Bowflex | Max Trainer M7 | Owner's Manual | Bowflex Max Trainer M7 El manual del propietario

Bowflex Max Trainer M7 El manual del propietario
M7
MANUAL DEL USUARIO/DE ENSAMBLAJE
Manual en español
latinoamericano:
www.support.nautilus.com
Índice/Registro
Instrucciones de seguridad importantes
- Ensamblaje
Etiquetas de advertencias de seguridad /
Número de serie
(VSHFL¿FDFLRQHV
$QWHVGHOHQVDPEODMH
Piezas
Tornillería
Herramientas
Ensamblaje
Traslado de la máquina
Nivelación de la máquina
5
7
8
8
9
20
20
Características
Características de la consola
Fundamentos de acondicionamiento físico
Operaciones
21
22
29
35
Cómo subir y bajar
,QLFLR
Modo de encendido/reposo
Modo de calentamiento
Programa MAX 14 MINUTE INTERVAL
(GLWDUXQSHU¿OGHXVXDULR
Programas de entrenamiento
Modo de pausa/resultados/enfriamiento
Personalización de la meta de calorías
0RGRGHFRQ¿JXUDFLyQGHODFRQVROD
Mantenimiento
Piezas para mantenimiento
Solución de problemas
Plan de Pérdida de Peso Corporal
Garantía de recompra
Garantía
3
35
37
37
37
39
41
42
44
45
47
50
58
59
Para validar el soporte de garantía, guarde el comprobante de compra original y anote la siguiente información:
Número de serie __________________________
Fecha de compra ____________________
3DUDUHJLVWUDUODJDUDQWtDGHVXSURGXFWRYLVLWHZZZERZÀH[FRPUHJLVWHUROODPHDO ±
6LWLHQHFRQVXOWDVRSUREOHPDVFRQVXSURGXFWROODPHDO ±
1DXWLOXV,QF ZZZ1DXWLOXV,QFFRP6HUYLFLRDO&OLHQWH$PpULFDGHO1RUWH FVQOV#QDXWLOXVFRP_IXHUDGHORV
((88ZZZQDXWLOXVLQWHUQDWLRQDOFRP_,PSUHVRHQ&KLQD_‹1DXWLOXV,QF_ŠLQGLFDODVPDUFDVFRPHUFLDOHVUHJLVWUDGDVHQ(VWDGRV
8QLGRV(VWDVPDUFDVSXHGHQHVWDUUHJLVWUDGDVHQRWUDVQDFLRQHVRGHRWUDIRUPDSURWHJLGDVSRUHOGHUHFKRDQJORDPHULFDQR%RZÀH[HOORJRWLSR
%%RZÀH[0D[7UDLQHU0D[7UDLQHU6HOHFW7HFK%RZÀH[7UDLQHU1DXWLOXV6FKZLQQ\8QLYHUVDOVRQPDUFDVFRPHUFLDOHVSHUWHQHFLHQWHVDR
con licencia concedida a Nautilus, Inc. Google Play es una marca comercial de Google Inc. App Store es una marca de servicio de Apple Inc.
La marca y los logotipos de BluetoothŠ son marcas comerciales registradas pertenecientes a Bluetooth SIG, Inc., y Nautilus, Inc. cuenta con la
licencia correspondiente para todo uso de dichas marcas. Polar, OwnCode, MyFitnessPal y Nut Thins son marcas comerciales pertenecientes a sus
respectivos dueños.
2
Manual de ensamblaje/del usuario
Instrucciones de seguridad importantes:
Al usar un artefacto eléctrico, siempre debe respetar precauciones básicas, incluidas las siguientes:
(VWHLFRQRVLJQLÀFDXQDVLWXDFLyQSRVLEOHPHQWHULHVJRVDTXHGHQRHYLWDUVHSRGUtDSURYRFDUODPXHUWHROHVLRQHVJUDYHV
$FDWHODVVLJXLHQWHVDGYHUWHQFLDV
/HD\HQWLHQGDWRGDVODVDGYHUWHQFLDVTXHVHHQFXHQWUDQHQHVWDPiTXLQD
/HDDWHQWDPHQWH\HQWLHQGDODVLQVWUXFFLRQHVGHHQVDPEODMH
!
/HDDWHQWDPHQWH\HQWLHQGDODVLQVWUXFFLRQHVGHHQVDPEODMH/HD\HQWLHQGDWRGRHOPDQXDO&RQVHUYHHOPDQXDOSDUD
IXWXUDVFRQVXOWDV
!
!
3DUDUHGXFLUHOULHVJRGHGHVFDUJDVHOpFWULFDVRHOXVRQRVXSHUYLVDGRGHOHTXLSRVLHPSUHGHVFRQHFWHODPiTXLQDGHO
WRPDFRUULHQWHHOpFWULFRLQPHGLDWDPHQWHGHVSXpVGHOXVR\DQWHVGHODOLPSLH]D
3DUDUHGXFLUHOULHVJRGHTXHPDGXUDVGHVFDUJDVHOpFWULFDVROHVLRQHVDSHUVRQDVOHD\HQWLHQGDWRGRHO0DQXDO
GHOXVXDULR'HQRVHJXLUHVWDVLQVWUXFFLRQHVVHSRGUtDSURGXFLUXQDGHVFDUJDHOpFWULFDJUDYHRSRVLEOHPHQWH
PRUWDOXRWUDOHVLyQJUDYH
•
Siempre mantenga a terceras personas y niños alejados del producto que está ensamblando.
•
No conecte la fuente de alimentación a la máquina hasta que se le indique hacerlo.
•
La máquina nunca debe dejarse desatendida cuando esté enchufada. Desenchúfela del tomacorriente cuando no esté en uso y antes de
limpiar, realizar mantenimiento o reparar la máquina.
•
Antes de cada uso, revise si hay daños en el cable de alimentación, piezas sueltas o señales de desgaste en la máquina. No la use si la
encuentra en estas condiciones. Póngase en contacto con el Servicio al Cliente de Nautilus para obtener información sobre reparaciones.
•
El artículo no está diseñado para que lo usen personas con padecimientos médicos en los casos en que dichos padecimientos quizá
repercutan en la operación segura del equipo o que representen un riesgo de lesiones para el usuario.
‡
1RGHMHFDHUQLLQWURGX]FDREMHWRVHQQLQJ~QRUL¿FLRGHODPiTXLQD
•
Nunca haga funcionar esta máquina para correr con las aberturas de aire obstruidas. Mantenga las aberturas libres de pelusa, cabellos y
obstrucciones semejantes.
•
No ensamble esta máquina al aire libre ni en un lugar mojado o húmedo.
•
Asegúrese de realizar el ensamblaje en un área de trabajo adecuada, alejada de transeúntes y terceras personas.
•
Algunos componentes de la máquina pueden ser pesados o difíciles de manipular. Solicite la ayuda de otra persona para realizar los pasos de
ensamblaje de dichas piezas. No realice usted solo los pasos que implican levantar objetos pesados o realizar movimientos difíciles.
‡
&RORTXHHVWDPiTXLQDVREUHXQDVXSHU¿FLHKRUL]RQWDOVyOLGD\QLYHODGD
•
No intente cambiar el diseño ni la funcionalidad de esta máquina. Si lo hace, podría poner en riesgo la seguridad de la máquina y anulará la
garantía.
•
Si necesita reemplazar piezas, use solo tornillería y piezas de repuesto originales de Nautilus. No usar repuestos originales puede provocar
riesgos para los usuarios, impedir que la máquina funcione correctamente y anular la garantía.
•
No use la máquina hasta que esté completamente ensamblada y haya sido inspeccionada para comprobar su correcto funcionamiento según el
manual.
•
Lea y comprenda la totalidad del manual que se suministra con esta máquina antes del primer uso. Conserve el manual para futuras consultas.
•
Ejecute todos los pasos de ensamblaje en la secuencia indicada. El ensamblaje incorrecto puede producir lesiones o funcionamiento incorrecto.
•
GUARDE ESTAS INSTRUCCIONES.
3
Manual de ensamblaje/del usuario
Instrucciones de seguridad importantes:
$QWHVGHXVDUHVWHHTXLSRDFDWHODVVLJXLHQWHVDGYHUWHQFLDV
/HD\HQWLHQGDWRGRHOPDQXDO&RQVHUYHHOPDQXDOSDUDIXWXUDVFRQVXOWDV
HD\HQWLHQGDWRGDVODVDGYHUWHQFLDVTXHVHHQFXHQWUDQHQHVWDPiTXLQD6LRFXUUHTXHXQDGHODVHWLTXHWDVDXWRDGKHVLYDVGH
/
DGYHUWHQFLDVHVXHOWDHVWiLOHJLEOHRVHGHVSUHQGHFRPXQtTXHVHFRQHO6HUYLFLRDOFOLHQWHGH1DXWLOXVSDUDUHHPSOD]DUOD
!
3DUDUHGXFLUHOULHVJRGHGHVFDUJDHOpFWULFDRHOXVRQRVXSHUYLVDGRGHOHTXLSRVLHPSUHGHVHQFKXIHHOFDEOHGH
DOLPHQWDFLyQGHOWRPDFRUULHQWHGHSDUHG\GHODPiTXLQD\HVSHUHPLQXWRVDQWHVGHODOLPSLH]DHOPDQWHQLPLHQWRROD
UHSDUDFLyQGHODPiTXLQD3RQJDHOFDEOHGHDOLPHQWDFLyQHQXQOXJDUVHJXUR
•
No se debe permitir que los niños se suban ni se acerquen a la máquina. Las piezas móviles u otras características de la máquina pueden ser
peligrosas para los niños.
•
No está diseñada para que la usen personas menores de 14 años de edad.
•
Consulte a su médico antes de comenzar un programa de ejercicios o un nuevo plan de salud y alimentación. Deje de ejercitarse si siente dolor
RWHQVLyQHQHOSHFKRVLWLHQHGL¿FXOWDGSDUDUHVSLUDURVLVLHQWHTXHYDDGHVPD\DUVH&RPXQtTXHVHFRQVXPpGLFRDQWHVGHYROYHUDXVDUOD
máquina. Use los valores calculados o medidos por la computadora de la máquina solo como referencia. La frecuencia cardíaca mostrada en la
FRQVRODHVXQDDSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWHFRPRUHIHUHQFLD
•
Antes de cada uso, revise si hay piezas sueltas o signos de desgaste en la máquina. No la use si la encuentra en estas condiciones. Vigile de
cerca los pedales y las bielas. Póngase en contacto con el Servicio al Cliente de Nautilus para obtener información sobre reparaciones.
‡
/tPLWHPi[LPRGHSHVRGHOXVXDULROE NJ 1RODXVHVLH[FHGHHVWHSHVR
•
Esta máquina es solo para uso doméstico.
•
No use ropa suelta ni joyas. Esta máquina contiene piezas móviles. No ponga los dedos ni otros objetos en las piezas móviles del equipo para
ejercicios.
‡
,QVWDOH\KDJDIXQFLRQDUHVWDPiTXLQDVREUHXQDVXSHU¿FLHVyOLGDQLYHODGD\KRUL]RQWDO
•
Estabilice los pedales antes de subirse a ellos. Tenga cuidado al subirse y al bajarse de la máquina.
•
No haga funcionar esta máquina al aire libre ni en lugares húmedos o mojados.
‡
'HMHXQHVSDFLROLEUHGHDOPHQRVSXOJDGDV P DFDGDODGRGHODPiTXLQD(VWDHVODGLVWDQFLDGHVHJXULGDGUHFRPHQGDGDSDUDWHQHU
acceso a la máquina, transitar alrededor de ella y bajarse en caso de emergencia. Cuando la máquina esté en uso, mantenga a terceros fuera
de este área.
‡
1RKDJDHVIXHU]RVH[FHVLYRVGXUDQWHHOHMHUFLFLR+DJDIXQFLRQDUODPiTXLQDGHODPDQHUDGHVFULWDHQHVWHPDQXDO
•
Efectúe todos los procedimientos de mantenimiento habituales y periódicos recomendados en el Manual del usuario.
•
Mantenga los pedales y los manubrios limpios y secos.
•
Para hacer ejercicio en esta máquina se necesitan buena coordinación y equilibrio. Asegúrese de prever que pueden ocurrir cambios en la
velocidad y el nivel de resistencia durante los entrenamientos, y preste atención para evitar la pérdida de equilibrio y posibles lesiones.
•
Esta máquina no puede detener los pedales ni los manubrios superiores de manera independiente del ventilador de resistencia. Reduzca el
ritmo para ralentizar el ventilador de resistencia, los manubrios superiores y los pedales hasta que se detengan. No se baje de la máquina
hasta que los pedales y los manubrios superiores se detengan completamente.
‡
1RGHMHFDHUQLLQWURGX]FDREMHWRVHQQLQJ~QRUL¿FLRGHODPiTXLQD
•
Lea y entienda el Manual del usuario antes de utilizar la máquina. El equipo no debe ser utilizado por personas con limitaciones funcionales y
GLVFDSDFLGDGHVFDSDFLGDGHVItVLFDVVHQVRULDOHVRPHQWDOHVUHGXFLGDVRVLQH[SHULHQFLD\FRQRFLPLHQWRV
4
Manual de ensamblaje/del usuario
Etiquetas de advertencias de seguridad y número de serie
$'9(57(1&,$
• Es posible sufrir lesiones o incluso la muerte si
no se guarda la debida precaución al utilizar la
máquina.
• Mantenga a los niños y las mascotas alejados.
• Lea y atienda todas las advertencias que se
encuentran en esta máquina.
• Consulte más advertencias e información en el
Manual del usuario.
• La frecuencia cardíaca mostrada es una
DSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWH
como referencia.
• No está diseñada para que la usen personas
menores de 14 años de edad.
• (OSHVRPi[LPRGHXVXDULRSDUDHVWDPiTXLQD
HVOE NJ • Esta máquina es solo para uso doméstico.
• Consulte a un médico antes de usar cualquier
equipo de ejercicios.
Etiqueta de
especificaciones del
producto
Etiqueta de número
de serie
Cumplimiento con la FCC
/RVFDPELRVRODVPRGLÀFDFLRQHVDHVWDXQLGDGTXHQRHVWpQH[SUHVDPHQWHDSUREDGRVSRUODSDUWHUHVSRQVDEOHGHOFXPSOLPLHQWR
SRGUtDQDQXODUODDXWRULGDGGHOXVXDULRSDUDRSHUDUHOHTXLSR
La máquina y el suministro de energía cumplen lo dispuesto en la parte 15 de las Reglas de la FCC. La operación está supeditada a las siguientes
GRVFRQGLFLRQHV (VWHGLVSRVLWLYRQRGHEHSURYRFDULQWHUIHUHQFLDVGDxLQDV\ GHEHDFHSWDUFXDOTXLHULQWHUIHUHQFLDUHFLELGDLQFOXLGDOD
interferencia que quizá provoque una operación indeseable.
Nota: esta máquina y el suministro de energía han demostrado en pruebas que cumplen los límites para un dispositivo digital de Clase A, de
acuerdo con la Parte 15 de las Reglas de la FCC. Dichos límites están destinados a ofrecer protección razonable contra las interferencias
dañinas en una instalación residencial. Este equipo genera, usa y puede irradiar energía de radiofrecuencia y, si no se instala y usa de
acuerdo con las instrucciones, puede causar interferencias dañinas a las comunicaciones de radio.
Sin embargo, no se garantiza que no vayan a ocurrir interferencias en una instalación determinada. Si este equipo causa interferencias dañinas en
ODUHFHSFLyQGHUDGLRRWHOHYLVLyQ ORFXDOVHSXHGHGHWHUPLQDUDSDJDQGR\HQFHQGLHQGRHOHTXLSR UHFRPHQGDPRVDOXVXDULRTXHLQWHQWHFRUUHJLUOD
interferencia tomando una o más de las siguientes medidas:
• Reorientar o reubicar la antena receptora.
• Aumentar la separación entre el equipo y el receptor.
• Conectar el equipo a un tomacorriente que esté en un circuito distinto a aquel donde está conectado el receptor.
‡3DUDREWHQHUD\XGDFRQVXOWHDOGLVWULEXLGRURDXQWpFQLFRHQUDGLR79H[SHULPHQWDGR
5
Manual de ensamblaje/del usuario
Especificaciones/Antes del ensamblaje
3HVRPi[LPRGHOXVXDULR $OWXUDPi[LPDGHORVSHGDOHV
5HTXLVLWRVGHHQHUJtD
Voltaje de funcionamiento:
9 V CD
Corriente de funcionamiento:
1500 mA
Banda de pecho de frecuencia cardíaca: 1 batería CR2032
65.5”
(166.4 cm)
3HVRGHHQVDPEODMH
49”
(124.5 cm)
OE NJ
SXOJDGDV FP $SUREDFLRQHVQRUPDWLYDV
$GDSWDGRUGHHQHUJtDGH&$
30.5”
(77.5 cm)
DSUR[LPDGDPHQWHOE NJ
RQFODVL¿FDFLyQ8/FRQFHUWL¿FDFLyQ&6$ R
&
HTXLYDOHQWH FRQFDSDFLGDGGHHQWUDGDGH9
+]\GHVDOLGDGH9&&P$&ODVH
o LPS.
Antes del ensamblaje
6HOHFFLRQHHOiUHDGRQGHYDDLQVWDODU\KDFHUIXQFLRQDUODPiTXLQD3DUDXQIXQFLRQDPLHQWRVHJXURODXELFDFLyQGHEHVHUVREUHXQDVXSHU¿FLH
UHVLVWHQWH\QLYHODGD'LVSRQJDXQiUHDGHHQWUHQDPLHQWRGHXQPtQLPRGH´ FP [´ FP $VHJ~UHVHGHTXHHOHVSDFLRGH
HQWUHQDPLHQWRTXHHVWiXWLOL]DQGRWHQJDHVSDFLROLEUHGHDOWXUDDGHFXDGRVHJ~QODHVWDWXUDGHOXVXDULR\ODDOWXUDPi[LPDGHORVSHGDOHVGHOD
máquina de ejercicios.
Consejos básicos de ensamblaje
Al ensamblar la máquina, respete estos puntos básicos:
• Lea y entienda las "Instrucciones de seguridad importantes" antes del ensamblaje.
• Reúna todas las piezas necesarias para cada paso del ensamblaje.
• &RQODVOODYHVUHFRPHQGDGDVJLUHORVSHUQRV\ODVWXHUFDVKDFLDODGHUHFKD HQGLUHFFLyQGHODVPDQHFLOODVGHOUHORM SDUDDSUHWDU\KDFLDOD
L]TXLHUGD FRQWUDODGLUHFFLyQGHODVPDQHFLOODVGHOUHORM SDUDVROWDUVDOYRTXHVHLQVWUX\DRWUDFRVD
• Al unir dos piezas, levántelas suavemente y mire a través de los orificios para los pernos con el fin de ayudar a insertar los pernos a través de los
orificios.
• El ensamblaje requiere 2 personas.
Estera para máquina
/DHVWHUDSDUDPiTXLQD%RZÀH[0D[7UDLQHUŒHVXQDFFHVRULRRSFLRQDOTXHOHD\XGDDPDQWHQHUHOiUHDGHHQWUHQDPLHQWRGHVSHMDGD\ODDJUHJD
XQDFDSDGHSURWHFFLyQDOSLVR/DHVWHUDGHJRPDSDUDODPiTXLQDOHEULQGDXQDVXSHU¿FLHDQWLGHVOL]DQWHGHJRPDTXHOLPLWDODVGHVFDUJDVHVWiWLFDV\UHGXFHODSRVLELOLGDGGHHUURUHVGHYLVXDOL]DFLyQRIXQFLRQDPLHQWR6LHVSRVLEOHSRQJDVXHVIHUDSDUDODPiTXLQD%RZÀH[0D[7UDLQHUŒHQ
el área de entrenamiento elegida antes de comenzar el ensamblaje.
3DUDSHGLUODHVWHUDRSFLRQDOSDUDODPiTXLQDYLVLWHZZZERZÀH[FRPROODPHDO ±
6
Manual de ensamblaje/del usuario
Piezas
(2 cajas)
Caja 1
Artículo
Cant.
1
1
Armazón
2
1
Cubierta, posterior
3
2
Reposapiés
4
1
Lista de tornillería
2
Descripción
1
3
4
Caja 2
6
18
5
8
17
9
16
7
12
13
11
15
9
14
7
10
&RPRD\XGDSDUDHOHQVDPEODGRVHKDDSOLFDGRXQDFDOFRPDQtDDWRGDVODVSLH]DVGHUHFKDV 5 HL]TXLHUGDV / Artículo
Cant.
Descripción
Artículo
Cant.
5
1
Adaptador de CA
12
2
Tapa
1
(QVDPEODMHGHODFRQVROD F%DUUDVGHVOL]DQWHV
13
1
Banda de pecho de frecuencia cardíaca
7
2
Pedal
14
1
Cubierta estabilizadora, izquierda
8
1
Ensamblaje del riel
15
1
Cubierta estabilizadora, derecha
9
2
Pata
1
Juego manual
10
4
Nivelador
17
1
Manubrio dinámico, izquierda
11
1
Ensamblaje del estabilizador
18
1
Manubrio dinámico, derecha
7
Manual de ensamblaje/del usuario
Descripción
Tornillería/Herramientas
A
B
C
D
Artículo
Cant.
A
B
E
F
G
I
H
J
Descripción
K
L
M
N
O
P
Q
R
Artículo
Cant.
Descripción
7RUQLOORKH[DJRQDOFRQKXHFRHQODFDEH]D
QHJUR0[[
J
4
7RUQLOORKH[DJRQDOFRQKXHFRHQODFDEH]D
0[[
$UDQGHODGHVHJXULGDGQHJUD0[
K
4
Contratuerca, M8
C
4
$UDQGHODSODQDQHJUD0[
L
8
$UDQGHODSODQD0[
D
4
7RUQLOORKH[DJRQDOFRQKXHFRHQODFDEH]D
QHJUR0[[
M
8
7RUQLOORKH[DJRQDOSODQRFRQKXHFRHQOD
FDEH]DQHJUR0[[
E
4
$UDQGHODSODQDQHJUD0[
N
4
7RUQLOORKH[DJRQDOFRQKXHFRHQODFDEH]D
QHJUR0[[
F
1
7RUQLOOR3KLOOLSVGHFDEH]DWURQFRFyQLFD0[
[
O
4
$UDQGHODGHVHJXULGDGQHJUD0[
G
2
$UDQGHODSODQDQHJUD0[
P
4
$UDQGHODSODQDQHJUD0[
H
2
Tapa
Q
7RUQLOORKH[DJRQDOFRQKXHFRHQODFDEH]D
0[[
I
2
$UDQGHODRQGXODGD[
R
$UDQGHODGHVHJXULGDG0[
1RWD$OJXQDVGHODVSLH]DVPHWiOLFDVWRUQLOOHUtDLQGLFDGDVVHKDQVXPLQLVWUDGRFRPRUHSXHVWRVHQOD¿FKDGHWRUQLOOHUtD7HQJDHQFXHQWD
que después del montaje/ensamblaje correcto de la máquina pueden sobrar piezas/tornillería.
Herramientas
Incluidas
No incluidas
N.° 2
4 mm
5 mm
PP
8 mm
UHFRPHQGDGR
13 mm
8
Manual de ensamblaje/del usuario
Ensamblaje
1. Acople el ensamblaje del riel al armazón y luego libere el armazón de la placa de embalaje
$OJXQRVFRPSRQHQWHVGHODPiTXLQDSXHGHQVHUSHVDGRVRGLItFLOHVGHPDQLSXODU6ROLFLWHODD\XGDGHRWUDSHUVRQDSDUDUHDOL]DU
ORVSDVRVGHHQVDPEODMHGHGLFKDVSLH]DV1RUHDOLFHXVWHGVRORORVSDVRVTXHLPSOLFDQOHYDQWDUREMHWRVSHVDGRVRUHDOL]DU
PRYLPLHQWRVGLItFLOHV
AVISO: Apriete la tornillería a mano.
1
X4
C
B
A
8
X2
13mm
9
Manual de ensamblaje/del usuario
2. Inserte los niveladores en el ensamblaje del estabilizador
11
X4
10
10
Manual de ensamblaje/del usuario
3. Levante cuidadosamente el ensamblaje del armazón de la placa de embalaje y acóplelo al ensamblaje del estabilizador
$OJXQRVFRPSRQHQWHVGHODPiTXLQDSXHGHQVHUSHVDGRVRGLItFLOHVGHPDQLSXODU6ROLFLWHODD\XGDGHRWUDSHUVRQDSDUDUHDOL]DU
ORVSDVRVGHHQVDPEODMHGHGLFKDVSLH]DV1RUHDOLFHXVWHGVRORORVSDVRVTXHLPSOLFDQOHYDQWDUREMHWRVSHVDGRVRUHDOL]DU
PRYLPLHQWRVGLItFLOHV/HYDQWHHOHQVDPEODMHGHODUPD]yQGHVGHHOH[WHULRUGHOHQVDPEODMHGHSLYRWDMHFRPRVHLQGLFDDFRQWLQXDFLyQ
AVISO: una vez que toda la tornillería se haya apretado a mano, apriete bien TODA la tornillería de los pasos anteriores.
X4
D
E
11
Manual de ensamblaje/del usuario
4. Acople la cubiertas del estabilizador al ensamblaje del armazón
15
14
12
Manual de ensamblaje/del usuario
5. Acople la cubierta posterior y las tapas al ensamblaje del armazón
AVISO: coloque el gancho interior de la cubierta posterior en el ensamblaje del armazón y luego eleve el pivote a
su lugar.
X1
2
F
#2
12
12
13
Manual de ensamblaje/del usuario
6. Acople las patas al ensamblaje del armazón
7HQJDHQFXHQWDTXHODVSDWDVHVWiQFRQHFWDGDV\TXHFXDQGRFXDOTXLHUDGHHVWDVSLH]DVVHPXHYHODRWUDORKDFHWDPELpQ
X2
G
B
9
A
H
6mm
X2
I
9
14
Manual de ensamblaje/del usuario
7. Acople los pedales al ensamblaje del armazón
3DUDSUHYHQLUSRVLEOHVOHVLRQHVJUDYHVDOLQVHUWDUORVH[WUHPRVGHORVWXERVHQHOHQVDPEODMHGHODVSDWDVWHQJDFXLGDGRSDUD
HYLWDUTXHORVGHGRVRODVPDQRVTXHGHQDWUDSDGRVRFRPSULPLGRV
7
13mm
X4
7
K
L
X4
L
J
6mm
15
Manual de ensamblaje/del usuario
8. Corte las abrazaderas plásticas de embalaje los reposapiés y colóquelos en los pedales
X2
3
4mm
X8
M
3
16
Manual de ensamblaje/del usuario
9. Corte la abrazadera plástica que asegura los cables, acople los cables y coloque el ensamblaje de la
consola
AVISO: no permita que los cables queden dentro del ensamblaje del armazón. No corte ni tuerza los cables de la
consola.
6
X4
P
O
N
5mm
17
Manual de ensamblaje/del usuario
10. Acople los manubrios superiores al ensamblaje del armazón
7HQJDHQFXHQWDTXHORVSHGDOHV\ORVPDQXEULRVVXSHULRUHVHVWiQFRQHFWDGRV\TXHFXDQGRFXDOTXLHUDGHHVWDVSLH]DVVHPXHYH
ODRWUDORKDFHWDPELpQ
$OJXQRVFRPSRQHQWHVGHODPiTXLQDSXHGHQVHUSHVDGRVRGLItFLOHVGHPDQLSXODU6ROLFLWHODD\XGDGHRWUDSHUVRQDSDUDUHDOL]DU
ORVSDVRVGHHQVDPEODMHGHGLFKDVSLH]DV1RUHDOLFHXVWHGVRORORVSDVRVTXHLPSOLFDQOHYDQWDUREMHWRVSHVDGRVRUHDOL]DUPRYLPLHQWRVGLItFLOHV
AVISO: asegúrese de acoplar los manubrios superiores de modo que estén en el rango de operación del usuario.
18
17
X6
R
Q
5mm
18
Manual de ensamblaje/del usuario
11. Conecte el adaptador de CA al ensamblaje del armazón
5
12. Inspección final
Inspeccione la máquina para asegurarse de que toda la tornillería esté apretada y de que los componentes estén correctamente ensamblados.
Asegúrese de anotar el número de serie en el espacio correspondiente al principio de este manual.
No use la máquina hasta que esté completamente ensamblada y haya sido inspeccionada para comprobar su correcto funcionamiento según
el Manual del usuario.
19
Manual de ensamblaje/del usuario
Ajustes
Traslado de la máquina
/DPiTXLQDSXHGHVHUWUDVODGDGDSRUXQDRPiVSHUVRQDVVHJ~QVXVFDSDFLGDGHV\GHVWUH]DVItVLFDV$VHJ~UHVHGHTXHWDQWR
XVWHGFRPRODVGHPiVSHUVRQDVVHDQItVLFDPHQWHFDSDFHV\DSWDVSDUDPRYHUODPiTXLQDGHPDQHUDVHJXUD
1.
Sujete las barras deslizantes para inclinar cuidadosamente la máquina hacia usted y sobre los rodillos para transporte. Asegúrese de no
sujetar el estante para medios.
7HQJDFXLGDGRFRQORVPDQXEULRV\HOSHVRGHODPiTXLQDDQWHVGH
LQFOLQDUOD
2.
Empuje la máquina hasta el lugar deseado.
3.
Baje cuidadosamente la máquina hasta que quede en el lugar deseado.
AVISO: tenga cuidado al mover la máquina. Todos los movimientos bruscos pueden
afectar el funcionamiento de la computadora.
Nivelación de la máquina
Si el área de entrenamiento es irregular o si el ensamblaje del riel está levemente separado del piso, es necesario nivelar la máquina. Para ajustar:
1.
Instale la máquina en su área de entrenamiento.
$ÀRMHODVFRQWUDWXHUFDV\DMXVWHORVQLYHODGRUHVKDVWDTXHHVWpQELHQHTXLOLEUDGRV\HQFRQWDFWRFRQHOSLVR
1RDMXVWHORVQLYHODGRUHVDXQDDOWXUDH[FHVLYDTXHRFDVLRQHTXHVHVHSDUHQRGHVHQURVTXHQGHODPiTXLQD8VWHGSXHGHVXIULU
OHVLRQHVRODPiTXLQDSXHGHUHVXOWDUGDxDGD
3.
Apriete las contratuercas.
$VHJ~UHVHGHTXHODPiTXLQDHVWpQLYHODGD\HVWDEOHDQWHVGHHMHUFLWDUVHHQHOOD
20
Manual de ensamblaje/del usuario
Características
B
A
C
M L
N
K
D
E
J
F
I
G
H
G
!
A
Consola
I
Rodillo
B
Estante para medios / entretenimiento
J
Pedal
C
Barras deslizantes
K
Soporte para botella de agua/bandeja
D
Ventilador de resistencia
L
6HQVRUHVGHIUHFXHQFLDFDUGtDFDSRUFRQWDFWR &+5
E
Conector de alimentación
M
Manubrio estático
F
Rodillo para transporte
N
Manubrios dinámicos
G
Nivelador
O
Conectividad BluetoothŠ QRVHPXHVWUD
H
Ensamblaje del riel
8VHORVYDORUHVFDOFXODGRVRPHGLGRVSRUODFRPSXWDGRUDGHODPiTXLQDVRORFRPRUHIHUHQFLD/DIUHFXHQFLD
FDUGtDFDPRVWUDGDHVXQDDSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWHFRPRUHIHUHQFLD(OHMHUFLFLRHQH[FHVR
SXHGHSURYRFDUOHVLRQHVJUDYHVRODPXHUWH6LVHVLHQWHGpELOGHMHGHHMHUFLWDUVHLQPHGLDWDPHQWH
21
Manual de ensamblaje/del usuario
Funciones de la consola
Pantalla Burn Rate
ËQGLFHGHTXHPD Rango LED del
índice objetivo de
quema
Pantalla de zona de
EHQH¿FLR
Pantalla de calorías totales
Botón de programas
Pantalla de usuario
activo
Botón Add Time
Botones de índice objetivo de
quema
Botones de nivel de resistencia
Pantalla Burn Rate (Índice de quema)
/DSDQWDOOD%XUQ5DWH ËQGLFHGHTXHPD PXHVWUDHOQLYHOGHFDORUtDVTXHPDGDVSRUPLQXWR'LFKRtQGLFHHVXQDIXQFLyQGHODLQWHQVLGDGTXHHVHO
QLYHODFWXDOGH530 YHORFLGDGGHORVSHGDOHV \HOQLYHOGHUHVLVWHQFLD (OtQGLFHGHTXHPDGHFDORUtDVDXPHQWDUiDPHGLGDTXHDXPHQWH
alguno de estos dos valores.
Rango LED objetivo del índice de quema
(OUDQJR/('REMHWLYRGHOtQGLFHGHTXHPDHVXQDJXtDGHHQWUHQDPLHQWREDVDGDHQORVDMXVWHVGHOSHU¿OGHXVXDULRHOHJLGR'XUDQWHXQ
entrenamiento, se activa un rango de cinco unidades LED. La primera LED del rango es una sugerencia de nivel principiante. Las LED más altas
VRQSDUDXQXVXDULRGHFRQGLFLyQItVLFDPiVDYDQ]DGD/DLQWHQVLGDGGHOUDQJRVHEDVDHQODSDQWDOODGHOSHU¿OGHHQWUHQDPLHQWR
1RWDDVHJ~UHVHGHTXHHOSHU¿OGHXVXDULRHVWpDFWXDOL]DGRSDUDREWHQHUGDWRVPiVH[DFWRVVREUHHOtQGLFHGHTXHPD\ODVXJHUHQFLDGHOUDQJR
objetivo.
(OUDQJR/('REMHWLYRHVXQDVXJHUHQFLDGHOQLYHOGHHQWUHQDPLHQWR\VRORGHEHVHJXLUVHVLDVtORSHUPLWHVXQLYHOGHFRQGLFLyQ
ItVLFD
'XUDQWHXQHQWUHQDPLHQWRSRULQWHUYDORVHOVHJPHQWR635,17 &DUUHUDDWRGDYHORFLGDG WHQGUiXQLGDGHV/('URMDV\HOVHJPHQWR5(&29(5
5HFXSHUDFLyQ WHQGUiXQLGDGHV/('YHUGHV
Marcador LED del índice máximo de quema
(OPDUFDGRU/('GHOtQGLFHPi[LPRGHTXHPDHVXQ/('FRORUQDUDQMDTXHPXHVWUDHOtQGLFHPiVDOWRGHTXHPDGHFDORUtDVFRQVHJXLGRGXUDQWHHO
entrenamiento actual.
22
Manual de ensamblaje/del usuario
3DQWDOODGH]RQDGHEHQHĆFLR
=RQDVXJHULGDGHtQGLFHREMHWLYRGHTXHPDSDUDREWHQHUHOPi[LPREHQH¿FLRFRQHOHQWUHQDPLHQWRDFWXDO)DW%XUQ 4XHPDGHJUDVD (QGXUDQFH
5HVLVWHQFLD \3HUIRUPDQFH=RQHV =RQDVGHUHQGLPLHQWR Programas de quema de calorías o
grasa
=RQDGHEHQH¿FLR)DW%XUQ 4XHPDGH
JUDVD
Programa manual
=RQDGHEHQH¿FLR(QGXUDQFH 5HVLVWHQFLD
Programa de escaleras
=RQDGHEHQH¿FLR3HUIRUPDQFH
5HQGLPLHQWR
Pantalla de calorías totales
/DSDQWDOOD7RWDO&DORULHV &DORUtDVWRWDOHV PXHVWUDODVFDORUtDVHVWLPDGDVTXHVHKDQTXHPDGRGXUDQWHHOHQWUHQDPLHQWR(OPi[LPRTXHSXHGH
visualizarse es 9999.
Pantalla de usuario activo
/DSDQWDOOD$FWLYH8VHU 8VXDULRDFWLYR PXHVWUDHOSHU¿OGHXVXDULRHOHJLGR6LHPSUHVHHOLJHXQSHU¿OGHXVXDULR
1RWDSDUDREWHQHUUHFXHQWRVGHFDORUtDVPiVSUHFLVRV\REMHWLYRVGHTXHPDDVHJ~UHVHGHHGLWDUVXSHU¿OGHXVXDULR
Botón del usuario
3UHVLyQHORSDUDHOHJLUHOSHU¿OGHXVXDULRGHVHDGRPDQWpQJDORSUHVLRQDGRSRUVHJXQGRVSDUDHGLWDUHOSHU¿OGHXVXDULRHOHJLGR
Botón de volumen y luces indicadoras
(OERWyQGHYROXPHQ¿MDHOQLYHOGHYROXPHQGHODFRQVROD\ODVOXFHVLQGLFDGRUDVPXHVWUDQHODMXVWHDFWXDOEDMR /(' PHGLR /(' DOWR /(' RDSDJDGR QLQJ~Q/(' Botón MAX 14 Minute Interval
3UHVLyQHORSDUDLQLFLDUHOHQWUHQDPLHQWR0$;0LQXWH,QWHUYDO ,QWHUYDORPi[LPRGHPLQXWRV
Botón PROGRAMS
3UHVLyQHORSDUDVHOHFFLRQDUXQSURJUDPDGHHQWUHQDPLHQWR&RQHOSURJUDPD&DORULH*RDO 0HWDGHFDORUtDV VHOHFFLRQDGRPDQWpQJDORSUHVLRQDGR
3 segundos para personalizar la meta de entrenamiento.
Botón ENTER/START
Inicia el programa de entrenamiento seleccionado o reanuda un entrenamiento en pausa. Presiónelo para aceptar el valor mostrado de la opción.
Botón PAUSE/STOP
&RORFDHQSDXVDXQHQWUHQDPLHQWRDFWLYR¿QDOL]DXQHQWUHQDPLHQWRHQSDXVDRvuelve a la pantalla anterior.
Botón Add Time
Aumenta la longitud de un entrenamiento en 2.5 minutos para los entrenamientos sin intervalos, o agrega otro intervalo para los entrenamientos por
intervalos.
1RWDel botón está deshabilitado para los programas de meta de calorías, manual y prueba de estado físico.
Botones de índice objetivo de quema
$MXVWDHOtQGLFHREMHWLYRGHTXHPDGXUDQWHXQHQWUHQDPLHQWR VLHVWiDFWLYR RDXPHQWDXQYDORU IHFKDKRUDHGDGRSHVR Botones de nivel de resistencia
Ajusta el nivel de resistencia del entrenamiento.
23
Manual de ensamblaje/del usuario
Datos en la pantalla LCD
La pantalla de la consola muestra las mediciones de entrenamiento y opciones actuales.
Pantalla de tiempo
Segmento de entrenamiento
activo
Pantalla de metas
Conteo de intervalo de entrenamiento
LQWHUYDORDFWXDOFDQWLGDG
WRWDOGHLQWHUYDORV
Programas Target CoaFKLQJ 5HFRPHQGDFLyQGH
REMHWLYR
3URJUDPDVGHPRGRGHEHQH¿cio
3DQWDOODGHOSHU¿OGHHQWUHQDPLHQWR
CARRERA A TODA VELOCIDAD
Segmento de alta intensidad de un entrenamiento por intervalos. Durante un entrenamiento por intervalos, el segmento activo cambia entre los
VHJPHQWRV635,17 &DUUHUDDWRGDYHORFLGDG \5(&29(5 5HFXSHUDFLyQ FRQXQDFRQ¿UPDFLyQVRQRUD\FRQWDUiHOWLHPSRUHVWDQWHGHOVHJPHQto actualmente activo.
RECUPERACIÓN
La reducción del segmento de entrenamiento de un entrenamiento por intervalos que cuenta de manera descendente hasta el siguiente segmento
635,17 &DUUHUDDWRGDYHORFLGDG CALENTAMIENTO
:$5083 &DOHQWDPLHQWR VHLQLFLDFXDQGRODPiTXLQDHVWiHQXVRSHURQRVHKDLQLFLDGRXQHQWUHQDPLHQWR/DSDQWDOOD:$5083 &DOHQWDPLHQWR VHDFWLYD\ODSDQWDOODGHOWLHPSRPXHVWUDHOWLHPSRHQFDOHQWDPLHQWR
ENFRIAMIENTO
&22/'2:1 (QIULDPLHQWR VHLQLFLDFXDQGR¿QDOL]DXQHQWUHQDPLHQWRSHURODPiTXLQDVLJXHHQXVR/DSDQWDOOD&22/'2:1 (QIULDPLHQWR VH
activa y la pantalla del tiempo muestra el tiempo en enfriamiento. Los resultados del entrenamiento se muestran durante el enfriamiento.
Pantalla de tiempo
/DSDQWDOODGHWLHPSRPXHVWUDODFXHQWDGHOWLHPSRVHJ~QHOHVWLORGHHQWUHQDPLHQWR,QWHUYDO ,QWHUYDOR %HQH¿W %HQH¿FLR R0DQXDO
'XUDQWHXQHQWUHQDPLHQWRSRULQWHUYDORVODSDQWDOODGHWLHPSRFXHQWDHOWLHPSRUHVWDQWHGHOVHJPHQWRGHLQWHUYDORDFWXDO 635,17R5(&29(5 (QHOFDVRGHOPRGR%HQH¿W %HQH¿FLR VHKDUiXQDFXHQWDUHJUHVLYDGHOWLHPSRWRWDOGHOHQWUHQDPLHQWR'XUDQWHXQHQWUHQDPLHQWR0DQXDOOD
pantalla de tiempo central contará el tiempo restante hasta que concluya el entrenamiento.
(OYDORUPi[LPRGHYLVXDOL]DFLyQSDUDHOWLHPSRHV
Conteo de intervalo de entrenamiento
Durante un entrenamiento por intervalos, el conteo de entrenamiento por intervalos muestra el intervalo activo actualmente y la cantidad total de
intervalos para el entrenamiento.
24
Manual de ensamblaje/del usuario
Pantalla de metas
/DSDQWDOOD*RDO 0HWD PXHVWUDHOWLHPSRWRWDOGHOHQWUHQDPLHQWRRHOWRWDOGHFDORUtDVSDUDHOHQWUHQDPLHQWR'XUDQWHXQHQWUHQDPLHQWRHQLQWHUYDORVODSDQWDOOD*RDOFXHQWDHQIRUPDUHJUHVLYDHOWLHPSRKDVWDHO¿QDOGHOHQWUHQDPLHQWR(VWDSDQWDOODHVWDUiHQEODQFRGXUDQWHXQHQWUHQDPLHQWR
manual. Cuando la meta es de tiempo, se muestra el icono del reloj.
1RWDdurante una prueba de estado físico, la meta que se muestra de 3 minutos comienza cuando la frecuencia cardíaca alcanza la zona
cardíaca. Tenga en cuenta el tiempo adicional antes de que comience la cuenta regresiva de los 3 minutos.
Pantalla de conexión de aplicación Bluetooth®
La pantalla muestra cuando un dispositivo se acopla a la aplicación
Programas Target Coaching (Recomendación de objetivo)
Los programas de recomendación de objetivo sugieren un índice de quema de calorías como objetivo durante el entrenamiento. El rango LED
REMHWLYRGHOtQGLFHGHTXHPDVHDFWLYD\PXHVWUDHOtQGLFHREMHWLYRGHTXHPDGHFDORUtDVGXUDQWHHOHQWUHQDPLHQWR/DSDQWDOOD:RUNRXW3UR¿OH
3HU¿OGHHQWUHQDPLHQWR HVHOtQGLFHGHTXHPDGHFDORUtDVGXUDQWHXQSURJUDPDGHUHFRPHQGDFLyQGHREMHWLYR
3URJUDPDVGHPRGRGHEHQHĆFLR
/RVSURJUDPDVGHPRGRGHEHQH¿FLRVXJLHUHQXQDDPSOLDYDULHGDGGHtQGLFHVGHTXHPDGHFDORUtDVSDUDHOHQWUHQDPLHQWR/DSDQWDOOD:RUNRXW
3UR¿OH 3HU¿OGHHQWUHQDPLHQWR PXHVWUD5HVLVWDQFH/HYHO 1LYHOGHUHVLVWHQFLD GXUDQWHXQSURJUDPDGHPRGRGHEHQH¿FLR
3DQWDOODGHOSHUĆOGHHQWUHQDPLHQWR
(OiUHDGHODSDQWDOODGHSHU¿OGHHQWUHQDPLHQWRPXHVWUDHOSHU¿OGHSURJUHVRGHOSURJUDPD&DGDFROXPQDGHOSHU¿OPXHVWUDXQVHJPHQWRGH
entrenamiento. Cuanto más alta sea la columna, mayor será la intensidad del entrenamiento.
'XUDQWHXQSURJUDPDGHUHFRPHQGDFLyQGHREMHWLYRHOSHU¿OGHHQWUHQDPLHQWRPXHVWUDHOQLYHOREMHWLYRGHOtQGLFHGHTXHPD'XUDQWHXQSURJUDPD
GHPRGRGHEHQH¿FLRHOSHU¿OGHHQWUHQDPLHQWRPXHVWUDHOQLYHOGHUHVLVWHQFLD/DFRQVRODDMXVWDUiHOQLYHOGHUHVLVWHQFLDGXUDQWHHOHQWUHQDPLHQWR
La columna intermitente muestra el segmento actualmente activo.
RPM
(OFDPSRGH530PXHVWUDODVUHYROXFLRQHVSRUPLQXWR YHORFLGDGGHORVSHGDOHV GHODPiTXLQD
Índice de quema de calorías
(OFDPSRGHSDQWDOOD&DORULH%XUQ5DWH ËQGLFHGHTXHPDGHFDORUtDV PXHVWUDHOtQGLFHDFWXDOHQHOTXHVHTXHPDQODVFDORUtDVSRUPLQXWR/DV
530\HOQLYHOGHUHVLVWHQFLDFDPELDQHVWHtQGLFHGLUHFWDPHQWH/RVDMXVWHVGHOSHU¿OGHXVXDULRWDPELpQLQÀX\HQVREUHHOtQGLFH SHVRGHOXVXDULR Frecuencia cardíaca
/DSDQWDOODGHIUHFXHQFLDFDUGtDFDPXHVWUDODIUHFXHQFLDFDUGtDFDHQODWLGRVSRUPLQXWR /30 SURYHQLHQWHGHORVVHQVRUHVGHIUHFXHQFLDFDUGtDFD
Este valor no se mostrará si no se detecta una señal de la frecuencia cardíaca.
&RQVXOWHDVXPpGLFRDQWHVGHFRPHQ]DUXQSURJUDPDGHHMHUFLFLRV'HMHGHHMHUFLWDUVHVLVLHQWHGRORURWHQVLyQHQHOSHFKRVL
WLHQHGLÀFXOWDGSDUDUHVSLUDURVLVLHQWHTXHYDDGHVPD\DUVH&RPXQtTXHVHFRQVXPpGLFRDQWHVGHYROYHUDXVDUODPiTXLQD/D
IUHFXHQFLDFDUGtDFDTXHVHPXHVWUDHQODFRQVRODHVXQDDSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWHFRPRUHIHUHQFLD
Nivel de resistencia
(OFDPSRGHSDQWDOOD5HVLVWDQFH/HYHO 1LYHOGHUHVLVWHQFLD PXHVWUDHOQLYHOGHUHVLVWHQFLDDFWXDO $PD\RUQLYHOGHUHVLVWHQFLDVHUiPiV
difícil empujar los pedales.
1RWDdurante un entrenamiento por intervalos de intensidad, la consola ajustará el nivel de resistencia para animar al usuario a alcanzar el
REMHWLYRGHTXHPD VHJ~QODYHORFLGDGGHORVSHGDOHV 25
Manual de ensamblaje/del usuario
&RQHFWLYLGDGHQVXP£TXLQDGHHMHUFLFLRFDUGLRYDVFXODU%RZćH[0D[7UDLQHU®
/DPiTXLQDGHHMHUFLFLRFDUGLRYDVFXODU%RZÀH[0D[7UDLQHUŠ M7 viene equipada con la conectividad BluetoothŠ y se puede sincronizar inalámbricaPHQWHFRQODDSOLFDFLyQGHSRUWLYD%RZÀH[0D[7UDLQHUŠ" en los dispositivos compatibles.
1RWDSDUDFRQVXOWDUXQDOLVWDGHORVGLVSRVLWLYRVFRPSDWLEOHVYLVLWHZZZERZÀH[PD[WUDLQHUFRP
/DDSOLFDFLµQGHSRUWLYD %RZćH[0D[7UDLQHU® 2")
/DDSOLFDFLyQ%RZÀH[0D[7UDLQHUŠVHVLQFURQL]DFRQVX%RZÀH[0D[7UDLQHUŠ M7 para llevar un seguimiento de las calorías totales quemadas,
el tiempo, los vatios y más. Registre y almacene cada entrenamiento para consultarlo rápidamente. Además, sincroniza automáticamente los datos
de su entrenamiento con MyFitnessPalŠ para que sea más fácil que nunca conseguir sus metas diarias. Lleve un seguimiento de sus resultados y
comparta información con su familia y amigos.
'
HVFDUJXHODDSOLFDFLyQGHVRIWZDUHJUDWXLWDGHQRPLQDGD³%RZÀH[0D[7UDLQHUŠ 2". La aplicación de software está disponible en Google
3OD\ŒH$SS6WRUH
1RWDSDUDFRQVXOWDUXQDOLVWDGHORVGLVSRVLWLYRVFRPSDWLEOHVYLVLWHZZZERZÀH[PD[WUDLQHUFRP
6LJDODVLQVWUXFFLRQHVGHODDSOLFDFLyQSDUDVLQFURQL]DUVXGLVSRVLWLYRFRQODPiTXLQDGHHMHUFLFLRFDUGLRYDVFXODU%RZÀH[0D[7UDLQHUŠ.
Sensores de frecuencia cardíaca por contacto
/RVVHQVRUHVGHIUHFXHQFLDFDUGtDFDSRUFRQWDFWR &+5 HQYtDQODVVHxDOHVGHVXIUHFXHQFLDFDUGtDFDDODFRQVROD/RVVHQVRUHVGH&+5VRQODV
SLH]DVGHDFHURLQR[LGDEOHGHOPDQXEULR3DUDXVDUORVFRORTXHVXVPDQRVFyPRGDPHQWHDOUHGHGRUORVVHQVRUHV$VHJ~UHVHGHTXHVXVPDQRV
WRTXHQWDQWRODSDUWHVXSHULRUFRPRODSDUWHLQIHULRUGHORVVHQVRUHV6XMpWHORVFRQ¿UPH]DSHURVLQGHPDVLDGDWHQVLyQQLKROJXUD3DUDTXHODFRQsola detecte el pulso, ambas manos deben estar en contacto con los sensores. Una vez que la consola detecte cuatro señales estables de pulso, se
mostrará su frecuencia de pulso inicial.
Una vez que la consola tenga su frecuencia cardíaca inicial, no mueva ni cambie de lugar las manos durante 10 a 15 segundos. La consola validará
DKRUDODIUHFXHQFLDFDUGtDFD+D\PXFKRVIDFWRUHVTXHLQÀX\HQHQODFDSDFLGDGGHORVVHQVRUHVSDUDGHWHFWDUODVHxDOGHVXIUHFXHQFLDFDUGtDFD
• (OPRYLPLHQWRGHORVP~VFXORVGHODSDUWHDOWDGHOFXHUSR LQFOXLGRVORVEUD]RV SURGXFHXQDVHxDOHOpFWULFD UXLGRPXVFXODU TXHSXHGHLQWHUIHULU
con la detección del pulso. Un leve movimiento de la mano mientras está en contacto con los sensores también puede producir interferencia.
• Las callosidades y la loción para las manos pueden actuar como una capa aislante que reduce la potencia de la señal.
• $OJXQDVVHxDOHVGHHOHFWURFDUGLRJUDPD (&* JHQHUDGDVSRUODVSHUVRQDVQRVRQVXILFLHQWHPHQWHSRWHQWHVSDUDTXHODVGHWHFWHQORVVHQVRUHV
• /DSUR[LPLGDGGHRWUDVPiTXLQDVHOHFWUyQLFDVSXHGHSURYRFDULQWHUIHUHQFLDV
8VHORVYDORUHVFDOFXODGRVRPHGLGRVSRUODFRPSXWDGRUDGHODPiTXLQDVRORFRPRUHIHUHQFLD
Monitor remoto de frecuencia cardíaca
El monitoreo de la frecuencia cardíaca es uno de los mejores procedimientos para controlar la intensidad de su ejercicio. Los sensores de frecuenFLDFDUGtDFDSRUFRQWDFWR &+5SRUVXVLJODHQLQJOpV HVWiQLQVWDODGRVSDUDHQYLDUODVVHxDOHVGHVXIUHFXHQFLDFDUGtDFDDODFRQVROD/DFRQVROD
también puede leer señales de HR de telemetría provenientes de un transmisor de banda de pecho para frecuencia cardíaca que funcione en el
UDQJRGHDN+=
1RWDODEDQGDGHSHFKRSDUDIUHFXHQFLDFDUGtDFDGHEHVHUXQDEDQGDSDUDIUHFXHQFLDFDUGtDFDQRFRGL¿FDGDGH3RODU(OHFWURRXQPRGHORQR
FRGL¿FDGRFRPSDWLEOHFRQ32/$5Š /DVEDQGDVGHSHFKRSDUDIUHFXHQFLDFDUGtDFDFRGL¿FDGDVGH32/$5Š como las bandas de pecho
POLARŠ OwnCodeŠQRIXQFLRQDUiQFRQHVWHHTXLSR 6LXVWHGWLHQHXQPDUFDSDVRVXRWURGLVSRVLWLYRHOHFWUyQLFRLPSODQWDGRFRQVXOWHDVXPpGLFRDQWHVGHXVDUXQDEDQGDGHSHFKR
LQDOiPEULFDXRWURPRQLWRUWHOHPpWULFRGHODIUHFXHQFLDFDUGtDFD
/DIUHFXHQFLDFDUGtDFDTXHVHPXHVWUDHQODFRQVRODHVXQDDSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWHFRPRUHIHUHQFLD
26
Manual de ensamblaje/del usuario
Banda de pecho
El uso de la banda de pecho con transmisor de frecuencia cardíaca le permite controlar su frecuencia cardíaca en cualquier momento durante el
entrenamiento.
&RQVXOWHDVXPpGLFRDQWHVGHFRPHQ]DUXQSURJUDPDGHHMHUFLFLRV'HMHGHHMHUFLWDUVHVLVLHQWHGRORURWHQVLyQHQHOSHFKRVL
WLHQHGLÀFXOWDGSDUDUHVSLUDURVLVLHQWHTXHYDDGHVPD\DUVH&RPXQtTXHVHFRQVXPpGLFRDQWHVGHYROYHUDXVDUODPiTXLQD8VH
ORVYDORUHVFDOFXODGRVRPHGLGRVSRUODFRPSXWDGRUDGHODPiTXLQDVRORFRPRUHIHUHQFLD
El transmisor de frecuencia cardíaca se instala en una banda de pecho para mantener las manos libres durante su entrenamiento. Para ponerse la
banda de pecho:
1.
Ajuste la longitud de la banda para que calce de manera ceñida y cómoda contra su piel. Asegure la banda alrededor de su pecho, justo
debajo de los músculos del pecho y abróchela.
2.
Separe el transmisor de su pecho y humedezca las dos áreas estriadas de los electrodos en la parte posterior.
&RPSUXHEHTXHODViUHDVGHORVHOHFWURGRVKXPHGHFLGDVVHDSR\HQ¿UPHPHQWHFRQWUDVXSLHO
(OWUDQVPLVRUHQYLDUiVXIUHFXHQFLDFDUGtDFDDOUHFHSWRUGHODPiTXLQD\VHPRVWUDUiQVXVODWLGRVSRUPLQXWR /30 HVWLPDGRV
Siempre quite el transmisor antes de limpiar la banda de pecho. Limpie regularmente la banda de pecho con jabón suave y agua, luego séquela
bien. Es posible que el sudor y la humedad residuales mantengan activo el transmisor y consuman la batería del transmisor. Seque y limpie con un
trapo el transmisor después de cada uso.
1RWD no utilice abrasivos ni productos químicos como lana de acero o alcohol para limpiar la banda de pecho, ya que pueden causar un daño
permanente a los electrodos.
Si la consola no muestra un valor de frecuencia cardíaca, es posible que el transmisor esté fallando. Asegúrese de que las áreas de contacto
WH[WXUL]DGDVGHODEDQGDGHSHFKRHVWpQHQFRQWDFWRFRQVXSLHO(VSRVLEOHTXHGHEDKXPHGHFHUOLJHUDPHQWHODViUHDVGHFRQWDFWR6LQRREWLHQH
señal o necesita asistencia adicional, comuníquese con un representante de Nautilus.
$QWHVGHGHVHFKDUXQDEDQGDGHSHFKRUHWLUHODEDWHUtD'LVSRQJDGHHOODGHDFXHUGRFRQODVUHJODPHQWDFLRQHVORFDOHVRHQXQ
FHQWURGHUHFLFODMHDSUREDGR
Cálculos de la frecuencia cardíaca
/DIUHFXHQFLDFDUGtDFDPi[LPDJHQHUDOPHQWHGLVPLQX\HFRQODHGDGFRPHQ]DQGRFRQXQRVODWLGRVSRUPLQXWR /30 HQODQLxH]KDVWDOOHJDU
DXQRV/30DORVDxRV(VWDFDtGDGHODIUHFXHQFLDFDUGtDFDHQJHQHUDOHVOLQHDOFRQXQDGLVPLQXFLyQGHDSUR[LPDGDPHQWH/30SRU
DxR1RKD\LQGLFLRVGHTXHHOHQWUHQDPLHQWRLQÀX\DHQODGLVPLQXFLyQGHODIUHFXHQFLDFDUGtDFDPi[LPD3HUVRQDVGHODPLVPDHGDGSXHGHQWHQHU
GLIHUHQWHVIUHFXHQFLDVFDUGtDFDVPi[LPDV(VPiVSUHFLVRGHWHUPLQDUHVWHYDORUVRPHWLpQGRVHDXQDSUXHEDGHHVIXHU]RTXHXVDUXQDIyUPXOD
relacionada con la edad.
(OHQWUHQDPLHQWRGHUHVLVWHQFLDLQÀX\HHQVXIUHFXHQFLDFDUGtDFDHQUHSRVR(ODGXOWRWtSLFRWLHQHXQDIUHFXHQFLDFDUGtDFDHQUHSRVRGHXQRV
LPM, mientras que los corredores muy entrenados pueden tener 40 LPM o menos.
/DWDEODGHIUHFXHQFLDFDUGtDFDHVXQDHVWLPDFLyQGHOD]RQDGHIUHFXHQFLDFDUGtDFD +5=SRUVXVLJODHQLQJOpV TXHHVH¿FD]SDUDTXHPDUJUDVD
\PHMRUDUVXVLVWHPDFDUGLRYDVFXODU/DVFRQGLFLRQHVItVLFDVYDUtDQSRUORWDQWRVX+5=SRGUtDVHUYDULRVODWLGRVPD\RURPHQRUTXHHOYDORUTXH
se muestra.
(OSURFHGLPLHQWRPiVH¿FD]SDUDTXHPDUJUDVDGXUDQWHHOHMHUFLFLRHVFRPHQ]DUDXQULWPROHQWR\DXPHQWDUJUDGXDOPHQWHODLQWHQVLGDGKDVWDTXH
VXIUHFXHQFLDFDUGtDFDDOFDQFHHQWUHHO\HOGHVXIUHFXHQFLDFDUGtDFDPi[LPD&RQWLQ~HDHVHULWPRPDQWHQLHQGRVXIUHFXHQFLDFDUGtDFD
en esa zona objetivo durante más de 20 minutos. Mientras más tiempo mantenga su frecuencia cardíaca objetivo, más grasa quemará su cuerpo.
(OJUi¿FRHVXQDSDXWDFRQFLVDTXHGHVFULEHODVIUHFXHQFLDVFDUGtDFDVREMHWLYRTXHVHVXJLHUHQJHQHUDOPHQWHHQIXQFLyQGHODHGDG7DOFRPR
se indicó antes, su frecuencia cardíaca objetivo óptima puede ser más alta o más baja. Consulte a su médico para conocer su zona de frecuencia
cardíaca objetivo individual.
27
Manual de ensamblaje/del usuario
1RWDal igual que con todos los regímenes de ejercicios y acondicionamiento físico, use siempre su mejor criterio cuando aumente el tiempo o la
intensidad del ejercicio.
FRECUENCIA CARDÍACA OBJETIVO PARA QUEMAR GRASA
200
196
167
191
186
162
181
158
154
150
(latidos por minuto)
Frecuencia cardíaca LPM
250
118
100
115
112
109
176
150
106
171
166
145
141
103
100
161
137
97
156
133
151
128
146
126
94
91
88
60-64
65-69
70+
50
0
20-24
25-29
30-34
35-39
40-44
45-49
50-54 55-59
Edad
Frecuencia cardíaca máxima
Zona de frecuencia
cardíaca máxima
(manténgase dentro de esta zona
para una quema de grasa óptima)
28
Manual de ensamblaje/del usuario
Fundamentos de acondicionamiento físico
Frecuencia
3DUDPDQWHQHUXQDEXHQDVDOXGSHUGHUSHVR\PHMRUDUODUHVLVWHQFLDFDUGLRYDVFXODUXVHODPiTXLQDGHHMHUFLFLRVFDUGLRYDVFXODUHV%RZÀH[0D[
TrainerŠ un mínimo de 3 veces por semana, alrededor de 14 minutos cada día.
6LHOHMHUFLFLRHVDOJRQXHYRSDUDXVWHG RVLHVWiUHWRPDQGRXQSURJUDPDUHJXODUGHHMHUFLFLRV \QROHDFRPRGDFRPSOHWDUPLQXWRVGHHMHUFLFLR
continuo de una vez, simplemente ejercítese de 5 a 10 minutos y aumente gradualmente el tiempo de su entrenamiento hasta que pueda alcanzar
el total de 14 minutos.
Si su agenda es muy ajetreada y no puede acomodar 14 minutos de ejercicio continuo en su día, pruebe acumular 14 minutos mediante la realización de varios entrenamientos más cortos en el mismo día. Por ejemplo, 7 minutos en la mañana y 7 minutos en la tarde. Esta puede ser una forma
grandiosa de comenzar su entrenamiento cardiovascular si la actividad vigorosa es algo nuevo para usted.
3DUDORJUDUORVPHMRUHVUHVXOWDGRVFRPELQHVXVHQWUHQDPLHQWRVGHODPiTXLQDGHHMHUFLFLRVFDUGLRYDVFXODUHV%RZÀH[0D[7UDLQHUŠ con un proJUDPDGHHQWUHQDPLHQWRGHIXHU]DGHXQJLPQDVLRSDUDHOKRJDU%RZÀH[ŠRXQDVSHVDV%RZÀH[Š SelectTechŠ, y siga la Guía de Pérdida de Peso
&RUSRUDO%RZÀH[ŒGHHVWHPDQXDO
Constancia
/DVDJHQGDVODERUDOHVDMHWUHDGDVODVREOLJDFLRQHVIDPLOLDUHV\ORVTXHKDFHUHVFRWLGLDQRVSXHGHQGL¿FXOWDUHODFRPRGRGHOHMHUFLFLRUHJXODUHQVX
YLGD3UXHEHORVVLJXLHQWHVFRQVHMRVSDUDDXPHQWDUVXVSRVLELOLGDGHVGHp[LWR
3URJUDPHVXVHQWUHQDPLHQWRVGHODPLVPDPDQHUDTXHSURJUDPDUHXQLRQHVRFLWDV6HOHFFLRQHGtDV\KRUDVHVSHFt¿FRVFDGDVHPDQD\QRFDPELH
sus horas de entrenamiento a menos que sea absolutamente necesario.
Comprométase con un familiar, amigo o cónyuge y anímense mutuamente para mantener el rumbo cada semana. Déjense mensajes con recordatorios amigables para ser constantes y hacerse responsables el uno del otro.
+DJDTXHVXVHQWUHQDPLHQWRVVHDQPiVLQWHUHVDQWHVDOWHUQDQGRHQWUHHQWUHQDPLHQWRVGHHVWDGRFRQVWDQWH YHORFLGDG~QLFD \HQWUHQDPLHQWRVSRU
LQWHUYDORV YHORFLGDGYDULDEOH /DPiTXLQDGHHMHUFLFLRVFDUGLRYDVFXODUHV%RZÀH[0D[7UDLQHUŠ es aún más divertida cuando le agrega este tipo de
variedad.
Indumentaria
(VLPSRUWDQWHXVDUFDO]DGR\URSDDGHFXDGRVVHJXURV\FyPRGRVDOXVDUODPiTXLQDGHHMHUFLFLRVFDUGLRYDVFXODUHV%RZÀH[0D[7UDLQHUŠ inclusive:
• Zapatillas deportivas para caminar o correr con suela de goma.
• Ropa de ejercicio que le permita moverse con libertad y mantenerse cómodamente fresco.
• Suspensorios que le brinden estabilidad y comodidad.
• Botella de agua para hidratarse constantemente e idónea para sesiones de ejercicio.
29
Manual de ensamblaje/del usuario
Calentamiento *
$QWHVGHXVDUODPiTXLQDGHHMHUFLFLRVFDUGLRYDVFXODUHV%RZÀH[0D[7UDLQHUŠ, contemple realizar estos estiramientos dinámicos de calentamiento
que le ayudarán a preparar su cuerpo para el entrenamiento:
$EUD]RGLQiPLFRGHURGLOOD
Párese con los pies juntos. Lleve una rodilla adelante y
levántela hacia el pecho. Rodee la espinilla con sus manos y
acerque la rodilla al pecho. Termine el estiramiento poniendo el pie nuevamente en el suelo. Cada repetición de la
secuencia debe tomar de 1 a 3 segundos. Repítalo como una
VHFXHQFLDÀXLGDFRQWURODGD\FRQWLQXDGHDYHFHV
Repita el estiramiento con la otra pierna.
)OH[LyQGLQiPLFDGHURGLOOD
Párese con los pies juntos. Apóyese en una pared para
mantener el equilibrio, si es necesario. Levante el talón de
un pie hacia los glúteos. Termine el estiramiento poniendo el
pie nuevamente en el suelo. Cada repetición de la secuencia
debe tomar de 1 a 3 segundos. Repítalo como una secuenFLDÀXLGDFRQWURODGD\FRQWLQXDGHDYHFHV5HSLWDHO
estiramiento con la otra pierna.
3DWDGDGLQiPLFDGHURGLOOD
Párese erguido y sostenga una pierna arriba con las manos
DODDOWXUDGHODFDGHUDPDQWHQLHQGRODURGLOODÀH[LRQDGD
Apóyese en una pared para mantener el equilibrio, si es necesario. Enderece la rodilla hasta donde le resulte cómodo.
7HUPLQHHOHVWLUDPLHQWRÀH[LRQDQGRODURGLOOD&DGDUHSHWLFLyQ
de la secuencia debe tomar de 1 a 3 segundos. Repítalo
FRPRXQDVHFXHQFLDÀXLGDFRQWURODGD\FRQWLQXDGHD
20 veces. Repita el estiramiento con la otra pierna.
*LURGLQiPLFR
Párese con los pies separados al ancho de los hombros.
)OH[LRQHORVFRGRVDEUDORVEUD]RVKDFLDORVODGRV*LUH
la parte superior del cuerpo hacia un lado y luego hacia el
otro hasta donde le resulte cómodo. Cada repetición de la
secuencia debe tomar de 1 a 3 segundos. Repítalo como una
VHFXHQFLDÀXLGDFRQWURODGD\FRQWLQXDGHDYHFHV
*)XHQWH-D\%ODKQLN¶V)XOO%RG\)OH[LELOLW\VHJXQGDHGLFLyQ+XPDQ.LQHWLFVFRP
30
Manual de ensamblaje/del usuario
3UHVLyQGLQiPLFDGHWDOyQFRQURGLOODÁH[LRQDGD
Párese con un pie adelante y un pie atrás, separados al
ancho de la cadera y con los pies apuntando hacia adelante.
Apóyese en una pared para mantener el equilibrio, si es
QHFHVDULR)OH[LRQHDPEDVURGLOODVDSR\DQGRHOSHVRHQHO
talón de más atrás. Termine el estiramiento volviendo a la
posición inicial. Cada repetición de la secuencia debe tomar
GHDVHJXQGRV5HStWDORFRPRXQDVHFXHQFLDÀXLGDFRQtrolada y continua de 10 a 20 veces. Repita el estiramiento
con la otra pierna. Apóyese en una pared o sosténgase de
algo para mantener el equilibrio, si es necesario.
([WHQVLyQGLQiPLFDODWHUDO
Párese con los pies separados, las rodillas ligeramente
ÀH[LRQDGDV\ORVEUD]RVDORVODGRVGHOFXHUSR([WLHQGD
una mano por encima de la cabeza e inclínese hacia el lado
opuesto. Termine el estiramiento volviendo a la posición iniFLDO/XHJRH[WLHQGDODRWUDPDQRKDFLDHOODGRRSXHVWR8VH
el otro brazo para apoyar el peso del cuerpo sobre el muslo,
si es necesario. Cada repetición de la secuencia debe tomar
GHDVHJXQGRV5HStWDORFRPRXQDVHFXHQFLDÀXLGD
controlada y continua de 10 a 20 veces.
31
Manual de ensamblaje/del usuario
Entrenamientos
Siga estas pautas para adoptar con facilidad un régimen semanal de ejercicios. Use su criterio o los consejos de su médico o profesional de atención médica para encontrar la intensidad y el nivel de sus entrenamientos.
&RQVXOWHDVXPpGLFRDQWHVGHFRPHQ]DUXQSURJUDPDGHHMHUFLFLRV'HMHGHHMHUFLWDUVHVLVLHQWHGRORURWHQVLyQHQHOSHFKRVL
WLHQHGLÀFXOWDGSDUDUHVSLUDURVLVLHQWHTXHYDDGHVPD\DUVH&RPXQtTXHVHFRQVXPpGLFRDQWHVGHYROYHUDXVDUODPiTXLQD8VH
ORVYDORUHVFDOFXODGRVRPHGLGRVSRUODFRPSXWDGRUDGHODPiTXLQDVRORFRPRUHIHUHQFLD/DIUHFXHQFLDFDUGtDFDTXHVHPXHVWUD
HQODFRQVRODHVXQDDSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWHFRPRUHIHUHQFLD
El entrenamiento por intervalos y el estado constante son dos tipos de entrenamiento que puede realizar en la máquina de ejercicios cardiovasculaUHV%RZÀH[0D[7UDLQHUŠ:
Entrenamientos de estado constante
8QHQWUHQDPLHQWRGHHVWDGRFRQVWDQWHVXSRQHDXPHQWDUOHQWDPHQWHODYHORFLGDGGHVXHQWUHQDPLHQWRKDVWDXQDYHORFLGDGH[LJHQWHSHURFyPRGD
que pueda mantener durante la mayor parte de su entrenamiento. Un gran entrenamiento de estado constante sería elevar su frecuencia cardíaca a
OD]RQDFDUGtDFD\GHTXHPDGHJUDVDGXUDQWHWRGRXQHQWUHQDPLHQWR3RUHMHPSORPDQWHQHUXQULWPRGHFDORUtDVTXHPDGDVSRUPLQXWRGXUDQWH
HOHQWUHQDPLHQWRFRPSOHWRVDOYRGXUDQWHHOFDOHQWDPLHQWR\HOHQIULDPLHQWR/RVHQWUHQDPLHQWRVGHHVWDGRFRQVWDQWHOHD\XGDQDDGTXLULUFRQ¿DQza, resistencia y constancia en el ejercicio, y son fundamentales para un programa de entrenamiento cardiovascular equilibrado.
Entrenamientos por intervalos
8QHQWUHQDPLHQWRSRULQWHUYDORVVXSRQHDMXVWDUODLQWHQVLGDGGHVXHQWUHQDPLHQWRDGXUDFLRQHVHVSHFt¿FDVSDUDDXPHQWDU\GLVPLQXLUVXULWPR
respiratorio, frecuencia cardíaca y quema de calorías. Este tipo de entrenamiento le permite quemar más calorías que un entrenamiento estándar
en un período de tiempo más corto. Con la pantalla del índice de quema de calorías, puede ajustar la intensidad de su entrenamiento rápidamente
para lograr sus metas.
/DPiTXLQDGHHMHUFLFLRVFDUGLRYDVFXODUHV%RZÀH[0D[7UDLQHUŠFRPELQDVHJPHQWRV635,17 &DUUHUDDWRGDYHORFLGDG \VHJPHQWRV5(&29(5 5HFXSHUDFLyQ SDUDFUHDUXQHQWUHQDPLHQWRSRULQWHUYDORV'XUDQWHXQVHJPHQWR635,17 &DUUHUDDWRGDYHORFLGDG OOHJXHDXQQLYHO
GHDOWDTXHPDGHFDORUtDVTXHSXHGDUHSHWLUVHGXUDQWHVHJPHQWRV'XUDQWHORVVHJPHQWRV5(&29(5 5HFXSHUDFLyQ SHUPtWDVHGLVPLQXLUOD
LQWHQVLGDG\SUHSDUDUVHSDUDHOSUy[LPRVHJPHQWR635,17 &DUUHUDDWRGDYHORFLGDG (VWRVFDPELRVH[WUHPRVGHLQWHQVLGDGDGHPiVGHOOHYDU
VXFXHUSRDODJRWDPLHQWREULQGDQORVPD\RUHVEHQH¿FLRVGHOHQWUHQDPLHQWRSRULQWHUYDORV
/RVHQWUHQDPLHQWRVSRULQWHUYDORSURYHHQYDULHGDGPD[LPL]DQODTXHPDGHFDORUtDV\PHMRUDQHODFRQGLFLRQDPLHQWRItVLFR
/DPiTXLQDGHHMHUFLFLRVFDUGLRYDVFXODUHV%RZÀH[0D[7UDLQHUŠ está diseñada para amortiguar sus articulaciones y músculos, y los entrenamientos
SRULQWHUYDORV\GHHVWDGRFRQVWDQWHGHEHQVHQWLUVHPXFKRPiVFyPRGRVTXHFDPLQDURFRUUHUDODLUHOLEUHVREUHXQDVXSHU¿FLHGXUDRHQXQDFLQWD
para correr.
Índice posterior a la quema
$O¿QDOGHXQHQWUHQDPLHQWRSRULQWHUYDORVLQWHQVRVXFXHUSRQHFHVLWDUiHQHUJtDDGLFLRQDOSDUDUHSRQHUODVUHVHUYDVGHVXRUJDQLVPR(VWDFDQWLGDGGHHQHUJtDDGLFLRQDOTXHVXRUJDQLVPRXWLOL]DUiHVHOtQGLFHSRVWHULRUDODTXHPDRH[FHVRGHFRQVXPRGHR[tJHQRSRVHMHUFLFLR (32&SRU
VXVVLJODVHQLQJOpV (OQLYHOGHHVWDQHFHVLGDGHQHUJpWLFDDGLFLRQDOGHVXFXHUSRVHUHODFLRQDGLUHFWDPHQWHFRQPXFKRVIDFWRUHV$OJXQRVIDFWRUHV
VRQVXQLYHOGHFRQGLFLyQItVLFDHOQLYHOGHLQWHQVLGDGGHOHQWUHQDPLHQWRSRULQWHUYDORVODGXUDFLyQGHODFDUHQFLDGHR[tJHQRGXUDQWHHOHQWUHQDPLHQWR\ODVH[LJHQFLDVItVLFDVGXUDQWHODIDVHGHUHFXSHUDFLyQ
En resumen, su organismo quemará más calorías durante horas después de su entrenamiento. En consecuencia, después de un entrenamiento por
intervalos MAX intenso, quizá sienta los efectos correspondientes durante horas posteriores.
32
Manual de ensamblaje/del usuario
Registro de entrenamiento
Use este registro para hacer un seguimiento de sus entrenamientos y su progreso. Dicho seguimiento de sus entrenamientos le ayuda a mantenerse motivado y a
lograr sus metas.
Fecha
Calorías
ËQGLFHGHTXHPD
SURPHGLR
Tiempo
530 SURPHGLR
Frecuencia carGtDFD SURPHGLR
1LYHO SURPHGLR
Enfriamiento *
Cuando termine de usar la máquina de ejercicio cardiovascular, contemple realizar estos estiramientos de relajación que le ayudarán a su cuerpo a
UHFXSHUDUVHGHOHQWUHQDPLHQWR\ORJUDUPD\RUÀH[LELOLGDG
/HYDQWDPLHQWRGHSLHUQDWHQGLGR
Tiéndase en el piso mirando hacia arriba con las piernas
OLJHUDPHQWHÀH[LRQDGDV/HYDQWHXQDSLHUQDKDFLDHOFLHOR
PDQWHQLHQGRODURGLOODUHFWD$SR\HODVPDQRV RXQDFLQWD alrededor del muslo y acerque la pierna a la cabeza. Mantenga el estiramiento durante 10 a 30 segundos. Repita el
estiramiento en la otra pierna. Mantenga la cabeza en el piso
y no arquee la columna.
33
Manual de ensamblaje/del usuario
)OH[LyQGHURGLOODWHQGLGRGHFRVWDGR
Tiéndase en el piso sobre un costado del cuerpo y apoye la
FDEH]DVREUHHOEUD]RLQIHULRU)OH[LRQHODURGLOODVXSHULRU\
VRVWHQJDHOWRELOORFRQODPDQRGHOPLVPRODGROXHJRWLUH
del talón hacia los glúteos. Mantenga el estiramiento durante
10 a 30 segundos. Tiéndase sobre el otro costado y repita
el estiramiento con la otra pierna. Recuerde mantener las
rodillas muy cercanas.
)LJXUDFXDWURWHQGLGR
Tiéndase en el piso mirando hacia arriba con las piernas
ÀH[LRQDGDV$SR\HXQSLHFUX]DGRVREUHHOPXVORGHOD
pierna opuesta en la posición que forma un cuatro. Alcance la
pierna en el piso y tírela hacia el pecho. Mantenga el estiramiento durante 10 a 30 segundos. Repita el estiramiento con
la otra pierna. Mantenga la cabeza en el piso.
*LURVHQWDGR
6LpQWHVHHQHOSLVR\H[WLHQGDODVSLHUQDVUHFWDVIUHQWHDO
FXHUSRFRQODVURGLOODVOLJHUDPHQWHÀH[LRQDGDV$SR\HXQD
mano en el piso detrás del cuerpo y la otra mano cruzada
sobre el muslo. Gire la parte superior del cuerpo hasta donde
le resulte cómodo hacia un lado. Mantenga el estiramiento
durante 10 a 30 segundos. Repita el estiramiento en el otro
lado.
)LJXUDFXDWURVHQWDGR
6LpQWHVHHQHOSLVR\H[WLHQGDXQDSLHUQDUHFWDIUHQWHDO
cuerpo. Apoye el pie de la otra pierna cruzado sobre el muslo
en la posición que forma un cuatro. Mueva el pecho hacia
las piernas, girando en la cadera. Mantenga el estiramiento
durante 10 a 30 segundos. Repita en la otra pierna. Use los
brazos para sostener la espalda.
'HVFHQVRGLQiPLFRGHWDOyQ
Apoye la parte delantera de un pie sobre el borde de un
peldaño o una escalera. Apoye el otro pie ligeramente en
frente. Apóyese en una pared para mantener el equilibrio,
si es necesario. Baje el talón del pie de atrás hasta donde
le resulte cómodo, manteniendo la rodilla recta. Termine el
estiramiento levantando el talón hasta la altura que le resulte
cómoda. Cada repetición de la secuencia debe tomar de 1 a
VHJXQGRV5HStWDORFRPRXQDVHFXHQFLDÀXLGDFRQWURODGD
y continua de 10 a 20 veces. Repita el estiramiento con la
otra pierna.
*)XHQWH-D\%ODKQLN¶V)XOO%RG\)OH[LELOLW\VHJXQGDHGLFLyQ+XPDQ.LQHWLFVFRP
34
Manual de ensamblaje/del usuario
Operaciones
¿Con qué frecuencia debe hacer ejercicios?
&RQVXOWHDVXPpGLFRDQWHVGHFRPHQ]DUXQSURJUDPDGHHMHUFLFLRV'HMHGHHMHUFLWDUVHVLVLHQWHGRORURWHQVLyQHQHOSHFKRVL
WLHQHGLÀFXOWDGSDUDUHVSLUDURVLVLHQWHTXHYDDGHVPD\DUVH&RPXQtTXHVHFRQVXPpGLFRDQWHVGHYROYHUDXVDUODPiTXLQD8VH
ORVYDORUHVFDOFXODGRVRPHGLGRVSRUODFRPSXWDGRUDGHODPiTXLQDVRORFRPRUHIHUHQFLD/DIUHFXHQFLDFDUGtDFDTXHVHPXHVWUD
HQODFRQVRODHVXQDDSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWHFRPRUHIHUHQFLD
• 7UHVYHFHVSRUVHPDQDGXUDQWHPLQXWRVGLDULRVDSUR[LPDGDPHQWH
• Programe sus sesiones de entrenamiento con antelación y procure respetar el programa.
1RWDVLHOHMHUFLFLRHVDOJRQXHYRSDUDXVWHG RVLHVWiUHWRPDQGRXQSURJUDPDUHJXODUGHHMHUFLFLRV \QROHDFRPRGDFRPSOHWDUPLQXWRV
de ejercicio continuo de una vez, simplemente ejercítese de 5 a 10 minutos y aumente gradualmente el tiempo de su entrenamiento
hasta que pueda alcanzar el total de 14 minutos.
Intensidad del entrenamiento
Para aumentar la intensidad del entrenamiento:
• $XPHQWHODH[LJHQFLDSDUDDXPHQWDUODFDQWLGDGGHUHYROXFLRQHVGHORVSHGDOHVSRUPLQXWR
• Coloque sus pies más cerca de la parte posterior de los pedales
• Aumente el nivel de intensidad y mantenga la constancia de sus RPM, o también auméntelas
• Utilice la partes alta y baja de su cuerpo a niveles diferentes
• Cambie el lugar de asimiento de los manubrios para ejercitar otras zonas de la parte alta de su cuerpo
Colocación de las manos (elección del asimiento)
Esta máquina de ejercicios tiene múltiples manubrios que permiten una serie de entrenamientos distintos. A medida que avance en su rutina de
condición física, cambie la colocación de sus manos para dirigirse a grupos musculares diferentes.
3DUDKDFHUHMHUFLFLRHQHVWDPiTXLQDVHQHFHVLWDQEXHQDFRRUGLQDFLyQ\HTXLOLEULR$VHJ~UHVHGHSUHYHUTXHSXHGHQRFXUULU
FDPELRVHQODYHORFLGDG\HOQLYHOGHUHVLVWHQFLDGXUDQWHORVHQWUHQDPLHQWRV\SUHVWHDWHQFLyQSDUDHYLWDUODSpUGLGDGHHTXLOLEULR\
SRVLEOHVOHVLRQHV
Los manubrios dinámicos permiten distintos entrenamientos de la parte alta del cuerpo. Al empezar, coloque sus manos donde sienta más comodidad y estabilidad sobre los manubrios dinámicos.
Los manubrios estáticos debajo del ensamblaje de la consola también pueden utilizarse para agregar estabilidad durante un entrenamiento, como
así también proporcionan la frecuencia cardíaca.
Para un entrenamiento focalizado en las piernas, inclínese hasta que los antebrazos queden apoyados sobre las barras deslizantes con las manos
hacia arriba. Al inclinarse, tenga en cuenta el movimiento de los manubrios dinámicos durante el entrenamiento.
Cómo subir y bajar de la máquina
6HGHEHWHQHUSUHFDXFLyQDOVXELU\EDMDUGHODPiTXLQD
7HQJDHQFXHQWDTXHORVSHGDOHV\ORVPDQXEULRVHVWiQFRQHFWDGRV\TXHFXDQGRFXDOTXLHUDGHHVWDVSLH]DVVHPXHYHODRWUDOR
KDFHWDPELpQ3DUDHYLWDUSRVLEOHVOHVLRQHVJUDYHVWRPHORVPDQXEULRVHVWiWLFRVSDUDHVWDELOL]DUVH
$VHJ~UHVHGHTXHQRKD\DQDGDGHEDMRGHORVSHGDOHVRHQHOYHQWLODGRUGHUHVLVWHQFLDGHDLUHDQWHVGHPRYHUDOJRGHODPiTXLQD
Para subir a su máquina de entrenamiento:
1. Mueva los pedales hasta que el más cercano a usted esté en la posición más baja.
2.
Tome los manubrios estáticos debajo del ensamblaje de la consola.
3.
Mientras se estabiliza con los manubrios estáticos, suba al pedal más bajo y coloque el otro pie en el pedal opuesto.
35
Manual de ensamblaje/del usuario
1RWDHOGHVFHQVRPi[LPRRFXUUHFXDQGRHOXVXDULRQRSXHGHFRPHQ]DUXQHQWUHQDPLHQWRGHELGRDTXHORVSHGDOHVQRVHPXHYHQ(QHVH
caso, sujete con cuidado los manubrios estáticos y aplique su peso sobre el talón del pie más elevado. Mientras aún sujeta el manubrio
estático, inclínese ligeramente hacia atrás aplicando más peso sobre el talón. Cuando los pedales comiencen a moverse, reanude el
entrenamiento deseado.
Para bajar de la máquina de entrenamiento:
1. Mueva el pedal del que desea bajarse a la posición más alta y detenga la máquina completamente.
(VWDPiTXLQDQRFXHQWDFRQXQDUXHGDOLEUH/DYHORFLGDGGHORVSHGDOHVVHGHEHUHGXFLUGHPDQHUDFRQWURODGD
2.
Tome los manubrios estáticos debajo de la consola para estabilizarse.
3.
Con su peso sobre el pie que se encuentra más abajo, mueva el pie que está más arriba de la máquina y bájelo al piso.
4.
Bájese de la máquina y suelte los manubrios estáticos.
Inicio
1.
Instale la máquina de ejercicios en su área de entrenamiento.
8ELTXHODPiTXLQDVREUHXQDVXSHUÀFLHOLPSLDUHVLVWHQWHQLYHODGD\TXHHVWpOLEUHGHPDWHULDOHVQRGHVHDGRVXRWURVREMHWRVTXH
SXHGDQHVWRUEDUVXFDSDFLGDGSDUDPRYHUVHOLEUHPHQWH6HSXHGHXVDUXQDHVWHUDGHJRPDEDMRODPiTXLQDSDUDHYLWDUODOLEHUDFLyQGHHOHFWULFLGDGHVWiWLFD\SURWHJHUHOSLVR
/DPiTXLQDSXHGHVHUWUDVODGDGDSRUXQDRPiVSHUVRQDV$VHJ~UHVHGHWHQHUODIXHU]DItVLFDVX¿FLHQWHSDUDPRYHUODPiTXLQDHQIRUPDVHJXUD
2.
Asegúrese de que no haya ningún objeto debajo de los pedales ni en el ventilador de resistencia de aire. Asegúrese de que estén despejados.
3.
Conecte el cable de alimentación a la máquina y a un tomacorriente de pared de CA conectado a tierra.
4.
Si utiliza el monitor de frecuencia cardíaca, siga las instrucciones de la banda de pecho.
5.
Para subirse a la máquina, mueva los pedales hasta que el más cercano a usted esté en la posición más baja.
6HGHEHWHQHUSUHFDXFLyQDOVXELU\EDMDUGHODPiTXLQD
7HQJDHQFXHQWDTXHORVSHGDOHV\ORVPDQXEULRVHVWiQFRQHFWDGRV\TXHFXDQGRFXDOTXLHUDGHHVWDVSLH]DVVHPXHYHODRWUDOR
KDFHWDPELpQ3DUDHYLWDUSRVLEOHVOHVLRQHVJUDYHVWRPHORVPDQXEULRVHVWiWLFRVSDUDHVWDELOL]DUVH
7RPHORVPDQXEULRVHVWiWLFRVGHEDMRGHOHQVDPEODMHGHOERWyQGHODFRQVROD
7.
Mientras se estabiliza con los manubrios estáticos, suba al pedal más bajo y coloque el otro pie en el pedal opuesto.
1RWDHOGHVFHQVRPi[LPRRFXUUHFXDQGRHOXVXDULRQRSXHGHFRPHQ]DUXQHQWUHQDPLHQWR
debido a que los pedales no se mueven. En ese caso, sujete con cuidado los manubrios estáticos y aplique su peso sobre el talón del pie más elevado. Mientras aún sujeta el manubrio estático, inclínese ligeramente hacia atrás aplicando más peso sobre el
talón. Cuando los pedales comiencen a moverse, reanude el entrenamiento deseado.
3UHVLRQHHOERWyQ86(5 8VXDULR SDUDHOHJLUHOSHU¿OGHXVXDULRGHVHDGR
0DQWHQJDSUHVLRQDGRHOERWyQ86(5 8VXDULR SDUDHGLWDUHOSHU¿OGHOXVXDULR
10. La pantalla de la consola mostrará el valor de unidades. Use los botones para aumentar/disminuir para ajustar el valor de unidades y presione ENTER/START para establecer el valor.
/ DFRQVRODPRVWUDUiHOYDORUGHSHVRGHOSHU¿OGHOXVXDULR8VHORVERWRQHVSDUDDXPHQWDU
disminuir para ajustar el valor de peso y presione ENTER/START para establecer el valor.
1RWDDVHJ~UHVHGHSURJUDPDUVXSHU¿OGHXVXDULR YHDODVHFFLyQ(GLWDUXQSHU¿OGHXVXDULR DQWHVGHFRPHQ]DUHOHQWUHQDPLHQWR/RVtQGLFHVREMHWLYRGHTXHPDVXJHULGRVVH
EDVDQHQVXVDMXVWHVGHSHU¿OGHXVXDULR
3
UHVLRQHHOERWyQ0D[0LQXWH,QWHUYDO ,QWHUYDORPi[LPRGHPLQXWRV SDUDFRPHQ]DU
un entrenamiento de inicio rápido. Deje pasar un tiempo para familiarizarse con el funcionaPLHQWRGHODPiTXLQD%RZÀH[0D[7UDLQHUŠ y la forma en que responde a los ajustes del nivel
de resistencia y el índice de quema.
36
Manual de ensamblaje/del usuario
1RWDDOKDFHUIXQFLRQDUODPiTXLQD%RZÀH[0D[7UDLQHUŠ, asegúrese de que las patas se estén moviendo en el sentido mostrado en la cubierta de la biela.
Modo de encendido/reposo (pantalla GET READY [Preparación])
La consola ingresará al modo Power-Up,GOH (QFHQGLGR5HSRVR VLVHHQFKXIDDXQWRPDFRUULHQWHVHSUHVLRQDXQRGHVXVERWRQHVRUHFLEHXQD
indicación del sensor de RPM como resultado de pedalear la máquina.
Apagado automático (modo de inactividad)
6LODFRQVRODQRUHFLEHQLQJ~QGDWRGXUDQWHDSUR[LPDGDPHQWHPLQXWRVHVWDVHDSDJDUiDXWRPiWLFDPHQWH/DSDQWDOOD/&'SHUPDQHFHDSDJDGD
mientras está en el modo de inactividad.
1RWD la consola no tiene un interruptor de encendido/apagado.
'HĆQLUODIHFKD\ODKRUD PRGRGHFRQĆJXUDFLµQ)HFKD+RUD
3DUDOOHYDUXQUHJLVWURGHORVHQWUHQDPLHQWRVODIHFKD\ODKRUDGHEHQHVWDUGH¿QLGDVHQODPiTXLQD
&
RQODPiTXLQDHQHOPRGR(QFHQGLGR SDQWDOOD*(75($'<>3UHSDUDFLyQ SUHVLRQH\PDQWHQJDORVERWRQHV3$86(6723 3DXVD)LQ \
$GG7LPH $JUHJDUWLHPSR GXUDQWHVHJXQGRV\YD\DDOPRGRGHFRQ¿JXUDFLyQGHIHFKDKRUD
1RWD3UHVLRQH3$86(6723 3DXVD$OWR SDUDVDOLUGHOPRGRGHFRQ¿JXUDFLyQGHIHFKDKRUD\YROYHUDODSDQWDOODGHOPRGRGHHQFHQGLGR
/DSDQWDOODGHODFRQVRODPXHVWUD6(7'$7( (VWDEOHFHUIHFKD \ORVYDORUHVDFWXDOHV PHVGtDDxR 8
VHORVERWRQHVSDUDDXPHQWDUGLVPLQXLUHOtQGLFHGHTXHPDSDUDDMXVWDUHOYDORU\SUHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDPRYerse al valor siguiente.
'
HVSXpVGHHVWDEOHFHUHOYDORUGHODxRODSDQWDOODGHODFRQVRODPXHVWUD6(77,0( (VWDEOHFHUKRUD \ORVYDORUHVDFWXDOHV KRUDPLQXWR
$0R30 8
VHORVERWRQHVSDUDDXPHQWDUGLVPLQXLUHOtQGLFHGHTXHPDSDUDDMXVWDUHOYDORU\SUHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDPRYerse al valor siguiente.
'HVSXpVGHHVWDEOHFHUHOYDORU$0R30ODFRQVRODDFHSWDUiORVYDORUHV\VDOGUiGHOPRGRGHFRQ¿JXUDFLyQGHIHFKDKRUD/DFRQVRODPRVWUDUiOD
SDQWDOODGHOPRGRGHHQFHQGLGR SDQWDOOD*(75($'<>3UHSDUDFLyQ@ 'HVSXpVGHHVWDEOHFHUHOYDORU$0R30ODFRQVRODDFHSWDUiORVYDORUHV\
VDOGUiGHOPRGRGHFRQ¿JXUDFLyQGHIHFKDKRUD/DFRQVRODPRVWUDUiODSDQWDOODGHOPRGRGHHQFHQGLGR SDQWDOOD*(75($'<>3UHSDUDFLyQ@ Si vive en un lugar donde se ajustan los relojes, por ejemplo, para ahorrar energía durante el día, necesitará ajustar la hora en la máquina cuando
ocurran estos sucesos para un seguimiento adecuado del entrenamiento.
Modo de calentamiento
En la pantalla de encendido se encuentra disponible un modo de calentamiento. Para comenzar, simplemente empiece a usar la máquina hasta que
HVWpOLVWDSDUDXQHQWUHQDPLHQWR'XUDQWHXQFDOHQWDPLHQWRVHSXHGHHGLWDUHOSHU¿OGHOXVXDULR\VHOHFFLRQDUXQHQWUHQDPLHQWR/DFRQVRODSHGLUi
DOXVXDULRTXHVHOHFFLRQHXQSURJUDPDOXHJRGHPLQXWRV(VWDHVVRORXQDQRWL¿FDFLyQ(OFDOHQWDPLHQWRGHEHFRQWLQXDUKDVWDTXHHOXVXDULRHVWp
listo para el entrenamiento.
1RWD ORVYDORUHVGHHQWUHQDPLHQWRGHOSHUtRGRGHFDOHQWDPLHQWRQRVHDJUHJDQDOHQWUHQDPLHQWRQLVHJXDUGDQSDUDH[SRUWDFLyQDODDSOLFDción.
Programa MAX 14 MINUTE INTERVAL (INTERVALO MÁXIMO DE 14
MINUTOS)
El Programa de Entrenamiento por Intervalos MAX es un entrenamiento que alterna entre ráfagas
LQWHQVDVGHSURGXFFLyQHQHUJpWLFD 635,17>&DUUHUDDWRGDYHORFLGDG@ \XQSHUtRGRGHWLHPSRGH
PHQRUULWPRSDUDUHFXSHUDUHODOLHQWR 5(&29(5>5HFXSHUDFLyQ@ ORVFXDOHVVHUHSLWHQHQRFKR
FLFORV/DSDQWDOODGHOSHU¿OGHHQWUHQDPLHQWRPXHVWUDHOtQGLFHREMHWLYRGHTXHPDSDUDHOSURJUDPD
GHLQWHUYDORPi[LPRGHPLQXWRV
37
Manual de ensamblaje/del usuario
1.
Párese en la máquina.
3UHVLRQHHOERWyQ86(5 8VXDULR SDUDHOHJLUHOSHU¿OGHXVXDULR
1RWD GXUDQWHHOHQWUHQDPLHQWRODFRQVRODPRVWUDUiHOUDQJR/('REMHWLYRVHJ~QORVDMXVWHVGHOSHU¿OGHXVXDULRHOHJLGRV.
3UHVLRQHHOERWyQ0$;0LQXWH,QWHUYDO ,QWHUYDOR0$;GHPLQXWRV 1RWDODSDQWDOODGHOSHU¿OGHHQWUHQDPLHQWRDMXVWDUiHOSHU¿OGHOtQGLFHGHTXHPDDODVFRQ¿JXUDFLRQHVGHOXVXDULR
4.
El entrenamiento comenzará con una cuenta regresiva sonora a medida que la aguja de la pantalla del índice de quema recorra la pantalla y
se detenga en el índice de quema actual. Los LED del índice objetivo de quema también se activarán y subirán al índice de quema recomendado.
(OSULPHUVHJPHQWRGHHQWUHQDPLHQWRHVXQVHJPHQWR635,17 &DUUHUDDWRGDYHORFLGDG TXHGXUDPHQRVWLHPSR(VIXpUFHVHGHPDQHUD
VHJXUDSDUDTXHODSDQWDOODGHOtQGLFHGHTXHPDOOHJXHDOtQGLFHREMHWLYRGHTXHPD /('GHFRORUURMR \PDQWpQJDORHQHOUDQJRKDVWDTXHHO
tiempo llegue a 00:00.
1RWD(OUDQJRGHOtQGLFHREMHWLYRGHTXHPD /(' VHRIUHFHVRORXQDVXJHUHQFLDGHREMHWLYR(OUDQJRGH/('RIUHFHXQREMHWLYRPHQRU\
permite a un usuario avanzar a los LED más altos del rango a medida que aumenta su nivel de condición física. Para cambiar el rango
GHOtQGLFHREMHWLYRGHTXHPD /(' SUHVLRQHHOERWyQGHOtQGLFHGHTXHPDFRUUHVSRQGLHQWHKDVWDTXHHOUDQJRREMHWLYRHVWpFHUFDGHO
valor deseado.
GXUDQWHORV~OWLPRVVHJXQGRVGHOHQWUHQDPLHQWR635,17 &DUUHUDDWRGDYHORFLGDG ODFRQVRODFRPHQ]DUiXQDFXHQWDUHJUHVLYDVRQRUD
$
PHGLGDTXHHOWLHPSROOHJXHDODFRQVRODHPLWLUiODWHUFHUDFRQ¿UPDFLyQVRQRUDHLQLFLDUiHOVLJXLHQWHVHJPHQWRGHOHQWUHQDPLHQWR
XQVHJPHQWR5(&29(5 5HFXSHUDFLyQ OUDQJR/('REMHWLYRFDPELDUiGHURMRDYHUGH\UHFRUUHUiXQtQGLFHGHTXHPDUHGXFLGR'XUDQWHHOVHJPHQWR5(&29(5 5HFXSHUDFLyQ (
continúe el entrenamiento, pero a una intensidad menor.
GXUDQWHORV~OWLPRVVHJXQGRVGHOHQWUHQDPLHQWR5(&29(5 5HFXSHUDFLyQ ODFRQVRODFRPHQ]DUiXQDFXHQWDUHJUHVLYDVRQRUD
$
PHGLGDTXHHOWLHPSROOHJXHDODFRQVRODHPLWLUiXQDFRQ¿UPDFLyQVRQRUD\FDPELDUiDOVLJXLHQWHVHJPHQWR635,17 &DUUHUDD
WRGDYHORFLGDG $VtFXOPLQDHOSULPHULQWHUYDOR
OFDPELRGHORVVHJPHQWRVGH635,17 &DUUHUDDWRGDYHORFLGDG D5(&29(5 5HFXSHUDFLyQ VHUHSHWLUiSRUXQWRWDOGHFLFORVGXUDQWH
(
el entrenamiento.
&
XDQGRKD\DFRQFOXLGRHO~OWLPRVHJPHQWR5(&29(5 5HFXSHUDFLyQ ODFRQVRODPRVWUDUiODOH\HQGD:25.287&203/(7( (QWUHQDPLHQWRFRPSOHWR HQVHJXLGDPRVWUDUiORVUHVXOWDGRVGHOHQWUHQDPLHQWR/DFRQVRODPRVWUDUiHOWLHPSRWRWDOGHFDGDVHJPHQWR635,17
&DUUHUDDWRGDYHORFLGDG MXQWRFRQ727$/7,0( 7LHPSRWRWDO 6LQRVHLQJUHVDQGDWRVGXUDQWHPLQXWRVODFRQVRODHQWUDUiDXWRPiWLFDmente al modo de inactividad.
1RWDVLXQHQWUHQDPLHQWRSRULQWHUYDORVVHLQWHUUXPSHDQWHVGHTXHVHKD\DQWHUPLQDGRWRGRVORVVHJPHQWRVODFRQVRODVRORPRVWUDUiHO
~OWLPRVHJPHQWRWHUPLQDGRHQHOSHU¿OGHOSURJUDPD
(GLWDUXQSHUĆOGHXVXDULR
3DUDXQDPD\RUSUHFLVLyQGHODFXHQWDGHFDORUtDV\ODTXHPDGHFDORUtDVREMHWLYRGHEHSHUVRQDOL]DUVHHOSHU¿OGHXVXDULR
3UHVLRQHHOERWyQ86(5 8VXDULR SDUDHOHJLUVXSHU¿OGHXVXDULR 8VXDULR 0DQWHQJDSUHVLRQDGRHOERWyQ86(5 8VXDULR GXUDQWHVHJXQGRVSDUDFRPHQ]DUHOPRGR(GLWDUXVXDULR
/ DFRQVRODPRVWUDUiHOLQGLFDGRU',63/$<81,76 0RVWUDUXQLGDGHV FRQHOYDORUGHXQLGDGHVSUHGHWHUPLQDGR /%6>OE@ 8VHORVERWRQHV
para aumentar o disminuir el índice de quema o el nivel resistencia para ajustar el valor y presione ENTER/START para establecer el valor.
/ DFRQVRODPRVWUDUiHOLQGLFDGRU:(,*+7 3HVR FRQHOYDORUGHSHVRSUHGHWHUPLQDGR /%6.* 8VHORVERWRQHVSDUDDXPHQWDUR
disminuir el índice de quema o el nivel resistencia para ajustar el valor y presione ENTER/START para establecer el valor.
/tPLWHPi[LPRGHSHVRGHOXVXDULROE NJ 1RODXVHVLH[FHGHHVWHSHVR
/ DFRQVRODPRVWUDUiHOLQGLFDGRU(5$6(:25.2876 %RUUDUHQWUHQDPLHQWRV FRQHOYDORUSUHGHWHUPLQDGR 12 'HVHUQHFHVDULRSUHVLRQH
ORVERWRQHVSDUDDXPHQWDURGLVPLQXLUHOtQGLFHREMHWLYRGHTXHPDRHOQLYHOUHVLVWHQFLDSDUDDMXVWDUHOYDORU3UHVLRQH(17(567$57 ,QWUR
,QLFLR SDUDDFHSWDUHOYDORU
/DUHYLVLyQGHOSHU¿OGHXVXDULRHVWiFRPSOHWD\ODFRQVRODPRVWUDUiODSDQWDOOD*(75($'< 3UHSDUDFLyQ 38
Manual de ensamblaje/del usuario
3DUDVDOLUGHOPRGRGHHGLFLyQGHXVXDULRSUHVLRQHHOERWyQ3$86(6723 3DXVD$OWR /RVYDORUHVDFWXDOHVVHJXDUGDQHQHOSHU¿OGHXVXDULR
Programas de entrenamiento
/RVSURJUDPDVGHHQWUHQDPLHQWRVHRUJDQL]DQHQGRVHVWLORVGLIHUHQWHVGHHQWUHQDPLHQWRV(QWUHQDPLHQWRV7DUJHW&RDFKLQJ 5HFRPHQGDFLyQGH
REMHWLYR \%HQH¿W0RGH 0RGRGHEHQH¿FLR ENTRENAMIENTOS DE RECOMENDACIÓN DE OBJETIVO
Los entrenamientos de recomendación de objetivo sugieren un índice objetivo de quema para el usuario mediante los LED de índice objetivo de
TXHPD(VWHtQGLFHREMHWLYRVHEDVDHQHOSHU¿OGHOSURJUDPDGHHQWUHQDPLHQWR&XDQWRPiVDOWDVHDODFROXPQDPiVLQWHQVRVHUiHOVHJPHQWRGHO
índice objetivo de quema. La columna intermitente muestra el segmento actualmente activo.
Luego de que un mismo usuario concluye dos entrenamientos por intervalos, la consola ajustará los valores de recomendación de objetivo según el
rendimiento durante los intervalos de carrera a toda velocidad. La consola utilizará esta valor "inteligente" como base de acondicionamiento físico
para entrenamientos por intervalos futuros.
Intervalo máximo
/RVSURJUDPDVGHLQWHUYDORPi[LPRVRQHQWUHQDPLHQWRVTXHDOWHUQDQHQWUHUiIDJDVLQWHQVDVGHSURGXFFLyQHQHUJpWLFD 635,17>&DUUHUDDWRGD
YHORFLGDG@ \XQSHUtRGRGHWLHPSRGHPHQRUULWPRSDUDUHFXSHUDUHODOLHQWR 5(&29(5>5HFXSHUDFLyQ@ ORVFXDOHVVHUHSLWHQDWUDYpVGHORV
LQWHUYDORV/DSDQWDOODGHOSHU¿OGHHQWUHQDPLHQWRPXHVWUDHOtQGLFHREMHWLYRGHTXHPDSDUDHOSURJUDPDGHLQWHUYDOR3DUDPiVGHWDOOHVFRQVXOWHOD
sección "Programa MAX 14 MINUTE INTERVAL" del manual.
Intervalo máximo 7 minutos LQWHUYDORV
Intervalo máximo 14 minutos LQWHUYDORV
Intervalo máximo 21 minutos LQWHUYDORV
Intervalo de intensidad LQWHUYDORV
(OSURJUDPDGHLQWHUYDORGHLQWHQVLGDGHVEiVLFDPHQWHHOSURJUDPDGHLQWHUYDORPi[LPRGHPLQXtos pero la consola ajusta automáticamente el nivel de resistencia. Si RPM se mantiene constante con
el nivel de resistencia ajustado, el usuario alcanzará el índice objetivo de quema.
La consola intenta sugerir al usuario, con los ajustes en el nivel de resistencia, el rango del índice
objetivo de quema . Si el usuario está por encima del índice objetivo de quema, la consola disminuirá
el nivel de resistencia. Si el usuario está por abajo del índice objetivo de quema, la consola aumentará el nivel de resistencia.
1RWD durante un entrenamiento por intervalos de intensidad, el índice objetivo de quema puede ajustarse, pero no el nivel de resistencia.
Meta de calorías LQWHUYDOR
El entrenamiento de la meta de calorías se basa en las calorías quemadas durante un entrenamienWR/DFRQVRODDVLJQDXQYDORUGHFDORUtDVDFDGDXQRGHORVVHJPHQWRVVHJ~QHOtQGLFHGHTXHPD
GHOSHU¿OGHHQWUHQDPLHQWR&XDQGRHOXVXDULRTXHPDHOYDORUGHFDORUtDVGHOVHJPHQWRDFWLYRHO
entrenamiento cambia al segmento siguiente.
39
Manual de ensamblaje/del usuario
1RWD si el índice de quema se cambia durante un entrenamiento, quizá se ajuste el tiempo de cada segmento restante en vista del nuevo
QLYHOGHOtQGLFHREMHWLYRGHTXHPD(OERWyQ$GG7LPH $JUHJDUWLHPSR VHGHVKDELOLWDGXUDQWHXQHQWUHQDPLHQWRGHPHWDGHFDORUtDV
Ritmo constante LQWHUYDORV
El entrenamiento de ritmo constante emplea un índice objetivo de quema constante durante todo el
entrenamiento. Durante un entrenamiento de ritmo constante, el tiempo total del entrenamiento se
cuenta en forma descendente.
ENTRENAMIENTOS DE MODO DE BENEFICIO
/RVHQWUHQDPLHQWRVGHPRGRGHEHQH¿FLRPXHVWUDQHOSHU¿OGHSURJUHVRGHOSURJUDPDHQQLYHOHVGHUHVLVWHQFLD&DGDFROXPQDGHOSHU¿OPXHVWUD
XQVHJPHQWRGHHQWUHQDPLHQWR&XDQWRPiVDOWDVHDODFROXPQDPD\RUVHUiHOQLYHOGHUHVLVWHQFLD'XUDQWHXQHQWUHQDPLHQWRGHPRGRGHEHQH¿FLRODSDQWDOOD%HQH¿W=RQH =RQDGHEHQH¿FLR VXJLHUHXQtQGLFHREMHWLYRGHTXHPDSDUDRSWLPL]DUHOSURJUDPD
/DFROXPQDLQWHUPLWHQWHPXHVWUDHOVHJPHQWRDFWXDOPHQWHDFWLYR/DFRQVRODDMXVWDUiHOQLYHOGHUHVLVWHQFLDSDUDVHJXLUODSDQWDOODGHOSHU¿OGH
entrenamiento.
1RWDVLHOQLYHOGHUHVLVWHQFLDVHDMXVWDGXUDQWHXQHQWUHQDPLHQWRHOSHU¿OGHOSURJUDPDGHHQWUHQDPLHQWRWDPELpQFDPELDUi'XUDQWHXQ
HQWUHQDPLHQWRGHPRGRGHEHQH¿FLRHOQLYHOGHUHVLVWHQFLDSXHGHDMXVWDUVHSHURQRHOtQGLFHREMHWLYRGHTXHPD
Quema de calorías LQWHUYDORV
Quema de grasas LQWHUYDORV
XWLOLFHOD]RQDGHEHQH¿FLR)DW%XUQ>4XHPDGHJUDVD@ XWLOLFHOD]RQDGHEHQH¿FLR)DW%XUQ>4XHPDGHJUDVD@
Escaleras LQWHUYDORV
XWLOLFHOD]RQDGHEHQH¿FLR3HUIRUPDQFH>5HQGLPLHQWR@
Manual XWLOLFHOD]RQDGHEHQH¿FLR(QGXUDQFH>5HVLVWHQFLD@
El programa de entrenamiento manual es un entrenamiento abierto que cuenta el tiempo de entreQDPLHQWRWRWDO'XUDQWHXQHQWUHQDPLHQWR0DQXDOODSDQWDOODGHOSHU¿OGHHQWUHQDPLHQWRPXHVWUDHO
nivel de resistencia.
1RWDGDGRHOGLVHxRDELHUWRGHOHQWUHQDPLHQWRPDQXDOHOERWyQ$GG7LPH $JUHJDUWLHPSR HVWiGHVKDELOLWDGR
Prueba de estado físico
La prueba de estado físico mide las mejorías del nivel de su estado físico. La prueba compara su
producción de energía con su frecuencia cardíaca. A medida que mejore su nivel de estado físico, su
producción de energía aumentará a una determinada frecuencia cardíaca.
1RWDpara funcionar correctamente, la consola debe ser capaz de leer la información de
IUHFXHQFLDFDUGtDFDGHVGHORVVHQVRUHVGHIUHFXHQFLDFDUGtDFDSRUFRQWDFWR &+5 RHO
PRQLWRUGHIUHFXHQFLDFDUGtDFD +50 40
Manual de ensamblaje/del usuario
La consola pedirá al usuario su peso y edad. Use los botones para aumentar y disminuir para ajustar el valor y presione ENTER/START para
establecer los valores. Comience el entrenamiento y sostenga los sensores de frecuencia cardíaca. El entrenamiento comienza con el nivel de
resistencia bajo y aumenta con cada columna. Mantenga de manera segura un ritmo estable a medida que aumentan los niveles de resistencia.
Esto debería aumentar gradualmente su frecuencia cardíaca. El nivel de resistencia continúa aumentando automáticamente hasta que su frecuenFLDFDUGtDFDDOFDQ]DOD³]RQDGHSUXHED´(VWD]RQDVHSURFHVDGHPDQHUDLQGLYLGXDOL]DGDFRPRXQYDORUFHUFDQRDOGHODIUHFXHQFLDFDUGtDFD
Pi[LPDSDUDVXHGDG&XDQGRDOFDQ]DOD]RQDGHSUXHEDODPiTXLQDLQLFLDXQDFXHQWDUHJUHVLYDGHPLQXWRV\PDQWLHQHHVWDEOHHOQLYHOGH
UHVLVWHQFLD(VWROHSHUPLWHFRQVHJXLUXQDFRQGLFLyQHVWDEOH GRQGHVXIUHFXHQFLDFDUGtDFDVHPDQWLHQHFRQVWDQWH 1RWDdurante una prueba de estado físico, la meta que se muestra de 3 minutos comienza cuando la frecuencia cardíaca alcanza la zona de
prueba.
Tenga en cuenta el tiempo adicional antes de que comience la cuenta regresiva de los 3 minutos.
$O¿QDOGHORVPLQXWRVODFRQVRODPLGHVXIUHFXHQFLDFDUGtDFD\ODSURGXFFLyQGHHQHUJtD(VWRVQ~PHURVMXQWRFRQODLQIRUPDFLyQDFHUFDGHVX
peso y edad, se procesan para producir un "puntaje de estado físico". Compare los puntajes de su estado físico para ver su mejoría.
1RWDORVSXQWDMHVGHODSUXHEDGHHVWDGRItVLFRVRORGHEHQFRPSDUDUVHFRQVXVSXQWDMHVDQWHULRUHV\QRFRQRWURVSHU¿OHVGHXVXDULR$O
comparar los puntajes de la prueba de estado físico, un aumento en el puntaje muestra una mejora en el nivel de estado físico.
Para iniciar un programa de entrenamiento:
1.
Párese en la máquina.
3UHVLRQHHOERWyQ352*5$06 3URJUDPDV SDUDVHOHFFLRQDUHOSURJUDPDGHHQWUHQDPLHQWRGHVHDGR
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDLQLFLDUHOSURJUDPDGHHQWUHQDPLHQWRHOHJLGR
1RWDla consola pedirá el peso y la edad del usuario antes de comenzar el entrenamiento de prueba de estado físico.
Modo de pausa/resultados/enfriamiento
Para interrumpir un entrenamiento:
'
HMHGHSHGDOHDU\SUHVLRQHHOERWyQ3$86(6723 3DXVD$OWR SDUDKDFHUXQDSDXVDHQHO
entrenamiento.
$OHVWDUHQSDXVDODSDQWDOODGHODFRQVRODPRVWUDUiODOH\HQGD:25.2873$86(' (QWUHQDPLHQWRHQSDXVD 1RWDla consola se interrumpirá automáticamente si no hay ninguna señal de RPM durante 5 minutos.
3DUDFRQWLQXDUVXHQWUHQDPLHQWRSUHVLRQH(17(567$57 ,QWUR,QLFLR RFRPLHQFHDSHGDOHDU
3DUD¿QDOL]DUHOHQWUHQDPLHQWRSUHVLRQHHOERWyQ3$86(6723 SDXVDDOWR /DFRQVRODPXHVWUD³:25.287&203/(7(´ (QWUHQDPLHQWR
FRPSOHWR \VHPXHVWUDQORVYDORUHVGHUHVXOWDGRGHOHQWUHQDPLHQWR 7RWDO&DORULHV &DORUtDVWRWDOHV7RWDO7LPH 7LHPSRWRWDO $YHUDJH&DORULH%XUQ5DWH ËQGLFHGHTXHPDGHFDORUtDVSURPHGLR $YHUDJH+HDUW5DWH )UHFXHQFLDFDUGtDFDSURPHGLR $YHUDJH530 530SURPHGLR \
$YHUDJH5HVLVWDQFH/HYHO 1LYHOGHUHVLVWHQFLDSURPHGLR Si un entrenamiento se completa y el usuario continúa utilizando la máquina, automáticamente comienza el enfriamiento. La consola rastreará el
tiempo en enfriamiento y muestra los resultados del entrenamiento completado. Los valores de enfriamiento no se agregan a los resultados ni se
JXDUGDQ(OHQIULDPLHQWR¿QDOL]DFRQHOERWyQ3$86(6723 3DXVD$OWR RVLQRKD\530GXUDQWHVHJXQGRV
Si no hay entradas en la consola durante 5 minutos, entrará automáticamente al modo de encendido/reposo.
41
Manual de ensamblaje/del usuario
Personalización de la meta para el programa de meta de calorías
La meta de entrenamiento del programa de meta de calorías puede ajustarse. Una vez cambiados, los nuevos valores se convertirán en los predeterminados para los entrenamientos de meta de calorías.
1.
Súbase a la máquina.
3UHVLRQHHOERWyQ352*5$06 3URJUDPDV KDVWDTXHVHHOLMDHOSURJUDPDGHPHWDGHFDORUtDV
0DQWHQJDSUHVLRQDGRHOERWyQ352*5$06 3URJUDPDV GXUDQWHVHJXQGRV
4.
Presione los botones para aumentar o disminuir el índice objetivo de quema o el nivel resistencia para ajustar el valor mostrado.
El valor de la meta de calorías predeterminado es de 300 calorías y se ajusta en aumentos de 50 calorías. El valor mínimo para un entrenaPLHQWRHVGHFDORUtDV\HOYDORUPi[LPRHVGHFDORUtDV
3UHVLRQH(17(567$57 ,QWUR,QLFLR SDUDHVWDEOHFHUHOYDORU\FRPHQ]DUXQSURJUDPDGHPHWDGHFDORUtDV
42
Manual de ensamblaje/del usuario
Modo de configuración de la consola
(OPRGRGHFRQ¿JXUDFLyQGHODFRQVRODOHSHUPLWHYHUODVHVWDGtVWLFDVGHPDQWHQLPLHQWR +RUDVGHIXQFLRQDPLHQWRWRWDOHV\YHUVLyQGHOVRIWZDUH R
restablecer totalmente la consola.
3
DUDLQJUHVDUDOPRGRGHFRQ¿JXUDFLyQGHODFRQVRODPDQWHQJDSUHVLRQDGRVVLPXOWiQHDPHQWHORVERWRQHVGH3$86(6723 3DXVDDOWR durante 3 segundos mientras está en el modo de encendido.
1RWD3UHVLRQH3$86(6723 3DXVD$OWR SDUDVDOLUGHOPRGRGHFRQ¿JXUDFLyQGHODFRQVROD\YROYHUDODSDQWDOODGHOPRGRGHHQFHQGLGR
/DSDQWDOODGHODFRQVRODPXHVWUDODV727$/+2856 +RUDVWRWDOHV GHIXQFLRQDPLHQWRGHODPiTXLQD
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDHOVLJXLHQWHLQGLFDGRU
4.
La pantalla de la consola muestra el indicador de versión del software.
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDHOVLJXLHQWHLQGLFDGRU
/DSDQWDOODGHODFRQVRODPXHVWUDHOLQGLFDGRUGHYHUVLyQ%/(9(56,21
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDHOVLJXLHQWHLQGLFDGRU
/DFRQVRODPXHVWUDHOLQGLFDGRU',6&211(&7%/( GHVFRQHFWDU%/( 1RWD Si desea desconectar la transmisión BluetoothŠSUHVLRQHHOERWyQGHDXPHQWRRGLVPLQXFLyQ SDUDVHOHFFLRQDUODRSFLyQ³'(6&21(&7$5%/(6Ë´\SUHVLRQH(17(567$57 ,QWUR,QLFLR /DFRQVRODVDOGUiGHOPRGRGHFRQ¿JXUDFLyQGHODFRQVROD\YROYHUiDODSDQWDOOD
del modo de encendido.
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDHOVLJXLHQWHLQGLFDGRU
/DFRQVRODPXHVWUDHOLQGLFDGRU83*5$'(%/(12 DFWXDOL]DU%/(12 (VWDRSFLyQHVSDUDXVRH[FOXVLYRGHOWpFQLFRGHVHUYLFLR
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDHOVLJXLHQWHLQGLFDGRU
/ DFRQVRODPXHVWUDHOLQGLFDGRU83*5$'(6281'12 YHUPHQVDMHVGHHUURU12 (VWDRSFLyQHVSDUDXVRH[FOXVLYRGHOWpFQLFRGHVHUYLcio.
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDHOVLJXLHQWHLQGLFDGRU
/DFRQVRODPXHVWUDHOLQGLFDGRU9,(:(552506*12 DFWXDOL]DUVRQLGR12 (VWDRSFLyQHVSDUDXVRH[FOXVLYRGHOWpFQLFRGHVHUYLFLR
3UHVLRQHHOERWyQ(17(567$57 ,QWUR,QLFLR SDUDHOVLJXLHQWHLQGLFDGRU
/DFRQVRODPXHVWUDHOLQGLFDGRU&2162/(5(6(7 UHVWDEOHFHUFRQVROD 1RWD6LGHVHDUHVWDEOHFHUODFRQVRODDODFRQ¿JXUDFLyQGHIiEULFDSUHVLRQHHOERWyQGHDXPHQWRRGLVPLQXFLyQSDUDVHOHFFLRQDUODRSFLyQ
³5(6(7&2162/(<(6´ UHVWDEOHFHUFRQVRODVt \SUHVLRQH(17(567$57 ,QWUR,QLFLR /DFRQVRODVDOGUiGHOPRGRGHFRQ¿JXUDFLyQ
de la consola y volverá a la pantalla del modo de encendido.
3UHVLRQHHOERWyQ3$86(6723 3DXVD$OWR SDUDVDOLUGHOPRGRGHFRQ¿JXUDFLyQGHODFRQVROD
La consola mostrará la pantalla del modo de encendido.
43
Manual de ensamblaje/del usuario
Mantenimiento
Lea íntegramente la totalidad de las instrucciones de mantenimiento antes de comenzar cualquier trabajo de reparación. En determinadas condiciones, se requiere un asistente para realizar las tareas necesarias.
(OHTXLSRVHGHEHUHYLVDUSHUPDQHQWHPHQWHSDUDYHUVLHVWiGDxDGRRKD\TXHKDFHUOHUHSDUDFLRQHV(OSURSLHWDULRHVUHVSRQVDEOH
GHJDUDQWL]DUTXHVHUHDOLFHXQPDQWHQLPLHQWRSHULyGLFR/RVFRPSRQHQWHVJDVWDGRVRGDxDGRVGHEHQUHSDUDUVHRUHHPSOD]DUVH
LQPHGLDWDPHQWH3DUDPDQWHQHU\UHSDUDUHOHTXLSRVRORSXHGHQXVDUVHFRPSRQHQWHVSURYLVWRVSRUHOIDEULFDQWH
6LRFXUUHTXHXQDGHODVHWLTXHWDVGHDGYHUWHQFLDVHVXHOWDHVWiLOHJLEOHRVHGHVSUHQGHFRPXQtTXHVHFRQHO6HUYLFLRDO&OLHQWHGH
1DXWLOXVSDUDREWHQHUHWLTXHWDVGHUHHPSOD]R
!
3DUDUHGXFLUHOULHVJRGHGHVFDUJDHOpFWULFDRHOXVRQRVXSHUYLVDGRGHOHTXLSRVLHPSUHGHVHQFKXIHHOFDEOHGHDOLPHQWDFLyQGHOWRPDFRUULHQWHGHSDUHG\GHODPiTXLQD\HVSHUHPLQXWRVDQWHVGHODOLPSLH]DHOPDQWHQLPLHQWRRODUHSDUDFLyQGHOD
PiTXLQD3RQJDHOFDEOHGHDOLPHQWDFLyQHQXQOXJDUVHJXUR
Diariamente:
Antes de cada uso, inspeccione si hay piezas sueltas, rotas, dañadas o gastadas en la máquina de ejercicios. No la use si la encuentra en estas condiciones. Repare o reemplace todas las piezas ante el primer
signo de desgaste o daño. Después de cada entrenamiento, use un paño húmedo para limpiar el sudor de la
máquina y la consola.
1RWDHYLWHODKXPHGDGH[FHVLYDHQODFRQVROD
Semanalmente:
9HUL¿TXHTXHORVURGLOORVIXQFLRQHQFRUUHFWDPHQWH/LPSLHODPiTXLQDSDUDHOLPLQDUHOSROYRODVXFLHGDGROD
PXJUH/LPSLHORVULHOHV\ODVXSHU¿FLHGHORVURGLOORVFRQXQSDxRK~PHGR
Nota: no use productos a base de petróleo.
Mensual
o después de 20
horas:
Asegúrese de que todos los pernos y tornillos estén bien apretados. Apriete según sea necesario.
AVISO: no limpie con solvente a base de petróleo ni limpiador para autos. Asegúrese de mantener la consola libre de humedad.
Reemplazo de la batería de la banda de pecho de frecuencia cardíaca
/DEDQGDGHSHFKRGHIUHFXHQFLDFDUGLDFD +5 XVDXQDEDWHUtD&5.
!
1RUHDOLFHHVWHSURFHGLPLHQWRDODLUHOLEUHQLHQOXJDUHV
K~PHGRVRPRMDGRV
8
VDQGRXQDPRQHGDDÀRMHODFXELHUWDUDQXUDGDGHOFRPSDUWLPLHQWR
para la batería. Retire la cubierta y la batería.
2.
Al reemplazar la batería, insértela en el compartimiento para la batería con el símbolo + hacia arriba.
3.
Instale de nuevo la cubierta en la banda.
4.
Deseche la batería usada. Disponga de ella de acuerdo con las
reglamentaciones locales o en un centro de reciclaje aprobado.
5.
Inspeccione su banda de pecho para comprobar que funcione.
CR2032
+
1RXVHHOHTXLSRKDVWDTXHHVWpFRPSOHWDPHQWHHQVDPEODGR\KD\DVLGRLQVSHFFLRQDGRSDUDFRPSUREDUVXFRUUHFWRIXQFLRQDPLHQWRVHJ~QHO0DQXDOGHOXVXDULR
44
Manual de ensamblaje/del usuario
Piezas para mantenimiento
C
A
B
T
D
E
F
I
G
D
V
J
F
U
S
H
K
W
R
EE
DD
L
H
M
X
Q
Y
M
Q
Z
AA
O
O
P
N
P
BB
N
CC
45
Manual de ensamblaje/del usuario
A
Manubrio dinámico, izquierda
L
Estabilizador
W
Ensamblaje del movimiento de brazos
B
Ensamblaje de la consola F%DUUDV
GHVOL]DQWHV
M
Nivelador
X
Biela
C
Manubrio dinámico, derecha
N
Pedal
<
Tensionador
D
Cubierta de la biela
O
Reposapiés
Z
Polea de transmisión, inferior
E
Cubierta, derecha
P
Rodillo
AA
Banda del ventilador
F
Tapa
Q
Pata
BB
Placa trasera del ventilador
G
Cubierta, derecha de ventilador
R
Cubierta, izquierda de ventilador
CC
6HQVRUGHYHORFLGDG GHWUiVGHO
YHQWLODGRU
H
Encastres del ensamblaje del ventilador
S
Ensamblaje del ventilador
DD
Correa de transmisión
I
Cubierta, posterior
T
Cubierta superior
EE
Polea de transmisión, superior
J
Ensamblaje del riel
U
Cubierta, derecha
K
Rueda para transporte
V
Cable de alimentación
46
Manual de ensamblaje/del usuario
Solución de problemas
&RQGLFLyQSUREOHPD
No enciende la pantalla /
pantalla parcial / la unidad no
enciende
/RTXHGHEHUHYLVDUVH
6ROXFLyQ
5HYLVHHOWRPDFRUULHQWH GH
SDUHG
Asegúrese de que la unidad esté enchufada en un tomacorriente de pared
que funcione.
&RPSUXHEHODFRQH[LyQHQOD
parte delantera de la unidad
/DFRQH[LyQGHEHVHU¿UPH\QRSUHVHQWDUGDxRV5HHPSODFHHODGDSWDGRUR
ODFRQH[LyQHQODXQLGDGVLFXDOTXLHUDGHHVWRVHVWiGDxDGR
&RPSUXHEHODVFRQH[LRQHV
orientación
del cable de datos
$VHJ~UHVHGHTXHHOFDEOHHVWp¿UPHPHQWHFRQHFWDGR\GHELGDPHQWHRULHQtado. El pequeño seguro del conector debe estar alineado y encajarse en su
lugar produciendo un chasquido.
Compruebe la integridad del
cable de datos
Todos los hilos del cable deben estar intactos. Si cualquiera de ellos está
visiblemente torcido o cortado, reemplace el cable.
Revise la pantalla de la consola
para ver si está dañada
Revise si hay signos visibles de que la pantalla de la consola esté agrietada
o presente algún otro daño. Reemplace la consola si está dañada.
Adaptador de CA
Revise si hay signos visibles de que el adaptador de CA esté agrietado o
presente algún otro daño. Reemplace el adaptador de CA si está dañado.
Pantalla de la consola
6LODFRQVRODVRORPXHVWUDXQDSDQWDOODSDUFLDO\WRGDVODVFRQH[LRQHVHVWiQ
bien, reemplace la consola.
Si los pasos anteriores no resuelven el problema, comuníquese con Atención
al Cliente para recibir ayuda adicional.
La consola no responde cuando Ensamblaje del botón de la
se presiona el botón
consola
Trate de obtener respuesta de la consola con otros botones.
Revise la integridad del cable
Todos los hilos del cable deben estar intactos. Si cualquiera de ellos está
de datos del ensamblaje del
visiblemente torcido o cortado, reemplace el cable.
botón de la consola a la consola
&RPSUXHEHODVFRQH[LRQHV
orientación
del cable de datos
$VHJ~UHVHGHTXHHOFDEOHHVWp¿UPHPHQWHFRQHFWDGR\GHELGDPHQWHRULHQtado. El pequeño seguro del conector debe estar alineado y encajarse en su
lugar produciendo un chasquido.
Revise la pantalla de la consola
para ver si está dañada
Revise si hay signos visibles de que la pantalla de la consola esté agrietada
o presente algún otro daño. Reemplace la consola si está dañada.
Revise el ensamblaje del botón
de la consola
Revise si hay signos visibles de que el ensamblaje del botón de la consola
tenga algún daño. Reemplace el ensamblaje del botón de la consola en caso
de estar dañado.
Si los pasos anteriores no resuelven el problema, comuníquese con Atención
al Cliente para recibir ayuda adicional.
No hay lectura de velocidad/
RPM
Compruebe la integridad del
cable de datos
Todos los hilos del cable deben estar intactos. Si hay alguno cortado o
torcido, reemplace el cable.
&RPSUXHEHODVFRQH[LRQHV
orientación
del cable de datos
$VHJ~UHVHGHTXHHOFDEOHHVWp¿UPHPHQWHFRQHFWDGR\GHELGDPHQWHRULHQtado. El pequeño seguro del conector debe estar alineado y encajarse en su
lugar produciendo un chasquido.
Revise la posición del imán
UHTXLHUHTXLWDUODFXELHUWD
El imán debe estar en su lugar en la polea.
Revise el sensor de velocidad
UHTXLHUHTXLWDUODFXELHUWD
El sensor de velocidad debe alinearse con el imán y conectarse al cable de
datos. Vuelva a alinear el sensor si es necesario. Reemplácelo si el sensor o
HOFDEOHGHFRQH[LyQSUHVHQWDQGDxRV
Componentes electrónicos de
la consola
Si no se descubren problemas mediante las pruebas, comuníquese con
Atención al Cliente.
47
Manual de ensamblaje/del usuario
La unidad funciona, pero la HR
telemétrica no aparece
Banda de pecho
La banda debe ser compatible con “POLARŠ´\QRFRGL¿FDGD$VHJ~UHVHGH
que la banda esté directamente sobre la piel y que el área de contacto esté
húmeda.
Interferencia
,QWHQWHDOHMDUODXQLGDGGHODVIXHQWHVGHLQWHUIHUHQFLD 79PLFURRQGDVHWF Reemplace la banda de pecho
Si se elimina la interferencia y HR no funciona, reemplace la banda.
5HYLVHHOWRPDFRUULHQWH GH
SDUHG
Asegúrese de que la unidad esté enchufada en un tomacorriente de pared
que funcione.
&RPSUXHEHODFRQH[LyQHQOD
parte delantera de la unidad
/DFRQH[LyQGHEHVHU¿UPH\QRSUHVHQWDUGDxRV5HHPSODFHHODGDSWDGRUR
ODFRQH[LyQHQODXQLGDGVLFXDOTXLHUDGHHVWRVHVWiGDxDGR
Compruebe la integridad del
cable de datos
Todos los cables deben estar intactos. Si hay alguno cortado o torcido,
reemplace el cable.
&RPSUXHEHODVFRQH[LRQHV
orientación
del cable de datos
$VHJ~UHVHGHTXHHOFDEOHHVWp¿UPHPHQWHFRQHFWDGR\GHELGDPHQWHRULHQtado. El pequeño seguro del conector debe estar alineado y encajarse en su
lugar produciendo un chasquido.
Restablezca la máquina
Desenchufe la unidad del tomacorriente durante 5 minutos. Vuelva a conectarla al tomacorriente.
Revise la posición del imán
UHTXLHUHTXLWDUODFXELHUWD
El imán debe estar en su lugar en la polea.
Revise el sensor de velocidad
UHTXLHUHTXLWDUODFXELHUWD
El sensor de velocidad debe alinearse con el imán y conectarse al cable de
datos. Vuelva a alinear el sensor si es necesario. Reemplácelo si el sensor o
HOFDEOHGHFRQH[LyQSUHVHQWDQGDxRV
Los pedales no se mueven
Ubicación de los pedales
/RVSHGDOHVSXHGHQHVWDUHQ³GHVFHQVRPi[LPR´7RPHFRQ¿UPH]DORV
manubrios estáticos
y aplique su peso a la rueda del pie que queda más alto. Mientras aún
sujeta el manubrio estático, inclínese ligeramente hacia atrás aplicando más
peso sobre el talón. Cuando los pedales comiencen a moverse, reanude el
entrenamiento deseado.
El ventilador no gira
Revise si el ventilador tiene una
obstrucción
Desenchufe la unidad del tomacorriente durante 5 minutos. Elimine el
material del ventilador. De ser necesario, quite las cubiertas para ayudar
en la eliminación. No utilice la máquina hasta que haber reemplazado las
cubiertas.
La unidad se bambolea / no se
mantiene a nivel
Compruebe el ajuste del
nivelador
Ajuste los niveladores hasta que la máquina esté nivelada.
/DFRQVRODVHDSDJD HQWUDDO
PRGRGHLQDFWLYLGDG PLHQWUDV
está en uso
&RPSUXHEHODVXSHU¿FLHGHEDMR (VSRVLEOHTXHHODMXVWHQRSXHGDFRPSHQVDUVXSHU¿FLHVH[WUHPDGDPHQWH
de la unidad
irregulares. Traslade la máquina a un área nivelada.
3HGDOHVVXHOWRVGL¿FXOWDGSDUD
pedalear en la unidad
Tornillería
$SULHWH¿UPHPHQWHWRGDODWRUQLOOHUtDGHORVEUD]RVGHORVSHGDOHV\ORV
brazos del manubrio.
Sonido de roce fuera de las
cubiertas durante la operación.
Tapas
7DSDVXQSRFRÀRMDVHQODVELHODV
Sonido de roce metálico proveniente de las cubiertas durante
la operación.
Abrazadera del freno
La abrazadera del freno debe alinearse. Comuníquese con atención al cliente para obtener ayuda adicional.
La máquina parece soltar los
Banda de deslizamiento
pedales por un momento durante la operación.
Comuníquese con atención al cliente para obtener ayuda adicional.
48
Manual de ensamblaje/del usuario
&RQGLFLyQSUREOHPD
Los resultados del entrenamiento no se sincronizan con
el dispositivo habilitado para
BluetoothŠ
/RTXHGHEHUHYLVDUVH
6ROXFLyQ
Máquina de ejercicios
Desenchufe la unidad del tomacorriente durante 5 minutos. Vuelva a conectarla al tomacorriente.
Dispositivo habilitado para
BluetoothŠ
9HUL¿TXHVXGLVSRVLWLYRSDUDDVHJXUDUVHGHTXHVHKD\DKDELOLWDGRODIXQFLyQ
inalámbrica BluetoothŠ.
Aplicación deportiva
5HYLVHODVHVSHFL¿FDFLRQHVGHODDSOLFDFLyQGHSRUWLYD\FRQ¿UPHTXHVX
dispositivo sea compatible.
49
Manual de ensamblaje/del usuario
Guía de pérdida de peso corporal Bowflex™
Presentación de información general
%LHQYHQLGRDODJXtDGHSpUGLGDGHSHVRGH%RZÀH[Œ(VWHSODQHVWiGLVHxDGRSDUDXVDUVHFRQHOHTXLSR%RZÀH[Š y ayudarlo a usted a lo siguiente:
• Bajar de peso y reducir grasa
• Mejorar su salud y su bienestar
• Aumentar su energía y vitalidad
&RQVXOWHDVXPpGLFRDQWHVGHFRPHQ]DUXQSURJUDPDGHHMHUFLFLRVRXQQXHYRSODQGHVDOXG\DOLPHQWDFLyQ'HMHGHHMHUFLWDUVHVL
VLHQWHGRORURWHQVLyQHQHOSHFKRVLWLHQHGLÀFXOWDGSDUDUHVSLUDURVLVLHQWHTXHYDDGHVPD\DUVH&RPXQtTXHVHFRQVXPpGLFR
DQWHVGHYROYHUDXVDUODPiTXLQD8VHORVYDORUHVFDOFXODGRVRPHGLGRVSRUODFRPSXWDGRUDGHODPiTXLQDVRORFRPRUHIHUHQFLD
/DIUHFXHQFLDFDUGtDFDPRVWUDGDHQODFRQVRODHVXQDDSUR[LPDFLyQ\GHEHUiXWLOL]DUVHVRODPHQWHFRPRUHIHUHQFLD
$OFRQFHQWUDUVHHQORVWUHVHOHPHQWRVSULQFLSDOHVGHOD*XtDGH3pUGLGDGH3HVR&RUSRUDO%RZÀH[ŒFDOLGDGHTXLOLEULR\FRQVWDQFLDSRGUiORJUDUOD
SpUGLGDGHSHVR\PDQWHQHUODDGHPiVGHORJUDUVXVPHWDVGHFRQGLFLyQItVLFDSDUDODVSUy[LPDVVHLVVHPDQDV\ODVSRVWHULRUHV
• &DOLGDG Este plan hace hincapié en el consumo de más alimentos integrales y la obtención de la mayor cantidad de nutrientes posible de
VXVFDORUtDV$OKDFHUTXHODPD\RUSDUWHGHVXGLHWDSURYHQJDGHDOLPHQWRVGHXQVRORLQJUHGLHQWH SRUHMHPSORIUXWDVYHUGXUDVSHVFDGR
SURWHtQDVVLQJUDVDKXHYRVIULMROHVQXHFHV\JUDQRVLQWHJUDOHV XVWHGREWHQGUiODVYLWDPLQDVORVPLQHUDOHVOD¿EUDODSURWHtQD\ODVJUDVDV
saludables que su organismo necesita.
• (TXLOLEULR&DGDXQRGHORVDOLPHQWRV\ORVUHIULJHULRVGHHVWDJXtDWLHQHXQDIXHQWHGH¿EUDRFDUERKLGUDWRVLQWHOLJHQWHVSURWHtQD\JUDVD
saludable para mantener la constancia de sus niveles de energía durante el día e impulsar sus entrenamientos. Con este equilibrio, usted se
sentirá satisfecho por más tiempo, lo cual es fundamental para la pérdida de peso.
• &RQVWDQFLD(VLPSRUWDQWHSDUDVXPHWDEROLVPR\VXPHQWHREWHQHUDSUR[LPDGDPHQWHODPLVPDFDQWLGDGGHFDORUtDVDOGtD6LXVWHGVH
H[FHGHXQGtDQRLQWHQWHFRPSHQVDUORHOGtDVLJXLHQWHFRQHOD\XQRRXQDUHGXFFLyQGUiVWLFDGHFDORUtDV£6LJDHVWDJXtDSDUDUHFXSHUDUHO
rumbo!
Resultados y expectativas
Los resultados variarán según la edad, peso al comenzar, y nivel de ejercicios. Al adherir a una dieta y una rutina de ejercicios, puede perder entre 1
DOLEUDVSRUVHPDQD\H[SHULPHQWDUPD\RUHVQLYHOHVGHHQHUJtD
Cinco consejos para el éxito a largo plazo
&RQVHUYHXQUHJLVWURGHDOLPHQWRV con niveles de apetito y consumo de agua. Hay registros de alimentos y aplicaciones móviles disponiEOHVHQZZZP\¿WQHVVSDOFRP\ZZZORVHLWFRP
3pVHVHRPtGDVHVHPDQDOPHQWH:no lo haga con mayor ni menor frecuencia. Lo mejor es pesarse semanalmente en lugar de hacerlo diariamente o cada dos días. Usted llevará un seguimiento de sus avances y de su régimen sin desanimarse si la báscula no se mueve durante
XQRVGtDV5HFXHUGHTXHHOSHVRHVVRORXQQ~PHUR\VHYHLQÀXLGRSRUHODXPHQWRGHPDVDPXVFXODUDGHPiVGHODSpUGLGDGHJUDVD*HQHralmente, la forma en que la ropa se ajusta es un mejor indicador de los avances a medida que su cuerpo se adapta al ejercicio y los cambios
nutricionales.
0LGDODVSRUFLRQHVSDUDHYLWDUHODXPHQWRGHODVSRUFLRQHVXWLOLFHWD]DVRFXFKDUDVGHPHGLFLyQSDUDJUDQRV DUUR]SDVWDFHUHDO IULMROHV
nueces, aceites y productos lácteos. Utilice la "Guía del tamaño de las porciones" para otros alimentos.
3ODQHHFRQDQWLFLSDFLyQ realice un plan semanal de sus comidas o registre sus alimentos con un día de anticipación. La planeación lo
SUHSDUDSDUDHOp[LWRHVSHFLDOPHQWHHQHOFDVRGHHYHQWRVVRFLDOHV\HOFRQVXPRHQUHVWDXUDQWHV
3UDFWLTXHVXVKiELWRVGHVHDGRVDODUJRSOD]RHVIiFLOMXVWL¿FDUODVHOHFFLRQHVGH¿FLHQWHVGHDOLPHQWDFLyQFXDQGRVRORVHFRQFHQWUDHQ
HOFRUWRSOD]R&RQFpQWUHVHHQODVDWLVIDFFLyQDODUJRSOD]RGHXQDYHUVLyQPiVVDOXGDEOH\HVWpWLFDGHVXFXHUSRHQOXJDUGHODJUDWL¿FDFLyQ
temporal derivada de los placeres.
Cómo utilizar esta guía
• &RQVXPDHOGHVD\XQRFRPRPi[LPRPLQXWRVGHVSXpVGHGHVSHUWDUVHHQODPDxDQD\HTXLOLEUHVXVFRPLGDV\UHIULJHULRVGXUDQWHHOGtD
±1RGHMHSDVDUPiVGHRKRUDVVLQFRPHU
±6LQRHVWiDFRVWXPEUDGRDGHVD\XQDUFRPLHQFHFRQXQDIUXWDSHTXHxD\FRPDDOJRPiVRKRUDVGHVSXpV6XFXHUSRVHDGDSWDDOD
falta del desayuno, pero tan pronto como comience a comer en la mañana y reduzca las porciones de la cena, se dará cuenta de que su
apetito aumentará. Esta es una buena señal de que su metabolismo está funcionando.
50
Manual de ensamblaje/del usuario
• &RPELQHODVRSFLRQHVGHODVFRPLGDV
±(OLMDRSFLyQGHOSODQGHFRPLGDVFRUUHVSRQGLHQWH SDUDKRPEUHRSDUDPXMHU SDUDHOGHVD\XQRODFRPLGD\ODFHQD\SRQJDDWHQFLyQ
al tamaño de las porciones
±(OLMDRRSFLRQHVGHUHIULJHULRSRUGtD
±7LHQHODRSFLyQGHVXVWLWXLUXQUHIULJHULRSRUXQGHOHLWHPHQRUDFDORUtDV
±8WLOLFHHOSODQGHFRPLGDVODVRSFLRQHVPXHVWUD\ODOLVWDGHYtYHUHVSDUDFUHDUVXVSURSLDVFRPLGDVFRQPiVYDULHGDG
±3XHGHFDPELDUFXDOTXLHUWLSRGHSURWHtQDYHUGXUDRFDUERKLGUDWRLQWHOLJHQWHSRUODVRSFLRQHVGHFRPLGDVTXHVHVXJLHUHQ3RUHMHPSOR
•
Pavo por atún
•
Cualquier pescado o marisco por pollo
•
Verduras cocidas en lugar de ensalada
• &RQVXPDVXVFDORUtDV
±5HGX]FDODVEHELGDVDOWDVHQFDORUtDVFRPRHOUHIUHVFRORVMXJRVODVEHELGDVFRQFDIHtQD\HODOFRKRO
±&RQVXPDDJXDWpVLQHGXOFRUDQWHV\FDIp&RQVXPDXQPtQLPRGHR] O GHDJXDDOGtDSDUDPDQWHQHUVHELHQKLGUDWDGR
• 6LD~QWLHQHKDPEUHGHVSXpVGHXQDFRPLGDRHQWUHFRPLGDV
±%HEDXQYDVRGHDJXD\HVSHUHDPLQXWRV0XFKDVYHFHVFRQIXQGLPRVHOKDPEUH £RLQFOXVRHODEXUULPLHQWR FRQODVHG7ROHUH
ODVJDQDVLQLFLDOHVGHFRPHUDOJXQDVYHFHVVHGHVYDQHFHUiQ
±6LD~QHVWiKDPEULHQWRGHVSXpVGHHVSHUDUDPLQXWRVFRQVXPDXQUHIULJHULRRFRPLGDSHTXHxDFRQIUXWDVYHUGXUDV\SURWHtQD
6LVXPHWDHVDXPHQWDUODPDVDPXVFXODURODIXHU]D
• Utilice el mismo plan de comidas, pero aumente el tamaño de las porciones en la misma proporción para aumentar el número total de calorías
TXHFRQVXPHGLDULDPHQWH3RUHMHPSORDXPHQWHHOWDPDxRGHODVSRUFLRQHVGHSURWHtQD\FDUERKLGUDWRVLQWHOLJHQWHVHQODVFRPLGDVDO
Otra opción consiste en agregar un refrigerio para satisfacer las necesidades de calorías en aumento de su organismo y aumentar la masa
muscular y la fuerza.
• 3DUDDWHQGHUODQXWULFLyQSRVWHULRUDOHQWUHQDPLHQWRFRQVXPDXQRGHVXVUHIULJHULRVFRPRPi[LPRPLQXWRVGHVSXpVGHKDEHUFRQFOXLGRVX
HQWUHQDPLHQWR$VHJ~UHVHGHFRPELQDUORVFDUERKLGUDWRVSRUHMHPSORIUXWDFRQSURWHtQD \RJXUOHFKHRSURWHtQDHQSROYR SDUDHVWLPXODUHO
aumento y la recuperación de los músculos. La leche con chocolate también es una gran opción.
Información general del plan de comidas
(OSODQGHFRPLGDVSDUDPXMHUHVDSRUWDDSUR[LPDGDPHQWHFDORUtDV\HOSODQGHFRPLGDVSDUDKRPEUHVDSRUWDDSUR[LPDGDPHQWH
FDORUtDVGHQXWULFLyQGHDOWDFDOLGDGSDUDD\XGDUORDEDMDUGHSHVR\VHQWLUVHELHQDGHPiVGHDSURYHFKDUDOPi[LPRVXVFDORUtDV/DVYLWDPLQDVORV
PLQHUDOHV\DQWLR[LGDQWHVGHULYDGRVGHOFRQVXPRGHDOLPHQWRVLQWHJUDOHVD\XGDQDGHVDUUROODUXQDVDOXGySWLPD(VWRVQLYHOHVGHFDORUtDVJHQHUDrán una pérdida de peso saludable para la mayoría de las personas. Recuerde que el metabolismo de las personas es muy diferente según la edad,
la estatura, el peso, el nivel de actividad y la genética. Ponga atención a su peso, los niveles de apetito y la energía, y ajuste sus calorías en caso
necesario.
6LJDHVWRVOLQHDPLHQWRVVLWLHQHPiVGHDxRVGHHGDG
• Si tiene más de 55 años, necesita menos calorías porque su metabolismo se hace más lento con la edad. Consuma tres comidas con un
refrigerio opcional al día.
6LJDHVWRVOLQHDPLHQWRVVLWLHQHPHQRVGHDxRVGHHGDG
• Si tiene menos de 25 años, quizá necesite más calorías. Agregue otro refrigerio si siente un bajo nivel energético o tiene demasiada hambre.
Desayuno
El desayuno incluye una porción de carbohidratos inteligentes, fruta y una fuente de proteína, que también tendrá grasa. Con un equilibrio de
FDUERKLGUDWRV\¿EUDGHORVFDUERKLGUDWRVLQWHOLJHQWHV\ODIUXWDHQFRPELQDFLyQFRQODSURWHtQD\ODJUDVDXVWHGWHQGUiHQHUJtDSDUDHOGtD\SRGUi
controlar los niveles de apetito durante el día.
Refrigerios
Cada refrigerio representa un equilibrio entre carbohidratos y proteína para procurar una mayor constancia de sus niveles de azúcar en la sangre, lo
FXDOVLJQL¿FDTXHXVWHGQRVHQWLUiKDPEUHQLGLVSDURVRGHUUXPEHVGHORVQLYHOHVHQHUJpWLFRV
Esto ocurre cuando usted consume un refrigerio que solo es alto en carbohidratos, como las chips, los dulces, los refrescos, las galletas saladas o
los pretzels.
51
Manual de ensamblaje/del usuario
Comida y cena
/DFRPLGDFRPELQDODVDWLVIDFFLyQGHOD¿EUDSURFHGHQWHGHODVYHUGXUDV\ORVFDUERKLGUDWRVLQWHOLJHQWHVFRQXQDSURWHtQDVLQJUDVDREDMDHQJUDVD
La grasa saludable puede provenir de la proteína, agregada durante la preparación de los alimentos, las nueces de una ensalada o como aderezo o
salsa, como el aderezo para ensaladas de aceite y vinagre.
La siguiente es información general de cómo debe ser un día ideal:
&RQVXOWHOD*XtDGHOWDPDxRGHODVSRUFLRQHVSDUDUHYLVDUHOWDPDxRDGHFXDGRGHODVSRUFLRQHV
Desayuno
Refrigerio n.° 1
rich
FDUERKLGUDWRV
carbs
LQWHOLJHQWHV
protein
IUXWD
FDUERKLGUDtos
LQWHOLJHQWHV
SURWHtQD
veggies
SURWHtQDJUDVD
Refrigerio n.° 2
Comida
FDUERKLGUDWRV
LQWHOLJHQWHV
SURWHtQD
JUDVD
VDOXGDEOH
FDUERKLGUDtos
LQWHOLJHQWHV
YHUGXUDV
Cena
FDUERKLGUDtos
LQWHOLJHQWHV
SURWHtQD
JUDVD
VDOXGDEOH
YHUGXUDV
52
Manual de ensamblaje/del usuario
SURWHtQD
La siguiente es información general de cómo debe ser un día ideal:
&RQVXOWHOD*XtDGHOWDPDxRGHODVSRUFLRQHVSDUDUHYLVDUHOWDPDxRDGHFXDGRGHODVSRUFLRQHV
2SFLRQHVGHGHVD\XQR
)UXWD
&DUERKLGUDWRVLQWHOLJHQWHV
3URWHtQD*UDVD
$YHQDFRQIUXWDV\QXHFHV
Cueza avena natural en agua.
Agregue encima fruta, nueces,
leche, canela y miel.
Bayas o plátanos
Avena natural
&RQYHQFLRQDORGHFRFFLyQ
UiSLGD
Nueces y leche
(PSDUHGDGRGHKXHYR Cueza
GHKXHYR V 7XHVWHXQSDQ\
agregue encima 1 rebanada de
queso, 1 rebanada de jamón y
jitomate.
Jitomate
Emparedado inglés o rebanada
delgada de pan para sándwich
Huevo, jamón y queso
3DUIDLWSRWHQWHGH\RJXU
Agregue fruta al yogur. Espolvoree 1 porción de nueces, 2 a 3
cucharaditas de germen de trigo,
o linaza molida, 1 cucharadita de
avena y canela.
Fruta picada de su elección
Avena, germen de trigo y linaza
molida
<RJXUJULHJRQDWXUDOVLQJUDVD\
nueces
6iQGZLFKGHFUHPDGHFDFDKXDWH\PDQ]DQDSDUDOOHYDU
con pan tostado. Unte crema de
cacahuate, agregue rebanadas
delgadas de media manzana y
una cucharadita de miel.
Manzana en rebanadas
Rebanada delgada de pan para
ViQGZLFK 6iQGZLFK7KLQ SDQ
o rebanada delgada de pan para
EDJHO %DJHO7KLQ
Crema de cacahuate
2SFLRQHVGHFRPLGD\FHQD
3URWHtQDVLQJUDVD
&DUERKLGUDWRVLQWHOLJHQWHV
9HUGXUDV
/RPRGHFHUGRFDPRWH\
MXGtDVYHUGHV HMRWHV
Lomo de cerdo a la parrilla o al
horno
Camote al horno
-XGtDVYHUGHV HMRWHV
3ROORVDOWHDGR
Sazone con 2 cucharaditas de
VDOVDWHUL\DNL
Pechuga de pollo o muslo sin piel
deshuesado
Arroz integral o silvestre
Verduras salteadas mezcladas
IUHVFDVRFRQJHODGDV
7DFRVGHÀOHWHFRQJXDUQLFLyQ
GHHQVDODGD SDUDKRPEUHV
SDUDPXMHUHV $JUHJXHVDOVDFLlantro y espolvoree queso rayado
Filete de arrachera o solomillo
Tortillas de maíz
Ensalada
Pasta de trigo entero
Brócoli al vapor
Papas a la francesa horneadas
Elote más guarnición de ensalada
:UDSDOWRHQ¿EUD
Sopa de verduras
KHFKDHQFDVDRHQODWDGDEDMD
HQVRGLR
3DVWDGHWULJRHQWHURFRQFDPD- &DPDUyQ FRQJHODGRRIUHVFR R
UyQRIULMROHVFDQHOLQLPiVVDOVD frijoles canelini
PDULQHUD
+DPEXUJXHVDVVLQEROORVFRQ
SDSDVDODIUDQFHVDDOKRUQR
PDt]\HQVDODGD
Ase hamburguesas. Hornee
papas en rebanadas sobre una
lámina para galletas rociada de
25 a 30 minutos a 425 °F.
Carne de res o pavo molidos con
JUDVDUHGXFLGDDO
:UDSGHDW~Q\DJXDFDWHFRQ
Atún
VRSDGHYHUGXUDV
8WLOLFHR] J GHDW~Q ODWD Agregue encima lechuga, jitomate, aguacate y mostaza
53
Manual de ensamblaje/del usuario
2SFLRQHVGHUHIULJHULR
&DUERKLGUDWRVLQWHOLJHQWHV
3URWHtQDV
1 manzana mediana
10 a 15 almendras
Zanahorias miniatura
2 cucharaditas de humus
1 porción de galletas saladas*
1 queso en tiras
Barra energética o proteínica con < 200 calorías*
9LVLWHZZZ%RZÀH[FRP5HVRXUFHVSDUDFRQVXOWDUUHFRPHQGDFLRQHVGHPDUFDV
Deleites opcionales
Tiene la opción de sustituir el refrigerio n.° 2 con un deleite de 100 a 150 calorías. Puede consumir un deleite opcional todos los días, aunque para
una salud óptima se recomienda limitar los pequeños lujos a 3 o 4 veces por semana. Utilice el método que le dé mejores resultados. A continuación
aparecen unos ejemplos:
• 1/2 taza de helado bajo en grasa
• 1 bolsa pequeña de chips de papas al horno
• R] PO GHYLQRRR] PO GHFHUYH]DOLJKW
• 3 tazas de palomitas dietéticas reventadas con aire caliente
Muestra del Plan de 3 Días
Según cada una de las opciones de comidas enumeradas anteriormente, un plan típico de 3 días podría ser así:
'tD
'tD
'tD
'HVD\XQR
Emparedado de huevo
Parfait potente de yogur
Avena con fruta y nueces
5HIULJHULR
Manzana con almendras
Galletas de nuez más queso en
tiras
Zanahorias en miniatura y humus
&RPLGD
Wrap de atún y aguacate con
sopa
Sobras de la cena - Día 1
Sobras de la cena - Día 2
5HIULJHULRRSFLRQDORGHOHLWH
½ taza de paleta helada
Barra energética
Bolsa de 100 calorías de palomitas dietéticas
&HQD
Pasta con camarón
Pollo salteado
Hamburguesas sin bollos
®
54
Manual de ensamblaje/del usuario
Guía del tamaño de las porciones
Cada uno de los elementos enumerados corresponde a una porción
HOMBRE
MUJER
3527(Ì1$
2 huevos
R] J GHSROORSHVFDGRFDUQHVLQJUDVDR
tofu.
2/3 taza de frijoles o lentejas*
1 taza de yogur griego*
R] J GHTXHVR
1 taza = pelota de béisbol
1 huevo
R] J GHSROORSHVFDGRRFDUQHVLQJUDVD
1/2 taza de frijoles o lentejas*
1/2 taza de yogur griego*
R] J GHTXHVR
1/2 taza = foco
*5$6$6$/8'$%/(
2 cucharaditas de crema de cacahuate o nuez
2 cucharaditas de aceite de oliva, lino o almendras
1/4 de taza de nueces
1/3 de aguacate mediano
1 cucharadita de crema de cacahuate o nuez
1 cucharadita de aceite de oliva, lino o almendras
1/8 de taza o 2 cucharaditas de nueces
DSUR[LPDGDPHQWHDOPHQGUDV
1/4 de aguacate mediano
&$5%2+,'5$726,17(/,*(17(6
WD]DGHJUDQRVFRFLGRV WD]DHQFUXGR avena, arroz integral, quinua, pasta
1 camote mediano o patata común
2 tortillas de maíz
UHEDQDGDGHSDQ RUHEDQDGDVGLHWpWLFDV
LJXDOHVDFDORUtDVRPHQRV
1 emparedado inglés, sándwich delgado o wrap
DOWRHQ¿EUD
WD]DGHJUDQRV GHWD]DHQFUXGR FRFLGRV
1/2 camote mediano o
papa común
2 tortillas de maíz
UHEDQDGDGHSDQ RUHEDQDGDVGLHWpWLFDVLJXDOHVD
FDORUtDVRPHQRV
1 emparedado inglés, sándwich delgado o wrap alto en
¿EUD
1 oz (29 ml) o 2
cucharaditas
= pelota de golf
1/4 de taza de nueces
= Lata de Altoids
)587$
1 manzana, naranja o pera medianas
1 plátano pequeño = la longitud de su mano
1 taza de bayas o fruta picada
GHWD]DGHIUXWDVHFD IUHVFDRFRQJHODGDHV
ORPHMRU
9HUGXUDV 3XHGHFRQVXPLUYHUGXUDVVLQOtPLWHVDOYRFKtFKDURV\PDt]FRQVXPDXQDSRUFLyQGHWD]D
3 oz (85 g) de pollo o carne
= juego de cartas
2 tazas de espinaca o lechuga = 2 manos juntas
en forma de recipiente
1 taza de verduras crudas
1/2 taza de verduras cocidas
R] PO GHMXJRGHYHUGXUDVEDMRHQVRGLR
'(/(,7(623&,21$/(6
1 papa mediana
= ratón de computadora
1/2 taza de helado bajo en grasa
1 bolsa pequeña de chips de papas al horno
R] J GHFKRFRODWHRVFXUR
R] PO GHYLQRRR] PO GHFHUYH]D
light
3 tazas de palomitas dietéticas reventadas con aire
caliente
* algunos alimentos son una combinación de proteína y carbohidratos, o proteína y grasas
55
Manual de ensamblaje/del usuario
1 fruta mediana = pelota de
tenis
1 -1/2 oz (28-14 g) de
queso = 3 dados
Lista de víveres
3$1<*5$126
3DQGHWULJRHQWHURDO
Pan de granos germinados
(PSDUHGDGRVLQJOHVHV (QJOLVKPXI¿QV GLHWpWLFRVRGHWULJRHQWHUR
Rebanadas delgadas para sándwich o bagels
Tortillas de maíz o de trigo entero bajas en carbohidratos
:UDSVDOWRVHQ¿EUD
Avena natural: De 1 minuto o pasada de moda
Granos enteros: arroz integral, bulgur, cebada, quinua, cuscús
&RQVHMRVEXVTXHWULJRHQWHURDOFRPRSULPHULQJUHGLHQWH
%XVTXHJGH¿EUDSRUUHEDQDGDRJSRUGRVUHEDQDGDVGHSDQ
dietético. Procure pan con menos de 100 calorías por rebanada
/É&7(26<$/7(51$7,9$6$/É&7(26
*$//(7$66$/$'$65()5,*(5,26<%$55$6(1(5*e7,&$6
<RJXUJULHJRVLQJUDVD\QDWXUDO
.p¿U \RJXUFRPREHELGD
Leche orgánica baja en grasa
Almendra enriquecida o leche de soya
Queso: feta, parmesano, mozarela, havarti dietético, provolone, sueco,
queso en tiras o paquetes de una sola porción
Nueces o semillas sin sal
Palomitas dietéticas reventadas
con aire caliente
Edamame en vaina
Barras energéticas
Galletas saladas
Humus
Consejos: Limite las galletas saladas, pretzels y chips a 2 o 3 porciones
por semana. Siempre conjúntelas con proteína como humus, queso o
nueces. Busque barras energéticas con menos de 200 calorías y 20 g
GHD]~FDU\DOPHQRVJGHSURWHtQD\JGH¿EUD%XVTXHJDOOHWDV
saladas con menos de 130 calorías y 4 g o menos de grasa por
porción.
&$51(3(6&$'2$9(6<3527(Ì1$
Carne de caza
6DOPyQÀHWiQDW~QWLODSLDFDPDUyQ
SH]JDWRYLHLUDV RVWLRQHV RFDQJUHMR
Lomo de cerdo, costillas de cerdo o asado de cerdo
3HFKXJDRPXVORVGHSROORRSDYR VLQSLHO
+XHYRV\FODUDVGHKXHYRVDO
&DUQHGHUHVVLQJUDVDVRORPLOORHVSDOGLOODFXHWHORPRGHUHV
GHUHGXFFLyQGHJUDVD HVPHMRUODRUJiQLFDRGHUHVDOLPHQWDGDFRQ
KLHUED
6DOPyQRDW~QHQODWDGRV HQDJXD
-DPyQSDYRSROORR¿DPEUHUHGXFLGRVHQVRGLR\VLQQLWUDWRV
Cualquier tipo de frijol, variedades secas o enlatadas de bajo sodio
Tofu y tempeh
*5$6$6<$&(,7(6
Aguacate
$FHLWHGHROLYDVHPLOODGHXYDQXH]VpVDPR DMRQMROt ROLQD]D
Mantequillas/cremas: busque productos sin grasas trans y aceites
parcialmente hidrogenados en la lista de ingredientes.
&RQVHMRV(ODFHLWHGHROLYDOLJHURVHUH¿HUHDOVDERUQRDOFRQWHQLGR
de calorías. Siempre mida el aceite y la mantequilla. Incluso si una
grasa se considera saludable, aún es muy alta en calorías, y las
porciones deben controlarse.
$'(5(=26&21',0(1726<6$/6$
&RQVHMRVEXVTXHFRUWHVGHFDUQH&KRLFH>'HHOHFFLyQ@R6HOHFW
>6HOHFWRV@HQOXJDUGHORV3ULPH>'HSULPHUD@
Los Prime tienen más grasa. Consuma carne altamente procesada
y productos de imitación de carne como chorizo, tocino, pepperoni y
salchichas menos de una vez a la semana.
Vinagre: arroz, vino, balsámico
Todas las hierbas y especias frescas y secas
Mostaza
6DOVD\VDOVDGHFKLFOH FKLOLVDXFH
Salsa marinera con jarabe de maíz que no sea alto en fructuosa
Limón y jugo de limón
Ajo y jengibre picados y embotellados
Salsa de soya baja en sodio
$/,0(1726&21*(/$'26
Todas las verduras sin salsa
Todas las frutas
Granos y mezclas de granos
Consejos: Busque productos sin GMS, colorantes agregados, ni jarabe
de maíz en fructuosa. Busque salsas con menos de 50 calorías por
porción. Evite salsas y aderezos con base de crema como "ranch",
queso azul, y alfredo.
Todas las frutas y verduras, frescas o congeladas, son una gran opción. En vista de que cada comida tiene una de estas o ambas, su carrito
GHFRPSUDVGHEHUHÀHMDUOR
56
Manual de ensamblaje/del usuario
Siga adelante
&RQVHMRVSDUDXQDSpUGLGDGHSHVRFRQWLQXD\SDUDPDQWHQHUORVFDPELRV
• 1RGHMHGHSHVDUVHVHPDQDOPHQWH, incluso después de haber logrado el objetivo de su peso
• 6LJDOOHYDQGRXQUHJLVWURGHDOLPHQWRV Si su plan de comidas está bien establecido, registre sus alimentos para cada semana para mantener el rumbo. No sienta que tiene que hacerlo todos los días.
• 3UHSiUHVHSDUDORVHVWDQFDPLHQWRV Es posible que la báscula no se mueva durante algunas semanas o incluso meses después de haber
perdido peso inicialmente. Esto es normal y está previsto. Se trata del proceso natural del cuerpo de ajustarse a su nuevo peso inferior. No
SLHUGDGHYLVWDVXPHWDGHODUJRSOD]RFHOHEUHVXVp[LWRV\FDPELRV\PH]FOHVXVHQWUHQDPLHQWRVSDUDGHMDUDWUiVHOHVWDQFDPLHQWR
• $MXVWHVGHFDORUtDVSDUDPDQWHQHUODSpUGLGDGHSHVR Después de haber logrado su meta de peso, puede aumentar sus calorías a 100 o
200 por día siempre que su nivel de actividad siga siendo el mismo
• 'HOpLWHVH Gratifíquese con algo que no sea un alimento cada vez que consiga una meta, por ejemplo: un masaje, un nuevo cambio de ropa
o una salida con los amigos y la familia
• 8WLOLFHORVUHFXUVRVTXHDSDUHFHQDFRQWLQXDFLyQSDUDHQFRQWUDUUHFHWDVQXHYDVREWHQHUDVHVRUtDGHH[SHUWRV\VHJXLUPRWLYDGR
Recursos
5HFXUVRVTXHVHSXHGHQGHVFDUJDUGHODSiJLQDGH,QWHUQHWGH%RZÁH[Œ ZZZ%RZÀH[FRP5HVRXUFHV
• /LVWDGHFRPSUDGHYtYHUHVSDUDHOUHIULJHUDGRU IRUPXODULRHQEODQFR
• Formulario de planeación de comidas de 7 días
• Opciones de cena adicionales
• Guía de energía para antes y después del entrenamiento
3UHJXQWDV\DVLVWHQFLD
• +DJDSUHJXQWDVSXEOLTXHVXJHUHQFLDV\FRQpFWHVHFRQQXHVWURGLHWLVWDGH%RZÀH[ŒHQODSiJLQDGH)DFHERRNGH%RZÀH[
5HFHWDV
• www.wholeliving.com
• www.eatingwell.com
• www.whfoods.org
• www.livebetteramerica.org
5HJLVWURVGHDOLPHQWRVHQOtQHD
• ZZZP\¿WQHVVSDOFRP
• www.loseit.com
57
Manual de ensamblaje/del usuario
Garantía de recompra
4XHUHPRVTXHVHSDTXHODPiTXLQDGHHMHUFLFLRV%RZÀH[0D[7UDLQHUŠ es un producto superior. Su satisfacción está garantizada. Si por cualquier
UD]yQXVWHGQRHVWiVDWLVIHFKRFRQPiTXLQDGHHMHUFLFLRV%RZÀH[0D[7UDLQHUŠ siga las instrucciones que se ofrecen a continuación para
devolver la mercadería y recibir un reembolso del precio de compra, menos los gastos de manipulación y envío.
/D*DUDQWtDGHVDWLVIDFFLyQGH%RZÀH[0D[7UDLQHUŠ%X\%DFNVRORVHDSOLFDDODPHUFDGHUtDDGTXLULGDGLUHFWDPHQWHSRUORVFRQVXPLGRUHVD1DXWLlus, Inc. Esta garantía no se aplica a ventas hechas por revendedores o distribuidores.
/ODPHDXQUHSUHVHQWDQWHGH%RZÀH[0D[7UDLQHUŠDOSDUDREWHQHUXQ1~PHURGHDXWRUL]DFLyQGHGHYROXFLyQ 50$ (O50$VH
concederá si:
D/DPiTXLQDGHHMHUFLFLRV%RZÀH[0D[7UDLQHUŠ fue adquirida directamente de Nautilus, Inc.
E/DVROLFLWXGGHGHYROXFLyQGHOSURGXFWRVHUHDOL]DHQHOODSVRGHVHPDQDVDFRQWDUGHODIHFKDGHHQWUHJDGHVXPHUFDQFtD
2. Si se asigna un RMA, las instrucciones siguientes le evitarán demoras en el trámite de su reembolso.
a. La mercancía debe devolverse a la dirección que se le entrega al momento de la llamada de solicitud del número de autorización de devolución.
b. Toda mercancía devuelta debe estar debidamente embalada y en buen estado, de preferencia en las cajas originales.
F(OH[WHULRUGHODVFDMDVGHEHPDUFDUVHFODUDPHQWHFRQ
Número de autorización de devolución.
Su nombre
Su dirección
Su número de teléfono
d. Además, debe colocarse en cada caja de mercancía un trozo de papel con su nombre, dirección y número telefónico, o copias
de su factura original.
H6XQ~PHURGH50$WLHQHXQDGXUDFLyQHVSHFt¿FD6XHQYtRGHEHWHQHUIHFKDGHHQWUHJDGHQWURGHGRVVHPDQDVDFRQWDUGH
ODIHFKDHQTXHHO5HSUHVHQWDQWHGH%RZÀH[0D[7UDLQHUŠ emitió su Número de autorización de devolución.
Nota: usted es responsable del envío de devolución y de cualquier daño o pérdida de la mercancía que ocurra durante el envío de devolución. Nautilus recomienda que obtenga números de seguimiento y asegure su envío.
Devoluciones no autorizadas
1DXWLOXV,QFGH¿QHXQDGHYROXFLyQQRDXWRUL]DGDFRPRFXDOTXLHUPHUFDQFtDGHYXHOWDDQXHVWUDVLQVWDODFLRQHVVLQXQQ~PHURYiOLGR\YLJHQWHGH
DXWRUL]DFLyQGHGHYROXFLyQGHPHUFDQFtD 50$ HPLWLGRSRU1DXWLOXV6LQRPDUFDGHELGDPHQWHORVSDTXHWHVFRQXQQ~PHURGH50$YiOLGRRVL
SHUPLWHTXHXQQ~PHURGH50$H[SLUHHVWRRFDVLRQDUiTXH1DXWLOXV,QFFRQVLGHUHXQDGHYROXFLyQFRPRQRDXWRUL]DGD7RGDPHUFDQFtDGHYXHOWD
sin un número de RMA no estará sujeta a reembolso ni crédito, y Nautilus desechará el producto. El cliente asume todos los gastos de envío de
cualquier devolución no autorizada.
58
Manual de ensamblaje/del usuario
Garantía
Quién está cubierto
Esta garantía solo tiene validez para el comprador original y no es transferible ni aplicable a ninguna otra persona.
Qué está cubierto
Nautilus, Inc. garantiza que este producto está libre de defectos de materiales y de mano de obra, si se usa para el fin para el que ha sido diseñado, bajo condiciones normales,
siempre y cuando reciba el cuidado y el mantenimiento correctos como se describe en el Manual de ensamblaje y del usuario del producto. Esta garantía solo es válida para
máquinas auténticas, originales y legítimas fabricadas por Nautilus, Inc., las cuales se venden a través de un agente autorizado y se usan en Estados Unidos o Canadá.
Plazos
•
Armazón
3 años
•
Piezas mecánicas
3 años
•
Electrónica
3 años
•
Todos los demás componentes
3 años
•
Mano de obra
90 días
(La asistencia de mano de obra no incluye la instalación de piezas de repuesto incluidas en el ensamblaje inicial del producto ni en los servicios de mantenimiento preventivo.
Todas las reparaciones cubiertas en la sección de mano de obra de la garantía deben ser autorizadas previamente por Nautilus. El cliente será responsable de un cargo mínimo por
el traslado).
Cómo respaldará Nautilus la garantía
Según las condiciones de la cobertura de garantía, Nautilus, Inc. reparará cualquier máquina cuyos defectos de materiales o de mano de obra estén comprobados. Nautilus se
reserva el derecho de reemplazar el producto en el supuesto caso de que una reparación sea imposible. Cuando Nautilus decida que un reemplazo constituye el recurso correcto,
Nautilus podrá aplicar un reembolso de crédito limitado para adquirir otro producto marca Nautilus, Inc., según nuestro criterio. El reembolso quizá se prorratee según el período
de duración de la propiedad. Nautilus, Inc. proporciona servicio de reparación dentro de áreas metropolitanas importantes. Nautilus, Inc. se reserva el derecho de cobrar al
cliente por el traslado fuera de estas áreas. Nautilus Inc. no se hace responsable por los gastos de mano de obra o mantenimiento que efectúe el distribuidor después del período
de garantía vigente establecido aquí. Nautilus, Inc. se reserva el derecho de sustituir materiales, piezas o productos de igual o mejor calidad, si no hay materiales o productos
idénticos disponibles en el momento del servicio conforme a esta garantía. Ningún reemplazo del producto según los términos de la Garantía extiende de manera alguna el período
de la Garantía. Cualquier reembolso de crédito limitado quizá se prorratee según el período de duración de la propiedad. ESTOS SON LOS ÚNICOS Y EXCLUSIVOS RECURSOS PARA
CUALQUIER INCUMPLIMIENTO DE LA GARANTÍA.
Qué debe hacer
•
Conservar un comprobante de compra adecuado y aceptable.
•
Hacer funcionar, mantener e inspeccionar el producto según lo especificado en la documentación del producto (Manual de ensamblaje, Manual del usuario, etc.).
•
El producto debe usarse exclusivamente para el fin para el que ha sido diseñado.
•
Notificar a Nautilus en el lapso de 30 días después de detectar un problema con el producto.
•
Instalar piezas o componentes de repuesto en conformidad con cualquier instrucción de Nautilus.
•
Efectuar los procedimientos de diagnóstico junto a un representante capacitado de Nautilus, Inc. en caso de solicitarlo.
Qué no está cubierto
•
Daños debidos al maltrato, alteración o modificación del producto, error al seguir debidamente las instrucciones de ensamblaje, las instrucciones de mantenimiento o
las advertencias de seguridad como aparecen en la documentación del producto (Manual de ensamblaje, Manual del usuario, etc.), daños debidos a un almacenamiento
indebido o al efecto de las condiciones medioambientales como la humedad o el clima, mal uso, mal manejo, accidente, desastres naturales, sobrecargas de energía.
•
Una máquina ubicada o utilizada en un entorno comercial o institucional. Esto incluye gimnasios, corporaciones, lugares de trabajo, clubes, centros de acondicionamiento
físico y cualquier entidad, pública o privada, que tenga una máquina para uso de sus miembros, clientes, empleados o afiliados.
•
Daños provocados por exceder el peso máximo del usuario, como se define en el Manual del usuario o en la etiqueta de advertencia del producto.
•
Daños debidos al uso, desgaste y rotura normales.
•
Esta garantía no se extiende a ningún territorio o país fuera de Estados Unidos o Canadá.
Cómo obtener servicio
Para los productos comprados directamente en Nautilus, Inc., comuníquese con la oficina de Nautilus que figura en la página de contactos del Manual del usuario del producto.
Es posible que se le solicite que devuelva el componente defectuoso, por su cuenta, a una dirección específica para su reparación o inspección. El envío normal por tierra de
cualquier pieza de repuesto de la garantía será pagado por Nautilus, Inc. En el caso de productos comprados en una tienda minorista, es posible que se le pida que se comunique
con dicha tienda para recibir asistencia de garantía.
Exclusiones
Las garantías precedentes son las únicas y exclusivas garantías expresas hechas por Nautilus, Inc. Reemplazan cualquier declaración anterior, contraria o adicional, ya sea verbal
o escrita. Ningún agente, representante, distribuidor, persona o empleado tiene autoridad para alterar o aumentar las obligaciones o limitaciones de esta garantía. La duración de
cualquier garantía implícita, incluida la GARANTÍA DE COMERCIABILIDAD y cualquier GARANTÍA DE ADECUACIÓN PARA UN PROPÓSITO DETERMINADO, está limitada al plazo de
la garantía expresa aplicable que se indicó anteriormente, la que sea más larga. Algunos estados no permiten limitaciones en la duración de una garantía implícita, de modo que
quizá la limitación anterior no se aplique a usted.
Limitación de recursos
A MENOS QUE LA LEY VIGENTE ESTIPULE LO CONTRARIO, EL RECURSO EXCLUSIVO DEL COMPRADOR SE LIMITA A LA REPARACIÓN O EL REEMPLAZO DE CUALQUIER
COMPONENTE QUE NAUTILUS, INC. CONSIDERE DEFECTUOSO SEGÚN LOS TÉRMINOS Y CONDICIONES QUE AQUÍ SE INDICAN. EN NINGÚN CASO, NAUTILUS, INC. SERÁ
RESPONSABLE POR NINGÚN DAÑO ESPECIAL, CONSECUENTE, INDIRECTO, INCIDENTAL O ECONÓMICO, SIN IMPORTAR LA TEORÍA DE LA RESPONSABILIDAD (INCLUIDOS,
ENTRE OTROS, LA RESPONSABILIDAD DE PRODUCTOS, NEGLIGENCIA U OTRO AGRAVIO) NI POR NINGUNA PÉRDIDA DE INGRESOS, GANANCIA, DATOS, PRIVACIDAD O DAÑOS
PUNITIVOS QUE SURJAN DE, O ESTÉN RELACIONADOS CON, EL USO DE LA MÁQUINA DE EJERCICIOS, INCLUSO SI A NAUTILUS, INC. SE LE HA DADO AVISO DE LA POSIBILIDAD
DE DICHOS DAÑOS. ESTA EXCLUSIÓN Y LIMITACIÓN DEBERÁ APLICARSE INCLUSO SI ALGÚN RECURSO FALLA EN SU OBJETIVO ESENCIAL. ALGUNOS ESTADOS NO PERMITEN
LA EXCLUSIÓN O LIMITACIÓN DE LOS DAÑOS CONSECUENTES O INCIDENTALES, DE MODO QUE QUIZÁ LA LIMITACIÓN ANTERIOR NO SE APLIQUE A USTED.
Leyes estatales
Esta garantía le da derechos legales específicos. Es posible que usted tenga otros derechos, los cuales varían de un estado a otro.
Vencimientos
Si la garantía ha vencido, Nautilus, Inc. puede ayudar con los reemplazos o reparaciones de las piezas y la mano de obra, pero habrá un cargo por dichos servicios. Llame a una
oficina de Nautilus para obtener información sobre piezas y servicios posteriores a la garantía. Nautilus no garantiza la disponibilidad de las piezas de repuesto después del
vencimiento del período de garantía.
Compras internacionales
Si compró su máquina fuera de Estados Unidos, consulte a su distribuidor o comerciante local en cuanto a la cobertura de la garantía.
59
Manual de ensamblaje/del usuario
8008003.071518.F
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising