylnej stronie (strona do zadrukowania jako pierwsza).
<2. strona>
Wydruk na przedniej stronie (strona przeciwna do tej, która została już zadrukowana).
Drukowanie dwustron.
Pozwala wybrać druk jednostronny lub dwustronny.
Wyłącz
Włącz
(
)
<Drukowanie dwustron.>
<Wyłącz> lub <Włącz>
499
Rozwiązywanie problemów (FAQ)
Rozwiązywanie problemów (FAQ)
Rozwiązywanie problemów (FAQ) ........................................................................................................ 501
500
Rozwiązywanie problemów (FAQ)
Rozwiązywanie problemów (FAQ)
6869-05H
Gdy wystąpi problem, przed skontaktowaniem się z firmą Canon należy sprawdzić dostępne rozwiązania w tym
rozdziale.
501
Konserwacja urządzenia
Konserwacja urządzenia
Konserwacja urządzenia ............................................................................................................................ 503
Czyszczenie urządzenia ..................................................................................................................................... 505
Obudowa ...................................................................................................................................................... 506
Moduł utrwalania ......................................................................................................................................... 507
Obszar dostarczania papieru ........................................................................................................................ 508
Wymiana zasobników z tonerem ..................................................................................................................... 513
Sposób wymiany zasobników z tonerem ...................................................................................................... 517
Wymiana zespołów bębna ................................................................................................................................ 520
Wymiana zespołów bębna ............................................................................................................................ 524
Wymiana zasobnika na zużyty toner ............................................................................................................... 526
Sposób wymiany zasobnika na zużyty toner ................................................................................................. 527
Przenoszenie urządzenia .................................................................................................................................. 529
Utrzymanie i poprawa jakości wydruku .......................................................................................................... 531
Regulacja gęstości wydruku ......................................................................................................................... 532
Korekcja niedopasowania kolorów i odcieni ................................................................................................. 534
Regulacja położenia wydruku ....................................................................................................................... 536
Drukowanie raportów i list ............................................................................................................................... 541
Wyświetlanie wartości licznika ........................................................................................................................ 550
Sprawdzanie stanu materiałów eksploatacyjnych .......................................................................................... 553
Inicjowanie ustawień ........................................................................................................................................ 556
Inicjowanie menu ......................................................................................................................................... 557
Resetowanie ustawień sieciowych ................................................................................................................ 558
502
Konserwacja urządzenia
Konserwacja urządzenia
6869-05J
W tym rozdziale opisano utrzymanie maszyny, czyszczenie oraz inicjowanie ustawień.
◼ Podstawowe czyszczenie
Czyszczenie urządzenia(P. 505)
● Urządzenie jest zabrudzone, zobacz
Obudowa(P. 506) .
● Na wydrukach pojawiają się czarne kropki, zobacz
Moduł utrwalania(P. 507) .
◼ Wymiana zasobników z tonerem
● Aby sprawdzić stan zasobników z tonerem, zobacz
z tonerem(P. 513) .
● Sposób wymiany zasobników z tonerem, zobacz
zasobników z tonerem(P. 517) .
Wymiana zasobników
Sposób wymiany
◼ Wymiana zespołów bębna
● Aby sprawdzić stan zespołów bębna, zobacz
● Sposób wymiany zespołów bębna, zobacz
Wymiana zespołów bębna(P. 520) .
Wymiana zespołów bębna(P. 524) .
◼ Wymiana zasobnika na zużyty toner
● Został wyświetlony komunikat dotyczący wymiany, patrz
Wymiana zasobnika na zużyty toner(P. 526) .
● Sposób wymiany zasobnika na zużyty toner przedstawiono w sekcji
toner(P. 527) .
Sposób wymiany zasobnika na zużyty
◼ Przenoszenie urządzenia
● Przenoszenie urządzenia z powodu konserwacji lub zmiany lokalizacji biura,
zobacz Przenoszenie urządzenia(P. 529) .
◼ Zarządzanie jakością druku
Utrzymanie i poprawa jakości wydruku(P. 531)
● Informacje o regulacji gęstości toneru użytego do drukowania zawiera
Regulacja gęstości wydruku(P. 532) .
● Informacje na temat korygowania niezgodności kolorów lub różnic odcieni zawiera sekcja
niedopasowania kolorów i odcieni(P. 534) .
● Informacje o dostosowaniu położenia wydruku zawiera
Regulacja położenia wydruku(P. 536) .
503
Korekcja
Konserwacja urządzenia
◼ Drukowanie raportów i list
● Informacje o drukowaniu listy ustawień itp. zawiera
Drukowanie raportów i list(P. 541) .
◼ Sprawdzanie łącznej liczby stron wydrukowanych przez urządzenie
Sprawdzanie łącznej liczby stron wszystkich wydruków, zobacz
Wyświetlanie wartości licznika(P. 550) .
◼ Inicjowanie ustawień
Przywracanie ustawień domyślnych, zobacz
Inicjowanie ustawień(P. 556) .
504
Konserwacja urządzenia
Czyszczenie urządzenia
6869-05K
Urządzenie należy regularnie czyścić, aby zapobiec pogorszeniu jakości druku oraz zapewnić bezpieczne i
bezproblemowe użytkowanie. Przed przystąpieniem do czyszczenia należy zapoznać się z instrukcjami dotyczącymi
bezpieczeństwa. Konserwacja i przeglądy(P. 9)
Miejsca czyszczenia
Obudowa urządzenia i otwory wentylacyjne
Obudowa(P. 506)
Wewnętrzny zespół zespołu utrwalacza
Moduł utrwalania(P. 507)
Wewnętrzny obszar dostarczania papieru
Obszar dostarczania papieru(P. 508)
505
Konserwacja urządzenia
Obudowa
6869-05L
Obudowę urządzenia, zwłaszcza obszary w pobliżu otworów wentylacyjnych, należy regularnie czyścić, aby utrzymać
urządzenie w dobrym stanie.
1
Wyłącz urządzenie i wyjmij wtyczkę przewodu z gniazda zasilania.
● Aby wyłączyć zasilanie urządzenia, należy wykonać procedurę wyłączania z poziomu panelu roboczego bez
korzystania z głównego wyłącznika zasilania. Wyłączanie zasilania (procedura wyłączania)(P. 37)
2
Wyczyść obudowę urządzenia i otwory wentylacyjne.
● Należy użyć miękkiej, dobrze wykręconej ściereczki, nawilżonej wodą lub wodnym roztworem łagodnego
detergentu.
● Aby zlokalizować otwory wentylacyjne, zapoznaj się z sekcją
Strona przednia(P. 20) .
3
Odczekaj, aż obudowa urządzenia zupełnie wyschnie.
4
Ponownie podłącz przewód zasilający i włącz urządzenie.
506
Konserwacja urządzenia
Moduł utrwalania
6869-05R
Do modułu utrwalającego wewnątrz urządzenia mogą przylegać zanieczyszczenia i powodować powstawanie czarnych
kropek na wydrukach. Czyszczenie modułu utrwalania należy wykonywać zgodnie z poniższą procedurą. Nie można
przeprowadzić czyszczenia modułu utrwalania, jeżeli w urządzeniu znajdują się dokumenty oczekujące na wydruk.
Należy pamiętać, że do czyszczenia modułu utrwalającego potrzebny jest papier w rozmiarze A4 lub Letter. Przed
przystąpieniem do wykonania poniższej procedury należy umieścić papier na tacy wielofunkcyjnej.
● Czyszczenie zużywa toner. Przed rozpoczęciem czyszczenia upewnij się, czy w zasobniku znajduje się
wystarczająca ilość toneru. Sprawdzanie stanu zasobnika z tonerem(P. 516)
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz rozmiar załadowanego papieru i naciśnij przycisk
4
Wybierz opcję <Tak> i naciśnij przycisk
(
).
/
wybierz opcję <Czyszczenie> i naciśnij przycisk
.
.
.
➠ Na wyświetlaczu pojawi się komunikat <Ustaw papier czy-szczący i naciśnij przycisk Online.>.
5
Naciśnij przycisk
(
).
➠ Papier czyszczący będzie powoli podawany do urządzenia i rozpocznie się czyszczenie modułu
utrwalającego.
● Nie można zatrzymać czyszczenia w połowie jego wykonywania. Należy zaczekać na zakończenie
czyszczenia.
507
Konserwacja urządzenia
Obszar dostarczania papieru
6869-05S
W przypadku częstego używania etykiet znajdujący się na nich klej może przywierać do obszaru dostarczania papieru,
powodując zacięcia papieru. Po użyciu etykiet należy zastosować następującą procedurę usuwania pozostałości kleju z
obszaru dostarczania papieru.
1
Wyłącz urządzenie i wyjmij wtyczkę przewodu z gniazda zasilania.
● Po wyłączeniu zasilania wyłącz urządzenie z poziomu panelu sterowania bez użycia wyłącznika zasilania.
Wyłączanie zasilania (procedura wyłączania)(P. 37)
2
Wytrzyj pozostałości kleju przywarte do obszaru dostarczania papieru.
● Wytrzyj pozostałości kleju za pomocą miękkiej, dobrze wykręconej ściereczki, nawilżonej wodą lub wodnym
roztworem łagodnego detergentu.
W przypadku szuflady na papier
● W celu usunięcia pozostałości kleju z opcjonalnego podajnika papieru lub podajnika Cassette Feeding Unit
można również zastosować następującą procedurę.
1
Wyciągnij szufladę do oporu.
2
Wytrzyj pozostałości kleju przywarte do prowadnic papieru.
● Gdy papier jest załadowany do danego źródła papieru, wyjmij papier przed rozpoczęciem wycierania.
3
Umieść szufladę z powrotem na miejscu.
● Jeśli papier był załadowany, załaduj go ponownie.
papier(P. 43)
508
Umieszczanie papieru w szufladzie na
Konserwacja urządzenia
4
Otwórz prawą pokrywę.
5
Wytrzyj pozostałości kleju przywarte do wnętrza jednostki głównej.
● Wycierając resztki kleju przywarte do wnętrza jednostki głównej, należy uważać, aby nie dotknąć
zespołu ITB ani automatycznego czujnika wykrywającego typ papieru.
6
Zamknij prawą pokrywę.
W przypadku tacy wielofunkcyjnej
1
Otwórz pokrywę.
2
Wytrzyj pozostałości kleju przywarte do prowadnic papieru.
509
Konserwacja urządzenia
3
Zdejmij pokrywę rolek podajnika.
4
Wyciągnij górną rolkę podajnika.
5
Wytrzyj pozostałości kleju przywarte do rolki podajnika.
6
Umieść wyjętą rolkę podajnika z powrotem na miejscu.
7
Załóż ponownie pokrywę rolek podajnika.
8
Zamknij pokrywę.
9
Otwórz prawą pokrywę.
510
Konserwacja urządzenia
10
Wytrzyj pozostałości kleju przywarte do wnętrza jednostki głównej.
● Wycierając resztki kleju przywarte do wnętrza jednostki głównej, należy uważać, aby nie dotknąć
zespołu ITB ani automatycznego czujnika wykrywającego typ papieru.
11
Zamknij prawą pokrywę.
3
Wytrzyj pozostałości kleju przywarte do tacy wyprowadzającej.
4
Odczekaj, aż obudowa urządzenia zupełnie wyschnie.
511
Konserwacja urządzenia
5
Ponownie podłącz przewód zasilający i włącz urządzenie.
512
Konserwacja urządzenia
Wymiana zasobników z tonerem
6869-05U
Gdy zbliża się termin wymiany zasobnika z tonerem, na wyświetlaczu pojawia się komunikat. Dalsze korzystanie z
funkcji drukowania, bez podjęcia odpowiednich czynności, spowoduje pogorszenie jakości druku. Stan zasobnika z
tonerem można też sprawdzić na wyświetlaczu.
Gdy zostanie wyświetlony komunikat(P. 513)
Jeśli wydruki są niskiej jakości(P. 515)
Sprawdzanie stanu zasobnika z tonerem(P. 516)
◼ Gdy zostanie wyświetlony komunikat
W zależności od wyświetlonego komunikatu należy wyposażyć się w zamienną kasetę z tonerem lub wymienić kasetę z
Materiały eksploatacyjne(P. 588)
tonerem. Sposób wymiany zasobników z tonerem(P. 517)
● „X” w poniższym komunikacie oznacza kolor CMYK.
<Wkrótce minie termin ważn. poj. z toner. X.>
<Wkrótce minie termin ważności kas. bębna X.>
Ten komunikat informuje użytkownika, że wkrótce należy wymienić kasetę z tonerem w danym kolorze.
Przygotuj kasetę z tonerem na wymianę. Wymień kasetę z tonerem przed rozpoczęciem drukowania dużej ilości
dokumentów, jeśli wyświetlany jest ten komunikat.
● Jeśli komunikat <Gotowe do druk.> się nie wyświetla, drukowanie zostanie tymczasowo zatrzymane.
Aby przywrócić drukowanie, należy nacisnąć przycisk
(
).
● To, jaki komunikat zostanie wyświetlony, zależy od ustawienia opcji <Czynn. przy ostrzeż.> w menu
ustawień panelu roboczego. Czynn. przy ostrzeż.(P. 335)
● Jako wartość wywołującą wyświetlenie komunikatu można ustawić dowolną wartość procentową ilości
toneru pozostałego w kasecie z tonerem. Okr.częst.spr.tonera(P. 416)
<Zalecana jest wymiana pojemnika z tonerem X.>
<Minął termin ważności. Zalecana jest wymiana pojemnika z tonerem X.>
Zasobnik z tonerem wskazanego koloru uległ całkowitemu zużyciu. Zalecana jest wymiana zasobnika na nowy.
513
Konserwacja urządzenia
● Można kontynuować drukowanie, gdy wyświetlany jest ten komunikat, ale jakość druku może ulec
pogorszeniu.
● Odbieranie wiadomości e-mail i dokumentów faksowych zostanie wyłączone.
odebranej wiadomości e-mail (Drukowanie e-maili)(P. 125)
Drukowanie
● Kiedy wyświetlany jest komunikat <Minął termin ważności. Zalecana jest wymiana pojemnika z
tonerem X.>, drukowanie zostaje tymczasowo zatrzymane. Aby wznowić drukowanie, naciśnij przycisk
(
).
● To, który komunikat jest wyświetlany, zależy od ustawienia <Czynn. przy br. ton.> w menu ustawień w
panelu sterowania. Czynn. przy br. ton.(P. 417)
<Zalecana jest wymiana pojemnika z tonerem X.>
Zasobnik z tonerem wskazanego koloru uległ całkowitemu zużyciu. Wymień kasetę z tonerem.
● Gdy widoczny jest ten komunikat, nie można kontynuować drukowania.
● To, czy ten komunikat jest wyświetlany, zależy od ustawień <Czynn. przy br. ton.> w menu ustawień w
panelu sterowania. Czynn. przy br. ton.(P. 417)
<Nie dotyczy pojemn. Fałszyw./innych firm.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zasobnika na nowy.
● Można kontynuować drukowanie, gdy wyświetlany jest ten komunikat, ale jakość druku może ulec
pogorszeniu. Może to spowodować uszkodzenie urządzenia.
514
Konserwacja urządzenia
<Może użyto fałsz. pojemn. z ton. lub poj. innej firmy.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zasobnika na nowy.
● Można nacisnąć przycisk
(
), aby kontynuować drukowanie, ale jakość druku może być
niższa. Może to spowodować uszkodzenie urządzenia.
<Nie można drukow. Poj.z ton.może być fał. lub inn. fir.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zasobnika na nowy.
● Gdy widoczny jest ten komunikat, nie można kontynuować drukowania.
Mode(P. 344)
Canon Genuine
<Bł. kom. z ton. X. Kas. może być innej firmy/fałsz.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zasobnika na nowy. Sposób wymiany zasobników z tonerem(P. 517)
◼ Jeśli wydruki są niskiej jakości
Jeśli na wydrukach zaczynają występować poniższe objawy, jeden z zasobników z tonerem jest bliski wyczerpania.
Zasobnik z tonerem, który jest bliski wyczerpania, należy wymienić, nawet jeśli nie pojawia się komunikat. Sposób
wymiany zasobników z tonerem(P. 517)
Zacieki pojawiają się na wydrukach albo
drukowanie jest nierównomierne
Wydruk jest częściowo
wyblakły
515
Nierównomierne zabarwienie
Konserwacja urządzenia
W pustych miejscach są odbicia druku
Pojawiają się białe plamy
Wydruki są słabo zabarwione
◼ Sprawdzanie stanu zasobnika z tonerem
Stan zasobnika z tonerem można sprawdzić na ekranie głównym. Zaleca się sprawdzać pozostałą ilość przed
rozpoczęciem drukowania dużej liczby dokumentów.
Wskaźnik stanu zasobnika
Wyświetla stan zasobnika z tonerem. Zależnie od środowiska, inne wewnętrzne części mogą osiągnąć koniec
okresu ich eksploatacji przed wyczerpaniem się toneru.
● Wyświetlony stan zasobnika z tonerem jest jedynie wskazówką i może różnić się od stanu
rzeczywistego.
● Stan zasobnika z tonerem można też sprawdzić za pomocą opcji <Pozostało tonera> w sekcji <Inf. o
mater. ekspl.>. Inf. o mater. ekspl.(P. 483)
ŁĄCZA
Materiały eksploatacyjne(P. 588)
516
Konserwacja urządzenia
Sposób wymiany zasobników z tonerem
6869-05W
Przed wymianą zasobników z tonerem należy zapoznać się ze środkami ostrożności opisanymi w sekcjach
Konserwacja i przeglądy(P. 9) i Materiały eksploatacyjne(P. 10) .
1
Otwórz całkowicie przednią pokrywę.
2
Wyciągnij kasetę z tonerem.
3
Wyjmij nowy zasobnik z tonerem z opakowania.
4
Wstrząśnij kasetę z tonerem pięć lub sześć razy, tak jak pokazano poniżej, aby
równomiernie rozprowadzić toner wewnątrz kasety, a następnie połóż ją na równej
powierzchni.
● Na razie nie zdejmuj pokrywy ochronnej (
).
517
Konserwacja urządzenia
5
Zdejmij pokrywę ochronną.
6
Zainstaluj zasobnik z tonerem.
● Wyrównaj zasobnik z tonerem z prowadnicą zasobnika z tonerem (
), trzymając go w pozycji poziomej, a
następnie wepchnij go do gniazda aż do oporu.
● Uważaj, aby nie dotknąć mechanizmu (
) ani obszaru podawania (
) oraz nie zetknąć ich z wylotem
gniazda.
● Włóż zasobnik z tonerem do gniazda oznaczonego danym kolorem (
518
).
Konserwacja urządzenia
7
Zamknij przednią pokrywę.
519
Konserwacja urządzenia
Wymiana zespołów bębna
6869-05X
Gdy zbliża się termin wymiany zespołów bębna, na wyświetlaczu pojawia się komunikat. Dalsze korzystanie z funkcji
drukowania, bez podjęcia odpowiednich czynności, spowoduje pogorszenie jakości druku. Stan zespołu bębna można
też sprawdzić na wyświetlaczu.
● Zespoły bębna, które zostały zużyte lub są używane dla określonego koloru, nie mogą być ponownie użyte
dla innego koloru. Takie ponowne wykorzystanie zespołów bębna powoduje pogorszenie jakości druku.
Gdy zostanie wyświetlony komunikat(P. 520)
Jeśli wydruki są niskiej jakości(P. 522)
Sprawdzanie stanu zespołu bębna(P. 523)
◼ Gdy zostanie wyświetlony komunikat
W zależności od wyświetlonego komunikatu należy wyposażyć się w zamienny zespół bębna lub wymienić zespół
bębna. Wymiana zespołów bębna(P. 524)
Materiały eksploatacyjne(P. 588)
● „N” w poniższym komunikacie oznacza liczbę od 1 do 4.
<Wkrótce minie termin ważności kas. bębna N.>
<Wkrótce minie termin ważności kasety bębna N.>
Ten komunikat informuje użytkownika, że wkrótce należy wymienić zespół bębna w określonym gnieździe.
Przygotuj zespół bębna na wymianę. Jeśli wyświetlany jest ten komunikat, wymień zespół bębna przed
rozpoczęciem drukowania dużej liczby dokumentów.
● Kiedy komunikat <Gotowe do druk.> nie jest wyświetlany, drukowanie zostaje tymczasowo
zatrzymane. Aby wznowić drukowanie, naciśnij przycisk
(
).
● To, który komunikat jest wyświetlany, zależy od ustawienia <Czynn. przy ostrzeż.> w menu ustawień w
panelu sterowania. Czynn. przy ostrzeż.(P. 335)
● Jako wartość wywołującą wyświetlenie komunikatu można ustawić dowolną wartość procentową ilości
toneru pozostałego w zespole bębna. Częst. sp. spr. bęb.(P. 417)
<Wymień kasetę bębna N.>
520
Konserwacja urządzenia
<Minął termin ważności. Wymień kasetę bębna N.>
Zespół bębna we wskazanym gnieździe uległ całkowitemu zużyciu. Zalecana jest wymiana zespołu bębna na
nowy.
● Można kontynuować drukowanie, gdy wyświetlany jest ten komunikat, ale jakość druku może ulec
pogorszeniu.
● Odbieranie wiadomości e-mail i faksów zostanie wyłączone.
e-mail (Drukowanie e-maili)(P. 125)
Drukowanie odebranej wiadomości
● Kiedy wyświetlany jest komunikat <Minął termin ważności. Wymień kasetę bębna N.>, drukowanie
zostaje tymczasowo zatrzymane. Aby wznowić drukowanie, naciśnij przycisk
(
).
<Wymień kasetę bębna N.>
Zespół bębna we wskazanym gnieździe uległ całkowitemu zużyciu. Wymień kasetę z tonerem.
● Gdy widoczny jest ten komunikat, nie można kontynuować drukowania.
<Nie dotyczy pojemn. Fałszyw./innych firm.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zespołu bębna na nowy.
● Można kontynuować drukowanie, gdy wyświetlany jest ten komunikat, ale jakość druku może ulec
pogorszeniu. Może to spowodować uszkodzenie urządzenia.
521
Konserwacja urządzenia
<Może użyto fałsz. kas. bęb. lub kas. bęb. innej firmy.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zespołu bębna na nowy.
● Można nacisnąć przycisk
(
), aby kontynuować drukowanie, ale jakość druku może być
niższa. Może to spowodować uszkodzenie urządzenia.
<Nie moż. drukow. Kas. bęb. moż. być fał. lub in. fir.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zespołu bębna na nowy.
● Gdy widoczny jest ten komunikat, nie można kontynuować drukowania.
Mode(P. 344)
Canon Genuine
<Bł. kom. z bęb. N. Kas. może być innej firmy/fałsz.>
Ten komunikat informuje użytkownika, że urządzenie może nie drukować z optymalną jakością. Zalecana jest
wymiana zespołu bębna na nowy.
◼ Jeśli wydruki są niskiej jakości
Jeśli na wydrukach zaczynają występować poniższe objawy, oznacza to, że toner w jednym z zespołów bębna już się
wyczerpał. Zespół bębna, który jest bliski wyczerpania, należy wymienić, nawet jeśli nie pojawia się komunikat.
Wymiana zespołów bębna(P. 524)
Zacieki pojawiają się na wydrukach albo
drukowanie jest nierównomierne
Wydruk jest częściowo
wyblakły
522
Nierównomierne zabarwienie
Konserwacja urządzenia
W pustych miejscach są odbicia druku
Pojawiają się białe plamy
◼ Sprawdzanie stanu zespołu bębna
Stan zespołu bębna można sprawdzić za pomocą opcji <Pozostało bębna> w sekcji <Inf. o mater. ekspl.>. Zaleca się
sprawdzać pozostałą ilość przed rozpoczęciem drukowania dużej liczby dokumentów.
ŁĄCZA
Materiały eksploatacyjne(P. 588)
523
Konserwacja urządzenia
Wymiana zespołów bębna
6869-05Y
Przed wymianą zespołów bębna należy zapoznać się ze środkami ostrożności opisanymi w sekcjach
przeglądy(P. 9) i Materiały eksploatacyjne(P. 10) .
1
Otwórz całkowicie przednią pokrywę.
2
Odblokuj dźwignię zespołu bębna.
3
Wyciągnij zespół bębna.
4
Wyjmij nowy zespół bębna z opakowania.
524
Konserwacja i
Konserwacja urządzenia
5
Zdejmij pokrywę ochronną.
6
Zainstaluj zespół bębna.
● Wyrównaj zespół bębna z prowadnicą zespołu bębna (
● Uważaj, aby nie dotknąć powierzchni bębna (
powierzchni bębna (
), a następnie wepchnij go do gniazda aż do oporu.
) oraz nie zetknąć jej z wylotem gniazda. Zarysowanie
) może spowodować awarię.
● Zespoły bębna, które zostały zużyte lub są używane dla określonego koloru, nie mogą być ponownie użyte
dla innego koloru. Takie ponowne wykorzystanie zespołów bębna powoduje pogorszenie jakości druku.
7
Zablokuj dźwignię zespołu bębna.
8
Zamknij przednią pokrywę.
525
Konserwacja urządzenia
Wymiana zasobnika na zużyty toner
6869-060
Gdy pozostała pojemność zasobnika na zużyty toner jest już mała, na wyświetlaczu są wyświetlane odpowiednie
komunikaty. Na wyświetlaczu można sprawdzić również stan zasobnika na zużyty toner.
Gdy zostanie wyświetlony komunikat(P. 526)
Sprawdzanie stanu zasobnika na zużyty toner(P. 526)
◼ Gdy zostanie wyświetlony komunikat
W zależności od wyświetlonego komunikatu należy wyposażyć się w zamienny pojemnik na zużyty toner lub wymienić
Materiały
pojemnik na zużyty toner. Sposób wymiany zasobnika na zużyty toner(P. 527)
eksploatacyjne(P. 588)
<Wymień wkrótce poj. na zużyty toner.>
Ten komunikat informuje użytkownika, że wkrótce należy wymienić zasobnik na zużyty toner. Należy
przygotować zasobnik do wymiany. Zasobnik na zużyty toner należy wymienić przed rozpoczęciem drukowania
dużej ilości dokumentów, jeśli wyświetlany jest ten komunikat.
● Kiedy komunikat <Gotowe do druk.> nie jest wyświetlany, drukowanie zostaje tymczasowo
zatrzymane. Aby wznowić drukowanie, naciśnij przycisk
(
).
● To, który komunikat jest wyświetlany, zależy od ustawienia <Czynn. przy ostrzeż.> w menu ustawień w
panelu sterowania. Czynn. przy ostrzeż.(P. 335)
<Wym.poj. na zuż.toner.>
<Wymień pojemnik na zużyty toner.>
Zasobnik na zużyty toner jest pełny. Należy wymienić zasobnik na zużyty toner na nowy.
◼ Sprawdzanie stanu zasobnika na zużyty toner
Stan zasobnika na zużyty toner można sprawdzić <Stan zużytego tonera> w obszarze <Inf. o mater. ekspl.>. Zalecane
jest przygotowanie nowego zasobnika na zużyty toner przed rozpoczęciem drukowania dużej liczby dokumentów.
Inf. o mater. ekspl.(P. 483)
ŁĄCZA
Materiały eksploatacyjne(P. 588)
526
Konserwacja urządzenia
Sposób wymiany zasobnika na zużyty toner
6869-061
Przed wymianą zasobników na zużyty toner należy zapoznać się ze środkami ostrożności opisanymi w sekcjach
Konserwacja i przeglądy(P. 9) i Materiały eksploatacyjne(P. 10) .
1
Otwórz całkowicie przednią pokrywę.
2
Otworzyć lewą pokrywę.
3
Wyjmij pojemnik na zużyty toner.
● Należy uważać, aby nie przechylić zasobnika. Przechylenie zasobnika na zużyty toner może skutkować
rozsypaniem zgromadzonego toneru.
● Umieść pojemnik na zużyty toner w plastikowej torbie, aby zapobiec rozsypaniu się toneru w pojemniku.
527
Konserwacja urządzenia
4
Wyjmij nowy pojemnik na zużyty toner z opakowania.
● Nie wolno demontować ani modyfikować pojemnika na zużyty toner.
5
Zainstalować nowy zasobnik na zużyty toner i zamknąć lewą pokrywę.
● Włóż go, wyrównując z lewą pokrywą i dolną tacą.
6
Zamknij przednią pokrywę.
528
Konserwacja urządzenia
Przenoszenie urządzenia
6869-062
Urządzenie jest ciężkie. Podczas przenoszenia urządzenia należy stosować się do poniższych instrukcji, aby zapobiec
obrażeniom. Przed rozpoczęciem wykonywania czynności należy także zapoznać się z informacjami na temat środków
ostrożności. Ważne instrukcje dotyczące bezpieczeństwa(P. 2)
1
W wypadku przenoszenia urządzenia na większe odległości wykonaj procedurę
<Zapob. roz. się ton.>,
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz opcję <Tak> i naciśnij przycisk
(
).
/
wybierz opcję <Zapob. roz. się ton.>, a następnie naciśnij przycisk
.
.
➠ Rozpocznie się czyszczenie.
● Rozpoczętego czyszczenia nie można anulować. Należy zaczekać na zakończenie operacji.
2
Wyłącz urządzenie oraz komputer.
● Po wyłączeniu zasilania koniecznie wyłącz urządzenie z poziomu panelu sterowania bez użycia wyłącznika
zasilania. Wyłączanie zasilania (procedura wyłączania)(P. 37)
3
Odłącz od urządzenia przewody i kable w kolejności zgodnej z numeracją podaną na
poniższej ilustracji.
● Przewody oznaczone „*” mogą nie być podłączone w zależności od danej konfiguracji.
Wtyczka przewodu
zasilającego
Przewód zasilający
Urządzenie USB*
Kabel USB*
Kabel LAN*
529
Konserwacja urządzenia
4
W przypadku transportu urządzenia na większe odległości należy wyjąć zasobnik z
tonerem i zespół bębna.
Sposób wymiany zasobników z tonerem(P. 517)
Wymiana zespołów bębna(P. 524)
5
Wysunąć szufladę na papier do oporu i wyjąć ją, unosząc przednią część.
6
Zamknij wszystkie otwarte osłony i przenieś urządzenie na nowe miejsce.
● Urządzenie jest ciężkie (
Moduł główny(P. 569) ). Nie staraj się na siłę przenosić maszyny.
● Urządzenie należy przenosić z pomocą drugiej osoby, trzymając je za uchwyty po obu stronach.
Jeśli opcjonalny podajnik papieru lub podajnik Cassette Feeding Unit jest podłączony do urządzenia
● Odblokuj podajnik papieru lub podajnik Cassette Feeding Unit przed podniesieniem urządzenia i
przetransportuj podajnik papieru lub podajnik Cassette Feeding Unit oddzielnie.
7
Ostrożnie ustaw urządzenie w nowym miejscu.
● Informacje dotyczące instalacji urządzenia w nowej lokalizacji znajdują się w sekcji Pierwsze kroki.
Instrukcje obsługi i ich zawartość(P. 605)
530
Konserwacja urządzenia
Utrzymanie i poprawa jakości wydruku
6869-063
Jeżeli nie można uzyskać zadowalających wyników drukowania, np. kolory na wydrukach różnią się od oryginalnych lub
wynikowe położenie druku jest niezgodne z oczekiwaniami, należy wykonać regulację w następujący sposób.
◼ Regulacja gęstości
Dostosować gęstość toneru. Można precyzyjnie wyregulować gęstość toneru przy pomocy poziomu gęstości.
Regulacja gęstości wydruku(P. 532)
◼ Niedopasowanie kolorów / korekcja odcieni
Wykonywanie korekcji w przypadku niedopasowania kolorów lub różnicy odcieni.
kolorów i odcieni(P. 534)
Korekcja niedopasowania
◼ Regulacja położenia wydruku
Położenie wydruku należy dostosować do każdego źródła wydruku.
531
Regulacja położenia wydruku(P. 536)
Konserwacja urządzenia
Regulacja gęstości wydruku
6869-064
Jeżeli wydruk jest ciemniejszy lub jaśniejszy niż oczekiwano, można dostosować gęstość tonera dla każdego koloru
CMYK. Można precyzyjnie wyregulować gęstość tonera przez podzielenie całego zakresu gęstości na trzy obszary.
● Jeżeli dla opcji <Oszczędzanie tonera> wybrano ustawienie <Włącz>, funkcja regulacji jest niedostępna.
Oszczędzanie tonera(P. 374)
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Dostosowanie gęstości.
(
).
/
wybierz opcję <Jakość wydruku> i naciśnij przycisk
1
Wybrać kolor, którego gęstość ma zostać dostosowana i nacisnąć przycisk
2
Przyciski
/
.
.
służą do dostosowania gęstości.
Regulacja gęstości
Aby zwiększyć gęstość, należy ustawić wartość dodatnią. Aby zmniejszyć gęstość, należy ustawić
wartość ujemną.
3
Naciśnij przycisk
.
Precyzyjna regulacja gęstości tonera za pomocą poziomu gęstości
Gęstość toneru można precyzyjnie wyregulować na trzech poziomach gęstości — wysokim, średnim i niskim.
1
Za pomocą przycisków
przycisk
2
/
wybierz kolor, dla którego będzie dostosowywana gęstość i naciśnij
.
Zaznacz wybrany poziom gęstości i naciśnij przycisk
532
.
Konserwacja urządzenia
3
Przyciski
/
służą do dostosowania gęstości.
Regulacja gęstości
Aby zwiększyć gęstość, należy ustawić wartość dodatnią. Aby zmniejszyć gęstość, należy ustawić
wartość ujemną.
Przykładowe dostosowanie poszczególnych obszarów gęstości
<Duży>
<Średnia>
<Mały>
4
Naciśnij przycisk
.
● Jeżeli chcesz także dokonać ustawień na innych poziomach gęstości, powtórz czynności opisane w
krokach od 2 do 4.
533
Konserwacja urządzenia
Korekcja niedopasowania kolorów i odcieni
6869-065
Jeśli występuje niedopasowanie kolorów lub jeśli obrazy są drukowane w kolorach innych niż oryginalne, problem
można usunąć, przeprowadzając kalibrację. Wymaga to odpowiedniej ilości toneru, dlatego też zaleca się, aby
Sprawdzanie stanu
wcześniej sprawdzić pozostałą ilość toneru i w razie potrzeby wymienić zasobnik(i) z tonerem.
zasobnika z tonerem(P. 516)
Korekcja niedopasowania kolorów
Niedopasowanie kolorów wydruków oznacza przesunięcie pozycji kolorów, które może mieć miejsce podczas
drukowania przy użyciu kilku zasobników z tonerem. Niedopasowanie kolorów może spowodować, że wydruki
będą nieostre. Niedopasowanie kolorów należy skorygować.
Gdy występuje niedopasowanie kolorów
Gdy nie występuje niedopasowanie kolorów
Korekcja odcieni
Odcień oznacza gęstość koloru takiego jak czerwony, żółty, zielony, niebieski czy fioletowy. Gdy odcienie na
wydrukowanym obrazie różnią się od odcieni na oryginale, niektóre kolory są ciemniejsze albo ogólny poziom
zabarwienia druku jest mniejszy niż oryginału, należy przeprowadzić korekcję.
Odcienie nie są drukowane poprawnie
Oryginał
Odcienie są drukowane poprawnie
● Częste wykonywanie kalibracji może mieć wpływ na czas eksploatacji zasobników z tonerem.
● Jeżeli zasobnik lub zasobniki z tonerem wyczerpią się, kalibracja może nie zostać wykonana prawidłowo. W
takim przypadku należy wymienić zasobnik lub zasobniki z tonerem i ponownie wykonać kalibrację.
Sposób wymiany zasobników z tonerem(P. 517)
● Normalnie kalibracja jest wykonywana automatycznie w zależności od warunków eksploatacji urządzenia lub
od zmian warunków eksploatacji.
● Można wprowadzić takie ustawienie, aby kalibracja była wykonywana automatycznie natychmiast po
włączeniu urządzenia, lub można ustawić częstotliwość kalibracji.
Pierwsza kalibracja(P. 408)
Częstot. kalibracji(P. 415)
534
Konserwacja urządzenia
1
Naciśnij przycisk
(
2
Naciśnij przycisk
/
3
Wybierz tryb kalibracji i naciśnij przycisk
).
, aby wybrać polecenie <Kalibracja> i naciśnij przycisk
.
.
● Jeśli chcesz skorygować niedopasowanie kolorów, które wystąpiło w druku POP, wybierz opcję <Kalibracja
druk. POP>.
● Korekcja poprzez kalibrację trwa dłużej w przypadku opcji <Kalibracja druk. POP> niż w przypadku opcji
<Pełna kalibracja>.
4
Wybierz opcję <Tak> i naciśnij przycisk
.
➠ Regulacja rozpocznie się.
● Można wprowadzić takie ustawienie, aby kalibracja była wykonywana automatycznie o określonej godzinie.
Zegar kalibracji(P. 330)
Czas kalibracji(P. 330)
● Chociaż zwykle typ kalibracji, która jest wykonywana automatycznie, jest taki sam jak w przypadku <Pełna
kalibracja>, można zmienić go na <Kalibracja druk. POP>.
Autom. kalibrac. POP(P. 413)
535
Konserwacja urządzenia
Regulacja położenia wydruku
6869-066
Jeżeli dokument zadrukowano nierówno lub poza zakresem wydruku, należy dostosować położenie wydruku. Można
dostosować położenie wydruku dla każdego źródła papieru.
Krok 1: Drukowanie bieżącego położenia wydruku(P. 536)
Krok 2: Sprawdzanie kierunku i odległości do regulacji(P. 537)
Krok 3: Dostosowywanie położenia wydruku dla poszczególnych źródeł papieru(P. 538)
Krok 1: Drukowanie bieżącego położenia wydruku
Na wydruku dostosowanego położenia drukowania można sprawdzić kierunek i odległość, które należy wyregulować.
● Aby sprawdzić położenie wydruku przy drukowaniu dwustronnym, należy w menu ustawień na panelu
roboczym wybrać ustawienie <Drukowanie dwustron.> dla opcji <Włącz>. Drukowanie dwustron.(P. 499)
1
Naciśnij przycisk
2
Za pomocą przycisków
3
4
( ).
/
wybierz opcję <Źródło papieru> i naciśnij przycisk
Wybierz źródło papieru, dla którego chcesz sprawdzić położenie drukowania, i
naciśnij przycisk
.
Naciśnij przycisk
(
).
➠ Nastąpi powrót do ekranu głównego.
5
Naciśnij przycisk
(
).
536
.
Konserwacja urządzenia
6
Wybierz opcję <Wydr. do regul. poz.> i naciśnij przycisk
7
Wybierz opcję <Tak> i naciśnij przycisk
.
.
➠ Zostanie wydrukowana regulacja położenia drukowania.
Krok 2: Sprawdzanie kierunku i odległości do regulacji
Na wydruku dostosowanego położenia wydrukowania znajdują się oznaczenia kontrolne położenia
. Na podstawie
tych oznaczeń należy wyznaczyć kierunek i odległość do wyregulowania. Jeśli położenie wydruku jest normalne,
wszystkie oznaczenia zostaną wydrukowane w położeniu 5 mm od najbliższej krawędzi papieru.
Sprawdzanie wydruków dostosowanego położenia drukowania
Krawędź papieru, która wychodzi z urządzenia jako pierwsza oznacza górną część wydruku dostosowanego
położenia drukowania. Sprawdzając położenie wydruku, należy zwracać uwagę na to, która krawędź jest górna.
● Rozmiar oznaczenia
do
sprawdzania położenia wydruku jest
taki, jak na poniższej ilustracji.
Położenie wydruku nie jest wyśrodkowane
Jeśli oznaczenia położenia wydruku są wydrukowane w nieprawidłowym położeniu, należy wyregulować
położenie wydruku. Podczas regulacji położenia wydruku należy wyznaczyć kierunek za pomocą wartości
dodatnich i ujemnych oraz odległość w „mm”. Aby przesunąć wydruk w górę, należy użyć wartości ujemnej, a w
dół wartości dodatniej (korekta położenia w pionie). Za pomocą wartości ujemnej przesuwa się położenie
wydruku w lewo, a za pomocą wartości dodatniej w prawo (korekta położenia w poziomie).
Kierunek w pionie (<Przesunięcie Y>)
Kierunek w poziomie (<Przesunięcie X>)
537
Konserwacja urządzenia
W poniższym przykładzie, aby przesunąć położenie wydruku o 5 mm górę i 1,5 mm w prawo, „-5,0 mm” należy
ustawić wartość <Przesunięcie Y> w opcji i „+1,50 mm” w opcji <Przesunięcie X>.
Krok 3: Dostosowywanie położenia wydruku dla poszczególnych źródeł
papieru
Po potwierdzeniu kierunku i odległości do dostosowania należy zdefiniować dostosowane położenie wydruku.
Położenie wydruku można regulować w pionie w zakresie -5,0 mm do +5,0 mm w krokach po 0,1 mm i w poziomie w
zakresie -3,5 mm do +3,5 mm w krokach po 0,25 mm.
1
Przełącz urządzenie w tryb offline.
● Gdy zaświeci się wskaźnik
(
2
Naciśnij przycisk
3
Za pomocą przycisków
4
przycisk
(
), naciśnij przycisk
(
).
).
/
wybierz opcję <Konserw. użytkownika> i naciśnij
.
Wybierz opcję <Dost. pozyc. wydruku> i naciśnij przycisk
538
.
Konserwacja urządzenia
5
Wybierz kombinację kierunku do dostosowania oraz źródło papieru, a następnie
naciśnij przycisk
.
● Aby określić parametr <Przes. X (2-str.)>, najpierw wybierz źródło papieru, a następnie wyreguluj położenie
wydruku.
Regulacja położenia wydruku dla drukowania dwustronnego
● Parametry <Przes. Y (2-str.)> i <Przes. X (2-str.)> pozwalają dostosować położenie wydruku na pierwszej
stronie (przedniej). Położenie wydruku na drugiej stronie (odwrocie) zostanie dostosowane na podstawie
wartości ustawionych dla każdego źródła papieru.
Przykład regulacji położenia wydruku
6
Pierwsza strona (przednia)
<Przes. Y (2-str.)> — wartość ustawienia
Druga strona (tylna)
<Przesunięcie Y (MP)> — wartość ustawienia
Ustaw wartość i naciśnij przycisk
.
● W oparciu o wydruk dostosowanego położenia wydrukowania wprowadź wartość za pomocą przycisków
.
● Jeżeli jest określony parametr <Przes. Y (2-str.)> , położenie wydruku jest regulowane z użyciem wartości
wejściowych dla wszystkich źródeł papieru.
● Aby dostosować inne położenie lub źródło papieru, powtórz kroki 5 i 6.
7
Naciśnij przycisk
(
).
➠ Nastąpi powrót do ekranu głównego.
8
Ponownie naciśnij przycisk
(
).
➠ Urządzenie przejdzie w tryb online.
9
Wykonaj wydruk dostosowanego położenia drukowania i sprawdź położenie na
wydruku. Krok 1: Drukowanie bieżącego położenia wydruku(P. 536)
Regulacja wszystkich położeń wydruku
539
/
Konserwacja urządzenia
Za pomocą opcji <Przesunięcie Y> i <Przesunięcie X> w menu ustawień panelu roboczego można dostosować
położenia wydruku dla wszystkich rodzajów drukowania, niezależnie od źródła papieru. Położenie wydruku
można regulować w zakresie -50,0 mm do +50,0 mm w krokach po 0,5 mm w każdym kierunku: pionowym i
poziomym. Przesunięcie Y/Przesunięcie X(P. 369)
540
Konserwacja urządzenia
Drukowanie raportów i list
6869-067
Stan materiałów eksploatacyjnych oraz ustawienia urządzenia można sprawdzić przez wydrukowanie raportów i list.
Gwiazdka (*)
● W przypadku niektórych ustawień innych opcji ustawienia oznaczone symbolem „*1” mogą nie być
wyświetlane.
● Ustawienia oznaczone symbolem „*2” mogą nie być wyświetlane, gdy nie zaznaczono pole wyboru [Wyświetl
rejestr zadań] w Remote UI (Zdalny interfejs użytkownika). Ukrywanie historii zadań drukowania(P. 261)
Strona konfiguracji
Można wyświetlić ustawienia urządzenia ( Menu konfiguracji(P. 326) ), zawartość zarejestrowaną w urządzeniu i
inne informacje w formie listy. Można też sprawdzić inne informacje, takie jak stan zasobnika z tonerem, liczba
wydrukowanych stron i pojemność pamięci (RAM) zainstalowanej w urządzeniu. Pozycje ustawień, których nazwa jest
poprzedzona gwiazdką (*), to te, których domyślne ustawienie fabryczne zostało zmienione.
(
)
<Strona konfiguracji>
<Tak>
Przykład:
Wydruk stanu sieci
Umożliwia wydrukowanie listy ustawień ( Sieć(P. 347) ) dotyczących sieci skonfigurowanej w urządzeniu. Drukowane
są również informacje na temat bezpieczeństwa, łącznie z ustawieniami filtra adresu i ustawieniami IPSec.
541
Konserwacja urządzenia
(
)
<Wydruk stanu sieci>
<Tak>
Przykład:
Wyd. stanu mat. eksploatacyjnych
Informacje takie jak stan zasobników z tonerem i zespołów bębna, komunikaty ostrzegawcze oraz informacje o tym,
gdzie można kupić nowe zasobniki z tonerem, można wyświetlić w formie listy.
(
)
<Dr. stan mat. ekspl.>
<Tak>
Przykład:
Lista zasad IPSec
Listę nazw zasad oraz ustawienia IPSec zarejestrowane w urządzeniu można sprawdzić, drukując listę zasad IPSec.
542
Konserwacja urządzenia
(
)
<Lista polityk IPSec>
<Tak>
Przykład:
Lista rejestru e-mail RX
Pozwala sprawdzić rejestr zawierający tematy i daty/godziny odbioru wiadomości e-mail odebranych na urządzeniu w
formie listy.
(
)
<Narz. do dr. e-maili>
<Lis. rej.odb.e-maili>
<Tak>
Przykład:
Lista liczników stron
Pozwala sprawdzić całkowitą liczbę wydrukowanych stron dla poszczególnych wydziałów poprzez wydrukowanie
raportu przy włączonej opcji [Zarządzanie ID wydziału].
543
Konserwacja urządzenia
(
)
<Lista zliczania str.>
<Tak>
Przykład:
Raport o licznikach
Wyświetla raport pokazujący całkowitą liczbę stron wydrukowanych do tej pory.
(
)
<Raport licznika>
<Tak>
Przykład:
Drukuj informacje o systemie MEAP
Pozwala sprawdzić informacje na temat aplikacji MEAP zainstalowanych w urządzeniu oraz aplikacji systemowych
MEAP w formie listy, jeśli włączona jest funkcja MEAP.
(
)
<Druk. inf. sys. MEAP>
<Tak>
Przykład:
544
Konserwacja urządzenia
Drukowanie dziennika zasobników z tonerem
Można sprawdzić dzienniki użycia zasobników z tonerem i zespołów bębna i wyświetlić je w formie listy.
(
)
<Wydr. rejest. pojem.>
<Tak>
Przykład:
Lista czcionek PCL
Pozwala sprawdzić listę czcionek dostępnych w trybie PCL.
(
)
<Narzędzie PCL>
Próbki czcionek(P. 636)
<Lista czcionek>
Przykład:
545
<Tak>
Konserwacja urządzenia
Lista trybu PS
Pozwala wydrukować listę ustawień na potrzeby trybu PS oraz listę elementów informacji wewnętrznych
zarejestrowanych w urządzeniu.
Strona konfiguracji(P. 546)
Lista czcionek(P. 546)
◼ Strona konfiguracji
Pozwala sprawdzić ustawienia urządzenia (
listy.
(
)
<Narzędzie PS>
PS(P. 464) ) i zawartość zarejestrowaną w urządzeniu w formie
<Strona konfiguracji>
Przykład:
◼ Lista czcionek
Pozwala sprawdzić listę czcionek dostępnych w trybie PS.
546
<Tak>
Konserwacja urządzenia
(
)
<Narzędzie PS>
<Lista czcionek>
<Tak>
Przykład:
Lista zapisanych zadań *1
Pozwala wydrukować listę dokumentów zapisanych na karcie SD zainstalowanej w urządzeniu.
(
)
<Lista zapis. zadań>
<Tak>
Przykład:
Rejestr wydruków *2
Pozwala wydrukować w formie listy rejestr dokumentów wydrukowanych z komputera.
(
)
<Rejestr wydr. zadań>
<Tak>
547
Konserwacja urządzenia
Przykład:
Rejestr zapisanych wydruków *1*2
Pozwala wydrukować w formie listy rejestr dokumentów zapisanych na karcie SD zainstalowanej w urządzeniu.
(
)
<Rej. wydr. zap. zad.>
<Tak>
Przykład:
Rejestr wydruków raportów *2
Pozwala wydrukować ustawienia i rejestr wydruków raportów w formie listy.
(
)
<Rejestr wydr. rapor.>
<Tak>
Przykład:
548
Konserwacja urządzenia
Rejestr wydruków e-maili *2
Pozwala wydrukować rejestr odebranych wiadomości e-mail w formie listy.
(
)
<Rej. wydr. e-maili>
<Tak>
Przykład:
ŁĄCZA
Menu podręczne(P. 480)
Menu zadań(P. 486)
549
Konserwacja urządzenia
Wyświetlanie wartości licznika
6869-068
Pozwala sprawdzić liczbę wydrukowanych stron.
Sprawdzanie całkowitej liczby wydrukowanych stron(P. 550)
Sprawdzanie liczby wydrukowanych stron dla każdego wydziału(P. 551)
Sprawdzanie całkowitej liczby wydrukowanych stron
Pozwala sprawdzić całkowitą liczbę dotychczas wydrukowanych stron, a także bieżącą liczbę stron wydrukowanych w
trybie czarno-białym i w trybie kolorowym.
(
)
<Sprawdź licznik>
Wybór ustawienia do wyświetlenia
<101: Suma 1>
Można sprawdzić całkowitą liczbę wydrukowanych stron.
<108: Suma (cz.-b. 1)>
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli.
<112: Suma (cz./duże)>
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli na papierze o formacie większym niż B4.
<113: Suma (cz-b/mał)>
Można sprawdzić liczbę stron wydrukowanych w czerni i bieli na papierze o formacie nie większym niż B4.
<114: Suma 1 (2-str.)>
Można sprawdzić liczbę stron wydrukowanych w trybie drukowania dwustronnego.
<122: Suma(peł.+1C/L)>
Można sprawdzić liczbę stron wydrukowanych na papierze o formacie większym niż B4 (nie licząc drukowania
wiadomości e-mail).
550
Konserwacja urządzenia
<123: Suma(peł.+1C/S)>
Można sprawdzić liczbę stron wydrukowanych na papierze o formacie nie większym niż B4 (nie licząc
drukowania wiadomości e-mail).
Sprawdzanie liczby wydrukowanych stron dla każdego wydziału
Istnieje możliwość sprawdzenia liczby wydrukowanych stron dla każdego wydziału.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Zarządzanie ID wydziału].
➠ Liczba wydrukowanych stron jest wyświetlana dla identyfikatora każdego wydziału w opcji [Wydrukowane
strony].
551
Konserwacja urządzenia
Drukowanie wyniku kontroli
Lista liczników stron(P. 543)
Zerowanie licznika stron
● Aby wyzerować licznik stron dla każdego wydziału, kliknij łącze tekstowe dostępne pod pozycją [ID wydziału],
a następnie kliknij opcje [Wyczyść licznik] [OK].
● Aby wyzerować liczniki dla wszystkich wydziałów, kliknij kolejno opcje [Wyczyść wszystkie liczniki]
552
[OK].
Konserwacja urządzenia
Sprawdzanie stanu materiałów eksploatacyjnych
6869-069
Na panelu roboczym można sprawdzić informacje na temat stanu materiałów eksploatacyjnych.
Sprawdzanie stanu papieru(P. 553)
Sprawdzanie modelu kasety z tonerem(P. 553)
Sprawdzanie stanu zasobnika z tonerem(P. 554)
Sprawdzanie modelu zespołu bębna(P. 554)
Sprawdzanie stanu zespołu bębna(P. 554)
Sprawdzanie numerów modelu zasobnika na zużyty toner(P. 555)
Sprawdzanie stanu zasobnika na zużyty toner(P. 555)
Sprawdzanie stanu papieru
Pozwala wyświetlić aktualnie zdefiniowany rozmiar i typ papieru oraz pozostały poziom papieru w poszczególnych jego
źródłach.
(
)
<Inf. o mater. ekspl.>
<Inform. o papierze>
Wybór źródło
papieru
Wybór źródła papieru
Wybierz źródło papieru, dla którego chcesz wyświetlić informacje.
Sprawdzanie modelu kasety z tonerem
Pozwala wyświetlić numer modelu kasety z tonerem do urządzenia.
(
)
<Inf. o mater. ekspl.>
<Model pojem. z ton.>
553
Wybierz kolor
Konserwacja urządzenia
Wybór koloru
Wybór koloru wyświetlania numeru modelu.
Sprawdzanie stanu zasobnika z tonerem
Wyświetla stan zasobnika z tonerem.
(
)
<Inf. o mater. ekspl.>
<Pozostało tonera>
● Wyświetlone wartości są jedynie wskazówką i mogą różnić się od stanu rzeczywistego.
Sprawdzanie modelu zespołu bębna
Można wyświetlić numer modelu zespołu bębna dla urządzenia.
(
)
<Inf. o mater. ekspl.>
<Model kasety bębna>
bębna
Wybór zespołu bębna
Wybierz zespół bębna, którego numer modelu chcesz wyświetlić.
Sprawdzanie stanu zespołu bębna
Wyświetla stan zespołu bębna.
554
Wybierz zespół
Konserwacja urządzenia
(
)
<Inf. o mater. ekspl.>
<Pozostało bębna>
● Wyświetlone wartości są jedynie wskazówką i mogą różnić się od stanu rzeczywistego.
Sprawdzanie numerów modelu zasobnika na zużyty toner
Wyświetlanie numeru modelu zasobnika na zużyty toner używanego w urządzeniu.
(
)
<Inf. o mater. ekspl.>
<Poj. na zużyty toner>
Sprawdzanie stanu zasobnika na zużyty toner
Wyświetlanie stanu zasobnika na zużyty toner używanego w urządzeniu.
(
)
<Inf. o mater. ekspl.>
<Stan zużytego tonera>
555
Konserwacja urządzenia
Inicjowanie ustawień
6869-06A
Istnieje możliwość przywrócenia następujących ustawień:
Inicjowanie menu(P. 557)
Resetowanie ustawień sieciowych(P. 558)
556
Konserwacja urządzenia
Inicjowanie menu
6869-06C
Istnieje możliwość przywrócenia domyślnych ustawień fabrycznych urządzenia (
Menu konfiguracji(P. 326) ).
Nie wolno naciskać głównego wyłącznika zasilania w trakcie inicjacji
● Wyłączenie urządzenia w trakcie jego inicjacji może doprowadzić do uszkodzenia.
Zdefiniowano kod PIN dostępu do Zdalnego interfejsu użytkownika
● W takim przypadku inicjowany jest również kod PIN dostępu zdalnego interfejsu użytkownika. Po
zakończeniu inicjacji należy ponownie ustawić kod PIN dostępu zdalnego interfejsu użytkownika.
Ustawiania kodu PIN Zdalnego interfejsu użytkownika(P. 232)
● W celu zresetowania ustawień sieciowych należy wykonać procedurę opisaną w części
ustawień sieciowych(P. 558) .
Resetowanie
● W celu zresetowania ustawień opcji <Dost. pozyc. wydruku> należy wykonać procedurę opisaną w części
Dost. pozyc. wydruku(P. 392) .
(
)
<Zainicjuj menu>
<Tak>
sprzętowy(P. 488) )
557
Wykonaj reset sprzętowy (
Reset
Konserwacja urządzenia
Resetowanie ustawień sieciowych
6869-06E
Istnieje możliwość przywrócenia domyślnych fabrycznych ustawień sieciowych (
Sieć(P. 347) ).
Nie wolno resetować ustawień sieciowych, gdy urządzenie jest w trakcie drukowania
lub odbierania danych drukowania
● Mogłoby to spowodować nieprawidłowe drukowanie, zakleszczenie papieru lub uszkodzenie urządzenia.
(
sieci>
)
<Sieć>
<Tak>
Sprawdź komunikat
<Inic. ustawień
Wykonaj reset sprzętowy (
Reset sprzętowy(P. 488) )
558
Dodatek
Dodatek
Dodatek ............................................................................................................................................................... 560
Oprogramowanie dostarczone przez strony trzecie ....................................................................................... 561
Wyróżnione funkcje .......................................................................................................................................... 562
Ekologia i niższe koszty ................................................................................................................................. 563
Większa wydajność ....................................................................................................................................... 564
Więcej funkcji dodatkowych .......................................................................................................................... 566
Dane techniczne ................................................................................................................................................ 568
Moduł główny ............................................................................................................................................... 569
Obsługiwane rodzaje papieru ....................................................................................................................... 571
Paper Feeder PF-G ........................................................................................................................................ 577
Cassette Feeding Unit-AU ............................................................................................................................. 578
Funkcje drukarki ........................................................................................................................................... 579
Funkcje zarządzania ..................................................................................................................................... 583
Środowisko systemowe ................................................................................................................................ 586
Środowisko sieciowe ..................................................................................................................................... 587
Materiały eksploatacyjne ................................................................................................................................. 588
Opcje .................................................................................................................................................................. 592
Wyposażenie opcjonalne .............................................................................................................................. 593
Opcje systemu .............................................................................................................................................. 594
Instalacja pamięci ROM ......................................................................................................................... 596
Instalacja karty pamięci SD .................................................................................................................... 600
Instrukcje obsługi i ich zawartość .................................................................................................................... 605
Korzystanie z programu Podręcznik użytkownika .......................................................................................... 606
Układ ekranu programu Podręcznik użytkownika ......................................................................................... 607
Przeglądanie programu Podręcznik użytkownika ......................................................................................... 610
Zarządzanie aplikacjami MEAP ......................................................................................................................... 612
Korzystanie z klientów FTP ............................................................................................................................... 613
Przygotowanie do korzystania z serwera FTP ............................................................................................... 614
Drukowanie za pośrednictwem klienta FTP (Wydruk z FTP) .......................................................................... 617
Definiowanie ustawień za pośrednictwem klienta FTP .................................................................................. 619
Inne .................................................................................................................................................................... 626
Podstawowe operacje systemu Windows ..................................................................................................... 627
Próbki czcionek ............................................................................................................................................. 636
Uwaga .......................................................................................................................................................... 641
559
Dodatek
Dodatek
6869-06F
Ten rozdział zawiera dane techniczne urządzenia, instrukcje dotyczące korzystania z programu Podręcznik
użytkownika, zrzeczenie odpowiedzialności, informacje o prawach autorskich oraz inne ważne dla klientów informacje.
560
Dodatek
Oprogramowanie dostarczone przez strony trzecie
6869-06H
Aby uzyskać informacje dotyczące oprogramowania dostarczonego przez strony trzecie, należy kliknąć ikonę lub ikony
pokazane poniżej.
561
Dodatek
Wyróżnione funkcje
6869-06J
Zachęcamy do wypróbowania funkcji opisanych w tej części. Funkcje te zostały pogrupowane według trzech kategorii:
„Ekologia i niższe koszty”, „Większa wydajność” i „Więcej funkcji dodatkowych”.
562
Dodatek
Ekologia i niższe koszty
6869-06K
Papier, toner, energię i pieniądze można oszczędzać na wiele sposobów.
Drukowanie dwustronne
Można drukować po obu stronach papieru. Drukowanie dwustronne pozwala oszczędzić papier zarówno w
przypadku drukowania dużych zadań drukowania, jak i zaledwie kilku stron. Aby zaoszczędzić jeszcze więcej
papieru, należy połączyć opcję drukowania dwustronnego z opcją drukowania N na 1 — drukowania wielu stron
na jednym arkuszu papieru. Można wydrukować maksymalnie 32 strony na pojedynczym arkuszu, co jest
oszczędnym i ekologicznym rozwiązaniem.
Drukowanie z komputera(P. 76)
Tryb uśpienia
Jeżeli urządzenie będzie bezczynne przez pewien czas, można zaoszczędzić energię poprzez włączenie trybu
uśpienia ręcznie lub automatycznie. Nie trzeba za każdym razem wyłączać zasilania, aby zminimalizować pobór
energii. Funkcja automatycznego wyłączenia umożliwia zwiększenie oszczędności poprzez automatyczne
wyłączanie urządzenia, jeżeli pozostaje ono bezczynne przez dłuższy czas. Dzięki tym wygodnym funkcjom,
które działają w tle, można oszczędzać energię i pieniądze każdego dnia.
Przechodzenie w tryb uśpienia(P. 68)
Ustawianie czasu automatycznego wyłączania(P. 71)
563
Dodatek
Większa wydajność
6869-06L
Oto kilka prostych operacji, które mogą usprawnić skomplikowane zadania.
Drukowanie bez programów aplikacji
Dane w formatach PDF/PS/EPS/JPEG/TIFF/XPS można wysyłać do urządzenia bezpośrednio ze Zdalnego
interfejsu użytkownika w celu wydrukowania. Można również drukować bez użycia komputera poprzez
podłączenie nośnika pamięci USB do urządzenia. Nie ma potrzeby otwierania plików, więc uruchamianie
programu aplikacji nie jest konieczne. Jest do bardzo wygodne rozwiązanie, gdy wydruki są potrzebne szybko, a
nie ma dostępu do komputera.
Drukowanie bez otwierania pliku (Wydruk bezpośredni)(P. 110)
Wydruk z urządzenia pamięci USB (Drukowanie bezpośrednio z USB)(P. 83)
Zdalne zarządzanie za pomocą Zdalnego interfejsu użytkownika
Zdalny interfejs użytkownika umożliwia zdalne zarządzanie urządzeniem z poziomu komputera. Można
sprawdzić stan papieru i zasobników z tonerem oraz sprawdzić aktualny stan zadań drukowania, aby
zadecydować, czy należy przerwać bieżące zadania, aby wydrukować bardziej pilne dokumenty lub przesunąć
dokumenty wyżej względem innych zadań oczekujących na wydrukowanie. Dzięki temu nie trzeba wstawać od
biurka i można zaoszczędzić czas.
Korzystanie ze Zdalnego interfejsu użytkownika(P. 299)
564
Dodatek
Oszczędność czasu dzięki skrótom
Gdy użytkownik ma do wydrukowania kilka dokumentów, wygodnie byłoby wydrukować je wszystkie
jednocześnie. [Canon PageComposer] umożliwia połączenie kilku dokumentów i wydrukowanie ich wszystkich
naraz. Można też zapisać często drukowane dokumenty, takie jak strona tytułowa faksu, na karcie pamięci SD
urządzenia, aby później drukować je bezpośrednio za pomocą panelu sterowania. Nie trzeba korzystać z
komputera i uruchamiać sterownika drukarki. Skróty te pozwalają zaoszczędzić czas i pracować wydajniej.
Drukowanie z komputera(P. 76)
Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)(P. 100)
Szybka zmiana ustawień drukowania dzięki intuicyjnej obsłudze
Dzięki podglądowi wydruku w sterowniku drukarki można w łatwy i intuicyjny sposób określić na przykład układ
strony czy krawędź bindowania lub przełączyć między drukowaniem jednostronnym i dwustronnym. Proste
kliknięcie pozwala w łatwy sposób zmieniać ustawienia podczas wyświetlania podglądu wydruku.
Drukowanie z komputera(P. 76)
565
Dodatek
Więcej funkcji dodatkowych
6869-06R
Różne opcje zaspokajają wszelkie potrzeby związane z pracą w domu, w biurze, a nawet w drodze.
Korzystanie ze smartfona/tabletu
W sytuacji, gdy trzeba szybko wydrukować ofertę przygotowaną na tablecie podczas podróży służbowej,
z pomocą przychodzi.
Bez potrzeby korzystania z komputera, szybko i łatwo! W obecnych czasach, gdy wszystko odbywa się tak
szybko, technologia ta oferuje nam jeszcze szerszy wachlarz możliwości w zakresie pracy czy zabawy.
Wygodna współpraca z urządzeniami przenośnymi(P. 132)
Prosty wydruk za pomocą technologii Google Cloud Print
Połącz się z technologią Google Cloud Print z laptopa lub telefonu, prześlij dane i już masz gotowe
wydrukowane dokumenty. Dzięki temu urządzeniu, technologii Google Cloud Print i przenośnemu urządzeniu
możesz drukować cokolwiek chcesz i gdziekolwiek chcesz.
Korzystanie z technologii Google Cloud Print(P. 144)
Zachowanie poufności wydruków
Zwykle w momencie drukowania dokumentów z komputera, wydruk natychmiast wychodzi z drukarki. Jednak w
przypadku dokumentacji zawierającej informacje poufne nie zawsze jest to wygodne. Wystarczy skorzystać z
opcji zabezpieczonego drukowania i nikt nie będzie mógł wydrukować danych dokumentów bez wprowadzenia
hasła na panelu operacyjnym urządzenia. Nie pozwól, aby dokumenty poufne leżały na podajniku dostępne dla
każdego.
566
Dodatek
Drukowanie dokumentu zabezpieczonego kodem PIN (Zabezpieczone drukowanie)(P. 95)
567
Dodatek
Dane techniczne
6869-06S
Dane techniczne mogą ulec zmianie bez powiadomienia w przypadku ulepszenia produktu lub udostępnienia nowej
wersji.
◼ Dane techniczne urządzenia
Moduł główny(P. 569)
Obsługiwane rodzaje papieru(P. 571)
◼ Dane techniczne wyposażenia dodatkowego
Paper Feeder PF-G(P. 577)
Cassette Feeding Unit-AU(P. 578)
◼ Specyfikacje funkcjonalne
Funkcje drukarki(P. 579)
Funkcje zarządzania(P. 583)
◼ Środowisko, w jakim należy korzystać z urządzenia
Środowisko systemowe(P. 586)
Środowisko sieciowe(P. 587)
568
Dodatek
Moduł główny
6869-06U
● Informacje dotyczące rozmiarów i typów papieru dla każdego źródła papieru znajdują się w sekcji „
Obsługiwane rodzaje papieru(P. 571) ”.
Typ
Pulpit
Obsługiwane kolory
Pełny Kolor
Rozdzielczość zapisu
600 x 600 pkt na cal
Liczba odcieni
256
Dopuszczalny stos papieru
Rozmiary papieru
● Maks.: 320,0 mm x 457,2 mm
● Maks. (szuflada na papier): 297,0 mm x 431,8 mm
● Min. (szuflada na papier): 148,0 mm x 148,0 mm
● Min. (taca wielofunkcyjna): 64,0 mm x 127,0 mm
Gramatura papieru
● Szuflada na papier: 60 g/m² do 256 g/m²*1
● Taca wielofunkcyjna: 60 g/m² do 300 g/m²
Rodzaj papieru
Czas rozgrzewania *2
Obsługiwane rodzaje papieru(P. 571)
Po włączeniu zasilania
34,0 sekund lub mniej
Powrót z trybu uśpienia
4,0 sekund lub mniej
Czas pierwszego drukowania
(A4)
Szybkość drukowania *3
(A4)
System podawania papieru/pojemność *4
● Pełne kolory: Ok. 7,4 sek.
● Czarno-biały: Ok. 6,7 sek.
● Pełne kolory: 36 arkuszy/minutę
● Czarno-biały: 36 arkuszy/minutę
Szuflada na papier
640 arkuszy (64 g/m²)/550 arkuszy (80 g/m²) x 1
Taca wielofunkcyjna
120 arkuszy (64 g/m²)/100 arkuszy (80 g/m²) x 1
569
Dodatek
System wyprowadzania papieru/pojemność *4 Taca wyprowadzania papieru
200 arkuszy (60 g/m² do 90 g/m²)
100 arkuszy (90 g/m² do 300 g/m²)
Źródła zasilania
AC 220 V - 240 V, 4,7 A, 50 Hz/60 Hz
Zużycie energii elektrycznej *2
Maksymalne zużycie energii
1 500 W lub mniej
W trybie uśpienia
Ok. 2,0 W
Przy wyłączonym głównym zasilaniu
0,1 W lub mniej
Wymiary
(szer. x głęb. x wys.)
556 mm x 608 mm x 403 mm
Ciężar
Moduł główny *5
Ok. 38,0 kg
Materiały eksploatacyjne
Materiały eksploatacyjne(P. 588)
Ilość miejsca wymaganego do instalacji
Zobacz rozdział „Pierwsze kroki”
Instrukcje obsługi i ich zawartość(P. 605)
Pojemność pamięci
Pamięć RAM: 1 GB
Warunki eksploatacji
Temperatura: 10°C do 30°C
Wilgotność: 20 % do 80 % wilgotności względnej (bez kondensacji)
*1W
przypadku ładowania papieru o długości 364,0 mm lub większej w orientacji poziomej gramatura papieru nie może
przekraczać 199 g/m².
*2Może
się różnić w zależności od środowiska pracy oraz warunków, w jakich urządzenie jest eksploatowane.
*3Prędkość
drukowania jest ustalana na podstawie testów wewnętrznych z wykorzystaniem papieru formatu A4, na
którym wykonywane są jednostronne wydruki przy współczynniku drukowania równym 100 % oryginału. W ramach
testów wewnętrznych w sposób ciągły wykonywane są wydruki tej samej strony z zawartością na papierze zwykłym.
Prędkość drukowania może się zmieniać zależnie od typu i formatu papieru oraz kierunku jego podawania.
Urządzenie może automatycznie wstrzymać lub zwolnić pracę w celu dostosowania do bieżącego stanu drukarki, np.
wyregulowania temperatury danego modułu lub zminimalizowania obniżenia jakości obrazów w przypadku ciągłego
drukowania.
*4Może
*5Bez
się różnić w zależności od środowiska instalacji i rodzaju papieru, który będzie używany.
uwzględnienia zasobników z tonerem i zespołów bębna.
570
Dodatek
Obsługiwane rodzaje papieru
6869-06W
◼ Obsługiwane formaty papieru
Poniżej wymieniono rozmiary papieru, które można załadować do szuflady na papier, na tacę wielofunkcyjną lub do
dodatkowych źródeł papieru.
: Dostępny
: Niedostępny
Format papieru
Szuflada na papier *1
Taca uniwersalna
Automatyczne drukowanie
2-stronne *2
A3
B4
A4
B5
A5
A6
Ledger (11x17)
Legal (LGL)
Letter (LTR)
*1W
*2
tym opcjonalny Paper Feeder PF-G/ Cassette Feeding Unit-AU.
Automatyczne 2-stronne drukowanie jest dostępne bez wymiany papieru.
*3Dostępne
są następujące formaty:
● W przypadku ładowania w orientacji pionowej (tylko gdy używany jest sterownik drukarki Canon Generic Plus UFR II):
szerokość 148,0 mm do 297,0 mm, długość 148,0 mm do 297,0 mm
● W przypadku ładowania w orientacji poziomej:
szerokość 148,0 mm do 297,0 mm, długość 148,0 mm do 431,8 mm
*4Dostępne
są następujące formaty:
● W przypadku ładowania w orientacji pionowej (tylko gdy używany jest sterownik drukarki Canon Generic Plus UFR II):
szerokość 120,0 mm do 320,0 mm, długość 120,0 mm do 320,0 mm
● W przypadku ładowania w orientacji poziomej:
szerokość 64,0 mm do 320,0 mm, długość 120,0 mm do 457,2 mm
szerokość 200,0 mm do 297,0 mm, długość 457,3 mm do 1200,0 mm (długi papier: tylko gdy używany jest sterownik drukarki Canon Generic
Plus UFR II)
*5Dostępne
są następujące formaty:
● szerokość 148,0 mm do 320,0 mm, długość 148,0 mm do 457,2 mm
571
Dodatek
Format papieru
Szuflada na papier *1
Taca uniwersalna
Automatyczne drukowanie
2-stronne *2
Statement (STMT)
Executive (EXEC)
Foolscap (FLSC)
305x457 mm
8K
16K
Karta katalogowa
Indian Legal (India-LGL)
Kartka pocztowa
Kartka pocztowa zwrotna
Kartka pocztowa 4 na 1
Koperta NAGAGATA 3
Koperta KAKUGATA 2
Koperta YOUGATANAGA 3 (Younaga 3)
Koperta nr 10 (COM10)
*1W
*2
tym opcjonalny Paper Feeder PF-G/ Cassette Feeding Unit-AU.
Automatyczne 2-stronne drukowanie jest dostępne bez wymiany papieru.
*3Dostępne
są następujące formaty:
● W przypadku ładowania w orientacji pionowej (tylko gdy używany jest sterownik drukarki Canon Generic Plus UFR II):
szerokość 148,0 mm do 297,0 mm, długość 148,0 mm do 297,0 mm
● W przypadku ładowania w orientacji poziomej:
szerokość 148,0 mm do 297,0 mm, długość 148,0 mm do 431,8 mm
*4Dostępne
są następujące formaty:
● W przypadku ładowania w orientacji pionowej (tylko gdy używany jest sterownik drukarki Canon Generic Plus UFR II):
szerokość 120,0 mm do 320,0 mm, długość 120,0 mm do 320,0 mm
● W przypadku ładowania w orientacji poziomej:
szerokość 64,0 mm do 320,0 mm, długość 120,0 mm do 457,2 mm
szerokość 200,0 mm do 297,0 mm, długość 457,3 mm do 1200,0 mm (długi papier: tylko gdy używany jest sterownik drukarki Canon Generic
Plus UFR II)
*5Dostępne
są następujące formaty:
● szerokość 148,0 mm do 320,0 mm, długość 148,0 mm do 457,2 mm
572
Dodatek
Format papieru
Szuflada na papier *1
Taca uniwersalna
Automatyczne drukowanie
2-stronne *2
Koperta Monarch
Koperta C5 (ISO-C5)
Koperta DL
Niestandardowy format papieru
*1W
*2
*3
*4
*5
tym opcjonalny Paper Feeder PF-G/ Cassette Feeding Unit-AU.
Automatyczne 2-stronne drukowanie jest dostępne bez wymiany papieru.
*3Dostępne
są następujące formaty:
● W przypadku ładowania w orientacji pionowej (tylko gdy używany jest sterownik drukarki Canon Generic Plus UFR II):
szerokość 148,0 mm do 297,0 mm, długość 148,0 mm do 297,0 mm
● W przypadku ładowania w orientacji poziomej:
szerokość 148,0 mm do 297,0 mm, długość 148,0 mm do 431,8 mm
*4Dostępne
są następujące formaty:
● W przypadku ładowania w orientacji pionowej (tylko gdy używany jest sterownik drukarki Canon Generic Plus UFR II):
szerokość 120,0 mm do 320,0 mm, długość 120,0 mm do 320,0 mm
● W przypadku ładowania w orientacji poziomej:
szerokość 64,0 mm do 320,0 mm, długość 120,0 mm do 457,2 mm
szerokość 200,0 mm do 297,0 mm, długość 457,3 mm do 1200,0 mm (długi papier: tylko gdy używany jest sterownik drukarki Canon Generic
Plus UFR II)
*5Dostępne
są następujące formaty:
● szerokość 148,0 mm do 320,0 mm, długość 148,0 mm do 457,2 mm
● W zależności od sterownika drukarki niektóre formaty papieru mogą nie być wyświetlane. Jeśli rozmiar
papieru, którego chcesz użyć, nie jest wyświetlany, pobierz odpowiedni sterownik drukarki ze strony
internetowej firmy Canon. Jeśli masz problemy z pobraniem sterownika, skontaktuj się z lokalnym
autoryzowanym sprzedawcą produktów firmy Canon lub z działem telefonicznej pomocy technicznej firmy
Canon.
◼ Obsługiwane typy papieru
W urządzeniu można używać papieru bezchlorowego.
● Jakość druku może ulec pogorszeniu w zależności od rodzaju używanego papieru.
: Dostępne
: Niedostępne
573
Dodatek
Typ papieru
Szuflada na papier *1 Taca wielofunkcyjna Automatyczne drukowanie
dwustronne *2
Zwykły L2
60 g/m²
Zwykły L *3
60 g/m² do 74 g/m²
Zwykły *3
75 g/m² do 90 g/m²
Gruby 1
91 g/m² do 120 g/m²
Gruby 2
121 g/m² do 163 g/m²
Gruby 3
164 g/m² do 220 g/m²
*4
Gruby 4
221 g/m² do 256 g/m²
*4
Gruby 5
257 g/m² do 300 g/m²
Powlekany 1
100 g/m² do 130 g/m²
Powlekany 2
131 g/m² do 160 g/m²
Powlekany 3
161 g/m² do 220 g/m²
Szorstki 1
60 g/m² do 74 g/m²
Szorstki 2
75 g/m² do 103 g/m²
Etykiety
Kartka pocztowa *5
Koperta
*1W
*2
tym opcjonalny Paper Feeder PF-G/ Cassette Feeding Unit-AU.
Automatyczne 2-stronne drukowanie jest dostępne bez wymiany papieru.
*3Dostępny
*4W
jest też papier z makulatury.
przypadku ładowania papieru o długości 364,0 mm lub większej w orientacji poziomej gramatura papieru nie może przekraczać 199 g/m².
*5Nie
można skorzystać z kartki pocztowej do wydruku przy użyciu drukarki atramentowej ani kartki pocztowej zwrotnej.
◼ Rodzaje papieru, których można używać z funkcją Optymalizacja drukowania reklam
Kiedy funkcja [Optymalizacja drukowania reklam] jest skonfigurowana w sterowniku drukarki, można używać
następujących rodzajów papieru.
574
Dodatek
● Aby uzyskać więcej informacji na temat funkcji [Optymalizacja drukowania reklam], zapoznaj się z
instrukcjami obsługi odpowiednich sterowników na stronie internetowej z podręcznikami online.
● Kiedy skonfigurowana jest funkcja [Optymalizacja drukowania reklam], nie można używać drukowania
dwustronnego.
● Można używać papieru w rozmiarach, które można określić jako rozmiar niestandardowy. Jednak jakość
druku może ulec pogorszeniu w przypadku stosowania papieru o szerokości 199,0 mm lub mniejszej bądź
298,0 mm lub większej. Zaleca się stosowanie papieru o szerokości od 200,0 mm do 297,0 mm.
: Dostępne
: Niedostępne
Rodzaj papieru *1*2
Gramatura papieru Prędkość drukow. POP *3
<Tryb 1>
Zwykły
75 g/m² do 90 g/m²
*4
Gruby 1
91 g/m² do 120 g/m²
*4
Gruby 2
121 g/m² do 128 g/m²
*4
129 g/m² do 163 g/m²
*5
Powlekany 1
100 g/m² do 130 g/m²
*6
Powlekany 2
131 g/m² do 160 g/m²
*6
<Tryb 2>
*1W przypadku skonfigurowania funkcji [Optymalizacja drukowania reklam] należy określić rodzaj papieru, która ma być
używany.
*2W
przypadku wykrycia nieobsługiwanego typu papieru wyświetlany jest komunikat o błędzie. Należy wymienić go na
obsługiwany rodzaj papieru, a następnie wykonać drukowanie.
*3Szczegółowe informacje na temat zmiany ustawień oraz powiązanych tematów można znaleźć w sekcji
drukow. POP(P. 412) .
*4Jakość
druku może ulec pogorszeniu w zależności od warunków eksploatacji. Jeżeli jakość wydruku jest
niezadowalająca, zaleca się wybranie ustawienia <Tryb 2>.
*5Jakość
druku może ulec pogorszeniu bez względu na warunki eksploatacji.
*6Nawet
gdy wybrano ustawienie <Tryb 1>, drukowanie jest wykonywane tak jak w przypadku <Tryb 2>.
◼ Typ papieru i ustawienia urządzenia
Ładowanie papieru(P. 41)
◼ Obszar wydruku
Zacieniowany obszar na poniższym rysunku oznacza obszar wydruku.
575
Prędkość
Dodatek
● Dla koperty NAGAGATA 3 i koperty YOUGATANAGA 3, górny i dolny margines
wynosi 10 mm, natomiast lewy i prawy margines wynosi 5 mm. W przypadku
wszystkich pozostałych kopert górny, dolny, lewy i prawy margines wynoszą
10 mm.
● W przypadku papieru o szerokości 312 mm lub większej, lewy i prawy
margines wynosi 5 mm lub więcej.
576
Dodatek
Paper Feeder PF-G
6869-06X
Rozmiary papieru
● Maks.: 297,0 mm x 431,8 mm
● Min.: 148,0 mm x 148,0 mm
Gramatura papieru
60 g/m² do 256 g/m²
Pojemność szuflad na papier * 640 arkuszy (64 g/m²)/550 arkuszy (80 g/m²) x 1
Wymiary
556 mm x 585 mm x 125 mm
(szer. x głęb. x wys.)
Ciężar
Ok. 10,0 kg
*
Może się różnić w zależności od środowiska instalacji i rodzaju papieru, który będzie używany.
577
Dodatek
Cassette Feeding Unit-AU
6869-06Y
Rozmiary papieru
● Maks.: 297,0 mm x 431,8 mm
● Min.: 148,0 mm x 148,0 mm
Gramatura papieru
60 g/m² do 256 g/m²
Pojemność szuflad na papier * 640 arkuszy (64 g/m²)/550 arkuszy (80 g/m²) x 2
Wymiary
641 mm x 717 mm x 325 mm
(szer. x głęb. x wys.)
Ciężar
Ok. 23,0 kg
*
Może się różnić w zależności od środowiska instalacji i rodzaju papieru, który będzie używany.
578
Dodatek
Funkcje drukarki
6869-070
◼ Funkcja drukarki UFR II
Typ
Rozmiar wydruku
Prędkość drukowania
Wewnętrzny
Obsługiwane rodzaje papieru(P. 571)
Taka sama, jak w wierszu „Prędkość drukowania” w sekcji „Jednostka główna”
Moduł główny(P. 569)
Rozdzielczość
Przetwarzanie danych
600 x 600 pkt na cal
Język opisu strony (PDL)
UFR II
Obsługiwany protokół
TCP/IP i SMB (z zainstalowaną kartą pamięci SD)
Czcionki rezydentne
Brak
Interfejs
USB
USB 2.0 Hi-Speed
Przewodowa sieć LAN
10Base-T, 100Base-TX, 1000Base-T (zgodność z IEEE 802.3)
◼ Funkcja drukarki PS
Typ
Rozmiar wydruku
Prędkość drukowania
Wewnętrzny
Obsługiwane rodzaje papieru(P. 571)
Taka sama, jak w wierszu „Prędkość drukowania” w sekcji „Jednostka główna”
Moduł główny(P. 569)
Rozdzielczość
Przetwarzanie danych
600 x 600 pkt na cal
Język opisu strony (PDL)
Adobe®PostScript®3TM
(*Oryginalny język Adobe PostScript. Obsługiwana wersja to 3018)
579
Dodatek
Obsługiwany protokół
TCP/IP i SMB (z zainstalowaną kartą pamięci SD)
Czcionki rezydentne
136 Roman
Interfejs
USB
USB 2.0 Hi-Speed
Przewodowa sieć LAN
10Base-T, 100Base-TX, 1000Base-T (zgodność z IEEE 802.3)
◼ Funkcja drukarki PCL
Typ
Wewnętrzny
Rozmiar wydruku
Obsługiwane rodzaje papieru(P. 571)
Prędkość drukowania
Taka sama, jak w wierszu „Prędkość drukowania” w sekcji „Jednostka główna”
Moduł główny(P. 569)
Rozdzielczość
Przetwarzanie danych
600 x 600 pkt na cal
Język opisu strony (PDL)
PCL6, PCL5
Obsługiwany protokół
TCP/IP i SMB (z zainstalowaną kartą pamięci SD)
Czcionki rezydentne
93 czcionki łacińskie, 10 czcionek bitmapowych, 2 czcionki OCR, Andalé Mono WT, J/K/S/
T*1 (japoński, koreański, chiński uproszczony i tradycyjny), czcionki kodów kreskowych*2
Interfejs
USB
USB 2.0 Hi-Speed
Przewodowa sieć LAN
10Base-T, 100Base-TX, 1000Base-T (zgodność z IEEE 802.3)
*1Wymagany
jest opcjonalny moduł PCL International Font Set
*2Wymagany
jest opcjonalny moduł Zestaw drukowania kodów kreskowych
◼ Funkcja drukowania bezpośredniego z USB
Formaty plików do druku
● PDF (wersja 1.7)
● JPEG
● TIFF
● XPS
580
Dodatek
◼ Funkcja drukowania zadań przechowywanych
● W urządzeniu można przechowywać do 1000 dokumentów (łącznie 3 GB).
◼ Funkcja drukowania bezpośredniego
Formaty drukowanych plików *1 ● PDF (wersja 1.7)*2
● PS
● EPS
● JPEG
● TIFF
● XPS
*1W
zależności od danych wykonanie drukowania może być niemożliwe.
*2Urządzenie
obsługuje algorytm 128-bitowego szyfrowania RC4 / 128-bitowego szyfrowania AES / 256-bitowego
szyfrowania AES.
Maksymalny rozmiar pliku, który można wydrukować, podano poniżej.
● Pliki PDF/XPS (z zainstalowaną kartą pamięci SD)
: 2 GB
(bez zainstalowanej karty pamięci SD) : 20 MB
● Pliki JPEG
(z zainstalowaną kartą pamięci SD)
: 2 GB
(bez zainstalowanej karty pamięci SD) : 2 GB
● Pliki TIFF*1
(z zainstalowaną kartą pamięci SD)
: 2 GB
(bez zainstalowanej karty pamięci SD) : 2 GB
*1Nawet
jeśli wielkość plików TIFF nie przekracza górnego limitu rozmiaru, mogą one nie być drukowane zależnie od
struktury pliku. W takiej sytuacji należy wybrać dla opcji <TIFF Spooler> ustawienie <Włącz> i spróbować wydrukować
ponownie. TIFF Spooler(P. 433)
◼ Funkcja drukowania wiadomości e-mail
Drukowanie wiadomości e-mail: przedstawienie w skrócie
Ogólne
● Wiadomości e-mail są drukowane razem z informacjami z nagłówka.
● Wiadomości e-mail w formacie HTML są drukowane jako zwykły tekst.
● Jeśli linia (bez znaku nowego wiersza) w wiadomości e-mail zawiera ponad 1000 znaków, znaki
przekraczające tę wartość są umieszczane w nowej linii i mogą nie być drukowane poprawnie.
Gdy dla opcji <TIFF Spooler> wybrano ustawienie <Włącz>
● Jeśli rozmiar wiadomości e-mail przekracza 25 MB lub rozmiar pliku e-mail przekracza 1,5 GB, wiadomość email nie jest drukowana.
● Jeśli rozmiar danych z nagłówka wiadomości e-mail przekracza 20 KB, dane stanowiące nadmiarową ilość
nie są drukowane.
● Jeśli nie zainstalowano karty pamięci SD, pliki TIFF, których rozmiar przekracza 40 MB, mogą nie być
drukowane.
581
Dodatek
● Jeżeli na karcie pamięci SD nie ma wystarczającej ilości wolnego miejsca, funkcja drukowania wiadomości email nie jest dostępna.
● Gdy zasobnik z tonerem jest prawie pusty, nie można odbierać wiadomości e-mail.
Obsługiwane formaty kodowania
● 7-bitowy
● 8-bitowy
● binarny
● uuencode
● x-uuencode
● base64
● quoted-printable
Obsługiwane zestawy znaków *
● us-ascii
● iso-8859-1
● iso-8859-15
Drukowane formaty dołączonych plików obrazów ● JPEG
● TIFF
*W
przypadku niepodania zestawu znaków stosowany jest zestaw US-ASCII.
Dołączone pliki obrazów
● Niektóre pliki są niedostępne zależnie od ich struktury.
● Dla każdej wiadomości e-mail można wydrukować maksymalnie trzy dołączone do niej pliki. (Jeśli plików jest
więcej, pozostałe nie są drukowane).
● Jeżeli zainstalowano kartę pamięci SD, rozmiar jednego pliku, który można wydrukować, wykosi maks.
100 MB.
582
Dodatek
Funkcje zarządzania
6869-071
◼ Ustawienia zapory
● Dla protokołu IPv4 i IPv6 można określić maksymalnie 16 adresów IP (lub zakresów adresów IP).
● Można określić do 16 adresów MAC.
◼ Rejestracja kluczy i certyfikatów
● Instalując klucz lub certyfikat CA z komputera, należy dopilnować, aby instalowane elementy spełniały następujące
wymagania:
Format
Rozszerzenie pliku
Algorytm klucza publicznego
(i długość klucza)
● Certyfikat CA: X.509 DER/PEM
● Klucz: „.p12” lub „.pfx”
● Certyfikat CA: „.cer” lub „.pem”
● RSA (512 bitów, 1024 bity, 2048 bitów, 4096 bitów)
● DSA (1024 bity, 2048 bitów, 3072 bity)
● ECDSA (P256, P384, P521)
● RSA: SHA-1, SHA-256, SHA-384*, SHA-512*, MD2, MD5
Algorytm podpisu certyfikatu
● DSA: SHA-1
● ECDSA: SHA-1, SHA-256, SHA-384, SHA-512
*
Algorytmy SHA384-RSA i SHA512-RSA są dostępne tylko w przypadku, gdy długość klucza RSA wynosi co najmniej 1024
bity.
● Urządzenie nie korzysta z listy odwołania certyfikatu (CRL).
◼ Maksymalna liczba rejestrów zadania, które można wyświetlić
[Drukuj zadanie/Bezpośredni wydruk] Wyświetlanych jest do 200 dokumentów wydrukowanych z komputerów i
urządzeń pamięci USB.
[Przechowywane zadanie]
Wyświetlana historia dotyczy maksymalnie 200 wydrukowanych dokumentów
przechowywanych w pamięci urządzenia (tylko gdy zainstalowano kartę
pamięci SD).
[Raport]
Wyświetlana historia dotyczy maksymalnie 16 dokumentów wydrukowanych
jako listy ustawień i raporty (maksymalnie 128 dokumentów, gdy
zainstalowano kartę pamięci SD).
[Wydruk E-Mail]
Wyświetlana historia dotyczy maksymalnie 16 wiadomości e-mail
wydrukowanych po odebraniu (maksymalnie 128 dokumentów, gdy
zainstalowano kartę pamięci SD).
583
Dodatek
◼ Kody błędów odbioru wiadomości
Poniżej znajdują się szczegółowe informacje na temat kodów błędów.
Kod błędu
Przyczyna
Działanie
Połączenie z serwerem poczty
POP3 zostało rozłączone.
407
Dane o rozmiarze 1 KB
(1024 bajtów) mogą nie zostać
odebrane w ciągu 10 minut od
rozpoczęcia odbierania.
● Skonsultuj się z administratorem sieci.
● Jeśli błąd występuje często z danymi wiadomości e-mail
tego samego typu, sprawdź, czy dane wiadomości email są poprawne.
408
Serwer poczty POP3 zwrócił
odpowiedź „ERR”.
412
Dane o rozmiarze 1 KB
(1024 bajtów) mogą nie zostać
odebrane w ciągu 10 minut od
rozpoczęcia odbierania.
420
Jeśli w urządzeniu zainstalowano kartę pamięci SD, rozmiar
Rozmiar danych wiadomości edanych wiadomości e-mail do wysłania musi wynosić co
mail przekracza 1,5 GB.
najwyżej 1,5 GB.
421
Rozmiar wiadomości e-mail
przekracza 25 MB.
Jeśli w urządzeniu zainstalowano kartę pamięci SD, rozmiar
wiadomości w pliku e-mail do wysłania musi wynosić co
najwyżej 25 MB.
422
Rozmiar dołączonego pliku
przekracza 100 MB.
Jeśli w urządzeniu zainstalowano kartę pamięci SD, rozmiar
każdego z załączonych plików musi wynosić co najwyżej
100 MB.
423
Odebrany dołączony plik ma
nieobsługiwany format.
Dołączone pliki muszą mieć format JPEG lub TIFF. Nie
dołączaj plików w innych formatach do wiadomości e-mail
do wysłania.
424
Dołączono więcej niż trzy pliki.
Jeśli plików jest więcej, pozostałe nie są drukowane.
430
Nadawca odebranej
wiadomości e-mail jest
nieznany.
Przed wysłaniem wiadomości e-mail upewnij się, że
określono nadawcę.
Skonsultuj się z administratorem sieci.
● Skonsultuj się z administratorem sieci.
● Jeśli błąd występuje często z danymi wiadomości e-mail
tego samego typu, sprawdź, czy dane wiadomości email są poprawne.
Aby uniknąć wysyłania podzielonych wiadomości e-mail,
stosuj się do poniższych wskazówek.
● Zmniejsz rozmiar wiadomości e-mail do wysłania.
(Zmniejsz rozmiar wiadomości e-mail tak, aby był
mniejszy niż rozmiar tej wysyłanej jako podzielona).
Odebrano podzieloną
wiadomość e-mail.
● Przed wysłaniem skonfiguruj aplikację tak, aby nie
zezwalała na dzielenie wiadomości e-mail.
431
Odebrana wiadomość e-mail
zawiera nieobsługiwane
kodowanie lub kody znaków.
Aby wiadomość e-mail została wysłana, zastosuj kodowanie
i kody znaków obsługiwane przez urządzenie.
Drukowanie wiadomości e-mail: przedstawienie w
skrócie(P. 581)
Odebrana wiadomość e-mail
ma nieobsługiwany format.
Sprawdź format wiadomości e-mail. Zaleca się wysyłanie
wiadomości e-mail w formacie tekstowym.
432
Odebrane dane są
nieprawidłowe.
Sprawdź, czy dane wysłanej wiadomości e-mail są
poprawne.
433
Odebrana wiadomość e-mail
ma format HTML.
Urządzenie nie obsługuje wiadomości e-mail w formacie
HTML. (Wiadomości e-mail w formacie HTML są drukowane
jako zwykły tekst).
584
Dodatek
434
W pliku e-mail nie ma
wiadomości.
Odebrany plik e-mail nie zawiera żadnej wiadomości.
435
Przekazany faks jest
niedozwolony.
Dołączony dokument ma format inny niż TIFF lub jego
wielkość przekracza rozmiar pliku, który można
wydrukować.
436
Do przekazanego faksu nie
dołączono pliku.
Żaden dokument nie jest drukowany, ponieważ nie
dołączono pliku.
440
Drukowanie zostało z jakiegoś
powodu anulowane.
Wyślij wiadomość e-mail ponownie.
441
Wystąpił błąd podczas
przetwarzania.
Wyślij wiadomość e-mail ponownie.
499
Wystąpił błąd dotyczący
urządzenia.
Wykonaj odpowiednie czynności zgodnie z treścią
komunikatu widocznego na wyświetlaczu urządzenia.
Więcej informacji znajduje się na stronie internetowej
podręcznika w sekcji „Rozwiązywanie problemów (FAQ)”.
● Jeśli wystąpi kilka błędów, wyświetlany jest kod błędu o niższym numerze.
● Kody błędów można też sprawdzić na liście historii odbierania wiadomości e-mail.
RX(P. 543)
585
Lista rejestru e-mail
Dodatek
Środowisko systemowe
6869-072
Wymagania systemowe dla Zdalnego interfejsu użytkownika *1 Windows
● Windows Vista/7/8/10: Internet Explorer 7.0 lub nowsza
Wymagania systemowe dla Podręcznik użytkownika
Windows
● Internet Explorer 9 lub nowszy
● Microsoft Edge
● Firefox
● Firefox ESR
● Chrome*2
macOS
● Safari
● Firefox
● Chrome*2
Linux
● Firefox
iOS
● Safari*2
Android
● Chrome*2
*1Przed
zmianą ustawień urządzenia należy ustawić przeglądarkę internetową tak, aby włączyć obsługę wszystkich
plików cookie i języka JavaScript.
*2Tylko
podczas przeglądania podręcznika w internecie.
586
Dodatek
Środowisko sieciowe
6869-073
◼ Dane techniczne sieci
Interfejs
10BASE-T/100BASE-TX/1000BASE-T (RJ-45)
Obsługiwany protokół
Protokoły połączeń
● TCP/IP (Rodzaj ramki: Ethernet II)
Aplikacje do drukowania
● LPD
● Raw
● IPP
● IPPS
● WSD
● Mopria
● Google Cloud Print
● AirPrint
● Windows 10 Mobile Print
587
Dodatek
Materiały eksploatacyjne
6869-074
Ta część zawiera opis materiałów eksploatacyjnych do urządzenia i przybliżoną
częstotliwość ich wymiany. W celu dokonania zakupu materiałów eksploatacyjnych
należy skontaktować się z lokalnym autoryzowanym sprzedawcą produktów firmy
Canon. Podczas użytkowania i przechowywania materiałów eksploatacyjnych (
Materiały eksploatacyjne(P. 10) ) należy przestrzegać zasad higieny i bezpieczeństwa
pracy. Dla uzyskania optymalnej jakości wydruku zalecamy stosowanie oryginalnych
pojemników z tonerem firmy Canon oraz oryginalnych części firmy Canon.
● W zależności od środowiska instalacyjnego, rozmiaru papieru albo rodzaju dokumentów może zaistnieć
konieczność wymiany materiału eksploatacyjnego przed upływem szacowanego terminu ważności.
◼ Zasobniki z tonerem
Dołączone zasobniki z tonerem
Poniżej przedstawiono średnią wydajność i wagę zasobników z tonerem dołączonych do urządzenia.
Canon Toner Cartridge 059
● Czarny
- Średnia wydajność* zasobnika z tonerem
7000 arkuszy
- Masa
Około 1,1 kg
● Y (żółty), M (amarantowy) i C (cyjanowy):
- Średnia wydajność* zasobnika z tonerem
5 000 arkuszy
- Masa
Około 1,0 kg
Canon Toner Cartridge 059 H
● Czarny
- Średnia wydajność* zasobnika z tonerem
15 500 arkuszy
- Masa
Około 1,2 kg
● Y (żółty), M (amarantowy) i C (cyjanowy):
- Średnia wydajność* zasobnika z tonerem
588
Dodatek
13 500 arkuszy
- Masa
Około 1,1 kg
*Średnia
liczba drukowanych arkuszy została określona na podstawie normy ISO/IEC 19798 (międzynarodowa norma
dotycząca „sposobu określenia wydajności kasety z tonerem w monochromatycznych elektrofotograficznych drukarkach
i urządzeniach wielofunkcyjnych zawierających moduł drukowania” opracowana przez organizację ISO (International
Organization for Standardization — Międzynarodowa Organizacja Standaryzacyjna)) podczas drukowania na papierze
formatu A4 i z domyślnym poziomem zabarwienia wydruku.
*Rodzaj dostarczanych tonerów różni się w zależności od kraju i regionu. W celu uzyskania szczegółowych informacji,
prosimy o kontakt z dealerem, u którego zakupiono produkt.
Wymiana zasobników z tonerem
Dla uzyskania optymalnej jakości wydruku zaleca się użycie oryginalnej kasety z tonerem firmy Canon.
Oryginalny zasobnik z tonerem firmy Canon
Średnia wydajność * i ciężar
Średnia wydajność zasobnika z tonerem
7000 arkuszy
Canon Toner Cartridge 059 Black (czarny)
Ciężar
Ok. 1,1 kg
Średnia wydajność zasobnika z tonerem
Canon Toner Cartridge 059 Yellow (żółty)
Canon Toner Cartridge 059 Magenta (amarantowy)
Canon Toner Cartridge 059 Cyan (cyjanowy)
5 000 arkuszy
Ciężar
Ok. 1,0 kg
Średnia wydajność zasobnika z tonerem
15 500 arkuszy
Canon Toner Cartridge 059 H Black (czarny)
Ciężar
Ok. 1,2 kg
Średnia wydajność zasobnika z tonerem
13 500 arkuszy
Canon Toner Cartridge 059 H Yellow (żółty)
Canon Toner Cartridge 059 H Magenta (amarantowy)
Ciężar
Canon Toner Cartridge 059 H Cyan (cyjanowy)
Ok. 1,1 kg
● Wymiana zasobników z tonerem
Sposób wymiany zasobników z tonerem(P. 517)
589
Dodatek
◼ Zespół bębna
Zespoły bębna w zestawie z urządzeniem
Poniżej przedstawiono średnią wydajność i wagę zespołów bębna dołączonych do urządzenia.
● Średnia wydajność zespołu bębna*
70 000 arkuszy
● Masa
Około 0,6 kg
*
Średnia wydajność została obliczona na podstawie naszych kryteriów oceny w przypadku drukowania na zwykłym
papierze formatu A4 w ostępach 3 arkuszy (przerwy w drukowaniu co 3 arkusze).
Zamienne zespoły bębna
W celu uzyskania optymalnej jakości drukowania zaleca się korzystanie z oryginalnych zespołów bębna firmy
Canon.
Oryginalny zespół bębna firmy Canon
Średnia wydajność * i ciężar
Średnia wydajność zespołu bębna
70 000 arkuszy
Canon Drum Cartridge 053
Ciężar
Ok. 0,6 kg
● Wymiana zespołów bębna
Wymiana zespołów bębna(P. 524) .
◼ Waste Toner Box WT-C1
Średnia liczba stron, które można zadrukować przy użyciu jednego pojemnika na zużyty toner, wynosi około
100 000 (w przypadku zwykłego papieru formatu A4).
590
Dodatek
● W przypadku wymiany zasobnika na zużyty toner
toner(P. 527)
591
Sposób wymiany zasobnika na zużyty
Dodatek
Opcje
6869-075
Instalacja elementów opcjonalnych na urządzeniu umożliwia korzystanie z większej liczby funkcji.
◼ Dostępne rodzaje opcji
Wyposażenie opcjonalne(P. 593)
◼ Wyposażenie opcjonalne według zastosowania
Dodanie szuflady na papier
Paper Feeder PF-G(P. 577)
Cassette Feeding Unit-AU(P. 593)
592
Dodatek
Wyposażenie opcjonalne
6869-076
Funkcje urządzenia można w pełni wykorzystać, instalując opcjonalne wyposażenie wymienione poniżej. Opcjonalne
wyposażenie można zakupić w tym samym sklepie, w którym zakupiono urządzenie, lub u sprzedawcy produktów
firmy Canon.
Paper Feeder PF-G
Korzystanie z opcjonalnego podajnika papieru pozwala na załadowanie papieru o
innym formacie niż ten, który można załadować do standardowej szuflady na
papier, co skraca czas i zmniejsza wysiłek związany ze zmianą formatu papieru.
● W urządzeniu można zainstalować do trzech podajników papieru. Jednak w przypadku korzystania z
opcjonalnego podajnika Cassette Feeding Unit maksymalna liczba zainstalowanych podajników wynosi dwa.
Sposób instalacji
Patrz „Pierwsze kroki”.
Cassette Feeding Unit-AU
Korzystanie z opcjonalnego podajnika Cassette Feeding Unit pozwala na
załadowanie papieru o innym formacie niż ten, który można załadować do
standardowej szuflady na papier, co skraca czas i zmniejsza wysiłek związany ze
zmianą formatu papieru.
Sposób instalacji
Patrz „Pierwsze kroki”.
593
Dodatek
Opcje systemu
6869-077
Funkcje urządzenia można w pełni wykorzystać, instalując opcjonalne wyposażenie wymienione poniżej. Opcjonalne
wyposażenie można zakupić w tym samym sklepie, w którym zakupiono urządzenie, lub u sprzedawcy produktów
firmy Canon.
Zestaw drukowania kodów kreskowych(P. 594)
PCL International Font Set(P. 594)
KARTA SD(P. 595)
Zestaw drukowania kodów kreskowych
Jeśli w urządzeniu zainstalowano moduł Zestaw drukowania kodów kreskowych, dostępny jest tryb
drukowania kodów kreskowych, który umożliwia wydruk kodów kreskowych za pomocą
komputera.
Moduł Zestaw drukowania kodów kreskowych zawiera następujące czcionki kodu kreskowego.
● OCR-B
● Symb. FontInform
● Symbole stethos
● BarDIMM ©1997
● USPS ZEBRA+4Stat
Ta opcja pozwala tworzyć kody kreskowe w różnych formatach. Należy pamiętać, że w celu
drukowania kodów kreskowych należy włączyć obsługę języka PCL. Szczegółowe informacje o
używaniu zestawu Zestaw drukowania kodów kreskowych znajdują się w instrukcji Barcode
Printing Guide (Podręcznik drukowania kodów kreskowych) (instrukcja w formacie PDF).
Metoda instalacji
Instalacja pamięci ROM(P. 596)
PCL International Font Set
Gdy w urządzeniu zainstalowano moduł PCL International Font Set, do drukarki PCL zostają
dodane wymienione poniżej czcionki. Dzięki temu można drukować w wielu językach w
środowisku SAP Unicode.
● Andale® i WorldType® Collection J (wersja japońska)
● Andale® i WorldType® Collection K (wersja koreańska)
● Andale® i WorldType® Collection S (wersja chińska uproszczona)
● Andale® i WorldType® Collection T (wersja chińska tradycyjna)
Aby zapewnić obsługę różnic w wyglądzie znaków zależnych od regionu, dostępne są cztery wersje
czcionek.
Metoda instalacji
Instalacja pamięci ROM(P. 596)
594
Dodatek
KARTA SD
Aby korzystać z opisanych poniżej funkcji, można zainstalować kartę pamięci SD.
● Drukowanie zabezpieczone
Drukowanie dokumentu zabezpieczonego kodem PIN (Zabezpieczone drukowanie)
(P. 95)
● Wydruk zapisanych zadań
Drukowanie dokumentu zapisanego w urządzeniu (Drukowanie zapisanego zadania)
(P. 100)
● Przerwij drukowanie, Priorytet drukowania, Wstrzymaj/Przywróć
Sprawdzanie bieżącego stanu drukowanych dokumentów(P. 309)
● Drukowanie SMB
Konfiguracja protokołu SMB(P. 209)
● Bufor wydruku
Bufor wydruku(P. 362)
Metoda instalacji
Instalacja karty pamięci SD(P. 600)
● W przypadku pozbywania się używanej karty pamięci SD, należy wykonać w odniesieniu do niej operację
<Pełne usuw. danych> lub ją zniszczyć, aby zapobiec wyciekowi danych osobowych. Instalacja karty
pamięci SD(P. 600)
595
Dodatek
Instalacja pamięci ROM
6869-078
W tej części opisano, w jaki sposób zainstalować
dodatkową pamięć ROM w urządzeniu. Pamięć ROM
podłącza się do złączy ROM wewnątrz obudowy z tyłu
urządzenia. Przed zainstalowaniem pamięci ROM, należy
się zapoznać ze środkami ostrożności wskazanymi w
części Instalacja(P. 3) .
Środki ostrożności podczas instalacji pamięci ROM
● Nie wolno przykładać żadnych metalowych elementów, takich jak śruby, do płyt obwodowych urządzenia.
Może to spowodować uszkodzenie urządzenia.
● Nie wolno dotykać części wewnętrznych, obwodów drukowanych, złączy ani przełączników. Może to
spowodować uszkodzenie urządzenia.
● Nie wolno włączać zasilania, gdy pokrywa pamięci ROM jest otwarta. Może to spowodować uszkodzenie
urządzenia.
Środki ostrożności związane z unikaniem ładunków elektrostatycznych
Pamięć ROM zawiera części wrażliwe na działanie ładunków elektrostatycznych. Aby zapobiec uszkodzeniu
pamięci ROM wskutek działania ładunków elektrostatycznych, należy stosować poniższe środki ostrożności.
● Przed dotknięciem modułu pamięci ROM należy dotknąć metalowej części znajdującej się w pomieszczeniu,
aby rozładować ładunki elektrostatyczne zgromadzone na ciele.
● Podczas pracy nie dotykać przedmiotów, które z dużym prawdopodobieństwem wytwarzają ładunki
elektrostatyczne, np. wyświetlacza.
● Aby zapobiec negatywnemu działaniu elektryczności statycznej, pamięć ROM należy wyjąć z opakowania
dopiero tuż przed podłączeniem jej do złączy ROM.
1
Wyłącz urządzenie i wyjmij wtyczkę z gniazda zasilania.
● Aby wyłączyć zasilanie urządzenia, należy wykonać procedurę wyłączania z poziomu panelu roboczego bez
korzystania z głównego wyłącznika zasilania. Wyłączanie zasilania (procedura wyłączania)(P. 37)
2
1
Zdejmij tylną pokrywę.
Pchnij zaczep i delikatnie otwórz pokrywę w swoją stronę.
596
Dodatek
2
3
Zdejmij pokrywę z prawej strony w kierunku wskazanym za pomocą strzałki.
Zdejmij pokrywę pamięci ROM.
1
Za pomocą żetonu odkręć śruby.
2
Otwórz pokrywę pamięci ROM i zdemontuj ją w kierunku wskazanym za pomocą strzałki.
4
Zainstaluj pamięć ROM.
● Ustaw moduł pamięci ROM równo z dwoma złączami pamięci ROM urządzenia i wepchnij moduł do oporu.
597
Dodatek
Odłączanie pamięci ROM
● Chwyć za krawędzie modułu pamięci ROM i wyciągnij moduł, jak zaprezentowano na poniższej ilustracji.
5
Zamontuj pokrywę pamięci ROM z powrotem na miejscu.
1
Zamknij pokrywę pamięci ROM, wpychając zaczep pokrywy pamięci ROM w kierunku oznaczonym
za pomocą strzałki.
2
Za pomocą żetonu ponownie przykręć śruby.
6
Załóż tylną pokrywę w kierunku wskazanym za pomocą strzałki, a następnie ją
zamknij, dociskając przy tym zaczep.
598
Dodatek
● Jeżeli w tym samym czasie instalowana będzie karta pamięci SD, należy przejść do części
pamięci SD(P. 600) .
Instalacja karty
◼ Sprawdzanie, czy moduł Zestaw drukowania kodów kreskowych został poprawnie
zainstalowany
Wydrukować Strona konfiguracji(P. 481) i sprawdzić, czy w menu „PCL”
jest wyświetlana pozycja „BarDIMM”.
Jeśli pozycja „BarDIMM” jest widoczna, oznacza to, że pamięć ROM jest
zainstalowana prawidłowo.
Pozycja „BarDIMM” jest niewidoczna
● Pamięć ROM nie jest zainstalowana prawidłowo. Wyjmij moduł pamięci
ROM z urządzenia i podłącz go ponownie.
599
Dodatek
Instalacja karty pamięci SD
6869-079
W tej części opisano sposób montażu i inicjacji karty SD. Włóż
kartę SD do szczeliny na kartę SD z lewej strony urządzenia. Przed
zainstalowaniem karty SD należy się zapoznać ze środkami
ostrożności opisanymi w części Instalacja(P. 3) . Należy
pamiętać, że dane urządzenia zapisane na karcie SD są
szyfrowane. Zapewnia to bezpieczeństwo korzystania z karty SD
na komputerze lub w innych okolicznościach, ponieważ
zaszyfrowane dane na karcie SD są zabezpieczone przed
nieupoważnionym wyodrębnianiem.
● Przed zamontowaniem karty SD należy sprawdzić, czy nie jest ona chroniona przed zapisem. Jeśli tak, należy
ją odblokować przed zainstalowaniem.
1
Wyłącz urządzenie i wyjmij wtyczkę z gniazda zasilania.
● Aby wyłączyć zasilanie urządzenia, należy wykonać procedurę wyłączania z poziomu panelu roboczego bez
korzystania z głównego wyłącznika zasilania. Wyłączanie zasilania (procedura wyłączania)(P. 37)
2
Zdejmij pokrywę szczeliny na kartę SD.
1
Za pomocą żetonu odkręć śruby.
2
Otwórz pokrywę szczeliny na kartę SD i zdemontuj ją w kierunku wskazanym za pomocą strzałki.
600
Dodatek
3
Zainstaluj kartę SD.
● Wsuń kartę do szczeliny na kartę SD, aż usłyszysz kliknięcie.
Wyjmowanie karty SD
● Naciśnij kartę SD aż do usłyszenia kliknięcia, jak pokazano na ilustracji, puść palec, a następnie wyjmij ją.
4
1
Ponownie załóż pokrywę szczeliny na kartę SD.
Zamknij pokrywę szczeliny na kartę SD, naciskając na zaczep pokrywy.
601
Dodatek
2
Za pomocą żetonu ponownie przykręć śruby.
Szczelina na kartę SD z zabezpieczeniem
antykradzieżowym
● Pokrywa szczeliny na kartę SD jest wyposażona w szczelinę z
zabezpieczeniem, do którego można zaczepić linkę
zabezpieczającą lub inne podobne zabezpieczenie.
● Otwór szczeliny z zabezpieczeniem ma szerokość 3,4 mm i
wysokość 7,4 mm.
● Aby uzyskać więcej informacji na temat szczeliny z
zabezpieczeniem, skontaktuj się z autoryzowanym sprzedawcą
produktów firmy Canon.
◼ Inicjowanie karty pamięci SD
Przy pierwszym włączeniu urządzenia od zainstalowania karty SD na wyświetlaczu
pojawi się komunikat <Format SD Card?>. Aby rozpocząć inicjację karty SD, należy
. Po zakończeniu inicjacji karta będzie gotowa do użycia.
nacisnąć przycisk
Opcja <Format SD Card?> się nie wyświetla
● W menu ustawień na panelu roboczym zainicjuj kartę SD, wybierając opcję <Formatowanie> dostępną w
<Konserwacja karty SD>. Konserwacja karty SD(P. 400)
602
Dodatek
◼ Sprawdzanie, czy karta pamięci SD została poprawnie zainstalowana w urządzeniu
Wydrukuj Strona konfiguracji(P. 541) . Jeśli opcja „Karta SD” w „Menu
sterowania” jest włączona, oznacza to, że karta SD jest zainstalowana
prawidłowo.
Nie ma informacji na temat stanu karty SD
● Karta SD nie jest zainstalowana prawidłowo. Wyjmij kartę SD z urządzenia i
zainstaluj ją ponownie.
◼ Konfiguracja informacji o karcie SD
Jeśli karta SD została dodana po zainstalowaniu sterownika drukarki, należy skonfigurować informacje o karcie SD w
sterowniku drukarki. Korzystanie z elementów opcjonalnych(P. 76)
◼ Usuwanie wszystkich danych z karty pamięci SD
Przed przekazaniem karty SD do utylizacji można przy użyciu opisanej poniżej procedury usunąć z niej wszystkie dane.
Procedura spowoduje usunięcie nawet tych fragmentów danych, których normalnie nie można usunąć. To eliminuje
ryzyko odczytania danych przez osoby trzecie, umożliwiając bezpieczną utylizację karty SD.
● Poniższej procedury nie wolno stosować do żadnych kart SD poza opcjonalną kartą „KARTA SD”.
1
Przełącz urządzenie w tryb offline.
● Gdy zaświeci się wskaźnik
(
2
Naciśnij przycisk
3
Za pomocą przycisków
4
przycisk
(
), naciśnij przycisk
(
).
)
/
wybierz opcję <Konserw. użytkownika> i naciśnij
.
Wybierz kolejno polecenia <Konserwacja karty SD>
● Gdy zostanie wyświetlony komunikat, naciśnij przycisk
603
.
<Pełne usuw. danych>.
Dodatek
5
Wybierz opcję <Tak> i naciśnij przycisk
.
➠ Urządzenie zostanie automatycznie uruchomione ponownie. Potem zostanie ono automatycznie
wyłączone.
● Po wykonaniu operacji <Pełne usuw. danych> ustawienie parametru <Karta SD> zostanie zmienione na
<Wyłącz>.
604
Dodatek
Instrukcje obsługi i ich zawartość
6869-07A
Do urządzenia dołączone są wyszczególnione poniżej instrukcje. Należy korzystać z nich w razie konieczności.
Pierwsze kroki
Należy najpierw przeczytać ten podręcznik. Opisuje on procedurę instalacyjną
dla urządzenia.
Podręcznik użytkownika
(Ten podręcznik)
Jest to podręcznik wyświetlany w przeglądarce internetowej. Opisano w nim
wszystkie funkcje urządzenia. Umożliwia przeglądanie informacji według
kategorii lub wyszukiwanie informacji na dany temat według słowa kluczowego.
Korzystanie z programu Podręcznik użytkownika(P. 606)
605
Dodatek
Korzystanie z programu Podręcznik użytkownika
6869-07C
Program Podręcznik użytkownika jest instrukcją obsługi, którą można wyświetlić na komputerze lub urządzeniu
przenośnym, opisującą wszystkie funkcje urządzenia. Istnieje możliwość wyszukania określonego zastosowania lub
wprowadzenia słowa kluczowego w celu błyskawicznego odnalezienia szukanej strony. W tej części opisano układ
ekranu programu Podręcznik użytkownika oraz sposób czytania Podręcznika. Wygląd programu Podręcznik
użytkownika można dostosować do własnych potrzeb.
◼ Układ ekranu programu Podręcznik użytkownika
W tej części opisano ekrany konfiguracji programu Podręcznik użytkownika i sposób korzystania z przycisków
wyświetlanych na ekranie. Układ ekranu programu Podręcznik użytkownika(P. 607)
◼ Przeglądanie programu Podręcznik użytkownika
W tej części opisano znaczenie symboli używanych w programie Podręcznik użytkownika, sposób przedstawiania
klawiszy na panelu sterowania i przycisków na wyświetlaczu komputera, a także inne tematy, które ułatwiają
zrozumienie informacji zawartych w programie Podręcznik użytkownika. Przeglądanie programu Podręcznik
użytkownika(P. 610)
◼ Określanie wyglądu programu Podręcznik użytkownika.
Można zmienić rozmiar znaków używanych w programie Podręcznik użytkownika, a także przełączyć układ ekranu, aby
pasował do urządzenia używanego do wyświetlania programu Podręcznik użytkownika.
● Użytkownicy niemający dostępu do programu Adobe Reader umożliwiającego wyświetlanie podręczników w
formacie PDF mogą skorzystać z innego oprogramowania, takiego jak aplikacja PDF Preview opracowana
przez firmę Vivid Document Imaging Technologies.
Jak odnaleźć szukany temat
Wyszukiwanie zawartości
● Szukaną stronę można odnaleźć, wybierając temat na karcie „Spis treści” widocznej po lewej stronie ekranu.
Wyszukiwanie według słów kluczowych
● Wyszukiwanie można wykonać, wpisując szukane wyrażenie np. „koperta” lub „zasobnik z tonerem”, w
wyniku czego wyświetlone zostają strony zawierające podany zwrot. Odpowiednią stronę można odnaleźć,
przeglądając wyniki tej operacji. Można również wpisywać całe wyrażenia, takie jak „podłączanie do sieci”.
Wyszukiwanie słów kluczowych obsługuje także operator logiczny AND w celu wyszukiwania wielu słów
kluczowych. Aby uzyskać informacje na temat organizacji ekranu wyszukiwania i sposobu obsługi ekranu
wyszukiwania, patrz Wyszukiwanie(P. 608) .
606
Dodatek
Układ ekranu programu Podręcznik użytkownika
6869-07E
Okno programu Podręcznik użytkownika jest podzielone na kilka obszarów z różną zawartością.
Strona główna
Wyświetlana po uruchomieniu programu Podręcznik użytkownika.
/
Kliknij
widoku.
, aby wyświetlić również wszystkie części rozdziałów. Kliknij
, aby powrócić do poprzedniego
/
Kliknij, aby przełączyć między widokiem zawartości a wyszukiwaniem. Kiedy wyświetlany jest spis treści,
każde kliknięcie
przełącza między ukrywaniem i pokazywaniem tego widoku. Kiedy wyświetlany jest
ekran wyszukiwania, każde kliknięcie
przełącza między ukrywaniem i pokazywaniem tego widoku.
Kliknij, aby ustawić parametry określające sposób wyświetlania programu Podręcznik użytkownika, np.
rozmiar znaków lub układ.
Kliknięcie tego elementu powoduje wyświetlenie instrukcji dotyczących otwierania programu Podręcznik
użytkownika, wykonywania wyszukiwania oraz innych informacji.
/
Kliknij, aby wyświetlić poprzedni lub następny temat.
[Uwaga]
Kliknij, aby zapoznać się z ważnymi informacjami, które należy znać podczas używania urządzenia.
607
Dodatek
Strona tematu
Zawiera informacje na temat konfiguracji i użytkowania urządzenia.
Nawigacja
Element umożliwiający sprawdzenie jaki temat jest obecnie wyświetlany.
Kliknięcie tego elementu powoduje przejście do podanej strony. Aby powrócić do poprzedniej strony,
należy kliknąć przycisk Wstecz przeglądarki internetowej.
/
Klikając
, można wyświetlić ukryte szczegółowe opisy. Kliknij
, aby zamknąć szczegółowe opisy.
Kliknij, aby powrócić do góry strony.
Wyszukiwanie
Kliknij
, aby wyświetlić okno wyszukiwania. Karta ta zawiera pole tekstowe umożliwiające wykonanie
wyszukiwania według słów kluczowych i odnalezienie szukanej strony.
608
Dodatek
[Tutaj wpisz słowa kluczowe]
, aby wyświetlić wyniki wyszukiwania. Możesz szukać
Wpisz słowo lub słowa kluczowe i kliknij przycisk
stron zawierających wszystkie słowa kluczowe poprzez oddzielanie słów kluczowych za pomocą spacji
(pustego pola). Możesz także szukać tylko stron zawierających dokładną frazę poprzez zamknięcie słów
kluczowych w cudzysłowie.
Wyniki wyszukiwania
Okno, w którym wyświetlane są wyniki wyszukiwania stron zawierających podane słowa kluczowe. Szukaną
stronę należy odnaleźć wśród wyników wyszukiwania i kliknąć temat będący tytułem strony.
● Podane słowa kluczowe są wyświetlone w wynikach wyszukiwania pogrubioną czcionką.
609
Dodatek
Przeglądanie programu Podręcznik użytkownika
6869-07F
W tej części opisano symbole, przyciski, ekrany oraz inne elementy używane w programie Podręcznik użytkownika.
Ostrzeżenia i przestrogi zawierają również „Ważne instrukcje dotyczące bezpieczeństwa” podane w podręczniku
„Pierwsze kroki” dołączonym do urządzenia. Należy zapoznać się również z tymi instrukcjami.
Symbole
Uwagi dotyczące bezpieczeństwa, ograniczeń, obsługi urządzenia, przydatne wskazówki oraz inne informacje
zostały oznaczone za pomocą podanych poniżej symboli.
Oznacza ostrzeżenie dotyczące czynności, których niewłaściwe
wykonanie może doprowadzić do obrażeń ciała lub śmierci. Aby
bezpiecznie korzystać z urządzenia, należy zawsze zwracać
uwagę na te ostrzeżenia.
Oznacza przestrogę dotyczącą czynności, których niewłaściwe
wykonanie może doprowadzić do obrażeń ciała. Aby bezpiecznie
korzystać z urządzenia, należy zawsze zwracać uwagę na te
przestrogi.
Wskazuje operację, której nie wolno przeprowadzać. Należy
uważnie zapoznać się z tymi pozycjami, aby na pewno nie
wykonać opisanych w nich operacji.
Oznacza wymagania lub ograniczenia. Należy zapoznać się z tymi
elementami w celu prawidłowego korzystania z urządzenia i
uniknięcia uszkodzeń tego urządzenia oraz mienia.
Oznacza wyjaśnienie czynności lub dodatkowe informacje
dotyczące procedury.
Oznacza przydatne funkcje lub wskazówki dotyczące korzystania
z urządzenia.
Klawisze i przyciski użyte w niniejszym podręczniku
Klawisze na panelu sterowania oraz przyciski na ekranie komputera w programie e-Podręcznik zostały
oznaczone w następujący sposób:
Typ
Przykład
Klawisze na panelu sterowania
(
)
<Ustawienia zegara>
<Papier jest zakleszcz.>
Ustawienia wyświetlone na panelu sterowania
Przyciski i inne tekstowe elementy interfejsu wyświetlone na ekranie komputera [Preferencje]
/
Użyte w tej instrukcji
Przyciski
/
służą do wyboru odpowiedniego ustawienia. Na danej stronie wyszczególnione jest tylko ich
pierwsze użycie. Gdy są używane po raz kolejny, nie jest to odnotowywane w instrukcjach. Na przykład, użycie
przycisków
/
jest wyszczególnione w kroku 2, jednak pominięte w 3.
Przykład:
610
Dodatek
1
Naciśnij przycisk
2
Za pomocą przycisków
3
Wybierz kolejno <Ustawienia TCP/IP>
(
).
/
wybierz opcję <Sieć> i naciśnij przycisk
<Ustawienia IPv4>
.
<Ustawienia adresu IP>.
Ekrany użyte w tym podręczniku
Wygląd ekranów użytych w tym podręczniku może nieznacznie odbiegać od rzeczywistych ekranów w zależności
od systemu operacyjnego. Również wygląd okien sterownika drukarki oraz innych aplikacji może różnić się w
zależności od wersji używanego oprogramowania.
Rysunki użyte w tej instrukcji
Na rysunkach w programie Podręcznik użytkownika przedstawiono zasobnik z tonerem do modelu Canon Toner
Cartridge 059 H.
611
Dodatek
Zarządzanie aplikacjami MEAP
6869-07J
W urządzeniu można zainstalować aplikacje MEAP (oprogramowanie do rozbudowy funkcji), aby dodać różne funkcje.
Funkcje można dostosowywać według potrzeb, na przykład skonfigurować system uwierzytelniania z zastosowaniem
kart IC lub zarządzanie wydrukami na podstawie rejestrów. Aby móc zarządzać aplikacjami MEAP, należy otworzyć
urządzenie z poziomu komputera za pośrednictwem przeglądarki internetowej. Więcej informacji znajduje się w
rozdziale Przewodnik po funkcji MEAP Application Management .
612
Dodatek
Korzystanie z klientów FTP
6869-07K
Za pomocą klienta FTP można uzyskać dostęp do serwera FTP urządzenia i określić ustawienia drukowania dokumentu
oraz ustawienia sieciowe. Drukowanie i konfigurację można przeprowadzać po zainstalowaniu w systemie
operacyjnym standardowego wiersza poleceń. Dzięki temu nie będzie potrzeby korzystania z żadnych konkretnych
sterowników ani aplikacji.
Przygotowanie do korzystania z serwera FTP
Określ ustawienia, aby umożliwić komunikację między urządzeniem a klientami.
korzystania z serwera FTP(P. 614)
Przygotowanie do
Drukowanie za pośrednictwem klienta FTP (Wydruk z FTP)
Istnieje możliwość wydrukowania dokumentu przesłanego do urządzenia za pośrednictwem serwera FTP.
Drukowanie za pośrednictwem klienta FTP (Wydruk z FTP)(P. 617)
Definiowanie ustawień za pośrednictwem klienta FTP
Ustawienia urządzenia można pobrać w formacie tekstowym do edycji.
pośrednictwem klienta FTP(P. 619)
613
Definiowanie ustawień za
Dodatek
Przygotowanie do korzystania z serwera FTP
6869-07L
Domyślne ustawienia fabryczne uniemożliwiają wykonywanie operacji z poziomu klientów FTP, dlatego w celu ich
wykorzystania należy zdefiniować ustawienia.
1
Uruchom Zdalny interfejs użytkownika i zaloguj się w trybie zarządzania.
Uruchamianie Zdalnego interfejsu użytkownika(P. 300)
2
Kliknij [Ustawienia/Rejestracja].
3
Kliknij [Sieć]
4
Kliknij element [Edytuj] znajdujący się w sekcji [Ustawienia FTP].
[Ustawienia TCP/IP].
614
Dodatek
5
Podaj wymagane ustawienia i kliknij przycisk [OK].
[Użyj wydruku z FTP]
To pole wyboru należy zaznaczyć, aby móc drukować za pośrednictwem serwera FTP. W przeciwnym razie nie
powinno być ono zaznaczone.
[Nazwa użytkownika wydruku z FTP]
Wprowadź złożoną ze znaków alfanumerycznych nazwę użytkownika, która jest używana do logowania na
serwerze FTP podczas drukowania z FTP.
● Nie można ustawić katalogu „root.”
[Ustaw/Zmień hasło]
Zaznacz pole wyboru, aby ustawić hasło dla drukowania z FTP, po czym wpisz składające się ze znaków
alfanumerycznych hasło w polu tekstowym [Hasło]. W celu potwierdzenia należy wprowadzić to samo hasło w
polu tekstowym [Potwierdź].
● Kliknięcie opcji [OK], gdy to pole wyboru jest zaznaczone, a pola wyboru [Hasło] i [Potwierdź] są puste,
spowoduje usunięcie aktualnie ustawionego hasła.
[Użyj UTF-8 do wyświetlenia nazwy zadania drukowania FTP]
Zaznacz to pole wyboru, jeśli korzystasz z kodowania UTF-8 dla nazwy drukowanego pliku.
[Zezwól na ustawienie przez FTP]
To pole wyboru należy zaznaczyć, aby umożliwić zmienianie ustawień urządzenia za pośrednictwem klienta
FTP.
6
Wykonaj reset sprzętowy.
615
Dodatek
● Kliknij opcję [Sterowanie urządzeniem], wybierz polecenie [Twardy reset], a następnie kliknij [Wykonaj].
➠ Po wykonaniu resetu sprzętowego ustawienia będą włączone.
Korzystanie z panelu sterowania
● Ustawienia FTP i drukowanie FTP można również włączać lub wyłączać z poziomu menu ustawień panelu
roboczego. FTP(P. 351)
ŁĄCZA
Drukowanie za pośrednictwem klienta FTP (Wydruk z FTP)(P. 617)
Definiowanie ustawień za pośrednictwem klienta FTP(P. 619)
616
Dodatek
Drukowanie za pośrednictwem klienta FTP (Wydruk z
FTP)
6869-07R
Z poziomu klientów FTP za pośrednictwem sieci można drukować dokumenty w formacie TEKST/JPEX/TIFF. Najpierw
należy sprawdzić ustawienie adresu IP urządzenia ( Wydruk stanu sieci(P. 541) ). W razie braku pewności co do
adresu IP, należy skontaktować się z administratorem sieci.
1
Uruchom [Wiersz polecenia].
● Otwórz menu [Start] i wybierz opcję [Wszystkie programy] lub kolejno opcje [Programy]
[Akcesoria]
[Wiersz polecenia].
W przypadku użytkowników systemu macOS
● Uruchom Terminal.
Dla użytkowników systemów UNIX
● Wyświetl ekran konsoli.
2
Skopiuj dokument do wydrukowania do katalogu wyświetlonego w wierszu poleceń.
● Na przykładowym ekranie dokument został skopiowany do folderu „USER_NAME” w lokalizacji [Użytkownicy]
na dysku C:.
3
Wpisz „ftp <adres IP urządzenia>” i naciśnij klawisz [ENTER].
● Przykład: ftp 192.168.1.45
4
Wpisz nazwę użytkownika przypisaną do funkcji Wydruk z FTP i naciśnij klawisz
[ENTER].
● Domyślna nazwa użytkownika to „guest”.
● Nie można zalogować się jako użytkownik anonimowy (nieposiadający konta).
5
Wpisz hasło przypisane do funkcji Wydruk z FTP i naciśnij klawisz [ENTER].
● Hasło domyślne to „7654321”.
➠ Zostanie wyświetlony komunikat „230 Użytkownik <nazwa użytkownika przypisana do funkcji Wydruk z
FTP> jest zalogowany”.
617
Dodatek
6
Wpisz „bin” i naciśnij klawisz [ENTER].
➠ Tryb transferu danych zostanie zmieniony na tryb binarny.
● Tryb binarny należy zdefiniować również podczas drukowania dokumentu tekstowego.
7
Wpisz „put <nazwa pliku do wydrukowania>” i naciśnij klawisz [ENTER].
● Przykład: put probka.txt
➠ Dokument zostanie wydrukowany.
8
Wpisz „quit” i naciśnij klawisz [ENTER].
9
Wpisz „exit” i naciśnij klawisz [ENTER].
➠ Wiersz poleceń zostanie zamknięty.
618
Dodatek
Definiowanie ustawień za pośrednictwem klienta FTP
6869-07S
Z poziomu klienta FTP, za pośrednictwem sieci TCP/IP, można definiować ustawienia, takie jak ustawienia sieciowe
urządzenia. Najpierw należy sprawdzić ustawienie adresu IP urządzenia ( Wydruk stanu sieci(P. 541) ). W razie
braku pewności co do adresu IP, należy skontaktować się z administratorem sieci.
1
Uruchom [Wiersz polecenia].
● Otwórz menu [Start] i wybierz opcję [Wszystkie programy] lub kolejno opcje [Programy]
[Akcesoria]
[Wiersz polecenia].
W przypadku użytkowników systemu macOS
● Uruchom Terminal.
Dla użytkowników systemów UNIX
● Wyświetl ekran konsoli.
2
Wpisz „ftp <adres IP urządzenia>” i naciśnij klawisz [ENTER].
● Przykład: ftp 192.168.1.45
3
Wpisz „root” dla nazwy użytkownika i naciśnij klawisz [ENTER].
4
Wpisz hasło menedżera systemu i naciśnij klawisz [ENTER].
● Hasło domyślne to „7654321”.
Ustawianie hasła menedżera systemu(P. 221)
➠ Zostanie wyświetlony komunikat „230 Użytkownik główny jest zalogowany”.
5
Wpisz „cd config” i naciśnij klawisz [ENTER].
6
Wpisz „get CONFIG <nazwa pliku>” i naciśnij klawisz [ENTER].
● Słowo „CONFIG” musi być zapisane wielkimi literami.
● <Nazwa pliku> może zawierać dowolne znaki (przykład: get CONFIG ustawienia.txt).
➠ Plik ustawienia jest pobierany do katalogu wyświetlanego po uruchomieniu wiersza polecenia. Na
przykładowym ekranie plik został pobrany do folderu „USER_NAME” w lokalizacji [Użytkownicy] na dysku
C:.
619
Dodatek
7
Pobrany plik konfiguracyjny można edytować za pomocą edytora tekstu, takiego jak
Notepad.
Lista pozycji ustawień pliku konfiguracyjnego
Menu ogólne (ustawienia ogólne)
Nazwa pozycji
Wartość ustawienia
Domyślne ustawienia
fabryczne
DEVICE_NAME
(Nazwa urządzenia)
Maksymalnie 128 znaków
LBP852Cx
SYS_LOC
(Położenie)
Maksymalnie 128 znaków
(Puste)
SYS_CONTACT
(Menedżer systemu)
Maksymalnie 128 znaków
(Puste)
ROOT_PWD
(Hasło menedżera systemu)
Maksymalnie 16 znaków alfanumerycznych
USER_JOB_CONT
ON, OFF
(Zezwalaj na obsługę zadań przez użytkownika)
LINK_URL1
(Adres URL łącza pomocy)
7654321
OFF
Maksymalnie 512 znaków alfanumerycznych https://global.canon
Menu TCP/IP (Ustawienia TCP/IP)
Nazwa pozycji
Wartość ustawienia
Domyślne ustawienia
fabryczne
INT_ADDR
(Adres IP)
Adres IP
0.0.0.0
NET_MASK
(Maska podsieci)
Adres IP
0.0.0.0
DEF_GW
(Adres bramy)
Adres IP
0.0.0.0
DHCP_ENB
(Użyj serwera DHCP)
ON, OFF
OFF
RARP_ENB
(Użyj protokołu RARP)
ON, OFF
OFF
BOOTP_ENB
(Użyj BOOTP)
ON, OFF
OFF
DNS_PADDR
Adres IP
0.0.0.0
620
Dodatek
(Adres głównego serwera DNS)
DNS_SADDR
(Adres pomocniczego serwera DNS)
Adres IP
HOST_NAME
(Nazwa hosta)
Maksymalnie 47 znaków
alfanumerycznych
DOMAIN_NAME
(Nazwa domeny)
Maksymalnie 47 znaków
alfanumerycznych
DDNS_ENB
(Dynamiczna aktualizacja DNS)
ON, OFF
OFF
WINS_ENB
(Rozdzielczość WINS)
ON, OFF
OFF
WINS_SERVER
(Adres serwera WINS)
Adres IP
0.0.0.0
ARP_PING_ENB
(Użyj ARP/PING)
ON, OFF
OFF
LPD_ENB
(Użyj drukowania LPD)
ON, OFF
ON
LPD_BANN
(Drukuj stronę banerową LPD)
ON, OFF
OFF
RAW_ENB
(Użyj drukowania RAW)
ON, OFF
ON
RAW_BIDIR_ENB
(Użyj komunikacji dwukierunkowej)
ON, OFF
OFF
FTP_PRINT_ENB
(Użyj funkcji Wydruk z FTP)
ON, OFF
OFF
FTP_PRINT_USER
Maksymalnie 24 znaków
(Nazwa użytkownika przypisana do funkcji Wydruk z FTP) alfanumerycznych
0.0.0.0
„Canon” +
„Dolne 6 cyfr
adresu MAC”
(Puste)
guest
FTP_PRINT_PWD
(Hasło przypisane do funkcji Wydruk z FTP)
Maksymalnie 24 znaków
alfanumerycznych
IPP_ENB
(Użyj IPP)
ON, OFF
ON
IPP_AUTH_ENB
(Użyj uwierzytelniania IPP)
ON, OFF
OFF
IPP_AUTH_ACCUNT1
(Nazwa użytkownika do uwierzytelniania IPP)
Maksymalnie 24 znaki alfanumeryczne
(obowiązkowe w przypadku korzystania z
uwierzytelniania IPP)
guest
IPP_AUTH_PASSWD1
(Hasło do uwierzytelniania IPP)
Maksymalnie 24 znaki alfanumeryczne
(obowiązkowe w przypadku korzystania z
uwierzytelniania IPP)
7654321
WSD_ENB
(Użyj funkcji drukowania WSD)
ON, OFF
ON
WSD_BROWSING
(Użyj funkcji przeglądania WSD)
ON, OFF
ON
WSD_MULTICAST_DISCOVERY
ON, OFF
ON
621
7654321
Dodatek
(Użyj funkcji odkrywania multiemisji)
HTTP_ENB
(Użyj protokołu HTTP)
ON, OFF
ON
SNTP_ENB
(Użyj protokołu SNTP)
ON, OFF
OFF
SNTP_ADDR
(Nazwa serwera NTP)
Adres IP lub nazwa hosta
SNTP_INTERVAL
(Interwał odpytywania)
1 do 48 (godz.)
24
DISCOVERY_ENB
(Odpowiedź na odkrycie)
ON, OFF
ON
DISCOVERY_SCOPE_NAME
(Nazwa zakresu)
Maksymalnie 32 znaki alfanumeryczne
EMAIL_PRINT_ENB
(POP3 RX)
ON, OFF
EMAIL_POP_ADDR
(Nazwa serwera POP3)
Maksymalnie 48 znaków
alfanumerycznych
(Puste)
EMAIL_POP_ACCOUNT
(Nazwa użytkownika serwera POP3)
Maksymalnie 32 znaki alfanumeryczne
(Puste)
EMAIL_POP_PASSWD
(Hasło serwera POP3)
Maksymalnie 32 znaki alfanumeryczne
(Puste)
EMAIL_POP_INTERVAL
(Interwał POP3 RX)
0 do 90 (min)
EMAIL_POP_PORTNO
(Numer portu serwera POP3)
0 do 65 535
110
IPV4_USE
(Użyj IPv4)
ON, OFF
ON
IPV6_USE
(Użyj IPv6)
ON, OFF
OFF
IPV6_STATELESS_USE
(Użyj adresu bezstanowego)
ON, OFF
ON
IPV6_MANUAL_ADDR_USE
(Użyj adresu ręcznego)
ON, OFF
OFF
IPV6_MANUAL_ADDR_SET
(Adres IP)
Adres IP
(Puste)
IPV6_MANUAL_ADDR_PREFIX
(Długość przedrostka)
0 do 128
64
IPV6_MANUAL_ROUTER_ADDR
(Domyślny adres routera)
Adres IP
(Puste)
IPV6_DHCPV6_USE
(Użyj DHCPv6)
ON, OFF
OFF
IPV6_DNS_ADDRESS_PRI
(Adres głównego serwera DNS)
Adres IP
(Puste)
IPV6_DNS_ADDRESS_SEC
Adres IP
(Puste)
622
(Puste)
default
OFF
0
Dodatek
(Adres pomocniczego serwera DNS)
IPV6_DNS_NAME_SAME_AS_IPV4
(Użyj hosta / nazw domen IPv4)
ON, OFF
IPV6_DNS_HOST_NAME_V6
(Nazwa hosta)
Maksymalnie 47 znaków
alfanumerycznych
IPV6_DNS_DOMAIN_NAME_V6
(Nazwa domeny)
Maksymalnie 47 znaków
alfanumerycznych
IPV6_DNS_DYNAMIC_SET
(Dynamiczna aktualizacja DNS)
ON, OFF
OFF
IPV6_DNS_STATELESS
(Zarejestruj adres bezstanowy)
ON, OFF
OFF
IPV6_DNS_MANUAL
(Zarejestruj adres ręczny)
ON, OFF
OFF
IPV6_DNS_STATEFUL
(Zarejestruj adres stanowy)
ON, OFF
OFF
OFF
„Canon” +
„Dolne 6 cyfr
adresu MAC”
(Puste)
Menu serwera SMB (ustawienia SMB)
Nazwa pozycji
Wartość ustawienia
Domyślne ustawienia
fabryczne
SMB_ENB
(Użyj SMB)
ON, OFF
SMB_SERVER
(Nazwa serwera)
Maksymalnie 16 znaków
(Puste)
SMB_WG
(Nazwa grupy roboczej)
Maksymalnie 16 znaków
WORKGROUP
SMB_COMMENT
(Komentarze)
Maksymalnie 192 znaków
(Puste)
OFF
SMB_LM_ENB
ON, OFF
(Użyj powiadomienia dla menedżera sieci LAN)
OFF
SMB_PRINT_ENB
(Użyj drukowania SMB)
ON, OFF
OFF
SMB_PRINTER
(Nazwa drukarki)
Maksymalnie 13 znaków
PRINTER
Menu SNMP (ustawienia SNMP)
Nazwa pozycji
Wartość ustawienia
Domyślne ustawienia
fabryczne
SNMP_V1_ENB
(Użyj SNMPv1)
ON, OFF
ON
SNMP_COMMUNITY1_ENB
(Użyj nazwy społeczności 1)
ON, OFF
ON
623
Dodatek
SNMP_COMMUNITY1_ACCESS
(Uprawnienia dostępu do menedżera MIB)
RW (odczyt/zapis), RO (tylko odczyt)
SNMP_COMMUNITY1_NAME
(Nazwa społeczności 1)
Maksymalnie 32 znaki
alfanumeryczne
SNMP_COMMUNITY2_ENB
(Użyj nazwy społeczności 2)
ON, OFF
OFF
SNMP_COMMUNITY2_ACCESS
(Uprawnienia dostępu do menedżera MIB)
RW (odczyt/zapis), RO (tylko odczyt)
RO
SNMP_COMMUNITY2_NAME
(Nazwa społeczności 2)
Maksymalnie 32 znaki
alfanumeryczne
SNMP_V3_ENB
(Użyj SNMPv3)
ON, OFF
OFF
SNMP_GET_PRT_MNG_INFO
ON, OFF
(Uzyskaj informacje o zarządzaniu drukarką z hosta)
OFF
RO
public
public2
Menu BUFORA WYDRUKU (ustawienia bufora)
Nazwa pozycji
SPOOL_ENB
(Użyj bufora)
Wartość ustawienia Domyślne ustawienia fabryczne
ON, OFF
OFF
Menu LICZNIK CZASU (ustawienia czasu oczekiwania na połączenie przy uruchamianiu)
Nazwa pozycji
Wartość ustawienia Domyślne ustawienia fabryczne
STRT_DELAY_TIME
0 do 300 (s)
(Czas oczekiwania na połączenie przy uruchamianiu)
0
Menu Zdalnego interfejsu użytkownika (ustawienia Zdalnego interfejsu użytkownika)
Nazwa pozycji
Wartość ustawienia Domyślne ustawienia fabryczne
RUI_ENB
ON, OFF
(Użyj Zdalnego interfejsu użytkownika)
8
ON
Wpisz „put <nazwa pliku> CONFIG” i naciśnij klawisz [ENTER].
● W miejsce <nazwy pliku> wstaw nazwę edytowanego pliku (przykład: put Ustawienia.txt CONFIG).
➠ Plik ustawień zostanie wczytany.
9
Wpisz „get reset” i naciśnij klawisz [ENTER].
➠ Urządzenie zostanie uruchomione ponownie. Po ponownym uruchomieniu urządzenia ustawienia zostaną
aktywowane.
624
Dodatek
10
Potwierdź, że urządzenie zostało normalnie uruchomione ponownie, naciskając
11
Wpisz „quit” i naciśnij klawisz [ENTER].
12
Wpisz „exit” i naciśnij klawisz [ENTER].
klawisz [C], przytrzymując jednocześnie klawisz [CTRL].
➠ Wiersz poleceń zostanie zamknięty.
ŁĄCZA
Sieć(P. 347)
625
Dodatek
Inne
6869-07U
Ta sekcja opisuje podstawowe czynności w systemie Windows i obejmuje zrzeczenie się odpowiedzialności,
informacje o prawach autorskich i inne.
626
Dodatek
Podstawowe operacje systemu Windows
6869-07W
Wyświetlanie folderu Drukarki(P. 627)
Włączanie funkcji [Odnajdowanie sieci](P. 627)
Wyświetlanie udostępnionych drukarek w serwerze drukowania(P. 628)
Wyświetlanie ekranu [Instalacja programów/podręczników](P. 629)
Drukowanie strony testowej w systemie Windows(P. 629)
Sprawdzanie architektury bitowej(P. 630)
Sprawdzanie nazwy komputera(P. 631)
Sprawdzanie portu drukarki(P. 632)
Sprawdzanie komunikacji dwukierunkowej(P. 633)
Podczas drukowania z aplikacji Windows Store(P. 634)
● W zależności od używanego komputera operacje mogą się różnić od siebie.
◼ Wyświetlanie folderu Drukarki
Windows Vista
[Start] wybierz [Panel sterowania]
[Drukarka].
Windows 7/Server 2008 R2
[Start] wybierz [Urządzenia i drukarki].
Windows 8 / Server 2012
Kliknij prawym przyciskiem myszy w lewym dolnym rogu ekranu
urządzenia i drukarki].
Windows 8.1 / Server 2012 R2
Kliknij prawym przyciskiem myszy [Start]
Windows 10
[
] wybierz [System Windows]
Windows Server 2016
Kliknij prawym przyciskiem myszy [
wybierz [Panel sterowania]
[Panel sterowania]
Windows Server 2008
[Start] wybierz [Panel sterowania]
wybierz [Panel sterowania]
[Wyświetl
[Wyświetl urządzenia i drukarki].
[Sprzęt i dźwięk]
[Urządzenia i drukarki].
dwukrotnie kliknij [Drukarki].
]
wybierz [Panel sterowania]
[Sprzęt]
[Urządzenia i drukarki].
◼ Włączanie funkcji [Odnajdowanie sieci]
Włączenie funkcji [Odnajdowanie sieci] pozwoli wyświetlić komputery w sieci.
Windows Vista
[Start] wybierz [Panel sterowania]
obszarze [Odnajdowanie sieci].
[Wyświetl stan sieci i zadania]
wybierz [Włącz odnajdowanie sieci] w
Windows 7 / Server 2008 R2
[Start] wybierz [Panel sterowania] [Wyświetl stan sieci i zadania] [Zmień zaawansowane ustawienia
udostępniania] wybierz [Włącz odnajdowanie sieci] w obszarze [Odnajdowanie sieci].
Windows 8 / Server 2012
627
Dodatek
Kliknij prawym przyciskiem myszy w lewym dolnym rogu ekranu wybierz [Panel sterowania] [Wyświetl stan
sieci i zadania] [Zmień zaawansowane ustawienia udostępniania] wybierz [Włącz odnajdowanie sieci] w
obszarze [Odnajdowanie sieci].
Windows 8.1 / Server 2012 R2
Kliknij prawym przyciskiem myszy [Start] wybierz [Panel sterowania] [Wyświetl stan sieci i zadania]
[Zmień zaawansowane ustawienia udostępniania] wybierz [Włącz odnajdowanie sieci] w obszarze
[Odnajdowanie sieci].
Windows 10
[ ] wybierz [System Windows] [Panel sterowania] [Wyświetl stan sieci i zadania] [Zmień
zaawansowane ustawienia udostępniania] wybierz [Włącz odnajdowanie sieci] w obszarze [Odnajdowanie
sieci].
Windows Server 2008
[Start] wybierz [Panel sterowania] dwukrotnie kliknij [Centrum sieci i udostępniania]
odnajdowanie sieci] w sekcji [Odnajdowanie sieci].
wybierz [Włącz
Windows Server 2016
Kliknij prawym przyciskiem myszy [ ] wybierz [Panel sterowania] [Wyświetl stan sieci i zadania] [Zmień
zaawansowane ustawienia udostępniania] wybierz [Włącz odnajdowanie sieci] w obszarze [Odnajdowanie
sieci].
◼ Wyświetlanie udostępnionych drukarek w serwerze drukowania
1
Otwórz program Windows Explorer.
Windows Vista / 7 / Server 2008
[Start] wybierz [Wszystkie programy] albo [Programy]
[Akcesoria]
Windows 8 / Server 2012
Kliknij prawym przyciskiem myszy w lewym dolnym rogu ekranu
[Eksplorator Windows].
wybierz [Eksplorator plików].
Windows 8.1/Server 2012 R2
Kliknij prawym przyciskiem myszy [Start]
Windows 10 / Server 2016
Kliknij prawym przyciskiem myszy [
2
]
wybierz [Eksplorator plików].
wybierz [Eksplorator plików].
Wybierz serwer wydruku w oknie [Sieć] albo [Moje miejsca sieciowe].
● Aby wyświetlić komputery w sieci, może zaistnieć konieczność włączenia opcji odnajdowania sieci lub
wyszukiwania komputerów w sieci.
➠ Zostaną wyświetlone udostępnione drukarki.
628
Dodatek
◼ Wyświetlanie ekranu [Instalacja programów/podręczników]
Jeśli komputer nie wyświetli ekranu [Instalacja programów/podręczników] po umieszczeniu dołączonego dysku CDROM/DVD-ROM, należy wykonać poniższą procedurę. W niniejszym podręczniku napęd CD-ROM/DVD-ROM jest
oznaczony literą „D:”. Oznaczenie stacji dysków CD-ROM/DVD-ROM może się różnić w zależności od używanego
komputera.
Windows Vista/7/Server 2008
[Start] wpisz „D:\MInst.exe” w polu [Wyszukaj programy i pliki] albo [Rozpocznij wyszukiwanie]
klawisz [ENTER].
naciśnij
Windows 8/Server 2012
Kliknij prawym przyciskiem myszy w lewym dolnym rogu ekranu
opcję [OK]
[Uruchom]
Wpisz „D:\MInst.exe”
kliknij
Windows 8.1/Server 2012 R2
Kliknij prawym przyciskiem myszy przycisk [Start]
[Uruchom]
Wpisz „D:\MInst.exe”
kliknij przycisk [OK]
Windows 10
Kliknij opcję [Zadaj pytanie]
wyszukiwania.
wpisz „D:\MInst.exe”
kliknij element [D:\MInst.exe] wyświetlony jako wynik
Windows Server 2016
Kliknij [
]
wpisz „D:\MInst.exe”
kliknij [D:\MInst.exe] wyświetlone jako wynik wyszukiwania.
◼ Drukowanie strony testowej w systemie Windows
Drukowanie strony testowej w systemie Windows pozwala sprawdzić poprawne działanie sterownika drukarki.
1
2
3
Załaduj papier formatu A4 do szuflady na papier lub na tacę wielofunkcyjną.
Ładowanie papieru(P. 41)
Otwórz folder drukarki.
Wyświetlanie folderu Drukarki(P. 627)
Kliknij prawym przyciskiem myszy ikonę sterownika drukarki i kliknij polecenie
[Właściwości drukarki] albo [Właściwości].
629
Dodatek
4
Kliknij przycisk [Drukuj stronę testową] na karcie [Ogólne].
➠ Zostanie wydrukowana strona testowa.
◼ Sprawdzanie architektury bitowej
Aby upewnić się, czy komputer jest wyposażony w 32- czy 64-bitową wersję systemu Windows, należy wykonać
poniższą procedurę.
1
Wyświetl okno [Panel sterowania].
Windows Vista / 7 / Server 2008
[Start] wybierz [Panel sterowania].
Windows 8 / Server 2012
Kliknij prawym przyciskiem myszy w lewym dolnym rogu ekranu
Windows 8.1 / Server 2012 R2
Kliknij prawym przyciskiem myszy [Start]
wybierz [Panel sterowania].
wybierz [Panel sterowania].
Windows 10/Server 2016
Przejdź do kroku 2.
630
Dodatek
2
Wyświetl okno [System].
Windows Vista / 7 / 8 / Server 2008 R2 / Server 2012
Kliknij [System i konserwacja] albo [System i zabezpieczenia]
Windows 10 / Server 2016
Kliknij [ ] [Ustawienia]
[System]
[System].
wybierz [Informacje].
Windows Server 2008
Kliknij dwukrotnie [System].
3
Sprawdź architekturę bitową.
Dla wersji 32-bitowych
wyświetlany jest komunikat [32-bitowy system operacyjny].
Dla wersji 64-bitowych
wyświetlany jest komunikat [64-bitowy system operacyjny].
◼ Sprawdzanie nazwy komputera
1
Wyświetl okno [Panel sterowania].
Windows Vista / 7 / Server 2008
[Start] wybierz [Panel sterowania].
Windows 8 / Server 2012
Kliknij prawym przyciskiem myszy w lewym dolnym rogu ekranu
Windows 8.1 / Server 2012 R2
Kliknij prawym przyciskiem myszy [Start]
wybierz [Panel sterowania].
Windows 10
Kliknij [ ] wybierz opcje [System Windows]
Windows Server 2016
Kliknij prawym przyciskiem myszy [
]
wybierz [Panel sterowania].
[Panel sterowania].
wybierz [Panel sterowania].
631
Dodatek
2
Wyświetl okno [System].
Windows Vista / 7 / 8 / 10 / Server 2008 R2 / Server 2012 / Server 2016
Kliknij [System i konserwacja] albo [System i zabezpieczenia] [System].
Windows Server 2008
Kliknij dwukrotnie [System].
3
Sprawdź nazwę komputera.
◼ Sprawdzanie portu drukarki
1
2
Otwórz folder drukarki.
Wyświetlanie folderu Drukarki(P. 627)
Kliknij prawym przyciskiem myszy ikonę sterownika drukarki i kliknij polecenie
[Właściwości drukarki] albo [Właściwości].
632
Dodatek
3
Na karcie [Porty] sprawdź, czy port jest odpowiednio wybrany.
◼ Sprawdzanie komunikacji dwukierunkowej
1
2
Otwórz folder drukarki.
Wyświetlanie folderu Drukarki(P. 627)
Kliknij prawym przyciskiem myszy ikonę sterownika drukarki i kliknij polecenie
[Właściwości drukarki] albo [Właściwości].
633
Dodatek
3
Na karcie [Porty] upewnij się, że pole wyboru [Włącz obsługę dwukierunkową] zostało
zaznaczone.
◼ Podczas drukowania z aplikacji Windows Store
Windows 8/Server 2012
Wyświetl panel przy prawej krawędzi ekranu
[Drukuj].
Dotknij albo kliknij [Urządzenia]
Sterownik, którego używasz
Windows 8.1/Server 2012 R2
Wyświetl panel przy prawej krawędzi ekranu
używasz [Drukuj].
Dotknij albo kliknij [Urządzenia]
[Drukuj]
Windows 10
Dotknij lub kliknij [Drukuj] w aplikacji
Sterownik, którego używasz
Sterownik, którego
[Drukuj].
● Przy drukowaniu z wykorzystaniem tej metody dostępna jest tylko ograniczona liczba ustawień drukowania.
● Jeśli pojawi się komunikat [Drukarka wymaga Twojego działania. Przejdź na pulpit, aby podjąć działanie.],
przejdź na pulpit i postępuj zgodnie z instrukcjami w oknie dialogowym. Komunikat ten pojawia się, gdy
634
Dodatek
w urządzeniu wybrano opcję wyświetlania nazwy użytkownika podczas drukowania i wykonywania
podobnych czynności.
635
Dodatek
Próbki czcionek
6869-07X
Listy czcionek wydrukowane z menu Narzędzie zawierają wyczerpujący wykaz wszystkich aktualnie dostępnych
czcionek. Lista zawiera nazwy i próbki wydruku czcionek zapisanych w drukarce.
Czcionki skalowalne (PCL)(P. 637)
Czcionki skalowalne kodu OCR (PCL) (P. 640)
Czcionki bitmapowe (PCL)(P. 640)
636
Dodatek
Czcionki skalowalne (PCL)
637
Dodatek
638
Dodatek
639
Dodatek
Czcionki skalowalne kodu OCR (PCL)
Czcionki bitmapowe (PCL)
640
Dodatek
Uwaga
6869-07Y
◼ Logo IPv6 Ready
Zestawowi protokołów zainstalowanych w urządzeniu przyznano logo IPv6 Ready Phase-2
ustanowione przez konsorcjum IPv6 Forum.
◼ Informacje o produkcie wymagane zgodnie z ROZPORZĄDZENIEM KOMISJI (UE) nr
801/2013 zmieniającym Rozporządzenie (WE) nr 1275/2008
Zużycie przez produkt energii w sieciowym trybie czuwania z przewodami podłączonymi do interfejsów przewodowych
i aktywowanymi wszystkimi bezprzewodowymi interfejsami sieciowymi (jeżeli są dostępne w tym samym czasie).
Nazwa modelu
LBP852Cx
Zużycie przez produkt energii w sieciowym trybie czuwania
3,0 W lub mniej
● Powyższe wartości są rzeczywistymi, wybranymi arbitralnie wartościami dla pojedynczego urządzenia i mogą
różnic się od wartości dla urządzenia będącego w użyciu. Podczas pomiaru nie podłączano ani nie
aktywowano opcjonalnych interfejsów sieciowych.
◼ Dyrektywy WEEE i dotyczące akumulatorów
Tylko dla krajów Unii Europejskiej oraz EOG (Norwegia, Islandia i Liechtenstein)
Te symbole oznaczają, że produktu nie należy wyrzucać razem z odpadami gospodarstwa domowego, zgodnie z
dyrektywą WEEE w sprawie zużytego sprzętu elektrycznego i elektronicznego (2012/19/UE) lub dyrektywą w sprawie
baterii (2006/66/WE) bądź przepisami krajowymi wdrażającymi te dyrektywy.
Jeśli pod powyższym symbolem znajduje się symbol chemiczny, zgodnie z dyrektywą w sprawie baterii oznacza to, że
bateria lub akumulator zawiera metal ciężki (Hg = rtęć, Cd = kadm, Pb = ołów) w stężeniu przekraczającym odpowiedni
poziom określony w dyrektywie w sprawie baterii.
Użytkownicy baterii i akumulatorów mają obowiązek korzystać z dostępnego programu zwrotu, recyklingu i utylizacji
baterii oraz akumulatorów. Niewłaściwe postępowanie z tego typu odpadami może mieć wpływ na środowisko i
zdrowie ludzi ze względu na substancje potencjalnie niebezpieczne, związane ze zużytym sprzętem elektrycznym i
641
Dodatek
elektronicznym.Państwa współpraca w zakresie właściwej utylizacji tego produktu przyczyni się do efektywnego
wykorzystania zasobów naturalnych.
W celu uzyskania informacji o sposobie recyklingu tego produktu prosimy o kontakt z właściwym urzędem miejskim
lub zakładem gospodarki komunalnej bądź zapraszamy na stronę www.canon-europe.com/weee, lub www.canoneurope.com/battery.
◼ Environmental Information
Reducing your environmental impact while saving money
Power Consumption and Activation Time
The amount of electricity a device consumes depends on the way the device is used. This product is designed and set
in a way to allow you to reduce your electricity costs. After the last print it switches to Ready Mode. In this mode it can
print again immediately if required. If the product is not used for a time, the device switches to its Power Save Mode.
The devices consume less power (Watt) in these modes.
If you wish to set a longer Activation Time or would like to completely deactivate the Power Save Mode, please
consider that this device may then only switch to a lower energy level after a longer period of time or not at all.
Canon does not recommend extending the Activation Times from the optimum ones set as default.
Energy Star®
The Energy Star® programme is a voluntary scheme to promote the development and purchase of energy efficient
models, which help to minimise environmental impact.
Products which meet the stringent requirements of the Energy Star® programme for both environmental benefits and
the amount of energy consumption will carry the Energy Star® logo accordingly.
Paper types
This product can be used to print on both recycled and virgin paper (certified to an environmental stewardship
scheme), which complies with EN12281 or a similar quality standard. In addition it can support printing on media
down to a weight of 64g/m².
Lighter paper means less resources used and a lower environmental footprint for your printing needs.
Duplex printing (Standard duplex printing products only)
Duplex printing capability enables you to print on both sides automatically, and therefore helps to reduce the use of
valuable resources by reducing your paper consumption.
The duplex function has been auto enabled during the set up and driver installation and Canon strongly recommends
that you do not disable this function. You should continue to use the duplex function to reduce the environmental
impact of your work with this product at all times.
642
Dodatek
◼ Zrzeczenie się odpowiedzialności
● Informacje zawarte w niniejszym dokumencie mogą ulec zmianie bez uprzedzenia.
● FIRMA CANON INC. NIE UDZIELA ŻADNEGO RODZAJU GWARANCJI, WYRAŹNEJ ANI DOROZUMIANEJ, W STOSUNKU
DO NINIEJSZYCH MATERIAŁÓW (Z WYJĄTKIEM GWARANCJI UDZIELONYCH W NINIEJSZYM DOKUMENCIE), M.IN.
GWARANCJI DOTYCZĄCEJ PRZYDATNOŚCI HANDLOWEJ, PRZYDATNOŚCI DO SPRZEDAŻY LUB PRZYDATNOŚCI DO
OKREŚLONEGO CELU LUB CHRONIĄCEJ PRZED NARUSZENIEM PRAWA. FIRMA CANON INC. NIE PONOSI
ODPOWIEDZIALNOŚCI ZA JAKIEGOKOLWIEK RODZAJU SZKODY BEZPOŚREDNIE, PRZYPADKOWE LUB NASTĘPCZE
ORAZ ZA STRATY LUB WYDATKI WYNIKŁE Z KORZYSTANIA Z NINIEJSZYCH MATERIAŁÓW.
◼ Znaki towarowe
„MEAP” jest znakiem towarowym firmy CANON Inc., który odnosi się do „platformy aplikacji” przeznaczonych dla
urządzeń wielofunkcyjnych i drukarek marki Canon.
Mopria®, logo Mopria® i logo Mopria® Alliance są zastrzeżonymi znakami towarowymi firmy Mopria Alliance w USA i
innych krajach. Nieautoryzowane wykorzystywanie jest surowo zabronione.
Adobe, Acrobat i Reader są zastrzeżonymi znakami towarowymi firmy Adobe Systems Incorporated w USA i innych
krajach.
Apple, Bonjour, iPad, iPhone, iPod touch, Mac, macOS, OS X, Safari, AirPrint oraz logo AirPrint są znakami towarowymi
firmy Apple Inc.
Microsoft, Windows, Windows Vista, Windows Server, Internet Explorer, Word i Excel są zastrzeżonymi znakami
towarowymi lub znakami towarowymi firmy Microsoft Corporation w USA i innych krajach.
iOS jest znakiem towarowym lub zastrzeżonym znakiem towarowym firmy Cisco w USA i innych krajach, używanym na
podstawie licencji.
Google Cloud Print, Google Chrome i Android są zastrzeżonymi znakami towarowymi lub znakami towarowymi firmy
Google Inc.
This product contains the Universal Font Scaling Technology or UFST® under license from Monotype Imaging, Inc.
UFST® is a trademark of Monotype Imaging, Inc. registered in the United States Patent and Trademark Office and may
be registered in certain jurisdictions.UFST: Copyright © 1989 - 1996, 1997, 2003, 2004, 2008, all rights reserved, by
Monotype Imaging Inc.
Java oraz wszystkie znaki towarowe i logo na bazie Java są znakami towarowymi spółki Oracle i/lub jej podmiotów
zależnych.
643
Dodatek
Adobe, PostScript oraz logo PostScript logo są zastrzeżonymi znakami towarowymi albo znakami towarowymi firmy
Adobe Systems Incorporated w Stanach Zjednoczonych lub innych krajach.
Copyright © 2007 -08 Adobe Systems Incorporated. All rights reserved.
Protected by U.S. Patents 5,737,599; 5,781,785; 5,819,301; 5,929,866; 5,943,063; 6,073,148; 6,515,763; 6,639,593;
6,754,382; 7,046,403; 7,213,269; 7,242,415; Patents pending in the U.S. and other countries.
All instances of the name PostScript in the text are references to the PostScript language as defined by Adobe Systems
Incorporated unless otherwise stated. The name PostScript also is used as a product trademark for Adobe Systems'
implementation of the PostScript language interpreter.
Except as otherwise stated, any reference to a "PostScript printing device," "PostScript display device," or similar item
refers to a printing device, display device or item (respectively) that contains PostScript technology created or licensed
by Adobe Systems Incorporated and not to devices or items that purport to be merely compatible with the PostScript
language.
Adobe, the Adobe logo, PostScript, the PostScript logo, and PostScript 3 are either registered trademarks or
trademarks of Adobe Systems Incorporated in the United States and/or other countries.
Linux is a registered trademark of Linus Torvalds. Microsoft and Windows are either registered trademarks or
trademarks of Microsoft Corporation in the United States and/or other countries.
All other trademarks are the property of their respective owners.
Wszystkie pozostałe marki i nazwy produktów są zastrzeżonym znakami towarowymi, znakami towarowymi lub
znakami usługowymi ich właścicieli.
◼ Copyright
Powielanie zawartości niniejszego dokumentu w całości lub w części bez uprzedniej zgody jest zabronione.
◼ Ograniczenia prawne dotyczące użytkowania produktów i korzystania z obrazów
Używanie produktu do skanowania, drukowania lub w inny sposób powielania niektórych dokumentów oraz
korzystanie z obrazów zeskanowanych, wydrukowanych lub inaczej powielonych może być prawnie zabronione i
zagrożone odpowiedzialnością karną i/lub cywilną. Lista wybranych dokumentów została przedstawiona poniżej i
służy wyłącznie do celów informacyjnych. W przypadku braku pewności co do legalności używania produktu do
skanowania, drukowania lub w inny sposób powielania określonego dokumentu i/lub korzystania z obrazów
zeskanowanych, wydrukowanych lub inaczej powielonych, należy wcześniej skontaktować się z radcą prawnym
celem zasięgnięcia opinii.
● Banknoty
● Czeki podróżne
● Przekazy pieniężne
644
Dodatek
● Kupony żywnościowe
● Certyfikaty depozytu
● Paszporty
● Znaczki pocztowe (ze stemplem lub bez)
● Dokumenty imigracyjne
● Identyfikatory i odznaki
● Znaczki opłaty skarbowej (ze stemplem lub bez)
● Niektóre dokumenty serwisowe lub wersje robocze
● Obligacje lub inne certyfikaty zobowiązań
● Czeki lub wyciągi wystawione przez urzędy państwowe
● Certyfikaty papierów wartościowych
● Prawa jazdy i akty własności
● Dzieła objęte prawami autorskimi/dzieła sztuki bez zgody właściciela praw autorskich
V_181009
645
SIL OPEN FONT LICENSE
This Font Software is licensed under the SIL Open Font License,
Version 1.1.
This license is copied below, and is also available with a FAQ at:
http://scripts.sil.org/OFL
----------------------------------------------------------SIL OPEN FONT LICENSE Version 1.1 - 26 February 2007
----------------------------------------------------------PREAMBLE
The goals of the Open Font License (OFL) are to stimulate worldwide
development of collaborative font projects, to support the font
creation efforts of academic and linguistic communities, and to
provide a free and open framework in which fonts may be shared and
improved in partnership with others.
The OFL allows the licensed fonts to be used, studied, modified and
redistributed freely as long as they are not sold by themselves. The
fonts, including any derivative works, can be bundled, embedded,
redistributed and/or sold with any software provided that any reserved
names are not used by derivative works. The fonts and derivatives,
however, cannot be released under any other type of license. The
requirement for fonts to remain under this license does not apply to
any document created using the fonts or their derivatives.
DEFINITIONS
"Font Software" refers to the set of files released by the Copyright
Holder(s) under this license and clearly marked as such. This may
include source files, build scripts and documentation.
"Reserved Font Name" refers to any names specified as such after the
copyright statement(s).
"Original Version" refers to the collection of Font Software
components as distributed by the Copyright Holder(s).
"Modified Version" refers to any derivative made by adding to,
deleting, or substituting -- in part or in whole -- any of the
components of the Original Version, by changing formats or by porting
the Font Software to a new environment.
"Author" refers to any designer, engineer, programmer, technical
writer or other person who contributed to the Font Software.
PERMISSION & CONDITIONS
Permission is hereby granted, free of charge, to any person obtaining
a copy of the Font Software, to use, study, copy, merge, embed,
modify, redistribute, and sell modified and unmodified copies of the
Font Software, subject to the following conditions:
646
SIL OPEN FONT LICENSE
1) Neither the Font Software nor any of its individual components, in
Original or Modified Versions, may be sold by itself.
2) Original or Modified Versions of the Font Software may be bundled,
redistributed and/or sold with any software, provided that each copy
contains the above copyright notice and this license. These can be
included either as stand-alone text files, human-readable headers or
in the appropriate machine-readable metadata fields within text or
binary files as long as those fields can be easily viewed by the user.
3) No Modified Version of the Font Software may use the Reserved Font
Name(s) unless explicit written permission is granted by the
corresponding Copyright Holder. This restriction only applies to the
primary font name as presented to the users.
4) The name(s) of the Copyright Holder(s) or the Author(s) of the Font
Software shall not be used to promote, endorse or advertise any
Modified Version, except to acknowledge the contribution(s) of the
Copyright Holder(s) and the Author(s) or with their explicit written
permission.
5) The Font Software, modified or unmodified, in part or in whole,
must be distributed entirely under this license, and must not be
distributed under any other license. The requirement for fonts to
remain under this license does not apply to any document created using
the Font Software.
TERMINATION
This license becomes null and void if any of the above conditions are
not met.
DISCLAIMER
THE FONT SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTIES OF
MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT
OF COPYRIGHT, PATENT, TRADEMARK, OR OTHER RIGHT. IN NO EVENT SHALL THE
COPYRIGHT HOLDER BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY,
INCLUDING ANY GENERAL, SPECIAL, INDIRECT, INCIDENTAL, OR CONSEQUENTIAL
DAMAGES, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING
FROM, OUT OF THE USE OR INABILITY TO USE THE FONT SOFTWARE OR FROM
OTHER DEALINGS IN THE FONT SOFTWARE.
647
8VĄXJLGRVWDUF]DQHSU]H]VWURQ\WU]HFLH
.RU]\VWDQLH]DSRĝUHGQLFWZHP352'8.78]XVĄXJGRVWDUF]DQ\FKSU]H]VWURQ\WU]HFLHSRGOHJDRSLVDQ\P
SRQLľHMZDUXQNRP:SU]\SDGNXX]\VNLZDQLDGRVWÛSXGR]DZDUWRĝFLVWURQWU]HFLFK WDNLHMMDNWHNVW\REUD]\
ILOP\ZLGHRQDJUDQLDGļZLÛNRZHOXERSURJUDPRZDQLH EÇGļMHMSR]\VNLZDQLD]DSRĝUHGQLFWZHP
2352*5$02:$1,$EH]Z\UDļQLHM]JRG\ZĄDĝFLFLHOD]DZDUWRĝFLOXE]H]ZROHQLD]DZDUWHJRZSU]HSLVDFK
SUDZQ\FK]DEURQLRQHMHVW D NRU]\VWDQLH]]DZDUWRĝFLGRZĄDVQ\FKFHOµZWZRU]HQLHED]GDQ\FKSU]\MHM
Xľ\FLXRUD]Z\NRQ\ZDQLHWUZDĄ\FKNRSLLWHJRW\SX]DZDUWRĝFLDWDNľHSU]HFKRZ\ZDQLHNRSLLZSDPLÛFLDFK
SRGUÛF]Q\FKGĄXľHMQLľGR]ZRORQHSU]H]ZĄDĝFLFLHODSDPLÛFLSRGUÛF]QHM E NRSLRZDQLHWĄXPDF]HQLH
PRG\ILNRZDQLHWZRU]HQLHSUDFSRFKRGQ\FKVSU]HGDZDQLHZ\QDMPRZDQLHZ\SRľ\F]DQLHSU]HND]\ZDQLH
UR]SRZV]HFKQLDQLHSXEOLF]QHRGWZDU]DQLHRUD]XG]LHODQLHVXEOLFHQFMLVWURQRPWU]HFLP F SU]HGVWDZLDQLH
QLHSUDZG]LZHJRļUµGĄDEÇGļZĄDĝFLFLHOD G XVXZDQLH]DNU\ZDQLHOXEPRG\ILNRZDQLHLQIRUPDFMLRSUDZDFK
DXWRUVNLFK]QDNµZKDQGORZ\FKOXEXZDJQDWHPDWLQQ\FKSUDZZ\QLNDMÇF\FK]ZĄDVQRĝFLIDĄV]RZDQLHOXE
XVXZDQLHRGQLHVLHĆGRDXWRUDLQIRUPDFMLSUDZQ\FKOXELQQ\FKHW\NLHWLQIRUPXMÇF\FKRSRFKRG]HQLXOXEļUµGOH
PDWHULDĄX
– 1 –
2SURJUDPRZDQLHRSDWU]RQHGRGDWNRZ\PLSRVWDQRZLHQLDPLOLFHQF\MQ\PL
:LÛFHMLQIRUPDFMLQDWHQWHPDWRUD]RGSRZLHGQLHZDUXQNLOLFHQFMLPRľQD]QDOHļÉZWDEHOLRSURJUDPRZDQLD
LSRQLľV]\FKSRVWDQRZLHQLDFKOLFHQF\MQ\FK
7DEHODRSURJUDPRZDQLD
1D]ZDRSURJUDPRZDQLD
3RVWDQRZLHQLD GRW\F]ÇFH
OLFHQFML
3DWU]VWU
$GREH3RVW6FULSW
+WWS&OLHQW$OSKD5HOHDVH
&U\SWR$3,
H[SDW
-0(
OLEMLQJOH
0'
1(76103
2SHQ66/
VHUYOHWMDU
– 2 –
-HĝOL SRWU]HEXMHV] NRGX ļUµGĄRZHJRSRQLľV]HJR RSURJUDPRZDQLD Z\ĝOLM ZLDGRPRĝÉ HPDLO ]QDVWÛSXMÇF\PL
LQIRUPDFMDPLZMÛ]\NXDQJLHOVNLPOXEMDSRĆVNLPQDDGUHVRLSRVVJ#FDQRQFRMS! ̽1D]ZD]DNXSLRQHJRPRGHOX
̽1XPHULGHQW\ILNDF\MQ\SURGXNWXZVND]DQ\]W\ĄXMHGQRVWNLJĄµZQHM
:LÛFHMLQIRUPDFMLQDWHQWHPDWRUD]RGSRZLHGQLHZDUXQNLOLFHQFMLPRľQD]QDOHļÉZWDEHOLRSURJUDPRZDQLD
LSRQLľV]\FKSRVWDQRZLHQLDFKOLFHQF\MQ\FK
7DEHODRSURJUDPRZDQLD
1D]ZDRSURJUDPRZDQLD
3RVWDQRZLHQLD GRW\F]ÇFH
OLFHQFML
3DWU]VWU /LQX[
JOLEF
MVRQJOLE
JOLE
26*L5HOHDVH
– 3 –
$GREH3RVW6FULSW
&RS\ULJKW$GREH6\VWHPV,QFRUSRUDWHGDQGLWVOLFHQVRUV $OOULJKWVUHVHUYHG
3RUWLRQVLQFOXGHVRIWZDUHXQGHUWKHIROORZLQJWHUPV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 7KLVSURGXFWFRQWDLQVHLWKHU%6$)(DQGRU7,3(0VRIWZDUHE\56$6HFXULW\,QF
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQVRI3RROFB&RS\ULJKW1H;7,QFDQGSRUWLRQVRI*UDSKLFVFB&RS\ULJKW 1H;7,QFDVDQ
XQSXEOLVKHGZRUN $OO5LJKWV5HVHUYHG
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KH$SDFKH6RIWZDUH/LFHQVH9HUVLRQ
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ KWWSZZZDSDFKHRUJ 3RUWLRQV&RS\ULJKW F 7KH$SDFKH6RIWZDUH)RXQGDWLRQ $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU 5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KH HQGXVHU GRFXPHQWDWLRQ LQFOXGHG ZLWK WKH UHGLVWULEXWLRQ LI DQ\ PXVW LQFOXGH WKH IROORZLQJ
DFNQRZOHGJPHQW 7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ KWWSZZZDSDFKHRUJ $OWHUQDWHO\ WKLV DFNQRZOHGJPHQW PD\ DSSHDU LQ WKH VRIWZDUH LWVHOI LI DQG ZKHUHYHU VXFK WKLUGSDUW\
DFNQRZOHGJPHQWVQRUPDOO\DSSHDU
7KHQDPHV;HUFHVDQG$SDFKH6RIWZDUH)RXQGDWLRQPXVWQRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWV
GHULYHG IURP WKLV VRIWZDUH ZLWKRXW SULRU ZULWWHQ SHUPLVVLRQ )RU ZULWWHQ SHUPLVVLRQ SOHDVH FRQWDFW
DSDFKH#DSDFKHRUJ
3URGXFWVGHULYHGIURPWKLVVRIWZDUHPD\QRWEHFDOOHG$SDFKHQRUPD\$SDFKHDSSHDULQWKHLUQDPH
ZLWKRXWSULRUZULWWHQSHUPLVVLRQRIWKH$SDFKH6RIWZDUH)RXQGDWLRQ
7+,662)7:$5(,63529,'('CC$6,6 $1'$1<(;35(66('25,03/,(':$55$17,(6,1&/8',1*
%87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2) 0(5&+$17$%,/,7< $1' ),71(66 )25 $
3$57,&8/$5 385326( $5( ',6&/$,0(' ,1 12 (9(17 6+$// 7+( $3$&+( 62)7:$5(
)281'$7,2125,76&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)
– 4 –
68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25 %86,1(66
,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1&2175$&7
675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<287
2)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
7KLVVRIWZDUHFRQVLVWVRIYROXQWDU\FRQWULEXWLRQVPDGHE\PDQ\LQGLYLGXDOVRQEHKDOIRIWKH$SDFKH6RIWZDUH
)RXQGDWLRQDQG ZDVRULJLQDOO\EDVHG RQ VRIWZDUH FRS\ULJKW F ,QWHUQDWLRQDO %XVLQHVV 0DFKLQHV ,QF
KWWSZZZLEPFRP )RU PRUH LQIRUPDWLRQ RQ WKH $SDFKH 6RIWZDUH )RXQGDWLRQ SOHDVH VHH
KWWSZZZDSDFKHRUJ!
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
3RUWLRQV&RS\ULJKW F 7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU
5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OO DGYHUWLVLQJ PDWHULDOV PHQWLRQLQJ IHDWXUHV RU XVH RI WKLV VRIWZDUH PXVW GLVSOD\ WKH IROORZLQJ
DFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
1HLWKHU WKH QDPH RI WKH 8QLYHUVLW\ QRUWKHQDPHV RI LWV FRQWULEXWRUV PD\ EHXVHG WRHQGRUVH RUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(5(*(176$1'&2175,%87256$6,6$1'$1<(;35(66
25 ,03/,(' :$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2)
0(5&+$17$%,/,7< $1' ),71(66 )25$3$57,&8/$5385326( $5( ',6&/$,0(' ,1 12 (9(17
6+$// 7+( 5(*(176 25 &2175,%87256 %( /,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/
63(&,$/ (;(03/$5< 25 &216(48(17,$/ '$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72
352&85(0(17 2) 68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25
%86,1(66 ,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1
&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<
:$< 287 2) 7+( 86( 2) 7+,6 62)7:$5( (9(1 ,) $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQV&RS\ULJKW F 7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD$OOULJKWVUHVHUYHG
– 5 –
7KLVFRGHLVGHULYHGIURPVRIWZDUHFRQWULEXWHGWR%HUNHOH\E\-DPHV$:RRGVGHULYHGIURPRULJLQDOZRUNE\
6SHQFHU7KRPDVDQG-RVHSK2URVW
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVDUHSHUPLWWHGSURYLGHGWKDWWKHDERYHFRS\ULJKWQRWLFHDQG
WKLVSDUDJUDSKDUHGXSOLFDWHGLQDOOVXFKIRUPVDQGWKDWDQ\GRFXPHQWDWLRQDGYHUWLVLQJPDWHULDOVDQGRWKHU
PDWHULDOVUHODWHGWRVXFKGLVWULEXWLRQDQGXVHDFNQRZOHGJHWKDWWKHVRIWZDUHZDVGHYHORSHGE\WKH8QLYHUVLW\
RI&DOLIRUQLD%HUNHOH\ 7KHQDPHRIWKH8QLYHUVLW\PD\QRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHG
IURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,6 62)7:$5( ,6 3529,'(' CC$6 ,6 $1' :,7+287 $1< (;35(66 25 ,03/,(' :$55$17,(6
,1&/8',1*:,7+287/,0,7$7,217+(,03/,(':$55$17,(62)0(5&+$17,%,/,7<$1'),71(66
)25$3$57,&8/$5385326(
3RUWLRQV&RS\ULJKW F ;&RQVRUWLXP
3HUPLVVLRQLVKHUHE\JUDQWHGIUHHRIFKDUJHWRDQ\SHUVRQREWDLQLQJDFRS\RIWKLVVRIWZDUHDQGDVVRFLDWHG
GRFXPHQWDWLRQILOHV WKH6RIWZDUH WRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKH
ULJKWVWRXVHFRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHVXEOLFHQVHDQGRUVHOOFRSLHVRIWKH6RIWZDUHDQGWR
SHUPLWSHUVRQVWRZKRPWKH6RIWZDUHLVIXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
7KHDERYHFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHVKDOOEHLQFOXGHGLQDOOFRSLHVRUVXEVWDQWLDOSRUWLRQVRI
WKH6RIWZDUH
7+( 62)7:$5( ,6 3529,'(' $6,6 :,7+287 :$55$17< 2) $1< .,1' (;35(66 25,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7<),71(66 )25 $
3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 ,1 12 (9(17 6+$// 7+(; &216257,80 %(
/,$%/( )25$1< &/$,0 '$0$*(6 25 27+(5 /,$%,/,7< :+(7+(5 ,1$1 $&7,21 2) &2175$&7
72572527+(5:,6($5,6,1*)5202872)25,1&211(&7,21:,7+7+(62)7:$5(257+(
86(2527+(5'($/,1*6,17+(62)7:$5(
([FHSWDVFRQWDLQHGLQWKLVQRWLFHWKHQDPHRIWKH;&RQVRUWLXPVKDOOQRWEHXVHGLQDGYHUWLVLQJRURWKHUZLVH
WR SURPRWH WKH VDOH XVH RU RWKHU GHDOLQJV LQ WKLV 6RIWZDUH ZLWKRXW SULRU ZULWWHQ DXWKRUL]DWLRQ IURP WKH ;
&RQVRUWLXP
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
127,&(5(*$5',1*6$%/27521
0DUFK
– 6 –
3RUWLRQVRIWKLVSURGXFWDUHEDVHGRQ0RGLILFDWLRQVFUHDWHGIURPWKH2ULJLQDO&RGHNQRZQDVWKH6DEORWURQ
;6/7 3URFHVVRU 7KH 6DEORWURQ ;6/7 3URFHVVRU LV VXEMHFW WR WKH 0R]LOOD 3XEOLF /LFHQVH 9HUVLRQ WKH
/LFHQVH <RXPD\REWDLQDFRS\RI
WKH/LFHQVHDWKWWSZZZPR]LOODRUJ03/
6RIWZDUH GLVWULEXWHG XQGHU WKH /LFHQVH LV GLVWULEXWHG RQDQ$6 ,6EDVLV :,7+287 :$55$17< 2) $1<
.,1'HLWKHUH[SUHVVRULPSOLHG6HHWKH/LFHQVHIRUWKHVSHFLILFODQJXDJHJRYHUQLQJULJKWVDQGOLPLWDWLRQVXQGHU
WKH/LFHQVH
7KH2ULJLQDO&RGHLVWKH6DEORWURQ;6/73URFHVVRU
7KH ,QLWLDO 'HYHORSHU RI WKH 2ULJLQDO &RGH LV *LQJHU $OOLDQFH /WG 3RUWLRQV FUHDWHG E\ *LQJHU $OOLDQFH DUH
&RS\ULJKW & *LQJHU$OOLDQFH/WG$OO5LJKWV5HVHUYHG
3XUVXDQWWRVHFWLRQVDQGRIWKH/LFHQVHWKH0RGLILFDWLRQVFUHDWHGE\$GREH6\VWHPV,QFRUSRUDWHGDUH
DYDLODEOHDV6RXUFH&RGH7KH0RGLILFDWLRQVPD\EHGRZQORDGHGYLDWKH,QWHUQHWIURP
KWWSSDUWQHUVDGREHFRPDVQWHFK[POVDEORWURQLQGH[MVS
7KH2ULJLQDO&RGHPD\EHGRZQORDGHGYLDWKH,QWHUQHWIURP
KWWSVVRXUFHIRUJHQHWSURMHFWVVDEORWURQ
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
3RUWLRQV &RS\ULJKW F 7KH 5HJHQWV RI WKH
8QLYHUVLW\RI&DOLIRUQLD $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU
5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OO DGYHUWLVLQJ PDWHULDOV PHQWLRQLQJ IHDWXUHV RU XVH RI WKLV VRIWZDUH PXVW GLVSOD\ WKH IROORZLQJ
DFNQRZOHGJHPHQW 7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWV
FRQWULEXWRUV
1HLWKHU WKH QDPH RI WKH 8QLYHUVLW\ QRUWKHQDPHV RI LWV FRQWULEXWRUV PD\ EHXVHG WRHQGRUVH RUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
– 7 –
7+,662)7:$5(,63529,'('%<7+(5(*(176$1'&2175,%87256$6,6$1'$1<(;35(66
25 ,03/,(' :$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2)
0(5&+$17$%,/,7< $1' ),71(66 )25$3$57,&8/$5385326( $5( ',6&/$,0(' ,1 12 (9(17
6+$// 7+( 5(*(176 25 &2175,%87256 %( /,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/
63(&,$/ (;(03/$5< 25 &216(48(17,$/ '$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72
352&85(0(17 2) 68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25
%86,1(66 ,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1
&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<
:$< 287 2) 7+( 86( 2) 7+,6 62)7:$5( (9(1 ,) $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQV&RS\ULJKW F E\$QGUHL$OH[DQGUHVFX 7KLVFRGHDFFRPSDQLHVWKHERRN
$OH[DQGUHVFX$QGUHL0RGHUQ&'HVLJQ*HQHULF3URJUDPPLQJDQG'HVLJQ3DWWHUQV$SSOLHG&RS\ULJKW
F $GGLVRQ:HVOH\
3HUPLVVLRQWRXVHFRS\PRGLI\GLVWULEXWHDQGVHOOWKLVVRIWZDUHIRUDQ\SXUSRVHLVKHUHE\JUDQWHGZLWKRXWIHH
SURYLGHG WKDW WKH DERYH FRS\ULJKW QRWLFH DSSHDU LQ DOO FRSLHV DQG WKDW ERWK WKDW FRS\ULJKW QRWLFH DQG WKLV
SHUPLVVLRQ QRWLFHDSSHDU LQ VXSSRUWLQJ GRFXPHQWDWLRQ 7KHDXWKRU RU $GGLVRQ:HOVH\ /RQJPDQ PDNH QR
UHSUHVHQWDWLRQVDERXWWKHVXLWDELOLW\RIWKLVVRIWZDUHIRUDQ\SXUSRVH,WLVSURYLGHGDVLVZLWKRXWH[SUHVVRU
LPSOLHGZDUUDQW\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQVGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
3RUWLRQV &RS\ULJKW k 8QLFRGH ,QF $OO ULJKWV UHVHUYHG 'LVWULEXWHG XQGHU WKH 7HUPV RI 8VH LQ
KWWSZZZXQLFRGHRUJFRS\ULJKWKWPO
3HUPLVVLRQ LVKHUHE\ JUDQWHG IUHHRI FKDUJHWRDQ\ SHUVRQREWDLQLQJ D FRS\RIWKH 8QLFRGHGDWDILOHVDQG
DVVRFLDWHG GRFXPHQWDWLRQ WKH 'DWD )LOHV RU 8QLFRGH VRIWZDUH DQG DVVRFLDWHG GRFXPHQWDWLRQ WKH
6RIWZDUH WRGHDOLQWKH'DWD)LOHVRU6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKHULJKWVWRXVH
FRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHDQGRUVHOOFRSLHVRIWKH'DWD)LOHVRU6RIWZDUHDQGWRSHUPLWSHUVRQV
WRZKRPWKH'DWD)LOHVRU6RIWZDUHDUHIXUQLVKHGWRGRVRSURYLGHGWKDW D WKHDERYHFRS\ULJKWQRWLFH V DQG
WKLVSHUPLVVLRQQRWLFHDSSHDULQDOOFRSLHVRIWKH'DWD)LOHVRU6RIWZDUH E ERWKWKHDERYHFRS\ULJKWQRWLFH V DQGWKLVSHUPLVVLRQQRWLFHDSSHDULQDVVRFLDWHGGRFXPHQWDWLRQDQG F WKHUHLVFOHDUQRWLFHLQHDFKPRGLILHG
'DWD)LOHRULQWKH6RIWZDUHDVZHOODVLQWKHGRFXPHQWDWLRQDVVRFLDWHGZLWKWKH'DWD)LOH V RU6RIWZDUHWKDW
WKHGDWDRUVRIWZDUHKDVEHHQPRGLILHG
7+( '$7$ ),/(6 $1' 62)7:$5( $5( 3529,'(' $6 ,6 :,7+287 :$55$17< 2) $1< .,1'
(;35(6625,03/,(',1&/8',1*%87127/,0,7('727+(:$55$17,(62)0(5&+$17$%,/,7<
– 8 –
),71(66)25$3$57,&8/$5385326($1'121,1)5,1*(0(172)7+,5'3$57<5,*+76,112
(9(176+$// 7+( &23<5,*+7 +2/'(5 25 +2/'(56 ,1&/8'(',1 7+,6 127,&( %(/,$%/( )25
$1< &/$,0 25 $1< 63(&,$/ ,1',5(&7 25 &216(48(17,$/ '$0$*(6 25 $1< '$0$*(6
:+$762(9(5 5(68/7,1* )520 /2662) 86( '$7$ 25352),76 :+(7+(5 ,1 $1$&7,212)
&2175$&71(*/,*(1&(2527+(57257,286$&7,21$5,6,1*2872)25,1&211(&7,21:,7+
7+(86(253(5)250$1&(2)7+('$7$),/(62562)7:$5(
([FHSWDVFRQWDLQHGLQWKLVQRWLFHWKHQDPHRIDFRS\ULJKWKROGHUVKDOOQRWEHXVHGLQDGYHUWLVLQJRURWKHUZLVH
WRSURPRWHWKHVDOHXVHRURWKHUGHDOLQJVLQWKHVH'DWD)LOHVRU6RIWZDUHZLWKRXWSULRUZULWWHQDXWKRUL]DWLRQRI
WKHFRS\ULJKWKROGHU
8QLFRGHDQGWKH8QLFRGHORJRDUHWUDGHPDUNVRI8QLFRGH,QFDQGPD\EHUHJLVWHUHGLQVRPHMXULVGLFWLRQV$OO
RWKHU WUDGHPDUNV DQG UHJLVWHUHG WUDGHPDUNV PHQWLRQHG KHUHLQ DUH WKH SURSHUW\ RI WKHLU UHVSHFWLYH RZQHUV
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
$GREHVKDOOUHWDLQDQGUHSURGXFHDQGUHTXLUHLWV6XEOLFHQVHHVWRUHWDLQDQGUHSURGXFH-,0 VIROORZLQJFRS\ULJKW
QRWLFHZLWKLQHDFKFRS\RIWKHOLFHQVHGSURJUDPVLQDQ\IRUPLQZKROHRULQSDUWk-0,&RQVXOWDQWV
,QF$OOULJKWVUHVHUYHG BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
3RUWLRQV&RS\ULJKW F 7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD $OOULJKWVUHVHUYHG
7KLVFRGHLVGHULYHGIURPVRIWZDUHFRQWULEXWHGWR%HUNHOH\E\&KULV7RUHN
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU
5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OO DGYHUWLVLQJ PDWHULDOV PHQWLRQLQJ IHDWXUHV RU XVH RI WKLV VRIWZDUH PXVW GLVSOD\ WKH IROORZLQJ
DFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH8QLYHUVLW\RI&DOLIRUQLD%HUNHOH\DQGLWVFRQWULEXWRUV
1HLWKHU WKH QDPH RI WKH 8QLYHUVLW\ QRUWKHQDPHV RI LWV FRQWULEXWRUV PD\ EHXVHG WRHQGRUVH RUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(5(*(176$1'&2175,%87256$6,6$1'$1<(;35(66
25 ,03/,(' :$55$17,(6 ,1&/8',1* %87 127 /,0,7(' 72 7+( ,03/,(' :$55$17,(6 2)
– 9 –
0(5&+$17$%,/,7< $1' ),71(66 )25$3$57,&8/$5385326( $5( ',6&/$,0(' ,1 12 (9(17
6+$// 7+( 5(*(176 25 &2175,%87256 %( /,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/
63(&,$/ (;(03/$5< 25 &216(48(17,$/ '$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72
352&85(0(17 2) 68%67,787( *22'6 25 6(59,&(6 /266 2) 86( '$7$ 25 352),76 25
%86,1(66 ,17(55837,21 +2:(9(5 &$86(' $1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1
&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<
:$< 287 2) 7+( 86( 2) 7+,6 62)7:$5( (9(1 ,) $'9,6(' 2) 7+( 3266,%,/,7< 2) 68&+
'$0$*(
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7KH/RNL/LEUDU\
3RUWLRQV &RS\ULJKW F E\ $QGUHL $OH[DQGUHVFX 7KLV FRGH DFFRPSDQLHV WKH ERRN $OH[DQGUHVFX
$QGUHL 0RGHUQ & 'HVLJQ *HQHULF 3URJUDPPLQJ DQG 'HVLJQ 3DWWHUQV $SSOLHG &RS\ULJKW F $GGLVRQ:HVOH\
3HUPLVVLRQWRXVHFRS\PRGLI\GLVWULEXWHDQGVHOOWKLVVRIWZDUHIRUDQ\SXUSRVHLVKHUHE\JUDQWHGZLWKRXWIHH
SURYLGHG WKDW WKH DERYH FRS\ULJKW QRWLFH DSSHDU LQ DOO FRSLHV DQG WKDW ERWK WKDW FRS\ULJKW QRWLFH DQG WKLV
SHUPLVVLRQ QRWLFHDSSHDU LQ VXSSRUWLQJ GRFXPHQWDWLRQ 7KHDXWKRU RU $GGLVRQ:HVOH\ /RQJPDQ PDNH QR
UHSUHVHQWDWLRQVDERXWWKHVXLWDELOLW\RIWKLVVRIWZDUHIRUDQ\SXUSRVH,WLVSURYLGHGDVLVZLWKRXWH[SUHVVRU
LPSOLHGZDUUDQW\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
8SGDWHG,QIRUPDWLRQ$GGLWLRQDO7KLUG3DUW\&RGH,QIRUPDWLRQDYDLODEOHDWKWWSZZZDGREHFRPJRWKLUGSDUW\
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
– 10 –
+WWS&OLHQW$OSKD5HOHDVH
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ
KWWSZZZDSDFKHRUJ DQGLVVXEMHFWWRWKHIROORZLQJWHUPVDQGFRQGLWLRQV
&RS\ULJKW F 7KH$SDFKH6RIWZDUH)RXQGDWLRQ$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQ
DUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLV
OLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKWQRWLFHWKLV
OLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHU
PDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHHQGXVHUGRFXPHQWDWLRQLQFOXGHGZLWKWKHUHGLVWULEXWLRQLIDQ\PXVW
LQFOXGHWKHIROORZLQJDFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH$SDFKH6RIWZDUH)RXQGDWLRQ
KWWSZZZDSDFKHRUJ $OWHUQDWHO\WKLVDFNQRZOHGJHPHQWPD\DSSHDULQWKHVRIWZDUHLWVHOILIDQG
ZKHUHYHUVXFKWKLUGSDUW\DFNQRZOHGJHPHQWVQRUPDOO\DSSHDU
7KHQDPHV7KH-DNDUWD3URMHFW&RPPRQV;HUFHV&ULPVRQ9HORFLW\
DQG$SDFKH6RIWZDUH)RXQGDWLRQPXVWQRWEHXVHGWRHQGRUVHRUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWSULRUZULWWHQSHUPLVVLRQ)RUZULWWHQ
SHUPLVVLRQSOHDVHFRQWDFWDSDFKH#DSDFKHRUJ
3URGXFWVGHULYHGIURPWKLVVRIWZDUHPD\QRWEHFDOOHG-DNDUWD&RPPRQV
;HUFHV&ULPVRQ9HORFLW\RU$SDFKHQRUPD\-DNDUWD&RPPRQV
;HUFHV&ULPVRQ9HORFLW\RU$SDFKHDSSHDULQWKHLUQDPHVZLWKRXWSULRU
ZULWWHQSHUPLVVLRQRIWKH$SDFKH*URXS
– 11 –
12:$55$17< 7+,662)7:$5(,63529,'('$6,6$1'$1<(;35(66('25
,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25
$3$57,&8/$5385326($5(',6&/$,0(',112(9(176+$//
7+($3$&+(62)7:$5()281'$7,2125,76&2175,%87256
%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87
127/,0,7('72352&85(0(172)68%67,787(*22'625
6(59,&(6/2662)86('$7$25352),7625%86,1(66
,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)
/,$%,/,7<:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257
,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<
2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)7+(
3266,%,/,7<2)68&+'$0$*(
7KLVVRIWZDUHFRQVLVWVRIYROXQWDU\FRQWULEXWLRQVPDGHE\PDQ\LQGLYLGXDOVRQ
EHKDOIRIWKH$SDFKH6RIWZDUH)RXQGDWLRQ)RUPRUHLQIRUPDWLRQRQWKH$SDFKH
6RIWZDUH)RXQGDWLRQSOHDVHVHHKWWSZZZDSDFKHRUJ!
– 12 –
&U\SWR$3,
&23<5,*+7,1)250$7,21
&RS\ULJKW F 7KH/HJLRQ2I7KH%RXQF\&DVWOH KWWSZZZERXQF\FDVWOHRUJ 3HUPLVVLRQLVKHUHE\JUDQWHGIUHHRIFKDUJHWRDQ\SHUVRQREWDLQLQJDFRS\RIWKLVVRIWZDUHDQGDVVRFLDWHG
GRFXPHQWDWLRQILOHV WKH6RIWZDUH WRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKH
ULJKWVWRXVHFRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHVXEOLFHQVHDQGRUVHOOFRSLHVRIWKH6RIWZDUHDQGWR
SHUPLWSHUVRQVWRZKRPWKH6RIWZDUHLVIXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
7KHDERYHFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHVKDOOEHLQFOXGHGLQDOOFRSLHVRUVXEVWDQWLDOSRUWLRQVRI
WKH6RIWZDUH
7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<2)$1<.,1'(;35(6625,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66 )25 $
3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 ,1 12 (9(17 6+$// 7+( $87+256 25
&23<5,*+7+2/'(56%(/,$%/()25$1<&/$,0'$0$*(62527+(5/,$%,/,7<:+(7+(5,1$1
$&7,212)&2175$&772572527+(5:,6($5,6,1*)5202872)25,1&211(&7,21:,7+
7+(62)7:$5(257+(86(2527+(5'($/,1*6,17+(62)7:$5(
– 13 –
H[SDW
&RS\ULJKW F 7KDL2SHQ6RXUFH6RIWZDUH&HQWHU/WG
DQG&ODUN&RRSHU
&RS\ULJKW F ([SDWPDLQWDLQHUV
3HUPLVVLRQLVKHUHE\JUDQWHGIUHHRIFKDUJHWRDQ\SHUVRQREWDLQLQJDFRS\RIWKLVVRIWZDUHDQGDVVRFLDWHG
GRFXPHQWDWLRQILOHV WKH6RIWZDUH WRGHDOLQWKH6RIWZDUHZLWKRXWUHVWULFWLRQLQFOXGLQJZLWKRXWOLPLWDWLRQWKH
ULJKWVWRXVHFRS\PRGLI\PHUJHSXEOLVKGLVWULEXWHVXEOLFHQVHDQGRUVHOOFRSLHVRIWKH6RIWZDUHDQGWR
SHUPLWSHUVRQVWRZKRPWKH6RIWZDUHLVIXUQLVKHGWRGRVRVXEMHFWWRWKHIROORZLQJFRQGLWLRQV
7KHDERYHFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHVKDOOEHLQFOXGHGLQDOOFRSLHVRUVXEVWDQWLDOSRUWLRQVRI
WKH6RIWZDUH
7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<2)$1<.,1'(;35(6625,03/,('
,1&/8',1* %87 127 /,0,7(' 72 7+( :$55$17,(6 2) 0(5&+$17$%,/,7< ),71(66 )25 $
3$57,&8/$5 385326( $1' 121,1)5,1*(0(17 ,1 12 (9(17 6+$// 7+( $87+256 25
&23<5,*+7+2/'(56%(/,$%/()25$1<&/$,0'$0$*(62527+(5/,$%,/,7<:+(7+(5,1$1
$&7,212)&2175$&772572527+(5:,6($5,6,1*)5202872)25,1&211(&7,21:,7+
7+(62)7:$5(257+(86(2527+(5'($/,1*6,17+(62)7:$5(
– 14 –
-0(
6RIWZDUHLVDಯFRPPHUFLDOLWHPರDVWKDWWHUPLVGHILQHGLQ&)5 2FW FRQVLVWLQJRIಯFRPPHUFLDO
FRPSXWHUVRIWZDUHರDQGಯFRPPHUFLDOFRPSXWHUVRIWZDUHGRFXPHQWDWLRQರDVVXFKWHUPVDUHXVHGLQ&)5
6HSW &RQVLVWHQW ZLWK &)5 DQG &)5 WKURXJK -XQH DOO 86
*RYHUQPHQW(QG8VHUVDFTXLUH6RIWZDUHZLWKRQO\WKRVHULJKWVVHWIRUWKKHUHLQ
– 15 –
OLEMLQJOH
&RS\ULJKW*RRJOH,QF
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXWPRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKH
IROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJ
GLVFODLPHU 5HGLVWULEXWLRQV LQ ELQDU\ IRUP PXVW UHSURGXFH WKH DERYH FRS\ULJKW QRWLFH WKLV OLVW RI FRQGLWLRQV DQG WKH
IROORZLQJGLVFODLPHULQWKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHQDPHRIWKHDXWKRUPD\QRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXW
VSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,6 62)7:$5( ,6 3529,'(' %< 7+( $87+25 CC$6 ,6 $1' $1< (;35(66 25 ,03/,('
:$55$17,(6,1&/8',1*%87127/,0,7('727+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<
$1'),71(66)25$3$57,&8/$5385326($5(',6&/$,0(',112(9(176+$//7+($87+25%(
/,$%/( )25 $1< ',5(&7 ,1',5(&7 ,1&,'(17$/ 63(&,$/ (;(03/$5< 25 &216(48(17,$/
'$0$*(6 ,1&/8',1* %87 127 /,0,7(' 72 352&85(0(17 2) 68%67,787( *22'6 25
6(59,&(6/2662) 86( '$7$25 352),76 25 %86,1(66 ,17(55837,21 +2:(9(5 &$86('
$1' 21 $1< 7+(25< 2) /,$%,/,7< :+(7+(5 ,1 &2175$&7 675,&7 /,$%,/,7< 25 7257
,1&/8',1* 1(*/,*(1&( 25 27+(5:,6( $5,6,1* ,1 $1< :$< 287 2) 7+( 86( 2) 7+,6
62)7:$5((9(1,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
– 16 –
0'
56$'DWD6HFXULW\,QF0'0HVVDJH'LJHVW$OJRULWKP
– 17 –
1(76103
9DULRXVFRS\ULJKWVDSSO\WRWKLVSDFNDJHOLVWHGLQYDULRXVVHSDUDWHSDUWV
EHORZ 3OHDVHPDNHVXUHWKDW\RXUHDGDOOWKHSDUWV 8SXQWLO
WKHSURMHFWZDVEDVHGDW8&'DYLVDQGWKHILUVWSDUWFRYHUVDOOFRGH
ZULWWHQGXULQJWKLVWLPH )URPRQZDUGVWKHSURMHFWKDVEHHQ
EDVHGDW6RXUFH)RUJHDQG1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QFKROGWKH
FRS\ULJKWRQEHKDOIRIWKHZLGHU1HW6103FRPPXQLW\FRYHULQJDOO
GHULYDWLYHZRUNGRQHVLQFHWKHQ $QDGGLWLRQDOFRS\ULJKWVHFWLRQKDV
EHHQDGGHGDV3DUWEHORZDOVRXQGHUD%6'OLFHQVHIRUWKHZRUN
FRQWULEXWHGE\&DPEULGJH%URDGEDQG/WGWRWKHSURMHFWVLQFH
$QDGGLWLRQDOFRS\ULJKWVHFWLRQKDVEHHQDGGHGDV3DUWEHORZDOVR
XQGHUD%6'OLFHQVHIRUWKHZRUNFRQWULEXWHGE\6XQ0LFURV\VWHPV,QF
WRWKHSURMHFWVLQFH
&RGHKDVEHHQFRQWULEXWHGWRWKLVSURMHFWE\PDQ\SHRSOHRYHU
WKH\HDUVLWKDVEHHQLQGHYHORSPHQWDQGDIXOOOLVWRIFRQWULEXWRUV
FDQEHIRXQGLQWKH5($'0(ILOHXQGHUWKH7+$1.6VHFWLRQ
3DUW&088&'FRS\ULJKWQRWLFH %6'OLNH &RS\ULJKWE\&DUQHJLH0HOORQ8QLYHUVLW\
'HULYDWLYH:RUN
&RS\ULJKW7KH5HJHQWVRIWKH8QLYHUVLW\RI&DOLIRUQLD
$OO5LJKWV5HVHUYHG
3HUPLVVLRQWRXVHFRS\PRGLI\DQGGLVWULEXWHWKLVVRIWZDUHDQGLWV
GRFXPHQWDWLRQIRUDQ\SXUSRVHDQGZLWKRXWIHHLVKHUHE\JUDQWHG
SURYLGHGWKDWWKHDERYHFRS\ULJKWQRWLFHDSSHDUVLQDOOFRSLHVDQG
WKDWERWKWKDWFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHDSSHDULQ
VXSSRUWLQJGRFXPHQWDWLRQDQGWKDWWKHQDPHRI&08DQG7KH5HJHQWVRI
WKH8QLYHUVLW\RI&DOLIRUQLDQRWEHXVHGLQDGYHUWLVLQJRUSXEOLFLW\
SHUWDLQLQJWRGLVWULEXWLRQRIWKHVRIWZDUHZLWKRXWVSHFLILFZULWWHQ
SHUPLVVLRQ
– 18 –
&08$1'7+(5(*(1762)7+(81,9(56,7<2)&$/,)251,$',6&/$,0$//
:$55$17,(6:,7+5(*$5'727+,662)7:$5(,1&/8',1*$//,03/,('
:$55$17,(62)0(5&+$17$%,/,7<$1'),71(66 ,112(9(176+$//&0825
7+(5(*(1762)7+(81,9(56,7<2)&$/,)251,$%(/,$%/()25$1<63(&,$/
,1',5(&725&216(48(17,$/'$0$*(625$1<'$0$*(6:+$762(9(55(68/7,1*
)5207+(/2662)86('$7$25352),76:+(7+(5,1$1$&7,212)
&2175$&71(*/,*(1&(2527+(57257,286$&7,21$5,6,1*2872)25,1
&211(&7,21:,7+7+(86(253(5)250$1&(2)7+,662)7:$5(
3DUW1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QFFRS\ULJKWQRWLFH %6' &RS\ULJKW F 1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QF
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRIWKH1HWZRUNV$VVRFLDWHV7HFKQRORJ\,QFQRUWKH
QDPHVRILWVFRQWULEXWRUVPD\EHXVHGWRHQGRUVHRUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQ
SHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
– 19 –
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW&DPEULGJH%URDGEDQG/WGFRS\ULJKWQRWLFH %6' 3RUWLRQVRIWKLVFRGHDUHFRS\ULJKW F &DPEULGJH%URDGEDQG/WG
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHQDPHRI&DPEULGJH%URDGEDQG/WGPD\QRWEHXVHGWRHQGRUVHRU
SURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRU
ZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(5CC$6,6 $1'$1<
(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5%(
/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25
&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)
68%67,787(*22'6256(59,&(6/2662)86('$7$25352),7625
%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(
2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1
,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW6XQ0LFURV\VWHPV,QFFRS\ULJKWQRWLFH %6' – 20 –
&RS\ULJKWk6XQ0LFURV\VWHPV,QF1HWZRUN&LUFOH6DQWD&ODUD &DOLIRUQLD86$$OOULJKWVUHVHUYHG
8VHLVVXEMHFWWROLFHQVHWHUPVEHORZ
7KLVGLVWULEXWLRQPD\LQFOXGHPDWHULDOVGHYHORSHGE\WKLUGSDUWLHV
6XQ6XQ0LFURV\VWHPVWKH6XQORJRDQG6RODULVDUHWUDGHPDUNVRUUHJLVWHUHG WUDGHPDUNVRI6XQ0LFURV\VWHPV,QFLQWKH86DQGRWKHUFRXQWULHV
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRIWKH6XQ0LFURV\VWHPV,QFQRUWKH
QDPHVRILWVFRQWULEXWRUVPD\EHXVHGWRHQGRUVHRUSURPRWH
SURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQ
SHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
– 21 –
3DUW6SDUWD,QFFRS\ULJKWQRWLFH %6' &RS\ULJKW F 6SDUWD,QF
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRI6SDUWD,QFQRUWKHQDPHVRILWVFRQWULEXWRUVPD\
EHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUH
ZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW&LVFR%8371,&FRS\ULJKWQRWLFH %6' &RS\ULJKW F &LVFR,QFDQG,QIRUPDWLRQ1HWZRUN
&HQWHURI%HLMLQJ8QLYHUVLW\RI3RVWVDQG7HOHFRPPXQLFDWLRQV
$OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
– 22 –
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRI&LVFR,QF%HLMLQJ8QLYHUVLW\RI3RVWVDQG
7HOHFRPPXQLFDWLRQVQRUWKHQDPHVRIWKHLUFRQWULEXWRUVPD\
EHXVHGWRHQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUH
ZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256CC$6
,6 $1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('72
7+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5625
&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72
352&85(0(172)68%67,787(*22'6256(59,&(6/2662)86('$7$25352),76
25%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(25
27+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
3DUW)DEDVRIW5 '6RIWZDUH*PE+ &R.*FRS\ULJKWQRWLFH %6' &RS\ULJKW F )DEDVRIW5 '6RIWZDUH*PE+ &R.*
RVV#IDEDVRIWFRP
$XWKRU%HUQKDUG3HQ]EHUQKDUGSHQ]#IDEDVRIWFRP!
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
– 23 –
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
7KHQDPHRI)DEDVRIW5 '6RIWZDUH*PE+ &R.*RUDQ\RILWVVXEVLGLDULHV EUDQGRUSURGXFWQDPHVPD\QRWEHXVHGWRHQGRUVHRUSURPRWHSURGXFWV GHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRUZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(5CC$6,6 $1'$1<
(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(&23<5,*+7+2/'(5%(
/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25
&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)
68%67,787(*22'6256(59,&(6/2662)86('$7$25352),7625
%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<
:+(7+(5,1&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(
2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1
,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(
– 24 –
2SHQ66/
2SHQ66//LFHQVH
&RS\ULJKW F 7KH2SHQ66/3URMHFW $OOULJKWVUHVHUYHG
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQV
DUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU 5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQ
WKHGRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKH
GLVWULEXWLRQ
$OODGYHUWLVLQJPDWHULDOVPHQWLRQLQJIHDWXUHVRUXVHRIWKLV
VRIWZDUHPXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/3URMHFW
IRUXVHLQWKH2SHQ66/7RRONLW KWWSZZZRSHQVVORUJ 7KHQDPHV2SHQ66/7RRONLWDQG2SHQ66/3URMHFWPXVWQRWEHXVHGWR
HQGRUVHRUSURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXW
SULRUZULWWHQSHUPLVVLRQ)RUZULWWHQSHUPLVVLRQSOHDVHFRQWDFW
RSHQVVOFRUH#RSHQVVORUJ
3URGXFWVGHULYHGIURPWKLVVRIWZDUHPD\QRWEHFDOOHG2SHQ66/
QRUPD\2SHQ66/DSSHDULQWKHLUQDPHVZLWKRXWSULRUZULWWHQ
SHUPLVVLRQRIWKH2SHQ66/3URMHFW
5HGLVWULEXWLRQVRIDQ\IRUPZKDWVRHYHUPXVWUHWDLQWKHIROORZLQJ
DFNQRZOHGJPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHGHYHORSHGE\WKH2SHQ66/3URMHFW
IRUXVHLQWKH2SHQ66/7RRONLW KWWSZZZRSHQVVORUJ – 25 –
7+,662)7:$5(,63529,'('%<7+(2SHQ66/352-(&7CC$6,6 $1'$1<
(;35(66('25,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326($5(',6&/$,0(' ,112(9(176+$//7+(2SHQ66/352-(&725
,76&2175,%87256%(/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/
63(&,$/(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*%87
127/,0,7('72352&85(0(172)68%67,787(*22'6256(59,&(6
/2662)86('$7$25352),7625%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1&2175$&7
675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('
2)7+(3266,%,/,7<2)68&+'$0$*(
7KLVSURGXFWLQFOXGHVFU\SWRJUDSKLFVRIWZDUHZULWWHQE\(ULF<RXQJ
HD\#FU\SWVRIWFRP 7KLVSURGXFWLQFOXGHVVRIWZDUHZULWWHQE\7LP
+XGVRQ WMK#FU\SWVRIWFRP 2ULJLQDO66/HD\/LFHQVH
&RS\ULJKW & (ULF<RXQJ HD\#FU\SWVRIWFRP $OOULJKWVUHVHUYHG
7KLVSDFNDJHLVDQ66/LPSOHPHQWDWLRQZULWWHQ
E\(ULF<RXQJ HD\#FU\SWVRIWFRP 7KHLPSOHPHQWDWLRQZDVZULWWHQVRDVWRFRQIRUPZLWK1HWVFDSHV66/
7KLVOLEUDU\LVIUHHIRUFRPPHUFLDODQGQRQFRPPHUFLDOXVHDVORQJDV
WKHIROORZLQJFRQGLWLRQVDUHDKHDUHGWR 7KHIROORZLQJFRQGLWLRQV
DSSO\WRDOOFRGHIRXQGLQWKLVGLVWULEXWLRQEHLWWKH5&56$
OKDVK'(6HWFFRGHQRWMXVWWKH66/FRGH 7KH66/GRFXPHQWDWLRQ
LQFOXGHGZLWKWKLVGLVWULEXWLRQLVFRYHUHGE\WKHVDPHFRS\ULJKWWHUPV
H[FHSWWKDWWKHKROGHULV7LP+XGVRQ WMK#FU\SWVRIWFRP – 26 –
&RS\ULJKWUHPDLQV(ULF<RXQJ VDQGDVVXFKDQ\&RS\ULJKWQRWLFHVLQ
WKHFRGHDUHQRWWREHUHPRYHG
,IWKLVSDFNDJHLVXVHGLQDSURGXFW(ULF<RXQJVKRXOGEHJLYHQDWWULEXWLRQ
DVWKHDXWKRURIWKHSDUWVRIWKHOLEUDU\XVHG
7KLVFDQEHLQWKHIRUPRIDWH[WXDOPHVVDJHDWSURJUDPVWDUWXSRU
LQGRFXPHQWDWLRQ RQOLQHRUWH[WXDO SURYLGHGZLWKWKHSDFNDJH
5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQV
DUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
$OODGYHUWLVLQJPDWHULDOVPHQWLRQLQJIHDWXUHVRUXVHRIWKLVVRIWZDUH
PXVWGLVSOD\WKHIROORZLQJDFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVFU\SWRJUDSKLFVRIWZDUHZULWWHQE\
(ULF<RXQJ HD\#FU\SWVRIWFRP 7KHZRUG FU\SWRJUDSKLF FDQEHOHIWRXWLIWKHURXLQHVIURPWKHOLEUDU\
EHLQJXVHGDUHQRWFU\SWRJUDSKLFUHODWHG ,I\RXLQFOXGHDQ\:LQGRZVVSHFLILFFRGH RUDGHULYDWLYHWKHUHRI IURP WKHDSSVGLUHFWRU\ DSSOLFDWLRQFRGH \RXPXVWLQFOXGHDQDFNQRZOHGJHPHQW
7KLVSURGXFWLQFOXGHVVRIWZDUHZULWWHQE\7LP+XGVRQ WMK#FU\SWVRIWFRP 7+,662)7:$5(,63529,'('%<(5,&<281*CC$6,6 $1'
$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5385326(
$5(',6&/$,0(' ,112(9(176+$//7+($87+2525&2175,%87256%(/,$%/(
)25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25&216(48(17,$/
'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)68%67,787(*22'6
256(59,&(6/2662)86('$7$25352),7625%86,1(66,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1&2175$&7675,&7
/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<
2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)7+(3266,%,/,7<2)
68&+'$0$*(
7KHOLFHQFHDQGGLVWULEXWLRQWHUPVIRUDQ\SXEOLFDOO\DYDLODEOHYHUVLRQRU
– 27 –
GHULYDWLYHRIWKLVFRGHFDQQRWEHFKDQJHG LHWKLVFRGHFDQQRWVLPSO\EH
FRSLHGDQGSXWXQGHUDQRWKHUGLVWULEXWLRQOLFHQFH
>LQFOXGLQJWKH*183XEOLF/LFHQFH@
– 28 –
VHUYOHWMDU
-DYD3ODWIRUP,QWHUIDFH /LFHQVHHPD\QRW
PRGLI\WKH-DYD3ODWIRUP
,QWHUIDFH -3,LGHQWLILHGDVFODVVHV
FRQWDLQHGZLWKLQWKHMDYD[SDFNDJHRUDQ\
VXESDFNDJHVRIWKHMDYD[SDFNDJH E\
FUHDWLQJDGGLWLRQDOFODVVHVZLWKLQWKH-3,RU
RWKHUZLVHFDXVLQJWKHDGGLWLRQWRRU
PRGLILFDWLRQRIWKHFODVVHVLQWKH-3, ,Q
WKHHYHQWWKDW/LFHQVHHFUHDWHVDQ\
-DYDUHODWHG$3,DQGGLVWULEXWHVXFK$3,WR
RWKHUVIRUDSSOHWRUDSSOLFDWLRQGHYHORSPHQW
\RXPXVWSURPSWO\SXEOLVKEURDGO\DQ
DFFXUDWHVSHFLILFDWLRQIRUVXFK$3,IRUIUHH
XVHE\DOOGHYHORSHUVRI-DYDEDVHG
VRIWZDUH
5HVWULFWLRQV 6RIWZDUHLVFRQILGHQWLDO
FRS\ULJKWHGLQIRUPDWLRQRI6XQDQG
WLWOHWRDOOFRSLHVLVUHWDLQHGE\6XQ
DQGRULWVOLFHQVRUV /LFHQVHHVKDOOQRW
PRGLI\GHFRPSLOHGLVDVVHPEOHGHFU\SW
H[WUDFWRURWKHUZLVHUHYHUVHHQJLQHHU
6RIWZDUH 6RIWZDUHPD\QRWEHOHDVHG
DVVLJQHGRUVXEOLFHQVHGLQZKROHRULQ
SDUW 6RIWZDUHLVQRWGHVLJQHGRULQWHQGHG
IRUXVHLQRQOLQHFRQWURORIDLUFUDIWDLU
WUDIILFDLUFUDIWQDYLJDWLRQRUDLUFUDIW
FRPPXQLFDWLRQVRULQWKHGHVLJQ
FRQVWUXFWLRQRSHUDWLRQRUPDLQWHQDQFHRI
DQ\QXFOHDUIDFLOLW\ /LFHQVHHZDUUDQWV
WKDWLWZLOOQRWXVHRUUHGLVWULEXWHWKH
6RIWZDUHIRUVXFKSXUSRVHV
'LVFODLPHURI:DUUDQW\ 6RIWZDUHLV
– 29 –
SURYLGHG$6,6ZLWKRXWDZDUUDQW\
RIDQ\NLQG $//(;35(6625,03/,('
5(35(6(17$7,216$1':$55$17,(6,1&/8',1*
$1<,03/,(':$55$17<2)0(5&+$17$%,/,7<
),71(66)25$3$57,&8/$5385326(25
121,1)5,1*(0(17$5(+(5(%<(;&/8'('
7HUPLQDWLRQ 7KLV/LFHQVHLVHIIHFWLYH
XQWLOWHUPLQDWHG /LFHQVHHPD\
WHUPLQDWHWKLV/LFHQVHDWDQ\WLPHE\
GHVWUR\LQJDOOFRSLHVRI6RIWZDUH 7KLV
/LFHQVHZLOOWHUPLQDWHLPPHGLDWHO\ZLWKRXW
QRWLFHIURP6XQLI/LFHQVHHIDLOVWRFRPSO\
ZLWKDQ\SURYLVLRQRIWKLV/LFHQVH 8SRQ
VXFKWHUPLQDWLRQ/LFHQVHHPXVWGHVWUR\DOO
FRSLHVRI6RIWZDUH
([SRUW5HJXODWLRQV 6RIWZDUHLQFOXGLQJ
WHFKQLFDOGDWDLVVXEMHFWWR86
H[SRUWFRQWUROODZVLQFOXGLQJWKH86
([SRUW$GPLQLVWUDWLRQ$FWDQGLWVDVVRFLDWHG
UHJXODWLRQVDQGPD\EHVXEMHFWWRH[SRUWRU
LPSRUWUHJXODWLRQVLQRWKHUFRXQWULHV
/LFHQVHHDJUHHVWRFRPSO\VWULFWO\ZLWKDOO
VXFKUHJXODWLRQVDQGDFNQRZOHGJHVWKDWLW
KDVWKHUHVSRQVLELOLW\WRREWDLQOLFHQVHVWR
H[SRUWUHH[SRUWRULPSRUW6RIWZDUH
6RIWZDUHPD\QRWEHGRZQORDGHGRURWKHUZLVH
H[SRUWHGRUUHH[SRUWHG L LQWRRUWRD
QDWLRQDORUUHVLGHQWRI&XED,UDT,UDQ
1RUWK.RUHD/LE\D6XGDQ6\ULDRUDQ\
FRXQWU\WRZKLFKWKH86KDVHPEDUJRHG
JRRGVRU LL WRDQ\RQHRQWKH86
7UHDVXU\'HSDUWPHQW VOLVWRI6SHFLDOO\
'HVLJQDWHG1DWLRQVRUWKH86 &RPPHUFH
– 30 –
'HSDUWPHQW V7DEOHRI'HQLDO2UGHUV
– 31 –
/LQX[
*18*(1(5$/38%/,&/,&(16(
9HUVLRQ-XQH &RS\ULJKW & )UHH6RIWZDUH)RXQGDWLRQ,QF )UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWHYHUEDWLPFRSLHV
RIWKLVOLFHQVHGRFXPHQWEXWFKDQJLQJLWLVQRWDOORZHG
3UHDPEOH
7KHOLFHQVHVIRUPRVWVRIWZDUHDUHGHVLJQHGWRWDNHDZD\\RXUIUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVW
WKH*18*HQHUDO3XEOLF/LFHQVHLVLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUHDQGFKDQJHIUHHVRIWZDUHWR
PDNHVXUHWKHVRIWZDUHLVIUHHIRUDOOLWVXVHUV7KLV*HQHUDO3XEOLF/LFHQVHDSSOLHVWRPRVWRIWKH)UHH
6RIWZDUH)RXQGDWLRQ VVRIWZDUHDQGWRDQ\RWKHUSURJUDPZKRVHDXWKRUVFRPPLWWRXVLQJLW 6RPHRWKHU)UHH
6RIWZDUH)RXQGDWLRQVRIWZDUHLVFRYHUHGE\WKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDG <RXFDQDSSO\
LWWR\RXUSURJUDPVWRR :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRPQRWSULFH2XU*HQHUDO3XEOLF/LFHQVHVDUH
GHVLJQHGWRPDNHVXUHWKDW\RXKDYHWKHIUHHGRPWRGLVWULEXWHFRSLHVRIIUHHVRIWZDUH DQGFKDUJHIRUWKLV
VHUYLFHLI\RXZLVK WKDW\RXUHFHLYHVRXUFHFRGHRUFDQJHWLWLI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUH
RUXVHSLHFHVRILWLQQHZIUHHSURJUDPVDQGWKDW\RXNQRZ\RXFDQGRWKHVHWKLQJV 7RSURWHFW\RXUULJKWVZHQHHGWRPDNHUHVWULFWLRQVWKDWIRUELGDQ\RQHWRGHQ\\RXWKHVHULJKWVRUWRDVN\RX
WRVXUUHQGHUWKHULJKWV7KHVHUHVWULFWLRQVWUDQVODWHWRFHUWDLQUHVSRQVLELOLWLHVIRU\RXLI\RXGLVWULEXWHFRSLHVRI
WKHVRIWZDUHRULI\RXPRGLI\LW )RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIVXFKDSURJUDPZKHWKHUJUDWLVRUIRUDIHH\RXPXVWJLYHWKH
UHFLSLHQWVDOOWKHULJKWVWKDW\RXKDYH<RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKHVRXUFHFRGH
$QG\RXPXVWVKRZWKHPWKHVHWHUPVVRWKH\NQRZWKHLUULJKWV :HSURWHFW\RXUULJKWVZLWKWZRVWHSV FRS\ULJKWWKHVRIWZDUHDQG RIIHU\RXWKLVOLFHQVHZKLFKJLYHV\RX
OHJDOSHUPLVVLRQWRFRS\GLVWULEXWHDQGRUPRGLI\WKHVRIWZDUH $OVRIRUHDFKDXWKRU VSURWHFWLRQDQGRXUVZHZDQWWRPDNHFHUWDLQWKDWHYHU\RQHXQGHUVWDQGVWKDWWKHUHLV
QRZDUUDQW\IRUWKLVIUHHVRIWZDUH,IWKHVRIWZDUHLVPRGLILHGE\VRPHRQHHOVHDQGSDVVHGRQZHZDQWLWV
UHFLSLHQWVWRNQRZWKDWZKDWWKH\KDYHLVQRWWKHRULJLQDOVRWKDWDQ\SUREOHPVLQWURGXFHGE\RWKHUVZLOOQRW
UHIOHFWRQWKHRULJLQDODXWKRUV UHSXWDWLRQV – 32 –
)LQDOO\DQ\IUHHSURJUDPLVWKUHDWHQHGFRQVWDQWO\E\VRIWZDUHSDWHQWV:HZLVKWRDYRLGWKHGDQJHUWKDW
UHGLVWULEXWRUVRIDIUHHSURJUDPZLOOLQGLYLGXDOO\REWDLQSDWHQWOLFHQVHVLQHIIHFWPDNLQJWKHSURJUDP
SURSULHWDU\7RSUHYHQWWKLVZHKDYHPDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH VIUHHXVHRU
QRWOLFHQVHGDWDOO 7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQIROORZ 7(506$1'&21',7,216)25&23<,1*',675,%87,21$1'02',),&$7,21
7KLV/LFHQVHDSSOLHVWRDQ\SURJUDPRURWKHUZRUNZKLFKFRQWDLQVDQRWLFHSODFHGE\WKHFRS\ULJKWKROGHU
VD\LQJLWPD\EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV*HQHUDO3XEOLF/LFHQVH7KH3URJUDPEHORZUHIHUVWR
DQ\VXFKSURJUDPRUZRUNDQGDZRUNEDVHGRQWKH3URJUDPPHDQVHLWKHUWKH3URJUDPRUDQ\GHULYDWLYH
ZRUNXQGHUFRS\ULJKWODZWKDWLVWRVD\DZRUNFRQWDLQLQJWKH3URJUDPRUDSRUWLRQRILWHLWKHUYHUEDWLPRU
ZLWKPRGLILFDWLRQVDQGRUWUDQVODWHGLQWRDQRWKHUODQJXDJH +HUHLQDIWHUWUDQVODWLRQLVLQFOXGHGZLWKRXW
OLPLWDWLRQLQWKHWHUPPRGLILFDWLRQ (DFKOLFHQVHHLVDGGUHVVHGDV\RX $FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWV
VFRSH7KHDFWRIUXQQLQJWKH3URJUDPLVQRWUHVWULFWHGDQGWKHRXWSXWIURPWKH3URJUDPLVFRYHUHGRQO\LILWV
FRQWHQWVFRQVWLWXWHDZRUNEDVHGRQWKH3URJUDP LQGHSHQGHQWRIKDYLQJEHHQPDGHE\UXQQLQJWKH
3URJUDP :KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH3URJUDPGRHV <RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH3URJUDP VVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\
PHGLXPSURYLGHGWKDW\RXFRQVSLFXRXVO\DQGDSSURSULDWHO\SXEOLVKRQHDFKFRS\DQDSSURSULDWHFRS\ULJKW
QRWLFHDQGGLVFODLPHURIZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRI
DQ\ZDUUDQW\DQGJLYHDQ\RWKHUUHFLSLHQWVRIWKH3URJUDPDFRS\RIWKLV/LFHQVHDORQJZLWKWKH3URJUDP <RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\DQG\RXPD\DW\RXURSWLRQRIIHUZDUUDQW\
SURWHFWLRQLQH[FKDQJHIRUDIHH <RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH3URJUDPRUDQ\SRUWLRQRILWWKXVIRUPLQJDZRUNEDVHGRQWKH
3URJUDPDQGFRS\DQGGLVWULEXWHVXFKPRGLILFDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQDERYHSURYLGHG
WKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV D <RXPXVWFDXVHWKHPRGLILHGILOHVWRFDUU\SURPLQHQWQRWLFHVVWDWLQJWKDW\RXFKDQJHGWKHILOHVDQG
WKHGDWHRIDQ\FKDQJH E <RXPXVWFDXVHDQ\ZRUNWKDW\RXGLVWULEXWHRUSXEOLVKWKDWLQZKROHRULQSDUWFRQWDLQVRULVGHULYHG
IURPWKH3URJUDPRUDQ\SDUWWKHUHRIWREHOLFHQVHGDVDZKROHDWQRFKDUJHWRDOOWKLUGSDUWLHVXQGHU
WKHWHUPVRIWKLV/LFHQVH – 33 –
F ,IWKHPRGLILHGSURJUDPQRUPDOO\UHDGVFRPPDQGVLQWHUDFWLYHO\ZKHQUXQ\RXPXVWFDXVHLWZKHQ
VWDUWHGUXQQLQJIRUVXFKLQWHUDFWLYHXVHLQWKHPRVWRUGLQDU\ZD\WRSULQWRUGLVSOD\DQDQQRXQFHPHQW
LQFOXGLQJDQDSSURSULDWHFRS\ULJKWQRWLFHDQGDQRWLFHWKDWWKHUHLVQRZDUUDQW\ RUHOVHVD\LQJWKDW\RX
SURYLGHDZDUUDQW\ DQGWKDWXVHUVPD\UHGLVWULEXWHWKHSURJUDPXQGHUWKHVHFRQGLWLRQVDQGWHOOLQJWKH
XVHU KRZWR YLHZ D FRS\ RIWKLV /LFHQVH ([FHSWLRQ LIWKH3URJUDP LWVHOI LV LQWHUDFWLYHEXWGRHVQRW
QRUPDOO\ SULQW VXFK DQ DQQRXQFHPHQW \RXU ZRUN EDVHG RQ WKH 3URJUDP LV QRW UHTXLUHG WR SULQW DQ
DQQRXQFHPHQW 7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGLILHGZRUNDVDZKROH,ILGHQWLILDEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHG
IURPWKH3URJUDPDQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQGVHSDUDWHZRUNVLQWKHPVHOYHVWKHQ
WKLV/LFHQVHDQGLWVWHUPVGRQRWDSSO\WRWKRVHVHFWLRQVZKHQ\RXGLVWULEXWHWKHPDVVHSDUDWHZRUNV%XW
ZKHQ\RXGLVWULEXWHWKHVDPHVHFWLRQVDVSDUWRIDZKROHZKLFKLVDZRUNEDVHGRQWKH3URJUDPWKH
GLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQG
WRWKHHQWLUHZKROHDQGWKXVWRHDFKDQGHYHU\SDUWUHJDUGOHVVRIZKRZURWHLW 7KXVLWLVQRWWKHLQWHQWRIWKLVVHFWLRQWRFODLPULJKWVRUFRQWHVW\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RX
UDWKHUWKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRUFROOHFWLYHZRUNVEDVHGRQWKH
3URJUDP ,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRWEDVHGRQWKH3URJUDPZLWKWKH3URJUDP RUZLWKDZRUN
EDVHGRQWKH3URJUDP RQDYROXPHRIDVWRUDJHRUGLVWULEXWLRQPHGLXPGRHVQRWEULQJWKHRWKHUZRUNXQGHU
WKHVFRSHRIWKLV/LFHQVH <RXPD\FRS\DQGGLVWULEXWHWKH3URJUDP RUDZRUNEDVHGRQLWXQGHU6HFWLRQ LQREMHFWFRGHRU
H[HFXWDEOHIRUPXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHSURYLGHGWKDW\RXDOVRGRRQHRIWKHIROORZLQJ D $FFRPSDQ\ LW ZLWK WKH FRPSOHWH FRUUHVSRQGLQJ PDFKLQHUHDGDEOH VRXUFH FRGH ZKLFK PXVW EH
GLVWULEXWHG XQGHU WKH WHUPV RI 6HFWLRQV DQG DERYH RQ D PHGLXP FXVWRPDULO\ XVHG IRU VRIWZDUH
LQWHUFKDQJHRU E $FFRPSDQ\LWZLWKDZULWWHQRIIHUYDOLGIRUDWOHDVWWKUHH\HDUVWRJLYHDQ\WKLUGSDUW\IRUDFKDUJH
QRPRUHWKDQ\RXUFRVWRISK\VLFDOO\SHUIRUPLQJVRXUFHGLVWULEXWLRQDFRPSOHWHPDFKLQHUHDGDEOHFRS\
RIWKHFRUUHVSRQGLQJVRXUFHFRGHWREHGLVWULEXWHGXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHRQD
PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJHRU F $FFRPSDQ\ LW ZLWKWKH LQIRUPDWLRQ \RX UHFHLYHGDV WRWKHRIIHU WRGLVWULEXWH FRUUHVSRQGLQJ VRXUFH
FRGH 7KLV DOWHUQDWLYH LV DOORZHG RQO\ IRU QRQFRPPHUFLDO GLVWULEXWLRQ DQG RQO\ LI \RX UHFHLYHG WKH
SURJUDPLQREMHFWFRGHRUH[HFXWDEOHIRUPZLWKVXFKDQRIIHULQDFFRUGZLWK6XEVHFWLRQEDERYH – 34 –
7KHVRXUFHFRGHIRUDZRUNPHDQVWKHSUHIHUUHGIRUPRIWKHZRUNIRUPDNLQJPRGLILFDWLRQVWRLW)RUDQ
H[HFXWDEOHZRUNFRPSOHWHVRXUFHFRGHPHDQVDOOWKHVRXUFHFRGHIRUDOOPRGXOHVLWFRQWDLQVSOXVDQ\
DVVRFLDWHGLQWHUIDFHGHILQLWLRQILOHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQDQGLQVWDOODWLRQRIWKH
H[HFXWDEOH+RZHYHUDVDVSHFLDOH[FHSWLRQWKHVRXUFHFRGHGLVWULEXWHGQHHGQRWLQFOXGHDQ\WKLQJWKDWLV
QRUPDOO\GLVWULEXWHG LQHLWKHUVRXUFHRUELQDU\IRUP ZLWKWKHPDMRUFRPSRQHQWV FRPSLOHUNHUQHODQGVRRQ RIWKHRSHUDWLQJV\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQWLWVHOIDFFRPSDQLHVWKH
H[HFXWDEOH ,IGLVWULEXWLRQRIH[HFXWDEOHRUREMHFWFRGHLVPDGHE\RIIHULQJDFFHVVWRFRS\IURPDGHVLJQDWHGSODFHWKHQ
RIIHULQJHTXLYDOHQWDFFHVVWRFRS\WKHVRXUFHFRGHIURPWKHVDPHSODFHFRXQWVDVGLVWULEXWLRQRIWKHVRXUFH
FRGHHYHQWKRXJKWKLUGSDUWLHVDUHQRWFRPSHOOHGWRFRS\WKHVRXUFHDORQJZLWKWKHREMHFWFRGH <RXPD\QRWFRS\PRGLI\VXEOLFHQVHRUGLVWULEXWHWKH3URJUDPH[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV
/LFHQVH$Q\DWWHPSWRWKHUZLVHWRFRS\PRGLI\VXEOLFHQVHRUGLVWULEXWHWKH3URJUDPLVYRLGDQGZLOO
DXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH+RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHVRUULJKWV
IURP\RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHVWHUPLQDWHGVRORQJDVVXFKSDUWLHVUHPDLQLQIXOO
FRPSOLDQFH <RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RX
SHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH3URJUDPRULWVGHULYDWLYHZRUNV7KHVHDFWLRQVDUHSURKLELWHGE\ODZLI
\RXGRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRUGLVWULEXWLQJWKH3URJUDP RUDQ\ZRUNEDVHGRQWKH
3URJUDP \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQGDOOLWVWHUPVDQGFRQGLWLRQVIRUFRS\LQJ
GLVWULEXWLQJRUPRGLI\LQJWKH3URJUDPRUZRUNVEDVHGRQLW (DFKWLPH\RXUHGLVWULEXWHWKH3URJUDP RUDQ\ZRUNEDVHGRQWKH3URJUDP WKHUHFLSLHQWDXWRPDWLFDOO\
UHFHLYHVDOLFHQVHIURPWKHRULJLQDOOLFHQVRUWRFRS\GLVWULEXWHRUPRGLI\WKH3URJUDPVXEMHFWWRWKHVHWHUPV
DQGFRQGLWLRQV<RXPD\QRWLPSRVHDQ\IXUWKHUUHVWULFWLRQVRQWKHUHFLSLHQWV H[HUFLVHRIWKHULJKWVJUDQWHG
KHUHLQ<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVWRWKLV/LFHQVH ,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQRISDWHQWLQIULQJHPHQWRUIRUDQ\RWKHUUHDVRQ QRW
OLPLWHGWRSDWHQWLVVXHV FRQGLWLRQVDUHLPSRVHGRQ\RX ZKHWKHUE\FRXUWRUGHUDJUHHPHQWRURWKHUZLVH WKDW
FRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX
FDQQRWGLVWULEXWHVRDVWRVDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQGDQ\RWKHUSHUWLQHQW
REOLJDWLRQVWKHQDVDFRQVHTXHQFH\RXPD\QRWGLVWULEXWHWKH3URJUDPDWDOO)RUH[DPSOHLIDSDWHQWOLFHQVH
ZRXOGQRWSHUPLWUR\DOW\IUHHUHGLVWULEXWLRQRIWKH3URJUDPE\DOOWKRVHZKRUHFHLYHFRSLHVGLUHFWO\RULQGLUHFWO\
WKURXJK\RXWKHQWKHRQO\ZD\\RXFRXOGVDWLVI\ERWKLWDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP
GLVWULEXWLRQRIWKH3URJUDP – 35 –
,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOGLQYDOLGRUXQHQIRUFHDEOHXQGHUDQ\SDUWLFXODUFLUFXPVWDQFHWKHEDODQFHRI
WKHVHFWLRQLVLQWHQGHGWRDSSO\DQGWKHVHFWLRQDVDZKROHLVLQWHQGHGWRDSSO\LQRWKHUFLUFXPVWDQFHV ,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\SDWHQWVRURWKHUSURSHUW\ULJKWFODLPVRUWR
FRQWHVWYDOLGLW\RIDQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJWKHLQWHJULW\RIWKHIUHH
VRIWZDUHGLVWULEXWLRQV\VWHPZKLFKLVLPSOHPHQWHGE\SXEOLFOLFHQVHSUDFWLFHV0DQ\SHRSOHKDYHPDGH
JHQHURXVFRQWULEXWLRQVWRWKHZLGHUDQJHRIVRIWZDUHGLVWULEXWHGWKURXJKWKDWV\VWHPLQUHOLDQFHRQFRQVLVWHQW
DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWRGHFLGHLIKHRUVKHLVZLOOLQJWRGLVWULEXWHVRIWZDUH
WKURXJKDQ\RWKHUV\VWHPDQGDOLFHQVHHFDQQRWLPSRVHWKDWFKRLFH 7KLVVHFWLRQLVLQWHQGHGWRPDNHWKRURXJKO\FOHDUZKDWLVEHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV
/LFHQVH ,IWKHGLVWULEXWLRQDQGRUXVHRIWKH3URJUDPLVUHVWULFWHGLQFHUWDLQFRXQWULHVHLWKHUE\SDWHQWVRUE\
FRS\ULJKWHGLQWHUIDFHVWKHRULJLQDOFRS\ULJKWKROGHUZKRSODFHVWKH3URJUDPXQGHUWKLV/LFHQVHPD\DGGDQ
H[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQH[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\LQRU
DPRQJFRXQWULHVQRWWKXVH[FOXGHG,QVXFKFDVHWKLV/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKH
ERG\RIWKLV/LFHQVH 7KH)UHH6RIWZDUH)RXQGDWLRQPD\SXEOLVKUHYLVHGDQGRUQHZYHUVLRQVRIWKH*HQHUDO3XEOLF/LFHQVHIURP
WLPHWRWLPH6XFKQHZYHUVLRQVZLOOEHVLPLODULQVSLULWWRWKHSUHVHQWYHUVLRQEXWPD\GLIIHULQGHWDLOWR
DGGUHVVQHZSUREOHPVRUFRQFHUQV (DFKYHUVLRQLVJLYHQDGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH3URJUDPVSHFLILHVDYHUVLRQQXPEHURIWKLV
/LFHQVHZKLFKDSSOLHVWRLWDQGDQ\ODWHUYHUVLRQ\RXKDYHWKHRSWLRQRIIROORZLQJWKHWHUPVDQGFRQGLWLRQV
HLWKHURIWKDWYHUVLRQRURIDQ\ODWHUYHUVLRQSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH3URJUDPGRHV
QRWVSHFLI\DYHUVLRQQXPEHURIWKLV/LFHQVH\RXPD\FKRRVHDQ\YHUVLRQHYHUSXEOLVKHGE\WKH)UHH
6RIWZDUH)RXQGDWLRQ ,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH3URJUDPLQWRRWKHUIUHHSURJUDPVZKRVHGLVWULEXWLRQFRQGLWLRQVDUH
GLIIHUHQWZULWHWRWKHDXWKRUWRDVNIRUSHUPLVVLRQ)RUVRIWZDUHZKLFKLVFRS\ULJKWHGE\WKH)UHH6RIWZDUH
)RXQGDWLRQZULWHWRWKH)UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRUWKLV2XUGHFLVLRQZLOO
EHJXLGHGE\WKHWZRJRDOVRISUHVHUYLQJWKHIUHHVWDWXVRIDOOGHULYDWLYHVRIRXUIUHHVRIWZDUHDQGRISURPRWLQJ
WKHVKDULQJDQGUHXVHRIVRIWZDUHJHQHUDOO\ 12:$55$17<
– 36 –
%(&$86(7+(352*5$0,6/,&(16(')5((2)&+$5*(7+(5(,612:$55$17<)257+(
352*5$0727+((;7(173(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6(67$7('
,1:5,7,1*7+(&23<5,*+7+2/'(56$1'2527+(53$57,(63529,'(7+(352*5$0$6,6
:,7+287:$55$17<2)$1<.,1'(,7+(5(;35(66('25,03/,(',1&/8',1*%87127
/,0,7('727+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326(7+((17,5(5,6.$6727+(48$/,7<$1'3(5)250$1&(2)7+(352*5$0,6:,7+
<286+28/'7+(352*5$03529('()(&7,9(<28$6680(7+(&2672)$//1(&(66$5<
6(59,&,1*5(3$,525&255(&7,21 ,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25$*5(('72,1:5,7,1*:,//$1<
&23<5,*+7+2/'(525$1<27+(53$57<:+20$<02',)<$1'255(',675,%87(7+(
352*5$0$63(50,77('$%29(%(/,$%/(72<28)25'$0$*(6,1&/8',1*$1<*(1(5$/
63(&,$/,1&,'(17$/25&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25,1$%,/,7<72
86(7+(352*5$0 ,1&/8',1*%87127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5('
,1$&&85$7(25/266(66867$,1('%<<28257+,5'3$57,(625$)$,/85(2)7+(
352*5$07223(5$7(:,7+$1<27+(5352*5$06 (9(1,)68&++2/'(52527+(53$57<
+$6%((1$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(6 (1'2)7(506$1'&21',7,216
+RZWR$SSO\7KHVH7HUPVWR<RXU1HZ3URJUDPV
,I\RXGHYHORSDQHZSURJUDPDQG\RXZDQWLWWREHRIWKHJUHDWHVWSRVVLEOHXVHWRWKHSXEOLFWKHEHVWZD\WR
DFKLHYHWKLVLVWRPDNHLWIUHHVRIWZDUHZKLFKHYHU\RQHFDQUHGLVWULEXWHDQGFKDQJHXQGHUWKHVHWHUPV 7RGRVRDWWDFKWKHIROORZLQJQRWLFHVWRWKHSURJUDP,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFHILOH
WRPRVWHIIHFWLYHO\FRQYH\WKHH[FOXVLRQRIZDUUDQW\DQGHDFKILOHVKRXOGKDYHDWOHDVWWKHFRS\ULJKWOLQHDQG
DSRLQWHUWRZKHUHWKHIXOOQRWLFHLVIRXQG RQHOLQHWRJLYHWKHSURJUDP VQDPHDQGDQLGHDRIZKDWLWGRHV
&RS\ULJKW & \\\\ QDPHRIDXWKRU
7KLVSURJUDPLVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18*HQHUDO3XEOLF/LFHQVH
DVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHUYHUVLRQ
RIWKH/LFHQVHRU DW\RXURSWLRQ DQ\ODWHUYHUVLRQ
7KLVSURJUDPLVGLVWULEXWHGLQWKHKRSHWKDWLWZLOOEHXVHIXO
EXW:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\RI
0(5&+$17$%,/,7<RU),71(66)25$3$57,&8/$5385326( 6HHWKH
– 37 –
*18*HQHUDO3XEOLF/LFHQVHIRUPRUHGHWDLOV
<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18*HQHUDO3XEOLF/LFHQVH
DORQJZLWKWKLVSURJUDPLIQRWZULWHWRWKH)UHH6RIWZDUH
)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
$OVRDGGLQIRUPDWLRQRQKRZWRFRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO ,IWKHSURJUDPLVLQWHUDFWLYHPDNHLWRXWSXWDVKRUWQRWLFHOLNHWKLVZKHQLWVWDUWVLQDQLQWHUDFWLYHPRGH *QRPRYLVLRQYHUVLRQ&RS\ULJKW & \HDUQDPHRIDXWKRU
*QRPRYLVLRQFRPHVZLWK$%62/87(/<12:$55$17<IRUGHWDLOV
W\SHCVKRZZ 7KLVLVIUHHVRIWZDUHDQG\RXDUHZHOFRPH
WRUHGLVWULEXWHLWXQGHUFHUWDLQFRQGLWLRQVW\SHCVKRZF IRUGHWDLOV
7KHK\SRWKHWLFDOFRPPDQGVCVKRZZ DQGCVKRZF VKRXOGVKRZWKHDSSURSULDWHSDUWVRIWKH*HQHUDO3XEOLF
/LFHQVH2IFRXUVHWKHFRPPDQGV\RXXVHPD\EHFDOOHGVRPHWKLQJRWKHUWKDQCVKRZZ DQGCVKRZF WKH\
FRXOGHYHQEHPRXVHFOLFNVRUPHQXLWHPVZKDWHYHUVXLWV\RXUSURJUDP <RXVKRXOGDOVRJHW\RXUHPSOR\HU LI\RXZRUNDVDSURJUDPPHU RU\RXUVFKRROLIDQ\WRVLJQDFRS\ULJKW
GLVFODLPHUIRUWKHSURJUDPLIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV <R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKW
LQWHUHVWLQWKHSURJUDPC*QRPRYLVLRQ ZKLFKPDNHVSDVVHVDWFRPSLOHUV ZULWWHQ E\-DPHV+DFNHU
VLJQDWXUHRI7\&RRQ$SULO
7\&RRQ3UHVLGHQWRI9LFH
7KLV*HQHUDO3XEOLF/LFHQVHGRHVQRWSHUPLWLQFRUSRUDWLQJ\RXUSURJUDPLQWRSURSULHWDU\SURJUDPV,I\RXU
SURJUDPLVDVXEURXWLQHOLEUDU\\RXPD\FRQVLGHULWPRUHXVHIXOWRSHUPLWOLQNLQJSURSULHWDU\DSSOLFDWLRQVZLWK
WKHOLEUDU\,IWKLVLVZKDW\RXZDQWWRGRXVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVH – 38 –
JOLEF
MVRQJOLE
*18/(66(5*(1(5$/38%/,&/,&(16(
9HUVLRQ)HEUXDU\ &RS\ULJKW & )UHH6RIWZDUH)RXQGDWLRQ,QF
)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWHYHUEDWLPFRSLHV
RIWKLVOLFHQVHGRFXPHQWEXWFKDQJLQJLWLVQRWDOORZHG
>7KLVLVWKHILUVWUHOHDVHGYHUVLRQRIWKH/HVVHU*3/ ,WDOVRFRXQWV
DVWKHVXFFHVVRURIWKH*18/LEUDU\3XEOLF/LFHQVHYHUVLRQKHQFH
WKHYHUVLRQQXPEHU@
3UHDPEOH
7KHOLFHQVHVIRUPRVWVRIWZDUHDUHGHVLJQHGWRWDNHDZD\\RXUIUHHGRPWRVKDUHDQGFKDQJHLW%\FRQWUDVW
WKH*18*HQHUDO3XEOLF/LFHQVHVDUHLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUHDQGFKDQJHIUHHVRIWZDUH
WRPDNHVXUHWKHVRIWZDUHLVIUHHIRUDOOLWVXVHUV 7KLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHDSSOLHVWRVRPHVSHFLDOO\GHVLJQDWHGVRIWZDUHSDFNDJHV
W\SLFDOO\OLEUDULHVRIWKH)UHH6RIWZDUH)RXQGDWLRQDQGRWKHUDXWKRUVZKRGHFLGHWRXVHLW<RXFDQXVHLWWRR
EXWZHVXJJHVW\RXILUVWWKLQNFDUHIXOO\DERXWZKHWKHUWKLVOLFHQVHRUWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVHLVWKH
EHWWHUVWUDWHJ\WRXVHLQDQ\SDUWLFXODUFDVHEDVHGRQWKHH[SODQDWLRQVEHORZ :KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRPRIXVHQRWSULFH2XU*HQHUDO3XEOLF/LFHQVHV
DUHGHVLJQHGWRPDNHVXUHWKDW\RXKDYHWKHIUHHGRPWRGLVWULEXWHFRSLHVRIIUHHVRIWZDUH DQGFKDUJHIRUWKLV
VHUYLFHLI\RXZLVK WKDW\RXUHFHLYHVRXUFHFRGHRUFDQJHWLWLI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUH
DQGXVHSLHFHVRILWLQQHZIUHHSURJUDPVDQGWKDW\RXDUHLQIRUPHGWKDW\RXFDQGRWKHVHWKLQJV 7RSURWHFW\RXUULJKWVZHQHHGWRPDNHUHVWULFWLRQVWKDWIRUELGGLVWULEXWRUVWRGHQ\\RXWKHVHULJKWVRUWRDVN
\RXWRVXUUHQGHUWKHVHULJKWV7KHVHUHVWULFWLRQVWUDQVODWHWRFHUWDLQUHVSRQVLELOLWLHVIRU\RXLI\RXGLVWULEXWH
FRSLHVRIWKHOLEUDU\RULI\RXPRGLI\LW )RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\ZKHWKHUJUDWLVRUIRUDIHH\RXPXVWJLYHWKHUHFLSLHQWVDOO
WKHULJKWVWKDWZHJDYH\RX<RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKHVRXUFHFRGH,I\RXOLQN
RWKHUFRGHZLWKWKHOLEUDU\\RXPXVWSURYLGHFRPSOHWHREMHFWILOHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQUHOLQN
WKHPZLWKWKHOLEUDU\DIWHUPDNLQJFKDQJHVWRWKHOLEUDU\DQGUHFRPSLOLQJLW$QG\RXPXVWVKRZWKHPWKHVH
WHUPVVRWKH\NQRZWKHLUULJKWV :HSURWHFW\RXUULJKWVZLWKDWZRVWHSPHWKRG ZHFRS\ULJKWWKHOLEUDU\DQG ZHRIIHU\RXWKLVOLFHQVH
ZKLFKJLYHV\RXOHJDOSHUPLVVLRQWRFRS\GLVWULEXWHDQGRUPRGLI\WKHOLEUDU\ 7RSURWHFWHDFKGLVWULEXWRUZHZDQWWRPDNHLWYHU\FOHDUWKDWWKHUHLVQRZDUUDQW\IRUWKHIUHHOLEUDU\$OVRLI
WKHOLEUDU\LVPRGLILHGE\VRPHRQHHOVHDQGSDVVHGRQWKHUHFLSLHQWVVKRXOGNQRZWKDWZKDWWKH\KDYHLVQRW
– 39 –
WKHRULJLQDOYHUVLRQVRWKDWWKHRULJLQDODXWKRU VUHSXWDWLRQZLOOQRWEHDIIHFWHGE\SUREOHPVWKDWPLJKWEH
LQWURGXFHGE\RWKHUV )LQDOO\VRIWZDUHSDWHQWVSRVHDFRQVWDQWWKUHDWWRWKHH[LVWHQFHRIDQ\IUHHSURJUDP:HZLVKWRPDNHVXUH
WKDWDFRPSDQ\FDQQRWHIIHFWLYHO\UHVWULFWWKHXVHUVRIDIUHHSURJUDPE\REWDLQLQJDUHVWULFWLYHOLFHQVHIURPD
SDWHQWKROGHU7KHUHIRUHZHLQVLVWWKDWDQ\SDWHQWOLFHQVHREWDLQHGIRUDYHUVLRQRIWKHOLEUDU\PXVWEH
FRQVLVWHQWZLWKWKHIXOOIUHHGRPRIXVHVSHFLILHGLQWKLVOLFHQVH 0RVW*18VRIWZDUHLQFOXGLQJVRPHOLEUDULHVLVFRYHUHGE\WKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVH7KLV
OLFHQVHWKH*18/HVVHU*HQHUDO3XEOLF/LFHQVHDSSOLHVWRFHUWDLQGHVLJQDWHGOLEUDULHVDQGLVTXLWHGLIIHUHQW
IURPWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH:HXVHWKLVOLFHQVHIRUFHUWDLQOLEUDULHVLQRUGHUWRSHUPLWOLQNLQJ
WKRVHOLEUDULHVLQWRQRQIUHHSURJUDPV :KHQDSURJUDPLVOLQNHGZLWKDOLEUDU\ZKHWKHUVWDWLFDOO\RUXVLQJDVKDUHGOLEUDU\WKHFRPELQDWLRQRIWKHWZR
LVOHJDOO\VSHDNLQJDFRPELQHGZRUNDGHULYDWLYHRIWKHRULJLQDOOLEUDU\7KHRUGLQDU\*HQHUDO3XEOLF/LFHQVH
WKHUHIRUHSHUPLWVVXFKOLQNLQJRQO\LIWKHHQWLUHFRPELQDWLRQILWVLWVFULWHULDRIIUHHGRP7KH/HVVHU*HQHUDO
3XEOLF/LFHQVHSHUPLWVPRUHOD[FULWHULDIRUOLQNLQJRWKHUFRGHZLWKWKHOLEUDU\ :HFDOOWKLVOLFHQVHWKH/HVVHU*HQHUDO3XEOLF/LFHQVHEHFDXVHLWGRHV/HVVWRSURWHFWWKHXVHU VIUHHGRP
WKDQWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH,WDOVRSURYLGHVRWKHUIUHHVRIWZDUHGHYHORSHUV/HVVRIDQ
DGYDQWDJHRYHUFRPSHWLQJQRQIUHHSURJUDPV7KHVHGLVDGYDQWDJHVDUHWKHUHDVRQZHXVHWKHRUGLQDU\
*HQHUDO3XEOLF/LFHQVHIRUPDQ\OLEUDULHV+RZHYHUWKH/HVVHUOLFHQVHSURYLGHVDGYDQWDJHVLQFHUWDLQVSHFLDO
FLUFXPVWDQFHV )RUH[DPSOHRQUDUHRFFDVLRQVWKHUHPD\EHDVSHFLDOQHHGWRHQFRXUDJHWKHZLGHVWSRVVLEOHXVHRID
FHUWDLQOLEUDU\VRWKDWLWEHFRPHVDGHIDFWRVWDQGDUG7RDFKLHYHWKLVQRQIUHHSURJUDPVPXVWEHDOORZHGWR
XVHWKHOLEUDU\$PRUHIUHTXHQWFDVHLVWKDWDIUHHOLEUDU\GRHVWKHVDPHMREDVZLGHO\XVHGQRQIUHHOLEUDULHV
,QWKLVFDVHWKHUHLVOLWWOHWRJDLQE\OLPLWLQJWKHIUHHOLEUDU\WRIUHHVRIWZDUHRQO\VRZHXVHWKH/HVVHU
*HQHUDO3XEOLF/LFHQVH ,QRWKHUFDVHVSHUPLVVLRQWRXVHDSDUWLFXODUOLEUDU\LQQRQIUHHSURJUDPVHQDEOHVDJUHDWHUQXPEHURISHRSOH
WRXVHDODUJHERG\RIIUHHVRIWZDUH)RUH[DPSOHSHUPLVVLRQWRXVHWKH*18&/LEUDU\LQQRQIUHHSURJUDPV
HQDEOHVPDQ\PRUHSHRSOHWRXVHWKHZKROH*18RSHUDWLQJV\VWHPDVZHOODVLWVYDULDQWWKH*18/LQX[
RSHUDWLQJV\VWHP $OWKRXJKWKH/HVVHU*HQHUDO3XEOLF/LFHQVHLV/HVVSURWHFWLYHRIWKHXVHUV IUHHGRPLWGRHVHQVXUHWKDWWKH
XVHURIDSURJUDPWKDWLVOLQNHGZLWKWKH/LEUDU\KDVWKHIUHHGRPDQGWKHZKHUHZLWKDOWRUXQWKDWSURJUDP
XVLQJDPRGLILHGYHUVLRQRIWKH/LEUDU\ 7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQIROORZ3D\FORVHDWWHQWLRQWRWKH
GLIIHUHQFHEHWZHHQDZRUNEDVHGRQWKHOLEUDU\DQGDZRUNWKDWXVHVWKHOLEUDU\7KHIRUPHUFRQWDLQVFRGH
GHULYHGIURPWKHOLEUDU\ZKHUHDVWKHODWWHUPXVWEHFRPELQHGZLWKWKHOLEUDU\LQRUGHUWRUXQ 7(506$1'&21',7,216)25&23<,1*',675,%87,21$1'02',),&$7,21
7KLV/LFHQVH$JUHHPHQWDSSOLHVWRDQ\VRIWZDUHOLEUDU\RURWKHUSURJUDPZKLFKFRQWDLQVDQRWLFHSODFHGE\
WKHFRS\ULJKWKROGHURURWKHUDXWKRUL]HGSDUW\VD\LQJLWPD\EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV/HVVHU
*HQHUDO3XEOLF/LFHQVH DOVRFDOOHGWKLV/LFHQVH (DFKOLFHQVHHLVDGGUHVVHGDV\RX – 40 –
$OLEUDU\PHDQVDFROOHFWLRQRIVRIWZDUHIXQFWLRQVDQGRUGDWDSUHSDUHGVRDVWREHFRQYHQLHQWO\OLQNHGZLWK
DSSOLFDWLRQSURJUDPV ZKLFKXVHVRPHRIWKRVHIXQFWLRQVDQGGDWD WRIRUPH[HFXWDEOHV 7KH/LEUDU\EHORZUHIHUVWRDQ\VXFKVRIWZDUHOLEUDU\RUZRUNZKLFKKDVEHHQGLVWULEXWHGXQGHUWKHVH
WHUPV$ZRUNEDVHGRQWKH/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\GHULYDWLYHZRUNXQGHUFRS\ULJKWODZWKDW
LVWRVD\DZRUNFRQWDLQLQJWKH/LEUDU\RUDSRUWLRQRILWHLWKHUYHUEDWLPRUZLWKPRGLILFDWLRQVDQGRUWUDQVODWHG
VWUDLJKWIRUZDUGO\LQWRDQRWKHUODQJXDJH +HUHLQDIWHUWUDQVODWLRQLVLQFOXGHGZLWKRXWOLPLWDWLRQLQWKHWHUP
PRGLILFDWLRQ 6RXUFHFRGHIRUDZRUNPHDQVWKHSUHIHUUHGIRUPRIWKHZRUNIRUPDNLQJPRGLILFDWLRQVWRLW)RUDOLEUDU\
FRPSOHWHVRXUFHFRGHPHDQVDOOWKHVRXUFHFRGHIRUDOOPRGXOHVLWFRQWDLQVSOXVDQ\DVVRFLDWHGLQWHUIDFH
GHILQLWLRQILOHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQDQGLQVWDOODWLRQRIWKHOLEUDU\ $FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQDUHQRWFRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWV
VFRSH7KHDFWRIUXQQLQJDSURJUDPXVLQJWKH/LEUDU\LVQRWUHVWULFWHGDQGRXWSXWIURPVXFKDSURJUDPLV
FRYHUHGRQO\LILWVFRQWHQWVFRQVWLWXWHDZRUNEDVHGRQWKH/LEUDU\ LQGHSHQGHQWRIWKHXVHRIWKH/LEUDU\LQD
WRROIRUZULWLQJLW :KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH/LEUDU\GRHVDQGZKDWWKHSURJUDPWKDWXVHVWKH
/LEUDU\GRHV <RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH/LEUDU\ VFRPSOHWHVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\
PHGLXPSURYLGHGWKDW\RXFRQVSLFXRXVO\DQGDSSURSULDWHO\SXEOLVKRQHDFKFRS\DQDSSURSULDWHFRS\ULJKW
QRWLFHDQGGLVFODLPHURIZDUUDQW\NHHSLQWDFWDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRI
DQ\ZDUUDQW\DQGGLVWULEXWHDFRS\RIWKLV/LFHQVHDORQJZLWKWKH/LEUDU\ <RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\DQG\RXPD\DW\RXURSWLRQRIIHUZDUUDQW\
SURWHFWLRQLQH[FKDQJHIRUDIHH <RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RUDQ\SRUWLRQRILWWKXVIRUPLQJDZRUNEDVHGRQWKH
/LEUDU\DQGFRS\DQGGLVWULEXWHVXFKPRGLILFDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQDERYHSURYLGHGWKDW
\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV x
D 7KHPRGLILHGZRUNPXVWLWVHOIEHDVRIWZDUHOLEUDU\ x
E <RXPXVWFDXVHWKHILOHVPRGLILHGWRFDUU\SURPLQHQWQRWLFHVVWDWLQJWKDW\RXFKDQJHGWKHILOHVDQG
WKHGDWHRIDQ\FKDQJH x
F <RXPXVWFDXVHWKHZKROHRIWKHZRUNWREHOLFHQVHGDWQRFKDUJHWRDOOWKLUGSDUWLHVXQGHUWKHWHUPV
RIWKLV/LFHQVH x
G ,IDIDFLOLW\LQWKHPRGLILHG/LEUDU\UHIHUVWRDIXQFWLRQRUDWDEOHRIGDWDWREHVXSSOLHGE\DQDSSOLFDWLRQ
SURJUDPWKDWXVHVWKHIDFLOLW\RWKHUWKDQDVDQDUJXPHQWSDVVHGZKHQWKHIDFLOLW\LVLQYRNHGWKHQ\RX
PXVWPDNHDJRRGIDLWKHIIRUWWRHQVXUHWKDWLQWKHHYHQWDQDSSOLFDWLRQGRHVQRWVXSSO\VXFKIXQFWLRQ
RUWDEOHWKHIDFLOLW\VWLOORSHUDWHVDQGSHUIRUPVZKDWHYHUSDUWRILWVSXUSRVHUHPDLQVPHDQLQJIXO )RUH[DPSOHDIXQFWLRQLQDOLEUDU\WRFRPSXWHVTXDUHURRWVKDVDSXUSRVHWKDWLVHQWLUHO\ZHOO
GHILQHGLQGHSHQGHQWRIWKHDSSOLFDWLRQ7KHUHIRUH6XEVHFWLRQGUHTXLUHVWKDWDQ\DSSOLFDWLRQ
VXSSOLHGIXQFWLRQRUWDEOHXVHGE\WKLVIXQFWLRQPXVWEHRSWLRQDOLIWKHDSSOLFDWLRQGRHVQRWVXSSO\LW
WKHVTXDUHURRWIXQFWLRQPXVWVWLOOFRPSXWHVTXDUHURRWV – 41 –
7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGLILHGZRUNDVDZKROH,ILGHQWLILDEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHG
IURPWKH/LEUDU\DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQGVHSDUDWHZRUNVLQWKHPVHOYHVWKHQWKLV
/LFHQVHDQGLWVWHUPVGRQRWDSSO\WRWKRVHVHFWLRQVZKHQ\RXGLVWULEXWHWKHPDVVHSDUDWHZRUNV%XWZKHQ
\RXGLVWULEXWHWKHVDPHVHFWLRQVDVSDUWRIDZKROHZKLFKLVDZRUNEDVHGRQWKH/LEUDU\WKHGLVWULEXWLRQRI
WKHZKROHPXVWEHRQWKHWHUPVRIWKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQGWRWKHHQWLUH
ZKROHDQGWKXVWRHDFKDQGHYHU\SDUWUHJDUGOHVVRIZKRZURWHLW 7KXVLWLVQRWWKHLQWHQWRIWKLVVHFWLRQWRFODLPULJKWVRUFRQWHVW\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RX
UDWKHUWKHLQWHQWLVWRH[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRUFROOHFWLYHZRUNVEDVHGRQWKH
/LEUDU\ ,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRWEDVHGRQWKH/LEUDU\ZLWKWKH/LEUDU\ RUZLWKDZRUNEDVHG
RQWKH/LEUDU\ RQDYROXPHRIDVWRUDJHRUGLVWULEXWLRQPHGLXPGRHVQRWEULQJWKHRWKHUZRUNXQGHUWKHVFRSH
RIWKLV/LFHQVH <RXPD\RSWWRDSSO\WKHWHUPVRIWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHLQVWHDGRIWKLV/LFHQVHWRD
JLYHQFRS\RIWKH/LEUDU\7RGRWKLV\RXPXVWDOWHUDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHVRWKDWWKH\UHIHU
WRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQLQVWHDGRIWRWKLV/LFHQVH ,IDQHZHUYHUVLRQWKDQ
YHUVLRQRIWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHKDVDSSHDUHGWKHQ\RXFDQVSHFLI\WKDWYHUVLRQ
LQVWHDGLI\RXZLVK 'RQRWPDNHDQ\RWKHUFKDQJHLQWKHVHQRWLFHV 2QFHWKLVFKDQJHLVPDGHLQDJLYHQFRS\LWLVLUUHYHUVLEOHIRUWKDWFRS\VRWKHRUGLQDU\*18*HQHUDO3XEOLF
/LFHQVHDSSOLHVWRDOOVXEVHTXHQWFRSLHVDQGGHULYDWLYHZRUNVPDGHIURPWKDWFRS\ 7KLVRSWLRQLVXVHIXOZKHQ\RXZLVKWRFRS\SDUWRIWKHFRGHRIWKH/LEUDU\LQWRDSURJUDPWKDWLVQRWDOLEUDU\ <RXPD\FRS\DQGGLVWULEXWHWKH/LEUDU\ RUDSRUWLRQRUGHULYDWLYHRILWXQGHU6HFWLRQ LQREMHFWFRGHRU
H[HFXWDEOHIRUPXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHSURYLGHGWKDW\RXDFFRPSDQ\LWZLWKWKHFRPSOHWH
FRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHZKLFKPXVWEHGLVWULEXWHGXQGHUWKHWHUPVRI6HFWLRQVDQG
DERYHRQDPHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJH ,IGLVWULEXWLRQRIREMHFWFRGHLVPDGHE\RIIHULQJDFFHVVWRFRS\IURPDGHVLJQDWHGSODFHWKHQRIIHULQJ
HTXLYDOHQWDFFHVVWRFRS\WKHVRXUFHFRGHIURPWKHVDPHSODFHVDWLVILHVWKHUHTXLUHPHQWWRGLVWULEXWHWKH
VRXUFHFRGHHYHQWKRXJKWKLUGSDUWLHVDUHQRWFRPSHOOHGWRFRS\WKHVRXUFHDORQJZLWKWKHREMHFWFRGH $SURJUDPWKDWFRQWDLQVQRGHULYDWLYHRIDQ\SRUWLRQRIWKH/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\
E\EHLQJFRPSLOHGRUOLQNHGZLWKLWLVFDOOHGDZRUNWKDWXVHVWKH/LEUDU\6XFKDZRUNLQLVRODWLRQLVQRWD
GHULYDWLYHZRUNRIWKH/LEUDU\DQGWKHUHIRUHIDOOVRXWVLGHWKHVFRSHRIWKLV/LFHQVH +RZHYHUOLQNLQJDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH/LEUDU\FUHDWHVDQH[HFXWDEOHWKDWLVDGHULYDWLYHRI
WKH/LEUDU\ EHFDXVHLWFRQWDLQVSRUWLRQVRIWKH/LEUDU\ UDWKHUWKDQDZRUNWKDWXVHVWKHOLEUDU\7KH
H[HFXWDEOHLVWKHUHIRUHFRYHUHGE\WKLV/LFHQVH6HFWLRQVWDWHVWHUPVIRUGLVWULEXWLRQRIVXFKH[HFXWDEOHV :KHQDZRUNWKDWXVHVWKH/LEUDU\XVHVPDWHULDOIURPDKHDGHUILOHWKDWLVSDUWRIWKH/LEUDU\WKHREMHFWFRGH
IRUWKHZRUNPD\EHDGHULYDWLYHZRUNRIWKH/LEUDU\HYHQWKRXJKWKHVRXUFHFRGHLVQRW:KHWKHUWKLVLVWUXHLV
HVSHFLDOO\VLJQLILFDQWLIWKHZRUNFDQEHOLQNHGZLWKRXWWKH/LEUDU\RULIWKHZRUNLVLWVHOIDOLEUDU\7KHWKUHVKROG
IRUWKLVWREHWUXHLVQRWSUHFLVHO\GHILQHGE\ODZ – 42 –
,IVXFKDQREMHFWILOHXVHVRQO\QXPHULFDOSDUDPHWHUVGDWDVWUXFWXUHOD\RXWVDQGDFFHVVRUVDQGVPDOOPDFURV
DQGVPDOOLQOLQHIXQFWLRQV WHQOLQHVRUOHVVLQOHQJWK WKHQWKHXVHRIWKHREMHFWILOHLVXQUHVWULFWHGUHJDUGOHVV
RIZKHWKHULWLVOHJDOO\DGHULYDWLYHZRUN ([HFXWDEOHVFRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRIWKH/LEUDU\
ZLOOVWLOOIDOOXQGHU6HFWLRQ 2WKHUZLVHLIWKHZRUNLVDGHULYDWLYHRIWKH/LEUDU\\RXPD\GLVWULEXWHWKHREMHFWFRGHIRUWKHZRUNXQGHUWKH
WHUPVRI6HFWLRQ$Q\H[HFXWDEOHVFRQWDLQLQJWKDWZRUNDOVRIDOOXQGHU6HFWLRQZKHWKHURUQRWWKH\DUH
OLQNHGGLUHFWO\ZLWKWKH/LEUDU\LWVHOI $VDQH[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\DOVRFRPELQHRUOLQNDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH
/LEUDU\WRSURGXFHDZRUNFRQWDLQLQJSRUWLRQVRIWKH/LEUDU\DQGGLVWULEXWHWKDWZRUNXQGHUWHUPVRI\RXU
FKRLFHSURYLGHGWKDWWKHWHUPVSHUPLWPRGLILFDWLRQRIWKHZRUNIRUWKHFXVWRPHU VRZQXVHDQGUHYHUVH
HQJLQHHULQJIRUGHEXJJLQJVXFKPRGLILFDWLRQV <RXPXVWJLYHSURPLQHQWQRWLFHZLWKHDFKFRS\RIWKHZRUNWKDWWKH/LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\
DQGLWVXVHDUHFRYHUHGE\WKLV/LFHQVH<RXPXVWVXSSO\DFRS\RIWKLV/LFHQVH,IWKHZRUNGXULQJH[HFXWLRQ
GLVSOD\VFRS\ULJKWQRWLFHV\RXPXVWLQFOXGHWKHFRS\ULJKWQRWLFHIRUWKH/LEUDU\DPRQJWKHPDVZHOODVD
UHIHUHQFHGLUHFWLQJWKHXVHUWRWKHFRS\RIWKLV/LFHQVH$OVR\RXPXVWGRRQHRIWKHVHWKLQJV x
D $FFRPSDQ\WKHZRUNZLWKWKHFRPSOHWHFRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHIRUWKH/LEUDU\
LQFOXGLQJZKDWHYHUFKDQJHVZHUHXVHGLQWKHZRUN ZKLFKPXVWEHGLVWULEXWHGXQGHU6HFWLRQVDQG
DERYH DQGLIWKHZRUNLVDQH[HFXWDEOHOLQNHGZLWKWKH/LEUDU\ZLWKWKHFRPSOHWHPDFKLQHUHDGDEOH
ZRUNWKDWXVHVWKH/LEUDU\DVREMHFWFRGHDQGRUVRXUFHFRGHVRWKDWWKHXVHUFDQPRGLI\WKH/LEUDU\
DQGWKHQUHOLQNWRSURGXFHDPRGLILHGH[HFXWDEOHFRQWDLQLQJWKHPRGLILHG/LEUDU\ ,WLVXQGHUVWRRGWKDW
WKH XVHU ZKR FKDQJHV WKH FRQWHQWV RI GHILQLWLRQV ILOHV LQ WKH /LEUDU\ ZLOO QRW QHFHVVDULO\ EH DEOH WR
UHFRPSLOHWKHDSSOLFDWLRQWRXVHWKHPRGLILHGGHILQLWLRQV x
E 8VHDVXLWDEOHVKDUHGOLEUDU\PHFKDQLVPIRUOLQNLQJZLWKWKH/LEUDU\$VXLWDEOHPHFKDQLVPLVRQH
WKDW XVHVDWUXQWLPHDFRS\RIWKHOLEUDU\DOUHDG\SUHVHQWRQWKHXVHU VFRPSXWHUV\VWHPUDWKHU
WKDQFRS\LQJOLEUDU\IXQFWLRQVLQWRWKHH[HFXWDEOHDQG ZLOORSHUDWHSURSHUO\ZLWKDPRGLILHGYHUVLRQ
RIWKHOLEUDU\LIWKHXVHULQVWDOOVRQHDVORQJDVWKHPRGLILHGYHUVLRQLVLQWHUIDFHFRPSDWLEOHZLWKWKH
YHUVLRQWKDWWKHZRUNZDVPDGHZLWK x
F $FFRPSDQ\WKH ZRUN ZLWK D ZULWWHQRIIHU YDOLGIRU DW OHDVWWKUHH \HDUV WR JLYH WKH VDPH XVHUWKH
PDWHULDOV VSHFLILHG LQ 6XEVHFWLRQ D DERYH IRU D FKDUJH QR PRUH WKDQ WKH FRVW RI SHUIRUPLQJ WKLV
GLVWULEXWLRQ x
G ,IGLVWULEXWLRQRIWKHZRUNLVPDGHE\RIIHULQJDFFHVVWRFRS\IURPDGHVLJQDWHGSODFHRIIHUHTXLYDOHQW
DFFHVVWRFRS\WKHDERYHVSHFLILHGPDWHULDOVIURPWKHVDPHSODFH x
H 9HULI\WKDWWKHXVHUKDVDOUHDG\UHFHLYHGDFRS\RIWKHVHPDWHULDOVRUWKDW\RXKDYHDOUHDG\VHQWWKLV
XVHUDFRS\ )RUDQH[HFXWDEOHWKHUHTXLUHGIRUPRIWKHZRUNWKDWXVHVWKH/LEUDU\PXVWLQFOXGHDQ\GDWDDQGXWLOLW\
SURJUDPVQHHGHGIRUUHSURGXFLQJWKHH[HFXWDEOHIURPLW+RZHYHUDVDVSHFLDOH[FHSWLRQWKHPDWHULDOVWREH
GLVWULEXWHGQHHGQRWLQFOXGHDQ\WKLQJWKDWLVQRUPDOO\GLVWULEXWHG LQHLWKHUVRXUFHRUELQDU\IRUP ZLWKWKH
– 43 –
PDMRUFRPSRQHQWV FRPSLOHUNHUQHODQGVRRQ RIWKHRSHUDWLQJV\VWHPRQZKLFKWKHH[HFXWDEOHUXQVXQOHVV
WKDWFRPSRQHQWLWVHOIDFFRPSDQLHVWKHH[HFXWDEOH ,WPD\KDSSHQWKDWWKLVUHTXLUHPHQWFRQWUDGLFWVWKHOLFHQVHUHVWULFWLRQVRIRWKHUSURSULHWDU\OLEUDULHVWKDWGRQRW
QRUPDOO\DFFRPSDQ\WKHRSHUDWLQJV\VWHP6XFKDFRQWUDGLFWLRQPHDQV\RXFDQQRWXVHERWKWKHPDQGWKH
/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RXGLVWULEXWH <RXPD\SODFHOLEUDU\IDFLOLWLHVWKDWDUHDZRUNEDVHGRQWKH/LEUDU\VLGHE\VLGHLQDVLQJOHOLEUDU\WRJHWKHU
ZLWKRWKHUOLEUDU\IDFLOLWLHVQRWFRYHUHGE\WKLV/LFHQVHDQGGLVWULEXWHVXFKDFRPELQHGOLEUDU\SURYLGHGWKDW
WKHVHSDUDWHGLVWULEXWLRQRIWKHZRUNEDVHGRQWKH/LEUDU\DQGRIWKHRWKHUOLEUDU\IDFLOLWLHVLVRWKHUZLVH
SHUPLWWHGDQGSURYLGHGWKDW\RXGRWKHVHWZRWKLQJV x
D $FFRPSDQ\WKHFRPELQHGOLEUDU\ZLWKDFRS\RIWKHVDPHZRUNEDVHGRQWKH/LEUDU\XQFRPELQHG
ZLWKDQ\RWKHUOLEUDU\IDFLOLWLHV7KLVPXVWEHGLVWULEXWHGXQGHUWKHWHUPVRIWKH6HFWLRQVDERYH x
E *LYH SURPLQHQW QRWLFH ZLWK WKH FRPELQHG OLEUDU\RI WKHIDFW WKDW SDUWRI LW LVDZRUN EDVHGRQ WKH
/LEUDU\DQGH[SODLQLQJZKHUHWRILQGWKHDFFRPSDQ\LQJXQFRPELQHGIRUPRIWKHVDPHZRUN <RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWHWKH/LEUDU\H[FHSWDVH[SUHVVO\SURYLGHG
XQGHUWKLV/LFHQVH$Q\DWWHPSWRWKHUZLVHWRFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWHWKH/LEUDU\LV
YRLGDQGZLOODXWRPDWLFDOO\WHUPLQDWH\RXUULJKWVXQGHUWKLV/LFHQVH+RZHYHUSDUWLHVZKRKDYHUHFHLYHG
FRSLHVRUULJKWVIURP\RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHVWHUPLQDWHGVRORQJDVVXFKSDUWLHV
UHPDLQLQIXOOFRPSOLDQFH <RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYHQRWVLJQHGLW+RZHYHUQRWKLQJHOVHJUDQWV\RX
SHUPLVVLRQWRPRGLI\RUGLVWULEXWHWKH/LEUDU\RULWVGHULYDWLYHZRUNV7KHVHDFWLRQVDUHSURKLELWHGE\ODZLI\RX
GRQRWDFFHSWWKLV/LFHQVH7KHUHIRUHE\PRGLI\LQJRUGLVWULEXWLQJWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH
/LEUDU\ \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQGDOOLWVWHUPVDQGFRQGLWLRQVIRUFRS\LQJ
GLVWULEXWLQJRUPRGLI\LQJWKH/LEUDU\RUZRUNVEDVHGRQLW (DFKWLPH\RXUHGLVWULEXWHWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH/LEUDU\ WKHUHFLSLHQWDXWRPDWLFDOO\
UHFHLYHVDOLFHQVHIURPWKHRULJLQDOOLFHQVRUWRFRS\GLVWULEXWHOLQNZLWKRUPRGLI\WKH/LEUDU\VXEMHFWWRWKHVH
WHUPVDQGFRQGLWLRQV<RXPD\QRWLPSRVHDQ\IXUWKHUUHVWULFWLRQVRQWKHUHFLSLHQWV H[HUFLVHRIWKHULJKWV
JUDQWHGKHUHLQ<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVZLWKWKLV/LFHQVH ,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQRISDWHQWLQIULQJHPHQWRUIRUDQ\RWKHUUHDVRQ QRW
OLPLWHGWRSDWHQWLVVXHV FRQGLWLRQVDUHLPSRVHGRQ\RX ZKHWKHUE\FRXUWRUGHUDJUHHPHQWRURWKHUZLVH WKDW
FRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRWH[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH,I\RX
FDQQRWGLVWULEXWHVRDVWRVDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV/LFHQVHDQGDQ\RWKHUSHUWLQHQW
REOLJDWLRQVWKHQDVDFRQVHTXHQFH\RXPD\QRWGLVWULEXWHWKH/LEUDU\DWDOO)RUH[DPSOHLIDSDWHQWOLFHQVH
ZRXOGQRWSHUPLWUR\DOW\IUHHUHGLVWULEXWLRQRIWKH/LEUDU\E\DOOWKRVHZKRUHFHLYHFRSLHVGLUHFWO\RULQGLUHFWO\
WKURXJK\RXWKHQWKHRQO\ZD\\RXFRXOGVDWLVI\ERWKLWDQGWKLV/LFHQVHZRXOGEHWRUHIUDLQHQWLUHO\IURP
GLVWULEXWLRQRIWKH/LEUDU\ ,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOGLQYDOLGRUXQHQIRUFHDEOHXQGHUDQ\SDUWLFXODUFLUFXPVWDQFHWKHEDODQFHRI
WKHVHFWLRQLVLQWHQGHGWRDSSO\DQGWKHVHFWLRQDVDZKROHLVLQWHQGHGWRDSSO\LQRWKHUFLUFXPVWDQFHV – 44 –
,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\SDWHQWVRURWKHUSURSHUW\ULJKWFODLPVRUWR
FRQWHVWYDOLGLW\RIDQ\VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJWKHLQWHJULW\RIWKHIUHH
VRIWZDUHGLVWULEXWLRQV\VWHPZKLFKLVLPSOHPHQWHGE\SXEOLFOLFHQVHSUDFWLFHV0DQ\SHRSOHKDYHPDGH
JHQHURXVFRQWULEXWLRQVWRWKHZLGHUDQJHRIVRIWZDUHGLVWULEXWHGWKURXJKWKDWV\VWHPLQUHOLDQFHRQFRQVLVWHQW
DSSOLFDWLRQRIWKDWV\VWHPLWLVXSWRWKHDXWKRUGRQRUWRGHFLGHLIKHRUVKHLVZLOOLQJWRGLVWULEXWHVRIWZDUH
WKURXJKDQ\RWKHUV\VWHPDQGDOLFHQVHHFDQQRWLPSRVHWKDWFKRLFH 7KLVVHFWLRQLVLQWHQGHGWRPDNHWKRURXJKO\FOHDUZKDWLVEHOLHYHGWREHDFRQVHTXHQFHRIWKHUHVWRIWKLV
/LFHQVH ,IWKHGLVWULEXWLRQDQGRUXVHRIWKH/LEUDU\LVUHVWULFWHGLQFHUWDLQFRXQWULHVHLWKHUE\SDWHQWVRUE\
FRS\ULJKWHGLQWHUIDFHVWKHRULJLQDOFRS\ULJKWKROGHUZKRSODFHVWKH/LEUDU\XQGHUWKLV/LFHQVHPD\DGGDQ
H[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQH[FOXGLQJWKRVHFRXQWULHVVRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\LQRU
DPRQJFRXQWULHVQRWWKXVH[FOXGHG,QVXFKFDVHWKLV/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLIZULWWHQLQWKH
ERG\RIWKLV/LFHQVH 7KH)UHH6RIWZDUH)RXQGDWLRQPD\SXEOLVKUHYLVHGDQGRUQHZYHUVLRQVRIWKH/HVVHU*HQHUDO3XEOLF
/LFHQVHIURPWLPHWRWLPH6XFKQHZYHUVLRQVZLOOEHVLPLODULQVSLULWWRWKHSUHVHQWYHUVLRQEXWPD\GLIIHULQ
GHWDLOWRDGGUHVVQHZSUREOHPVRUFRQFHUQV (DFKYHUVLRQLVJLYHQDGLVWLQJXLVKLQJYHUVLRQQXPEHU,IWKH/LEUDU\VSHFLILHVDYHUVLRQQXPEHURIWKLV
/LFHQVHZKLFKDSSOLHVWRLWDQGDQ\ODWHUYHUVLRQ\RXKDYHWKHRSWLRQRIIROORZLQJWKHWHUPVDQGFRQGLWLRQV
HLWKHURIWKDWYHUVLRQRURIDQ\ODWHUYHUVLRQSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQ,IWKH/LEUDU\GRHVQRW
VSHFLI\DOLFHQVHYHUVLRQQXPEHU\RXPD\FKRRVHDQ\YHUVLRQHYHUSXEOLVKHGE\WKH)UHH6RIWZDUH
)RXQGDWLRQ ,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH/LEUDU\LQWRRWKHUIUHHSURJUDPVZKRVHGLVWULEXWLRQFRQGLWLRQVDUH
LQFRPSDWLEOHZLWKWKHVHZULWHWRWKHDXWKRUWRDVNIRUSHUPLVVLRQ)RUVRIWZDUHZKLFKLVFRS\ULJKWHGE\WKH
)UHH6RIWZDUH)RXQGDWLRQZULWHWRWKH)UHH6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRUWKLV
2XUGHFLVLRQZLOOEHJXLGHGE\WKHWZRJRDOVRISUHVHUYLQJWKHIUHHVWDWXVRIDOOGHULYDWLYHVRIRXUIUHHVRIWZDUH
DQGRISURPRWLQJWKHVKDULQJDQGUHXVHRIVRIWZDUHJHQHUDOO\ 12:$55$17< %(&$86(7+(/,%5$5<,6/,&(16(')5((2)&+$5*(7+(5(,612:$55$17<)257+(
/,%5$5<727+((;7(173(50,77('%<$33/,&$%/(/$:(;&(37:+(127+(5:,6(67$7('
,1:5,7,1*7+(&23<5,*+7+2/'(56$1'2527+(53$57,(63529,'(7+(/,%5$5<$6,6
:,7+287:$55$17<2)$1<.,1'(,7+(5(;35(66('25,03/,(',1&/8',1*%87127
/,0,7('727+(,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326(7+((17,5(5,6.$6727+(48$/,7<$1'3(5)250$1&(2)7+(/,%5$5<,6:,7+
<286+28/'7+(/,%5$5<3529('()(&7,9(<28$6680(7+(&2672)$//1(&(66$5<
6(59,&,1*5(3$,525&255(&7,21 ,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25$*5(('72,1:5,7,1*:,//$1<
&23<5,*+7+2/'(525$1<27+(53$57<:+20$<02',)<$1'255(',675,%87(7+(
/,%5$5<$63(50,77('$%29(%(/,$%/(72<28)25'$0$*(6,1&/8',1*$1<*(1(5$/
– 45 –
63(&,$/,1&,'(17$/25&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25,1$%,/,7<72
86(7+(/,%5$5< ,1&/8',1*%87127/,0,7('72/2662)'$7$25'$7$%(,1*5(1'(5('
,1$&&85$7(25/266(66867$,1('%<<28257+,5'3$57,(625$)$,/85(2)7+(/,%5$5<
7223(5$7(:,7+$1<27+(562)7:$5( (9(1,)68&++2/'(52527+(53$57<+$6%((1
$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(6 (1'2)7(506$1'&21',7,216
+RZWR$SSO\7KHVH7HUPVWR<RXU1HZ/LEUDULHV
,I\RXGHYHORSDQHZOLEUDU\DQG\RXZDQWLWWREHRIWKHJUHDWHVWSRVVLEOHXVHWRWKHSXEOLFZHUHFRPPHQG
PDNLQJLWIUHHVRIWZDUHWKDWHYHU\RQHFDQUHGLVWULEXWHDQGFKDQJH<RXFDQGRVRE\SHUPLWWLQJUHGLVWULEXWLRQ
XQGHUWKHVHWHUPV RUDOWHUQDWLYHO\XQGHUWKHWHUPVRIWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH 7RDSSO\WKHVHWHUPVDWWDFKWKHIROORZLQJQRWLFHVWRWKHOLEUDU\,WLVVDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFK
VRXUFHILOHWRPRVWHIIHFWLYHO\FRQYH\WKHH[FOXVLRQRIZDUUDQW\DQGHDFKILOHVKRXOGKDYHDWOHDVWWKH
FRS\ULJKWOLQHDQGDSRLQWHUWRZKHUHWKHIXOOQRWLFHLVIRXQG RQHOLQHWRJLYHWKHOLEUDU\ VQDPHDQGDQLGHDRIZKDWLWGRHV
&RS\ULJKW & \HDU QDPHRIDXWKRU
7KLVOLEUDU\LVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18/HVVHU*HQHUDO3XEOLF
/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHU
YHUVLRQRIWKH/LFHQVHRU DW\RXURSWLRQ DQ\ODWHUYHUVLRQ
7KLVOLEUDU\LVGLVWULEXWHGLQWKHKRSHWKDWLWZLOOEHXVHIXO
EXW:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\RI
0(5&+$17$%,/,7<RU),71(66)25$3$57,&8/$5385326( 6HHWKH*18
/HVVHU*HQHUDO3XEOLF/LFHQVHIRUPRUHGHWDLOV
<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18/HVVHU*HQHUDO3XEOLF
/LFHQVHDORQJZLWKWKLVOLEUDU\LIQRWZULWHWRWKH)UHH6RIWZDUH
)RXQGDWLRQ,QF)UDQNOLQ6WUHHW)LIWK)ORRU%RVWRQ0$ 86$
$OVRDGGLQIRUPDWLRQRQKRZWRFRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO <RXVKRXOGDOVRJHW\RXUHPSOR\HU LI\RXZRUNDVDSURJUDPPHU RU\RXUVFKRROLIDQ\WRVLJQDFRS\ULJKW
GLVFODLPHUIRUWKHOLEUDU\LIQHFHVVDU\+HUHLVDVDPSOHDOWHUWKHQDPHV <R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQ
WKHOLEUDU\C)URE DOLEUDU\IRUWZHDNLQJNQREV ZULWWHQ
E\-DPHV5DQGRP+DFNHU
VLJQDWXUHRI7\&RRQ$SULO
7\&RRQ3UHVLGHQWRI9LFH
– 46 –
7KDW VDOOWKHUHLVWRLW
– 47 –
JOLE
*18/,%5$5<*(1(5$/38%/,&/,&(16(
9HUVLRQ-XQH
&RS\ULJKW & )UHH6RIWZDUH)RXQGDWLRQ,QF
7HPSOH3ODFH6XLWH%RVWRQ0$ 86$
(YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWHYHUEDWLPFRSLHV
RIWKLVOLFHQVHGRFXPHQWEXWFKDQJLQJLWLVQRWDOORZHG
>7KLVLVWKHILUVWUHOHDVHGYHUVLRQRIWKHOLEUDU\*3/ ,WLV
QXPEHUHGEHFDXVHLWJRHVZLWKYHUVLRQRIWKHRUGLQDU\*3/@
3UHDPEOH
7KHOLFHQVHVIRUPRVWVRIWZDUHDUHGHVLJQHGWRWDNHDZD\\RXU
IUHHGRPWRVKDUHDQGFKDQJHLW %\FRQWUDVWWKH*18*HQHUDO3XEOLF
/LFHQVHVDUHLQWHQGHGWRJXDUDQWHH\RXUIUHHGRPWRVKDUHDQGFKDQJH
IUHHVRIWZDUHWRPDNHVXUHWKHVRIWZDUHLVIUHHIRUDOOLWVXVHUV
7KLVOLFHQVHWKH/LEUDU\*HQHUDO3XEOLF/LFHQVHDSSOLHVWRVRPH
VSHFLDOO\GHVLJQDWHG)UHH6RIWZDUH)RXQGDWLRQVRIWZDUHDQGWRDQ\
RWKHUOLEUDULHVZKRVHDXWKRUVGHFLGHWRXVHLW <RXFDQXVHLWIRU
\RXUOLEUDULHVWRR
:KHQZHVSHDNRIIUHHVRIWZDUHZHDUHUHIHUULQJWRIUHHGRPQRW
SULFH 2XU*HQHUDO3XEOLF/LFHQVHVDUHGHVLJQHGWRPDNHVXUHWKDW\RX
KDYHWKHIUHHGRPWRGLVWULEXWHFRSLHVRIIUHHVRIWZDUH DQGFKDUJHIRU
WKLVVHUYLFHLI\RXZLVK WKDW\RXUHFHLYHVRXUFHFRGHRUFDQJHWLW
LI\RXZDQWLWWKDW\RXFDQFKDQJHWKHVRIWZDUHRUXVHSLHFHVRILW
LQQHZIUHHSURJUDPVDQGWKDW\RXNQRZ\RXFDQGRWKHVHWKLQJV
7RSURWHFW\RXUULJKWVZHQHHGWRPDNHUHVWULFWLRQVWKDWIRUELG
DQ\RQHWRGHQ\\RXWKHVHULJKWVRUWRDVN\RXWRVXUUHQGHUWKHULJKWV
7KHVHUHVWULFWLRQVWUDQVODWHWRFHUWDLQUHVSRQVLELOLWLHVIRU\RXLI
\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\RULI\RXPRGLI\LW
)RUH[DPSOHLI\RXGLVWULEXWHFRSLHVRIWKHOLEUDU\ZKHWKHUJUDWLV
– 48 –
RUIRUDIHH\RXPXVWJLYHWKHUHFLSLHQWVDOOWKHULJKWVWKDWZHJDYH
\RX <RXPXVWPDNHVXUHWKDWWKH\WRRUHFHLYHRUFDQJHWWKHVRXUFH
FRGH ,I\RXOLQNDSURJUDPZLWKWKHOLEUDU\\RXPXVWSURYLGH
FRPSOHWHREMHFWILOHVWRWKHUHFLSLHQWVVRWKDWWKH\FDQUHOLQNWKHP
ZLWKWKHOLEUDU\DIWHUPDNLQJFKDQJHVWRWKHOLEUDU\DQGUHFRPSLOLQJ
LW $QG\RXPXVWVKRZWKHPWKHVHWHUPVVRWKH\NQRZWKHLUULJKWV
2XUPHWKRGRISURWHFWLQJ\RXUULJKWVKDVWZRVWHSV FRS\ULJKW
WKHOLEUDU\DQG RIIHU\RXWKLVOLFHQVHZKLFKJLYHV\RXOHJDO
SHUPLVVLRQWRFRS\GLVWULEXWHDQGRUPRGLI\WKHOLEUDU\
$OVRIRUHDFKGLVWULEXWRU VSURWHFWLRQZHZDQWWRPDNHFHUWDLQ
WKDWHYHU\RQHXQGHUVWDQGVWKDWWKHUHLVQRZDUUDQW\IRUWKLVIUHH
OLEUDU\ ,IWKHOLEUDU\LVPRGLILHGE\VRPHRQHHOVHDQGSDVVHGRQZH
ZDQWLWVUHFLSLHQWVWRNQRZWKDWZKDWWKH\KDYHLVQRWWKHRULJLQDO
YHUVLRQVRWKDWDQ\SUREOHPVLQWURGXFHGE\RWKHUVZLOOQRWUHIOHFWRQ
WKHRULJLQDODXWKRUV UHSXWDWLRQV
)LQDOO\DQ\IUHHSURJUDPLVWKUHDWHQHGFRQVWDQWO\E\VRIWZDUH
SDWHQWV :HZLVKWRDYRLGWKHGDQJHUWKDWFRPSDQLHVGLVWULEXWLQJIUHH
VRIWZDUHZLOOLQGLYLGXDOO\REWDLQSDWHQWOLFHQVHVWKXVLQHIIHFW
WUDQVIRUPLQJWKHSURJUDPLQWRSURSULHWDU\VRIWZDUH 7RSUHYHQWWKLV
ZHKDYHPDGHLWFOHDUWKDWDQ\SDWHQWPXVWEHOLFHQVHGIRUHYHU\RQH V
IUHHXVHRUQRWOLFHQVHGDWDOO
0RVW*18VRIWZDUHLQFOXGLQJVRPHOLEUDULHVLVFRYHUHGE\WKHRUGLQDU\
*18*HQHUDO3XEOLF/LFHQVHZKLFKZDVGHVLJQHGIRUXWLOLW\SURJUDPV 7KLV
OLFHQVHWKH*18/LEUDU\*HQHUDO3XEOLF/LFHQVHDSSOLHVWRFHUWDLQ
GHVLJQDWHGOLEUDULHV 7KLVOLFHQVHLVTXLWHGLIIHUHQWIURPWKHRUGLQDU\
RQHEHVXUHWRUHDGLWLQIXOODQGGRQ WDVVXPHWKDWDQ\WKLQJLQLWLV
WKHVDPHDVLQWKHRUGLQDU\OLFHQVH
7KHUHDVRQZHKDYHDVHSDUDWHSXEOLFOLFHQVHIRUVRPHOLEUDULHVLVWKDW
WKH\EOXUWKHGLVWLQFWLRQZHXVXDOO\PDNHEHWZHHQPRGLI\LQJRUDGGLQJWRD
SURJUDPDQGVLPSO\XVLQJLW /LQNLQJDSURJUDPZLWKDOLEUDU\ZLWKRXW
FKDQJLQJWKHOLEUDU\LVLQVRPHVHQVHVLPSO\XVLQJWKHOLEUDU\DQGLV
DQDORJRXVWRUXQQLQJDXWLOLW\SURJUDPRUDSSOLFDWLRQSURJUDP +RZHYHULQ
DWH[WXDODQGOHJDOVHQVHWKHOLQNHGH[HFXWDEOHLVDFRPELQHGZRUND
– 49 –
GHULYDWLYHRIWKHRULJLQDOOLEUDU\DQGWKHRUGLQDU\*HQHUDO3XEOLF/LFHQVH
WUHDWVLWDVVXFK
%HFDXVHRIWKLVEOXUUHGGLVWLQFWLRQXVLQJWKHRUGLQDU\*HQHUDO
3XEOLF/LFHQVHIRUOLEUDULHVGLGQRWHIIHFWLYHO\SURPRWHVRIWZDUH
VKDULQJEHFDXVHPRVWGHYHORSHUVGLGQRWXVHWKHOLEUDULHV :H
FRQFOXGHGWKDWZHDNHUFRQGLWLRQVPLJKWSURPRWHVKDULQJEHWWHU
+RZHYHUXQUHVWULFWHGOLQNLQJRIQRQIUHHSURJUDPVZRXOGGHSULYHWKH
XVHUVRIWKRVHSURJUDPVRIDOOEHQHILWIURPWKHIUHHVWDWXVRIWKH
OLEUDULHVWKHPVHOYHV 7KLV/LEUDU\*HQHUDO3XEOLF/LFHQVHLVLQWHQGHGWR
SHUPLWGHYHORSHUVRIQRQIUHHSURJUDPVWRXVHIUHHOLEUDULHVZKLOH
SUHVHUYLQJ\RXUIUHHGRPDVDXVHURIVXFKSURJUDPVWRFKDQJHWKHIUHH
OLEUDULHVWKDWDUHLQFRUSRUDWHGLQWKHP :HKDYHQRWVHHQKRZWRDFKLHYH
WKLVDVUHJDUGVFKDQJHVLQKHDGHUILOHVEXWZHKDYHDFKLHYHGLWDVUHJDUGV
FKDQJHVLQWKHDFWXDOIXQFWLRQVRIWKH/LEUDU\ 7KHKRSHLVWKDWWKLV
ZLOOOHDGWRIDVWHUGHYHORSPHQWRIIUHHOLEUDULHV
7KHSUHFLVHWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLRQDQG
PRGLILFDWLRQIROORZ 3D\FORVHDWWHQWLRQWRWKHGLIIHUHQFHEHWZHHQD
ZRUNEDVHGRQWKHOLEUDU\DQGDZRUNWKDWXVHVWKHOLEUDU\ 7KH
IRUPHUFRQWDLQVFRGHGHULYHGIURPWKHOLEUDU\ZKLOHWKHODWWHURQO\
ZRUNVWRJHWKHUZLWKWKHOLEUDU\
1RWHWKDWLWLVSRVVLEOHIRUDOLEUDU\WREHFRYHUHGE\WKHRUGLQDU\
*HQHUDO3XEOLF/LFHQVHUDWKHUWKDQE\WKLVVSHFLDORQH
*18/,%5$5<*(1(5$/38%/,&/,&(16(
7(506$1'&21',7,216)25&23<,1*',675,%87,21$1'02',),&$7,21
7KLV/LFHQVH$JUHHPHQWDSSOLHVWRDQ\VRIWZDUHOLEUDU\ZKLFK
FRQWDLQVDQRWLFHSODFHGE\WKHFRS\ULJKWKROGHURURWKHUDXWKRUL]HG
SDUW\VD\LQJLWPD\EHGLVWULEXWHGXQGHUWKHWHUPVRIWKLV/LEUDU\
*HQHUDO3XEOLF/LFHQVH DOVRFDOOHGWKLV/LFHQVH (DFKOLFHQVHHLV
DGGUHVVHGDV\RX
$OLEUDU\PHDQVDFROOHFWLRQRIVRIWZDUHIXQFWLRQVDQGRUGDWD
SUHSDUHGVRDVWREHFRQYHQLHQWO\OLQNHGZLWKDSSOLFDWLRQSURJUDPV
– 50 –
ZKLFKXVHVRPHRIWKRVHIXQFWLRQVDQGGDWD WRIRUPH[HFXWDEOHV
7KH/LEUDU\EHORZUHIHUVWRDQ\VXFKVRIWZDUHOLEUDU\RUZRUN
ZKLFKKDVEHHQGLVWULEXWHGXQGHUWKHVHWHUPV $ZRUNEDVHGRQWKH
/LEUDU\PHDQVHLWKHUWKH/LEUDU\RUDQ\GHULYDWLYHZRUNXQGHU
FRS\ULJKWODZWKDWLVWRVD\DZRUNFRQWDLQLQJWKH/LEUDU\RUD
SRUWLRQRILWHLWKHUYHUEDWLPRUZLWKPRGLILFDWLRQVDQGRUWUDQVODWHG
VWUDLJKWIRUZDUGO\LQWRDQRWKHUODQJXDJH +HUHLQDIWHUWUDQVODWLRQLV
LQFOXGHGZLWKRXWOLPLWDWLRQLQWKHWHUPPRGLILFDWLRQ 6RXUFHFRGHIRUDZRUNPHDQVWKHSUHIHUUHGIRUPRIWKHZRUNIRU
PDNLQJPRGLILFDWLRQVWRLW )RUDOLEUDU\FRPSOHWHVRXUFHFRGHPHDQV
DOOWKHVRXUFHFRGHIRUDOOPRGXOHVLWFRQWDLQVSOXVDQ\DVVRFLDWHG
LQWHUIDFHGHILQLWLRQILOHVSOXVWKHVFULSWVXVHGWRFRQWUROFRPSLODWLRQ
DQGLQVWDOODWLRQRIWKHOLEUDU\
$FWLYLWLHVRWKHUWKDQFRS\LQJGLVWULEXWLRQDQGPRGLILFDWLRQDUHQRW
FRYHUHGE\WKLV/LFHQVHWKH\DUHRXWVLGHLWVVFRSH 7KHDFWRI
UXQQLQJDSURJUDPXVLQJWKH/LEUDU\LVQRWUHVWULFWHGDQGRXWSXWIURP
VXFKDSURJUDPLVFRYHUHGRQO\LILWVFRQWHQWVFRQVWLWXWHDZRUNEDVHG
RQWKH/LEUDU\ LQGHSHQGHQWRIWKHXVHRIWKH/LEUDU\LQDWRROIRU
ZULWLQJLW :KHWKHUWKDWLVWUXHGHSHQGVRQZKDWWKH/LEUDU\GRHV
DQGZKDWWKHSURJUDPWKDWXVHVWKH/LEUDU\GRHV
<RXPD\FRS\DQGGLVWULEXWHYHUEDWLPFRSLHVRIWKH/LEUDU\ V
FRPSOHWHVRXUFHFRGHDV\RXUHFHLYHLWLQDQ\PHGLXPSURYLGHGWKDW
\RXFRQVSLFXRXVO\DQGDSSURSULDWHO\SXEOLVKRQHDFKFRS\DQ
DSSURSULDWHFRS\ULJKWQRWLFHDQGGLVFODLPHURIZDUUDQW\NHHSLQWDFW
DOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHDQGWRWKHDEVHQFHRIDQ\
ZDUUDQW\DQGGLVWULEXWHDFRS\RIWKLV/LFHQVHDORQJZLWKWKH
/LEUDU\
<RXPD\FKDUJHDIHHIRUWKHSK\VLFDODFWRIWUDQVIHUULQJDFRS\
DQG\RXPD\DW\RXURSWLRQRIIHUZDUUDQW\SURWHFWLRQLQH[FKDQJHIRUD
IHH
<RXPD\PRGLI\\RXUFRS\RUFRSLHVRIWKH/LEUDU\RUDQ\SRUWLRQ
RILWWKXVIRUPLQJDZRUNEDVHGRQWKH/LEUDU\DQGFRS\DQG
– 51 –
GLVWULEXWHVXFKPRGLILFDWLRQVRUZRUNXQGHUWKHWHUPVRI6HFWLRQ
DERYHSURYLGHGWKDW\RXDOVRPHHWDOORIWKHVHFRQGLWLRQV
D 7KHPRGLILHGZRUNPXVWLWVHOIEHDVRIWZDUHOLEUDU\
E <RXPXVWFDXVHWKHILOHVPRGLILHGWRFDUU\SURPLQHQWQRWLFHV
VWDWLQJWKDW\RXFKDQJHGWKHILOHVDQGWKHGDWHRIDQ\FKDQJH
F <RXPXVWFDXVHWKHZKROHRIWKHZRUNWREHOLFHQVHGDWQR
FKDUJHWRDOOWKLUGSDUWLHVXQGHUWKHWHUPVRIWKLV/LFHQVH
G ,IDIDFLOLW\LQWKHPRGLILHG/LEUDU\UHIHUVWRDIXQFWLRQRUD
WDEOHRIGDWDWREHVXSSOLHGE\DQDSSOLFDWLRQSURJUDPWKDWXVHV
WKHIDFLOLW\RWKHUWKDQDVDQDUJXPHQWSDVVHGZKHQWKHIDFLOLW\
LVLQYRNHGWKHQ\RXPXVWPDNHDJRRGIDLWKHIIRUWWRHQVXUHWKDW
LQWKHHYHQWDQDSSOLFDWLRQGRHVQRWVXSSO\VXFKIXQFWLRQRU
WDEOHWKHIDFLOLW\VWLOORSHUDWHVDQGSHUIRUPVZKDWHYHUSDUWRI
LWVSXUSRVHUHPDLQVPHDQLQJIXO
)RUH[DPSOHDIXQFWLRQLQDOLEUDU\WRFRPSXWHVTXDUHURRWVKDV
DSXUSRVHWKDWLVHQWLUHO\ZHOOGHILQHGLQGHSHQGHQWRIWKH
DSSOLFDWLRQ 7KHUHIRUH6XEVHFWLRQGUHTXLUHVWKDWDQ\
DSSOLFDWLRQVXSSOLHGIXQFWLRQRUWDEOHXVHGE\WKLVIXQFWLRQPXVW
EHRSWLRQDOLIWKHDSSOLFDWLRQGRHVQRWVXSSO\LWWKHVTXDUH
URRWIXQFWLRQPXVWVWLOOFRPSXWHVTXDUHURRWV 7KHVHUHTXLUHPHQWVDSSO\WRWKHPRGLILHGZRUNDVDZKROH ,I
LGHQWLILDEOHVHFWLRQVRIWKDWZRUNDUHQRWGHULYHGIURPWKH/LEUDU\
DQGFDQEHUHDVRQDEO\FRQVLGHUHGLQGHSHQGHQWDQGVHSDUDWHZRUNVLQ
WKHPVHOYHVWKHQWKLV/LFHQVHDQGLWVWHUPVGRQRWDSSO\WRWKRVH
VHFWLRQVZKHQ\RXGLVWULEXWHWKHPDVVHSDUDWHZRUNV %XWZKHQ\RX
GLVWULEXWHWKHVDPHVHFWLRQVDVSDUWRIDZKROHZKLFKLVDZRUNEDVHG
RQWKH/LEUDU\WKHGLVWULEXWLRQRIWKHZKROHPXVWEHRQWKHWHUPVRI
WKLV/LFHQVHZKRVHSHUPLVVLRQVIRURWKHUOLFHQVHHVH[WHQGWRWKH
HQWLUHZKROHDQGWKXVWRHDFKDQGHYHU\SDUWUHJDUGOHVVRIZKRZURWH
LW
7KXVLWLVQRWWKHLQWHQWRIWKLVVHFWLRQWRFODLPULJKWVRUFRQWHVW
– 52 –
\RXUULJKWVWRZRUNZULWWHQHQWLUHO\E\\RXUDWKHUWKHLQWHQWLVWR
H[HUFLVHWKHULJKWWRFRQWUROWKHGLVWULEXWLRQRIGHULYDWLYHRU
FROOHFWLYHZRUNVEDVHGRQWKH/LEUDU\
,QDGGLWLRQPHUHDJJUHJDWLRQRIDQRWKHUZRUNQRWEDVHGRQWKH/LEUDU\
ZLWKWKH/LEUDU\ RUZLWKDZRUNEDVHGRQWKH/LEUDU\ RQDYROXPHRI
DVWRUDJHRUGLVWULEXWLRQPHGLXPGRHVQRWEULQJWKHRWKHUZRUNXQGHU
WKHVFRSHRIWKLV/LFHQVH
<RXPD\RSWWRDSSO\WKHWHUPVRIWKHRUGLQDU\*18*HQHUDO3XEOLF
/LFHQVHLQVWHDGRIWKLV/LFHQVHWRDJLYHQFRS\RIWKH/LEUDU\ 7RGR
WKLV\RXPXVWDOWHUDOOWKHQRWLFHVWKDWUHIHUWRWKLV/LFHQVHVR
WKDWWKH\UHIHUWRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHYHUVLRQ
LQVWHDGRIWRWKLV/LFHQVH ,IDQHZHUYHUVLRQWKDQYHUVLRQRIWKH
RUGLQDU\*18*HQHUDO3XEOLF/LFHQVHKDVDSSHDUHGWKHQ\RXFDQVSHFLI\
WKDWYHUVLRQLQVWHDGLI\RXZLVK 'RQRWPDNHDQ\RWKHUFKDQJHLQ
WKHVHQRWLFHV
2QFHWKLVFKDQJHLVPDGHLQDJLYHQFRS\LWLVLUUHYHUVLEOHIRU
WKDWFRS\VRWKHRUGLQDU\*18*HQHUDO3XEOLF/LFHQVHDSSOLHVWRDOO
VXEVHTXHQWFRSLHVDQGGHULYDWLYHZRUNVPDGHIURPWKDWFRS\
7KLVRSWLRQLVXVHIXOZKHQ\RXZLVKWRFRS\SDUWRIWKHFRGHRI
WKH/LEUDU\LQWRDSURJUDPWKDWLVQRWDOLEUDU\
<RXPD\FRS\DQGGLVWULEXWHWKH/LEUDU\ RUDSRUWLRQRU
GHULYDWLYHRILWXQGHU6HFWLRQ LQREMHFWFRGHRUH[HFXWDEOHIRUP
XQGHUWKHWHUPVRI6HFWLRQVDQGDERYHSURYLGHGWKDW\RXDFFRPSDQ\
LWZLWKWKHFRPSOHWHFRUUHVSRQGLQJPDFKLQHUHDGDEOHVRXUFHFRGHZKLFK
PXVWEHGLVWULEXWHGXQGHUWKHWHUPVRI6HFWLRQVDQGDERYHRQD
PHGLXPFXVWRPDULO\XVHGIRUVRIWZDUHLQWHUFKDQJH
,IGLVWULEXWLRQRIREMHFWFRGHLVPDGHE\RIIHULQJDFFHVVWRFRS\
IURPDGHVLJQDWHGSODFHWKHQRIIHULQJHTXLYDOHQWDFFHVVWRFRS\WKH
VRXUFHFRGHIURPWKHVDPHSODFHVDWLVILHVWKHUHTXLUHPHQWWR
GLVWULEXWHWKHVRXUFHFRGHHYHQWKRXJKWKLUGSDUWLHVDUHQRW
FRPSHOOHGWRFRS\WKHVRXUFHDORQJZLWKWKHREMHFWFRGH
– 53 –
$SURJUDPWKDWFRQWDLQVQRGHULYDWLYHRIDQ\SRUWLRQRIWKH
/LEUDU\EXWLVGHVLJQHGWRZRUNZLWKWKH/LEUDU\E\EHLQJFRPSLOHGRU
OLQNHGZLWKLWLVFDOOHGDZRUNWKDWXVHVWKH/LEUDU\ 6XFKD
ZRUNLQLVRODWLRQLVQRWDGHULYDWLYHZRUNRIWKH/LEUDU\DQG
WKHUHIRUHIDOOVRXWVLGHWKHVFRSHRIWKLV/LFHQVH
+RZHYHUOLQNLQJDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH/LEUDU\
FUHDWHVDQH[HFXWDEOHWKDWLVDGHULYDWLYHRIWKH/LEUDU\ EHFDXVHLW
FRQWDLQVSRUWLRQVRIWKH/LEUDU\ UDWKHUWKDQDZRUNWKDWXVHVWKH
OLEUDU\ 7KHH[HFXWDEOHLVWKHUHIRUHFRYHUHGE\WKLV/LFHQVH
6HFWLRQVWDWHVWHUPVIRUGLVWULEXWLRQRIVXFKH[HFXWDEOHV
:KHQDZRUNWKDWXVHVWKH/LEUDU\XVHVPDWHULDOIURPDKHDGHUILOH
WKDWLVSDUWRIWKH/LEUDU\WKHREMHFWFRGHIRUWKHZRUNPD\EHD
GHULYDWLYHZRUNRIWKH/LEUDU\HYHQWKRXJKWKHVRXUFHFRGHLVQRW
:KHWKHUWKLVLVWUXHLVHVSHFLDOO\VLJQLILFDQWLIWKHZRUNFDQEH
OLQNHGZLWKRXWWKH/LEUDU\RULIWKHZRUNLVLWVHOIDOLEUDU\ 7KH
WKUHVKROGIRUWKLVWREHWUXHLVQRWSUHFLVHO\GHILQHGE\ODZ
,IVXFKDQREMHFWILOHXVHVRQO\QXPHULFDOSDUDPHWHUVGDWD
VWUXFWXUHOD\RXWVDQGDFFHVVRUVDQGVPDOOPDFURVDQGVPDOOLQOLQH
IXQFWLRQV WHQOLQHVRUOHVVLQOHQJWK WKHQWKHXVHRIWKHREMHFW
ILOHLVXQUHVWULFWHGUHJDUGOHVVRIZKHWKHULWLVOHJDOO\DGHULYDWLYH
ZRUN ([HFXWDEOHVFRQWDLQLQJWKLVREMHFWFRGHSOXVSRUWLRQVRIWKH
/LEUDU\ZLOOVWLOOIDOOXQGHU6HFWLRQ 2WKHUZLVHLIWKHZRUNLVDGHULYDWLYHRIWKH/LEUDU\\RXPD\
GLVWULEXWHWKHREMHFWFRGHIRUWKHZRUNXQGHUWKHWHUPVRI6HFWLRQ
$Q\H[HFXWDEOHVFRQWDLQLQJWKDWZRUNDOVRIDOOXQGHU6HFWLRQ
ZKHWKHURUQRWWKH\DUHOLQNHGGLUHFWO\ZLWKWKH/LEUDU\LWVHOI
$VDQH[FHSWLRQWRWKH6HFWLRQVDERYH\RXPD\DOVRFRPSLOHRU
OLQNDZRUNWKDWXVHVWKH/LEUDU\ZLWKWKH/LEUDU\WRSURGXFHD
ZRUNFRQWDLQLQJSRUWLRQVRIWKH/LEUDU\DQGGLVWULEXWHWKDWZRUN
XQGHUWHUPVRI\RXUFKRLFHSURYLGHGWKDWWKHWHUPVSHUPLW
PRGLILFDWLRQRIWKHZRUNIRUWKHFXVWRPHU VRZQXVHDQGUHYHUVH
HQJLQHHULQJIRUGHEXJJLQJVXFKPRGLILFDWLRQV
– 54 –
<RXPXVWJLYHSURPLQHQWQRWLFHZLWKHDFKFRS\RIWKHZRUNWKDWWKH
/LEUDU\LVXVHGLQLWDQGWKDWWKH/LEUDU\DQGLWVXVHDUHFRYHUHGE\
WKLV/LFHQVH <RXPXVWVXSSO\DFRS\RIWKLV/LFHQVH ,IWKHZRUN
GXULQJH[HFXWLRQGLVSOD\VFRS\ULJKWQRWLFHV\RXPXVWLQFOXGHWKH
FRS\ULJKWQRWLFHIRUWKH/LEUDU\DPRQJWKHPDVZHOODVDUHIHUHQFH
GLUHFWLQJWKHXVHUWRWKHFRS\RIWKLV/LFHQVH $OVR\RXPXVWGRRQH
RIWKHVHWKLQJV
D $FFRPSDQ\WKHZRUNZLWKWKHFRPSOHWHFRUUHVSRQGLQJ
PDFKLQHUHDGDEOHVRXUFHFRGHIRUWKH/LEUDU\LQFOXGLQJZKDWHYHU
FKDQJHVZHUHXVHGLQWKHZRUN ZKLFKPXVWEHGLVWULEXWHGXQGHU
6HFWLRQVDQGDERYH DQGLIWKHZRUNLVDQH[HFXWDEOHOLQNHG
ZLWKWKH/LEUDU\ZLWKWKHFRPSOHWHPDFKLQHUHDGDEOHZRUNWKDW
XVHVWKH/LEUDU\DVREMHFWFRGHDQGRUVRXUFHFRGHVRWKDWWKH
XVHUFDQPRGLI\WKH/LEUDU\DQGWKHQUHOLQNWRSURGXFHDPRGLILHG
H[HFXWDEOHFRQWDLQLQJWKHPRGLILHG/LEUDU\ ,WLVXQGHUVWRRG
WKDWWKHXVHUZKRFKDQJHVWKHFRQWHQWVRIGHILQLWLRQVILOHVLQWKH
/LEUDU\ZLOOQRWQHFHVVDULO\EHDEOHWRUHFRPSLOHWKHDSSOLFDWLRQ
WRXVHWKHPRGLILHGGHILQLWLRQV E $FFRPSDQ\WKHZRUNZLWKDZULWWHQRIIHUYDOLGIRUDW
OHDVWWKUHH\HDUVWRJLYHWKHVDPHXVHUWKHPDWHULDOV
VSHFLILHGLQ6XEVHFWLRQDDERYHIRUDFKDUJHQRPRUH
WKDQWKHFRVWRISHUIRUPLQJWKLVGLVWULEXWLRQ
F ,IGLVWULEXWLRQRIWKHZRUNLVPDGHE\RIIHULQJDFFHVVWRFRS\
IURPDGHVLJQDWHGSODFHRIIHUHTXLYDOHQWDFFHVVWRFRS\WKHDERYH
VSHFLILHGPDWHULDOVIURPWKHVDPHSODFH
G 9HULI\WKDWWKHXVHUKDVDOUHDG\UHFHLYHGDFRS\RIWKHVH
PDWHULDOVRUWKDW\RXKDYHDOUHDG\VHQWWKLVXVHUDFRS\
)RUDQH[HFXWDEOHWKHUHTXLUHGIRUPRIWKHZRUNWKDWXVHVWKH
/LEUDU\PXVWLQFOXGHDQ\GDWDDQGXWLOLW\SURJUDPVQHHGHGIRU
UHSURGXFLQJWKHH[HFXWDEOHIURPLW +RZHYHUDVDVSHFLDOH[FHSWLRQ
WKHVRXUFHFRGHGLVWULEXWHGQHHGQRWLQFOXGHDQ\WKLQJWKDWLVQRUPDOO\
GLVWULEXWHG LQHLWKHUVRXUFHRUELQDU\IRUP ZLWKWKHPDMRU
FRPSRQHQWV FRPSLOHUNHUQHODQGVRRQ RIWKHRSHUDWLQJV\VWHPRQ
– 55 –
ZKLFKWKHH[HFXWDEOHUXQVXQOHVVWKDWFRPSRQHQWLWVHOIDFFRPSDQLHV
WKHH[HFXWDEOH
,WPD\KDSSHQWKDWWKLVUHTXLUHPHQWFRQWUDGLFWVWKHOLFHQVH
UHVWULFWLRQVRIRWKHUSURSULHWDU\OLEUDULHVWKDWGRQRWQRUPDOO\
DFFRPSDQ\WKHRSHUDWLQJV\VWHP 6XFKDFRQWUDGLFWLRQPHDQV\RXFDQQRW
XVHERWKWKHPDQGWKH/LEUDU\WRJHWKHULQDQH[HFXWDEOHWKDW\RX
GLVWULEXWH
<RXPD\SODFHOLEUDU\IDFLOLWLHVWKDWDUHDZRUNEDVHGRQWKH
/LEUDU\VLGHE\VLGHLQDVLQJOHOLEUDU\WRJHWKHUZLWKRWKHUOLEUDU\
IDFLOLWLHVQRWFRYHUHGE\WKLV/LFHQVHDQGGLVWULEXWHVXFKDFRPELQHG
OLEUDU\SURYLGHGWKDWWKHVHSDUDWHGLVWULEXWLRQRIWKHZRUNEDVHGRQ
WKH/LEUDU\DQGRIWKHRWKHUOLEUDU\IDFLOLWLHVLVRWKHUZLVH
SHUPLWWHGDQGSURYLGHGWKDW\RXGRWKHVHWZRWKLQJV
D $FFRPSDQ\WKHFRPELQHGOLEUDU\ZLWKDFRS\RIWKHVDPHZRUN
EDVHGRQWKH/LEUDU\XQFRPELQHGZLWKDQ\RWKHUOLEUDU\
IDFLOLWLHV 7KLVPXVWEHGLVWULEXWHGXQGHUWKHWHUPVRIWKH
6HFWLRQVDERYH
E *LYHSURPLQHQWQRWLFHZLWKWKHFRPELQHGOLEUDU\RIWKHIDFW
WKDWSDUWRILWLVDZRUNEDVHGRQWKH/LEUDU\DQGH[SODLQLQJ
ZKHUHWRILQGWKHDFFRPSDQ\LQJXQFRPELQHGIRUPRIWKHVDPHZRUN
<RXPD\QRWFRS\PRGLI\VXEOLFHQVHOLQNZLWKRUGLVWULEXWH
WKH/LEUDU\H[FHSWDVH[SUHVVO\SURYLGHGXQGHUWKLV/LFHQVH $Q\
DWWHPSWRWKHUZLVHWRFRS\PRGLI\VXEOLFHQVHOLQNZLWKRU
GLVWULEXWHWKH/LEUDU\LVYRLGDQGZLOODXWRPDWLFDOO\WHUPLQDWH\RXU
ULJKWVXQGHUWKLV/LFHQVH +RZHYHUSDUWLHVZKRKDYHUHFHLYHGFRSLHV
RUULJKWVIURP\RXXQGHUWKLV/LFHQVHZLOOQRWKDYHWKHLUOLFHQVHV
WHUPLQDWHGVRORQJDVVXFKSDUWLHVUHPDLQLQIXOOFRPSOLDQFH
<RXDUHQRWUHTXLUHGWRDFFHSWWKLV/LFHQVHVLQFH\RXKDYHQRW
VLJQHGLW +RZHYHUQRWKLQJHOVHJUDQWV\RXSHUPLVVLRQWRPRGLI\RU
GLVWULEXWHWKH/LEUDU\RULWVGHULYDWLYHZRUNV 7KHVHDFWLRQVDUH
SURKLELWHGE\ODZLI\RXGRQRWDFFHSWWKLV/LFHQVH 7KHUHIRUHE\
PRGLI\LQJRUGLVWULEXWLQJWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH
– 56 –
/LEUDU\ \RXLQGLFDWH\RXUDFFHSWDQFHRIWKLV/LFHQVHWRGRVRDQG
DOOLWVWHUPVDQGFRQGLWLRQVIRUFRS\LQJGLVWULEXWLQJRUPRGLI\LQJ
WKH/LEUDU\RUZRUNVEDVHGRQLW
(DFKWLPH\RXUHGLVWULEXWHWKH/LEUDU\ RUDQ\ZRUNEDVHGRQWKH
/LEUDU\ WKHUHFLSLHQWDXWRPDWLFDOO\UHFHLYHVDOLFHQVHIURPWKH
RULJLQDOOLFHQVRUWRFRS\GLVWULEXWHOLQNZLWKRUPRGLI\WKH/LEUDU\
VXEMHFWWRWKHVHWHUPVDQGFRQGLWLRQV <RXPD\QRWLPSRVHDQ\IXUWKHU
UHVWULFWLRQVRQWKHUHFLSLHQWV H[HUFLVHRIWKHULJKWVJUDQWHGKHUHLQ
<RXDUHQRWUHVSRQVLEOHIRUHQIRUFLQJFRPSOLDQFHE\WKLUGSDUWLHVWR
WKLV/LFHQVH
,IDVDFRQVHTXHQFHRIDFRXUWMXGJPHQWRUDOOHJDWLRQRISDWHQW
LQIULQJHPHQWRUIRUDQ\RWKHUUHDVRQ QRWOLPLWHGWRSDWHQWLVVXHV FRQGLWLRQVDUHLPSRVHGRQ\RX ZKHWKHUE\FRXUWRUGHUDJUHHPHQWRU
RWKHUZLVH WKDWFRQWUDGLFWWKHFRQGLWLRQVRIWKLV/LFHQVHWKH\GRQRW
H[FXVH\RXIURPWKHFRQGLWLRQVRIWKLV/LFHQVH ,I\RXFDQQRW
GLVWULEXWHVRDVWRVDWLVI\VLPXOWDQHRXVO\\RXUREOLJDWLRQVXQGHUWKLV
/LFHQVHDQGDQ\RWKHUSHUWLQHQWREOLJDWLRQVWKHQDVDFRQVHTXHQFH\RX
PD\QRWGLVWULEXWHWKH/LEUDU\DWDOO )RUH[DPSOHLIDSDWHQW
OLFHQVHZRXOGQRWSHUPLWUR\DOW\IUHHUHGLVWULEXWLRQRIWKH/LEUDU\E\
DOOWKRVHZKRUHFHLYHFRSLHVGLUHFWO\RULQGLUHFWO\WKURXJK\RXWKHQ
WKHRQO\ZD\\RXFRXOGVDWLVI\ERWKLWDQGWKLV/LFHQVHZRXOGEHWR
UHIUDLQHQWLUHO\IURPGLVWULEXWLRQRIWKH/LEUDU\
,IDQ\SRUWLRQRIWKLVVHFWLRQLVKHOGLQYDOLGRUXQHQIRUFHDEOHXQGHUDQ\
SDUWLFXODUFLUFXPVWDQFHWKHEDODQFHRIWKHVHFWLRQLVLQWHQGHGWRDSSO\
DQGWKHVHFWLRQDVDZKROHLVLQWHQGHGWRDSSO\LQRWKHUFLUFXPVWDQFHV
,WLVQRWWKHSXUSRVHRIWKLVVHFWLRQWRLQGXFH\RXWRLQIULQJHDQ\
SDWHQWVRURWKHUSURSHUW\ULJKWFODLPVRUWRFRQWHVWYDOLGLW\RIDQ\
VXFKFODLPVWKLVVHFWLRQKDVWKHVROHSXUSRVHRISURWHFWLQJWKH
LQWHJULW\RIWKHIUHHVRIWZDUHGLVWULEXWLRQV\VWHPZKLFKLV
LPSOHPHQWHGE\SXEOLFOLFHQVHSUDFWLFHV 0DQ\SHRSOHKDYHPDGH
JHQHURXVFRQWULEXWLRQVWRWKHZLGHUDQJHRIVRIWZDUHGLVWULEXWHG
WKURXJKWKDWV\VWHPLQUHOLDQFHRQFRQVLVWHQWDSSOLFDWLRQRIWKDW
V\VWHPLWLVXSWRWKHDXWKRUGRQRUWRGHFLGHLIKHRUVKHLVZLOOLQJ
WRGLVWULEXWHVRIWZDUHWKURXJKDQ\RWKHUV\VWHPDQGDOLFHQVHHFDQQRW
– 57 –
LPSRVHWKDWFKRLFH
7KLVVHFWLRQLVLQWHQGHGWRPDNHWKRURXJKO\FOHDUZKDWLVEHOLHYHGWR
EHDFRQVHTXHQFHRIWKHUHVWRIWKLV/LFHQVH
,IWKHGLVWULEXWLRQDQGRUXVHRIWKH/LEUDU\LVUHVWULFWHGLQ
FHUWDLQFRXQWULHVHLWKHUE\SDWHQWVRUE\FRS\ULJKWHGLQWHUIDFHVWKH
RULJLQDOFRS\ULJKWKROGHUZKRSODFHVWKH/LEUDU\XQGHUWKLV/LFHQVHPD\DGG
DQH[SOLFLWJHRJUDSKLFDOGLVWULEXWLRQOLPLWDWLRQH[FOXGLQJWKRVHFRXQWULHV
VRWKDWGLVWULEXWLRQLVSHUPLWWHGRQO\LQRUDPRQJFRXQWULHVQRWWKXV
H[FOXGHG ,QVXFKFDVHWKLV/LFHQVHLQFRUSRUDWHVWKHOLPLWDWLRQDVLI
ZULWWHQLQWKHERG\RIWKLV/LFHQVH
7KH)UHH6RIWZDUH)RXQGDWLRQPD\SXEOLVKUHYLVHGDQGRUQHZ
YHUVLRQVRIWKH/LEUDU\*HQHUDO3XEOLF/LFHQVHIURPWLPHWRWLPH
6XFKQHZYHUVLRQVZLOOEHVLPLODULQVSLULWWRWKHSUHVHQWYHUVLRQ
EXWPD\GLIIHULQGHWDLOWRDGGUHVVQHZSUREOHPVRUFRQFHUQV
(DFKYHUVLRQLVJLYHQDGLVWLQJXLVKLQJYHUVLRQQXPEHU ,IWKH/LEUDU\
VSHFLILHVDYHUVLRQQXPEHURIWKLV/LFHQVHZKLFKDSSOLHVWRLWDQG
DQ\ODWHUYHUVLRQ\RXKDYHWKHRSWLRQRIIROORZLQJWKHWHUPVDQG
FRQGLWLRQVHLWKHURIWKDWYHUVLRQRURIDQ\ODWHUYHUVLRQSXEOLVKHGE\
WKH)UHH6RIWZDUH)RXQGDWLRQ ,IWKH/LEUDU\GRHVQRWVSHFLI\D
OLFHQVHYHUVLRQQXPEHU\RXPD\FKRRVHDQ\YHUVLRQHYHUSXEOLVKHGE\
WKH)UHH6RIWZDUH)RXQGDWLRQ
,I\RXZLVKWRLQFRUSRUDWHSDUWVRIWKH/LEUDU\LQWRRWKHUIUHH
SURJUDPVZKRVHGLVWULEXWLRQFRQGLWLRQVDUHLQFRPSDWLEOHZLWKWKHVH
ZULWHWRWKHDXWKRUWRDVNIRUSHUPLVVLRQ )RUVRIWZDUHZKLFKLV
FRS\ULJKWHGE\WKH)UHH6RIWZDUH)RXQGDWLRQZULWHWRWKH)UHH
6RIWZDUH)RXQGDWLRQZHVRPHWLPHVPDNHH[FHSWLRQVIRUWKLV 2XU
GHFLVLRQZLOOEHJXLGHGE\WKHWZRJRDOVRISUHVHUYLQJWKHIUHHVWDWXV
RIDOOGHULYDWLYHVRIRXUIUHHVRIWZDUHDQGRISURPRWLQJWKHVKDULQJ
DQGUHXVHRIVRIWZDUHJHQHUDOO\
12:$55$17<
%(&$86(7+(/,%5$5<,6/,&(16(')5((2)&+$5*(7+(5(,612
– 58 –
:$55$17<)257+(/,%5$5<727+((;7(173(50,77('%<$33/,&$%/(/$:
(;&(37:+(127+(5:,6(67$7(',1:5,7,1*7+(&23<5,*+7+2/'(56$1'25
27+(53$57,(63529,'(7+(/,%5$5<$6,6:,7+287:$55$17<2)$1<
.,1'(,7+(5(;35(66('25,03/,(',1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5
385326( 7+((17,5(5,6.$6727+(48$/,7<$1'3(5)250$1&(2)7+(
/,%5$5<,6:,7+<28 6+28/'7+(/,%5$5<3529('()(&7,9(<28$6680(
7+(&2672)$//1(&(66$5<6(59,&,1*5(3$,525&255(&7,21
,112(9(1781/(665(48,5('%<$33/,&$%/(/$:25$*5(('72,1
:5,7,1*:,//$1<&23<5,*+7+2/'(525$1<27+(53$57<:+20$<02',)<
$1'255(',675,%87(7+(/,%5$5<$63(50,77('$%29(%(/,$%/(72<28
)25'$0$*(6,1&/8',1*$1<*(1(5$/63(&,$/,1&,'(17$/25
&216(48(17,$/'$0$*(6$5,6,1*2872)7+(86(25,1$%,/,7<7286(7+(
/,%5$5< ,1&/8',1*%87127/,0,7('72/2662)'$7$25'$7$%(,1*
5(1'(5(',1$&&85$7(25/266(66867$,1('%<<28257+,5'3$57,(625$
)$,/85(2)7+(/,%5$5<7223(5$7(:,7+$1<27+(562)7:$5( (9(1,)
68&++2/'(52527+(53$57<+$6%((1$'9,6('2)7+(3266,%,/,7<2)68&+
'$0$*(6
(1'2)7(506$1'&21',7,216
+RZWR$SSO\7KHVH7HUPVWR<RXU1HZ/LEUDULHV
,I\RXGHYHORSDQHZOLEUDU\DQG\RXZDQWLWWREHRIWKHJUHDWHVW
SRVVLEOHXVHWRWKHSXEOLFZHUHFRPPHQGPDNLQJLWIUHHVRIWZDUHWKDW
HYHU\RQHFDQUHGLVWULEXWHDQGFKDQJH <RXFDQGRVRE\SHUPLWWLQJ
UHGLVWULEXWLRQXQGHUWKHVHWHUPV RUDOWHUQDWLYHO\XQGHUWKHWHUPVRIWKH
RUGLQDU\*HQHUDO3XEOLF/LFHQVH 7RDSSO\WKHVHWHUPVDWWDFKWKHIROORZLQJQRWLFHVWRWKHOLEUDU\ ,WLV
VDIHVWWRDWWDFKWKHPWRWKHVWDUWRIHDFKVRXUFHILOHWRPRVWHIIHFWLYHO\
FRQYH\WKHH[FOXVLRQRIZDUUDQW\DQGHDFKILOHVKRXOGKDYHDWOHDVWWKH
FRS\ULJKWOLQHDQGDSRLQWHUWRZKHUHWKHIXOOQRWLFHLVIRXQG
RQHOLQHWRJLYHWKHOLEUDU\ VQDPHDQGDEULHILGHDRIZKDWLWGRHV!
&RS\ULJKW & \HDU! QDPHRIDXWKRU!
– 59 –
7KLVOLEUDU\LVIUHHVRIWZDUH\RXFDQUHGLVWULEXWHLWDQGRU
PRGLI\LWXQGHUWKHWHUPVRIWKH*18/LEUDU\*HQHUDO3XEOLF
/LFHQVHDVSXEOLVKHGE\WKH)UHH6RIWZDUH)RXQGDWLRQHLWKHU
YHUVLRQRIWKH/LFHQVHRU DW\RXURSWLRQ DQ\ODWHUYHUVLRQ
7KLVOLEUDU\LVGLVWULEXWHGLQWKHKRSHWKDWLWZLOOEHXVHIXO
EXW:,7+287$1<:$55$17<ZLWKRXWHYHQWKHLPSOLHGZDUUDQW\RI
0(5&+$17$%,/,7<RU),71(66)25$3$57,&8/$5385326( 6HHWKH*18
/LEUDU\*HQHUDO3XEOLF/LFHQVHIRUPRUHGHWDLOV
<RXVKRXOGKDYHUHFHLYHGDFRS\RIWKH*18/LEUDU\*HQHUDO3XEOLF
/LFHQVHDORQJZLWKWKLVOLEUDU\LIQRWZULWHWRWKH )UHH6RIWZDUH)RXQGDWLRQ,QF7HPSOH3ODFH6XLWH %RVWRQ0$ 86$
$OVRDGGLQIRUPDWLRQRQKRZWRFRQWDFW\RXE\HOHFWURQLFDQGSDSHUPDLO
<RXVKRXOGDOVRJHW\RXUHPSOR\HU LI\RXZRUNDVDSURJUDPPHU RU\RXU
VFKRROLIDQ\WRVLJQDFRS\ULJKWGLVFODLPHUIRUWKHOLEUDU\LI
QHFHVVDU\ +HUHLVDVDPSOHDOWHUWKHQDPHV
<R\RG\QH,QFKHUHE\GLVFODLPVDOOFRS\ULJKWLQWHUHVWLQWKH
OLEUDU\C)URE DOLEUDU\IRUWZHDNLQJNQREV ZULWWHQE\-DPHV5DQGRP+DFNHU
VLJQDWXUHRI7\&RRQ!$SULO
7\&RRQ3UHVLGHQWRI9LFH
7KDW VDOOWKHUHLVWRLW
&RS\ULJKW F 8QLYHUVLW\RI&DPEULGJH
൹5HGLVWULEXWLRQDQGXVHLQVRXUFHDQGELQDU\IRUPVZLWKRUZLWKRXW
PRGLILFDWLRQDUHSHUPLWWHGSURYLGHGWKDWWKHIROORZLQJFRQGLWLRQVDUHPHW
5HGLVWULEXWLRQVRIVRXUFHFRGHPXVWUHWDLQWKHDERYHFRS\ULJKWQRWLFH
WKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHU
5HGLVWULEXWLRQVLQELQDU\IRUPPXVWUHSURGXFHWKHDERYHFRS\ULJKW
– 60 –
QRWLFHWKLVOLVWRIFRQGLWLRQVDQGWKHIROORZLQJGLVFODLPHULQWKH
GRFXPHQWDWLRQDQGRURWKHUPDWHULDOVSURYLGHGZLWKWKHGLVWULEXWLRQ
1HLWKHUWKHQDPHRIWKH8QLYHUVLW\RI&DPEULGJHQRUWKHQDPHRI*RRJOH
,QFQRUWKHQDPHVRIWKHLUFRQWULEXWRUVPD\EHXVHGWRHQGRUVHRU
SURPRWHSURGXFWVGHULYHGIURPWKLVVRIWZDUHZLWKRXWVSHFLILFSULRU
ZULWWHQSHUPLVVLRQ
7+,662)7:$5(,63529,'('%<7+(&23<5,*+7+2/'(56$1'&2175,%87256$6,6
$1'$1<(;35(6625,03/,(':$55$17,(6,1&/8',1*%87127/,0,7('727+(
,03/,(':$55$17,(62)0(5&+$17$%,/,7<$1'),71(66)25$3$57,&8/$5385326(
$5(',6&/$,0(',112(9(176+$//7+(&23<5,*+72:1(525&2175,%87256%(
/,$%/()25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/(;(03/$5<25
&216(48(17,$/'$0$*(6 ,1&/8',1*%87127/,0,7('72352&85(0(172)
68%67,787(*22'6256(59,&(6/2662)86('$7$25352),7625%86,1(66
,17(55837,21 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1
&2175$&7675,&7/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(86(2)7+,662)7:$5((9(1,)$'9,6('2)7+(
3266,%,/,7<2)68&+'$0$*(
&RS\ULJKW & 5HG+DW,QF
3HUPLVVLRQLVKHUHE\JUDQWHGIUHHRIFKDUJHWRDQ\SHUVRQ
REWDLQLQJDFRS\RIWKLVVRIWZDUHDQGDVVRFLDWHGGRFXPHQWDWLRQILOHV
WKH6RIWZDUH WRGHDOLQWKH6RIWZDUH ൹ZLWKRXWUHVWULFWLRQ
LQFOXGLQJZLWKRXWOLPLWDWLRQWKHULJKWVWRXVHFRS\PRGLI\PHUJH
SXEOLVKGLVWULEXWHVXEOLFHQVHDQGRUVHOOFRSLHVRIWKH6RIWZDUH
DQGWRSHUPLWSHUVRQVWRZKRPWKH6RIWZDUHLVIXUQLVKHGWRGRVR
VXEMHFWWRWKHIROORZLQJFRQGLWLRQV 7KHDERYHFRS\ULJKWQRWLFHDQGWKLVSHUPLVVLRQQRWLFHVKDOOEH
LQFOXGHGLQDOOFRSLHVRUVXEVWDQWLDOSRUWLRQVRIWKH6RIWZDUH 7+(62)7:$5(,63529,'('$6,6:,7+287:$55$17<2)$1<.,1'
(;35(6625,03/,(',1&/8',1*%87127/,0,7('727+(:$55$17,(62)
0(5&+$17$%,/,7<),71(66)25$3$57,&8/$5385326($1'
121,1)5,1*(0(17,112(9(176+$//7+($87+25625&23<5,*+7+2/'(56
%(/,$%/()25$1<&/$,0'$0$*(62527+(5/,$%,/,7<:+(7+(5,1$1
– 61 –
$&7,212)&2175$&772572527+(5:,6($5,6,1*)5202872)25,1
&211(&7,21:,7+7+(62)7:$5(257+(86(2527+(5'($/,1*6,17+(
62)7:$5(
– 62 –
26*L5HOHDVH
(FOLSVH3XEOLF/LFHQVHY 7+($&&203$1<,1*352*5$0,63529,'('81'(57+(7(5062)7+,6(&/,36(38%/,&
/,&(16( $*5((0(17 $1<86(5(352'8&7,2125',675,%87,212)7+(352*5$0
&2167,787(65(&,3,(17 6$&&(37$1&(2)7+,6$*5((0(17 '(),1,7,216 &RQWULEXWLRQPHDQV D LQ WKH FDVH RI WKH LQLWLDO &RQWULEXWRU WKH LQLWLDO FRGH DQG GRFXPHQWDWLRQ GLVWULEXWHG XQGHU WKLV
$JUHHPHQWDQG
E LQWKHFDVHRIHDFKVXEVHTXHQW&RQWULEXWRU
L FKDQJHVWRWKH3URJUDPDQG
LL DGGLWLRQVWRWKH3URJUDP
ZKHUHVXFKFKDQJHVDQGRUDGGLWLRQVWRWKH3URJUDPRULJLQDWHIURPDQGDUHGLVWULEXWHGE\WKDWSDUWLFXODU
&RQWULEXWRU $ &RQWULEXWLRQ RULJLQDWHV IURP D &RQWULEXWRU LI LW ZDV DGGHG WR WKH 3URJUDP E\ VXFK
&RQWULEXWRULWVHOIRUDQ\RQHDFWLQJRQVXFK&RQWULEXWRU VEHKDOI&RQWULEXWLRQVGRQRWLQFOXGHDGGLWLRQV
WRWKH3URJUDPZKLFK L DUHVHSDUDWHPRGXOHVRIVRIWZDUHGLVWULEXWHGLQFRQMXQFWLRQZLWKWKH3URJUDP
XQGHUWKHLURZQOLFHQVHDJUHHPHQWDQG LL DUHQRWGHULYDWLYHZRUNVRIWKH3URJUDP &RQWULEXWRUPHDQVDQ\SHUVRQRUHQWLW\WKDWGLVWULEXWHVWKH3URJUDP /LFHQVHG3DWHQWVPHDQSDWHQWFODLPVOLFHQVDEOHE\D&RQWULEXWRUZKLFKDUHQHFHVVDULO\LQIULQJHGE\WKHXVH
RUVDOHRILWV&RQWULEXWLRQDORQHRUZKHQFRPELQHGZLWKWKH3URJUDP 3URJUDPPHDQVWKH&RQWULEXWLRQVGLVWULEXWHGLQDFFRUGDQFHZLWKWKLV$JUHHPHQW 5HFLSLHQWPHDQVDQ\RQHZKRUHFHLYHVWKH3URJUDPXQGHUWKLV$JUHHPHQWLQFOXGLQJDOO&RQWULEXWRUV *5$172)5,*+76 D 6XEMHFWWRWKHWHUPVRIWKLV$JUHHPHQWHDFK&RQWULEXWRUKHUHE\JUDQWV5HFLSLHQWDQRQH[FOXVLYH
ZRUOGZLGH UR\DOW\IUHH FRS\ULJKW OLFHQVH WR UHSURGXFH SUHSDUH GHULYDWLYH ZRUNV RI SXEOLFO\ GLVSOD\
SXEOLFO\ SHUIRUP GLVWULEXWH DQG VXEOLFHQVH WKH &RQWULEXWLRQ RI VXFK &RQWULEXWRU LI DQ\ DQG VXFK
GHULYDWLYHZRUNVLQVRXUFHFRGHDQGREMHFWFRGHIRUP
E 6XEMHFWWRWKHWHUPVRIWKLV$JUHHPHQWHDFK&RQWULEXWRUKHUHE\JUDQWV5HFLSLHQWDQRQH[FOXVLYH
ZRUOGZLGHUR\DOW\IUHHSDWHQWOLFHQVHXQGHU/LFHQVHG3DWHQWVWRPDNHXVHVHOORIIHUWRVHOOLPSRUW
– 63 –
DQGRWKHUZLVHWUDQVIHUWKH&RQWULEXWLRQRIVXFK&RQWULEXWRULIDQ\LQVRXUFHFRGHDQGREMHFWFRGHIRUP
7KLVSDWHQWOLFHQVHVKDOODSSO\WRWKHFRPELQDWLRQRIWKH&RQWULEXWLRQDQGWKH3URJUDPLIDWWKHWLPHWKH
&RQWULEXWLRQLVDGGHGE\WKH&RQWULEXWRUVXFKDGGLWLRQRIWKH&RQWULEXWLRQFDXVHVVXFKFRPELQDWLRQWR
EHFRYHUHGE\WKH/LFHQVHG3DWHQWV7KHSDWHQWOLFHQVHVKDOOQRWDSSO\WRDQ\RWKHUFRPELQDWLRQVZKLFK
LQFOXGHWKH&RQWULEXWLRQ1RKDUGZDUHSHUVHLVOLFHQVHGKHUHXQGHU F 5HFLSLHQWXQGHUVWDQGVWKDWDOWKRXJKHDFK&RQWULEXWRUJUDQWVWKHOLFHQVHVWRLWV&RQWULEXWLRQVVHWIRUWK
KHUHLQQRDVVXUDQFHVDUHSURYLGHGE\DQ\&RQWULEXWRUWKDWWKH3URJUDPGRHVQRWLQIULQJHWKHSDWHQWRU
RWKHULQWHOOHFWXDOSURSHUW\ULJKWVRIDQ\RWKHUHQWLW\(DFK&RQWULEXWRUGLVFODLPVDQ\OLDELOLW\WR5HFLSLHQW
IRUFODLPVEURXJKWE\DQ\RWKHUHQWLW\EDVHGRQLQIULQJHPHQWRILQWHOOHFWXDOSURSHUW\ULJKWVRURWKHUZLVH
$VDFRQGLWLRQWRH[HUFLVLQJWKHULJKWVDQGOLFHQVHVJUDQWHGKHUHXQGHUHDFK5HFLSLHQWKHUHE\DVVXPHV
VROHUHVSRQVLELOLW\WRVHFXUHDQ\RWKHULQWHOOHFWXDOSURSHUW\ULJKWVQHHGHGLIDQ\)RUH[DPSOHLIDWKLUG
SDUW\ SDWHQW OLFHQVH LV UHTXLUHG WR DOORZ 5HFLSLHQW WR GLVWULEXWH WKH 3URJUDP LW LV 5HFLSLHQW V
UHVSRQVLELOLW\WRDFTXLUHWKDWOLFHQVHEHIRUHGLVWULEXWLQJWKH3URJUDP
G (DFK&RQWULEXWRUUHSUHVHQWVWKDWWRLWVNQRZOHGJHLWKDVVXIILFLHQWFRS\ULJKWULJKWVLQLWV&RQWULEXWLRQ
LIDQ\WRJUDQWWKHFRS\ULJKWOLFHQVHVHWIRUWKLQWKLV$JUHHPHQW 5(48,5(0(176 $&RQWULEXWRUPD\FKRRVHWRGLVWULEXWHWKH3URJUDPLQREMHFWFRGHIRUPXQGHULWVRZQOLFHQVHDJUHHPHQW
SURYLGHGWKDW D LWFRPSOLHVZLWKWKHWHUPVDQGFRQGLWLRQVRIWKLV$JUHHPHQWDQG
E LWVOLFHQVHDJUHHPHQW
L HIIHFWLYHO\GLVFODLPVRQEHKDOIRIDOO&RQWULEXWRUVDOOZDUUDQWLHVDQGFRQGLWLRQVH[SUHVVDQGLPSOLHG
LQFOXGLQJZDUUDQWLHVRUFRQGLWLRQVRIWLWOHDQGQRQLQIULQJHPHQWDQGLPSOLHGZDUUDQWLHVRUFRQGLWLRQVRI
PHUFKDQWDELOLW\DQGILWQHVVIRUDSDUWLFXODUSXUSRVH LL HIIHFWLYHO\H[FOXGHVRQEHKDOIRIDOO&RQWULEXWRUVDOOOLDELOLW\IRUGDPDJHVLQFOXGLQJGLUHFWLQGLUHFW
VSHFLDOLQFLGHQWDODQGFRQVHTXHQWLDOGDPDJHVVXFKDVORVWSURILWV LLL VWDWHVWKDWDQ\SURYLVLRQVZKLFKGLIIHUIURPWKLV$JUHHPHQWDUHRIIHUHGE\WKDW&RQWULEXWRUDORQHDQG
QRWE\DQ\RWKHUSDUW\DQG
LY VWDWHVWKDWVRXUFHFRGHIRUWKH3URJUDPLVDYDLODEOHIURPVXFK&RQWULEXWRUDQGLQIRUPVOLFHQVHHV
KRZ WR REWDLQ LW LQ D UHDVRQDEOH PDQQHU RQ RU WKURXJK D PHGLXP FXVWRPDULO\ XVHG IRU VRIWZDUH
H[FKDQJH :KHQWKH3URJUDPLVPDGHDYDLODEOHLQVRXUFHFRGHIRUP D LWPXVWEHPDGHDYDLODEOHXQGHUWKLV$JUHHPHQWDQG E DFRS\RIWKLV$JUHHPHQWPXVWEHLQFOXGHGZLWKHDFKFRS\RIWKH3URJUDP &RQWULEXWRUVPD\QRWUHPRYHRUDOWHUDQ\FRS\ULJKWQRWLFHVFRQWDLQHGZLWKLQWKH3URJUDP – 64 –
(DFK&RQWULEXWRUPXVWLGHQWLI\LWVHOIDVWKHRULJLQDWRURILWV&RQWULEXWLRQLIDQ\LQDPDQQHUWKDWUHDVRQDEO\
DOORZVVXEVHTXHQW5HFLSLHQWVWRLGHQWLI\WKHRULJLQDWRURIWKH&RQWULEXWLRQ &200(5&,$/',675,%87,21 &RPPHUFLDOGLVWULEXWRUVRIVRIWZDUHPD\DFFHSWFHUWDLQUHVSRQVLELOLWLHVZLWKUHVSHFWWRHQGXVHUVEXVLQHVV
SDUWQHUVDQGWKHOLNH:KLOHWKLVOLFHQVHLVLQWHQGHGWRIDFLOLWDWHWKHFRPPHUFLDOXVHRIWKH3URJUDPWKH
&RQWULEXWRUZKRLQFOXGHVWKH3URJUDPLQDFRPPHUFLDOSURGXFWRIIHULQJVKRXOGGRVRLQDPDQQHUZKLFKGRHV
QRWFUHDWHSRWHQWLDOOLDELOLW\IRURWKHU&RQWULEXWRUV7KHUHIRUHLID&RQWULEXWRULQFOXGHVWKH3URJUDPLQD
FRPPHUFLDOSURGXFWRIIHULQJVXFK&RQWULEXWRU &RPPHUFLDO&RQWULEXWRU KHUHE\DJUHHVWRGHIHQGDQG
LQGHPQLI\HYHU\RWKHU&RQWULEXWRU ,QGHPQLILHG&RQWULEXWRU DJDLQVWDQ\ORVVHVGDPDJHVDQGFRVWV
FROOHFWLYHO\/RVVHV DULVLQJIURPFODLPVODZVXLWVDQGRWKHUOHJDODFWLRQVEURXJKWE\DWKLUGSDUW\DJDLQVWWKH
,QGHPQLILHG&RQWULEXWRUWRWKHH[WHQWFDXVHGE\WKHDFWVRURPLVVLRQVRIVXFK&RPPHUFLDO&RQWULEXWRULQ
FRQQHFWLRQZLWKLWVGLVWULEXWLRQRIWKH3URJUDPLQDFRPPHUFLDOSURGXFWRIIHULQJ7KHREOLJDWLRQVLQWKLVVHFWLRQ
GRQRWDSSO\WRDQ\FODLPVRU/RVVHVUHODWLQJWRDQ\DFWXDORUDOOHJHGLQWHOOHFWXDOSURSHUW\LQIULQJHPHQW,Q
RUGHUWRTXDOLI\DQ,QGHPQLILHG&RQWULEXWRUPXVWD SURPSWO\QRWLI\WKH&RPPHUFLDO&RQWULEXWRULQZULWLQJRI
VXFKFODLPDQGE DOORZWKH&RPPHUFLDO&RQWULEXWRUWRFRQWURODQGFRRSHUDWHZLWKWKH&RPPHUFLDO
&RQWULEXWRULQWKHGHIHQVHDQGDQ\UHODWHGVHWWOHPHQWQHJRWLDWLRQV7KH,QGHPQLILHG&RQWULEXWRUPD\
SDUWLFLSDWHLQDQ\VXFKFODLPDWLWVRZQH[SHQVH )RUH[DPSOHD&RQWULEXWRUPLJKWLQFOXGHWKH3URJUDPLQDFRPPHUFLDOSURGXFWRIIHULQJ3URGXFW;7KDW
&RQWULEXWRULVWKHQD&RPPHUFLDO&RQWULEXWRU,IWKDW&RPPHUFLDO&RQWULEXWRUWKHQPDNHVSHUIRUPDQFHFODLPV
RURIIHUVZDUUDQWLHVUHODWHGWR3URGXFW;WKRVHSHUIRUPDQFHFODLPVDQGZDUUDQWLHVDUHVXFK&RPPHUFLDO
&RQWULEXWRU VUHVSRQVLELOLW\DORQH8QGHUWKLVVHFWLRQWKH&RPPHUFLDO&RQWULEXWRUZRXOGKDYHWRGHIHQGFODLPV
DJDLQVWWKHRWKHU&RQWULEXWRUVUHODWHGWRWKRVHSHUIRUPDQFHFODLPVDQGZDUUDQWLHVDQGLIDFRXUWUHTXLUHVDQ\
RWKHU&RQWULEXWRUWRSD\DQ\GDPDJHVDVDUHVXOWWKH&RPPHUFLDO&RQWULEXWRUPXVWSD\WKRVHGDPDJHV 12:$55$17< (;&(37$6(;35(66/<6(7)257+,17+,6$*5((0(177+(352*5$0,63529,'('21$1$6
,6%$6,6:,7+287:$55$17,(625&21',7,2162)$1<.,1'(,7+(5(;35(6625,03/,('
,1&/8',1*:,7+287/,0,7$7,21$1<:$55$17,(625&21',7,2162)7,7/(121
,1)5,1*(0(170(5&+$17$%,/,7<25),71(66)25$3$57,&8/$5385326((DFK5HFLSLHQWLV
VROHO\UHVSRQVLEOHIRUGHWHUPLQLQJWKHDSSURSULDWHQHVVRIXVLQJDQGGLVWULEXWLQJWKH3URJUDPDQGDVVXPHVDOO
ULVNVDVVRFLDWHGZLWKLWVH[HUFLVHRIULJKWVXQGHUWKLV$JUHHPHQWLQFOXGLQJEXWQRWOLPLWHGWRWKHULVNVDQG
FRVWVRISURJUDPHUURUVFRPSOLDQFHZLWKDSSOLFDEOHODZVGDPDJHWRRUORVVRIGDWDSURJUDPVRUHTXLSPHQW
DQGXQDYDLODELOLW\RULQWHUUXSWLRQRIRSHUDWLRQV ',6&/$,0(52)/,$%,/,7< – 65 –
(;&(37$6(;35(66/<6(7)257+,17+,6$*5((0(171(,7+(55(&,3,(17125$1<
&2175,%872566+$//+$9($1</,$%,/,7<)25$1<',5(&7,1',5(&7,1&,'(17$/63(&,$/
(;(03/$5<25&216(48(17,$/'$0$*(6 ,1&/8',1*:,7+287/,0,7$7,21/267352),76 +2:(9(5&$86('$1'21$1<7+(25<2)/,$%,/,7<:+(7+(5,1&2175$&7675,&7
/,$%,/,7<257257 ,1&/8',1*1(*/,*(1&(2527+(5:,6( $5,6,1*,1$1<:$<2872)7+(
86(25',675,%87,212)7+(352*5$0257+((;(5&,6(2)$1<5,*+76*5$17('
+(5(81'(5(9(1,)$'9,6('2)7+(3266,%,/,7<2)68&+'$0$*(6 *(1(5$/ ,IDQ\SURYLVLRQRIWKLV$JUHHPHQWLVLQYDOLGRUXQHQIRUFHDEOHXQGHUDSSOLFDEOHODZLWVKDOOQRWDIIHFWWKH
YDOLGLW\RUHQIRUFHDELOLW\RIWKHUHPDLQGHURIWKHWHUPVRIWKLV$JUHHPHQWDQGZLWKRXWIXUWKHUDFWLRQE\WKH
SDUWLHVKHUHWRVXFKSURYLVLRQVKDOOEHUHIRUPHGWRWKHPLQLPXPH[WHQWQHFHVVDU\WRPDNHVXFKSURYLVLRQ
YDOLGDQGHQIRUFHDEOH ,I5HFLSLHQWLQVWLWXWHVSDWHQWOLWLJDWLRQDJDLQVWDQ\HQWLW\ LQFOXGLQJDFURVVFODLPRUFRXQWHUFODLPLQDODZVXLW DOOHJLQJWKDWWKH3URJUDPLWVHOI H[FOXGLQJFRPELQDWLRQVRIWKH3URJUDPZLWKRWKHUVRIWZDUHRUKDUGZDUH LQIULQJHVVXFK5HFLSLHQW VSDWHQW V WKHQVXFK5HFLSLHQW VULJKWVJUDQWHGXQGHU6HFWLRQ E VKDOOWHUPLQDWHDV
RIWKHGDWHVXFKOLWLJDWLRQLVILOHG $OO5HFLSLHQW VULJKWVXQGHUWKLV$JUHHPHQWVKDOOWHUPLQDWHLILWIDLOVWRFRPSO\ZLWKDQ\RIWKHPDWHULDOWHUPVRU
FRQGLWLRQVRIWKLV$JUHHPHQWDQGGRHVQRWFXUHVXFKIDLOXUHLQDUHDVRQDEOHSHULRGRIWLPHDIWHUEHFRPLQJ
DZDUHRIVXFKQRQFRPSOLDQFH,IDOO5HFLSLHQW VULJKWVXQGHUWKLV$JUHHPHQWWHUPLQDWH5HFLSLHQWDJUHHVWR
FHDVHXVHDQGGLVWULEXWLRQRIWKH3URJUDPDVVRRQDVUHDVRQDEO\SUDFWLFDEOH+RZHYHU5HFLSLHQW V
REOLJDWLRQVXQGHUWKLV$JUHHPHQWDQGDQ\OLFHQVHVJUDQWHGE\5HFLSLHQWUHODWLQJWRWKH3URJUDPVKDOOFRQWLQXH
DQGVXUYLYH (YHU\RQHLVSHUPLWWHGWRFRS\DQGGLVWULEXWHFRSLHVRIWKLV$JUHHPHQWEXWLQRUGHUWRDYRLGLQFRQVLVWHQF\WKH
$JUHHPHQWLVFRS\ULJKWHGDQGPD\RQO\EHPRGLILHGLQWKHIROORZLQJPDQQHU7KH$JUHHPHQW6WHZDUG
UHVHUYHVWKHULJKWWRSXEOLVKQHZYHUVLRQV LQFOXGLQJUHYLVLRQV RIWKLV$JUHHPHQWIURPWLPHWRWLPH1RRQH
RWKHUWKDQWKH$JUHHPHQW6WHZDUGKDVWKHULJKWWRPRGLI\WKLV$JUHHPHQW7KH(FOLSVH)RXQGDWLRQLVWKHLQLWLDO
$JUHHPHQW6WHZDUG7KH(FOLSVH)RXQGDWLRQPD\DVVLJQWKHUHVSRQVLELOLW\WRVHUYHDVWKH$JUHHPHQW
6WHZDUGWRDVXLWDEOHVHSDUDWHHQWLW\(DFKQHZYHUVLRQRIWKH$JUHHPHQWZLOOEHJLYHQDGLVWLQJXLVKLQJ
YHUVLRQQXPEHU7KH3URJUDP LQFOXGLQJ&RQWULEXWLRQV PD\DOZD\VEHGLVWULEXWHGVXEMHFWWRWKHYHUVLRQRIWKH
$JUHHPHQWXQGHUZKLFKLWZDVUHFHLYHG,QDGGLWLRQDIWHUDQHZYHUVLRQRIWKH$JUHHPHQWLVSXEOLVKHG
&RQWULEXWRUPD\HOHFWWRGLVWULEXWHWKH3URJUDP LQFOXGLQJLWV&RQWULEXWLRQV XQGHUWKHQHZYHUVLRQ([FHSWDV
H[SUHVVO\VWDWHGLQ6HFWLRQV D DQG E DERYH5HFLSLHQWUHFHLYHVQRULJKWVRUOLFHQVHVWRWKHLQWHOOHFWXDO
SURSHUW\RIDQ\&RQWULEXWRUXQGHUWKLV$JUHHPHQWZKHWKHUH[SUHVVO\E\LPSOLFDWLRQHVWRSSHORURWKHUZLVH$OO
ULJKWVLQWKH3URJUDPQRWH[SUHVVO\JUDQWHGXQGHUWKLV$JUHHPHQWDUHUHVHUYHG – 66 –
7KLV$JUHHPHQWLVJRYHUQHGE\WKHODZVRIWKH6WDWHRI1HZ<RUNDQGWKHLQWHOOHFWXDOSURSHUW\ODZVRIWKH
8QLWHG6WDWHVRI$PHULFD1RSDUW\WRWKLV$JUHHPHQWZLOOEULQJDOHJDODFWLRQXQGHUWKLV$JUHHPHQWPRUHWKDQ
RQH\HDUDIWHUWKHFDXVHRIDFWLRQDURVH(DFKSDUW\ZDLYHVLWVULJKWVWRDMXU\WULDOLQDQ\UHVXOWLQJOLWLJDWLRQ – 67 –
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising