Bradford White BWCH0500 Copper Brute II Boiler (BWCH) Manual

Bradford White BWCH0500 Copper Brute II Boiler (BWCH) Manual
Installation and Operation Instructions
Document 1392A
,QVWDOODWLRQDQG2SHUDWLRQ
,QVWUXFWLRQVIRU
Copper Brute™ II
includes Low Temp Copper Brute ll
Hydronic Boiler
Model BWCH
Water Heater
Model BWCV
Sizes 500-2000
865HJ
FOR YOUR SAFETY: This product must be installed and serviced by a professional service technician,
TXDOL¿HGLQKRWZDWHUERLOHULQVWDOODWLRQDQGPDLQWHQDQFH,PSURSHULQVWDOODWLRQDQGRURSHUDWLRQFRXOG
FUHDWHFDUERQPRQR[LGHJDVLQÀXHJDVHVZKLFKFRXOGFDXVHVHULRXVLQMXU\SURSHUW\GDPDJHRUGHDWK
,PSURSHULQVWDOODWLRQDQGRURSHUDWLRQZLOOYRLGWKHZDUUDQW\)RULQGRRULQVWDOODWLRQVDVDQDGGLWLRQDO
measure of safety, Laars strongly recommends installation of suitable Carbon Monoxide detectors in the
YLFLQLW\RIWKLVDSSOLDQFHDQGLQDQ\DGMDFHQWRFFXSLHGVSDFHV
WARNING
If the information in this manual is not
IROORZHGH[DFWO\D¿UHRUH[SORVLRQPD\
UHVXOWFDXVLQJSURSHUW\GDPDJHSHUVRQDO
injury or loss of life.
H2380100A
Do not store or use gasoline or other
ÀDPPDEOHYDSRUVDQGOLTXLGVLQWKHYLFLQLW\
RIWKLVRUDQ\RWKHUDSSOLDQFH
WHAT TO DO IF YOU SMELL GAS
‡ 'RQRWWU\WROLJKWDQ\DSSOLDQFH
• Do not touch any electrical switch; do not
XVHDQ\SKRQHLQ\RXUEXLOGLQJ
‡ ,PPHGLDWHO\FDOO\RXUJDVVXSSOLHUIURPD
QHDUE\SKRQH)ROORZWKHJDVVXSSOLHU V
instructions.
‡ ,I\RXFDQQRWUHDFK\RXUJDVVXSSOLHUFDOO
WKH¿UHGHSDUWPHQW
,QVWDOODWLRQDQGVHUYLFHPXVWEHSHUIRUPHG
E\DTXDOL¿HGLQVWDOOHUVHUYLFHDJHQF\RUJDV
VXSSOLHU
AVERTISSEMENT
$VVXUH]YRXVGHELHQVXLYUHVOHVLQVWUXFWLRQV
GRQQpHVGDQVFHWWHQRWLFHSRXUUpGXLUHDX
PLQLPXPOHULVTXHG¶LQFHQGLHRXG¶H[SORVLRQ
RXSRXUpYLWHUWRXWGRPPDJHPDWpULHOWRXWH
EOHVVXUHRXODPRUW
1HSDVHQWUHSRVHUQLXWLOLVHUG¶HVVHQFHQL
G¶DXWUHVYDSHXUVRXOLTXLGHVLQÀDPPDEOHVGDQV
OHYRLVLQDJHGHFHWDSSDUHLORXGHWRXWDXWUH
DSSDUHLO
QUE FAIRE SI VOUS SENTEZ UNE ODEUR DE GAZ:
‡ 1HSDVWHQWHUG¶DOOXPHUG¶DSSDUHLOV
‡ 1HWRXFKH]jDXFXQLQWHUUXSWHXU1HSDVYRXV
VHUYLUGHVWpOpSKRQHVGDQVOHEkWLPHQWRYRXV
YRXVWURXYH]
‡ $SSHOH]LPPpGLDWHPHQWYRWUHIRXUQLVVHXUGH
JD]GHSXLVXQYRLVLQ6XLYH]OHVLQVWUXFWLRQVGX
fournisseur.
‡ 6LYRXVQHSRXYH]UHMRLQGUHOHIRXUQLVVHXUGH
JD]DSSHOH]OHVVHUYLFHGHVLQFHQGLHV
/¶LQVWDOODWLRQHWO¶HQWUHWLHQGRLYHQWrWUHDVVXUpVSDU
XQLQVWDOODWHXURXXQVHUYLFHG¶HQWUHWLHQTXDOL¿pRX
SDUOHIRXUQLVVHXUGHJD]
BRADFORD WHITE CORP.
Page 2
TABLE OF CONTENTS
SECTION 1 General Information ............................4
%
)UHH]H3URWHFWLRQ±:DWHU+HDWHU ........................ 25
1.A
Introduction ............................................................... 4
%
)LOOLQJWKH:DWHU+HDWHU6\VWHP ............................. 30
1.B
Warranty ................................................................... 5
&
0RGHO,GHQWL¿FDWLRQ 1RPHQFODWXUH ......................... 5
SECTION 5 Electrical Connections .....................31
'
'LPHQVLRQV ............................................................... 6
$
,QVWDOODWLRQ:DUQLQJV .............................................. 31
1.E
Locating the Appliance ............................................. 7
%
/LQH9ROWDJH&RQQHFWLRQV ....................................... 31
)
/RFDWLQJ3XPS0RXQWHG:DWHU+HDWHUZLWK
5HVSHFWWR6WRUDJH7DQN V ...................................... 7
%
0DLQ3RZHU............................................................. 31
%
3XPS3RZHU ........................................................... 31
*
/RFDWLQJ3XPS0RXQWHG%RLOHUZLWK5HVSHFW
WR5HWXUQ6XSSO\+HDGHU .......................................... 7
%
%RLOHU+HDWHU3XPS ............................................... 31
+
/RFDWLQJ$SSOLDQFHIRU&RUUHFW+RUL]RQWDO
9HQW'XFWHG$LU'LVWDQFH)URP2XWVLGH:DOO ........... 8
%
$X[LOLDU\3RZHU2XWSXW ........................................... 32
&
/RZ9ROWDJH&RQQHFWLRQV ....................................... 32
&
)LHOG:LULQJ,QSXWV................................................ 32
,
,QVWDOODWLRQ.LW ........................................................... 8
6(&7,219HQWLQJDQG&RPEXVWLRQ$LU .............9
&D 6DIHW\,QWHUORFNV ..................................................... 32
&E %RLOHU+HDWHU+HDW'HPDQGV.................................. 32
$
&RPEXVWLRQ$LU ......................................................... 9
&F )LHOG,QSXWV 2SHQ&ORVHG ..................................... 32
$
&RPEXVWLRQ$LU)URP5RRP ..................................... 9
&G 7HPSHUDWXUH6HQVRUV ............................................. 32
$
,QWDNH&RPEXVWLRQ$LU .............................................. 9
&H $QDORJ %$6 ,QSXW ................................................. 33
2.B
Venting.................................................................... 10
&
%
9HQW&DWHJRULHV ...................................................... 10
&D 'U\&RQWDFWV ........................................................... 33
2.B.2
Category I Vent ....................................................... 10
&E &DVFDGH56 ..................................................... 34
%
&RPPRQ9HQWLQJ6\VWHPV ......................................11
&F %
$656 %$&QHW0673RU0RGEXV ............... 34
2.B.4
Category III Vent ..................................................... 13
5.C.2.d
24VAC .................................................................... 34
&
/RFDWLQJ9HQW &RPEXVWLRQ$LU7HUPLQDOV............. 13
'
&DVFDGH:LULQJ&RQQHFWLRQV ................................. 35
&
6LGH:DOO9HQW7HUPLQDO .......................................... 13
(
:
LULQJ'LDJUDP ...................................................... 36
&
6LGH:DOO&RPEXVWLRQ$LU7HUPLQDO......................... 15
)
/
DGGHU'LDJUDP ...................................................... 38
&
9HUWLFDO9HQW7HUPLQDO ............................................. 15
&
9HUWLFDO&RPEXVWLRQ$LU7HUPLQDO ............................ 15
'
&RPPRQ9HQW7HVW²%RLOHUV................................. 15
(
9HQW7HUPLQDOVIRU2XWGRRU8QLWV............................ 16
6(&7,21*DV6XSSO\DQG3LSLQJ .....................17
$
*DV6XSSO\DQG3LSLQJ ........................................... 17
)LHOG:LULQJ2XWSXWV ............................................ 33
6(&7,217RXFKVFUHHQDQG6\VWHP2SV ........40
6.A
The Home Screen ................................................. 40
$
+RPH6FUHHQ6WDWXV:LQGRZ................................. 40
$
+RPH6FUHHQ$FWLYH,FRQV ..................................... 41
%
/2*,1/RFN8QORFN'LVSOD\6FUHHQ ................ 42
&
.H\SDG2SHUDWLRQV............................................... 43
6.D
Quick Start .......................................................... 44
SECTION 4 Water Connections BOILER
or WATER HEATER ................18
'
&+'+: ............................................................... 44
4.A
Boiler ..................................................................... 18
'E &+'+: .......................................................... 44
$
+
HDWLQJ6\VWHP3LSLQJ
+RW6XSSO\&RQQHFWLRQV²%RLOHU .......................... 18
'
'+:'+: .......................................................... 45
'
2XWGRRU5HVHW ....................................................... 45
'
:DUP:HDWKHU6KXW'RZQ ................................... 45
'
$QWL6KRUW&\FOH..................................................... 46
'
7LPH 'DWH........................................................... 46
$
&ROG:DWHU0DNH8S²%RLOHU ............................... 18
$
:DWHU)ORZ5HTXLUHPHQWV²%RLOHU ........................ 18
$
:
DWHU)ORZ5HTXLUHPHQWV²
/RZ7HPSHUDWXUH&RSSHU%UXWHOO%RLOHUV .............. 18
$
)UHH]H3URWHFWLRQ²%RLOHU .................................... 19
$
)LOOLQJWKH%RLOHU6\VWHP ......................................... 22
4.B
Water Heaters ....................................................... 24
%
:
DWHU6\VWHP3LSLQJ²:DWHU+HDWHU .................... 24
%
+
RW:DWHU6XSSO\3LSLQJ²:DWHU+HDWHU............... 25
%
:
DWHU)ORZ5HTXLUHPHQWV²:DWHU+HDWHU ............ 25
%
&
RPELQHG:DWHU+HDWLQJ SRWDEOH DQG
6SDFH+HDWLQJ²:DWHU+HDWHU ............................. 25
'D &+'+: .......................................................... 44
(
&RQ¿JXUH6FUHHQ ......................................47
(
&+'+: ................................................................ 47
(D &+'+: ............................................................. 47
(E $GGLWLRQDO6HWWLQJV ................................................. 50
(
&+'+: ............................................................. 50
(
'+:'+: .......................................................... 51
(
2XWGRRU5HVHW ....................................................... 51
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 3
(
&RQ¿JXUH6FUHHQ(continued)
SECTION 8 Burner Set Up ....................................73
6.E.5
Cascade ........................................................... 53
$
6HW8SIRUWR)HHW$OWLWXGH .......................... 73
%
6HW8SIRU+LJK$OWLWXGH !)HHW .................. 73
(D &RQ¿JXUH/HDG8QLW................................................ 53
(E &RQ¿JXUH/DJ8QLW.................................................. 54
(F &DVFDGH&+ ........................................................... 55
(G &DVFDGH'+: ........................................................ 56
(H &DVFDGH5RWDWLRQ .................................................. 56
(I
&DVFDGH5HGXQGDQF\ ............................................ 57
(J &DVFDGH+\EULG .................................................... 57
(
3XPSV ................................................................... 58
(
)LULQJ5DWH ............................................................. 58
(
7HPS/LPLWV ........................................................... 59
(
([WHUQDO ................................................................. 59
(D ([WHUQDO±5HPRWH6HW3RLQW .................................. 60
(E ([WHUQDO)LULQJ5DWH ................................................ 61
(
6HWWLQJWKH7LPHDQG'DWH ..................................... 62
6.E.11
Miscellaneous Features ................................. 62
(D 0L[LQJ9DOYH/RZ7HPS&RSSHU%UXWHOO ............... 62
(E $QWL6KRUW&\FOH..................................................... 63
(F :LUHOHVV6HWXS ....................................................... 63
(G :DUP:HDWKHU....................................................... 63
(H &203RUW............................................................... 64
(I 7HPSHUDWXUH&RQYHUVLRQ ....................................... 65
(J )URVW3URWHFWLRQ ..................................................... 65
(
/RJLQ ...................................................................... 65
6.F
Service Screens .................................................... 66
)
%XUQHU ..................................................................... 66
)
'LJLWDO,2 ,QSXW2XWSXW .................................... 66
)
$QDORJ,2............................................................... 67
)
6FUHHQ6HWWLQJV ...................................................... 67
)
+LVWRU\ .................................................................... 68
)
5HVWDUW .................................................................... 68
)
)DFWRU\5HVHW ......................................................... 68
6.G
Messages and USB .............................................. 68
6.G.1
Messages ............................................................... 68
*
86%)XQFWLRQDOLW\ ................................................... 69
6.H
Active Demands.................................................... 70
6.I
The Navigation Bar ............................................... 70
6.J
Date and Time Display Area ................................ 70
SECTION 7 Sequence of Operation ...................71
$
5HVWDUWLQJWKH&RSSHU%UXWHOO ................................ 71
%
6HTXHQFHRI2SHUDWLRQ .......................................... 71
&
6KXWWLQJ'RZQWKH&RSSHU%UXWHOO ......................... 72
SECTION 9 Maintenance ......................................75
$
6\VWHP0DLQWHQDQFH .............................................. 75
%
$SSOLDQFH0DLQWHQDQFHDQG&RPSRQHQW'HVFULSWLRQ75
%
%XUQHUV ................................................................... 75
%
)LOWHU........................................................................ 75
%
*DV9DOYHV ............................................................. 75
%
0DQXDO5HVHW+LJK/LPLW&RQWURO ............................ 75
%
$XWRPDWLF5HVHW+LJK/LPLW&RQWURO........................ 76
%
&RQWUROOHU ................................................................ 76
%
,JQLWRUV .................................................................... 77
%
,JQLWLRQ6HQVRUV ...................................................... 77
%
7UDQVIRUPHU ............................................................ 77
%
%ORZHUV ................................................................... 77
%
)ORZ6ZLWFK ............................................................ 77
%
+HDW([FKDQJHU&RLO.............................................. 77
SECTION 10 Trouble Shooting ............................78
$
5HVROYLQJ/RFNRXWV ................................................ 78
%
'HOD\HG,JQLWLRQ²3RVVLEOH&DXVHV ..................... 79
&
6KRUW&\FOLQJ²%RLOHU ........................................... 79
'
6KRUW&\FOLQJ²:DWHU+HDWHU ............................... 79
(
+LJK*DV&RQVXPSWLRQ .......................................... 79
)
7
URXEOHVKRRWLQJ(UURUVDQG/RFNRXWV..................... 80
*
3
DUDPHWHU7DEOHV ................................................... 82
*
%
RLOHU3DUDPHWHUV LQFOXGLQJ/RZ7HPS ................ 82
*
:
DWHU+HDWHU3DUPHWHUV LQFOXGLQJ/RZ7HPS ...... 86
*
0
RGEXV0HPRU\0DS ............................................. 90
*
%$&QHW06730HPRU\0DS .................................. 92
SECTION 11 Replacement Parts .........................94
$
*HQHUDO,QIRUPDWLRQ ................................................ 94
%
3DUWV/LVW................................................................. 94
&
3DUWV,OOXVWUDWLRQV .................................................. 100
BRADFORD WHITE CORP.
Page 4
SECTION 1
General Information
USING THIS MANUAL – Because the
Copper Brute ll Boilers and Copper Brute ll Water
Heaters are identical appliances, with the exception
of materials of manufacture, labels and ultimate
use application, this manual provides information
for the proper installation, operation and
maintenance of both products. Where differences
exist between the application of the appliances and
their operation, the sections pertinent to only one
DSSOLDQFHRUWKHRWKHUZLOOEHVRLGHQWL¿HG
In the Commonwealth of Massachusetts, this
appliance must be installed by a licensed plumber or
JDV¿WWHU
1.A
Introduction
This manual provides information necessary
for the installation, operation, and maintenance of
Bradford White Copper Brute ll appliances (including
WKH/RZ7HPS&RSSHU%UXWHOO 5HDGWKLVPDQXDO
FDUHIXOO\EHIRUHLQVWDOODWLRQ
All application and installation procedures
should be reviewed completely before proceeding
ZLWKWKHLQVWDOODWLRQ&RQVXOWWKH%UDGIRUG:KLWH
factory, or local factory representative, with any issues
RUTXHVWLRQVUHJDUGLQJWKLVHTXLSPHQW([SHULHQFH
has shown that most operating issues are caused by
LPSURSHULQVWDOODWLRQ
The Copper Brute ll appliance is protected
DJDLQVWRYHUSUHVVXUL]DWLRQ$SUHVVXUHUHOLHIYDOYH
LV¿WWHGWRDOODSSOLDQFHV,WLVLQVWDOOHGRQWKHRXWOHW
KHDGHUDWWKHZDWHURXWOHWRIWKHDSSOLDQFH
,03257$177KHLQOHWJDVSUHVVXUHWRWKHDSSOLDQFH
PXVWQRWH[FHHGZF N3D All installations must be made in accordance with:
,QWKH86WKH1DWLRQDO)XHO*DV
&RGH$16,=1)3$/DWHVW(GLWLRQDQGDOO
applicable local codes as required by the Authorities
Having Jurisdiction (AHJ), or
,Q&DQDGDWKH1DWXUDO*DVDQG3URSDQH
,QVWDOODWLRQ&RGH&6$%ODWHVWHGLWLRQDQGDOO
DSSOLFDEOHORFDOFRGHVDVUHTXLUHGE\WKH$+-
All electrical wiring is to be done in accordance with:
,QWKH86WKH1DWLRQDO(OHFWULFDO&RGH
1(& $16,1)3$ODWHVW(GLWLRQDQGDOO
applicable local codes as required by the AHJ, or
,Q&DQDGDWKH³&DQDGLDQ(OHFWULFDO&RGH
3DUW´&6$67'&DQGDOODSSOLFDEOHORFDO
FRGHVDVUHTXLUHGE\WKH$+-
This appliance must be electrically grounded in
accordance with the applicable codes and standards
UHIHUHQFHGDERYH
WARNING
7KH&RSSHU%UXWHOOK\GURQLFERLOHURUZDWHU
heater mustEHLQVWDOOHGLQDFFRUGDQFHZLWKWKH
SURFHGXUHVGHWDLOHGLQWKLVPDQXDORUWKH%UDGIRUG
:KLWHZDUUDQW\PD\EHYRLGHG7KHLQVWDOODWLRQPXVW
FRQIRUPWRWKHUHTXLUHPHQWVRIWKHORFDOMXULVGLFWLRQ
KDYLQJDXWKRULW\DQGLQWKH8QLWHG6WDWHVWRWKH
ODWHVWHGLWLRQRIWKH1DWLRQDO)XHO*DV&RGH$16,
=1)3$,Q&DQDGDWKHLQVWDOODWLRQPXVW
FRQIRUPWRWKHODWHVWHGLWLRQRIWKH1DWXUDO*DV
DQG3URSDQH,QVWDOODWLRQ&RGH&6$%DQG
RUORFDOFRGHV:KHUHUHTXLUHGE\WKHDXWKRULW\
KDYLQJMXULVGLFWLRQWKHLQVWDOODWLRQRI&RSSHU%UXWH
OODSSOLDQFHVPXVWFRQIRUPWRWKH6WDQGDUGIRU
&RQWUROVDQG6DIHW\'HYLFHVIRU$XWRPDWLFDOO\)LUHG
%RLOHUV$16,$60(&6'$Q\PRGL¿FDWLRQVWR
WKHERLOHULWVJDVFRQWUROVRUZLULQJPD\YRLGWKH
ZDUUDQW\,I¿HOGFRQGLWLRQVUHTXLUHPRGL¿FDWLRQV
FRQVXOWWKHIDFWRU\UHSUHVHQWDWLYHEHIRUHLQLWLDWLQJ
VXFKPRGL¿FDWLRQV
AVERTISSEMENT
$¿QGHUpGXLUHDXPLQLPXPOHVULVTXHVGH
FRPPRWLRQpOHFWULTXHGHIHXRXG¶DXWUHQDWXUHTXL
SRXUUDLHQWFDXVHUGHVGRPPDJHVPDWpULHOVGHV
EOHVVXUHVRXGHVDFFLGHQWVPRUWHOVOHVFKDXGLqUHV
jHDXFKDXGHRXOHVFKDXIIHHDX&RSSHU%UXWHOO
GRLYHQWrWUHLQVWDOOpVFRQIRUPpPHQWDX[GLUHFWLYHV
GpWDLOOpHVFRQWHQXHVGDQVFHPDQXHOjGpIDXWGH
TXRLODJDUDQWLHIRXUQLHSDU%UDGIRUG:KLWHVHUDLW
DQQXOpH/¶LQVWDOODWLRQGRLWrWUHFRQIRUPHDX[
H[LJHQFHVGHODUpJOHPHQWDWLRQORFDOHHQYLJXHXU
HWDX[eWDWV8QLVjO¶pGLWLRQODSOXVUpFHQWH
GX1DWXUDO)XHO*DV&RGH &RGHSRXUOHJD]
FRPEXVWLEOHQDWXUHO $16,=1)3$Au
&DQDGDO¶LQVWDOODWLRQGRLWUHVSHFWHUOHVH[LJHQFHV
GHODSOXVUpFHQWHpGLWLRQGX&RGHG¶LQVWDOODWLRQGX
JD]QDWXUHOHWGXSURSDQH&6$%HWRXGHV
FRGHVORFDX[GHFRQVWUXFWLRQHQYLJXHXU/RUVTXH
ODUpJOHPHQWDWLRQORFDOHO¶H[LJHO¶LQVWDOODWLRQGHV
DSSDUHLOVpOHFWURPpQDJHUV&RSSHU%UXWHOOGRLW
UHVSHFWHUOHVH[LJHQFHVGX6WDQGDUGIRU&RQWUROV
DQG6DIHW\'HYLFHVIRU$XWRPDWLFDOO\)LUHG%RLOHUV
&RGHSRXUOHVpTXLSHPHQWVGHFRPPDQGHHWGH
VpFXULWpGHVFKDXGLqUHVjFRPEXVWLRQDXWRPDWLTXH $16,$60(&6'7RXWHPRGL¿FDWLRQDSSRUWpHj
ODFKDXGLqUHDX[UpJXODWHXUVGHJD]RXDXFkEODJH
SHXWFRPSURPHWWUHODJDUDQWLH6LFHUWDLQHV
FRQGLWLRQVSDUWLFXOLqUHVUHQGHQWGHVDGDSWDWLRQV
QpFHVVDLUHVFRQVXOWHUXQUHSUpVHQWDQWGXIDEULFDQW
DYDQWG¶HQWUHSUHQGUHFHVPRGL¿FDWLRQV
Page 5
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
1.B
Warranty
6RPHDFFHVVRU\LWHPVDUHVKLSSHGLQVHSDUDWH
SDFNDJHV9HULI\UHFHLSWRIDOOSDFNDJHVOLVWHGRQ
WKHSDFNLQJVOLS,QVSHFWHYHU\WKLQJIRUGDPDJH
immediately upon delivery, and advise the carrier of
DQ\VKRUWDJHVRUGDPDJH$Q\VXFKFODLPVVKRXOGEH
¿OHGZLWKWKHFDUULHU7KHFDUULHUQRWWKHVKLSSHULV
responsible for shortages and damage to the shipment
ZKHWKHUYLVLEOHRUFRQFHDOHG
Bradford White’ appliances are covered by
DOLPLWHGZDUUDQW\2ZQHUVVKRXOGVXEPLWRQOLQH
warranty registration at www.BradfordWhite.com
All warranty claims must be made to an authorized
Bradford White representative, directly to Customer
6HUYLFHRURQOLQHDWwww.BradfordWhite.com
Claims must include the serial number and model
number (this information can be found on the rating
SODWH LQVWDOODWLRQGDWHDQGQDPHRIWKHLQVWDOOHU
6KLSSLQJFRVWVDUHQRWLQFOXGHGLQWKHZDUUDQW\
FRYHUDJH
0RGHO,GHQWL¿FDWLRQ 1RPHQFODWXUH
1.C
1
2
3
B
W
C
4
6(5,(6
B
W
C
5
6
7
6,=(
0%78K
8
9
10
11
A
C
H -+<'521,&
V - 92/80(:$7(5
1 2 5 0
1 5 0 0
1 7 5 0
14
/2&$7,21
5(9,6,21
C
,1'225
287'225
3
7+,5'
REV
)8(/
K -67$*( 3 3523$1(
N -67$*( &RQVXOWWKHUDWLQJSODWHRQWKHXQLW7KH
following information describes the model number
VWUXFWXUH
L - 67$*( +/:67$03 %:&9RQO\
2 - */$66/,1('&$67
,521&233(5%5=
75,0
5 - */$66/,1('&$67
,521&81,&.(/
%5=75,0
237,216&2'(
X - 67$1'$5'
J - &6')0
*$3,/
),5,1*02'(
N - 1$785$/
2 0 0 0
15
16
3
$/7,78'(
0 7 5 0
1 0 0 0
13
A - 0 5 0 0
86$*(
12
B -
C -
N -
3
+($7(;&+$1*(5
*/$66/,1('&$67
,521&233(5%5=
75,0 VWGRQ%:&9
*/$66/,1('&$67
,521&233(5
VWGRQ%:&+
QRWDYDLORQ%:&9
*/$66/,1('&$67
,521&81,&.(/
QRWDYDLORQ%:&9
*/$66/,1('&$67
,521&81,&.(/
%5=75,0
3803237,216
X - 123803
H -380307'7$&2
+$5':$7(5
3803 %:&9
N -380307'7$&2
1250:$7(5
3803 %:&9%:&+
S - 380307'7$&2
62)7:$7(5
3803 %:&9
C -380307'% *
+$5':$7(5
3803 %:&9
B -380307'% *
1250:$7(5
3803 %:&9%:&+
D -380307'% *
62)7:$7(5
3803 %:&9
Model Character Designation
1-3
4
5-8
9
Model Series Designation
%:& %UDGIURG:KLWH&RSSHU%UXWH,,
Usage
+ +\GURQLF
9 9ROXPH:DWHU
Size
%78KLQSXW
%78KLQSXW
%78KLQSXW
%78KLQSXW
%78KLQSXW
%78KLQSXW
%78KLQSXW
Fuel
1 1DWXUDO*DV
P = Propane
10 Altitude
$ IHHW
11 Location
& ,QGRRUDQG2XWGRRU
12
14
Firing Mode
. 7ZRVWDJH PRGHOV 1 7KUHHVWDJH PRGHO
/ )RXUVWDJH PRGHOV
5HYLVLRQ
7KLUGYHUVLRQ
Heat Exchanger
% *ODVVOLQHG&,FRSSHUEU]WULP VWG%:&9
& *ODVVOLQHGFDVWLURQFRSSHU VWDQGDUG%:&+
1 *ODVVOLQHGFDVWLURQFXQLFNHO
3 *ODVVOLQHGFDVWLURQFXQLFNHOEU]WULP
2SWLRQ&RGH
; 6WDQGDUGXQLW
- &6')0,5,,/
3XPS2SWLRQV
; 1R3XPS
+ 3XPSPRXQWHG7$&2KDUGZDWHUSXPS
1 3XPSPRXQWHG7$&2QRUPDOSXPS
6 3XPSPRXQWHG7$&2VRIWZDWHUSXPS
& 3XPSPRXQWHG% *KDUGZDWHUSXPS
% 3XPSPRXQWHG% *QRUPDOSXPS
' 3XPSPRXQWHG% *VRIWZDWHUSXPS
BRADFORD WHITE CORP.
Page 6
1.D
Dimensions
Ø
Ø
6+,33,1*:(,*+7
6+,33,1*
:(,*+7*
6,=(
OEV
OEV
kg
500
750
1000
1250
1500
1750
2000
640
735
830
925
1020
1115
1210
290
333
376
420
463
506
549
$GGWROEV
WR OEV 34 to 91 kg *$GG
GHSHQGLQJ RQ VL]H
GHSHQGLQJRQVL]H
IRUSXPSPRXQWHGXQLWV
6L]H
A
B
C
'
(
)
*
H
Air
&RQQ
W*
9HQW
&RQQ
9
+RUL]
9HQW
3LSH
8
33½
85
15¾
40
5¾
15 29¾ 76 33¾
86 7¾ 20 8¾ 22
46
117
6
15
20
6
15
45½
116
21¾
55
5¾
15 29¾ 76 33¾
86 7¾ 20 8¾ 22
58
147
8
20 10 25
8
20
57½
146
28¾
73
5¾
15 29¾ 76 33¾
86 7¾ 20
18
70
178
8
20 10 25
8
20
86
10 »
68
172
34
18
7
26 30¾ 78
31 »
79 8¾ 22 8¾ 22
80
203 12 30 12 30 10 25
18
78½
199
39¾
101
10 »
26 30¾ 78
31 »
79 8¾ 22 8¾ 22
91
231 12 30 12 30 10 25
89
226
44½
113
101»8 26 30¾ 78
311»8
79 8¾ 22 8¾ 22 101
256 12 30 14 36 12 30
126
10 »
31 »
79 8¾ 22 8¾ 22
284 12 30 14 36 12 30
99½
253
49¾
18
18
26 30¾ 78
18
18
112
$LUDQGYHQWFRQQHFWLRQVPD\EHRQWRSRUEDFNRIWKHXQLWDQGDUH¿HOGFRQYHUWLEOH'LPHQVLRQVLQinches cm
Figure 1. Dimensional Data.
Page 7
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6,=(
500
750
1000
1250
1500
1750
2000
9(17&2//$5
6,=(
in.
8
10
10
12
12
14
14
cm
20
25
25
30
30
36
36
+25,=217$/
9(173,3(
',$0(7(5
,17$.($,5
3,3(
',$0(7(5
0$;3,3(
/(1*7+
in.
6
8
8
10
10
12
12
in.
6
8
8
12
12
12
12
ft.
50
50
50
50
50
50
50
cm
15
20
20
25
25
30
30
cm
15
20
20
30
30
30
30
0$;12
2)(/%2:6
6,'(:$//
9(17
7(50,1$/
3$57180%(5
6,'(:$//
&20%867,21
$,57(50,1$/
3$57180%(5
3
3
3
3
3
3
3
CA001401
CA001402
CA001402
CA001405
CA001405
CA001404
CA001404
CA20260701
CA20260703
CA20260703
CA20260706
CA20260706
CA20260706
CA20260706
m
15
15
15
15
15
15
15
7DEOH +RUL]RQWDO9HQW&RPEXVWLRQ$LU3DUDPHWHUV
1.E
/RFDWLQJWKH$SSOLDQFH
The appliance should be located to provide
FOHDUDQFHVRQDOOVLGHVIRUPDLQWHQDQFHDQGLQVSHFWLRQ
It should not be located in an area where leakage of
any connections will result in damage to the area
DGMDFHQWWRWKHDSSOLDQFHRUWRORZHUÀRRUVRIWKH
VWUXFWXUH
When such a location is not available, it is
recommended that a suitable drain pan, adequately
GUDLQHGEHLQVWDOOHGXQGHUWKHDSSOLDQFH
7KHDSSOLDQFHLVGHVLJQFHUWL¿HGE\&6$
,QWHUQDWLRQDOIRULQVWDOODWLRQRQFRPEXVWLEOHÀRRULQJ
LQEDVHPHQWVLQFORVHWVXWLOLW\URRPVRUDOFRYHV.
Copper Brute ll Boilers or Water Heaters must
never be installed on carpeting. The location for the
appliance should be chosen with regard to the vent
SLSHOHQJWKVDQGH[WHUQDOSOXPELQJ7KHXQLWVKDOOEH
installed such that the gas ignition system components
DUHSURWHFWHGIURPZDWHU GULSSLQJVSUD\LQJUDLQHWF during operation and service (circulator replacement,
FRQWUROUHSODFHPHQWHWF :KHQYHQWHGYHUWLFDOO\WKH
Copper Brute ll must be located as close as practical
WRDFKLPQH\RURXWVLGHZDOO,IWKHYHQWWHUPLQDODQG
or combustion air terminal terminate through a wall,
and there is potential for snow accumulation in the
local area, both terminals should be installed at an
DSSURSULDWHOHYHODERYHJUDGH
The dimensions and requirements that are shown
in 7DEOHshould be met when choosing the locations
IRUWKHDSSOLDQFH
1.F /RFDWLQJ3XPS0RXQWHG:DWHU
+HDWHUZLWK5HVSHFWWR6WRUDJH7DQN V
)RUEHVWUHVXOWVDSXPSPRXQWHG&RSSHU%UXWH
OOZDWHUKHDWHUVKRXOGEHORFDWHGZLWKLQIHHW P RIWKHVWRUDJHWDQN V 7KHSXPSLVVL]HGIRUIHHW
P RISLSLQJ
If the appliance must be installed with longer
piping runs, then larger diameter pipe or tubing shall
EHXVHG&RQVXOWWKHIDFWRU\IRUDVVLVWDQFH
1.G /RFDWLQJ3XPS0RXQWHG%RLOHUZLWK
5HVSHFWWR5HWXUQ6XSSO\+HDGHU
)RUWKHEHVWUHVXOWVDSXPSPRXQWHG&RSSHU
%UXWHOO%RLOHUVKRXOGEHORFDWHGZLWKLQIHHW P RIWKHVXSSO\DQGUHWXUQKHDGHUV7KHSXPSLVVL]HGIRU
IHHW P RISLSLQJ
If the appliance must be installed with longer
SLSLQJUXQVWKHQODUJHUGLDPHWHUWXELQJVKDOOEHXVHG
&RQVXOWWKHIDFWRU\IRUDVVLVWDQFH
$33/,$1&(
685)$&(
/HIW6LGH
5LJKW6LGH
7RS
%DFN
Front
Vertical
&DWHJRU\ Vent
+RUL]RQWDO
&DWHJRU\ 9HQW
5(48,5('
&/($5$1&()520
&20%867,%/(0$7(5,$/
5(&200(1'('
6(59,&($&&(66
&/($5$1&(
inches
cm
inches
1
1
1
1
1
2.5
2.5
2.5
2.5
2.5
24
24
12
12**
36
6*
15.2*
SHU8/YHQWLQJ
V\VWHPVXSSOLHU¶V
LQVWUXFWLRQV
FP ZKHQEYHQWLVXVHG
:KHQYHQWDQGRUFRPEXVWLRQDLUFRQQHFWVWRWKHEDFN
UHFRPPHQGHGFOHDUDQFHLV FP 7DEOH Clearances.
cm
61
61
30
30**
91
BRADFORD WHITE CORP.
Page 8
1.H
RFDWLQJ$SSOLDQFHIRU&RUUHFW
/
Horizontal Vent/Ducted Air Distance
From Outside Wall
7KHIRUFHGGUDIWFRPEXVWLRQDLUEORZHUEORZHUV
LQWKHDSSOLDQFHKDVKDYHVXI¿FLHQWSRZHUWRSXOODLU
and vent properly when the following guidelines for
horizontal air and vent are followed (see Table 1 on
SDJH NOTE:2QDOOPRGHOVL]HVWKHYHQWFROODUVL]HLV
ODUJHUWKDQWKHVL]HRIWKHYHQWSLSHWKDWFDQEHXVHG
9HQWFROODUVL]HDQGKRUL]RQWDOSLSHGLDPHWHUVFDQ
EHIRXQGLQ7DEOH7KHODUJHUYHQWFROODUVL]HLVWR
DFFRPPRGDWH&DWHJRU\, YHUWLFDO YHQWV\VWHPV
NOTE::KHQORFDWHGRQWKHVDPHZDOOWKH&RSSHU
%UXWHOOFRPEXVWLRQDLULQWDNHWHUPLQDOPXVWEH
LQVWDOOHGDPLQLPXPRI FP EHORZWKHH[KDXVW
YHQWWHUPLQDODQGVHSDUDWHGE\DPLQLPXPRI
LQFKHV FP KRUL]RQWDOO\
1.I
Installation Kit
All units are shipped with an Installation Kit which
FRQWDLQVWKHIROORZLQJLWHPV
'HVFULSWLRQ
7HUPLQDO%ORFN,QVHUWLRQ5HPRYDO7RROV
:HOO,PPHUVLRQIRU%XOE
:HOO,PPHUVLRQ137
6HQVRU2XWOHW7KHUPLVWRU'XDO.
7DSHUHG5XEEHU6WRSSHU
5HVLVWRU.:DWW9$[LDO
%XVKLQJ1\ORQ
&DSLOODU\&ODPS
2XWGRRU6HQVRU
6HQVRUV,QOHW7HPSHUDWXUH:DWHU
/DEHO%R[5HPRWH6HQVRU
The air intake terminal must be installed high
enough to avoid blockage from snow, leaves and
RWKHUGHEULV
1
2
3
4
5
6
7
9
8
10
11
Figure 2. ,QVWDOODWLRQ.LW&RPSRQHQWV
4W\
Page 9
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
SECTION 2 Venting and
&RPEXVWLRQ$LU
2.A
&RPEXVWLRQ$LU
Copper Brute ll boilers and water heaters must
have provisions for combustion and ventilation air
LQDFFRUGDQFHZLWK6HFWLRQ$LUIRU&RPEXVWLRQ
DQG9HQWLODWLRQRIWKH1DWLRQDO)XHO*DV&RGH$16,
=RU6HFWLRQVRURI&6$%
Installation Codes, or applicable provisions of the
ORFDOEXLOGLQJFRGHV
A Copper Brute ll appliance may receive
combustion air from the space in which it is installed,
RULWFDQEHGXFWHGGLUHFWO\WRWKHXQLWIURPWKHRXWVLGH
9HQWLODWLRQDLUPXVWEHSURYLGHGLQHLWKHUFDVH
2.A.1 &RPEXVWLRQ$LU)URP5RRP
,QWKH8QLWHG6WDWHVWKHPRVWFRPPRQ
requirements specify that the space shall communicate
ZLWKWKHRXWGRRUVLQDFFRUGDQFHZLWKPHWKRGRU
ZKLFKIROORZ:KHUHGXFWVDUHXVHGWKH\VKDOOEHRI
the same cross-sectional area as the free area of the
RSHQLQJVWRZKLFKWKH\FRQQHFW
Method 1: Two permanent openings, one
FRPPHQFLQJZLWKLQLQFKHV FP RIWKHWRS
DQGRQHFRPPHQFLQJZLWKLQLQFKHV FP RI
WKHERWWRPRIWKHHQFORVXUHVKDOOEHSURYLGHG7KH
openings shall communicate directly, or by ducts,
with the outdoors or spaces that freely communicate
WARNING
)RULQGRRULQVWDOODWLRQVDVDQDGGLWLRQDOPHDVXUH
RIVDIHW\%UDGIRUG:KLWHVWURQJO\UHFRPPHQGV
LQVWDOODWLRQRIVXLWDEOH&DUERQ0RQR[LGHGHWHFWRUV
LQWKHYLFLQLW\RIWKLVDSSOLDQFHDQGLQDQ\DGMDFHQW
RFFXSLHGVSDFHV
AVERTISSEMENT
3RXUGHVLQVWDOODWLRQVLQWpULHXUHV%UDGIRUG:KLWH
UHFRPPDQGHIRUWHPHQWFRPPHPHVXUHGHVpFXULWp
VXSSOpPHQWDLUHO¶LQVWDOODWLRQGHGpWHFWHXUVGH
PRQR[\GHGHFDUERQHDGDSWpVGDQVOHYRLVLQDJH
GHO¶DSSDUHLOHWGDQVFKDFXQHGHVSLqFHVKDELWpHV
DGMDFHQWHV
ZLWKWKHRXWGRRUV:KHQGLUHFWO\FRPPXQLFDWLQJ
with the outdoors, or when communicating to the
outdoors through vertical ducts, each opening shall
KDYHDPLQLPXPIUHHDUHDRIVTXDUHLQFKSHU
%WXKU VTXDUHFPN: RIWRWDOLQSXWUDWLQJRIDOO
HTXLSPHQWLQWKHHQFORVXUH:KHQFRPPXQLFDWLQJWR
the outdoors through horizontal ducts, each opening
shall have a minimum free area of not less than
VTXDUHLQFKSHU%WXKU VTXDUHFPN: RI
WRWDOLQSXWUDWLQJRIDOOHTXLSPHQWLQWKHHQFORVXUH
7DEOHVKRZVGDWDIRUWKLVVL]LQJPHWKRGIRUHDFK
&RSSHU%UXWHOOPRGHO
Method 22QHSHUPDQHQWRSHQLQJFRPPHQFLQJ
ZLWKLQLQFKHV FP RIWKHWRSRIWKHHQFORVXUH
VKDOOEHSHUPLWWHG7KHRSHQLQJVKDOOGLUHFWO\
communicate with the outdoors or shall communicate
through a vertical or horizontal duct to the outdoors
or spaces that directly communicate with the outdoors
and shall have a minimum free area of 1 square inch
SHU%WXKU VTXDUHFPN: RIWKHWRWDOLQSXW
UDWLQJRIDOOHTXLSPHQWORFDWHGLQWKHHQFORVXUH7KLV
opening must not be less than the sum of the areas of
DOOYHQWFRQQHFWRUVLQWKHFRQ¿QHGVSDFH
2WKHUPHWKRGVRILQWURGXFLQJFRPEXVWLRQDQG
ventilation air are acceptable, providing they conform
to the requirements in the applicable codes listed
DERYH
In Canada, consult local building and safety
FRGHVRULQDEVHQFHRIVXFKUHTXLUHPHQWVIROORZ&6$
%
2.A.2 ,QWDNH&RPEXVWLRQ$LU
The combustion air can be taken through the
ZDOORUWKURXJKWKHURRI:KHQWDNHQIURPWKHZDOO
6,=(
500
750
1000
1250
1500
1750
2000
($&+23(1,1*
SQUARE INCHES
SQUARE CM
125
188
250
313
375
438
500
807
1213
1613
2020
2420
2826
3226
1HW)UHH$UHDLQ6TXDUH,QFKHV6TXDUHFP
$UHDLQGLFDWHGLVIRURQHRIWZRRSHQLQJVRQHDWÀRRUOHYHODQG
RQHDWWKHFHLOLQJVRWKHWRWDOQHWIUHHDUHDFRXOGEHGRXEOHWKH
¿JXUHVLQGLFDWHG
7KLVFKDUWLVIRUXVHZKHQFRPPXQLFDWLQJGLUHFWO\ZLWKWKH
RXWGRRUV)RUVSHFLDOFRQGLWLRQVDQGDOWHUQDWHPHWKRGVUHIHUWR
WKHODWHVWHGLWLRQRI$16,=
Note:&KHFNZLWKORXYHUPDQXIDFWXUHUVIRUQHWIUHHDUHDRI
ORXYHUV&RUUHFWIRUVFUHHQUHVLVWDQFHWRWKHQHWIUHHDUHD
LIDVFUHHQLVLQVWDOOHG&KHFNDOOORFDOFRGHVDSSOLFDEOHWR
FRPEXVWLRQDLU
7DEOH &RPEXVWLRQ$LU2SHQLQJV
BRADFORD WHITE CORP.
Page 10
it must be taken from out-of-doors by means of the
%UDGIRUG:KLWHKRUL]RQWDOZDOOWHUPLQDO VHH7DEOH :KHQWDNHQIURPWKHURRID¿HOGVXSSOLHGUDLQFDSRU
an elbow arrangement must be used to prevent entry of
UDLQZDWHU VHH)LJXUH 8VHVLQJOHZDOOJDOYDQL]HGSLSHSHU7DEOHIRU
the combustion air intake (see Table 1) for appropriate
VL]H5RXWHWKHLQWDNHWRWKHKHDWHUDVGLUHFWO\DV
SRVVLEOH6HDODOOMRLQWVZLWKWDSH3URYLGHDGHTXDWH
KDQJHUV7KHXQLWPXVWQRWVXSSRUWWKHZHLJKWRI
WKHFRPEXVWLRQDLULQWDNHSLSH0D[LPXPOLQHDU
SLSHOHQJWKDOORZHGLVIHHW P 7KUHHHOERZV
KDYHEHHQFDOFXODWHGLQWRWKHIRRW P OLQHDU
UXQ6XEWUDFWDOORZDEOHOLQHDUIHHW P IRUHYHU\
DGGLWLRQDOHOERZXVHG VHH7DEOH :KHQIHZHUWKDQ
HOERZVDUHXVHGWKHPD[LPXPOLQHDUSLSHOHQJWK
DOORZHGLVVWLOOIHHW P The connection for the intake air pipe is on the
¿OWHUER[7KH&RSSHU%UXWHOODSSOLDQFHVPD\KDYH
venting and combustion air ducting attached to the top
RUWKHEDFN7KH\DUHVKLSSHGZLWKWKHFRQQHFWLRQV
DWWKHWRS)RUDWWDFKLQJHLWKHURUERWKSLSHVWRWKH
EDFNWKHPRXQWLQJÀDQJHVDUHUHYHUVLEOHE\UHPRYLQJ
WKHPRXQWLQJVFUHZVDQGRULHQWLQJWKHÀDQJHVLQWKH
GHVLUHGSRVLWLRQ5HSODFHWKHVFUHZVDIWHUSRVLWLRQLQJ
ÀDQJHV5XQDEHDGRIVLOLFRQHDURXQGWKHFROODUDQG
VOLGHWKHSLSHRYHUWKHFROODU6HFXUHZLWKVKHHWPHWDO
VFUHZV
In addition to air needed for combustion, air
shall also be supplied for ventilation, including all air
required for comfort and proper working conditions
IRUSHUVRQQHO7KH&RSSHU%UXWHOOORVHVOHVVWKDQ
percent of its input rating to the room, but other heat
VRXUFHVPD\EHSUHVHQW
7(50
3LSH
-RLQW
6HDOLQJ
7DEOH
2.B
'(6&5,37,21
6LQJOHZDOOJDOYDQL]HGVWHHOSLSHJDXJH
PLQLPXP HLWKHULQVXODWHGRUQRQLQVXODWHG
3HUPDQHQWGXFWWDSHRUDOXPLQXPWDSH
5HTXLUHG&RPEXVWLRQ$LU3LSLQJ0DWHULDO
Venting
2.B.1 Vent Categories
'HSHQGLQJXSRQGHVLUHG&RSSHU%UXWHOOYHQWLQJ
it may be considered a Category I or a Category III
DSSOLDQFH,QJHQHUDODYHUWLFDOYHQWV\VWHPZLOO
EHD&DWHJRU\,V\VWHP+RZHYHULQUDUHLQVWDQFHV
a Copper Brute ll’s vertical vent system may be
FRQVLGHUHG&DWHJRU\,,,,QWKH86WKH1DWLRQDO)XHO
*DV&RGH $16,=/DWHVW(GLWLRQ RULQ&DQDGD
WKH&6$% ODWHVWHGLWLRQ GH¿QHVD&DWHJRU\
I vent system, and includes rules and tables to size
WKHVHYHQWV\VWHPV,IWKH&RSSHU%UXWHOO¶VYHUWLFDO
vent system does not satisfy the criteria for Category I
YHQWLQJLWPXVWEHYHQWHGDVD&DWHJRU\,,,V\VWHP
All Copper Brute ll vent systems which discharge
horizontally (without the use of a power venter) are
FRQVLGHUHG&DWHJRU\,,,YHQWV\VWHPV
2.B.2 Category I Vent
When vented as a category I appliance, the
YHQWV\VWHPPXVWFRQIRUPWRWKH1DWLRQDO)XHO*DV
&RGH $16,=/DWHVW(GLWLRQ LQWKH86RU
LQ&DQDGDWR&6$% ODWHVWHGLWLRQ 7KHYHQW
system must be sized and installed for a Category I
)DQ$VVLVWHG$SSOLDQFH
,IFKLPQH\KHLJKWLVJUHDWHUWKDQIHHWRU
if multiple units are vented into the same vertical
vent, a barometric damper must be installed on each
DSSOLDQFHVXFKWKDWWKHÀXHGUDIWGRHVQRWH[FHHG
QHJDWLYH ZF
If using a power venter for any type of Category
I venting, the draft should be set between (negative)
DQGZF
Figure 3. &RPEXVWLRQ$LUDQG9HQW7KURXJK5RRI
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
2.B.3 Common Venting Systems
Copper Brute ll units are Category I fan-assisted
when vented vertically and adhering to all applicable
FRGHV&RSSHU%UXWHOOXQLWVDUHQRWDOORZHGWREH
vented into a common horizontal Cat III vent system
KRUL]RQWDOGLVFKDUJHRURWKHUFRQ¿JXUDWLRQIRU&DW
III), unless a properly sized vent fan is used, and the
common vent system is properly designed by the
YHQWIDQPDQXIDFWXUHURUDTXDOL¿HGHQJLQHHU:KHQ
common venting Copper Brute ll fan-assisted unit
with other appliances through one shared vertical duct
FDOOHGD³FRPPRQYHQW´VSHFLDOFDUHPXVWEHWDNHQE\
WKHLQVWDOOHUWRHQVXUHVDIHRSHUDWLRQ,QWKHHYHQWWKDW
the common vent is blocked, it is possible, especially
for fan-assisted devices, to vent backwards through
non-operating appliances sharing the vent, allowing
FRPEXVWLRQSURGXFWVWRLQ¿OWUDWHRFFXSLHGVSDFHV
If the appliances are allowed to operate in this
condition, serious injury or death may occur.
WARNING
2SHUDWLRQRIDSSOLDQFHVZLWKDEORFNHGFRPPRQ
YHQWPD\OHDGWRVHULRXVLQMXU\RUGHDWK6DIHW\
GHYLFHVPXVWEHLPSOHPHQWHGWRSUHYHQWEORFNHG
FRPPRQYHQWRSHUDWLRQ,IVDIHRSHUDWLRQRIDOO
DSSOLDQFHVFRQQHFWHGWRDFRPPRQYHQWFDQQRW
EHDVVXUHGLQFOXGLQJSUHYHQWLRQRIVSLOODJHRIÀXH
JDVVHVLQWROLYLQJVSDFHVFRPPRQYHQWLQJVKRXOG
QRWEHDSSOLHGDQGDSSOLDQFHVVKRXOGHDFKEH
YHQWHGVHSDUDWHO\
AVERTISSEMENT
/HIRQFWLRQQHPHQWG¶DSSDUHLOVFRQQHFWpVjXQ
pYHQWFRPPXQERXFKpSHXWSURYRTXHUGHVpULHXVHV
EOHVVXUHVFRUSRUHOOHVRXODPRUW'HVGLVSRVLWLIVGH
VpFXULWpGRLYHQWrWUHPLVHQSODFHSRXUHPSrFKHU
TXHOHVDSSDUHLOVVRLHQWXWLOLVpVDYHFXQpYHQW
FRPPXQERXFKp6LXQIRQFWLRQQHPHQWVpFXULWDLUH
GHWRXVOHVDSSDUHLOVUHOLpVjXQpYHQWFRPPXQHWVL
ODSUpYHQWLRQGHVGpJDJHPHQWVDFFLGHQWHOVGHJD]
GHFRPEXVWLRQGDQVGHV]RQHVKDELWpHVQHSHXYHQW
SDVrWUHDVVXUpVXQpYHQWFRPPXQQHGRLWSDV
rWUHPLVHQSODFHHWOHVDSSDUHLOVGRLYHQWrWUHPXQLV
G¶pYHQWVLQGLYLGXHOVVpSDUpV
It is for this reason that, in addition to
following proper vent sizing, construction and safety
UHTXLUHPHQWVIURPWKH1DWLRQDO)XHO*DV&RGH
$16,=RULQ&DQDGDIURP&6$%DV
well as all applicable local codes, it is required that
installers provide some means to prevent operation
ZLWKDEORFNHGFRPPRQYHQW,WLVVXJJHVWHGWKDWD
blocked vent safety system be employed such that if
WKHVZLWFKIURPRQHDSSOLDQFHWULSVGXHWRH[FHVVLYH
stack spill or backpressure indicating a blocked vent
Page 11
condition, that all appliances attached to the vent be
ORFNHGRXWDQGSUHYHQWHGIURPRSHUDWLQJ1RWHWKDW
the Copper Brute ll is equipped with a blocked vent
VDIHW\ SUHVVXUH VZLWFKDVVKLSSHG+RZHYHUWKLV
safety switch has only been designed and tested to be
effective in installations where the Copper Brute ll
LVYHQWHGVHSDUDWHO\DQG127FRPPRQYHQWHGZLWK
RWKHUDSSOLDQFHV$VDQDGGLWLRQDOSUHFDXWLRQLWLV
UHFRPPHQGHGWKDWD&DUERQ0RQR[LGH &2 DODUPEH
installed in all enclosed spaces containing combustion
DSSOLDQFHV,IDVVLVWDQFHLVUHTXLUHGLQGHWHUPLQLQJ
how a blocked vent safety system should be connected
to a Bradford White product, please call Applications
(QJLQHHULQJDWWKH5RFKHVWHUSKRQHQXPEHUOLVWHGRQ
EDFNFRYHURIWKLVPDQXDO
5HIHUWRWKHLQVWDOODWLRQDQGRSHUDWLQJ
instructions on all appliances to be common vented
for instructions, warnings, restrictions and safety
UHTXLUHPHQWV,IVDIHRSHUDWLRQRIDOODSSOLDQFHV
connected to a common vent cannot be assured,
LQFOXGLQJSUHYHQWLRQRIVSLOODJHRIÀXHJDVVHVLQWR
living spaces, common venting should not be applied,
DQGDSSOLDQFHVVKRXOGHDFKEHYHQWHGVHSDUDWHO\
BRADFORD WHITE CORP.
Page 12
A = &OHDUDQFHDERYHJUDGHYHUDQGDSRUFK
GHFNRUEDOFRQ\
B = &OHDUDQFHWRZLQGRZRUGRRUWKDWPD\EH
RSHQHG
C = &OHDUDQFHWRSHUPDQHQWO\FORVHGZLQGRZ
D = 9HUWLFDOFOHDUDQFHWRYHQWLODWHGVRI¿WORFDWHG
DERYHWKHWHUPLQDOZLWKLQDKRUL]RQWDO
GLVWDQFHRIIHHW FP IURPWKHFHQWHU
OLQHRIWKHWHUPLQDO
E = &OHDUDQFHWRXQYHQWLODWHGVRI¿W
F = &OHDUDQFHWRRXWVLGHFRUQHU
G = &OHDUDQFHWRLQVLGHFRUQHU
H = &OHDUDQFHWRHDFKVLGHRIFHQWHUOLQH
H[WHQGHGDERYHPHWHUUHJXODWRUDVVHPEO\
I = &OHDUDQFHWRVHUYLFHUHJXODWRUYHQWRXWOHW
J = &OHDUDQFHWRQRQPHFKDQLFDODLUVXSSO\LQOHW
WREXLOGLQJRUWKHFRPEXVWLRQDLULQOHWWR
DQ\RWKHUDSSOLDQFH
K = &OHDUDQFHWRDPHFKDQLFDODLUVXSSO\LQOHW
U.S. Installations (see note 1)
LQFKHV FP Canadian Installations (see note 2)
LQFKHV FP
IHHW P EHORZRUWRVLGHRIRSHQLQJ
IRRW FP DERYHRSHQLQJ
6HHQRWH
LQFKHV FP
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
6HHQRWH
IHHW FP ZLWKLQDKHLJKWIHHWDERYH
WKHPHWHUUHJXODWRUDVVHPEO\
IHHW FP
IHHW P EHORZRUWRVLGHRIRSHQLQJ
IRRW FP DERYHRSHQLQJ
IHHW FP DERYHLIZLWKLQIHHW P KRUL]RQWDOO\
LQFKHV FP
9HQWWHUPLQDWLRQQRWDOORZHGLQWKLVORFDWLRQ
L = &OHDUDQFHDERYHSDYHGVLGHZDONRUSDYHG IRUFDWHJRU\,9DSSOLDQFHV)RU&DWHJRU\,,,
GULYHZD\ORFDWHGRQSXEOLFSURSHUW\
DSSOLDQFHVYHQWPXVWWHUPLQDWHDWOHDVW
IHHW P DERYHWKHVLGHZDONRUGULYHZD\
M = &OHDUDQFHXQGHUYHUDQGDSRUFKGHFN
6HHQRWH
RUEDOFRQ\
IHHW P
9HQWWHUPLQDWLRQQRWDOORZHGLQWKLVORFDWLRQ
IRUFDWHJRU\,9DSSOLDQFHV$YHQWVKDOOQRW
WHUPLQDWHGLUHFWO\DERYHDVLGHZDONRUSDYHG
GULYHZD\WKDWLVORFDWHGEHWZHHQWZRVLQJOH
IDPLO\GZHOOLQJVDQGVHUYHVERWKGZHOOLQJV
)RU&DWHJRU\,,,DSSOLDQFHVWKDWGRQRWYLRODWH
WKHSUHYLRXVFRQGLWLRQYHQWPXVWWHUPLQDWH
DWOHDVWIHHW P DERYHWKHVLGHZDONRU
GULYHZD\
LQFKHV FP VHHQRWH
Notes:
,QDFFRUGDQFHZLWKWKHFXUUHQW$16,=1)3$1DWLRQDO)XHO*DV&RGH
,QDFFRUGDQFHZLWKWKHFXUUHQW&6$%,QVWDOODWLRQ&RGHV
3HUPLWWHGRQO\LIYHUDQGDSRUFKGHFNRUEDOFRQ\LVIXOO\RSHQRQDPLQLPXPRIWZRVLGHVEHQHDWKWKHÀRRU
)RUFOHDUDQFHVQRWVSHFL¿HGLQ$16,=1)3$FOHDUDQFHLVLQDFFRUGDQFHZLWKORFDOLQVWDOODWLRQFRGHVDQGWKHUHTXLUHPHQWVRI
WKHJDVVXSSOLHU
)RUFOHDUDQFHVQRWVSHFL¿HGLQ&6$%FOHDUDQFHLVLQDFFRUGDQFHZLWKORFDOLQVWDOODWLRQFRGHVDQGWKHUHTXLUHPHQWVRIWKHJDV
VXSSOLHU
Figure 4. &RPEXVWLRQ$LUDQG9HQW7KURXJK6LGH:DOO
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
2.B.4 Category III Vent
When the Copper Brute ll is vented with horizontal
discharge, it must be installed per this installation
manual and the venting system manufacturer’s
LQVWDOODWLRQLQVWUXFWLRQV7KHYHQWV\VWHPPXVWEH
VHDOHGVWDLQOHVVVWHHOSHU7DEOH
5RXWHWKHYHQWSLSHWRWKHKHDWHUDVGLUHFWO\DV
SRVVLEOH6HDODOOMRLQWVDQGSURYLGHDGHTXDWHKDQJHUV
as required in the venting system manufacturer’s
,QVWDOODWLRQ,QVWUXFWLRQV+RUL]RQWDOSRUWLRQVRIWKH
venting system must be supported to prevent sagging
and may not have any low sections that could trap
FRQGHQVDWH
The unit must not support the weight of the vent
SLSH+RUL]RQWDOUXQVPXVWVORSHGRZQZDUGVQRWOHVV
WKDQóLQFKSHUIRRW FPP IURPWKHXQLWWRWKHYHQW
WHUPLQDO
L’appareil ne doit pas supporter le poids de la
gaine d’évent. Les parties horizontales doivent être
installées avec une pente de 2 cm/m (1/4 inch par pied)
descendant de l’appareil vers la sortie de l’évent.
5HIHUHQFH7DEOHIRUWKHVL]HRIWKH&DWHJRU\
,,,YHQWV\VWHP8SWRWKUHHHOERZVFDQEHXVHGZLWK
OLQHDUIHHW P RISLSH6XEWUDFWDOORZDEOH
OLQHDUIHHW P IRUHYHU\DGGLWLRQDOHOERZXVHG
7(50
'(6&5,37,21
3LSH
-RLQW
6HDOLQJ
0XVWFRPSO\ZLWK8/6WDQGDUG
VXFKDV7\SH&6WDLQOHVV6WHHO
HLWKHULQVXODWHGRUQRQLQVXODWHG )ROORZYHQWPDQXIDFWXUHU¶VLQVWUXFWLRQV
7DEOH 5HTXLUHG+RUL]RQWDO9HQWLQJ0DWHULDO
WARNING
7KHRXWGRRUYHQWWHUPLQDOJHWVKRW8QLWPXVWEH
LQVWDOOHGLQVXFKDZD\DVWRUHGXFHWKHULVNRI
EXUQVIURPFRQWDFWZLWKWKHYHQWWHUPLQDO
Page 13
9HQWWHUPLQDOVIRUFRQGHQVLQJDSSOLDQFHVRU
appliances with condensing vents are not
permitted to terminate above a public walkway,
or over an area where condensate or vapor could
FUHDWHDQXLVDQFHRUKD]DUG
/RFDWHWKHYHQWWHUPLQDOVRWKDWYHQWJDVHVFDQQRW
EHGUDZQLQWRDLUFRQGLWLRQLQJV\VWHPLQOHWV
/RFDWHWKHYHQWWHUPLQDOVRWKDWYHQWJDVHVFDQQRW
enter the building through doors, windows,
JUDYLW\LQOHWVRURWKHURSHQLQJV:KHQHYHU
possible, locations under windows or near doors
VKRXOGEHDYRLGHG
/RFDWHWKHYHQWWHUPLQDOVRWKDWLWFDQQRWEHEORFNHG
E\VQRZ7KHLQVWDOOHUPD\GHWHUPLQHWKDWDYHQW
terminal must be higher than the minimum shown
LQFRGHVGHSHQGLQJXSRQORFDOFRQGLWLRQV
/RFDWHWKHWHUPLQDOVRWKHYHQWH[KDXVWGRHV
not settle on building surfaces or other nearby
REMHFWV9HQWSURGXFWVPD\GDPDJHVXFK
VXUIDFHVRUREMHFWV
,IWKHERLOHURUZDWHUKHDWHUXVHVGXFWHG
combustion air from an intake terminal located
on the same wall, locate the vent terminal at least
IHHW P KRUL]RQWDOO\IURPWKHFRPEXVWLRQ
air terminal, and locate the vent terminal at least
IRRW P DERYHWKHFRPEXVWLRQDLUWHUPLQDO
WARNING
7KHRXWGRRUYHQWWHUPLQDOJHWVKRW8QLWPXVWEH
LQVWDOOHGLQVXFKDZD\DVWRUHGXFHWKHULVNRI
EXUQVIURPFRQWDFWZLWKWKHYHQWWHUPLQDO
AVERTISSEMENT
/DVRUWLHG¶pYHQWjO¶H[WpULHXUGHYLHQWWUqVFKDXGH
(OOHGRLWrWUHLQVWDOOpHGHIDoRQjUpGXLUHOHULVTXH
GHEU€OXUHVDXFRQWDFWGHO¶H[WUpPLWpGHO¶pYHQW
,PSRUWDQW1RWH0DVVDFKXVHWWV&RGH
5HTXLUHPHQW
2.C
RFDWLQJ9HQW &RPEXVWLRQ$LU
/
Terminals
2.C.1 Side Wall Vent Terminal
The appropriate Bradford White side wall vent
hood must be used, and is listed in the installation and
RSHUDWLRQPDQXDO7KHWHUPLQDOSURYLGHVDPHDQVRI
installing the vent piping through the building wall,
DQGPXVWEHORFDWHGLQDFFRUGDQFHZLWK$16,=
1)3$DQGDSSOLFDEOHORFDOFRGHV,Q&DQDGDWKH
LQVWDOODWLRQPXVWEHLQDFFRUGDQFHZLWK&6$%RU
DQGORFDODSSOLFDEOHFRGHV&RQVLGHUWKHIROORZLQJ
when installing the terminal:
)LJXUHVKRZVWKHUHTXLUHPHQWVIRUPHFKDQLFDO
YHQWWHUPLQDOFOHDUDQFHVIRUWKH86DQG&DQDGD
From Massachusetts Rules and
Regulations 248 CMR 5.08:
(a)
For all side wall horizontally vented gas
fueled equipment installed in every dwelling,
building or structure used in whole or in
part for residential purposes, including those
owned or operated by the Commonwealth
and where the side wall exhaust vent
termination is less than seven (7) feet above
¿QLVKHGJUDGHLQWKHDUHDRIWKHYHQWLQJ
including but not limited to decks and
porches, the following requirements shall be
VDWLV¿HG
Page 14
,167$//$7,212)&$5%210212;,'(
'(7(&7256
At the time of installation of the side wall
horizontal vented gas fueled equipment, the
LQVWDOOLQJSOXPEHURUJDV¿WWHUVKDOOREVHUYHWKDW
DKDUGZLUHGFDUERQPRQR[LGHGHWHFWRUZLWKDQ
DODUPDQGEDWWHU\EDFNXSLVLQVWDOOHGRQWKHÀRRU
OHYHOZKHUHWKHJDVHTXLSPHQWLVWREHLQVWDOOHG
,QDGGLWLRQWKHLQVWDOOLQJSOXPEHURUJDV¿WWHU
shall observe that a battery operated or hardZLUHGFDUERQPRQR[LGHGHWHFWRUZLWKDQDODUPLV
installed on each additional level of the dwelling,
building or structure served by the side wall
KRUL]RQWDOYHQWHGJDVIXHOHGHTXLSPHQW,WVKDOOEH
the responsibility of the property owner to secure
WKHVHUYLFHVRITXDOL¿HGOLFHQVHGSURIHVVLRQDOVIRU
WKHLQVWDOODWLRQRIKDUGZLUHGFDUERQPRQR[LGH
GHWHFWRUV
D ,QWKHHYHQWWKDWWKHVLGHZDOOKRUL]RQWDOO\YHQWHG
gas fueled equipment is installed in a crawl space
RUDQDWWLFWKHKDUGZLUHGFDUERQPRQR[LGH
detector with alarm and battery back-up may be
LQVWDOOHGRQWKHQH[WDGMDFHQWÀRRUOHYHO
E ,QWKHHYHQWWKDWWKHUHTXLUHPHQWVRIWKLV
subdivision cannot be met at the time of
completion of installation, the owner shall have a
SHULRGRIWKLUW\ GD\VWRFRPSO\ZLWKWKHDERYH
UHTXLUHPHQWVSURYLGHGKRZHYHUWKDWGXULQJVDLG
WKLUW\ GD\SHULRGDEDWWHU\RSHUDWHGFDUERQ
PRQR[LGHGHWHFWRUZLWKDQDODUPVKDOOEHLQVWDOOHG
$33529('&$5%210212;,'(
'(7(&7256
(DFKFDUERQPRQR[LGHGHWHFWRUDVUHTXLUHGLQ
accordance with the above provisions shall comply
ZLWK1)3$DQGEH$16,8/OLVWHGDQG
,$6FHUWL¿HG
6,*1$*(
$PHWDORUSODVWLFLGHQWL¿FDWLRQSODWHVKDOOEH
SHUPDQHQWO\PRXQWHGWRWKHH[WHULRURIWKH
building at a minimum height of eight (8) feet
DERYHJUDGHGLUHFWO\LQOLQHZLWKWKHH[KDXVWYHQW
terminal for the horizontally vented gas fueled
KHDWLQJDSSOLDQFHRUHTXLSPHQW7KHVLJQVKDOO
read, in print size no less than one-half (½) inch
LQVL]H³*$69(17',5(&7/<%(/2:.((3
&/($52)$//2%6758&7,216´
,163(&7,21
The state or local gas inspector of the side wall
horizontally vented gas fueled equipment shall not
approve the installation unless, upon inspection,
WKHLQVSHFWRUREVHUYHVFDUERQPRQR[LGHGHWHFWRUV
and signage installed in accordance with the
SURYLVLRQVRI&05 D WKURXJK
BRADFORD WHITE CORP.
E (;(037,2167KHIROORZLQJHTXLSPHQWLV
H[HPSWIURP&05 D WKURXJK
7KHHTXLSPHQWOLVWHGLQ&KDSWHUHQWLWOHG
³(TXLSPHQW1RW5HTXLUHG7R%H9HQWHG´LQWKH
PRVWFXUUHQWHGLWLRQRI1)3$DVDGRSWHGE\
WKH%RDUGDQG
3URGXFW$SSURYHGVLGHZDOOKRUL]RQWDOYHQWHGJDV
fueled equipment installed in a room or structure
separate from the dwelling, building or structure
XVHGLQZKROHRULQSDUWIRUUHVLGHQWLDOSXUSRVHV
(c) MANUFACTURER REQUIREMENTS –
GAS EQUIPMENT VENTING SYSTEM
PROVIDED. When the manufacturer of
Product Approved side wall horizontally
vented gas equipment provides a venting
system design or venting system components
with the equipment, the instructions provided
by the manufacturer for installation of the
equipment and the venting system shall
LQFOXGH
'HWDLOHGLQVWUXFWLRQVIRUWKHLQVWDOODWLRQRIWKH
venting system design or the venting system
FRPSRQHQWVDQG
$FRPSOHWHSDUWVOLVWIRUWKHYHQWLQJV\VWHP
GHVLJQRUYHQWLQJV\VWHP
(d) MANUFACTURER REQUIREMENTS – GAS
EQUIPMENT VENTING SYSTEM NOT
PROVIDED. When the manufacturer of a
Product Approved side wall horizontally vented
gas fueled equipment does not provide the parts
IRUYHQWLQJWKHIXHOJDVHVEXWLGHQWL¿HV³VSHFLDO
venting systems”, the following requirements
VKDOOEHVDWLV¿HGE\WKHPDQXIDFWXUHU
7KHUHIHUHQFHG³VSHFLDOYHQWLQJV\VWHP´
instructions shall be included with the appliance or
HTXLSPHQWLQVWDOODWLRQLQVWUXFWLRQVDQG
7KH³VSHFLDOYHQWLQJV\VWHPV´VKDOOEH3URGXFW
Approved by the Board, and the instructions for
that system shall include a parts list and detailed
LQVWDOODWLRQLQVWUXFWLRQV
(e) A copy of all installation instructions for all
Product Approved side wall horizontally vented
gas fueled equipment, all venting instructions,
all parts lists for venting instructions, and/or all
venting design instructions shall remain with the
appliance or equipment at the completion of the
installation.
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
2.C.2 6LGH:DOO&RPEXVWLRQ$LU7HUPLQDO
The Bradford White side wall combustion air
terminal (listed in Table 1) must be used when the
unit takes its combustion air through a duct from a
VLGHZDOO&RQVLGHUWKHIROORZLQJZKHQLQVWDOOLQJWKH
terminal:
'RQRWORFDWHWKHDLULQOHWWHUPLQDOQHDUD
VRXUFHRIFRUURVLYHFKHPLFDOIXPHV HJ
FOHDQLQJÀXLGFKORULQDWHGFRPSRXQGVHWF
/RFDWHWKHWHUPLQDOVRWKDWLWZLOOQRWEHVXEMHFW
WRGDPDJHE\DFFLGHQWRUYDQGDOLVP
/RFDWHWKHFRPEXVWLRQDLUWHUPLQDOVRWKDWLW
FDQQRWEHEORFNHGE\VQRZ7KH1DWLRQDO)XHO
*DV&RGHUHTXLUHVWKDWLWEHDWOHDVWLQFKHV
FP DERYHJUDGHEXWWKHLQVWDOOHUPD\
determine it should be higher, depending upon
ORFDOFRQGLWLRQV
,IWKH&RSSHU%UXWHOOLVVLGHZDOOYHQWHGWRWKH
VDPHZDOOORFDWHWKHYHQWWHUPLQDODWOHDVW
IHHW P KRUL]RQWDOO\IURPWKHFRPEXVWLRQ
air terminal, and locate the vent terminal at
OHDVWIRRW P DERYHWKHFRPEXVWLRQDLU
WHUPLQDO VHH)LJXUH 2.C.3 Vertical Vent Terminal
When the unit is vented through the roof, the
YHQWPXVWH[WHQGDWOHDVWIHHW P DERYHWKH
SRLQWDWZKLFKLWSHQHWUDWHVWKHURRI,WPXVWH[WHQG
DWOHDVWIHHW P KLJKHUWKDQDQ\SRUWLRQRI
DEXLOGLQJZLWKLQDKRUL]RQWDOGLVWDQFHRIIHHW
P DQGKLJKHQRXJKDERYHWKHURRIOLQHWR
SUHYHQWEORFNDJHIURPVQRZ:KHQWKHFRPEXVWLRQ
air is taken from the roof, the combustion air
PXVWWHUPLQDWHDWOHDVW FP EHORZWKHYHQW
WHUPLQDO VHH)LJXUH 2.C.4 9HUWLFDO&RPEXVWLRQ$LU7HUPLQDO
When combustion air is taken from the roof,
D¿HOGVXSSOLHGUDLQFDSRUDQHOERZDUUDQJHPHQW
must be used to prevent entry of rain water (see
)LJXUH 7KHRSHQLQJRQWKHHQGRIWKHWHUPLQDO
PXVWEHDWOHDVW FP DERYHWKHSRLQWDWZKLFK
it penetrates the roof, and high enough above the
URRIOLQHWRSUHYHQWEORFNDJHIURPVQRZ:KHQ
the vent terminates on the roof, the combustion air
PXVWWHUPLQDWHDWOHDVW FP EHORZWKHYHQW
WHUPLQDO
2.D
Common Vent Test — Boilers
:KHQDQH[LVWLQJERLOHULVUHPRYHGIURP
a common venting system, the common venting
system is likely to be too large for proper venting of
WKHDSSOLDQFHVUHPDLQLQJFRQQHFWHGWRLW
$WWKHWLPHRIUHPRYDORIDQH[LVWLQJERLOHU
the following steps shall be followed with each
appliance remaining connected to the common
Page 15
venting system placed in operation, while the other
appliances remaining connected to the common venting
V\VWHPDUHQRWLQRSHUDWLRQ
6HDODQ\XQXVHGRSHQLQJVLQWKHFRPPRQYHQWLQJ
V\VWHP
9LVXDOO\LQVSHFWWKHYHQWLQJV\VWHPIRUSURSHU
size and horizontal pitch and determine there is
no blockage or restriction, leakage, corrosion and
RWKHUGH¿FLHQFLHVZKLFKFRXOGFDXVHDQXQVDIH
FRQGLWLRQ
,QVRIDUDVLWLVSUDFWLFDOFORVHDOOEXLOGLQJGRRUV
and windows and all doors between the space in
which the appliances remaining connected to the
common venting system are located and other
VSDFHVRIWKHEXLOGLQJ7XUQRQFORWKHVGU\HUV
and any appliance not connected to the common
YHQWLQJV\VWHP7XUQRQDQ\H[KDXVWIDQVVXFK
DVUDQJHKRRGVDQGEDWKURRPH[KDXVWVVRWKH\
ZLOORSHUDWHDWPD[LPXPVSHHG'RQRWRSHUDWHD
VXPPHUH[KDXVWIDQ&ORVH¿UHSODFHGDPSHUV
3ODFHLQRSHUDWLRQWKHDSSOLDQFHEHLQJLQVSHFWHG
)ROORZWKHOLJKWLQJLQVWUXFWLRQV$GMXVWWKHUPRVWDW
VRDSSOLDQFHZLOORSHUDWHFRQWLQXRXVO\
7HVWIRUVSLOODJHDWWKHGUDIWKRRGUHOLHIRSHQLQJ
DIWHUPLQXWHVRIPDLQEXUQHURSHUDWLRQ8VH
WKHÀDPHRIDPDWFKRUFDQGOHRUVPRNHIURPD
FLJDUHWWHFLJDURUSLSH
$IWHULWKDVEHHQGHWHUPLQHGWKDWHDFKDSSOLDQFH
remaining connected to the common venting
system properly vents when tested as outlined
DERYHUHWXUQGRRUVZLQGRZVH[KDXVWIDQV
¿UHSODFHGDPSHUVDQGDQ\RWKHUJDVEXUQLQJ
DSSOLDQFHWRWKHLUSUHYLRXVFRQGLWLRQVRIXVH
$Q\LPSURSHURSHUDWLRQRIWKHFRPPRQYHQWLQJ
system should be corrected so that the installation
FRQIRUPVWRWKH1DWLRQDO)XHO*DV&RGH$16,
=1)3$DQGRU&6$%,QVWDOODWLRQ
&RGHV:KHQUHVL]LQJDQ\SRUWLRQRIWKHFRPPRQ
venting system, the common venting system
should be resized to approach the minimum size
DVGHWHUPLQHGXVLQJWKHDSSURSULDWHWDEOHVLQ3DUW
,,RIWKH1DWLRQDO)XHO*DV&RGH$16,=
1)3$DQGRU&6$%,QVWDOODWLRQ&RGHV
' 9pUL¿FDWLRQGHVpYHQWVFRPPXQV²
&KDXGLqUHV
Lorsqu’une chaudière existante est déconnectée du
réseau d’évents commun, ce réseau d’évents commun
devient probablement trop grand pour les appareils qui
lui restent connectés. Lorsqu’une chaudière existante
est retirée, les étapes suivantes doivent être accomplies
pour chaque appareil qui reste connecté au réseau
d’évents commun utilisé, alors que les autres appareils
qui sont encore connectés au réseau commun d’évents
ne sont pas en fonctionnement.:
1. Sceller toutes les ouvertures non utilisées du
BRADFORD WHITE CORP.
Page 16
2.
3.
4.
5.
6.
7.
système d'évacuation.
Inspecter de façon visuelle le système
d'évacuation pour déterminer la grosseur et
l'inclinaison horizontale qui conviennent et
s'assurer que le système est exempt d'obstruction,
d'étranglement, de fuite, de corrosion et autres
défaillances qui pourraient présenter des risques.
Dans la mesure du possible, fermer toutes les
portes et les fenêtres du bâtiment et toutes les
portes entre l'espace où les appareils toujours
raccordés au système d'évacuation sont installés
et les autres espaces du bâtiment. Mettre en
marche les sécheuses, tous les appareils non
raccordés au système d'évacuation common
et tous les ventilateurs d'extraction comme
les hottes de cuisinière et les ventilateurs des
salles de bain. S'assurer que ces ventilateurs
fonctionnent à la vitesse maximale. Ne pas faire
fonctionner les ventilateurs d'été. Fermer les
registres des cheminées.
Mettre l'appareil inspecté en marche. Suivre les
instructions d'allumage. Réegler le thermostat de
façon continue.
Faire fonctionner le brûleur principal pendant
5 min ensuite, déterminer si le coupe-tirage
déborde à l'ouverture de décharge. Utiliser la
ÀDPPHG XQHDOOXPHWWHRXG XQHFKDQGHOOHRXOD
fumée d'une cigarette, d'un cigare ou d'une pipe.
Une fois qu'il a été déterminé, selon la méthode
indiquée ci-dessus, que chaque appareil
raccordé au système d'évacuation est mis à l'air
libre de façon adéquate. Remettre les portes
et les fenêtres, les ventilateurs, les registres de
cheminées et les appareils au gaz à leur position
originale.
Tout mauvais fonctionnement du système
d'évacuation commun devrait être corrigé
de façon que l'installation soit conforme au
National Fuel Gas Code, ANSI Z223.1/NFPA
54 et (ou) aux codes d'installation CSA-B149.1.
Si la grosseur d'une section du système devrait
rWUHPRGL¿pOHV\VWqPHGHYUDLWrWUHPRGL¿pSRXU
respecter les valeurs minimales des tableaux
pertinents de l'appendice F du National Fuel Gas
Code, ANSI Z223.1/NFPA 54 et (ou) les codes
d'installation CSA-B149.1
2.E
Vent Terminals for Outdoor Units
)RURXWGRRUDSSOLFDWLRQVWKHYHQWDQG
combustion air openings must be covered with proper
terminals to prevent rain, snow and other objects from
IDOOLQJLQWRWKH&RSSHU%UXWHOO
If local codes allow, outdoor installations may
use 1' of appropriately sized galvanized single wall
RU%9HQWDQGDUDLQFDSIRUH[KDXVWYHQWWHUPLQDWLRQ
LQWKHGHIDXOWFRQ¿JXUDWLRQ YHQWLQJRXWRIWKHWRS $QDSSURSULDWHO\VL]HGJDOYDQL]HGƒHOOSRVLWLRQHG
with the opening facing down, may be used on the
FRPEXVWLRQDLULQOHWLQWKHGHIDXOWFRQ¿JXUDWLRQRQ
WKHEDFNRIWKHXQLW1RWHWKDWVRPHORFDOFRGHVPD\
UHTXLUHDKLJKHUYHUWLFDOYHQWKHLJKWH[WHQGLQJDERYH
DQ\SHULPHWHUIHQFLQJHWF,QLQVWDOODWLRQVZKHUH
the appearance of the vent is objectionable, the low
SUR¿OHYHQWWHUPLQDOVLQ7DEOHPD\EHXVHG
3DUWQXPEHUVIRUWKHORZSUR¿OHWHUPLQDOV
to cover the vent and combustion air openings are
VKRZQLQ7DEOH
6,=(
287'225
9(17
7(50,1$/
287'225
&20%867,21
$,57(50,1$/
500
750
1000
1250
1500
1750
2000
20254703
20254705
20254705
D2007700
D2007700
D2007800
D2007800
D2007900
D2008000
D2008000
D2008200
D2008200
D2008200
D2008200
7DEOH Vent Terminals for Outdoor Units.
WARNING
'RQRWXVHRSHQÀDPHWRFKHFNIRUOHDNV$QRSHQ
ÀDPHFRXOGOHDGWRH[SORVLRQZKLFKFRXOGUHVXOWLQ
SURSHUW\GDPDJHVHULRXVLQMXU\RUGHDWK
AVERTISSEMENT
1HUHFKHUFKH]SDVOHVIXLWHVDYHFXQHÀDPPHQXH
8QHÀDPPHQXHSHXWSURYRTXHUXQHH[SORVLRQTXL
SHXWFDXVHUGHVGRPPDJHVPDWpULHOVGHVpULHXVHV
EOHVVXUHVFRUSRUHOOHVRXODPRUW
Page 17
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
SECTION 3
3.A
*DV6XSSO\DQG3LSLQJ
*DV6XSSO\DQG3LSLQJ
*DVSLSLQJVKRXOGEHVXSSRUWHGE\VXLWDEOH
KDQJHUVRUÀRRUVWDQGVQRWE\WKHDSSOLDQFH
The Copper Brute ll’s gas train allows the user to
pipe the gas from either the right side or the left side
RIWKHXQLW$VVKLSSHGWKHULJKWVLGHRIWKHJDVWUDLQLV
FDSSHGRIIDQGWKHUHLVDPDQXDOYDOYHRQWKHOHIWVLGH
If desired, the manual valve on the left side of the gas
train may be moved to the right side, and the cap on
WKHULJKWVLGHPD\EHPRYHGWRWKHOHIW
5HYLHZWKHIROORZLQJLQVWUXFWLRQVEHIRUH
SURFHHGLQJZLWKWKHLQVWDOODWLRQ
9HULI\WKDWWKHDSSOLDQFHLV¿WWHGIRUWKHSURSHU
W\SHRIJDVE\FKHFNLQJWKHUDWLQJSODWH&RSSHU
Brute ll appliances are equipped to operate at
HOHYDWLRQVXSWRIHHW P &RSSHU
Brute ll appliances may be adjusted to operate
SURSHUO\DWDOWLWXGHVDERYHIHHW VHH
6(&7,21RQSDJH DQGWKHLQSXWZLOOEH
reduced if the heating value of the gas supply is
EHORZVHDOHYHOYDOXHV
7KHPD[LPXPLQOHWJDVSUHVVXUHPXVWQRW
H[FHHGZF N3D 7KHPLQLPXPLQOHWJDV
SUHVVXUHLVZF N3D 5HIHUWR7DEOHVL]HVXSSO\
5XQJDVVXSSO\OLQHLQDFFRUGDQFHZLWKDOO
DSSOLFDEOHFRGHV
/RFDWHDQGLQVWDOOPDQXDOVKXWRIIYDOYHVLQ
DFFRUGDQFHZLWKVWDWHDQGORFDOUHTXLUHPHQWV
$VHGLPHQWWUDSPXVWEHSURYLGHGXSVWUHDPRI
WKHJDVFRQWUROV
$OOWKUHDGHGMRLQWVVKRXOGEHFRDWHGZLWK
SLSLQJFRPSRXQGUHVLVWDQWWRDFWLRQRIOLTXH¿HG
SHWUROHXPJDV
7KHDSSOLDQFHDQGLWVLQGLYLGXDOVKXWRIIYDOYH
must be disconnected from the gas supply piping
during any pressure testing of that system at test
SUHVVXUHVLQH[FHVVRI36,* NSD 7KHXQLWPXVWEHLVRODWHGIURPWKHJDVVXSSO\
system by closing its individual manual shutoff
valve during any pressure testing of the gas
supply piping system at test pressures equal to or
OHVVWKDQ36,* NSD 7KHDSSOLDQFHDQGLWVJDVFRQQHFWLRQPXVWEH
OHDNWHVWHGEHIRUHSODFLQJLWLQRSHUDWLRQ
3XUJHDOODLUIURPJDVOLQHV
NOTE7KH&RSSHU%UXWHOODSSOLDQFHDQGDOORWKHU
JDVDSSOLDQFHVVKDULQJWKHJDVVXSSO\OLQHPXVWEH
¿ULQJDWPD[LPXPFDSDFLW\WRSURSHUO\PHDVXUHWKH
LQOHWVXSSO\SUHVVXUH7KHSUHVVXUHFDQEHPHDVXUHG
DWWKHVXSSO\SUHVVXUHSRUWRQWKHJDVYDOYH/RZ
JDVSUHVVXUHFRXOGEHDQLQGLFDWLRQRIDQXQGHUVL]HG
JDVPHWHUXQGHUVL]HGJDVVXSSO\OLQHVDQGRUDQ
REVWUXFWHGJDVVXSSO\OLQH
DISTANCE FROM GAS METER
OR LAST STAGE REGULATOR
6,=($1'
*$67<3(
500 natural
SURSDQH
750 natural
SURSDQH
1000 natural
SURSDQH
1250 natural
SURSDQH
1500 natural
SURSDQH
1750 natural
SURSDQH
2000 natural
SURSDQH
P
3.8cm
2.5cm
5.1cm
3.8cm
5.1cm
3.8cm
6.4cm
5.1cm
6.4cm
5.1cm
6.4cm
5.1cm
7.6cm
6.4cm
P
5.1cm
3.8cm
5.1cm
3.8cm
6.4cm
5.1cm
6.4cm
5.1cm
7.6cm
6.4cm
7.6cm
6.4cm
7.6cm
6.4cm
Notes:
7KHVH¿JXUHVDUHEDVHGRQ N3D ZDWHUFROXPQSUHVVXUHGURS
&KHFNVXSSO\SUHVVXUHDQGORFDOFRGHUHTXLUHPHQWVEHIRUHSURFHHGLQJZLWKZRUN
3LSH¿WWLQJVPXVWEHFRQVLGHUHGZKHQGHWHUPLQLQJJDVSLSHVL]LQJ.
7DEOH *DV3LSLQJ6L]H
P
5.1cm
3.8cm
6.4cm
5.1cm
7.6cm
6.4cm
7.6cm
6.4cm
7.6cm
6.4cm
7.6cm
6.4cm
8.9cm
7.6cm
BRADFORD WHITE CORP.
Page 18
SECTION 4
4.A
Water Connections —
BOILER or
WATER HEATER
Boiler
4.A.1 +
HDWLQJ6\VWHP3LSLQJ
+RW6XSSO\&RQQHFWLRQV²%RLOHU
NOTE: 7KLVDSSOLDQFHPXVWEHLQVWDOOHGLQDFORVHG
SUHVVXUHV\VWHPZLWKDPLQLPXPRISVL N3D VWDWLFSUHVVXUHDWWKHERLOHU
Hot water piping should be supported by suitable
KDQJHUVRUÀRRUVWDQGV'RQRWVXSSRUWSLSLQJZLWK
WKLVDSSOLDQFH'XHWRH[SDQVLRQDQGFRQWUDFWLRQRI
copper pipe, consideration should be given to the type
RIKDQJHUVXVHG5LJLGKDQJHUVPD\WUDQVPLWQRLVH
through the system resulting from the piping sliding in
WKHKDQJHUV,WLVUHFRPPHQGHGWKDWSDGGLQJEHXVHG
ZKHQULJLGKDQJHUVDUHLQVWDOOHG0DLQWDLQFOHDUDQFH
WRFRPEXVWLEOHVIRUKRWZDWHUSLSHV
3LSHWKHGLVFKDUJHRIWKHUHOLHIYDOYH IXOOVL]H to a drain or in a manner to prevent injury in the event
RISUHVVXUHUHOLHI,QVWDOODQDLUSXUJHUDQDLUYHQW
DGLDSKUDJPW\SHH[SDQVLRQWDQNDQGDK\GURQLF
ÀRZFKHFNLQWKHV\VWHPVXSSO\ORRS0LQLPXP¿OO
SUHVVXUHPXVWEHSVLJ N3D ,QVWDOOVKXWRII
YDOYHVZKHUHUHTXLUHGE\FRGH
6XJJHVWHGSLSLQJGLDJUDPVDUHVKRZQLQ)LJXUHV
WKURXJK7KHVHGLDJUDPVDUHPHDQWRQO\DVDJXLGH
Components required by local codes must be properly
LQVWDOOHG
127( the recommended location of the
WHPSHUDWXUHVHQVRURQWKHGLDJUDPV\RXPXVWSURYLGH
a location for the additional sensor shipped with the
&RSSHU%UXWHOO7KLVVHQVRUPD\EHVWUDSSHGRQWRSLSH
IURPWRGLDPHWHURULQVHUWHGLQWRDQLPPHUVLRQ
ZHOO
4.A.2 &ROG:DWHU0DNH8S²%RLOHU
&RQQHFWWKHFROGZDWHUVXSSO\WRWKHLQOHW
FRQQHFWLRQRIDQDXWRPDWLF¿OOYDOYH
,QVWDOODVXLWDEOHEDFNÀRZSUHYHQWHUEHWZHHQWKH
DXWRPDWLF¿OOYDOYHDQGWKHFROGZDWHUVXSSO\
,QVWDOOVKXWRIIYDOYHVZKHUHUHTXLUHG
NOTE: 7KHERLOHUZKHQXVHGLQFRQQHFWLRQZLWKD
UHIULJHUDWLRQV\VWHPPXVWEHLQVWDOOHGVRWKHFKLOOHG
PHGLXPLVSLSHGLQSDUDOOHOZLWKWKHERLOHUZLWK
DSSURSULDWHYDOYHVWRSUHYHQWWKHFKLOOHGPHGLXPIURP
HQWHULQJWKHERLOHU
The boiler piping system of a hot water heating
boiler connected to heating coils located in air
KDQGOLQJDSSOLDQFHVZKHUHWKH\PD\EHH[SRVHGWR
UHIULJHUDWHGDLUFLUFXODWLRQPXVWEHHTXLSSHGZLWKÀRZ
control valves or other automatic means to prevent
gravity circulation of the boiler water during the
FRROLQJF\FOH
A boiler installed above radiation level, or as
required by the authority having jurisdiction, must be
provided with a low water cutoff device either as a part
RIWKHERLOHURUDWWKHWLPHRIERLOHULQVWDOODWLRQ
4.A.3 :DWHU)ORZ5HTXLUHPHQWV²%RLOHU
A hydronic heating (closed loop) application
UHFLUFXODWHVWKHVDPHÀXLGLQWKHSLSLQJV\VWHP$VD
UHVXOWQRQHZPLQHUDOVRUR[\JHQLVLQWURGXFHGLQWR
WKHV\VWHP7RHQVXUHDSURSHURSHUDWLQJWHPSHUDWXUH
OHDGLQJWRORQJERLOHUOLIHDÀRZUDWHKDVEHHQ
HVWDEOLVKHGEDVHGRQWKHÀXLGWHPSHUDWXUHULVHIRUWKLV
VSHFL¿FVL]HERLOHU
3XPSPRXQWHGERLOHUVFDQEHRUGHUHGIRUXVHLQ
SULPDU\VHFRQGDU\SLSLQJV\VWHPV7KHSXPSVXVHG
DUHVL]HGIRUWKHKHDGORVVWKURXJKWKHKHDWHUSOXV
IHHW P RIIXOOVL]HGSLSLQJ VDPHVL]HDVERLOHU
RXWOHW DQGDQRUPDOQXPEHURI¿WWLQJV
7DEOHVSHFL¿HVZDWHUÀRZUDWHVIRUERLOHUV
ZKLFKZLOOHQDEOHWKHXVHUWRVL]HDSXPS7KH
headloss shown is for the heater only, and the user
will need to add the headloss of the system piping to
SURSHUO\VL]HWKHSXPS
The minimum inlet water temperature for the
&RSSHU%UXWHOOLVƒ) ƒ& WRDYRLGFRQGHQVLQJ
RQWKHFRSSHUFRLOV
4.A.4 :
DWHU)ORZ5HTXLUHPHQWV²
/RZ7HPSHUDWXUH&RSSHU%UXWHOO
Boilers
DUHHTXLSSHGZLWKDPRXQWHGSXPS7KHSXPSV
DUHVL]HGIRUWKHERLOHU¶VKHDGORVVDQGIHHWRIIXOO
size piping (same size as boiler outlet), with a normal
QXPEHURI¿WWLQJV7KHERLOHUVPXVWEHSLSHGLQD
primary-secondary system, such that the boiler’s pump
RQO\VHUYHVWKHERLOHU)LJXUHDQG)LJXUHVKRZ
H[DPSOHVRIWKLVW\SHRISLSLQJ
The minimum inlet water temperature to the
&RSSHU%UXWHOOLVƒ) ƒ& 7KHPL[LQJV\VWHPRQ
WKH&RSSHU%UXWHOOZLOOHQVXUHWKDWWKHKHDWH[FKDQJHU
in the Copper Brute ll does not see water that is less
WKDQƒ) ƒ& VRWKDWH[FHVVLYHFRQGHQVDWLRQ
GRHVQRWIRUPRQWKHKHDWH[FKDQJHU
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Table 8VKRZVDUHODWLRQVKLSEHWZHHQZDWHUÀRZ
through the boiler and the temperature difference (rise)
EHWZHHQWKHLQOHWDQGRXWOHWRIWKHERLOHU7KLVWDEOH
will enable the user to test the boiler for proper water
ÀRZ6LQFHWKHERLOHUKDVDPL[LQJV\VWHPWKDWVHQGV
a portion of the hot water from the boiler outlet to the
ERLOHULQOHWWKHZDWHUÀRZFRPLQJRXWRIWKHPL[LQJ
system will vary, depending on the return water
WHPSHUDWXUH
20°F
6,=(
500
750
1000
1250
1500
1750
2000
ÀRZ
JSP
+/
IHHW
500
750
1000
1250
1500
+/
IHHW
30°F
ÀRZ
JSP
+/
IHHW
43
1.7
34
1.1
28
0.9
64
3.3
51
2.3
43
1.7
85
5.0
68
3.6
57
3.1
106 8.1
85
6.1
71
4.7
128 10.0 102 7.2
85
5.5
N/R N/R 119 10.5 99
8.4
N/R N/R 136 12.5 113 10.4
0HWULF(TXLYDOHQW
11°C
SIZE
25°F
ÀRZ
JSP
14°C
17°C
35°F
ÀRZ
JSP
+/
IHHW
24
36
49
61
73
85
97
0.7
1.2
2.2
3.4
4.2
5.8
8.3
Page 19
4.A.5 )UHH]H3URWHFWLRQ²%RLOHU
Boiler installations are not recommended in
DUHDVZKHUHWKHGDQJHURIIUHH]LQJH[LVWVXQOHVVSURSHU
SUHFDXWLRQVDUHPDGHIRUIUHH]HSURWHFWLRQ$QRQ
WR[LFKHDWLQJV\VWHPDQWLIUHH]HPD\EHDGGHGWR
the hydronic system provided that the concentration
GRHVQRWH[FHHGDQGWKHDQWLIUHH]HFRQWDLQVDQ
DQWLIRDPDQW:KHQDPL[WXUHLVXVHGLQFUHDVH
WKHZDWHUÀRZUHTXLUHPHQWVE\DQGLQFUHDVHWKH
KHDGORVVUHTXLUHPHQWVE\
3RZHURXWDJHLQWHUUXSWLRQRIJDVVXSSO\IDLOXUH
of system components, activation of safety devices,
HWFPD\SUHYHQWDERLOHUIURP¿ULQJAny time a
boiler is subjected to freezing conditions, and the
ERLOHULVQRWDEOHWR¿UHDQGRUWKHZDWHULVQRWDEOH
to circulate, there is a risk of freezing in the boiler
or in the pipes in the system. When water freezes,
LWH[SDQGV7KLVFDQUHVXOWLQEXUVWLQJRISLSHVLQWKH
system, or damage to the boiler, which could result in
OHDNLQJRUÀRRGLQJFRQGLWLRQV
19°C
ÀRZ
lpm
+/
m
ÀRZ
lpm
+/
m
ÀRZ
lpm
+/
m
ÀRZ
lpm
+/
m
161
241
321
401
483
15
15
0.5
1.0
1.5
2.5
3.0
15
15
129
193
257
322
386
0.3
0.7
1.1
1.9
2.2
107
161
214
269
322
0.3
0.5
0.9
1.4
1.7
92
138
184
231
276
0.2
0.4
0.7
1.0
1.3
Notes:JSP JDOORQVSHUPLQXWHOSP OLWHUVSHUPLQXWH
+/ KHDGORVVIW KHDGORVVLQIHHWP KHDGORVVLQPHWHUV
0D[LPXPWHPSHUDWXUHULVHLVƒ) ƒ& DVVKRZQ
+HDGORVVLVIRUERLOHU¶VKHDWH[FKDQJHURQO\
15 QRWUHFRPPHQGHG
7DEOH :DWHU)ORZ5HTXLUHPHQWV%RLOHU
,03257$17127(6'LIIHUHQWJO\FROSURGXFWV
PD\SURYLGHYDU\LQJGHJUHHVRISURWHFWLRQ*O\FRO
SURGXFWVPXVWEHPDLQWDLQHGSURSHUO\LQDKHDWLQJ
V\VWHPRUWKH\PD\EHFRPHLQHIIHFWLYH&RQVXOWWKH
JO\FROVSHFL¿FDWLRQVRUWKHJO\FROPDQXIDFWXUHUIRU
LQIRUPDWLRQDERXWVSHFL¿FSURGXFWVPDLQWHQDQFH
RIVROXWLRQVDQGVHWXSDFFRUGLQJWR\RXUSDUWLFXODU
FRQGLWLRQV
BRADFORD WHITE CORP.
Page 20
150°F
C
COLD WATER
MAKE-UP
C
C
6<67(05(7851
7(03(5$785(
6(1625
130°F
180°F
6<67(06833/<
7(03(5$785(
6(1625
C
180°F
SYSTEM PUMP
PUMP LOCATION FOR
NON-PUMP-MOUNTED UNITS
NOTES:
1. BOILER LOOP IN EXAMPLE IS MAINTAINED AT 180°F.
2. ZONE THERMOSTATS CAN BE INTERLOCKED WITH BOILER,
SO THAT BOILER FIRES UPON CALL FOR HEAT FROM ANY
ZONE.
3. ZONE PIPING AND INTERLOCK WIRING TO BE DESIGNED
BY SYSTEM ENGINEER.
CAUTION: THIS DRAWING SHOWS SUGGESTED
PIPING CONFIGURATION AND VALVING, CHECK PUMP LOCATION FOR PUMP-MOUNTED UNITS
WITH LOCAL CODES AND ORDINANCES FOR
ADDITIONAL REQUIREMENTS.
PRIMARY/SECONDARY MANDITORY FOR ALL
VARIABLE FLOW SYSTEMS
INSTALL AIR VENTS AT HIGH POINTS IN SYSTEM
LEGEND
PIPING & SIZING OF EXPANSION TANK
PER TANK MANUFACTURER'S INSTRUCTIONS
EXPANSION TANK
THERMOMETER
WITH AIR SCOOP AND
DIMENSION "C" (COMMON PIPING) TO BE FOUR
AUTO AIR VENT
PIPE DIAMETERS, MAX. (NO ELBOWS OR VALVES)
TEMPERATURE PURGE
BOILER CIRCUIT PIPING MUST BE EQUAL
VALVE
SENSOR
TO BOILER WATER CONNECTION SIZE
3-WAY
VALVE
GLOBE VALVE
BOILER CIRC. PUMP SIZED FOR FLOW THROUGH BOILER
CHECK VALVE
VALVE
PRESSURE REDUCING VALVE
W/ FAST FILL BYPASS
PUMP
DOTTED DEVICES INDICATE ALTERNATE LOCATIONS
PUT BOILER CONTROL SENSOR IN THE SYSTEM
SUPPLY WHEN USING THIS PIPING STYLE.
MINIMUM BOILER INLET WATER TEMPERATURE
MUST BE AT LEAST 120°F.
Figure 5. +\GURQLF3LSLQJ²2QH%RLOHU0XOWL7HPSHUDWXUH6\VWHP
Page 21
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
COLD WATER
MAKE-UP
6<67(05(7851
7(03(5$785(
6(1625
6<67(06833/<
7(03(5$785(
6(1625
SYSTEM
RETURN
C
C
SYSTEM PUMP
PRIMARY/SECONDARY MANDITORY FOR ALL
VARIABLE FLOW SYSTEMS
INSTALL AIR VENTS AT HIGH POINTS IN SYSTEM
PIPING & SIZING OF EXPANSION TANK
PER TANK MANUFACTURER'S INSTRUCTIONS
DIMENSION "C" (COMMON PIPING) TO BE FOUR
PIPE DIAMETERS, MAX. (NO ELBOWS OR VALVES)
PUMP
LOCATION FOR
BOILER CIRCUIT PIPING MUST
BE EQUAL
NON-PUMP-MOUNTED
UNITS
TO BOILER WATER CONNECTION
SIZE
BOILER CIRC. PUMP SIZED FOR FLOW THROUGH BOILER
DOTTED DEVICES INDICATE ALTERNATE LOCATIONS
PUT BOILER CONTROL SENSOR IN THE SYSTEM
SUPPLY WHEN USING THIS PIPING STYLE.
MINIMUM BOILER INLET WATER TEMPERATURE
MUST BE AT LEAST 120°F.
3803/2&$7,21)25
121380302817('81,76
LEGEND
EXPANSION TANK
WITH AIR SCOOP AND
AUTO AIR VENT
THERMOMETER
TEMPERATURE
SENSOR
CAUTION: THIS DRAWING SHOWS SUGGESTED
PIPING CONFIGURATION AND VALVING, CHECK
WITH LOCAL CODES AND ORDINANCES FOR
ADDITIONAL REQUIREMENTS.
PUMP LOCATION FOR PUMP-MOUNTED UNITS
PURGE
VALVE
GLOBE VALVE
CHECK
PRIMARY/SECONDARY MANDITORY FOR
ALLVALVE
PRESSURE REDUCING VALVE
W/ FAST FILL BYPASS
Figure 6. +\GURQLF3LSLQJ²0XOWLSOH%RLOHUV
3ULPDU\6HFRQGDU\6\VWHP
6<67(05(7851
7(03(5$785(
6(1625
C
3-WAY VALVE
VALVE
PUMP
6<67(06833/<
7(03(5$785(
6(1625
WARNING: THIS DRAWING SHOWS SUGGESTED
PIPING CONFIGURATION AND VALVING, CHECK
WITH LOCAL CODES AND ORDINANCES FOR
ADDITIONAL REQUIREMENTS.
System
Return
SYSTEM
SUPPLY
System
Pump
C
System
Supply
PRIMARY/SECONDARY MANDATORY FOR ALL
VARIABLE FLOW SYSTEMS.
INSTALL AIR VENTS AT HIGH POINTS IN SYSTEM.
PIPING & SIZING OF EXPANSION TANK
PER TANK MANUFACTURER'S INSTRUCTIONS.
COMMON PIPING MUST BE SIZED FOR
COMBINED FLOW OF ALL BOILERS.
BOILER WATER CONNECTIONS (INLET/OUTLET)
MAY VARY. VERIFY CONNECTION ORIENTATION.
BOILER CIRCUIT PIPING MUST BE EQUAL
BOILER WATER CONNECTION SIZE.
BOILER CIRC. PUMP SIZED FOR FLOW
THROUGH BOILER AND 30 FEET OF
FULL-SIZED PIPING.
DIMENSION "C" TO BE 4 PIPE DIAMETERS.
MINIMUM INLET WATER TEMP = 70°F
Cold Water
Make-Up
3-Way Valve
Mounted on Pennant
DOTTED DEVICES INDICATE ALTERNATE
LOCATIONS.
TEMPERATURE SENSORS REQUIRE FIELD
INTERLOCK TO BOILER CONTROLS.
Pump Mounted
on Pennant
LEGEND
THERMOMETER
GLOBE VALVE
TEMPERATURE
SENSOR
CHECK VALVE
PRESSURE REDUCING VALVE
W/ FAST FILL BYPASS
PURGE
VALVE
3-WAY VALVE
VALVE
EXPANSION TANK
WITH AIR SCOOP AND
AUTO AIR VENT
Figure 7. 6XJJHVWHG3LSLQJ/RZ7HPSHUDWXUH3ULPDU\6HFRQGDU\6\VWHP
PUMP
BRADFORD WHITE CORP.
Page 22
COLD WATER
MAKE-UP
6<67(05(7851
7(03(5$785(
6(1625
6<67(06833/<
7(03(5$785(
6(1625
SYSTEM
RETURN
C
SYSTEM PUMP
SYSTEM
SUPPLY
PUMP LOCATION FOR
NON-PUMP-MOUNTED UNITS
PUMP LOCATION FOR PUMP-MOUNTED UNITS
CAUTION: THIS DRAWING SHOWS SUGGESTED
PIPING CONFIGURATION AND VALVING, CHECK
WITH LOCAL CODES AND ORDINANCES FOR
ADDITIONAL REQUIREMENTS.
PRIMARY/SECONDARY MANDITORY FOR ALL
VARIABLE FLOW SYSTEMS
INSTALL AIR VENTS AT HIGH POINTS IN SYSTEM
PIPING & SIZING OF EXPANSION TANK
PER TANK MANUFACTURER'S INSTRUCTIONS
LEGEND
EXPANSION TANK
WITH AIR SCOOP AND
AUTO AIR VENT
THERMOMETER
TEMPERATURE
SENSOR
PURGE
VALVE
DIMENSION "C" (COMMON PIPING) TO BE FOUR
PIPE DIAMETERS, MAX. (NO ELBOWS OR VALVES)
BOILER CIRCUIT PIPING MUST BE EQUAL
TO BOILER WATER CONNECTION SIZE
BOILER CIRC. PUMP SIZED FOR FLOW THROUGH BOILER
GLOBE VALVE
3-WAY VALVE
CHECK VALVE
VALVE
PRESSURE REDUCING VALVE
W/ FAST FILL BYPASS
PUMP
DOTTED DEVICES INDICATE ALTERNATE LOCATIONS
PUT BOILER CONTROL SENSOR IN THE SYSTEM
SUPPLY WHEN USING THIS PIPING STYLE.
MINIMUM BOILER INLET WATER TEMPERATURE
MUST BE AT LEAST 120°F.
Figure 8. +\GURQLF3LSLQJ3ULPDU\6HFRQGDU\5HYHUVH5HWXUQ
4.A.6 Filling the Boiler System
(QVXUHWKHV\VWHPLVIXOO\FRQQHFWHG&ORVHDOO
EOHHGLQJGHYLFHVDQGRSHQPDNHXSZDWHUYDOYH
$OORZV\VWHPWR¿OOVORZO\
,IPDNHXSZDWHUSXPSLVHPSOR\HGDGMXVW
pressure switch on pumping system to provide a
PLQLPXPRISVL N3D DWWKHKLJKHVWSRLQW
LQWKHKHDWLQJORRS
,IDZDWHUSUHVVXUHUHJXODWRULVSURYLGHGRQWKH
make-up water line, adjust the pressure regulator
WRSURYLGHDWOHDVWSVL N3D DWWKHKLJKHVW
SRLQWLQWKHKHDWLQJORRS
2SHQEOHHGLQJGHYLFHVRQDOOUDGLDWLRQXQLWVDWWKH
high points in the piping throughout the system,
unless automatic air bleeders are provided at such
SRLQWV
5XQV\VWHPFLUFXODWLQJSXPSIRUDPLQLPXPRI
PLQXWHVZLWKWKHERLOHUVKXWRII
2SHQDOOVWUDLQHUVLQWKHFLUFXODWLQJV\VWHPcheck
ÀRZVZLWFKRSHUDWLRQDQGFKHFNIRUGHEULV
If debris is present, clean out to ensure proper
FLUFXODWLRQ
5HFKHFNDOODLUEOHHGHUVDVGHVFULEHGLQ6WHS
Page 23
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
COLD WATER
MAKE-UP
6<67(05(7851
7(03(5$785(
6(1625
6<67(06833/<
7(03(5$785(
6(1625
SYSTEM
RETURN
C
SYSTEM PUMP
B
B
A
A
PUMP LOCATION FOR
NON-PUMP-MOUNTED UNITS
T1
CAUTION: THIS DRAWING SHOWS SUGGESTED
PIPING CONFIGURATION AND VALVING, CHECK
WITH LOCAL CODES AND ORDINANCES FOR
ADDITIONAL REQUIREMENTS.
TEMPERATURE
SENSOR
T1
PRIMARY/SECONDARY MANDITORY FOR ALL
VARIABLE FLOW SYSTEMS
INSTALL AIR VENTS AT HIGH POINTS IN SYSTEM
EXPANSION TANK
WITH AIR SCOOP AND
AUTO AIR VENT
PURGE
VALVE
PIPING & SIZING OF EXPANSION TANK
PER TANK MANUFACTURER'S INSTRUCTIONS
DIMENSION "C" (COMMON PIPING) TO BE FOUR
PIPE DIAMETERS, MAX. (NO ELBOWS OR VALVES)
BOILER CIRCUIT PIPING MUST BE EQUAL
TO BOILER WATER CONNECTION SIZE
GLOBE VALVE
3-WAY VALVE
CHECK VALVE
VALVE
PRESSURE REDUCING VALVE
W/ FAST FILL BYPASS
ADJUSTMENT PROCEDURE TO MAINTAIN
120°F INLET TEMP:
1. Turn on boiler and open valves A & B.
2. After steady-state operation, if T1 is less than
120°F, slowly close valve B until T1 climbs to
120°F.
3. If T1 is greater than 120°F, slowly close valve
A until T1 drops to 120°F.
4. Check after system operating temperature has
stabilized. Make final adjustments.
PUMP LOCATION FOR PUMP-MOUNTED UNITS
LEGEND
THERMOMETER
SYSTEM
SUPPLY
BOILER CIRC. PUMP SIZED FOR FLOW THROUGH BOILER
DOTTED DEVICES INDICATE ALTERNATE LOCATIONS
PUT BOILER CONTROL SENSOR IN THE SYSTEM
SUPPLY WHEN USING THIS PIPING STYLE.
PUMP
MINIMUM BOILER INLET WATER TEMPERATURE
MUST BE AT LEAST 120°F.
Figure 9. +\GURQLF3LSLQJ3ULPDU\6HFRQGDU\5HYHUVH5HWXUQ/RZ7HPSHUDWXUH
&KHFNOLTXLGOHYHOLQH[SDQVLRQWDQN:LWKWKH
system full of water and under normal operating
SUHVVXUHWKHOHYHORIZDWHULQWKHH[SDQVLRQWDQN
VKRXOGQRWH[FHHGóRIWKHWRWDOZLWKWKHEDODQFH
¿OOHGZLWKDLU
6WDUWXSERLOHUDFFRUGLQJWRWKHSURFHGXUHLQWKLV
PDQXDO2SHUDWHWKHHQWLUHV\VWHPLQFOXGLQJWKH
SXPSERLOHUDQGUDGLDWLRQXQLWVIRURQH KRXU
5HFKHFNWKHZDWHUOHYHOLQWKHH[SDQVLRQWDQN,I
WKHZDWHUOHYHOH[FHHGVóRIWKHYROXPHRIWKH
H[SDQVLRQWDQNRSHQWKHWDQNGUDLQDQGGUDLQWR
WKDWOHYHO
6KXWGRZQWKHHQWLUHV\VWHPDQGYHQWDOOUDGLDWLRQ
units and high points in the system piping, as
GHVFULEHGLQ6WHS
&ORVHPDNHXSZDWHUYDOYHDQGFKHFNVWUDLQHULQ
pressure reducing valve for sediment or debris
IURPWKHPDNHXSZDWHUOLQH5HRSHQPDNHXS
ZDWHUYDOYH
&KHFNJDXJHIRUFRUUHFWZDWHUSUHVVXUHDQGDOVR
FKHFNZDWHUOHYHOLQWKHV\VWHP,IWKHKHLJKW
indicated above the boiler insures that water is at
the highest point in the circulating loop, then the
V\VWHPLVUHDG\IRURSHUDWLRQ
BRADFORD WHITE CORP.
Page 24
4.B
5HIHUWRORFDOFRGHVDQGWKHPDNHXSZDWHUYDOYH
manufacturer’s instructions as to whether the
PDNHXSZDWHUYDOYHVKRXOGEHOHIWRSHQRUFORVHG
$IWHUSODFLQJWKHXQLWLQRSHUDWLRQWKHLJQLWLRQ
V\VWHPVDIHW\VKXWRIIGHYLFHPXVWEHWHVWHG)LUVW
shut off the manual gas valve, and call the unit
IRUKHDW$IWHUWKHSUHSXUJHDQGLJQLWRUKHDWXS
time, the main gas terminals will be energized,
DWWHPSWLQJWROLJKWIRUIRXU VHFRQGVDQGWKHQ
ZLOOGHHQHUJL]H7KHXQLWZLOOJRLQWRORFNRXW
PRGH6HFRQGWXUQWKHSRZHURIIDQGWKHQRQ
again, open the manual gas valve and allow the
XQLWWROLJKW:KLOHWKHXQLWLVRSHUDWLQJFORVHWKH
manual gas valve and ensure that power to the
PDLQJDVYDOYHKDVEHHQFXW
:LWKLQWKUHH GD\VRIVWDUWXSUHFKHFNDOODLU
EOHHGHUVDQGWKHH[SDQVLRQWDQNDVGHVFULEHGLQ
6WHSVDQGDERYH
,PSRUWDQW7KHLQVWDOOHULVUHVSRQVLEOHIRULGHQWLI\LQJ
WRWKHRZQHURSHUDWRUWKHORFDWLRQRIDOOHPHUJHQF\
VKXWRIIGHYLFHV
WARNING
'RQRWXVHWKLVDSSOLDQFHLIDQ\SDUWKDVEHHQ
XQGHUZDWHU,PPHGLDWHO\FDOODTXDOL¿HGVHUYLFH
WHFKQLFLDQWRLQVSHFWWKHDSSOLDQFH
DQGWRUHSODFHDQ\SDUWRIWKHFRQWUROV\VWHPDQG
DQ\JDVFRQWUROWKDWPD\KDYHEHHQ
XQGHUZDWHU
Water Heaters
4.B.1 :DWHU6\VWHP3LSLQJ²:DWHU+HDWHU
Hot water piping should be supported by suitable
KDQJHUVRUÀRRUVWDQGV'RQRWVXSSRUWSLSLQJZLWK
WKLVDSSOLDQFH'XHWRH[SDQVLRQDQGFRQWUDFWLRQRI
copper pipe, consideration should be given to the type
RIKDQJHUVXVHG5LJLGKDQJHUVPD\WUDQVPLWQRLVH
through the system resulting from the piping sliding in
WKHKDQJHUV,WLVUHFRPPHQGHGWKDWSDGGLQJEHXVHG
ZKHQULJLGKDQJHUVDUHLQVWDOOHG
The Copper Brute ll can be used with several
GLIIHUHQWW\SHVRIUHDGLO\DYDLODEOHVWRUDJHWDQNV$
pump draws water from the storage tank and pumps
WKHZDWHUWKURXJKWKHKHDWHUDQGEDFNLQWRWKHWDQN
3XPSPRXQWHGXQLWVKDYHDFLUFXODWLQJSXPSEXLOW
LQWRWKHZDWHUKHDWHU7KHSXPSVXVHGDUHVL]HGIRUWKH
KHDGORVVWKURXJKWKHKHDWHUSOXVIHHW P RIIXOO
sized piping (same size as boiler outlet) and a normal
QXPEHURI¿WWLQJV3XPSVXVHGRQSXPSPRXQWHGXQLW
DUHVL]HGIRUVRIWQRUPDORUKDUGZDWHUVRPDNHVXUH
a pump-mounted unit matches the water quality of the
LQVWDOODWLRQ
3LSHWKHRXWOHWIURPWKHKHDWHU¶VUHOLHIYDOYH
such that any discharge from the relief valve will be
conducted to a suitable place for disposal when relief
RFFXUV'RQRWUHGXFHOLQHVL]HRULQVWDOODQ\YDOYHVLQ
WKLVOLQH7KHOLQHPXVWEHLQVWDOOHGWRDOORZFRPSOHWH
GUDLQDJHRIERWKWKHYDOYHDQGWKHOLQH
6XJJHVWHGSLSLQJGLDJUDPVDUHVKRZQLQ)LJXUHV
WKURXJK7KHVHGLDJUDPVDUHPHDQWRQO\DVD
JXLGH&RPSRQHQWVUHTXLUHGE\ORFDOFRGHVPXVWEH
SURSHUO\LQVWDOOHG
1RWHWKHUHFRPPHQGHGORFDWLRQRIWKH
WHPSHUDWXUHVHQVRURQWKHGLDJUDPV7KH&RSSHU%UXWH
ll is shipped with an additional sensor that can be used
the storage tank, in lieu of a separate tank thermostat,
or for more full-featured domestic water heating
FRQWURO7RJHWWKHVHIHDWXUHV\RXPXVWSURYLGHD
ORFDWLRQIRUWKHDGGLWLRQDOVHQVRU,WFDQEHVWUDSSHGWR
DSLSHIURPWRGLDPHWHURULQVHUWHGLQWRDWDQN
LPPHUVLRQZHOO
The minimum inlet water temperature for a
&RSSHU%UXWHOO%RLOHU:DWHU+HDWHULVƒ) ƒ& WRDYRLGFRQGHQVLQJRQWKHFRSSHUFRLOV
The minimum inlet water temperature for the
/RZ7HPS&RSSHU%UXWHOOLVƒ) ƒ& 7KHPL[LQJ
system on the Copper Brute ll will ensure that the
KHDWH[FKDQJHULQWKH&RSSHU%UXWHOOGRHVQRWVHH
ZDWHUWKDWLVOHVVWKDQƒ) ƒ& VRWKDWH[FHVVLYH
FRQGHQVDWLRQGRHVQRWIRUPRQWKHKHDWH[FKDQJHU
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
4.B.2 +
RW:DWHU6XSSO\3LSLQJ²:DWHU
Heater
)ROORZWKHWDQNPDQXIDFWXUHU¶VJXLGHOLQHVIRU
FRPSOHWLRQRIWKHKRWZDWHUV\VWHPFRQQHFWLRQV
127($OLVWHGWHPSHUDWXUHDQGSUHVVXUHUHOLHI
YDOYHOLVWHGDVFRPSO\LQJZLWKWKH6WDQGDUGIRU
5HOLHI9DOYHVDQG$XWRPDWLF*DV6KXWRII'HYLFHV
IRU+RW:DWHU6XSSO\6\VWHPV $16,=
&6$ RIVXLWDEOHGLVFKDUJHFDSDFLW\PXVWEH
LQVWDOOHGLQWKHVHSDUDWHVWRUDJHWDQNV\VWHP
If the Copper Brute ll water heater is installed
in a closed water supply system, such as one having a
EDFNÀRZSUHYHQWHULQWKHFROGZDWHUVXSSO\OLQHWKH
relief valve may discharge periodically, due to thermal
H[SDQVLRQ0HDQV VXFKDVDSURSHUO\VL]HGH[SDQVLRQ
WDQN VKDOOEHSURYLGHGWRFRQWUROWKHUPDOH[SDQVLRQ
Contact the water supplier or local plumbing inspector
RQKRZWRFRQWUROWKLVVLWXDWLRQ
4.B.3 :
DWHU)ORZ5HTXLUHPHQWV²:DWHU
Heater
In a water heating application (an open system),
QHZZDWHULVFRQVWDQWO\EHLQJLQWURGXFHG:LWKWKH
new water comes a fresh supply of minerals that can
EHGHSRVLWHGRQWKHXQLW¶VKHDWH[FKDQJHU7KLVLV
FRPPRQO\NQRZQDVVFDOLQJ7KHDPRXQWRIPLQHUDOV
ZLOOGHSHQGXSRQWKHKDUGQHVVRIWKHZDWHU:DWHUFDQ
also be aggressive, and can erode metals, including
FRSSHULIWKHZDWHULVPRYHGWRRTXLFNO\7KHZDWHU
ÀRZUHTXLUHPHQWVIRUWKH&RSSHU%UXWHOOZDWHUKHDWHU
DUHEDVHGXSRQWKHKDUGQHVVRIWKHZDWHU7KHZDWHU
ÀRZLVNHSWKLJKHQRXJKWRSUHYHQWVFDOLQJEXWORZ
HQRXJKWRSUHYHQWWXEHHURVLRQ)RUH[WUHPHO\VRIWRU
KDUGZDWHUFXSURQLFNHOWXEHVDUHDYDLODEOH&RQWDFWD
%UDGIRUG:KLWH5HSUHVHQWDWLYHLI\RXKDYHTXHVWLRQV
RUFRQFHUQVDERXWZDWHUTXDOLW\
3XPSPRXQWHGZDWHUKHDWHUVFDQEHRUGHUHG
with standard pumps for soft or normal water or with
SXPSVIRUKDUGZDWHU7KHSXPSVXVHGDUHVL]HGIRU
WKHKHDGORVVWKURXJKWKHKHDWHUSOXVIHHW P of full-sized piping (same size as heater outlet) and a
QRUPDOQXPEHURI¿WWLQJV
7DEOHRQSDJHVSHFL¿HVZDWHUÀRZUDWHV
for water heaters, which will enable the user to size a
SXPS7KHKHDGORVVVKRZQLVIRUWKHKHDWHURQO\DQG
the user will need to add the headloss of the piping
V\VWHPWRSURSHUO\VL]HWKHSXPS
Page 25
4.B.4 &RPELQHG:DWHU+HDWLQJ SRWDEOH DQG
6SDFH+HDWLQJ²:DWHU+HDWHU
NOTE: 7KHVHV\VWHPVDUHQRWDOORZHGLQWKH
&RPPRQZHDOWKRI0DVVDFKXVHWWV
3LSLQJDQGFRPSRQHQWVFRQQHFWHGWRWKLVZDWHU
heater for the space heating application shall be
VXLWDEOHIRUXVHZLWKSRWDEOHZDWHU
7R[LFFKHPLFDOVVXFKDVXVHGIRUERLOHU
treatment, shall not be introduced into the potable
ZDWHUXVHGIRUVSDFHKHDWLQJ
This water heater when used to supply potable
water shall not be connected to any heating system
or component(s) previously used with a non-potable
ZDWHUKHDWLQJDSSOLDQFH
When the system requires water for heating at
temperatures higher than required for other uses,
an anti-scald mixing or tempering valve shall be
installed to temper the water for those uses in order
to reduce scald hazard potential.
4.B.5 )UHH]H3URWHFWLRQ±:DWHU+HDWHU
Although Copper Brute ll water heaters are
GHVLJQFHUWL¿HGIRURXWGRRULQVWDOODWLRQVVXFK
installations are not recommended in areas subject to
freezing temperatures, unless proper precautions are
WDNHQ
3RZHURXWDJHLQWHUUXSWLRQRIJDVVXSSO\IDLOXUH
of system components, activation of safety devices,
HWFPD\SUHYHQWDKHDWHUIURP¿ULQJAny time a
heater is subjected to freezing conditions, and the
KHDWHULVQRWDEOHWR¿UHDQGRUWKHZDWHULVQRW
able to circulate, there is a risk of freezing in the
heater or in the pipes in the system. When water
IUHH]HVLWH[SDQGV7KLVFDQUHVXOWLQEXUVWLQJRISLSHV
in the system, or damage to the heater, which could
UHVXOWLQOHDNLQJRUÀRRGLQJFRQGLWLRQV
Contact the local factory representative or
%UDGIRUG:KLWHIRUDGGLWLRQDOLQIRUPDWLRQ
Page 26
Figure 10. :DWHU+HDWHU3LSLQJ/RZ7HPSHUDWXUH6\VWHP
— One Heater, One Tank.
Figure 11. :DWHU+HDWHU3LSLQJ²2QH+HDWHU2QH7DQN
BRADFORD WHITE CORP.
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Figure 12. :DWHU+HDWHU3LSLQJ²0XOWLSOH+HDWHUV2QH7DQN
Figure 13. 6XJJHVWHG3LSLQJ/RZ7HPS6\VWHP²0XOWLSOH:DWHU+HDWHUV2QH7DQN
Page 27
Page 28
BRADFORD WHITE CORP.
Figure 14. :DWHU+HDWHU3LSLQJ²2QH+HDWHU0XOWLSOH7DQNV
Figure 15. 6XJJHVWHG3LSLQJ/RZ7HPS6\VWHP²2QH:DWHU+HDWHU0XOWLSOH7DQNV
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Figure 16. :DWHU+HDWHU3LSLQJ²0XOWLSOH+HDWHUV0XOWLSOH7DQNV
Figure 17. 6XJJHVWHG3LSLQJ/RZ7HPSHUDWXUH²0XOWLSOH:DWHU+HDWHUV0XOWLSOH7DQNV
Page 29
BRADFORD WHITE CORP.
Page 30
*30
7(035,6(ƒ)
/30
0
7(035,6(ƒ&
6,=(
6
1
+
6
1
+
6
1
+
6
1
+
6
1
+
6
1
+
500
45
68
90
1.8
2.3
3.5
19
13
9
170
257
341
0.5
0.7
1.1
10
7
5
750
45
68
90
2.1
3.0
6.0
28
19
14
170
257
341
0.6
0.9
1.8
16
10
8
1000
45
68
90
2.3
3.6
6.1
38
25
19
170
257
341
0.6
1.1
1.9
21
14
10
1250
68
68
90
3.8
3.8
6.3
31
31
24
257
257
341
1.2
1.2
1.9
17
17
13
1500
68
68
90
3.9
3.9
6.5
38
38
28
257
257
341
1.2
1.2
2.0
21
21
16
1750
68
68
90
4.0
4.0
6.7
44
44
33
257
257
341
1.2
1.2
2.0
24
24
18
2000
112
112
112
10.0 10.0 10.0
30
30
30
424
424
424
3.0
3.0
3.0
17
17
17
NOTES:
)7
6 VRIWZDWHU WRJUDLQVKDUGQHVV 1 QRUPDOZDWHU WRJUDLQVKDUGQHVV + KDUGZDWHU PRUHWKDQJUDLQVKDUGQHVV JSP JDOORQVSHUPLQXWHVOSP OLWHUVSHUPLQXWHIW KHDGOHVVLQIHHWP KHDGORVVLQPHWHUV
+HDGORVVLVIRUKHDWHU¶VKHDWH[FKDQJHURQO\
7DEOH :DWHU)ORZ5HTXLUHPHQWV±
Heater.
4.B.6 Filling the Water Heater System
(
QVXUHWKHV\VWHPLVIXOO\FRQQHFWHG&ORVHDOOEOHHGLQJ
GHYLFHVDQGRSHQPDNHXSZDWHUYDOYH$OORZV\VWHPWR¿OO
VORZO\
,IPDNHXSZDWHUSXPSLVHPSOR\HGDGMXVWSUHVVXUHVZLWFK
RQSXPSLQJV\VWHPWRSURYLGHDPLQLPXPRISVL N3D DWWKHKLJKHVWSRLQWLQWKHKHDWLQJORRS
,IDZDWHUSUHVVXUHUHJXODWRULVSURYLGHGRQWKHPDNHXS
ZDWHUOLQHDGMXVWWKHSUHVVXUHUHJXODWRUWRSURYLGHDWOHDVW
SVL N3D DWWKHKLJKHVWSRLQWLQWKHKHDWLQJORRS
2
SHQEOHHGLQJGHYLFHVRQDOOUDGLDWLRQXQLWVDWWKHKLJK
points in the piping throughout the system, unless automatic
DLUEOHHGHUVDUHSURYLGHGDWVXFKSRLQWV
5
XQV\VWHPFLUFXODWLQJSXPSIRUDPLQLPXPRIPLQXWHV
ZLWKWKHERLOHUVKXWRII
2SHQDOOVWUDLQHUVLQWKHFLUFXODWLQJV\VWHPFKHFNÀRZ
VZLWFKRSHUDWLRQDQGFKHFNIRUGHEULV,IGHEULVLVSUHVHQW
FOHDQRXWWRHQVXUHSURSHUFLUFXODWLRQ
5HFKHFNDOODLUEOHHGHUVDVGHVFULEHGLQ6WHS
&
KHFNOLTXLGOHYHOLQH[SDQVLRQWDQN:LWKWKHV\VWHPIXOO
of water and under normal operating pressure, the level of
ZDWHULQWKHH[SDQVLRQWDQNVKRXOGQRWH[FHHGóRIWKHWRWDO
ZLWKWKHEDODQFH¿OOHGZLWKDLU
6
WDUWXSWKHZDWHUKHDWHUDFFRUGLQJWRWKHSURFHGXUHLQWKLV
PDQXDO2SHUDWHWKHHQWLUHV\VWHPLQFOXGLQJWKHSXPS
ERLOHUDQGUDGLDWLRQXQLWVIRURQH KRXU
5HFKHFNWKHZDWHUOHYHOLQWKHH[SDQVLRQWDQN,IWKHZDWHU
OHYHOH[FHHGVóRIWKHYROXPHRIWKHH[SDQVLRQWDQNRSHQ
WKHWDQNGUDLQDQGGUDLQWRWKDWOHYHO
6KXWGRZQWKHHQWLUHV\VWHPDQGYHQWDOOUDGLDWLRQXQLWVDQG
KLJKSRLQWVLQWKHV\VWHPSLSLQJDVGHVFULEHGLQ6WHS
&ORVHWKHPDNHXSZDWHUYDOYHDQGFKHFNVWUDLQHULQSUHVVXUH
reducing valve for sediment or debris from the make-up
ZDWHUOLQH5HRSHQPDNHXSZDWHUYDOYH
&KHFNJDXJHIRUFRUUHFWZDWHUSUHVVXUHDQGDOVRFKHFN
ZDWHUOHYHOLQWKHV\VWHP,IWKHKHLJKWLQGLFDWHGDERYH
the boiler insures that water is at the highest point in the
FLUFXODWLQJORRSWKHQWKHV\VWHPLVUHDG\IRURSHUDWLRQ
5HIHUWRORFDOFRGHVDQGWKHPDNHXSZDWHUYDOYHPDQXIDFturer’s instructions as to whether the make-up water valve
VKRXOGEHOHIWRSHQRUFORVHG
$IWHUSODFLQJWKHXQLWLQRSHUDWLRQWKHLJQLWLRQV\VWHP
VDIHW\VKXWRIIGHYLFHPXVWEHWHVWHG)LUVWVKXWRIIWKH
PDQXDOJDVYDOYHDQGFDOOWKHXQLWIRUKHDW$IWHUWKHSUH
purge and ignitor heat-up time, the main gas terminals will
EHHQHUJL]HGDWWHPSWLQJWROLJKWIRUIRXU VHFRQGVDQG
WKHQZLOOGHHQHUJL]H7KHXQLWZLOOJRLQWRORFNRXWPRGH
6HFRQGWXUQWKHSRZHURIIDQGWKHQRQDJDLQRSHQWKH
PDQXDOJDVYDOYHDQGDOORZWKHXQLWWROLJKW:KLOHWKHXQLW
is operating, close the manual gas valve and ensure that
SRZHUWRWKHPDLQJDVYDOYHKDVEHHQFXW
:LWKLQWKUHH GD\VRIVWDUWXSUHFKHFNDOODLUEOHHGHUV
DQGWKHH[SDQVLRQWDQNDVGHVFULEHGLQ6WHSVDQGDERYH
,PSRUWDQW7KHLQVWDOOHULVUHVSRQVLEOHIRULGHQWLI\LQJ
WRWKHRZQHURSHUDWRUWKHORFDWLRQRIDOOHPHUJHQF\
VKXWRIIGHYLFHV
WARNING
'RQRWXVHWKLVDSSOLDQFHLIDQ\SDUWKDVEHHQ
XQGHUZDWHU,PPHGLDWHO\FDOODTXDOL¿HGVHUYLFH
WHFKQLFLDQWRLQVSHFWWKHDSSOLDQFH
DQGWRUHSODFHDQ\SDUWRIWKHFRQWUROV\VWHPDQG
DQ\JDVFRQWUROWKDWPD\KDYHEHHQ
XQGHUZDWHU
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
SECTION 5
5.A
Electrical Connections
Installation Warnings
WARNING
This appliance must be electrically grounded in
accordance with the requirements of the authority having
jurisdiction or, in the absence of such requirements, with
WKHODWHVWHGLWLRQRIWKH1DWLRQDO(OHFWULFDO&RGH$16,
1)3$LQWKH86DQGZLWKWKHODWHVWHGLWLRQRI&6$
&&DQDGLDQ(OHFWULFDO&RGH3DUWLQ&DQDGD'R
not rely on the gas or water piping to ground the metal
SDUWVRIWKHERLOHU3ODVWLFSLSHRUGLHOHFWULFXQLRQVPD\
LVRODWHWKHERLOHUHOHFWULFDOO\6HUYLFHDQGPDLQWHQDQFH
personnel, who work on or around the boiler may be
VWDQGLQJRQZHWÀRRUVFRXOGEHHOHFWURFXWHGE\DQ
XQJURXQGHGERLOHU(OHFWURFXWLRQFDQUHVXOWLQVHYHUH
LQMXU\RUGHDWK
6LQJOHSROHVZLWFKHVLQFOXGLQJWKRVHRIVDIHW\
controls and protective devices, must not be wired in a
JURXQGHGOLQH
All electrical connections are made at the power
terminals, which are located at the rear of the appliance,
RUDWWKHLQSXWRXWSXWWHUPLQDOVWULSVZKLFKDUHORFDWHGRQ
WKHULJKWVLGHRIWKHDSSOLDQFH
All internal electrical components have been
SUHZLUHG1RDWWHPSWVKRXOGEHPDGHWRFRQQHFW
HOHFWULFDOZLUHVWRDQ\RWKHUORFDWLRQH[FHSWWKHWHUPLQDO
EORFNV
5.B
Page 31
5.B.2 3XPS3RZHU
7KHSXPSFLUFXLWLVLGHQWL¿HGE\WKUHH$:*
ZLUHVEODFNZLWKDZKLWHVWULSH / ZKLWH 1 DQG
JUHHQ *URXQG If desired, an installer can change the pump
mounted single service units to use a separate circuit
IRUWKHSXPS,QVWUXFWLRQVWRPDNHWKLVFKDQJHDUH
IRXQGLQWKHQH[W6HFWLRQ
Over Current Recommendations (Amps)
Pennant
Pump Only
Without
With
Size
Pump
Pump
Taco
B&G
500
15
20
15
15
750
15
20
15
15
25 –Taco
1000
20
15
15
30 – B & G
1250
25
30
15
15
1500
25
30
15
15
1750
25
–
15
20
2000
25
–
20
20
7DEOH &LUFXLW3URWHFWLRQ
Line Voltage Connections
Incoming power must be protected by the
appropriate circuit breaker (fuse) and installed by a
TXDOL¿HGHOHFWULFLDQRUDXWKRUL]HGTXDOL¿HGSHUVRQQHO
5HFRPPHQGHGRYHUFXUUHQWSURWHFWLRQUDWLQJVDUH
VKRZQLQ7DEOHRQSDJH
5.B.1 0DLQ3RZHU
All non-pump mounted Copper Brute lls require
DVLQJOHYROWVXSSO\3XPSPRXQWHG&RSSHU%UXWH
OOVL]HVDOVRXVHDVLQJOHYROWVXSSO\DQG
&RSSHU%UXWHOOVL]HVUHTXLUHWZRVHSDUDWH
YROWVXSSOLHV
&RSSHU%UXWHOOVL]HVPDLQSRZHU
/1DQG*URXQG VKDOOEHFRQQHFWHGWRWKHWKUHH
ZLUHVVXSSOLHG7KLVPDLQSRZHUFLUFXLWLVLGHQWL¿HG
E\WKUHHVROLGFRORUHGZLUHV $:* ±EODFN / ZKLWH 1 DQGJUHHQ *URXQG &RSSHU%UXWHOOVL]HVPDLQSRZHU /
1DQG*URXQG LVLGHQWL¿HGE\WKUHHVROLGFRORUHG
ZLUHV $:* ±EODFN / ZKLWH 1 DQGJUHHQ
*URXQG 7KHSXPSFLUFXLWLVLGHQWL¿HGE\WKUHH
$:*ZLUHVDVRXWOLQHGLQWKHQH[W6HFWLRQ
5.B.3 %RLOHU+HDWHU3XPS
Conversion to a separate pump circuit requires
bringing in a separate circuit for the pump and
removing the three jumper wires within the internal
ZLULQJRIWKHYROWSRUWLRQRIWKH&RSSHU%UXWHOO
VHH)LJXUH 7KLVDFWLRQVKRXOGRQO\EHSHUIRUPHG
E\TXDOL¿HGSHUVRQQHOZLWKWKHSRZHUGLVFRQQHFWHG
IURPWKHXQLW
To rewire the pump circuit, bring in a separate
YROWFLUFXLW /1DQG*URXQG 5HPRYH
WKHMXPSHUZLUHVVKRZQLQ)LJXUH&RQQHFWWKH
LQFRPLQJOLQHYROWDJH / WRWKHPDLQSRZHUVZLWFK
XVLQJDó´IHPDOHLQVXODWHGSXVKRQWHUPLQDO)URP
the other side of the main power switch, connect to
the main power terminal block, in the rear of the unit,
XVLQJDó´IHPDOHLQVXODWHGSXVKRQWHUPLQDO7KLV
will be in the same position where the line voltage
MXPSHUWHUPLQDWHG&RQQHFW1DQG*URXQGWRWKH
PDLQWHUPLQDOEORFNLQWKHUHDURIWKHXQLWXVLQJó´
IHPDOHLQVXODWHGSXVKWHUPLQDOV7KHVHFRQQHFWLRQV
will also be the same positions where the neutral and
JURXQGMXPSHUVZHUHWHUPLQDWHG
Page 32
BRADFORD WHITE CORP.
'+:'+:&RQQHFWWKHDTXDVWDWRUHQGVZLWFK
LVRODWHGFRQWDFWRQO\ ZLUHVWRWHUPLQDOVDQGRIWKH
LQSXWWHUPLQDOVWULS,ISUHIHUUHGD'+:WDQNVHQVRU
can be used in lieu of an aquastat to generate a heat
GHPDQGUHIHUWR6HFWLRQ&G
127(7KHKHDWGHPDQGFRQWDFWVPXVWEHGU\
FRQWDFWV7KH&RSSHU%UXWHOOFRQWUROOHUKHDWGHPDQG
YROWDJHLV9'&
5.C.1.c )LHOG,QSXWV 2SHQ&ORVHG
)LHOG,QSXW)LHOG,QSXWLIXVHGLVFRQQHFWHG
DFURVVWHUPLQDOVDQGRIWKHLQSXWWHUPLQDOVWULS
:KHQFRQQHFWHG)LHOG,QSXWFRQWUROVWKH$X[LOLDU\
'U\&RQWDFW,I)LHOG,QSXWLVRSHQWKH$X[LOLDU\
'U\&RQWDFWLVRSHQ,I)LHOG,QSXWLVFORVHGWKH
$X[LOLDU\'U\&RQWDFWLVFORVHG2QO\GU\FRQWDFWV
FDQEHFRQQHFWHGWR)LHOG,QSXW
Figure 18. 5HPRYLQJ-XPSHUV
5.B.4 $X[LOLDU\3RZHU2XWSXW
7KH$X[LOLDU\3RZHU2XWSXWLIXVHGLVFRQWUROOHG
E\)LHOG,QSXW:KHQ)LHOG,QSXWLVFORVHG
OLQHYROWDJHLVVXSSOLHGDWWHUPLQDODQGQHXWUDORQ
WHUPLQDORIWKHRXWSXWWHUPLQDOVWULS7KLVRXWSXWLV
UDWHGIRU9$&$PD[LPXP
5.C
Low Voltage Connections
5RXWHDOOZLUHVWKURXJKWKHNQRFNRXWVRQWKHULJKWVLGH
RIWKH&RSSHU%UXWHOO&RQQHFWORZYROWDJHZLULQJ
WRWKHLQSXWDQGRXWSXWWHUPLQDOVVKRZQLQ)LJXUH
&RQQHFWDOOZLULQJDVVKRZQRQWKHZLULQJGLDJUDP
5.C.1
Field Wiring - Inputs
5.C.1.a Safety Interlocks
)LHOG,QWHUORFN,IWKH)LHOG,QWHUORFNLVXWLOL]HG
UHPRYHWKHMXPSHUIURPWKHWHUPLQDOVDQGRIWKH
input terminal strip and wire the interlock to these
WHUPLQDOV2QO\GU\FRQWDFWVFDQEHFRQQHFWHGWRWKH
)LHOG,QWHUORFNWHUPLQDOV
127(6DIHW\FKDLQYROWDJHLV9'&
&E Boiler/Heater Heat Demands
&+'+:&RQQHFWWKHWKHUPRVWDWDTXDVWDWRUHQG
VZLWFK LVRODWHGFRQWDFWRQO\ ZLUHVWRWHUPLQDOVDQG
RIWKHLQSXWWHUPLQDOVWULS
&+'+:&RQQHFWDQDGGLWLRQDOWKHUPRVWDW
aquastat or end switch (isolated contact only) wires to
WHUPLQDOVDQGRIWKHLQSXWWHUPLQDOVWULS
)LHOG,QSXW)LHOG,QSXWLIXVHGLVFRQQHFWHG
DFURVVWHUPLQDOVDQGRIWKHLQSXWWHUPLQDOVWULS
:KHQFRQQHFWHG)LHOG,QSXWFRQWUROVWKH$X[LOLDU\
3RZHU2XWSXW,I)LHOG,QSXWLVRSHQWKH$X[LOLDU\
3RZHU2XWSXWLVRII,I)LHOG,QSXWLVFORVHGWKH
FRQWUROOHUWXUQVSRZHURQDWWKH$X[LOLDU\3RZHU
2XWSXW
127(7KHFRQWUROOHUDSSOLHV9'&WRWKH)LHOG
,QSXWVWRGHWHFWWKHVWDWXVRIWKHFRQWDFWV
5.C.1.d 7HPSHUDWXUH6HQVRUV
6\VWHP6XSSO\7KHV\VWHPVXSSO\VHQVRULIXVHGLV
FRQQHFWHGWRWHUPLQDOVDQGRIWKHLQSXWWHUPLQDO
VWULS:KHQFRQQHFWHGWKHFRQWUROOHUDXWRPDWLFDOO\
GHWHFWVWKHSUHVHQFHRIWKLVVHQVRU,ILQVWDOOHGWKH
Copper Brute ll controls the staging of the burners to
maintain the system supply temperature to the heat
GHPDQGVHWSRLQW7KHV\VWHPVXSSO\WHPSHUDWXUH
is shown on the home screen above the red system
LQSXWDUURZVHH)LJXUHRQSDJH7KLVVHQVRU
is supplied loose with the Copper Brute ll and is
installed in the piping or tank per the suggested piping
GLDJUDPV
6\VWHP5HWXUQ7KHV\VWHPUHWXUQVHQVRULIXVHGLV
FRQQHFWHGWRWHUPLQDOVDQGRIWKHLQSXWWHUPLQDO
VWULS:KHQFRQQHFWHGWKHFRQWUROOHUDXWRPDWLFDOO\
GHWHFWVWKHSUHVHQFHRIWKLVVHQVRU7KHUHLVQRFRQWURO
ORJLFDVVRFLDWHGZLWKWKLVVHQVRU:KHQFRQQHFWHG
this temperature is shown on the home screen above
WKHEOXHV\VWHPRXWSXWDUURZ7KLVVHQVRULVVXSSOLHG
loose with the Copper Brute ll and is installed in the
SLSLQJRUWDQNSHUWKHVXJJHVWHGSLSLQJGLDJUDPV
'RPHVWLF+RW:DWHU '+: 7KH'+:VHQVRULI
XVHGLVFRQQHFWHGWRWHUPLQDOVDQGRQWKHLQSXW
Page 33
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Detail
Figure 19. ,QSXWDQG2XWSXW7HUPLQDO6WULSV
5.C.2 )LHOG:LULQJ2XWSXWV
WHUPLQDOVWULS:KHQFRQQHFWHGWKH&RSSHU%UXWHOO
ZLOOXVHWKLVVHQVRUWRSHUIRUPWKH'+:WKHUPRVWDW
IXQFWLRQ7KHFRQWUROOHUDXWRPDWLFDOO\GHWHFWVWKH
presence of this sensor and initiates a call for heat
ZKHQWKH'+:WHPSHUDWXUHGURSVEHORZWKH'+:
VHWSRLQWE\WKHYDOXHRIWKH'+:2Q+\VWHUHVLV
'+:6HW3RLQW±'+:2Q+\VWHUHVLV '+:KHDW
GHPDQG 7KH'+:KHDWGHPDQGLVVDWLV¿HGZKHQWKH
'+:WHPSHUDWXUHULVHVDERYHWKH'+:VHWSRLQWE\
WKHYDOXHRIWKH'+:2II+\VWHUHVLV '+:6HW3RLQW
'+:2II+\VWHUHVLV '+:KHDWGHPDQGVDWLV¿HG When connected, this temperature is shown on the
KRPHVFUHHQEHORZWKHIDXFHWLFRQ7KLVVHQVRULV
supplied loose with the Copper Brute ll and is installed
LQWKHWDQNSHUWKHVXJJHVWHGSLSLQJGLDJUDPV
2XWGRRU7KHRXWGRRUVHQVRULIXVHGLVFRQQHFWHGWR
WHUPLQDOVDQGRIWKHLQSXWWHUPLQDOVWULS:KHQ
connected, the controller automatically detects the
SUHVHQFHRIWKLVVHQVRU,ILQVWDOOHGRSWLRQVVXFKDV
outdoor reset and warm weather shutdown can be
HQDEOHGWKURXJKWKHGLVSOD\
5.C.1.e
$QDORJ %$6 ,QSXW
%XLOGLQJ$XWRPDWLRQ6\VWHP %$6 7KH%$6LQSXW
LIXVHGLVFRQQHFWHGWRWHUPLQDOVDQGRIWKH
LQSXWWHUPLQDOVWULS:KHQPDNLQJWKHFRQQHFWLRQ
adhere to the polarity designations shown on the label
RUZLULQJGLDJUDP7KHLQSXWVLJQDOFDQEH
±9'&RU±P$DQGFDQEHXVHGWRFRQWURO
WKH¿ULQJUDWHRUVHWSRLQWUHIHUWR(RQSDJH
7KHIDFWRU\GHIDXOWVHWWLQJLVIRUD±9'&VLJQDO
&RQ¿JXUHIRU±P$E\SODFLQJDMXPSHURQ&1
RQWKHFRQWUROERDUGVHH)LJXUH
5.C.2.a Dry Contacts
5XQ7KHVHFRQWDFWVZKHQXVHGDUHFRQQHFWHGWR
WHUPLQDOV FRPPRQ QRUPDOO\FORVHG DQG
QRUPDOO\RSHQ RIWKHRXWSXWWHUPLQDOVWULS7KH
controller closes the normally open set of contacts
ZKHQHYHUWKH&RSSHU%UXWHOOLVUXQQLQJ7KLVLV
W\SLFDOO\XVHGE\D%$6WRYHULI\WKH&RSSHU%UXWHOOLV
VDWLVI\LQJDKHDWGHPDQG&RQWDFWUDWLQJVDUH9$&
$PD[LPXP
Alarm: These contacts, when used, are connected
WRWHUPLQDOV FRPPRQ QRUPDOO\FORVHG DQG
QRUPDOO\RSHQ RIWKHRXWSXWWHUPLQDOVWULS7KH
controller closes the normally open set of contacts
whenever the Copper Brute ll is locked out or power
LVWXUQHGRII&RQWDFWUDWLQJVDUH9$&$
PD[LPXP
'+:3XPS:KHQFRQQHFWLQJDGRPHVWLFKRWZDWHU
'+: SXPSXVHWHUPLQDOVDQGRIWKHRXWSXW
WHUPLQDOVVWULS$VWKLVLVDGU\FRQWDFWWKH'+:SXPS
FRQWDFWPXVWEHZLUHGZLWKHLWKHUWKH'+:SXPS
VXSSO\YROWDJHRU'+:SXPSUHOD\FRLOYROWDJH'+:
SXPSIXQFWLRQDOLW\LVFRQ¿JXUHGXVLQJWKHWRXFKVFUHHQ
&RQWDFWUDWLQJVDUH9$&$PD[LPXP
6\VWHP3XPS:KHQFRQQHFWLQJDV\VWHPSXPSXVH
WHUPLQDOVDQGRIWKHRXWSXWWHUPLQDOVWULS$V
this is a dry contact, the system pump contact must
be wired with either the system pump supply voltage
RUWKHV\VWHPSXPSUHOD\FRLOYROWDJH6\VWHPSXPS
IXQFWLRQDOLW\LVFRQ¿JXUHGXVLQJWKHWRXFKVFUHHQ
&RQWDFWUDWLQJVDUH9$&$PD[LPXP
$8;7KHVHFRQWDFWVZKHQXVHGDUHFRQQHFWHGWR
WHUPLQDOVDQGRIWKHRXWSXWWHUPLQDOVWULS7KH
FRQWUROOHUFORVHVWKLVFRQWDFWZKHQ)LHOG,QSXWLV
BRADFORD WHITE CORP.
Page 34
JUMPER
4 - 20mA
ANALOG
INPUTS
NO JUMPER
0 - 10VDC
JUMPERS
4-20 mA
JUMPERS
0 - 10VDC
ANALOG OUTPUTS
Figure 20. $QDORJ,QSXWDQG2XWSXW-XPSHU3ODFHPHQW
FORVHGRWKHUZLVHWKLVFRQWDFWUHPDLQVRSHQ&RQWDFW
UDWLQJVDUH9$&$PD[LPXP
&E Cascade RS485
3ULRUWRZLULQJ&RSSHU%UXWHOOXQLWVIRUFDVFDGH
operations, select one Copper Brute ll as the lead
ERLOHUKHDWHU2WKHU&RSSHU%UXWHOOVFRQQHFWHGWRWKH
OHDGERLOHUKHDWHUZLOOEHUHIHUUHGWRDVODJXQLWV
Communication between lead and lag units is
DFFRPSOLVKHGXVLQJ56:KHQZLULQJ&RSSHU
Brute ll units for cascade operations, use terminals
$ % DQG *1' RIWKHRXWSXWWHUPLQDO
VWULS8VHZLUHWZLVWHGSDLUVKLHOGHGZGUDLQ
FRPPXQLFDWLRQFDEOHEHWZHHQXQLWV5HIHUULQJ
WR)LJXUHFRQQHFWRQHHQGRIWKHWZLVWHGSDLU
ZLUHVWR$ WHUPLQDO DQGWKHRWKHUWRWHUPLQDO%
WHUPLQDO DQGWKHGUDLQZLUHWR*1' WHUPLQDO
&RQQHFWWKHRWKHUHQGRIWKHFDEOHWRWKHQH[W
Copper Brute ll, matching the termination wiring on
WKHSUHYLRXVXQLWH[FHSWIRU*1'2QO\FRQQHFWWKH
drain wire to ground on one end of the cable to avoid
JURXQGORRSLVVXHV,IPRUHWKDQWZR&RSSHU%UXWH
ll units are cascaded together, daisy chain the wiring
from Copper Brute ll to Copper Brute ll, keeping the
FDEOHVDVVKRUWDVSRVVLEOH
A system supply sensor must be installed and
FRQQHFWHGWRWKHOHDGERLOHUVHH6\VWHP6XSSO\LQ
&GRQSDJH±7HPSHUDWXUH6HQVRUV7KH
lead boiler will use this system supply sensor as the
WHPSHUDWXUHFRQWUROVHQVRUIRUFDVFDGHRSHUDWLRQV
&+'+:WHUPLQDOVDUHXVHGWRLQLWLDWHDKHDW
GHPDQGDWWKHOHDGERLOHUUHIHUWR&+'+:LQ
&ERQSDJH±+HDW'HPDQGV
5.C.2.c
BAS RS485 (%$&QHW0673RU
0RGEXV
7KHVHWHUPLQDOVZKHQXVHGDUHIRU56VHULDO
FRPPXQLFDWLRQZLWKD%$6V\VWHPXVLQJ%$&QHW
0673RU0RGEXVSURWRFROV8VHZLUHWZLVWHGSDLU
VKLHOGHGZGUDLQFRPPXQLFDWLRQFDEOHEHWZHHQWKH
%$6DQG&RSSHU%UXWHOO
5.C.2.d
24VAC
7KHUHDUHWHUPLQDOVIRU9$&RQWKHRXWSXWWHUPLQDO
VWULS7KHVHWHUPLQDOVDUHUHVHUYHGIRU&RSSHU%UXWHOO
ORZWHPSXQLWVRUDORZZDWHUFXWRRIIRSWLRQNLW
Cascade Wiring Connections
5.D
TB2-23
TB2-22
TB2-24
TB2-23
TB2-22
TB2-24
TB2-23
TB2-22
TB2-24
TB2-20
TB2-19
TB2-21
TB2-20
TB2-19
TB2-21
TB2-20
TB2-19
TB2-21
BAS
RS485 A
RS485 B
RS485 GND
BAS
RS485 A
RS485 B
RS485 GND
BAS
RS485 A
RS485 B
RS485 GND
BAS Wiring Connections
Figure 22.
Cascade Wiring Connections
Figure 21.
Page 35
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
BRADFORD WHITE CORP.
Page 36
5.E
Wiring
Diagram
L2
FIELD INPUTS
Low Voltage
MAIN POWER SWITCH
120VAC
K1
PUMP
*
M
*
L1
N2
NOTE: L2/N2 only applicable on sizes 1750 and 2000,
otherwise power received from L1 to N1.
Voltage Legend
120 VAC
Low Voltage
BLACK
BLUE
FIELD
*
INPUT 1
FIELD
N1
INPUT 2
WHITE
SYSTEM
YELLOW
SUPPLY
24VAC
BLUE
1
BLUE
SENSOR
LWCO SUPPLY VOLTAGE
2
TB2-26
TB2-25
YELLOW
SYSTEM
RETURN
SENSOR
YELLOW
BOILER/HEATER CONTROLLER
BLUE
X9-11
BLUE
GAS VALVE VOLTAGE
X9-2
X5-10
BLACK
X10-1
X10-2
CONTROLLER VOLTAGE
X10-3
X15-8
X5-5
X8-1
BLACK
TB1-3
TT - 1
RED
TB1-4
ORANGE
TB1-7
TT - 2
VIOLET
TB1-8
BLUE
TB1-5
DHW
DEMAND
GREY
TB1-6
WHITE/RED
FLOW
VIOLET/WHITE
BROWN
LWCO
RED/BLACK
RED
RED/BLACK
BLOCKED
FLUE
GREY/BLACK
RED
HIGH GAS
PRESSURE
RED
GREY/RED
WHITE/YELLOW
AUTO
RESET
HIGH LIMIT
WHITE/BROWN
ORANGE
TB1-1
FIELD
INTERLOCK
GREY/ORANGE
TB1-2
RED
AIR PROVING
SWITCH #1
VIOLET
X2-3
X8-4
VIOLET/WHITE
X8-5
X2-2
X8-6
X2-9
X8-7
X4-1
X8-9
X4-11
BOILER PUMP
CONTROL RELAY
X14-8
X14-1
X4-3
HIGH
X4-13
LOW
X11-2
X11-1
X4-4
X4-14
X11-3
HIGH
LOW
X11-6
X11-5
X4-15
X11-4
X4-6
X12-3
X4-16
X12-4
X4-8
X15-4
X4-18
X12-1
X4-7
X12-2
X4-17
X15-3
X4-9
X9-1
X9-3
X4-20
RED
1
2
3
4
BLACK
ORANGE
YELLOW
2
1
VIOLET
X1-1
X1-2
OUTDOOR
WHITE
SENSOR
GREEN
BAS (-)
GREEN
YELLOW
BROWN
RED
BLUE
GREY
ORANGE
GREEN
VIOLET
BROWN/RED
0-10VDC (+)
X59-1
X59-2
X59-3
X59-4
X59-5
X59-6
X59-7
X59-8
K1
WHITE
BROWN
M
BLOWER#1
M
BLOWER#2
BLUE/WHITE
WHITE
BROWN/WHITE
BLUE/BLACK
WHITE/BLACK
GREY
GREY
HSI #1
GREY
GREY
GREY
HSI #2
GREY
BROWN
YELLOW
GAS
VALVE #1
GAS
VALVE #1A
X9-4
X9-7
X9-9
BROWN
YELLOW
BROWN
YELLOW
GAS
VALVE #2
GAS
VALVE #3
GAS
VALVE #3A
X1-14
X9-10
X1-13
SENSOR
GREEN
X4-10
X9-6
BLACK
WHITE
INLET
SENSOR
10K
24VDC
X4-12
OUTLET SENSOR
DUAL ELEMENT
10K
20K
TOUCH SCREEN
X2-10
X4-19
RED/WHITE
AIR PROVING
SWITCH #2
X2-8
X8-3
X4-5
GREY/VIOLET
LOW GAS
PRESSURE
X8-2
X4-2
GREY/WHITE
MANUAL
RESET
HIGH LIMIT
X2-1
DHW
YELLOW
X9-12
BROWN
YELLOW
GAS
VALVE #4
Page 37
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
INDICATES FIELD I/O
BOILER/HEATER CONTROLLER
FIELD INPUTS
FIELD
INPUT 1
FIELD
INPUT 2
SYSTEM
TB1-9
TB1-10
TB1-11
TB1-12
TB1-13
SUPPLY
TB1-14
SENSOR
TB1-15
SYSTEM
RETURN
SENSOR
TB1-16
DHW
TB1-18
SENSOR
TB1-19
OUTDOOR
TB1-20
SENSOR
TB1-21
TB1-17
BAS (-)
TB1-22
0-10VDC (+)
TB1-23
YELLOW
X13-3
X2-7
WHITE
X13-4
X2-14
RED
VIOLET (10k)
BLACK
WHITE
GREEN
BLUE/WHITE
X1-3
X13-5
X1-15
X13-6
X1-1
X14-2
X1-5
X14-9
X1-17
X14-3
X1-6
BLUE
X14-10
X14-4
X1-18
BROWN
X1-7
BROWN/YELLOW
ORANGE
X13-2
X2-13
BROWN
ORANGE/BLACK
X13-1
X2-6
BLACK/RED
X14-11
X14-6
X1-19
X3-1
X14-13
X3-9
X3-5
X3-13
X7-1
X7-2
X7-3
X6-1
X6-2
X6-3
X3-7
X3-15
OWER#1
BLOWER #1
BLOWER #2
HSI #1
HSI #2
GAS VALVE #1
GAS VALVE #1A
GAS VALVE #2
GAS VALVE #3
GAS VALVE #3A
GAS VALVE #4
Figure 23.
500
X
N/A
X
N/A
X
N/A
X
N/A
N/A
N/A
750
X
N/A
X
N/A
X
X
X
N/A
N/A
N/A
Wiring Diagram.
Sizes 500 - 2000.
1000
1250
X
N/A
X
X
X
N/A
X
X
N/A
N/A
OWER#2
X
X
X
X
X
#1
X
X
X
N/A
X
#2
ORANGE
RED
GREY
BLUE
VIOLET
GREY
BROWN/WHITE
VIOLET
BROWN/VIOLET
ORANGE
BROWN/ORANGE
YELLOW
BROWN/YELLOW
TB2-1
RUN COMMON
TB2-2
RUN N.C.
TB2-3
RUN N.O.
TB2-4
ALARM COMMON
TB2-5
ALARM N.C.
TB2-6
ALARM N.O.
TB2-7
AUX POWER (N)
TB2-8
OUTPUT (L)
TB2-9
DHW PUMP
TB2-10
DRY CONTACT
TB2-11
SYSTEM PUMP
TB2-12
DRY CONTACT
TB2-13
AUXILIARY
TB2-14
DRY CONTACT
SEE MIXING VALVE WIRING BELOW FOR
TB2-15 AND TB2-16
WHITE/RED
TB2-17
PUMP (-)
WHITE
TB2-18
0-10VDC (+)
BROWN/GREEN
BMS
TB2-19
RS485 B
WHITE/GREEN
TB2-20
RS485 A
YELLOW/GREEN
TB2-21
RS485 GND
BROWN/RED
CASCADE
TB2-22
RS485 B
WHITE/RED
TB2-23
RS485 A
YELLOW/RED
TB2-24
RS485 GND
BLUE/RED
BLUE
TB2-15
TB2-16
MIXING VALVE REQ'D FOR LOW TEMP OR POOL OPERATIONS
MIXING VALVE
SIZE (MBTU/h)
COMPONENT
YELLOW
FIELD OUTPUTS
1500
1750
2000
X
X
X
X
X
X
X
X
N/A
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
0-10 VDC
3
24 VAC
2
COMMON
1
BLUE/YELLOW
YELLOW
TB2-26
TB2-25
SYSTEM SUPPLY SENSOR WIRING (HYDRONIC & VOLUME WATER)
SYSTEM
SUPPLY
SENSOR
10K
TB1-14
TB1-15
BRADFORD WHITE CORP.
Page 38
5.F
Ladder
Diagram
Low Voltage
MAIN POWER SWITCH
120VAC
L2*
K1
BOILER/HEATER PUMP
N2*
M
L1
N1
* NOTE: L2 only applicable on sizes 1750 and 2000,
otherwise power received from L1 to N1.
CONTROLLER SUPPLY POWER
X10-1
Voltage Legend
120 VAC
Low Voltage
HIGH
X11-3
X10-3
M
X11-1
BLOWER #1
M
X11-4
BLOWER #2
K1
X14-1
BOILER/HEATER
PUMP CONTACTOR
LOW
X11-2
HIGH
X11-6
LOW
X11-5
X14-8
TB2-11
X14-4
X14-11
TB2-12
SYSTEM PUMP
DRY CONTACT
TB2-9
X14-3
X14-10
TB2-10
DHW PUMP
DRY CONTACT
X12-3
HSI #1
X12-4
HSI #1 FLAME SENSE
X15-4
X12-1
HSI #2
X12-2
HSI #2 FLAME SENSE
X15-3
120VAC
CB
24VAC
TB2-26
TB2-25
X5-10
CONTROLLER 24VAC POWER
X5-5
X9-11
GAS VALVE SUPPLY VOLTAGE
X9-2
LWCO
1 SUPPLY POWER 2
SAFETY CHAIN: 24VDC
X4-1
LWCO
FLOW
X4-11
X4-2
X4-14
X4-5
BLOCKED FLUE
X4-4
MRHL
X4-12
X4-3
X4-15
X4-6
X4-17
X4-8
HIGH GAS PRESSURE
LOW GAS PRESSURE SWITCH
FIELD INTERLOCK
(FACTORY INSTALLED JUMPER)
X4-7
TB1-1
TB1-1
APS#1
X4-9
X4-19
X9-1
X4-13
X4-16
ARHL
GAS
VALVE #1
X9-3
X9-4
X4-18
GAS
VALVE #2
X9-6
GAS
VALVE #1A
APS#2
X4-10
X4-20
X9-7
GAS
VALVE #3
X9-12
X9-9
GAS
VALVE #3A
Figure 24.
Ladder Diagram.
Sizes 500 - 2000.
X9-10
GAS
VALVE #4
Page 39
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
MIXING VALVE
TB2-16
3
0-10 VDC
TB2-26
2
24 VAC
TB2-25
1
COMMON
TB2-15
MIXING VALVE REQ'D FOR LOW TEMP
OPERATIONS
X1-1
FACTORY
INSTALLED
SENSORS
X1-14
X1-2
COMPONENT
BLOWER #1
BLOWER #2
HSI #1
HSI #2
GAS VALVE #1
GAS VALVE #1A
GAS VALVE #2
GAS VALVE #3
GAS VALVE #3A
GAS VALVE #4
DUAL ELEMENT
10k
1
2
3
4
OUTLET
SENSOR
20k
X1-13
2
X1-1
1
INLET
SENSOR
500
X
N/A
X
N/A
X
N/A
X
N/A
N/A
N/A
750
X
N/A
X
N/A
X
X
X
N/A
N/A
N/A
SIZE (MBTU/h)
1000 1250 1500 1750 2000
X
X
X
X
X
X
X
X
N/A
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
N/A
X
X
X
X
X
X
X
X
X
X
X
X
X
X
N/A N/A N/A
X
X
N/A
X
X
X
X
INDICATES FIELD I/O
FIELD INPUTS
TB1-1
FIELD
TB1-2
INTLK
TB1-3
TB1-4
TB1-5
DHW
TB1-6
DHW
TB1-7
TB1-8
FIELD OUTPUTS
TB2-1
COMMON
TB2-2
N.C.
CH1
TB2-3
N.O.
CH1
TB2-4
COMMON
TB2-5
N.C.
TB2-6
N.O.
CH2
TB2-7
AUX
CH2
TB2-8
AUX
TB1-9
FIELD
TB2-9
DHW
TB1-10
INPUT1
TB2-10
PUMP
TB1-11
FIELD
TB2-11
SYSTEM
TB1-12
INPUT2
TB2-12
PUMP
TB2-13
AUX
TB2-14
AUX
TB1-13
TB1-14
TB1-15
SAFETY CHAIN
HEAT
DEMANDS
FIELD
INPUTS
SYSTEM
SUPPLY
TB1-16
SYSTEM
TB1-17
RETURN
TB1-18
DHW
TB1-19
DHW
TB1-20
OUTDOOR
TB1-21
OUTDOOR
TB1-22
BAS (-)
TB1-23
0-10V (+)
ALARM RELAY
DRY CONTACTS
POWER
OUTPUTS
DRY
CONTACTS
SEE MIXING VALVE WIRING BELOW FOR
TB2-15 AND TB2-16
SENSOR
INPUTS
ANALOG
INPUT
TB2-17
PUMP(-)
TB2-18
0-10V(+)
TB2-19
B
TB2-20
A
TB2-21
GND
TB2-22
B
TB2-23
A
TB2-24
GND
SYSTEM SUPPLY SENSOR WIRING (HYDRONIC & VOLUME WATER)
SYSTEM
SUPPLY
SENSOR
RUN RELAY
DRY CONTACTS
10K
TB1-14
TB1-15
ANALOG
OUTPUT
RS485
BMS
RS485
CASCADE
BRADFORD WHITE CORP.
Page 40
SECTION 6
6.A
7RXFKVFUHHQDQG6\VWHP2SHUDWLRQV
The Home Screen
Figure 25. The Home Screen
6.A.1 Home Screen Status Window
Model
Low Temp
6WDJHV
2Q2II
The central area of the home screen displays the
7DEOH 6WDJHVSHU0RGHO
FXUUHQWVWDWXVLQIRUPDWLRQIRUWKHXQLW
Heat Demand Set Points.
Pump Status.
Boiler Status (Boiler Bank).
System Temp.
+HDW'HPDQG6HW3RLQWV
DHW Temp (if installed).
,QOHW 2XWOHW7HPSHUDWXUH
127(7KHKHDWGHPDQGVHWSRLQWZLOO
turn green in color when active
Boiler Status
B1: Running
B2: Running
Stage 1:
Stage 2:
Stage 3:
Stage 4:
Blower 1:
Blower 2:
OAT:
3HQQDQW6WDWXV
x Burner %DQN
x Burner %DQN
x 6WDJLQJ RQRII
x %ORZHU6SHHG
KLJKORZ
x 2$7 2XWGRRU
$PELHQW
7HPSHUDWXUH
ZKHQ
connectedͿ
3XPS6WDWXV
Figure 26. 7KH6WDWXV'LVSOD\$UHDGH¿QHG
6\VWHP6XSSO\
5HWXUQ7HPSHUDWXUH
ZKHQFRQQHFWHG '+:
Temperature
ZKHQFRQQHFWHG COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 41
6.A.2 +RPH6FUHHQ$FWLYH,FRQV
Name
Icon
'HVFULSWLRQ
Security
'LVSOD\VWKHFXUUHQWORFNVWDWXV7RXFKWKHORFNLFRQWRORFNRUXQORFNWKH
7RXFKVFUHHQ'LVSOD\6HHSection 6.B on page 42
Quick Start
3URYLGHVTXLFNWRXFKDFFHVVWRWKHPRVWFRPPRQO\XVHGSDUDPHWHUVIRUHDV\
LQVWDOODWLRQ6HHSection 6.D on page 44
&RQ¿JXUH
:LOOWDNH\RXWR$//RI\RXUFRQ¿JXUDWLRQVDQGSDUDPHWHUVIRUDGHWDLOHGVHWXSRI
WKHXQLW7KLVLVWKHODUJHVWJURXSRIPHQXVFUHHQV6HHSection 6.E on page 47
Service
Allows the service technician to access the basic diagnostic and troubleshooting
LQIRUPDWLRQ6HHSection 6.F on page 66
0HVVDJHV
:LOOVKRZDQ ([FODPDWLRQ ZKHQWKHUHLVDPHVVDJH
&OLFNLQJRQWRWKH0HVVDJHLFRQZLOOWDNH\RXWRWKHPHVVDJHLWVHOI
7KH86%IXQFWLRQDOLW\ZLOOVKRZWKH86%,FRQDWWKLVORFDWLRQLI
EHLQJXVHG6HHSection 6.G on page 68
Active
Demands
1DYLJDWLRQ
Bar
Will show icons that indicate the active parameters that are
FXUUHQWO\LQGHPDQG6HHSection 6.H on page 70
7KH1DYLJDWLRQ%DULVWKHFRQVWDQWLQGLFDWRURIZKHUH\RXDUHDV\RX
QDYLJDWHLQWRDQGRXWRIWKHWRXFKVFUHHQV6HHSection 6.I on page 70
ERROR Codes also show in the 1DYLJDWLRQ%DUwhen there is one of several unit
HUURUVRUVKXWGRZQVWKDWKDYHRFFXUHG
Date &
Time
)RU'LVSOD\2QO\7RFKDQJHGDWHDQGWLPHJRWRWKH
&RQ¿JXUDWLRQPHQXSection 6.J on page 70
7DEOH 7KH$FWLYH,FRQVRQWKH+RPH6FUHHQDQGZKDWWKH\GR
BRADFORD WHITE CORP.
Page 42
6.B
/RFN8QORFN'LVSOD\6FUHHQ
3DVVZRUG3URWHFWLRQ
7RFKDQJHSDUDPHWHUVDSDVVZRUGLVUHTXLUHG
The control system includes three levels of password
SURWHFWLRQ7RXFKWKH &XUUHQW/RFN6WDWXV ,FRQ
&XUUHQW/RFN6WDWXV
7R/RJRXW
:DON$ZD\5HVXOW
Screen 1.
Sign in Screen
-USER3DVVZRUG1RQFULWLFDODGMXVWPHQWVDQG
IXQFWLRQVThe user password is lhs. When
unlocked in the User mode, the icon
will change to-
-INSTALLER3DVVZRUG6HWXSDQGSDUDPHWHU
changes made during the initial setup and
FRPPLVVLRQLQJThe installer password is 17.
When unlocked in the Installer mode, the icon
will change to-
-OEM3DVVZRUG6HWXSDQGSDUDPHWHUFKDQJHV
DYDLODEOHRQO\WRWKHIDFWRU\
Walk-Away Result. The unit will either Lock or
VWD\8QORFNHGLI\RXZDONDZD\:KDWLWZLOOGRLV
GLVSOD\HGLQWKHERWWRPULJKWFRUQHU7KHGHIDXOWGHOD\
WLPHWRORFNLVPLQXWHVRILQDFWLYLW\
This time duration can be adjusted in
6HUYLFH!6FUHHQ!$XWR/RFN7LPHRXW
$QGLWFDQDOVREHVHWXSWRQHYHU/RFN
If the Installer is done and wants to lock the
display immediately, tap the Logout Icon to get out of
,QVWDOOHURU8VHU0RGH
Page 43
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6.C
.H\SDG2SHUDWLRQV
$V\RXQDYLJDWHLQ\RX¿QGWKDWDOOVFUHHQVKDYHHLWKHUD
QXPHULFNH\SDGWRHQWHULQ\RXUFXVWRPL]DEOHSDUDPHWHUV25
VHOHFWLRQEXWWRQVWRFKRRVHWKHRSWLRQVIRU\RXUFRQ¿JXUDWLRQ
NOTE<RXFDQDOZD\VWHOOH[DFWO\ZKHUH\RXKDYHQDYLJDWHGWR
by looking at the icons in the 1DYLJDWLRQ%DU
,QWKLVH[DPSOH\RXDUHLQ
+RPH&RQ¿JXUH&HQWUDO+HDW&HQWUDO+HDW2QH
6KRZVWKHFXUUHQWVHWWLQJ
RIWKH3DUDPHWHU
7KHVHZLQGRZVZLOOUHÀHFWWKH
allowable ranges that the setting
FDQEHDGMXVWHGWR
To delete the current setting before
HQWHULQJLQWKHQHZYDOXH
³8SDQG'RZQ´DUURZVDUHXVHGWR
LQFUHPHQWWKHVHWWLQJDFFRUGLQJO\
7KH³(QWHU´EXWWRQLVXVHGWRDFFHSW
WKHQHZYDOXHWKDWZDVMXVWHQWHUHG
Screen 2.
$W\SLFDOQXPHULFNH\SDGHQWU\VFUHHQ
This is the indicator that will be shown when
the correct password has been entered to
DOORZWKHVHWWLQJWRFKDQJH
The highlighted button (orange)
VKRZVZKLFKRQHLVVHOHFWHG
6RPHVFUHHQVPD\RQO\DOORZ\RX
to set one or the other, while some
RWKHUVFUHHQV H[DPSOHSXPS
selection) will allow you to select
DQ\RUDOORIWKHRSWLRQV
7KH³%DFN´EXWWRQMXPSVWRWKH
SUHYLRXVVFUHHQ
Screen 3.
$W\SLFDOVHOHFWLRQVFUHHQ
BRADFORD WHITE CORP.
Page 44
6.D
Quick Start
7RQDYLJDWHWRWKH4XLFN6WDUW6FUHHQWRXFKWKH
4XLFN6WDUW,FRQLQWKHORZHUOHIWKDQGSRUWLRQRIWKH
+RPH6FUHHQ
Screen 4.
Home Screen
7RXFKLQJ&+QDYLJDWHVWRWKH&+4XLFN6WDUW
6FUHHQ
1
6.D.1.a CH1
Screen 7.
CH1 Quick Start Screen
• Enable/Disable ±7KLVDOORZV&+WREHHQDEOHG
GLVDEOHG7KHGHIDXOWVHWWLQJLV(QDEOHG
• Set Point±7KLVLVWKHWHPSHUDWXUHWKDWWKLVKHDW
GHPDQGZLOOFRQWUROWR
2
'E CH2
7RQDYLJDWHWRWKH&+4XLFN6WDUW6FUHHQWRXFK
WKH&+,FRQRQWKH&+4XLFN6WDUW6HOHFWLRQ6FUHHQ
Screen 5.
Quick Start Screen
6.D.1 CH
2QWKH4XLFN6WDUW6FUHHQWRXFKWKH&+
WKHUPRPHWHULFRQWRQDYLJDWHWRWKH&+6HOHFWLRQ
6FUHHQ
There are two identical heat demands, CH1 and
&+HDFKZLWKLQGHSHQGHQWFRQWURODOJRULWKPVDQG
independent inputs on the input terminal strip, see
)LJXUHRQSDJH
Screen 6.
CH Quick Start Selection Screen
Screen 8.
CH2 Quick Start Screen
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6.D.2 DHW/DHW3
7RQDYLJDWHWRWKH'+:'+:4XLFN6WDUW
6FUHHQWRXFKWKH'+:IDXFHWLFRQRQWKH4XLFN6WDUW
6FUHHQ
Page 45
outdoor temperature at which the Copper Brute ll
ZLOOPD[LPL]HWKHERLOHURXWOHWWHPSHUDWXUHWRWKH
0D[LPXP:DWHU7HPSHUDWXUH
• Max Water Temp ±7RVHWPD[ZDWHUWHPS
• Min Water Temp±7RVHWPLQLPXPZDWHUWHPS
NOTE2XWGRRUIXQFWLRQDOLW\LVDSSOLFDEOHWR
K\GURQLFXQLWVRQO\DQGLVH[SODLQHGLQ6HFWLRQ(
RQSDJH:LULQJRIWKHRXWGRRUVHQVRULVFRYHUHG
LQ6HFWLRQ&GRQSDJH
Screen 9.
DHW/DHW3 Quick Start Screen
6.D.4 Warm Weather Shut Down
7RQDYLJDWHWRWKH:DUP:HDWKHU4XLFN6WDUW
6FUHHQWRXFKWKH:DUP:HDWKHU,FRQRQWKH4XLFN
6WDUW6FUHHQ
7KH'+:'+:4XLFN6WDUW6FUHHQDOORZV
adjustment of the following parameter:
• Enable/Disable ±7KLVDOORZV'+:'+:WREH
HQDEOHGGLVDEOHG7KHGHIDXOWVHWWLQJLV(QDEOHG
• Set Point±7KLVLVWKHWHPSHUDWXUHWKDWWKLVKHDW
GHPDQGZLOOFRQWUROWR
NOTE$'+:'+:KHDWGHPDQGFDQEH
LQLWLDWHGE\DQDTXDVWDWRUVHQVRUVHH6HFWLRQV&E
DQG&GUHVSHFWLYHO\
Screen 11. Warm Weather Quick Start Screen
6.D.3 Outdoor Reset
7RQDYLJDWHWRWKH2XWGRRU4XLFN6WDUW6FUHHQ
WRXFKWKH2XWGRRU,FRQRQWKH4XLFN6WDUW6FUHHQ
Screen 10. Outdoor Quick Start Screen
7KH2XWGRRU4XLFN6WDUW6FUHHQDOORZVWKH
adjustment of the following parameters:
• Enable/Disable ±7KLVDOORZV2XWGRRU5HVHWWR
EHHQDEOHGGLVDEOHG7KHGHIDXOWVHWWLQJLV(QDEOHG
• Maximum Ambient Temperature±7KHRXWGRRU
temperature at which the Copper Brute ll will limit
the boiler outlet temperature to the Minimum Water
7HPSHUDWXUH
• Minimum Ambient Temperature±7KH
7KH:DUP:HDWKHU4XLFN6WDUW6FUHHQDOORZV
adjustment of the following parameters:
• Temp Min ±8SRQDQDFWLYHZDUPZHDWKHU
shutdown condition, this is the temperature at which
the Copper Brute ll will reset the shutdown condition
WRVDWLVI\DKHDWGHPDQG
• Temp Max ±7KLVLVWKHWHPSHUDWXUHDWZKLFKWKH
ZDUPZHDWKHUVKXWGRZQFRQGLWLRQZLOORFFXU
• Feature Options±7KLVSDUDPHWHUSURYLGHVWKH
ability to either disable warm weather shutdown or
XSRQDZDUPZHDWKHUFRQGLWLRQFRQ¿JXUHWKH&RSSHU
Brute ll to shut down immediately or to shut down
DIWHUWKHFXUUHQWKHDWGHPDQGLVVDWLV¿HG
BRADFORD WHITE CORP.
Page 46
6.D Quick Start
(continued)
6.D.5 Anti-Short Cycle
7RQDYLJDWHWRWKH$QWL6KRUW&\FOH4XLFN6WDUW
6FUHHQWRXFKWKH$QWL6KRUW&\FOH,FRQRQWKH4XLFN
6WDUW6FUHHQ
Screen 12. Anti-Short Cycle Quick Start Screen
7KH$QWL6KRUW&\FOH4XLFN6WDUW6FUHHQDOORZV
adjustment of the following parameter:
• Cycle Time±7KHDPRXQWRIWLPHDIWHUDKHDW
GHPDQGLVVDWLV¿HGWKDWWKH&RSSHU%UXWHOOZLOOZDLW
WRVDWLVI\WKHQH[WDFWLYHKHDWGHPDQG
127($QWL6KRUW&\FOH7LPHGRHVQRWDSSO\WR
'+:'+:KHDWGHPDQGV
6.D.6 Time & Date
7RQDYLJDWHWRWKH7LPH 'DWH4XLFN6WDUW
6FUHHQWRXFKWKH7LPH 'DWH,FRQRQWKH4XLFN6WDUW
6FUHHQ
Screen 13.
Time & Date Quick Start Screen
127(7KH7LPHLVVHWLQDKRXUSDUDPHWHU
EXWGLVSOD\VRQO\DVDKRXUFORFNZLWKWKH
$030DXWRPDWLFDOO\DGGHG
7KH7LPH 'DWH4XLFN6WDUW6FUHHQDOORZV
adjustment of the following parameters:
• Hour ±7KHKRXUWKDWZLOOEHGLVSOD\HGLQWKH
upper banner on each screen, and the time captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
• Minute ±7KHPLQXWHWKDWZLOOEHGLVSOD\HGLQWKH
upper banner on each screen, and the time captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
• Month±7KHPRQWKWKDWZLOOEHGLVSOD\HGLQWKH
upper banner on each screen, and the date captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
• Day±7KHGD\WKDWZLOOEHGLVSOD\HGLQWKHXSSHU
banner on each screen, and the date captured in the
GDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HGRQ
WKHKLVWRU\VFUHHQ
• Year±7KHPRQWKWKDWZLOOEHGLVSOD\HGLQWKH
upper banner on each screen, and the date captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 47
6.E &RQ¿JXUH6FUHHQ
7RQDYLJDWHWRWKH&RQ¿JXUH6FUHHQWRXFKWKH
&RQ¿JXUH,FRQLQWKHORZHUOHIWKDQGSRUWLRQRIWKH
+RPH6FUHHQ
There are two identical heat demands, CH1 and
&+HDFKZLWKLQGHSHQGHQWFRQWURODOJRULWKPVDQG
independent inputs on the input terminal strip, see
)LJXUHRQSDJH
)URPWKH&+6HOHFWLRQ6FUHHQWRXFKLQJ&+
QDYLJDWHVWRWKH&+
6.E.1.a
CH1
Screen 14. Home Screen
Screen 17. &+&RQ¿JXUDWLRQ6FUHHQ
Screen 15. &RQ¿JXUH6FUHHQ
)URPWKH&RQ¿JXUH6FUHHQWKH&RSSHU%UXWH
OOIXQFWLRQDOLW\FDQEHFRQ¿JXUHGIRUWKHVSHFL¿F
DSSOLFDWLRQLQVWDOODWLRQ7KHIROORZLQJVHFWLRQVJLYH
DQRYHUYLHZRIHDFKFRQ¿JXUDWLRQVXEPHQX
6.E.1 CH
2QWKH&RQ¿JXUH6FUHHQWRXFKWKH&+WKHUPRPHWHU
LFRQWRQDYLJDWHWRWKH&+6HOHFWLRQ6FUHHQ
Screen 16. CH Selection Screen
7KH&+&RQ¿JXUDWLRQ6FUHHQDOORZVDGMXVWPHQW
of the following parameters:
• Enable/Disable ±7KLVDOORZV&+WREHHQDEOHG
GLVDEOHG7KHGHIDXOWVHWWLQJLV(QDEOHG
• Control Mode ±7KLVSURYLGHVWKHDELOLW\WR
VHOHFWHLWKHU7HPSHUDWXUH'LIIHUHQWLDOFRQWURORU
3,'FRQWURO7KHGHIDXOWVHWWLQJLV7HPSHUDWXUH
'LIIHUHQWLDO
• Set Point ±7KLVLVWKHWHPSHUDWXUHWKDWWKLVKHDW
GHPDQGZLOOFRQWUROWR
• Demand Priority ±7KLVDOORZVWKHXVHUWR
SULRULWL]HWKHKHDWGHPDQGVXFKDV'+:EHIRUH&+
7KHKLJKHUWKHQXPEHUWKHKLJKHUWKHSULRULW\6HH
7DEOHRQSDJH
• Temperature Differential This button navigates
to the parameters applicable to temperature differential
FRQWURO
• PID This button navigates to the parameters
DSSOLFDEOHWR3,' 3URSRUWLRQDO,QWHJUDO'HULYDWLYH FRQWURO
• Additional Settings This button navigates to
DGGLWLRQDO&+FRQWUROSDUDPHWHUV
BRADFORD WHITE CORP.
Page 48
Source
Heat Demand
'+:
&DVFDGH
77
77
([WHUQDO'HPDQG
)URVW3URWHFWLRQ
31&+
%:&+
31&9
BWCV
'+:
'+:
3ULRULW\
'+:6HQVRU
6HFWLRQ
&+
'+:
Applied at the lead
ERLOHUKHDWHU
6HFWLRQ
&+
'+:
&+
'+:
Analog Input
±9'&±P$
,QOHW7HPSHUDWXUH
127( If controlling to the system sensor, the
Copper Brute ll will continue to use the outlet sensor
IRU$XWR0DQXDO5HVHW/LPLWFRQGLWLRQV
90
80
60
50
20
10
7DEOH 'HPDQG3ULRULW\
7KH&+'+:7HPSHUDWXUH'LIIHUHQWLDO6FUHHQ
allows the adjustment of the following parameters:
• Stage 1/2/3/4 Off Hysteresis±DQRIIVHWRIWKH
WHPSHUDWXUHVHWSRLQWDWZKLFKWKHVWDJHWXUQVRII
(DFKVWDJHKDVDQRIIK\VWHUHVLVDVVRFLDWHGZLWKLW
• Stage 1/2/3/4 On Hysteresis±DQRIIVHWRIWKH
WHPSHUDWXUHVHWSRLQWDWZKLFKWKHVWDJHWXUQVRQ
(DFKVWDJHKDVDQRQK\VWHUHVLVDVVRFLDWHGZLWKLW
127(6WDJHDSSOLHVWR±VL]HVDQG
VWDJHDSSOLHVWR±VL]HV6HH7DEOHRQ
SDJH
6.E.1.a.1 7HPSHUDWXUH'LIIHUHQWLDO 3,'
Temperature Control
The Copper Brute ll stages on & off burners to
VDWLVI\KHDWGHPDQGV6WDJLQJFRQWUROLVGHVLJQHGWR
RSHUDWHXSWRVWDJHVXVLQJWZRVHSDUDWHKRWVXUIDFH
LJQLWHUV +6, DQGPXOWLSOHJDVYDOYHV7KHLJQLWRUV
DUHDVVRFLDWHGZLWKVWDJHVDQGDQGJDVYDOYHV
FRQWUROVWDJHVDQG7KHFRQWURODOJRULWKPZLOO
WUHDWVWDJHVDQGDVDERLOHUDQGRQDSSOLFDEOH
XQLWVVWDJHVDQGDVDVHSDUDWHERLOHU$VDUHVXOW
IRUVL]HV±LIVWDJHLVUXQQLQJEXWVWDJH
LVQRWUXQQLQJWKHIDQIRUVWDJHZRXOGQHHGWR
EHUXQQLQJDWORZVSHHGWRSUHYHQWÀXHJDVHVIURP
UHFLUFXODWLQJ6LPLODUO\LIVWDJHLVUXQQLQJEXW
stage 1 is not running, the fan for stage 1 would need
WREHUXQQLQJDWORZVSHHGWRSUHYHQWÀXHJDVHVIURP
UHFLUFXODWLQJ)RUVLQJOHEORZHUPRGHOVWKHIDQ
RSHUDWHVRQO\DWKLJKVSHHG
Copper Brute lls have two modes of temperature
FRQWUROHLWKHU7HPSHUDWXUH'LIIHUHQWLDOFRQWURORU
3URSRUWLRQDO,QWHJUDO'HULYDWLYH 3,' FRQWURO
7HPSHUDWXUH'LIIHUHQWLDOFRQWUROLVWKHGHIDXOWFRQWURO
PRGH7KHKHDWGHPDQGVHWSRLQWLVLQGHSHQGHQWRI
WKHPHWKRGRIWHPSHUDWXUHFRQWUROEHLQJXVHG
7HPSHUDWXUH'LIIHUHQWLDOSDUDPHWHUVDUH
Stage Off Hysteresis – the temperature at which
WKHQH[WVWDJHWXUQVRII(DFKVWDJHKDVDQ
RIIK\VWHUHVLVDVVRFLDWHGZLWKLW
Stage On Hysteresis – the temperature at which
WKHQH[WVWDJHWXUQVRQ(DFKVWDJHKDVDQ
RQK\VWHUHVLVDVVRFLDWHGZLWKLW
Stage Delay On Time – the amount of time that
PXVWHODSVHSULRUWRWXUQLQJRQWKHQH[W
VWDJH
Stage Delay Off Time – the amount of time that
PXVWHODSVHSULRUWRWXUQLQJRIIWKHQH[W
VWDJH
Minimum Stage On Time – the minimum time
that a stage must be on before it is allowed to
WXUQRII
Minimum Stage Off Time – the minimum time
that a stage must be off before it is allowed to
WXUQRQ
6.E.1.a.2 7
KHUPRVWDW$TXDVWDW=RQH&RQWURO
BACnet
7KHUHDUHWKUHH³77´RU³&+´KHDWGHPDQGLQSXWV
DYDLODEOH&+&+'+:IRU%RLOHUDQG'+:
'+:'+:IRU+HDWHU(DFKGHPDQGKDVDQ
LQGHSHQGHQWVHWSRLQWDQGFRQWUROVHWWLQJV
6HH6HFWLRQ&RQSDJHIRUZLULQJLQIRUPDWLRQ
DQGFRQ¿JXUDWLRQLQIRUPDWLRQ
127(%$&QHWFDQDOVREHXVHGWRLQLWLDWHD&+
&+'+: ERLOHUV RU'+:'+:'+: ZDWHU
KHDWHUV KHDWGHPDQG6HH6HFWLRQ(HRQSDJH
IRUFRQ¿JXUDWLRQLQIRUPDWLRQ
Screen 18. &+'+:7HPS'LIIHUHQWLDOScreen
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 49
8VLQJDVHWSRLQWRIƒ)DQGWKH
default values for each stage on
and off hysteresis, this table shows
the temperatures at which stages 1
DQGZLOOWXUQRQRIIIRUD&RSSHU
%UXWHOO
7DEOH 7HPSHUDWXUH'LIIHUHQWLDO6WDJLQJRID6WDJH&RSSHU%UXWHOO
8VLQJDVHWSRLQWRIƒ)DQG
the default values for each stage
on and off hysteresis, this table
shows the temperatures at which
VWDJHVDQGZLOOWXUQRQRII
IRU&RSSHU%UXWHOO
7DEOH 7HPSHUDWXUH'LIIHUHQWLDO6WDJLQJRID6WDJH&RSSHU%UXWHOO
8VLQJDVHWSRLQWRIƒ)
and the default values
for each stage on and off
hysteresis, this table shows the
temperatures at which stages
DQGZLOOWXUQRQRII
IRU&RSSHU%UXWHOO
7DEOH 7HPSHUDWXUH'LIIHUHQWLDO6WDJLQJRID6WDJH&RSSHU%UXWHOO
BRADFORD WHITE CORP.
Page 50
6.E.1.a.3 3,'
(E
Screen 19. &+'+:3,'6FUHHQ
Screen 20. CH1/DHW1 Additional Settings Screen
7RDFWLYDWH3,'\RXPXVW¿UVWJRLQWR&RQWURO
0RGHDQGVHOHFW3,'<RXPD\EHSURPSWHGWR6DYH
DQ\FRQ¿JXUDWLRQFKDQJHVWKDW\RXKDYHPDGHVRIDU
7KHQFRPHEDFN&+3DUDPHWHUVDQGVHOHFW3,'
7KH&+'+:3,'6FUHHQDOORZVDGMXVWPHQWRI
the following parameters:
• On Hysteresis±7KHWHPSHUDWXUHEHORZWKHVHW
SRLQW 6HW3RLQW±2Q+\VWHUHVLV DWZKLFKWKHFRQWURO
EHJLQVFDOFXODWLQJWKH3,'RXWSXWWRWXUQRQVWDJHV
• Off Hysteresis±7KHWHPSHUDWXUHDERYHWKH
VHWSRLQW 6HW3RLQW2II+\VWHUHVLV DWZKLFKWKH
FRQWUROOHUZLOOVWRSFDOFXODWLQJWKH3,'RXWSXWDQGVHW
WKH3,'RXWSXWWRWRWXUQRIIDOOVWDJHV
• Proportional Gain±7KLVYDOXHLVWKHFRUUHFWLYH
DFWLRQWKDWLVSURSRUWLRQDOWRWKHHUURU VHWSRLQW±
FRQWUROWHPSHUDWXUH • Integral Time±7KLVYDOXHLVDSSOLHGWRWKHVXP
RIWKHHUURURYHUDSHULRGRIWLPH
• Derivative Time±7KLVYDOXHLVDSSOLHGWRWKH
UDWHRIFKDQJHRIWKHHUURU
7KH&+'+:$GGLWLRQDO6HWWLQJV6FUHHQ
allows the adjustment of the following parameters:
• Stage Delay On Time ±7KHDPRXQWRIWLPHWKDW
PXVWHODSVHSULRUWRWXUQLQJRQWKHQH[WVWDJH
• Stage Delay Off Time±7KHDPRXQWRIWLPHWKDW
PXVWHODSVHSULRUWRWXUQLQJRIIWKHQH[WVWDJH
• Minimum Stage On Time±7KHPLQLPXPWLPH
WKDWDVWDJHPXVWEHRQEHIRUHLWLVDOORZHGWRWXUQRII
• Minimum Stage Off Time±7KHPLQLPXPWLPH
WKDWDVWDJHPXVWEHRIIEHIRUHLWLVDOORZHGWRWXUQRQ
127( By default, the control sensor is the
Copper Brute ll outlet sensor, or when installed, the
V\VWHPVXSSO\VHQVRU
Additional Settings
127( These setting only apply to Temperature
'LIIHUHQWLDOFRQWURO
6.E.2
CH2/DHW2
&+'+:KDVDOOWKHVDPHSDUDPHWHUVDV&+
'+:
127(&+DSSOLHVWRK\GURQLFVXQLWV ERLOHUV ZKLOH'+:DSSOLHVWRYROXPHZDWHUXQLWV ZDWHU
KHDWHUV 7KH3,'FRQWURODOJRULWKPJLYHVDQRXWSXWVLJQDO
IURP±DQGPDNHVDGHFLVLRQWRWXUQDVWDJHRQ
RIIEDVHGRQWKHWDEOHEHORZ
7DEOH
3
,'7HPSHUDWXUH&RQWURO
3,'2XWSXW6WDJH)LULQJ
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6.E.3
DHW/DHW3
7RQDYLJDWHWRWKH'+:'+:6FUHHQWRXFKWKH
'+:IDXFHWLFRQRQWKH&RQ¿JXUH6FUHHQ
Screen 21. '+:'+:&RQ¿JXUDWLRQ6FUHHQ
'+:'+:KDVDOOWKHVDPHSDUDPHWHUVDV&+
'+:DQG&+'+:ZLWKRQHH[FHSWLRQ'+:
'+:KDVWKHIROORZLQJDGGLWLRQDOSDUDPHWHUIRU
adjustment:
• DHW Offset ±8SRQD'+:'+:KHDW
GHPDQGWKH&RSSHU%UXWHOOZLOOFRQWUROWKHERLOHU
KHDWHURXWOHWWHPSHUDWXUHWRWKH'+:6HW3RLQWSOXV
WKH'+:2IIVHW VHWSRLQW'+:2IIVHW )RU
H[DPSOHZLWKD'+:'+:6HW3RLQWRIƒ)DQG
D'+:2IIVHWRIƒ)WKH&RSSHU%UXWHOOZLOOFRQWURO
WKHERLOHUKHDWHURXWOHWWHPSHUDWXUHWRƒ) ƒ)
ƒ) WRVDWLVI\WKHKHDWGHPDQG
127($'+:'+:KHDWGHPDQGFDQEH
LQLWLDWHGE\DQDTXDVWDWRUVHQVRUVHH6HFWLRQV&E
RQSDJHDQG&GRQSDJHUHVSHFWLYHO\
6.E.4
Page 51
Outdoor Reset
2XWGRRU5HVHWLVDSSOLFDEOHWRK\GURQLFXQLWVRQO\
and since this functionality is not mandatory, it can be
HQDEOHGGLVDEOHGRQWKHRXWGRRUUHVHWFRQ¿JXUDWLRQ
VFUHHQ2XWGRRU5HVHWYDULHVWKHFRQWUROVHWSRLQW
EDVHGRQWKHRXWGRRUWHPSHUDWXUH7KH2XWGRRU5HVHW
parameters are:
When there is an active outdoor reset condition, the
FRQWUROVHWSRLQW &63 ZLOOYDU\IURPWKHSURJUDPPHG
VHWSRLQW)RUH[DPSOHLQWKH%RLOHU6WDWXV:LQGRZ
VKRZQEHORZWKH2XWGRRU$PELHQW7HPSHUDWXUH
2$7 LVƒ)7KLV2$7IRUFHVWKHQRQ'+:KHDW
demand set point to the low point of the outdoor reset
FXUYHZKLFKLQWKHJUDSKEHORZLVƒ),QWKH
%RLOHU6WDWXV:LQGRZVKRZQLQ)LJXUHWKH&+
heat demand is active and the programmed set point
LVƒ)KRZHYHUGXHWRWKH2$7WKH&63LV
ƒ)±ZKLFKLVWKHWHPSHUDWXUHWKH&RSSHU%UXWHOOZLOO
FRQWUROWR
Screen 22. 2XWGRRU3DUDPHWHUV6FUHHQ
7KH2XWGRRU3DUDPHWHUV6FUHHQDOORZVWKH
adjustment of the following parameters:
• Enable/Disable ±(QDEOHVDQGGLVDEOHVWKH
RXWGRRUUHVHWIXQFWLRQDOLW\
• Maximum Ambient Temperature ±7KHRXWGRRU
temperature at which the Copper Brute ll will limit
the boiler outlet temperature to the Minimum Water
7HPSHUDWXUH
• Minimum Ambient Temperature ±7KH
outdoor temperature at which the Copper Brute ll
ZLOOPD[LPL]HWKHERLOHURXWOHWWHPSHUDWXUHWRWKH
0D[LPXP:DWHU7HPSHUDWXUH
• Maximum Water Temperature ±7KHPD[LPXP
boiler outlet temperature based on the Minimum
$PELHQW7HPSHUDWXUH
• Minimum Water Temperature ±7KHPLQLPXP
ERLOHURXWOHWWHPSHUDWXUHEDVHGRQWKH0D[LPXP
$PELHQW7HPSHUDWXUH
BRADFORD WHITE CORP.
Page 52
Figure 27.
Boiler Status Window.
&63ZLWKDQDFWLYHRXWGRRU
reset condition
190
Set Point Temperature
180
170
160
150
140
130
120
110
100
0
10
20
30
40
50
Outdoor Temperature
7DEOH 2XWGRRU5HVHW&XUYH
60
70
80
90
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6.E.5
Cascade
An installation with two or more
&RSSHU%UXWHOO VPD\EHFRQ¿JXUHGIRUFDVFDGH
RSHUDWLRQV$PD[LPXPRIXQLWVFDQEHFRQ¿JXUHG
LQDFDVFDGHLQVWDOODWLRQ2QH&RSSHU%UXWHOOZLOOEH
FRQ¿JXUHGDVWKHOHDGXQLWZLWKWKHUHPDLQLQJ&RSSHU
%UXWHOOVFRQ¿JXUHGDVODJXQLWV5HIHUWR6HFWLRQ
&RQSDJHIRUGHWDLOVRQZLULQJIRUFDVFDGH
FRPPXQLFDWLRQEHWZHHQWKHOHDGDQGODJXQLWV
6.E.5.a
Page 53
&RQ¿JXUH/HDG8QLW
7
RFRQ¿JXUHD&RSSHU%UXWHOODVWKHOHDGXQLW
QDYLJDWHWRWKH&DVFDGH3DUDPHWHUV6FUHHQVKRZQ
EHORZDQGVHWWKH$GGUHVVWR³´7KH&RSSHU%UXWHOO
LVQRZFRQ¿JXUHGDVWKHOHDGERLOHUKHDWHU6HWWLQJWKH
DGGUHVVWRD³´WDNHVWKHXQLWRXWRIFDVFDGHPRGH
A system supply sensor must be installed and
FRQQHFWHGWRWKHOHDGERLOHUKHDWHUVHH6HFWLRQ&G
RQSDJH±7HPSHUDWXUH6HQVRUV7KHOHDGERLOHU
will use this system supply sensor as the temperature
FRQWUROVHQVRUIRUFDVFDGHRSHUDWLRQV
A system pump may be wired to the lead Copper
%UXWHOOUHIHUWR6HFWLRQ%RQSDJHIRUZLULQJ
DQG(RQSDJHIRUSXPSFRQ¿JXUDWLRQ
A cascade heat demand is made at the lead Copper
%UXWHOOXVLQJ&+'+:H[WHUQDOGHPDQG 9'&RUP$ RUWKURXJKDQ56%XLOGLQJ
0DQDJHPHQW6\VWHP %06 KHDWGHPDQGFRPPDQG
Screen 24. &DVFDGH3DUDPHWHUV
2QFHFRQ¿JXUHGDVWKHOHDG&RSSHU%UXWHOOWKH
³/HDG6HWWLQJV´EXWWRQEHFRPHVVHOHFWDEOH7RXFKLQJ
WKLVEXWWRQQDYLJDWHVWRWKH³/HDG6HWWLQJV´VFUHHQ
$FFHVVWKH&DVFDGH&RQ¿JXUDWLRQ6FUHHQE\
VHOHFWLQJ&RQ¿JXUDWLRQ&DVFDGH
Screen 25. Lead Settings
Screen 23. &DVFDGH&RQ¿JXUDWLRQ6FUHHQ
7KH&DVFDGH6FUHHQSURYLGHVIRXUQDYLJDWLRQLFRQV
WRFRQ¿JXUHWKHV\VWHPIRUFDVFDGHRSHUDWLRQV7KHVH
navigation icons are:
• Cascade CH±7KLVLFRQQDYLJDWHVWRWKHVHWXS
VFUHHQIRUK\GURQLFFDVFDGHRSHUDWLRQV7KLVLFRQLV
DYDLODEOHRQK\GURQLFXQLWVRQO\ ERLOHUV • Cascade DHW±7KLVLFRQQDYLJDWHVWRWKHVHWXS
VFUHHQIRUYROXPHZDWHUFDVFDGHRSHUDWLRQV7KLV
icon is available on volume water units only (water
KHDWHUV • Rotation ±7KLVLFRQQDYLJDWHVWRWKHFDVFDGH
URWDWLRQVFUHHQ
• Redundancy ±7KLVLFRQQDYLJDWHVWRWKHVHWXS
VFUHHQIRUFDVFDGH/HDGHUUHGXQGDQF\IXQFWLRQDOLW\
7KH/HDG6HWWLQJV6FUHHQDOORZVDGMXVWPHQWRIWKH
following parameters:
Set Point – This parameter is the system supply
temperature the cascade heat demand is trying to
VDWLVI\
Proportional Gain – This value is the corrective
action that is proportional to the error (set point
±FRQWUROWHPSHUDWXUH ,QFUHDVLQJWKLVSDUDPHWHU
LQFUHDVHVWKHUHVSRQVHWRWKHHUURU
Integral Time – This value is applied to the sum
RIWKHHUURURYHUDSHULRGRIWLPH$GGLQJWKHLQWHJUDO
WHUPFDQKHOSWRDFKLHYHWKHVHWSRLQW
Derivative Time – This value is applied to the rate
RIFKDQJHRIWKHHUURU$GGLQJWKHGHULYDWLYHWHUPFDQ
help with sudden changes in temperature, and may
KHOSSUHYHQWRYHUVKRRWLQJ
BRADFORD WHITE CORP.
Page 54
Demand Priority – This parameter sets the heat
GHPDQGSULRULW\LQUHODWLRQWRRWKHUKHDWGHPDQGV7KH
KLJKHUWKHQXPEHUWKHKLJKHUWKHSULRULW\LWLVDVVLJQHG
Off Hysteresis – The temperature above the
VHWSRLQW 6HW3RLQW2II+\VWHUHVLV DWZKLFKWKH
FRQWUROOHUZLOOWXUQRIIDOOVWDJHV
On Hysteresis – The temperature below the
VHWSRLQW 6HW3RLQW±2Q+\VWHUHVLV DWZKLFKWKH
FRQWUROOHUEHJLQVWRWXUQRQVWDJHV
Max Lag Temp – 7KHPD[LPXPRXWOHWWHPSHUDWXUH
WKHFDVFDGHGERLOHUVKHDWHUVDUHDOORZHGWRVXSSO\WKH
V\VWHPDWWKHLULQGLYLGXDOERLOHUKHDWHURXWOHWZDWHU
VHQVRU
7KHKRPHVFUHHQRIWKHOHDGERLOHUZLOOUHÀHFW
LQIRUPDWLRQUHJDUGLQJWKHFDVFDGHVHWXS
6HH6FUHHQ7KH&&+LVWKHVHWSRLQWRIWKH
&DVFDGH&+V\VWHP$QDFWLYHKHDWGHPDQGLV
UHÀHFWHGE\WKHFDVFDGHLFRQVKRZQLQWKHORZHUULJKW
hand section of the home screen, and the set point will
EHVKRZQLQJUHHQWH[W,IFRQ¿JXUHGIRU&DVFDGH
'+:WKHFDVFDGHVHWSRLQWZLOOEHVKRZQWRWKH
ULJKWRI&+:7KHKRPHVFUHHQZLOODOVRUHÀHFWWKH
DGGUHVVDQGQXPEHURIXQLWVFDVFDGHG,QWKHLPDJH
EHORZWKLVXQLWLVFRQ¿JXUHGZLWKDQDGGUHVV³´DQG
LVWKHUHIRUHWKHOHDGERLOHUKHDWHU7KHOHDGERLOHU
KHDWHULVGHQRWHGE\WKH³0´LQWKH³0RI´7KH
³´LQWKH³0RI´LQGLFDWHVWKDWWKHUHDUHERLOHUV
KHDWHUVFDVFDGHGWRJHWKHU7KH&63ZLOOUHÀHFW
WKH³0D[/DJ7HPS´ZKLFKLVWKHPD[LPXPRXWOHW
WHPSHUDWXUHWKHFDVFDGHGERLOHUVKHDWHUVDUHDOORZHGWR
VXSSO\WKHV\VWHP
(E
&RQ¿JXUH/DJ8QLW
7RFRQ¿JXUHD&RSSHU%UXWHOODVDODJXQLW
QDYLJDWHWRWKH&DVFDGH3DUDPHWHUV6FUHHQVKRZQ
below, and set the Address to any number from 1 to
7KHOHDGERLOHULVFRQ¿JXUHGDVD³´WKHUHIRUH
WKHWKFDVFDGHGERLOHULVFRQ¿JXUHGZLWKDQDGGUHVV
RI6HWWLQJWKHDGGUHVVWRD³´WDNHVWKHXQLWRXWRI
FDVFDGHPRGH
7RDXWRPDWLFDOO\FRQ¿JXUHODJXQLWVDIWHU
FRQ¿JXULQJWKHOHDGXQLWSUHVVWKH&DVFDG$XWR
&RQ¿JRQWKH/HDGXQLWDQGLWZLOODXWRPDWLFDOO\
DGGUHVVWKHODJXQLWV
Screen 26. Lag On, Lag Off Hysteresis
2QFHFRQ¿JXUHGDVDODJXQLWWKH³/DJ2Q
+\VWHUHVLV´DQG³/DJ2II+\VWHUHVLV´EXWWRQVDUH
VHOHFWDEOH7KHVHSDUDPHWHUVKDYHWKHIROORZLQJ
functionality:
Lag On Hysteresis – WKHYDOXHEHORZWKH³0D[
/DJ7HPS´ 0D[/DJ7HPS±/DJ2Q+\VWHUHVLV WKDWWKHERLOHUKHDWHUZLOOWXUQRQWRVDWLVI\DQDFWLYH
cascade demand, based on their local outlet water
VHQVRU
Lag Off Hysteresis – WKHYDOXHDERYHWKH³0D[
/DJ7HPS´ 0D[/DJ7HPS/DJ2II+\VWHUHVLV WKDWWKHERLOHUKHDWHUZLOOWXUQRIIZKHQVDWLVI\LQJDQ
active cascade demand, based on their local outlet
ZDWHUVHQVRU
/DJERLOHUVKHDWHUVFRQWUROWRWKHLURXWOHW
WHPSHUDWXUHXVLQJWKH³0D[/DJ7HPS´DVWKHRXWOHW
WHPSHUDWXUHVHWSRLQW:LWKDQDFWLYHGHPDQGIURP
WKHOHDGERLOHUKHDWHUWKHODJERLOHUVKHDWHUVZLOOF\FOH
RQRIIEDVHGRQWKH³/DJ2Q+\VWHUHVLV´DQG³/DJ2II
+\VWHUHVLV´VHWDWHDFKLQGLYLGXDOODJXQLW$PHVVDJH
ZLOOLQGLFDWHZKHQDXQLWLVRIIGXHWRD 0D[/DJ
7HPS FRQGLWLRQ
7KHKRPHVFUHHQRIDODJERLOHUZLOOUHÀHFW
LQIRUPDWLRQUHJDUGLQJWKHFDVFDGHVHWXS6HH6FUHHQ
The C-CH is the set point of the Cascade CH
V\VWHP,IFRQ¿JXUHGIRU&DVFDGH'+:WKHFDVFDGH
VHWSRLQWZLOOEHVKRZQWRWKHULJKWRI&+:7KH
KRPHVFUHHQZLOODOVRUHÀHFWWKHDGGUHVVDQGQXPEHU
RIXQLWVFDVFDGHG,QWKHLPDJHEHORZWKLVXQLWLV
FRQ¿JXUHGZLWKDQDGGUHVV³´DQGLVWKHUHIRUHDODJ
ERLOHUKHDWHUDQGLVRIFDVFDGHGXQLWV$QDFWLYH
heat demand from the lead boiler is indicated by the
cascade icon shown in the lower right hand portion
RIWKHKRPHVFUHHQ7KH&63ZLOOUHÀHFWWKH³0D[
/DJ7HPS´ZKLFKLVWKHPD[LPXPRXWOHWWHPSHUDWXUH
WKHFDVFDGHGERLOHUVKHDWHUVDUHDOORZHGWRVXSSO\WKH
V\VWHP7KH³0D[/DJ7HPS´SDUDPHWHULVFRYHUHG
LQWKHOHDGERLOHUKHDWHUVHWWLQJV
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Screen 27. Home Screen of a Lag Boiler
6.E.5.c Cascade CH
An installation with two or more Copper Brute lls
PD\EHFRQ¿JXUHGIRUFDVFDGHRSHUDWLRQV$PD[LPXP
RIXQLWVFDQEHFDVFDGHG
7RQDYLJDWHWRWKH&DVFDGH&+&RQ¿JXUDWLRQ
6FUHHQWRXFKWKH&DVFDGH,FRQRQWKH&RQ¿JXUH
6FUHHQWKHQWRXFKWKH&DVFDGH&+,FRQRQWKH
&DVFDGH&RQ¿JXUDWLRQ6FUHHQ
Screen 28. &DVFDGH&+&RQ¿JXUDWLRQ6FUHHQ
7KH&DVFDGH&+&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
• Address±:KHQPDQXDOO\DGGUHVVLQJHDFK
ERLOHUKHDWHUIRUFDVFDGHRSHUDWLRQVWKLVSDUDPHWHULV
XVHGWRVHWWKHORFDOERLOHUKHDWHUDGGUHVV(DFKERLOHU
KHDWHUPXVWKDYHDXQLTXHDGGUHVV$ERLOHUKHDWHU
ZLWKDYDOXHRILVWKHOHDGERLOHUKHDWHU/DJERLOHUV
KHDWHUVXVHYDOXHVWKURXJK
:KHQDXWRPDWLFDOO\DGGUHVVLQJHDFKERLOHU
KHDWHUVHWWKHOHDGERLOHUKHDWHUWRDYDOXHRI
:LWKDYDOXHRIWKH&DVFDGH$XWR&RQ¿JEXWWRQ
is available to use, refer to this parameter below for
LQVWUXFWLRQVIRUDXWRPDWLFDGGUHVVLQJWKHODJERLOHUV
KHDWHUV
• Dynamic Address±7KLVIXQFWLRQLVXVHGIRU
Page 55
LQGLYLGXDOERLOHUVHUYLFLQJDVLWZLOOUHPRYHWKHERLOHU
KHDWHUIURPFDVFDGHRSHUDWLRQV
&OLFNLQWR'\QDPLF$GGUHVVDQGVHWWKLV
SDUDPHWHUWR:KHQ¿QLVKHGUHWXUQWKLVQXPEHUWR
LW VSUHYLRXVO\DVVLJQHGQXPEHU
• Lead Settings±7KLVEXWWRQLVRQO\VHOHFWDEOH
ZKHQFRQ¿JXUHGDVWKHOHDGERLOHUKHDWHU:KHQ
FRQ¿JXUHGDVWKHOHDGERLOHUKHDWHUWRXFKLQJWKLV
EXWWRQQDYLJDWHVWRWKH/HDGERLOHUKHDWHUVHWWLQJV
• Lost Lead Backup Set Point±7KLVLVXVHGIRU
FDVFDGHUHGXQGDQF\VHH6HFWLRQ6FUHHQRQSDJH
:KHQFRQ¿JXUHGIRU&DVFDGH5HGXQGDQF\
%RLOHU,QWHUQDO6HW3RLQWWKLVSDUDPHWHULVWKH
PD[LPXPRXWOHWWHPSHUDWXUHWKHORFDOERLOHUKHDWHULV
DOORZHGWRVXSSO\WKHV\VWHP
• Lag On Hysteresis 7KHYDOXHEHORZWKH0D[
/DJ7HPS 0D[/DJ7HPS±/DJ2Q+\VWHUHVLV WKDWWKHERLOHUKHDWHUZLOOWXUQRQWRVDWLVI\DQDFWLYH
FDVFDGHGHPDQGEDVHGRQWKHORFDOERLOHUKHDWHURXWOHW
ZDWHUWHPSHUDWXUH0D[/DJ7HPSLVVHWDWWKH/HDG
ERLOHUKHDWHU
• Lag Off Hysteresis 7KHYDOXHDERYHWKH0D[
/DJ7HPS 0D[/DJ7HPS/DJ2II+\VWHUHVLV WKDW
WKHERLOHUKHDWHUZLOOWXUQRIIZKHQVDWLVI\LQJDQDFWLYH
FDVFDGHKHDWGHPDQGEDVHGRQWKHORFDOERLOHUKHDWHU
RXWOHWZDWHUWHPSHUDWXUH0D[/DJ7HPSLVVHWDWWKH
/HDGERLOHUKHDWHU
‡&DVFDGH$XWR&RQ¿J±7KLVLVRQO\DGMXVWDEOH
DWWKHOHDGERLOHUKHDWHU2QFHFRQ¿JXUHGDVWKHOHDG
ERLOHUKHDWHUSUHVVLQJWKLVEXWWRQZLOOLQLWLDWHWKH
OHDGERLOHUKHDWHUWR¿QGDQGDGGUHVVDOOODJERLOHUV
DXWRPDWLFDOO\
127($OOERLOHUVKHDWHUVPXVWEHZLUHGIRUFDVFDGH
RSHUDWLRQVSULRUWRSHUIRUPLQJ&DVFDGH$XWR&RQ¿J
• Cascade Release Demand - When
communications with the master is lost and the lag
units continue to satisfy the cascade heat demand,
SUHVVLQJWKLVEXWWRQZLOOUHPRYHWKHKHDWGHPDQG
127(7KLVRQO\DSSOLHVZKHQFRQ¿JXUHGIRUFDVFDGH
%RLOHU,QWHUQDO6HW3RLQW&RQWURO
BRADFORD WHITE CORP.
Page 56
6.E.5.d
Cascade DHW
7RQDYLJDWHWRWKH&DVFDGH'+:&RQ¿JXUDWLRQ
6FUHHQWRXFKWKH&DVFDGH,FRQRQWKH&RQ¿JXUH
6FUHHQWKHQWRXFKWKH&DVFDGH'+:,FRQRQWKH
&DVFDGH&RQ¿JXUDWLRQ6FUHHQ
Screen 29. '+:&RQ¿JXUDWLRQ6FUHHQ
&DVFDGH'+:KDVWKHVDPHSDUDPHWHUVDQGVHWXS
as Cascade CH
127(&DVFDGH'+:DSSOLHVWRYROXPHZDWHU
ZDWHUKHDWHUV XQLWVRQO\
6.E.5.e
Rotation
7RQDYLJDWHWRWKH&DVFDGH5RWDWLRQ6FUHHQWRXFK
WKH&DVFDGH,FRQRQWKH&RQ¿JXUH6FUHHQWKHQWRXFK
WKH5RWDWLRQ,FRQRQWKH&DVFDGH&RQ¿JXUDWLRQ
6FUHHQ
Screen 30. Cascade Rotation Screen
7KH&DVFDGH5RWDWLRQ6FUHHQLVDYLHZRQO\VFUHHQ
This screen indicates how many Copper Brute ll units
DUHFRQQHFWHGLQDFDVFDGHFRQ¿JXUDWLRQWKHRUGHU
in which each unit will run, and the percent at which
HDFK&RSSHU%UXWHOOLVUXQQLQJ
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6.E.5.f
Page 57
Cascade Redundancy
7RQDYLJDWHWRWKH&DVFDGH5HGXQGDQF\6FUHHQ
/RVVRI/HDG6HWXS WRXFKWKH&DVFDGH,FRQRQWKH
&RQ¿JXUH6FUHHQWKHQWRXFKWKH5HGXQGDQF\,FRQRQ
WKH&DVFDGH&RQ¿JXUDWLRQ6FUHHQ
WKDWWKHERLOHUKHDWHUZLWKWKHDGGUHVVRIKDYHWKH
VDPHVHWWLQJVDVWKHOHDGXQLW7KLVDOVRUHTXLUHVWKDW
WKHERLOHUKHDWHUZLWKWKHDGGUHVVRIKDYHDV\VWHP
supply sensor installed, and if applicable a system
SXPSRUSXPSFRQWDFWRUAll cascaded units must
have this option selected for this functionality to work.
2SWLRQ'LVDEOH5HGXQGDQF\±:LWKWKLVRSWLRQ
VHOHFWHGLQDFDVFDGHFRQ¿JXUDWLRQXSRQORVVRI
communication with the lead Copper Brute ll, all lag
ERLOHUVZLOOQRORQJHUVDWLVI\WKHFDVFDGHKHDWGHPDQG
6.E.5.g
Screen 31. Cascade Redundancy Screen (Loss of
/HDGHU6HWXS
+\EULG
127(7KLV+\EULG6FUHHQLVQRWFXUUHQWO\
active, but is included for future integration of
%UDGIRUG:KLWHFRQGHQVLQJSURGXFWV
In circumstances where the communication link
between the lead and lag units has been disrupted,
there are three options for how lag units respond to
WKLVGLVUXSWLRQ
7KH&DVFDGH5HGXQGDQF\6FUHHQDOORZVWKH
selection of one of three options for redundancy in
FDVFDGHRSHUDWLRQV
7RQDYLJDWHWRWKH+\EULG&RQ¿JXUDWLRQ6FUHHQ
WRXFKWKH+\EULG,FRQRQWKH&RQ¿JXUH6FUHHQ
These options are:
2SWLRQ%RLOHU,QWHUQDO6HW3RLQW±With this
RSWLRQVHOHFWHGLQDFDVFDGHFRQ¿JXUDWLRQXSRQORVV
of communication with the lead Copper Brute ll,
WKHODJXQLWVZLOOFRQWLQXHWRRSHUDWH:KHQUXQQLQJ
LQWKLVPRGHWKHODJERLOHUZLOOXVHWKH³/RVV/HDG
%DFNXS6HW3RLQWSDUDPHWHUDVWKHORFDOERLOHU
&637KH³/RVV/HDG%DFNXS6HW3RLQWSDUDPHWHU
LVFRQ¿JXUHGRQWKH&DVFDGH3DUDPHWHU6FUHHQ,I
FRPPXQLFDWLRQWRWKHOHDGERLOHUKHDWHULVUHVWRUHG
WKHODJXQLWVZLOOUHVSRQGWRWKHOHDGERLOHUKHDWHU
FRPPDQGVZLWKRXWXVHULQWHUYHQWLRQ$OOODJXQLWV
must have this option enabled for this functionality
WRZRUNDVZHOODVWKH/RVV/HDG%DFNXS6HW3RLQW
FRQ¿JXUHG,IWKHODJERLOHUVKHDWHUVDUHQRW¿ULQJ
when communication with the lead unit is lost, they
ZLOOQRW¿UHWRVDWLVI\DFDVFDGHKHDWGHPDQGXQWLO
FRPPXQLFDWLRQVZLWKWKHOHDGERLOHUKHDWHULVUHVWRUHG
Screen 32. +\EULG&RQ¿JXUDWLRQ6FUHHQ
2SWLRQ5HGXQGDQW/HDGHU±With this option
VHOHFWHGLQDFDVFDGHFRQ¿JXUDWLRQXSRQORVVRI
communication with the lead Copper Brute ll, the
lag boiler with the address of 1 will assume lead
ERLOHUUHVSRQVLELOLWLHV7KLVUHTXLUHVWKDWWKHOHDG
XQLW DGGUHVV DQGUHGXQGDQWOHDG DGGUHVV EH
DGGUHVVHGPDQXDOO\7KHUHPDLQLQJFDVFDGHGXQLWVFDQ
EHFRQ¿JXUHGPDQXDOO\RUDXWRPDWLFDOO\7KLVUHTXLUHV
7KH+\EULG&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
• Hybrid Enable – This parameter allows Hybrid
0RGHWREHHQDEOHGRUGLVDEOHG
• Lag Mode – This parameter allows Lag Mode to
EHHQDEOHGRUGLVDEOHG
• Hybrid Set Point – Based on the system
return temperature, with Hybrid Mode enabled, this
temperature set point determines which type of boiler
FRQGHQVLQJRUQRQFRQGHQVLQJ UXQV¿UVWWRVDWLVI\D
KHDWGHPDQG
• Hybrid Differential – This parameter is a
RIIVHWRIWKH+\EULG6HW3RLQWXVHGWRSUHYHQW
FRQGHQVLQJLQQRQFRQGHQVLQJXQLWV
• Hybrid Delay – This parameter is a time delay
WKDWLQDGGLWLRQWR+\EULG'LIIHUHQWLDOLVXVHGWR
SUHYHQWFRQGHQVLQJLQQRQFRQGHQVLQJXQLWV
Page 58
6.E.6
3XPSV
The Copper Brute ll allows control of three
SXPSVERLOHUKHDWHUSXPSV\VWHPSXPSDQG'+:
SXPS(DFKSXPSKDVDQDGMXVWDEOHSRVWFLUFXODWLRQ
time that allows the pump to run after a heat
GHPDQGKDVEHHQVDWLV¿HGRUDVKXWGRZQFRQGLWLRQ
KDVRFFXUUHG6HH6HFWLRQ%RQSDJH
)RUZLULQJLQIRUPDWLRQVHH6HFWLRQSXPS
FRQ¿JXUDWLRQLQIRUPDWLRQ
Boiler/Heater Pump
8SRQDKHDWGHPDQGWKHERLOHUKHDWHUSXPSFDQ
EHFRQ¿JXUHGWRRSHUDWHDVIROORZV
Auto – the pump will turn on automatically upon a
FDOOIRUKHDW
Always On ±WKHSXPSZLOOUXQFRQWLQXRXVO\
ZLWKRUZLWKRXWDKHDWGHPDQG
Off During DHW – the pump will not turn on
GXULQJD'+:KHDWGHPDQG
DHW Pump
8SRQDKHDWGHPDQGWKHERLOHUKHDWHUSXPSFDQ
EHFRQ¿JXUHGWRRSHUDWHDVIROORZV
Auto – the pump will turn on automatically upon
DFDOOIRUKHDW
Always On – the pump will run continuously,
ZLWKRUZLWKRXWDKHDWGHPDQG
Disable – WKHSXPSZLOOQRWWXUQRQXSRQD'+:
KHDWGHPDQG
System Pump
Upon a heat demand, the system pump can be
FRQ¿JXUHGWRRSHUDWHDVIROORZV
Auto – the pump will turn on automatically upon a
FDOOIRUKHDW
Always On ±WKHSXPSZLOOUXQFRQWLQXRXVO\
ZLWKRUZLWKRXWDKHDWGHPDQG
Off During DHW – the pump will not turn on
GXULQJD'+:KHDWGHPDQG
Disable – the pump will not turn on during a call
IRUKHDW
7RQDYLJDWHWRWKH3XPS&RQ¿JXUDWLRQ6FUHHQ
WRXFKWKH3XPS,FRQRQWKH&RQ¿JXUH6FUHHQ
BRADFORD WHITE CORP.
Screen 33. 3XPS&RQ¿JXUDWLRQ6FUHHQ
7KH3XPS&RQ¿JXUDWLRQ6FUHHQDOORZVDGMXVWPHQW
of the following parameters:
• Boiler Pump Control – The parameter provides
the ability to set the boiler pump functionality to be:
$XWR$OZD\V2QRU2IIGXULQJ'+:
• Boiler Pump Post Circulation – This parameter
LVWKHDPRXQWRIWLPHWKHERLOHUKHDWHUSXPSZLOO
FRQWLQXHWRUXQDIWHUDKHDWGHPDQGKDVEHHQVDWLV¿HG
RUDIWHUDORFNRXWFRQGLWLRQKDVRFFXUUHG
• DHW Pump Control – This parameter provides
WKHDELOLW\WRVHWWKH'+:SXPSIXQFWLRQDOLW\WREH
$XWR'LVDEOHGRU$OZD\V2Q
• DHW Pump Post Circulation – This parameter
LVWKHDPRXQWRIWLPHWKH'+:SXPSZLOOFRQWLQXH
WRUXQDIWHUDKHDWGHPDQGKDVEHHQVDWLV¿HGRUDIWHUD
ORFNRXWFRQGLWLRQKDVRFFXUUHG
• System Pump Control – This parameter
provided the ability to set the system pump
IXQFWLRQDOLW\WREH$XWR$OZD\V2Q2IIGXULQJ
'+:RU'LVDEOHG
• System Pump Post Circulation – This
SDUDPHWHULVWKHDPRXQWRIWLPHWKH6\VWHPSXPSZLOO
FRQWLQXHWRUXQDIWHUDKHDWGHPDQGKDVEHHQVDWLV¿HG
RUDIWHUDORFNRXWFRQGLWLRQKDVRFFXUUHG
6.E.7 Firing Rate
)LULQJ5DWHUHIHUVWRVPRRWKPRGXODWLRQDQGLVQRW
DSSOLFDEOHWRWKHVWDJH¿UHG&RSSHU%UXWHOO
Page 59
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
The number of available
stages varies based on
ERLOHUKHDWHUVL]HDQG
LGHQWL¿HVZKHQVWDJHVZLOO
EHEORFNHGXQEORFNHG7KH
equations apply to both
%RLOHUDQG+HDWHUXQLWV
‡ 6WDJH/LPLW+\VWHUHVLV
6/+ ƒ)
‡ $XWR5HVHW $5
ƒ) ERLOHUV
‡ 5HVHW'LIIHUHQWLDO 5' ƒ)
7DEOH %RLOHU+HDWHUEORFNLQJSDUDPHWHUV
6.E.8 7HPS/LPLWV
7RQDYLJDWHWRWKH7HPS/LPLWV&RQ¿JXUDWLRQ6FUHHQ
WRXFKWKH7HPS/LPLWV,FRQRQWKH&RQ¿JXUH6FUHHQ
QG5RZ 6.E.9 External
7RQDYLJDWHWRWKH([WHUQDO&RQ¿JXUDWLRQ6FUHHQ
WRXFKWKH([WHUQDO,FRQRQWKH&RQ¿JXUH6FUHHQ
Screen 35. ([WHUQDO&RQ¿JXUDWLRQ6FUHHQ
Screen 34. 7HPS/LPLWV&RQ¿JXUDWLRQ6FUHHQ
7KH7HPS/LPLWV&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
• Auto Reset Boiler Outlet– The temperature at
which the Copper Brute ll with shutdown on an outlet
WHPSHUDWXUHDXWRUHVHWFRQGLWLRQ
• Manual Reset Boiler Outlet– The temperature at
which the Copper Brute ll will shut down on an outlet
WHPSHUDWXUHPDQXDOUHVHWFRQGLWLRQ
• Reset Differential – The value below the Auto
5HVHWWHPSHUDWXUHDWZKLFKWKH&RSSHU%UXWHOOZLOO
DXWRPDWLFDOO\UHVHWLWVHOIDQGUHVXPHIXQFWLRQDOLW\
• Stage Limit Hysteresis – The temperatrue at
ZKLFKDVWDJLQJERLOHUKHDWHUZLOOEHJLQWREORFNRU
GHUDWHWRDYRLGWULSSLQJOLPLWV
7KH([WHUQDO&RQ¿JXUDWLRQ6FUHHQDSSOLHVWR
WKH9'& P$ DQDORJLQSXW%$6VLJQDO
and allows adjustment of the following parameters:
• Control Mode – This parameter provides
WKHDELOLW\WRHLWKHUGLVDEOHH[WHUQDOFRQWURORU
FRQ¿JXUHWKH&RSSHU%UXWHOOIRU([WHUQDO6HW3RLQW
RU)LULQJ5DWHFRQWUROPRGH
• Priority – This parameter sets the heat
GHPDQGSULRULW\LQUHODWLRQWRRWKHUKHDWGHPDQGV
The higher the number, the higher the priority it is
DVVLJQHG
• Max Set Point – When the Control Mode is
VHWWR([WHUQDO6HW3RLQWWKLVLVWKHPD[LPXPYDOXH
WKDWFRUUHVSRQGVWRWKH'HPDQG0D[YDOXH
• Min Set Point – When the Control Mode is
VHWWR([WHUQDO6HW3RLQWWKLVLVWKHPLQLPXPYDOXH
WKDWFRUUHVSRQGVWRWKH'HPDQG0LQYDOXH
• Demand Max – 7KLVLVWKHPD[LPXPYDOXH
WKDWFRUUHVSRQGVWRWKHFRQWUROPRGHVHOHFWHG
BRADFORD WHITE CORP.
Page 60
:LWK)LULQJ5DWHFRQWUROPRGHVHOHFWHGWKLVLVWKH
PD[LPXPUDWHDWZKLFKWKHERLOHUKHDWHUZLOOUXQ
7KHXQLWRIWKLVSDUDPHWHULVVRLIWKHYDOXHRI
WKLVSDUDPHWHULVRUWKLVHTXDWHVWR
9'&RUP$
• Demand Min – This is the minimum value
WKDWFRUUHVSRQGVWRWKHFRQWUROPRGHVHOHFWHG
:LWK)LULQJ5DWHFRQWUROPRGHVHOHFWHGWKLVLVWKH
PLQLPXPUDWHDWZKLFKWKHERLOHUKHDWHUZLOOUXQ
7KHXQLWRIWKLVSDUDPHWHULVVRLIWKHYDOXHRI
WKLVSDUDPHWHULVRUWKLVHTXDWHVWR
9'&RUP$
• Demand On –7KLVLVWKHWKUHVKROG 9'&
mA) at which the input signal will initiate the
VHOHFWHGFRQWUROPRGHEHKDYLRU7KHXQLWRIWKLV
SDUDPHWHULVVRLIWKHYDOXHRIWKLVSDUDPHWHULV
RUWKLVHTXDWHVWR9'&RUP$
• Demand Off –7KLVLVWKHWKUHVKROG 9'&
mA) at which the input signal will deactivate the
VHOHFWHGFRQWUROPRGHEHKDYLRU7KHXQLWRIWKLV
SDUDPHWHULVVRLIWKHYDOXHRIWKLVSDUDPHWHULV
RUWKLVHTXDWHVWR9'&RUP$
• Input Type – This parameter allows the user
WRVHOHFWEHWZHHQYROWDJH 9'& DQGFXUUHQW
P$ LQSXW-XPSHUVZLOOQHHGWREHFRQ¿JXUHG
DFFRUGLQJO\6HH&RQSDJH
6.E.9.a
([WHUQDO±5HPRWH6HW3RLQW
:LWK([WHUQDO6HW3RLQWVHOHFWHGWKH&RSSHU
Brute ll will initiate a heat demand once the analog
LQSXWVLJQDOH[FHHGVWKH'HPDQG2QYDOXH2QFHWKH
demand is initiated, the analog input signal must be
ORZHUWKDQ'HPDQG2IIWRUHPRYHWKHKHDWGHPDQG
With an active demand, the Copper Brute ll will
linearize the set point according to the analog input
signal as shown in Figure 28.
8VLQJWKHGHIDXOWYDOXHVIRU%RLOHU0D[6HW
3RLQW ƒ) %RLOHU0LQ6HW3RLQW ƒ) 'HPDQG
0LQLPXP 9'& 'HPDQG0D[LPXP 9'& the Copper Brute ll will linearize the set point,
according to the formula in Figure 28
([WHUQDO ±9'&RU±P$
$Q([WHUQDOKHDWGHPDQGFDQEHLQLWLDWHGE\
D%XLOGLQJ$XWRPDWLRQ6\VWHP %$6 XVLQJD±
9'&RU±P$VLJQDO7KLVLQSXWFDQEH
FRQ¿JXUHGIRU5HPRWH6HW3RLQWRU([WHUQDO)LULQJ
5DWHRSHUDWLRQV6HH6HFWLRQ&HRQSDJH
IRUZLULQJDQG6HFWLRQ(HRQSDJHIRU
FRQ¿JXUDWLRQLQIRUPDWLRQ
190
180
Temperature
170
160
Rem
150
140
130
120
0 0.5 1 1.5 2 2.5 3 3.5 4 4.5 5 5.5 6 6.5 7 7.5 8 8.5 9 9.5 10
Voltage
Figure 28. ([WHUQDO&RQWURO0RGHDQG7HPSHUDWXUH
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
(E
External Firing Rate
:LWK([WHUQDO)LULQJ5DWHVHOHFWHGWKH&RSSHU
Brute ll will initiate a heat demand once the analog
LQSXWVLJQDOH[FHHGVWKH'HPDQG2QYDOXH2QFHWKH
demand is initiated, the analog input signal must be
ORZHUWKDQ'HPDQG2IIWRUHPRYHWKHKHDWGHPDQG
7KHH[WHUQDODQDORJVLJQDOZLOODFWLYDWHVWDJHVEDVHGRQ
Table 20. In this control mode, if the Copper Brute ll
RXWOHWWHPSHUDWXUHH[FHHGVWKH$XWR5HVHW+LJK/LPLW
VHWWLQJWKHERLOHUZLOOVKXWGRZQDQGDQ³$XWR5HVHW
+LJK/LPLW´FRQGLWLRQZLOODQQXQFLDWHRQWKH0HVVDJHV
VFUHHQ2QFHWKHRXWOHWWHPSHUDWXUHGHFUHDVHV
EHORZWKHYDOXHRI $XWR5HVHW+LJK/LPLW±5HVHW
'LIIHUHQWLDO WKHERLOHUZLOOWXUQEDFNRQDWWKH¿ULQJ
UDWHVHWE\WKHDQDORJLQSXWVLJQDO
127(6LQFH/RZ7HPSXQLWVDUH2Q2IIXVLQJ
H[WHUQDO¿ULQJUDWHZLOOWXUQDOOVWDJHVRQRIIRQFH
WKH'HPDQG2Q9DOXHKDVEHHQH[FHHGHG
100
90
80
70
Firing Rate
Page 61
60
50
40
30
20
10
0
0 0.5 1 1.5 2 2.5 3 3.5 4 4.5 5 5.5 6 6.5 7 7.5 8 8.5 9 9.5 10
Voltage
Figure 29.
Firing Rate Control
7DEOH
External Demand - External Firing Rate Control
BRADFORD WHITE CORP.
Page 62
7RQDYLJDWHWRWKH7LPH 'DWH&RQ¿JXUDWLRQ6FUHHQ
WRXFKWKH7LPH 'DWH,FRQRQWKH&RQ¿JXUH6FUHHQ
6.E.11 Miscellaneous Features
7RQDYLJDWHWRWKH0LVFHOODQHRXV)HDWXUHV6FUHHQ
WRXFKWKH0LVFHOODQHRXV)HDWXUHV,FRQRQWKH&RQ¿JXUH
6FUHHQ
Screen 36. 7LPH 'DWH&RQ¿JXUDWLRQ6FUHHQ
Screen 37. Miscellaneous Features Screen
6.E.10 Setting the Time and Date
127(7KH7LPHLVVHWLQDKRXUSDUDPHWHU
EXWGLVSOD\VRQO\DVDKRXUFORFNZLWKWKH$0
30DXWRPDWLFDOO\DGGHG
7KH7LPH 'DWH&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
•Hour – The hour that will be displayed in the
upper banner on each screen, and the time captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
• Minute – The minute that will be displayed in the
upper banner on each screen, and the time captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
• Month – The month that will be displayed in the
upper banner on each screen, and the date captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
• Day – The day that will be displayed in the upper
banner on each screen, and the date captured in the
GDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HGRQ
WKHKLVWRU\VFUHHQ
• Year – The month that will be displayed in the
upper banner on each screen, and the date captured in
WKHGDWHWLPHVWDPSIRUORFNRXWFRQGLWLRQVGLVSOD\HG
RQWKHKLVWRU\VFUHHQ
7KH0LVFHOODQHRXV)HDWXUHVVFUHHQSURYLGHV
navigation for the following items:
• Mixing Valve – This feature applies to Low7HPS&RSSHU%UXWHOOV
• Anti-short Cycle – This icon navigates to the
$QWLVKRUW&\FOH&RQ¿JXUDWLRQ6FUHHQ
• Wireless Setup – This icon navigates to the
:LUHOHVV6HWXS6FUHHQQRWDYDLODEOHDWWKLVWLPH
• Warm Weather – This icon navigates to the
:DUP:HDWKHU&RQ¿JXUDWLRQ6FUHHQ
• COM Port – Icon navigates to a selection menu
IRUHLWKHU0RGEXVRU%$&QHW0673SURWRFROV
• Temperature Conversion – This icon navigates
WRWKH7HPSHUDWXUH&RQYHUVLRQ&RQ¿JXUDWLRQ6FUHHQ
• Anti-Frost –7KLVLFRQQDYLJDWHVWRWKH$QWL)URVW
&RQ¿JXUDWLRQ6FUHHQ
6.E.11.a
0L[LQJ9DOYH/RZ7HPS&RSSHU%UXWHOO
Accessable only on Low Temp Copper Brute ll
PRGHOV
7RQDYLJDWHWRWKH0L[LQJ9DOYH&RQ¿JXUDWLRQ
6FUHHQWRXFKWKH0LVFHOODQHRXV)HDWXUHV,FRQRQWKH
&RQ¿JXUH6FUHHQWKHQWRXFKWKH0L[LQJ9DOYH,FRQ
RQWKH0LVFHOODQHRXV)HDWXUHVVFUHHQ
Miscellaneous Features Screen
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
7KH0L[LQJ9DOYH&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
• Enable Feature±7KLVDOORZVWKHPL[LQJYDOYH
WREHHQDEOHGRUGLVDEOHG
• Temperature Set Point±7KHPL[LQJYDOYHZLOO
PDLQWDLQWKLVWHPSHUDWXUHDWWKHLQOHWWRWKHERLOHU
KHDWHU
• Proportional Gain±7KLVYDOXHLVWKH
corrective action that is proportional to the error (set
SRLQW±FRQWUROWHPSHUDWXUH • Integral Time±7KLVYDOXHLVDSSOLHGWRWKHVXP
RIWKHHUURURYHUDSHULRGRIWLPH
• Derivative Time±7KHYDOXHLVDSSOLHGWRWKH
UDWHRIFKDQJHRIWKHHUURU
• Condensing Set Point±7KHFRQGHQVLQJDODUP
DQGVKXWGRZQDUHEDVHGRQWKLVVHWSRLQW
• Min Voltage±7KHPLQLPXPYROWDJHWKH
FRQWUROOHUZLOOVHQGWKHPL[LQJYDOYH
• Max Voltage±7KHPD[LPXPYROWDJHWKH
FRQWUROOHUZLOOVHQGWKHPL[LQJYDOYH
• Alarm Delay±,IWKHERLOHUKHDWHULQOHW
WHPSHUDWXUHLVEHORZ&RQGHQVLQJ6HW3RLQWIRUWKH
GXUDWLRQRIWKH$ODUP'HOD\WLPHWKHERLOHUKHDWHU
ZLOODQQXQFLDWHDFRQGHQVLQJDODUP
• Shutdown Delay±,IWKHERLOHUKHDWHULQOHW
WHPSHUDWXUHLVEHORZWKH&RQGHQVLQJ6HW3RLQWIRU
WKHGXUDWLRQRIWKH6KXWGRZQ'HOD\WLPHWKHERLOHU
heater will shut down and annunciate a condensing
VKXWGRZQFRQGLWLRQ
(E Anti-Short Cycle
7RQDYLJDWHWRWKH$QWL6KRUW&\FOH&RQ¿JXUDWLRQ
6FUHHQWRXFKWKH0LVFHOODQHRXV)HDWXUHV,FRQRQWKH
&RQ¿JXUH6FUHHQWKHQWRXFKWKH$QWL6KRUW&\FOH
,FRQRQWKH0LVFHOODQHRXV)HDWXUHVVFUHHQ
$IWHUDKHDWGHPDQGKDVEHHQVDWLV¿HGWKH
Copper Brute ll will wait the duration of the Anti6KRUW&\FOH7LPHEHIRUHVDWLVI\LQJWKHQH[WKHDW
GHPDQG
127($QWL6KRUW&\FOHGRHVQRWDSSO\WR
'+:'+:KHDWGHPDQGV
Page 63
7KH$QWL6KRUW&\FOH&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameter:
• Cycle Time – The amount of time after a heat
GHPDQGLVVDWLV¿HGWKDWWKH&RSSHU%UXWHOOZLOOZDLW
WRVDWLVI\WKHQH[WDFWLYHKHDWGHPDQG
6.E.11.c :LUHOHVV6HWXS
Wireless control is not available on this version of
WKLV7RXFKVFUHHQ'LVSOD\6\VWHP
6.E.11.d
Warm Weather
:DUP:HDWKHU6KXWGRZQ ::6' LVDSSOLFDEOH
to hydronic units only, and since it is not mandatory, it
FDQEHHQDEOHGGLVDEOHGRQWKH::6'FRQ¿JXUDWLRQ
VFUHHQ7KHUHDUHWKUHHRSWLRQVIRU::6'VKXWGRZQ
LPPHGLDWHO\VKXWGRZQDIWHUGHPDQGLVVDWLV¿HGDQG
::6'GLVDEOHG7KHGHIDXOWRSWLRQLV::6'GLVDEOHG
$QRXWGRRUVHQVRUPXVWEHDWWDFKHGIRU::6'
RSHUDWLRQV$&RSSHU%UXWHOOLQD::6'FRQGLWLRQZLOO
KDYHD::6'LFRQVKRZQRQWKHKRPHVFUHHQ
WWSD - Shutdown Immediately
When the outdoor temperature, measured by the
RXWGRRUVHQVRUH[FHHGVWKH::6'VHWSRLQWRQHRIWKH
IROORZLQJWZRFRQGLWLRQVZLOORFFXU,IWKHXQLWLVLGOH
upon a call for heat, the unit will not turn on to satisfy a
KHDWGHPDQG,IWKHXQLWLVUXQQLQJWRVDWLVI\DFDOOIRU
KHDWWKHXQLWZLOOLPPHGLDWHO\VKXWGRZQ,QHLWKHUFDVH
WKH::6'LFRQZLOODSSHDURQWKHKRPHVFUHHQ
::6'±6KXWGRZQ$IWHU'HPDQGLV6DWLV¿HG
When the outdoor temperature, measured by the
RXWGRRUVHQVRUH[FHHGVWKH::6'VHWSRLQWRQHRI
WKHIROORZLQJWZRFRQGLWLRQVZLOORFFXU,IWKHXQLW
is ide, upon a call for heat, the unit will not turn on
WRVDWLVI\DKHDWGHPDQGDQGWKH::6'LFRQZLOO
EHVKRZQRQWKHKRPHVFUHHQ,IWKHXQLWLVUXQQLQJ
to satisfy a call for heat, the unit will satisfy the heat
GHPDQGDQGWKHQWKH::6'VKXWGRZQLFRQZLOO
DSSHDU$VORQJDVWKHXQLWLVLQD::6'FRQGLWLRQ
QRDGGLWLRQDOKHDWGHPDQGVZLOOEHVDWLV¿HG
WWWD – Disabled
When the outdoor temperature, measured by the outdoor
VHQVRUH[FHHGVWKH::6'VHWSRLQWQRWKLQJRFFXUV
7RQDYLJDWHWRWKH:DUP:HDWKHU&RQ¿JXUDWLRQ
6FUHHQWRXFKWKH0LVFHOODQHRXV)HDWXUHVRQWKH
&RQ¿JXUH6FUHHQWKHQWRXFKWKH:DUP:HDWKHU,FRQ
RQWKH0LVFHOODQHRXV)HDWXUHVVFUHHQ
Screen 38. $QWL6KRUW&\FOH&RQ¿JXUDWLRQ6FUHHQ
Page 64
BRADFORD WHITE CORP.
7KH&203RUW&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
• Protocol – Allows selection of either Modbus or
%$&QHW0673SURWRFROV
127(&KDQJLQJWKHSURWRFROUHTXLUHVDSRZHUF\FOH
RIWKHXQLWIRUWKHFKDQJHWRWDNHHIIHFW
Screen 39. :DUP:HDWKHU&RQ¿JXUDWLRQ6FUHHQ
7KH:DUP:HDWKHU&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
• Temp Min – Upon an active warm weather
shutdown condition, this is the temperature at which
the Copper Brute ll will reset the shutdown condition
WRVDWLVI\DKHDWGHPDQG
• Temp Max – This is the temperature at which the
ZDUPZHDWKHUVKXWGRZQFRQGLWLRQZLOORFFXU
• Feature Options – This parameter provides the
ability to either disable warm weather shutdown or
XSRQDZDUPZHDWKHUFRQGLWLRQFRQ¿JXUHWKH&RSSHU
Brute ll to shut down immediately or to shut down
DIWHUWKHFXUUHQWKHDWGHPDQGLVVDWLV¿HG
• Summer Kick CH – This is the amount of time
the Copper Brute ll pump is energized if it hasn’t
F\FOHGIRUDQH[WHQGHGSHULRGRIWLPH
• Summer Kick DHW – This is the amount of
WLPHWKH'+:SXPSLVHQHUJL]HGLILWKDVQ¶WF\FOHG
IRUDQH[WHQGHGSHULRGRIWLPH
• Summer Kick SYS – This is the amount of time
WKH6<6SXPSLVHQHUJL]HGLILWKDVQ¶WF\FOHGIRUDQ
H[WHQGHGSHULRGRIWLPH
• Summer Kick Period – The duration of time
between heat demands that the boiler will wait before
H[HUFLVLQJWKHERLOHU'+:DQGV\VWHPSXPSV
6.E.11.e &203RUW
7RQDYLJDWHWRWKH&203RUW&RQ¿JXUDWLRQ6FUHHQ
WRXFKWKH0LVF,FRQRQWKH&RQ¿JXUH6FUHHQWKHQ
WRXFKWKH&203RUW,FRQRQWKH0LVF&RQ¿JXUDWLRQ
6FUHHQ
Screen 40. &203RUW&RQ¿J6FUHHQ0RG%XV
With Modbus protocol selected, the following
parameters are adjustable on this screen:
• Baudrate –0RGEXVFDQEHFRQ¿JXUHGIRUWKH
IROORZLQJVWDQGDUGEDXGUDWHG
DQG
• Address – The address of the Copper Brute ll on the
0RGEXVQHWZRUN
• Timeout – Upon loss of communication, this is the
duration of time in which the Copper Brute ll will
ZDLWSULRUWRDWLPHRXWFRQGLWLRQVRFFXUULQJ
Screen 41. &203RUW&RQ¿J6FUHHQ%$&QHW
With BACnet protocol selected, the following
parameters are adjustable on this screen:
• Baudrate – %$&QHWFDQEHFRQ¿JXUHGIRUWKH
IROORZLQJVWDQGDUGEDXGUDWHV
DQG
• Address – The address of the Copper Brute ll on the
%$&QHWQHWZRUN
• Device Model Name – The name of the Copper
%UXWHOO0RGHORQWKH%$&QHWQHWZRUN
• Device Object Name – The name of the Copper
%UXWHOO2EMHFWRQWKH%$&QHWQHWZRUN
• Object Instance – The object number of the Copper
%UXWHOORQWKH%$&QHWQHWZRUN
• Timeout – Upon loss of communication, this is the
duration of time in which the Copper Brute ll will
ZDLWSULRUWRDWLPHRXWFRQGLWLRQVRFFXUULQJ
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6.E.11.f
7HPSHUDWXUH&RQYHUVLRQ
To navigate to the Temperature Conversion
&RQ¿JXUDWLRQ6FUHHQWRXFKWKH0LVFHOODQHRXV
)HDWXUHV,FRQRQWKH&RQ¿JXUH6FUHHQWKHQWRXFKWKH
Temperature Conversion Icon on the Miscellaneous
)HDWXUHVVFUHHQ
Screen 42. 7HPS&RQYHUVLRQ&RQ¿J6FUHHQ
7KH7HPSHUDWXUH&RQYHUVLRQ&RQ¿JXUDWLRQ6FUHHQ
allows adjustment of the following parameter:
• Conversion Unit – This parameter can be
FKDQJHGEHWZHHQ)DKUHQKHLWDQG&HOVLXV
Page 65
• Set Point – The temperature at which the Copper
Brute ll will apply the Hysteresis value to enable the
$QWL)URVWPRGH
• Hysteresis – 7KLVSDUDPHWHULVDRIIVHWRIWKH
$QWL)URVW6HW3RLQWXVHGWRWXUQRQRIIWKH$QWL)URVW
PRGH
• Pump Control – This parameter provides the
DELOLW\WRVHOHFWZKLFKSXPS V WRDSSO\WKH$QWL)URVW
0RGHWR
$QWL)URVW0RGHDOORZVDQRSHUDWRUWRVHOHFW
RQHRIWKHIROORZLQJWKUHHPRGHV'LVDEOHG3XPS
2QO\3XPSDQG%XUQHU7KH6HW3RLQWSDUDPHWHULV
WHPSHUDWXUHDWZKLFKWKHERLOHUKHDWHUZLOODSSO\WKH
+\VWHUHVLVYDOXHWRHQDEOHWKH$QWL)URVWPRGH)RU
H[DPSOHLIWKH6HW3RLQWLVƒ)DQGWKH+\VWHUHVLV
LVWKH$QWL)URVWDFWLRQZLOOLQLWLDWHDWƒ) VHW
SRLQW±K\VWHUHVLV DQGWKHQZLOOHQGDWƒ) VHWSRLQW
K\VWHUHVLV ,I3XPS2QO\RU3XPSDQG%XUQHU
PRGHLVVHOHFWHGWKH3XPS&RQWUROSDUDPHWHUDOORZV
FRQ¿JXUDWLRQRIZKLFKSXPS V ZLOOUXQGXULQJDQDQWL
IURVWFRQGLWLRQ$WOHDVWRQHSXPSPXVWEHVHOHFWHG
EXWDOOWKUHHSXPSV &RSSHU%UXWHOO'+:RU6\VWHP FDQEHVHOHFWHG,I$QWL)URVWPRGHLVDFWLYHDVQRZ
ÀDNHLFRQZLOODSSHDUDERYHWKH&RSSHU%UXWHOOLQOHW
WHPSHUDWXUHRQWKHKRPHVFUHHQ6HH)LJXUH
6.E.11.g )URVW3URWHFWLRQ
)URVWSURWHFWLRQSURYLGHVVRPHSURWHFWLRQIRUWKH
ERLOHUDQGLIFRQ¿JXUHGLQVWDOOHGSURSHUO\WKHV\VWHP
DVZHOO
7RQDYLJDWHWRWKH$QWL)URVW&RQ¿JXUDWLRQ
6FUHHQWRXFKWKH0LVFHOODQHRXV)HDWXUHV,FRQRQWKH
&RQ¿JXUH6FUHHQWKHQWRXFKWKH$QWL)URVW,FRQRQ
WKH0LVFHOODQHRXV)HDWXUHVVFUHHQ
Figure 30. $FWLYH$QWL)URVW&RQGLWLRQ
6.E.12 Login
7RQDYLJDWHWRWKH/RJLQ6FUHHQWRXFKWKH/RJLQ,FRQ
RQDQ\RIWKHPHQXV See Section 6.B on page 42
Screen 43. $QWL)URVW&RQ¿JXUDWLRQ6FUHHQ
7KH$QWL)URVW&RQ¿JXUDWLRQ6FUHHQDOORZV
adjustment of the following parameters:
• Anti-Frost – This parameter provides the ability
to either disable anti-frost or upon an anti-frost
FRQGLWLRQFRQ¿JXUHWKH&RSSHU%UXWHOOWRRQO\WXUQ
RQWKHSXPSRUWRWXUQRQWKHSXPSDQG¿UHWKHEXUQHU
Screen 44. Touch the lock on any screen.
Page 66
6.F
6HUYLFH6FUHHQV
7RQDYLJDWHWRWKH6HUYLFH6FUHHQWRXFKWKH6HUYLFH
,FRQLQWKHORZHUOHIWKDQGSRUWLRQRIWKH+RPH6FUHHQ
BRADFORD WHITE CORP.
7KH%XUQHU6FUHHQDOORZVHDFKVWDJHWREH
HQDEOHGRUGLVDEOHGIRUWURXEOHVKRRWLQJDQGRU
GLDJQRVWLFSXUSRVHV7KLVVFUHHQZLOORQO\GLVSOD\
the number of stages associated with the size of the
XQLW)RUH[DPSOH&RSSHU%UXWHOOVL]HV
KDYHWZRVWDJHVVL]HKDVWKUHHVWDJHVDQGVL]HV
KDYHIRXUVWDJHV/RZ7HPS
XQLWVDUH2Q2IIXQLWVRQO\6HH7DEOHRQSDJH
127(7KHKRWVXUIDFHLJQLWRUV +6, DUHDVVRFLDWHG
ZLWK6WDJHVDQG,I6WDJHLVGLVDEOHGWKHQ
6WDJHZLOODXWRPDWLFDOO\EHGLVDEOHG,I6WDJHLV
GLVDEOHGWKHQ6WDJHZLOODXWRPDWLFDOO\EHGLVDEOHG
Screen 45. Home Screen
6.F.2 'LJLWDO,2 ,QSXW2XWSXW
1DYLJDWHWRWKH'LJLWDO,26FUHHQE\WRXFKLQJWKH
'LJLWDO,2%XWWRQRQWKH6HUYLFH6FUHHQ
Screen 46. 7KH6HUYLFH6FUHHQ
127(7KH1DYLJDWLRQ%DUGRHVQRWSRSOXODWHZLWK
QHZLFRQVDV\RXQDYLJDWHLQWRWKHYDULRXV6HUYLFH
6FUHHQV
)
URPWKH6HUYLFH6FUHHQEDVLFGLDJQRVWLFRU
VHUYLFHPRGHVFDQEHFRQ¿JXUHG7KHIROORZLQJ
VHFWLRQVJLYHDQRYHUYLHZRIHDFKVHUYLFHVXEPHQX
6.F.1 Burner
1DYLJDWHWRWKH%XUQHU6FUHHQE\WRXFKLQJWKH
%XUQHU%XWWRQRQWKH6HUYLFH6FUHHQ
Screen 47. The Burner Screen
Screen 48. 'LJLWDO,26FUHHQ,QSXWV
7KHUHDUHWZRVFUHHQVDVVRFLDWHGZLWKWKH'LJLWDO,2
1WKH'LJLWDO,26FUHHQ±,QSXWVVHHDERYHDQG
2'LJLWDO,26FUHHQ±2XWSXWVVHHEHORZ
)RUGLJLWDO RQRII LQSXWVLIWKHLQSXWLVVDWLV¿HG
WKHLQGLFDWRUOLJKWDVVRFLDWHGZLWKWKDWLQSXWLVJUHHQ
)RUH[DPSOHLIWKHUHLVDGHTXDWHÀRZWKHÀRZVZLWFK
LVVDWLV¿HGDQGWKHÀRZVZLWFKGLJLWDOLQSXWLQGLFDWRU
OLJKWLVJUHHQ6LPLODUO\LIWKHLQSXWLVQRWVDWLV¿HG
WKHLQGLFDWRUOLJKWDVVRFLDWHGZLWKWKDWLQSXWLVUHG
)RUH[DPSOHLIWKHEORZHULVRIIWKHQWKHDLUSURYLQJ
VZLWFKLVQRWVDWLV¿HGDQGWKHDLUSURYLQJVZLWFK
GLJLWDOLQSXWLQGLFDWRUOLJKWLVUHG
)RUGLJLWDO RQRII RXWSXWVLIWKHRXWSXWLVRQ
the indicator light associated with that output is
JUHHQ)RUH[DPSOHLIWKHERLOHUSXPSLVUXQQLQJ
then the boiler pump output indicator light will be
JUHHQ6LPLODUO\LIWKHRXWSXWLVRIIWKHLQGLFDWRU
OLJKWDVVRFLDWHGZLWKWKDWRXWSXWLVUHG)RUH[DPSOH
if there is no call for heat, then the gas valves are off,
DQGWKHJDVYDOYHLQGLFDWRUOLJKWVZLOOEHUHG
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 67
127( If the input is not attached, the value will
EH]HUR
Screen 49. 'LJLWDO,26FUHHQ2XWSXWV
Screen 51. $QDORJ,26FUHHQ2XWSXWV
6.F.3 Analog I/O
1DYLJDWHWRWKH$QDORJ,26FUHHQE\WRXFKLQJWKH
$QDORJ,2%XWWRQRQWKH6HUYLFH6FUHHQ
6.F.4 Screen Settings
1DYLJDWHWRWKH6FUHHQ6HWWLQJV6FUHHQE\WRXFKLQJ
WKH6FUHHQ%XWWRQRQWKH6HUYLFH6FUHHQ
Screen 50. $QDORJ,26FUHHQ,QSXWV
127(&RSSHU%UXWHOOGRHVQRWXVHDÀXHVWDFN
VHQVRU
There are two screens associated with the Analog
,2WKH$QDORJ,26FUHHQ±,QSXWVVHHDERYHDQGWKH
$QDORJ,26FUHHQ±2XWSXWVVHHEHORZ
)RUDQDORJLQSXWVWKHUHDUHWKUHHW\SHVRIDQDORJ
LQSXWVVHQVRUVÀDPHVLJQDODQGYROWDJHFXUUHQW
9'&P$ :LULQJRIWKHVHLQSXWVDUHFRYHUHGLQ
6HFWLRQ&
Screen 52. Screen Settings Screen
There are two adjustable screen settings: Light
7LPHRXWDQG$XWR/RFN7LPHRXW/LJKW7LPHRXW
allows the user to adjust the amount of time the touch
screen backlight will remain lit after user interaction
KDVFHDVHG$XWR/RFN7LPHRXWDOORZVWKHXVHUWR
adjust the amount of time the touch screen will remain
XQORFNHGZLWKQRXVHULQWHUDFWLRQ
BRADFORD WHITE CORP.
Page 68
6.F.5 History
1DYLJDWHWRWKH+LVWRU\6FUHHQE\WRXFKLQJWKH
+LVWRU\%XWWRQRQWKH6HUYLFH6FUHHQ
6.F.7 Factory Reset
7RXFKLQJWKH)DFWRU\5HVHW%XWWRQRQWKH6HUYLFH
6FUHHQUHVHWVDOOWRXFKVFUHHQDGMXVWDEOHSDUDPHWHUV
EDFNWRWKHIDFWRU\GHIDXOWVHWWLQJ
Screen 53. History Screen
7KH+LVWRU\6FUHHQSURYLGHVLQIRUPDWLRQRQERLOHU
RSHUDWLRQVDQGF\FOHFRXQWV7KH&RSSHU%UXWHOO
control accumulates and displays the number of heat
GHPDQGF\FOHVEXUQHUF\FOHVDQGSXPSF\FOHV,W
GLVSOD\VWKHPRVWUHFHQWORFNRXWFRQGLWLRQVDQG
&RSSHU%UXWHOOWHPSHUDWXUHDQG¿ULQJVWDWLVWLFV
Screen 55. Factory Reset Screen
6.G
6.G.1
6.F.6 Restart
7RXFKLQJWKH5HVWDUW%XWWRQRQWKH6HUYLFH6FUHHQ
UHERRWVWKH&RSSHU%UXWHOOGLVSOD\,IWKHWRXFKVFUHHQ
seems to be out of alignment, this is used to recalibrate
WKHWRXFKVFUHHQ
Messages and USB
Messages
The 'Message' icon at the bottom of the
KRPHVFUHHQZLOOGLVSOD\DQ ([FODPDWLRQ ZKHQWKHUHLVDPHVVDJH3UHVVWKHLFRQWR
VHHZKDWWKHPHVVDJHLV
0HVVDJHVDUHJHQHUDOO\VHOIH[SODQDWRU\DQG
ZLOOJXLGHDTXDOL¿HGVHUYLFHWHFKQLFLDQWRWKHLVVXHRU
SDUDPHWHUWKDWQHHGVWREHDGMXVWHGDQGRUVHUYLFHG
$ 0HVVDJH ZLOOQRWEHD /RFN2XW FRQGLWLRQ
ZKLFKLVGLVFXVVHGLQ6HFWLRQ$RQSDJH
Additionally, this area of the home screen will
LQGLFDWHWKDWD86%GHYLFHKDVEHHQLQVHUWHGLQWRWKH
86%SRUWZKLFKLVORFDWHGEHKLQGWKHWRXFKVFUHHQ
GLVSOD\6HH)LJXUHRQSDJH
6.G.1 Messages
Screen 54. Restart Screen
To recalibrate the touch screen. After pressing
WKH5HVWDUW%XWWRQSURPSWO\WRXFKWKHWRXFKVFUHHQ
and follow the calibration procedure as shown on the
WRXFKVFUHHQ
Screen 56. +RPH6FUHHQ7\SLFDO
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
6.G.2
Page 69
USB Functionality
7
KH'LVSOD\KDVD86%SRUWWKDWFDQEHXVHGWR
perform the following tasks:
D'RZQORDGSDUDPHWHUVIURPDWKXPEGULYHWRD
ERLOHU
E8SORDGSDUDPHWHUVIURPDERLOHUWRDWKXPEGULYH
F8SORDGGDWDIURPWKHERLOHUWRDWKXPEGULYH
is to upload all parameters and settings into a thumb
drive for documentation purposes or to be able to copy
these settings from boiler to boiler without having to
UHHQWHUWKHPLQGLYLGXDOO\
Upload DATAIURPWKHERLOHU This is used to
retrieve runtime data, history, as well as capture all
VHWWLQJVLQDWDEGHOLPLWHG([FHOIRUPDWGRFXPHQW
7
KH86%SRUWLVLQWHJUDWHGLQWRWKHEDFNRIWKH
WRXFKVFUHHQGLVSOD\7RDFFHVVLWWKHIURQWSDQHORI
the unit must be removed and then the touchscreen
UHPRYHGIURPLW VPRXQWHGORFDWLRQ7KH86%SRUWFDQ
WKHQEHVHHQRQWKHEDFNRIWKHWRXFKVFUHHQGLVSOD\
Screen 58. 'DWD7DVNVIRUWKH86%3RUW
Figure 31. 3KRWRRI86%6ORWRQWKHEDFNRI
WRXFKVFUHHQGLVSOD\
2QFHD86%WKXPEGULYHKDVEHHQLQVHUWHGLQWR
WKH86%SRUWWKH86%LFRQZLOOSRSXSRQWKHKRPH
VFUHHQ
6FUHHQ
Screen 57. Home Screen showing USB
2QFHWKH86%LFRQKDVDSSHDUHGRYHUWKH0HVVDJH
LFRQ\RXFDQWKHQVHOHFWWKH86%LFRQDQGLWZLOO
VZLWFKWRWKH86%PHQX 6HH6FUHHQ +HUH\RX
FDQSHUIRUPWKHVHWDVNV
'RZQORDG3DUDPHWHUVIURPWKHERLOHU This
saves time during a cascade setup or a control
replacement where the contractor only has to enter the
YDOXHVLQERLOHULQVWHDGRIXSZDUGVRIERLOHUV
8SORDG3DUDPHWHUVIURPWKHERLOHU This feature
BRADFORD WHITE CORP.
Page 70
6.H
$FWLYH'HPDQGV
6.I
7KH$FWLYH'HPDQG:LQGRZLQGLFDWHVWKHVWDWXVRI
DFWLYHKHDWGHPDQGV
7KH1DYLJDWLRQ%DU
7KH1DYLJDWLRQ%DULVDWRXFKVHQVLWLYHDUHDDWWKH
top left of every screen, that shows you where you
are at any time as you navigate into and out of the
WRXFKVFUHHQV7KHIXUWKHULQWKDW\RXJRWKHPRUH
LFRQVZLOODSSHDULQWKH1DYLJDWLRQ%DU,I\RXDUH
LFRQVLQDQGZDQWWRJREDFNWRWKH+RPH6FUHHQ
VLPSO\FOLFNRQWRWKH+RPH,FRQ,I\RXFOLFNRQWRDQ\
LFRQLQWKH1DYLJDWLRQ%DU\RXZLOOJRWRWKDWORFDWLRQ
GLUHFWO\,I\RXZDQWWRJREDFNMXVWRQHVWHS\RXFDQ
FOLFNRQWRWKHQH[W,FRQEDFN25XVWWKH%DFNEXWWRQ
Screen 59. $FWLYH'HPDQG:LQGRZ
The darker$FWLYH'HPDQ,FRQLQGLFDWHVWKHKHDW
GHPDQGWKDWLVFXUUHQWO\EHLQJVDWLV¿HG$ greyed
out $FWLYH'HPDQG,FRQLVHLWKHUORZHULQSULRULW\
WKDQWKHKHDWGHPDQGWKDWLVFXUUHQWO\EHLQJVDWLV¿HG
or the heat demand has reached set point, but remains
DFWLYH
CH1/2 or DHW1/2
Screen 60. 7KH1DYLJDWLRQ%DU
Lock-out Conditions will also display inside the
1avigation %DU5HIHUWR7DEOHRQSDJHIRUD
OLVWRISRVVLEOH/RFNRXWFRQGLWLRQV
DHW or DHW3
External
Warm Weather Shutdown
6.J
'DWHDQG7LPH'LVSOD\$UHD
NOTE: Warm Weather Shutdown is not
a heat demand. This icon indicates that
a space heating demand is disabled due
to high outdoor ambient temperature.
Cascade
Figure 32. $FWLYH'HPDQG([DPSOHV
7KHWRSULJKWSRUWLRQRIWKH+RPH6FUHHQVKRZV
WKH'DWHDQG7LPH7RVHWWKH'DWHDQG7LPH
please refer to Section 6.E.10 on page 62.
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
SECTION 7
7.A
6HTXHQFHRI2SHUDWLRQ
5HVWDUWLQJWKH&RSSHU%UXWHOO
,IGUDLQHGIROORZ$RQSDJHLQWKLVPDQXDO
IRUSURSHU¿OOLQJDQGSXUJLQJ
6ZLWFKRIIWKHPDLQHOHFWULFDOGLVFRQQHFWVZLWFK
&ORVHDOOPDQXDOJDVYDOYHV
3. WAIT FIVE (5) MINUTES.
6
HWWKHDTXDVWDWRUWKHUPRVWDWWRLWVORZHVWVHWWLQJ
2SHQDOOPDQXDOJDVYDOYHV
5
HVHWDOOVDIHW\VZLWFKHV SUHVVXUHVZLWFKPDQXDO
UHVHWKLJKOLPLWHWF 6
HWWKHWHPSHUDWXUHFRQWUROOHUWRWKHGHVLUHG
WHPSHUDWXUHVHWWLQJDQGVZLWFKRQHOHFWULFDOSRZHU
%
XUQHUZLOOJRWKURXJKDSUHSXUJHSHULRGDQG
LJQLWRUZDUPXSSHULRGIROORZHGE\LJQLWLRQ
7.B
Page 71
6HTXHQFHRI2SHUDWLRQ
Copper Brute lls follow the sequence of operations
H[SODLQHGLQWKLVVHFWLRQDQGUHÀHFWHGLQWKHÀRZFKDUW
RQWKHQH[WSDJH
127(&RSSHU%UXWHOOPRGHOV±
KDYHWZRLJQLWLRQVRXUFHV7KHFRQWUROOHUWUHDWVWKH
burners associated with each ignitor as an independent
ERLOHUKHDWHU,IRQHLJQLWRUVKRXOGIDLOIRUDQ\UHDVRQ
the remaining ignitor and burner(s) will operate
LQGHSHQGHQWO\
Standby
Upon a call for heat, the pump is energized and
RQFHWKHDGHTXDWHOLTXLGÀRZLVHVWDEOLVKWKHÀRZ
VZLWFKLVVDWLV¿HG,IDOORWKHUVDIHW\LQWHUORFNVDUH
VDWLV¿HGWKH3UH3XUJHF\FOHEHJLQV
Pre-Purge
,Q3UH3XUJHWKH&RSSHU%UXWHOOEORZHUWXUQVRQ
KLJKVSHHGDQGFRQ¿UPVWKDWWKH$LU3URYLQJ6ZLWFK
$36 WUDQVLWLRQVIURPRSHQWRFORVHG7KHJDVYDOYHV
DQG+RW6XUIDFH,JQLWRU +6, DUHRII7KHGXUDWLRQ
RI3UH3XUJHLVVHFRQGVDQGRQFHH[SLUHGWKH
&RSSHU%UXWHOOWUDQVLWLRQVWR+6,:DUPXS,IWKH
$36UHPDLQVRSHQRULIWKHUHLVDVHSDUDWHORFNRXW
condition, the Copper Brute ll locks out and transitions
WRWKH/RFNRXWPRGH,IWKHFDOOIRUKHDWLVUHPRYHG
WKHERLOHUKHDWHUZLOOWUDQVLWLRQEDFNWRWKH6WDQGE\
PRGH
127(7KHGXUDWLRQRI3UH3XUJHLVHVWDEOLVKHG
to ensure proper evacuation of any unspent fuel in the
FRPEXVWLRQFKDPEHUDQGÀXHFROOHFWRU
HSI Warmup
,Q+6,:DUPXSWKHEORZHUFRQWLQXHVWRUXQDW
6WDUW8SDQG6KXW'RZQRIWKH&RSSHU%UXWH
OO PXVW EH SHUIRUPHG E\ D TXDOL¿HG VHUYLFH
SHUVRQ
high speed, the gas valves remain off, and power is
DSSOLHGWRWKH+6,7KHFXUUHQWÀRZLQJWKURXJKWKH
+6,PXVWEHEHWZHHQ±$PSVVHFRQGV
,IWKH+6,DPSHUDJHPHHWVWKHWKUHVKROGDQGWLPH
UHTXLUHPHQWVWKHERLOHUKHDWHUZLOOWUDQVLWLRQWR
WKH,JQLWLRQPRGH,IWKHDPSHUDJHGRHVQ¶WPHHW
the threshold and time requirements, or if there is a
separate lock-out condition, the Copper Brute ll will
WUDQVLWLRQWR/RFNRXWPRGH,IWKHFDOOIRUKHDWLV
UHPRYHGWKH&RSSHU%UXWHOOZLOOUHWXUQWR6WDQGE\
Ignition
In Ignition, the blower continues to run at high
VSHHGWKH+6,LVRQDQGWKHJDVYDOYHDVVRFLDWHGZLWK
WKH+6,LVHQHUJL]HG3URSHULJQLWLRQKDVRFFXUUHGLI
WKHÀDPHVLJQDOLVJUHDWHUWKDQRUHTXDOWRX$PSV
LQVHFRQGV,IDSURSHUÀDPHKDVEHHQHVWDEOLVKHG
WKH&RSSHU%UXWHOOZLOOWUDQVLWLRQWR5XQPRGH,I
SURSHULJQLWLRQGRHVQRWRFFXUDQGWKHPD[LPXP
DWWHPSWVIRULJQLWLRQKDVQRWRFFXUUHGWKHERLOHUKHDWHU
ZLOOWUDQVLWLRQWR,QWHU3XUJHPRGH,ISURSHULJQLWLRQ
GRHVQRWRFFXUDQGWKHPD[LPXPDWWHPSWVIRULJQLWLRQ
KDVEHHQUHDFKHGWKHERLOHUKHDWHUZLOOWUDQVLWLRQWR
/RFNRXWPRGH,IWKHFDOOIRUKHDWLVUHPRYHGWKH
ERLOHUKHDWHUZLOOWUDQVLWLRQWR6WDQGE\
127( Three attempts for ignition, prior to lockRXWLVVWDQGDUG&6'XQLWVKDYHDVLQJOHDWWHPSWIRU
LJQLWLRQSULRUWRORFNRXW
Run
,Q5XQWKHEORZHUFRQWLQXHVWRUXQDWKLJKVSHHG
WKH+6,LVRIIDQGWKHJDVYDOYHDVVRFLDWHGZLWKWKH
+6,LVHQHUJL]HG7KHVWDJHRUVWDJHJDVYDOYHZLOO
VWDJHRQRIIDVUHTXLUHGWRVDWLVI\DFDOOIRUKHDW,I
WKHUHLVDORVVRIÀDPHGXULQJ5XQPRGHWKH&RSSHU
%UXWHOOZLOOWUDQVLWLRQWR,QWHU3XUJHPRGH,IDORFN
RXWFRQGLWLRQRFFXUVGXULQJ5XQPRGHWKH&RSSHU
%UXWHOOZLOOWUDQVLWLRQWR/RFNRXWPRGH,IWKHFDOO
for heat is removed, the Copper Brute ll will transition
WR3RVW3XUJHSULRUWRUHWXUQLQJWR6WDQGE\
Inter-Purge
In Inter-purge, the blower continues to run at high
VSHHGWKH+6,LVRIIDQGWKHJDVYDOYHVDUHRII7KH
&RSSHU%UXWHOOZLOOVWD\LQ,QWHU3XUJHIRUVHFRQGV
$IWHUVHFRQGVWKH&RSSHU%UXWHOOZLOOWUDQVLWLRQ
BRADFORD WHITE CORP.
Page 72
WR+6,3UH+HDW,IDORFNRXWFRQGLWLRQRFFXUVGXULQJ
,QWHU3XUJHWKH&RSSHU%UXWHOOZLOOWUDQVLWLRQWR/RFN
RXW,IWKHFDOOIRUKHDWLVUHPRYHGGXULQJ,QWHU3XUJH
WKH&RSSHU%UXWHOOZLOOWUDQVLWLRQWR3RVW3XUJHSULRU
WRUHWXUQLQJWR6WDQGE\
FRPEXVWLRQFKDPEHUDQGÀXHFROOHFWRU
Post-Purge
,Q3RVWSXUJHWKHEORZHUFRQWLQXHVWRUXQDWKLJK
VSHHGWKH+6,LVRIIDQGWKHJDVYDOYHVDUHRII7KH
&RSSHU%UXWHOOZLOOVWD\LQ3RVWSXUJHIRUVHFRQGV
After this time, the Copper Brute ll will return to
6WDQGE\
127(7KHGXUDWLRQRI3RVW3XUJHLVHVWDEOLVK
to ensure proper evacuation of any unspent fuel in the
Reset Lock-out
7.C
6KXWWLQJ'RZQWKH&RSSHU%UXWHOO
6ZLWFKRIIWKHPDLQHOHFWULFDOGLVFRQQHFWVZLWFK
&ORVHDOOPDQXDOJDVYDOYHV
, IIUHH]LQJLVDQWLFLSDWHGGUDLQWKH&RSSHU%UXWH
ll and be sure to also protect building piping from
IUHH]LQJ
Standby
Fan-Kī; HSI-Oī
GV1-Kī; GV2-Oī
Lock-out
Fan-HighͬKī; HSIOī
Lock-out
Lock-out
In Lock-out, the blower continues to run at high
VSHHGWKH+6,LVRIIDQGWKHJDVYDOYHVDUHRII7KH
&RSSHU%UXWHOOEORZHUZLOOVWD\RQIRUVHFRQGV
The lock-out condition will remain until it has been
PDQXDOO\UHVHW2QFHUHVHWWKH&RSSHU%UXWHOOZLOO
WUDQVLWLRQWR6WDQGE\PRGH
Call for heat
No heat demand
Pre-Purge
Fan-High; HSI-Oī
GV1-Kī; GV2-Oī
HSI Warmup
Fan-High; HSI-On
GV1-Kī; GV2-Oī
Lock-out
IgniƟon
Fan-High; HSI-On
GV1-On; GV2-Oī
No Flame
Flame OK
GV2 Req'd
No heat demand
ŌĞƌ Inter-Purge
Run
Fan-High; HSI-Oī
GV1-On; GV2-KīͬKn
Inter-Purge
Fan-High; HSI-Oī
GV1-Kī; GV2-Oī
No Flame
No heat
demand
No heat demand
Figure 33. Timing and Ignition Flow
Post-Purge
Fan-High; HSI-Oī
GV1-Kī; GV2-Oī
Page 73
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
SECTION 8
8.A
%XUQHU6HW8S
6HW8SIRUWR)HHW$OWLWXGH
The Copper Brute ll appliance utilizes a modular
GHVLJQWRDFKLHYHLWVVWDJH¿ULQJ7KHVHWXSPXVW
EHFKHFNHGEHIRUHWKHXQLWLVSXWLQRSHUDWLRQ
3UREOHPVVXFKDVIDLOXUHWRVWDUWURXJKLJQLWLRQ
VWURQJH[KDXVWRGRUVHWFFDQEHGXHWRLPSURSHU
VHWXS'DPDJHWRWKH&RSSHU%UXWHOOUHVXOWLQJ
from improper setup is not covered by the limited
ZDUUDQW\
8VLQJWKLVPDQXDOPDNHVXUHWKHLQVWDOODWLRQ
is complete and fully in compliance with the
LQVWUXFWLRQV
'HWHUPLQHWKDWWKHDSSOLDQFHDQGV\VWHPDUH¿OOHG
ZLWKZDWHUDQGDOODLUKDVEHHQEOHGIURPERWK
2SHQDOOYDOYHV
2EVHUYHDOOZDUQLQJVRQWKH2SHUDWLQJ,QVWUXFWLRQV
label and turn on gas and electrical power to
DSSOLDQFH
6ZLWFKRQWKHDSSOLDQFHSRZHUVZLWFKORFDWHGRQ
WKHULJKWVLGHRIWKHXQLW
7KH&RSSHU%UXWHOOZLOOHQWHUWKHVWDUWVHTXHQFHDV
ORQJDVWKHXQLWLVEHLQJFDOOHGIRUKHDW7KHEORZHU
and pump come on for pre-purge, then the ignitor
warm-up sequence starts and after the ignitor warmXSLVFRPSOHWHDQGDOOVDIHW\GHYLFHVDUHYHUL¿HG
WKHJDVYDOYHVRSHQ,ILJQLWLRQGRHVQ¶WRFFXUFKHFN
WKDWWKHUHLVSURSHUJDVVXSSO\:DLWPLQXWHVDQG
VWDUWWKHXQLWDJDLQ'XULQJLQLWLDOVWDUWXSDLULQWKH
JDVOLQHPD\FDXVHWKH&RSSHU%UXWHOOWRORFNRXW
GXULQJWKH¿UVWIHZWULDOVIRULJQLWLRQ'HSHQGLQJ
on the ignition modules installed, the manual reset
button on the ignition modules may need to be
GHSUHVVHGWRUHVWDUWWKH&RSSHU%UXWHOO
:LWKWKHXQLWUXQQLQJYHULI\WKHVXSSO\JDV
SUHVVXUHPDQLIROGJDVSUHVVXUHDQG&2DFFRUGLQJ
WRWKH7DEOH
7\SLFDO
6XSSO\*DV
3UHVVXUH
Range
0DQLIROG*DV3UHVVXUH
&22
1DWXUDO*DV
´ZF N3D
Propane
´ZF N3D
´ZF” VXSSO\SUHVVXUH ”´ZF
´ZF N3D
7DEOH 6XSSO\*DV3UHVVXUH
7. After placing the appliance in operation, the
Burner Safety Shutoff Device must be tested
To test:
D &ORVHJDVVKXWRIIYDOYHZLWKEXUQHURSHUDWLQJ
E 7KHÀDPHZLOOJRRXWDQGEORZHUZLOOFRQWLQXH
WRUXQIRUWKHSRVWSXUJHF\FOH2QHDGGLWLRQDO
DWWHPSWWROLJKWZLOOIROORZ,JQLWLRQZLOOQRWRFFXU
DVWKHJDVLVRII7KHLJQLWLRQFRQWUROZLOOORFNRXW
and will have to be reset before the unit will
RSHUDWH
F 2SHQJDVVKXWRIIYDOYH5HVWDUWWKHDSSOLDQFH
The ignition sequence will start again and the
EXUQHUZLOOVWDUW7KHDSSOLDQFHZLOOUHWXUQWRLWV
SUHYLRXVPRGHRIRSHUDWLRQ
NOTE:6L]HV±KDYHWZRLJQLWLRQFRQWUROV
DQGWZRLJQLWRUVZKLFKZRUNLQGHSHQGHQWO\RIRQH
DQRWKHU,IWKHLJQLWLRQFRQWUROIRUVWDJHVDQG
IDLOVWRSURSHUO\OLJKWWKHPDLQEXUQHUVIRUWKRVH
VWDJHVWKHVHFRQGLJQLWLRQFRQWUROZLOOVWLOOEHDFWLYH
DQGZLOOEHDEOHWRHQHUJL]HVWDJHVDQG7KLV
RIFRXUVHZLOORQO\RFFXULIDOORWKHUVDIHW\GHYLFHV
FRQ¿UPWKDWWKHXQLWZLOOUXQLQDVDIHFRQGLWLRQ
8.B
6HW8SIRU+LJK$OWLWXGH
( >2500 Feet )
Copper Brute ll appliances may be operated at
KLJKDOWLWXGH IWP ZLWKDUHGXFWLRQLQ
RXWSXWRIDSSUR[LPDWHO\$WDOWLWXGHVRIOHVV
WKDQRUPRUHWKDQIW P WKHDSSOLDQFHZLOO
perform equally as well, but with differing reductions in
RXWSXW$WHOHYDWLRQVKLJKHUWKDQIW P WKH
UHGXFWLRQLQRXWSXWZLOOH[FHHGDQGDWHOHYDWLRQV
EHORZIW P LWZLOOEHOHVVWKDQ+LJK
altitude adjustment must not be made on appliances
RSHUDWLQJDWHOHYDWLRQVEHORZIW P 1RRUL¿FHFKDQJHVDUHUHTXLUHGWRDGMXVWWKH
&RSSHU%UXWHOODSSOLDQFHVIRUKLJKDOWLWXGH+LJK
altitude adjustment is accomplished by adjustment of
WKHJDVYDOYHPDQLIROGSUHVVXUHDQGWKHDLUVKXWWHU V The required instruments used to assist in these
DGMXVWPHQWVDUHD&2RU2 Analyzer and a U-Tube
Manometer or other device capable of reading a
SUHVVXUHRILQFKHVZF N3D 6WDUWWKHDGMXVWPHQWSURFHVVE\FKHFNLQJWKH
&2LQWKH³DVLQVWDOOHG´FRQGLWLRQ$GMXVWWKHDLU
VKXWWHU V VRWKDWWKH&2LVDERXWRUWKH2 is
DERXWIRUDSSOLDQFHVRSHUDWLQJRQ1DWXUDO*DV
)RUDSSOLDQFHVRSHUDWLQJRQ/3*DVDGMXVWWKHDLU
VKXWWHU V VRWKDWWKH&2LVDERXWRUWKH2 is
DERXW$SSOLDQFHVZLWKWZREORZHUVVKRXOGEH
adjusted so that the air shutters below each blower are
RSHQWKHVDPHDPRXQW
2QFHWKH&2RU2 has been set, the manifold
SUHVVXUHPD\EHDGMXVWHG5HPRYHWKH137SOXJ
from the lower side of the gas valve that is to be
VHWDQGLQVWDOOD¿WWLQJKRVHDQGPDQRPHWHU6WDUW
WKHDSSOLDQFHDQGREVHUYHWKHPDQLIROGSUHVVXUH
0DQLIROGSUHVVXUHPXVWEHDGMXVWHGWRLQZF
N3D IRUKLJKDOWLWXGHRQO\VWDQGDUGRSHUDWLQJ
PRUHRQQH[WSDJH
Page 74
SUHVVXUHLVLQZF N3D ,WLVDGMXVWHGE\
removing the slotted cap on the gas valve and turning
the adjustment screw (beneath the cap) clockwise to
increase pressure and replaced after the adjustments
KDYHEHHQFRPSOHWHGDQGWKH¿WWLQJKRVHDQG
PDQRPHWHUKDYHEHHQUHPRYHGDQGWKHSOXJKDV
EHHQUHSODFHG5HSHDWWKLVSURFHVVXQWLODOOJDVYDOYHV
KDYHEHHQVHW1RWH The pressure can be set only
when the appliance is operating and only when the
particular gas valve being adjusted is energized by a
FDOOIRUKHDWIURPWKHVWDJLQJFRQWURO
After all of the gas valve manifold pressures have
EHHQVHWWKH&2RU2PXVWEHUHVHW&2RU2
will have changed when the manifold pressure was
DGMXVWHG2SHQWKHDLUVKXWWHU V WRUHGXFHWKH&2 or
2WRWKHYDOXHVDFKLHYHGSUHYLRXVO\
The procedure is complete when all gas valves are
DGMXVWHGWRDPDQLIROGSUHVVXUHRILQZF N3D DQGWKH&2LVDGMXVWHGWRIRU1DWXUDO*DV
DSSOLDQFHVRUIRU/3DSSOLDQFHV:KHQXVLQJDQ
2DQDO\]HUWKHFRUUHFW2LVIRUERWK1DWXUDO
*DVDQG/3DSSOLDQFHV
Caution
6KRXOGDQ\RGRURIJDVEHGHWHFWHGRULIWKHJDV
EXUQHUGRHVQRWDSSHDUWREHIXQFWLRQLQJLQDQRUPDO
PDQQHUFORVHPDLQVKXWRIIYDOYHGRQRWVKXWRII
VZLWFKDQGFRQWDFW\RXUKHDWLQJFRQWUDFWRUJDV
FRPSDQ\RUIDFWRU\UHSUHVHQWDWLYH
BRADFORD WHITE CORP.
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
SECTION 9
9.A
Page 75
Maintenance
System Maintenance
/XEULFDWHWKHV\VWHPZDWHUFLUFXODWLQJSXPSLI
UHTXLUHGSHUWKHLQVWUXFWLRQVRQWKHSXPS
,IDVWUDLQHULVHPSOR\HGLQDSUHVVXUHUHGXFLQJYDOYH
RUWKHSLSLQJFOHDQLWHYHU\VL[PRQWKV
,QVSHFWWKHYHQWLQJV\VWHPIRUREVWUXFWLRQRUOHDNDJH
DWOHDVWRQFHD\HDU3HULRGLFDOO\FOHDQWKHVFUHHQVLQ
the vent terminal and combustion air terminal (when
XVHG .HHSWKHDSSOLDQFHDUHDFOHDUDQGIUHHIURP
FRPEXVWLEOHPDWHULDOVJDVROLQHDQGRWKHUÀDPPDEOH
YDSRUVDQGOLTXLGV
,IWKHDSSOLDQFHLVQRWJRLQJWREHXVHGIRUH[WHQGHG
periods in locations where freezing normally occurs,
it should be isolated from the system and completely
GUDLQHGRIDOOZDWHU$OOV\VWHPVFRQQHFWHGWRLW
VKRXOGDOVREHGUDLQHGRUSURWHFWHGIURPIUHH]LQJ
/RZZDWHUFXWRIIVLILQVWDOOHGVKRXOGEHFKHFNHG
HYHU\PRQWKV)ORDWW\SHORZZDWHUFXWRIIVKRXOG
EHÀXVKHGSHULRGLFDOO\
,QVSHFWÀXHSDVVDJHVDQGFOHDQZLWKEUXVKHV
YDFXXPVLIQHFHVVDU\6RRWLQJLQÀXHSDVVDJHV
LQGLFDWHVLPSURSHUFRPEXVWLRQ'HWHUPLQHWKHFDXVH
DQGFRUUHFW
,QVSHFWWKHYHQWV\VWHPDQGDLULQWDNHV\VWHPDQGLI
the vent system is Category III, ensure that all joints
DUHVHDOHGSURSHUO\,IMRLQWVQHHGWREHUHVHDOHG
FRPSOHWHO\UHPRYHH[LVWLQJVHDOLQJPDWHULDODQG
FOHDQZLWKDOFRKRO$SSO\QHZVHDOLQJPDWHULDODQG
UHDVVHPEOH
9.B.1 Burners
&ORVHPDLQPDQXDOJDVYDOYHEHIRUHSURFHHGLQJ
&KHFNLQJWKHEXUQHUVIRUGHEULV5HPRYHWKHLJQLWRU
inspection panels(s) and ignitor(s) and inspect the
EXUQHUVWKURXJKWKHLJQLWRUKROH V XVLQJDÀDVKOLJKW
WRLOOXPLQDWH,IWKHUHLVDQ\LQGLFDWLRQRIGHEULVRQ
the burners that are visible, all the burners will need
WREHLQVSHFWHGPRUHWKRURXJKO\5HPRYHWKHVFUHZV
IURPDURXQGWKHIURQWRIWKHDLUER[ ODUJHSDQHOIURP
which the ignitor inspection panel(s) were removed),
DQGUHPRYHWKHODUJHSDQHO5HPRYHWKHJDVPDQLIROG
DVVHPEOLHVDQGWKHEXUQHUSDQHOV,QVSHFWWKHEXUQHUV
Clean burners, if necessary, by blowing compressed
air from the outside of the burners into the center
RIWKHEXUQHU$GLUW\EXUQHUPD\EHDQLQGLFDWLRQ
RILPSURSHUFRPEXVWLRQRUGLUW\FRPEXVWLRQDLU
'HWHUPLQHWKHFDXVHDQGFRUUHFW5HSODFHWKHEXUQHUV
in the reverse order
9.B.2 Filter
7KH¿OWHUXVHGLQWKH&RSSHU%UXWHOOLVZDVKDEOH
ZLWKDQDUUHVWDQFH6LQFHWKH¿OWHULVZDVKDEOH
it will only need replacement when unwashable,
GHWHULRUDWHGRUGDPDJHG,I¿OWHUUHSODFHPHQWLV
QHHGHGLWVKRXOGRQO\EHUHSODFHGZLWKDIDFWRU\SDUW
,QVSHFWWKHDLU¿OWHU,IWKHUHLVGHEULVRQWKHDLU¿OWHU
UHPRYHLWIURPWKH¿OWHUER[DQGZDVKLWZLWKPLOG
VRDSDQGZDWHU(QVXUHWKDWWKH¿OWHULVFRPSOHWHO\GU\
EHIRUHUHLQVWDOOLQJLQUHYHUVHRUGHU
Caution
/DEHODOOZLUHVSULRUWRGLVFRQQHFWLRQZKHQ
VHUYLFLQJFRQWUROV:LULQJHUURUVFDQFDXVHLPSURSHU
DQGGDQJHURXVRSHUDWLRQ9HULI\SURSHURSHUDWLRQ
DIWHUVHUYLFLQJ
.
9.B.3 *DV9DOYHV
The gas valves are designed to operate with supply
SUHVVXUHVRILQFKHVZF WRN3D 7RUHPRYHDYDOYHVKXWRIIYROWSRZHUDQGWKH
PDQXDOJDVVKXWRIIYDOYH5HPRYHWKHWRSIURQWSDQHO
IURPWKHXQLW'LVFRQQHFWWKHZLUHVWRWKHYDOYH
'LVHQJDJHWKHÀDQJHG¿WWLQJEHIRUHDQGDIWHUWKH
YDOYHDQGUHPRYHWKHYDOYH5HLQVWDOOLQUHYHUVH
RUGHU(QVXUHRULQJVDUHSURSHUO\LQVWDOOHGIRUERWK
LQOHWDQGRXWOHW7XUQRQPDQXDOJDVVKXWRIIYDOYHDQG
YROWSRZHUDQGFKHFNDSSOLDQFHRSHUDWLRQDQG
WLJKWQHVVRIJDVYDOYHFRQQHFWLRQV
6HH)LJXUHDQG)LJXUHIRUORFDWLRQRIJDV
WUDLQDQGFRQWUROFRPSRQHQWV
The gas and electric controls on the appliance are
engineered for long life and dependable operation,
but the safety of the equipment depends on their
SURSHUIXQFWLRQLQJ,WLVVWURQJO\UHFRPPHQGHGWKDW
DTXDOL¿HGVHUYLFHWHFKQLFLDQLQVSHFWWKHEDVLFLWHPV
listed below every year:
D &RQWUROOHU
G 3UHVVXUHVZLWFKHV
E ,JQLWRUV
I %ORZHUV
F$XWRPDWLFJDVYDOYH
9.B.4 Manual Reset High Limit Control
When used, the high limit switch is a manual
UHVHWVZLWFKZLWKDQDGMXVWDEOHVHWSRLQWXSWRƒ)
ƒ& RQERLOHUPRGHOVDQGƒ) ƒ& RQ
water heater models and boilers ordered with low
WHPSHUDWXUHFRQWUROV7RUHSODFHWKHVZLWFKVKXWRII
WKHYROWSRZHUWRWKHDSSOLDQFH5HPRYHWKH
FRYHUIURPWKHVZLWFKWRDFFHVVWKHPRXQWLQJVFUHZV
5HPRYHWKHVFUHZVDQGSXOOWKHVZLWFKRIIWKHFRQWURO
SDQHO5HPRYHWKHFDSLOOLDU\DQGEXOEIURPWKH
WKHUPDOZHOOORFDWHGLQWKHKHDGHU5HSODFHLQUHYHUVH
RUGHU
9.B $SSOLDQFH0DLQWHQDQFHDQG
&RPSRQHQW'HVFULSWLRQ
2QO\JHQXLQH%UDGIRUG:KLWHUHSODFHPHQWSDUWVVKRXOG
EHXVHG
Page 76
BRADFORD WHITE CORP.
9.B.5 Automatic Reset High Limit Control
When used, an automatic reset high limit switch
KDVDQDGMXVWDEOHVHWSRLQWXSWRƒ) ƒ& RQ
ERLOHUPRGHOVDQGƒ) ƒ& ZDWHUKHDWHUPRGHOV
DQGERLOHUVRUGHUHGZLWKORZWHPSHUDWXUHFRQWUROV
7RUHSODFHWKHVZLWFKVKXWRIIWKHYROWSRZHU
WRWKHDSSOLDQFH5HPRYHWKHFRYHUIURPWKHVZLWFK
WRDFFHVVWKHPRXQWLQJVFUHZV5HPRYHWKHVFUHZV
DQGSXOOWKHVZLWFKRIIWKHFRQWUROSDQHO5HPRYHWKH
capilliary and bulb from the thermal well located in
WKHKHDGHU5HSODFHLQUHYHUVHRUGHU
9.B.6 Controller
7KHFRQWUROOHULVD%UDGIRUG:KLWH%,&7KH
controller ensures the proved interrupted-type ignition
V\VWHP,WFRQWUROVWKHKRWVXUIDFHLJQLWRU V DQGSURYH
WKDWWKHÀDPHVLJQDOLVDSSURSULDWHIRUSRZHULQJWKH
JDVYDOYHV,WDOVRFRQWUROVWKHEORZHU¶VSUHSXUJHDQG
SRVWSXUJH
7RUHSODFHDFRQWUROOHUVKXWRIIWKHYROW
SRZHUWRWKHDSSOLDQFH5HPRYHWKHFRYHUIURPWKH
FRQWUROSDQHO5HPRYHWKHHOHFWULFDOFRQQHFWRUVIURP
WKHFRQWUROOHU7DNHRXWWKHFRQWUROOHU¶VPRXQWLQJ
VFUHZVDQGSXOOWKHFRQWUROOHURXW5HSODFHLQUHYHUVH
RUGHU
Figure 35. 7\SLFDO&RQWURO3DQHO
Figure 34. 7\SLFDO*DV7UDLQ&RQ¿JXUDWLRQ
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
9.B.7 Ignitors
7KHLJQLWRUVXVHGDUHY³+RW6XUIDFH´W\SH
They are energized whenever there is a call for heat
and switched off when ignition is established and the
ÀDPHKDVEHHQVHQVHG&RSSHU%UXWHOOVL]HVDQG
KDYHRQHLJQLWRU6L]HVWRKDYHWZR
LJQLWRUV7RUHSODFHWKHLJQLWRUVKXWRIIWKHYROW
power to the appliance, remove the ignitor access
SDQHOGLVFRQQHFWWKH0ROH[FRQQHFWRUUHPRYHWKH
WZRPRXQWLQJVFUHZVRQWKHLJQLWRUÀDQJHDQGSXOO
WKHLJQLWRURXW,QVWDOOLQUHYHUVHRUGHUDOZD\VXVLQJD
QHZLJQLWRUJDVNHWZLWKWKHUHSODFHPHQWLJQLWRU
Caution
,JQLWRUJHWVKRW
9.B.8 Ignition Sensors
7KHLJQLWLRQVHQVRUVHQVXUHWKDWWKHPDLQÀDPH
LVLJQLWHGVRWKDWUDZJDVLVQRWDOORZHGWR¿OOWKH
FRPEXVWLRQFKDPEHU&RSSHU%UXWHOOVL]HVDQG
KDYHRQHVHQVRU6L]HVWRKDYHWZR
VHQVRUV RQHIRUHDFKLJQLWLRQFRQWURO 7KHLJQLWRUV
DUHWKHLJQLWLRQVHQVRUVRQ&RSSHU%UXWHOODSSOLDQFHV
7KHUHDUHQRVHSDUDWHLJQLWLRQVHQVRUV
9.B.9 Transformer
The Copper Brute ll’s transformer is not capable
RIVXSSO\LQJFRQWUROYROWDJHIRUH[WHUQDOGHYLFHVVXFK
as zone valves, which must have their own separate
SRZHUVXSSO\6KRXOGDWUDQVIRUPHUQHHGUHSODFLQJ
VKXWRIIWKHYROWSRZHU8QSOXJWKHWUDQVIRUPHU
wires, remove the mounting screws and remove the
WUDQVIRUPHU5HSODFHWUDQVIRUPHULQWKHUHYHUVHRUGHU
9.B.10 Blowers
The combustion air blowers bring the combustion
air for the Copper Brute ll from the upper chamber to
WKHORZHUFKDPEHU0L[LQJRIWKHJDVDQGDLURFFXUV
LQWKHEXUQHUV6L]HVDQGHDFKKDYHRQH
EORZHUDQGVL]HVWRHDFKKDYHWZREORZHUV
RQHEORZHUIRUVWDJHVDQGDQGRQHIRUVWDJHV
DQG ,IDEORZHUFKDQJHLVUHTXLUHGWXUQRIIWKH
YROWSRZHUDQGJDVVXSSO\WRWKHXQLW5HPRYH
WKHIURQWSDQHO'LVFRQQHFWWKHEORZHU VZLUHKDUQHVV
5HPRYHWKHVFUHZVDWWKHEORZHUÀDQJHDQGSXOOWKH
EORZHURXW5HSODFHEORZHULQUHYHUVHRUGHUHQVXULQJ
WKDWDOOMRLQWVDUHPDGHFRUUHFWO\$IWHUUHSODFHPHQW
ensure that the unit operates properly, by following the
VHWXSSURFHGXUHLQWKLVPDQXDO
9.B.11 Flow Switch
7KH&RSSHU%UXWHOOXVHVDSDGGOHW\SHÀRZ
VZLWFKWRHQVXUHWKDWWKHXQLWKDVZDWHUÀRZEHIRUH
LJQLWLRQLVDOORZHG
Page 77
9.B.12 Heat Exchanger Coil
WARNING
%ODFNFDUERQVRRWEXLOGXSRQDGLUW\KHDW
H[FKDQJHUFDQEHLJQLWHGE\DUDQGRPVSDUNRU
ÀDPHWKHUHE\FUHDWLQJDULVNRI¿UHRUH[SORVLRQ
7RSUHYHQWWKLVIURPKDSSHQLQJGDPSHQWKHVRRW
GHSRVLWVZLWKDZHWEUXVKRU¿QHZDWHUVSUD\EHIRUH
VHUYLFLQJWKHKHDWH[FKDQJHU
7KH&RSSHU%UXWHOOKDVDSUHPL[HGEXUQHU
V\VWHP7KHVHV\VWHPVSURYLGHWKHEXUQHUVZLWK
VXI¿FLHQWDLUIRUFRPSOHWHFRPEXVWLRQDQGEODFN
FDUERQVRRWLQJLVVHOGRPH[SHULHQFHG,IVRRWLQJ
is suspected, view ports for inspection of the heat
H[FKDQJHUDUHSURYLGHGRQERWKVLGHVRIWKHERLOHU
They are located below the headers, and are accessed
by opening the small round cover that is attached by
RQHVFUHZ,QWKHXQOLNHO\HYHQWWKDWWKHUHLVDEXLOGXS
of black carbon soot or other debris on the heat
H[FKDQJHUFOHDQSHUWKHIROORZLQJ
'LVFRQQHFWWKHHOHFWULFDOVXSSO\WRWKHXQLW
7XUQRIIWKHJDVVXSSO\E\FORVLQJWKHPDQXDOJDV
YDOYHRQWKHKHDWHU
'LVFRQQHFWDQGUHPRYHWKHZLUHVFRQGXLWDQG
sensors from all components that are attached to
WKHLQOHWRXWOHWKHDGHU
,VRODWHWKHKHDWH[FKDQJHUIURPWKHZDWHUVXSSO\
'LVFRQQHFWKHDGHUÀDQJHVIURPLQOHWDQGRXWOHW
$OORZWKHKHDWH[FKDQJHUWRGUDLQ5HPRYHWKH
front cover(s) by removing the rubber access
VWULS V DQGWKHUHWDLQLQJVFUHZV5HPRYHWKH
venting and remove the top, by removing the
VFUHZVWKDWDWWDFKWKHWRSWRWKHVLGHSDQHOV
5HPRYHWKHVLGHSDQHOV5HPRYHWKHIURQWORZHU
SDQHOVVHDOLQJWKHFRPEXVWLRQDUHD7RUHPRYH
the gas train, disconnect the unions located below
WKHLQWHUPHGLDWHSDQDQGWKH¿HOGLQVWDOOHGXQLRQ
located outside the cabinet, and pull up, bringing
the union end connectors through the grommets in
WKHLQWHUPHGLDWHSDQ7RUHPRYHWKHLQWHUPHGLDWH
pan, remove the slide out control assembly and
EORZHU V WRUHYHDOWKHVFUHZV5HPRYHWKHVFUHZV
holding the intermediate pan, and lift up to remove
LW7KHKHDWH[FKDQJHUKDVLQWHJUDOPHWDOVHFWLRQV
DWWDFKHGZKLFKFRQQHFWWRWKHIUDPHRIWKHERLOHU
Locate and remove the screws along the front,
rear and bottom of the integral metal sections, and
UHPRYHWKHKHDWH[FKDQJHUDQGPHWDOVHFWLRQVE\
OLIWLQJXS2QWKHODUJHUDSSOLDQFHVDFHQWHUKHDW
H[FKDQJHUVXSSRUWPXVWEHXQEROWHGEHIRUHLWFDQ
EHUHPRYHG
5HPRYHWKHKHDWH[FKDQJHUIURPWKHXQLW
NOTE:7KHKHDWH[FKDQJHUVDUHKHDY\DQGPD\
UHTXLUHWZRSHRSOHWRUHPRYHWRDYRLGSHUVRQDO
LQMXU\
Page 78
BRADFORD WHITE CORP.
SECTION 10 7URXEOH6KRRWLQJ
&OHDQWKHKHDWH[FKDQJHU$OLJKWDFFXPXODWLRQ
of soot or corrosion on the outside of the heat
H[FKDQJHUFDQEHHDVLO\UHPRYHG8VHDZLUH
brush to remove loose soot and scale from the heat
H[FKDQJHU'RQRWXVHZDWHURUFRPSUHVVHGDLUIRU
FOHDQLQJ
:KLOHWKHKHDWH[FKDQJHULVRXWRIWKHXQLWLQVSHFW
WKH¿UHZDOOUHIUDFWRU\LQVXODWLRQ5HSODFHLI
QHFHVVDU\
,QVSHFWWKHLQVLGHRIWKHFRSSHUWXEHVIRUVFDOH
EXLOGXS6FDOHFDQEXLOGXSRQWKHLQQHUVXUIDFHRI
WKHKHDWH[FKDQJHUWXEHVZKLFKFDQUHVWULFWZDWHU
ÀRZ,IWKHWXEHVVKRZVLJQVRIVFDOLQJFOHDQWKH
LQWHUQDOVXUIDFH%UDGIRUG:KLWHRIIHUVDWXEH
FOHDQLQJNLWSDUWQXPEHU5
5HDVVHPEOHLQWKHUHYHUVHRUGHUDQGFKHFN
DSSOLDQFHRSHUDWLRQDIWHUVWDUWXS
10.A 5HVROYLQJ/RFNRXWV
7KHUHDUHPDQ\FDXVHVRIORFNRXWV7KHWKUHHPRVW
FRPPRQFDXVHVDUH LQDGHTXDWHJDVVXSSO\ SRRU
FRPEXVWLRQ LJQLWRUIDLOXUH
7KH7URXEOHVKRRWLQJ(UURUV /RFNRXWVOLVWLVVKRZQ
RQ7DEOH)RQSDJH
,QDGHTXDWHJDVVXSSO\Before proceeding, ensure
WKDWWKHJDVVXSSO\KDVQRWEHHQVKXWRIIRUWKH/3
WDQN /3ERLOHUV LVQRWHPSW\
If your boiler is equipped with the optional gas
SUHVVXUHVZLWFKHVWKHQWKH/RZ3UHVVXUHVZLWFKPLJKW
KDYHWULSSHGDQGZLOOQHHGWREHUHVHW
127(7KH:DUUDQW\GRHVQRWFRYHUGDPDJH
FDXVHGE\ODFNRIUHTXLUHGPDLQWHQDQFHODFNRI
ZDWHUÀRZRULPSURSHURSHUDWLQJSUDFWLFHV
After resetting, restart the boiler and observe the
RSHUDWLRQDOF\FOH$IWHUDVHFRQGIDQSUHSXUJHWKH
LJQLWRUZLOOKHDWXSIRUVHFRQGVDQGWKHQWKHXQLW
ZLOOOLJKW,ILWGRHVQRWFKHFNWKHJDVVXSSO\SUHVVXUH
to the appliance, after resetting the appliance and
DWWHPSWLQJDQRWKHUVWDUWXS7KHJDVSUHVVXUHWRWKH
DSSOLDQFHPXVWEHDERYHZF N3D WKURXJKRXW
WKHHQWLUHVWDUWXSF\FOH,ILWLVQRWFRUUHFWWKHVXSSO\
SUREOHP FKHFNJDVYDOYHVRUVXSSO\SLSLQJ ,IWKH
supply pressure is adequate, consult the factory for
DVVLVWDQFH
3RRU&RPEXVWLRQ3RRUFRPEXVWLRQVKRXOGEH
VXVSHFWHGLIWKHUHLVDVWURQJÀXHJDVRGRU7KHRGRU
PD\UHVXOWIURPDQLPSURSHUJDVDLUUDWLR KLJKRU
ORZ2RU&2 &RSSHU%UXWHOODSSOLDQFHVRSHUDWH
EHVWZLWKH[FHVVDLU &2 on natural gas,
&2RQ/3 &KHFNWKH&2 of the appliance
DQGDGMXVWLIQHFHVVDU\
,JQLWRUIDLOXUHIf the boiler goes through a normal
start cycle but combustion does not occur, ignitor
IDLOXUHVKRXOGEHVXVSHFWHG&KHFNWKHLJQLWRUE\
unplugging the ignitor plug and measuring the
LJQLWRUUHVLVWDQFH,WVKRXOGEHRKPV,IWKH
UHVLVWDQFHLVQRWRKPVUHSODFHWKHLJQLWRU
If the resistance is correct, reset the boiler and
FKHFNIRU9$&DWWKHLJQLWRUSOXJGXULQJWKH
VWDUWF\FOH,IWKHUHLVQRYROWDJHUHSODFHWKHIDXOW\
LJQLWRUZLUHKDUQHVVRUWKHLJQLWLRQFRQWURO
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
10.B 'HOD\HG,JQLWLRQ²3RVVLEOH&DXVHV
$GHIHFWLYHEXUQHUFDQFDXVHDGHOD\HGLJQLWLRQ
If the gas supply pressure is proper and the gas
valves are functioning properly, then burners should
EHLQVSHFWHG7KHUHVKRXOGEHQRGLVWRUWLRQRU
perforations in the burners outside of the active burner
SRUWDUHD5HSODFHLILQGLFDWHG
10.C Short Cycling — Boiler
%HFDXVHWKH&RSSHU%UXWHOOLVDVWDJH¿UHGERLOHU
and its input will decrease when there is a reduction
LQKHDWLQJORDGVKRUWF\FOLQJLVJUHDWO\UHGXFHG,I
the heating load drops below the minimum input of
WKHERLOHUIRUDQH[WHQGHGSHULRGWKHERLOHUZLOOKDYH
DWHQGHQF\WRVKRUWF\FOH7KLVFDQEHDV\PSWRP
RILPSURSHUFRQWUROVWUDWHJ\RU6HW3RLQWVRUDORDG
GLVWULEXWLRQSUREOHP&RQWDFW\RXU%UDGIRUG:KLWH
UHSUHVHQWDWLYHWRGLVFXVVSRVVLEOHUHPHGLHV
10.D Short Cycling — Water Heater
6KRUWF\FOLQJZLOOJHQHUDOO\RFFXURQO\LQ
combination space heating and water heating
applications when the water heater is operating in the
VSDFHKHDWLQJPRGH%HFDXVHWKH&RSSHU%UXWHOOLVD
VWDJH¿UHGZDWHUKHDWHUDQGLWVLQSXWZLOOUHGXFHZKHQ
there is a reduction in heating load, short cycling is
JUHDWO\UHGXFHG,IWKHKHDWLQJORDGGURSVEHORZWKH
PLQLPXPLQSXWRIWKHZDWHUKHDWHUIRUDQH[WHQGHG
period, the water heater will have a tendency to short
F\FOH,IVKRUWF\FOLQJLVIUHTXHQWO\H[SHULHQFHG
regardless of the control’s attempt to limit it, the
KHDWLQJORDGVKRXOGEHUHGLVWULEXWHGWRFRQWUROLW
If short cycling occurs in a water heater
application, it is probably caused by undersized
piping between the water heater and the storage tank
or by some other factor that restricts proper water
ÀRZWKURXJKWKHZDWHUKHDWHU7KHFDXVHVKRXOGEH
GHWHUPLQHGDQGFRUUHFWHG
10.E +LJK*DV&RQVXPSWLRQ
Page 79
$SSOLDQFHVRSHUDWLQJZLWKDQLPSURSHUDLUIXHO
UDWLRDUHYHU\LQHI¿FLHQWDQGFRQVHTXHQWO\KDYH
YHU\KLJKJDVFRQVXPSWLRQ%HFDXVHHI¿FLHQF\LV
KLJKZKHQWKH&2LVKLJK RU2 is low), appliances
RSHUDWLQJZLWKORZ&2RUKLJK2 HVSHFLDOO\/3
DSSOLDQFHV FRQVXPHPRUHJDV$GMXVWWKH&2RU2
IRURSWLPXPHI¿FLHQF\,IQRFRPEXVWLRQDQDO\]LQJ
HTXLSPHQW &2RU2) is available then a proper
DGMXVWPHQWRIWKHDLUIXHOUDWLR &2RU2) cannot be
DFFRPSOLVKHG+RZHYHUE\EULHÀ\VQLI¿QJWKHÀXH
JDVHVLWLVSRVVLEOHWRGHWHUPLQHLIWKH&2RU2 is
ZLWKLQWKHSURSHUUDQJH1RVLJQL¿FDQWÀXHJDVRGRU
VKRXOGEHGHWHFWHGZKHQFRPEXVWLRQLVSURSHU$
strong piercing smell indicates poor combustion and
JHQHUDOO\DOHDQPL[WXUHORZ&2RUKLJK2 7KH
&2VKRXOGEHDWKLJK¿UH7RFKHFNWKH&2¿UVW
YHULI\WKDWWKHVXSSO\JDVSUHVVXUHLVZLWKLQWR
ZF WRN3D :LWKWKH&RSSHU%UXWHOOUXQQLQJ
ZLWKDOOVWDJHV¿ULQJVHWWKHDLUER[SUHVVXUHWR
ZF N3D DVDVWDUWLQJSRLQW E\DGMXVWLQJWKH
DLUVKXWWHU V DWWKHERWWRPRIWKHIDQ V &KHFNWKH
&2, and adjust the air shutters if further adjustment
WRWKH&2LVQHHGHG6L]HVWRKDYHWZR
EORZHUVDQGWZRDLUFKDPEHUV ER[HV 7KHSUHVVXUHRI
HDFKDLUER[PXVWEHHTXDOZKHQWKH¿QDODGMXVWPHQW
LVPDGH
BRADFORD WHITE CORP.
Page 80
10.F 7
URXEOHVKRRWLQJ
Errors & Lockouts
Error
)ORZ6ZLWFK
'HVFULSWLRQ
,QVXIILFLHQWIORZ at
WKHRXWOHWRIWKH
ERLOHUKHDWHU
/RZ:DWHU&XW
2II
,QVXIILFLHQWZDWHU
OHYHOLQWKH
ERLOHUKHDWHUheat
exchanger.
2XWOHWZDWHU
WHPSHUDWXUHKDV
exceeded the
PDQXDOUHVHWKLJK
OLPLWVHWWLQJ
2XWOHWZDWHU
WHPSHUDWXUHKDV
exceeded the auto
UHVHWKLJKOLPLW
VHWWLQJ
%ORFNHGIOXH VZLWFK
FRQWDFWVDUHRSHQ.
0DQ5HVHW+LJK
/LPLW
$XWR5HVHW+LJK
/LPLW
3UHVVXUH6ZLWFK
+LJK*DV
3UHVVXUH
/RZ*DV
3UHVVXUH
)LHOG,QWHUORFN
2XWOHW6HQVRU
2XWOHW6HQVRU
'ULIW
7KHKLJKJDV
SUHVVXUHVZLWFKKDV
tripped.
7KHORZJDV
SUHVVXUHVZLWFKKDV
tripped.
)LHOGLQWHUORFNLV
open.
2XWOHWSUREHLVnot
connected.
&RUUHFWLYH$FWLRQ
x )DXOW\ERLOHUKHDWHUSXPS± UHSODFHSXPS.
x )DXOW\SXPSFRQWDFWRU± replace contactor.
x %ORZQERLOHUKHDWHUSXPSIXVH± UHSODFHIXVH)RQWKHFRQWURO
ERDUG
x 5HVHWWKH/:&2IURPWKHUHVHWEXWWRQRQWKH/:&2PRGXOH
x 9HULI\WKHV\VWHPLVIXOORIZDWHUDQGDOODLUKDVEHHQSXUJHGIURPWKH
V\VWHP
x &KHFNIRUORRVHMXPSHUVLIWKH/:&2LVQRWLQVWDOOHG
x 9HULI\WKHV\VWHPLVIXOORIZDWHUDQGDOODLUKDVEHHQSXUJHGIURPWKH
V\VWHP
x 9HULI\WKHERLOHUKHDWHULVSLSHGSURSHUO\LQWRWKHKHDWLQJV\VWHP
x &KHFNIRUSURSHUSXPSRSHUDWLRQV
x &KHFNWKHPDQXDOUHVHWKLJKOLPLWVHWSRLQW
x 9HULI\WKHV\VWHPLVIXOORIZDWHUDQGDOODLUKDVEHHQSXUJHGIURPWhe
V\VWHP
x 9HULI\WKHERLOHUKHDWHULVSLSHGSURSHUO\LQWRWKHKHDWLQJV\VWHP
x &KHFNIRUSURSHUSXPSRSHUDWLRQV
x &KHFNWKHPDQXDOUHVHWKLJKOLPLWVHWSRLQW
x &KHFNWKHZLULQJFRQQHFWLRQVWRWKHVZLWFK7KHZLUHVVKRXOGEH
FRQQHFWHGWRWKHFRPPRQDQGQRUPDOO\RSHQWHUPLQDOV
x &KHFNUHIHUHQFHKRVHDQGWXELQJFRQQHFWHGWRWKHSUHVVXUHVZLWFK
IRUEORFNDJHREVWUXFWLRQ
x )DXOW\VZLWFK± UHSODFHVZLWFK
x 9HULI\EORZHULVRSHUDWLQJ± UHSODFHLIQHFHVVDU\
x %ORZQEORZHUIXVH± UHSODFHIXVH)RQWKHFRQWUROERDUGIRU
EORZHURUIXVH)IRUEORZHU
x 5HIHUWR6HFWLRQIRU*DV6XSSO\DQG3LSLQJLQIRUPDWLRQ
x 9HULI\VXSSO\DQGPDQLIROGJDVSUHVVXUHVVDWLVI\UHTXLUHPHQWVLQ
6HFWLRQ± FRUUHFWLIQHFHVVDU\
x 5HIHUWR6HFWLRQIRU*DV6XSSO\DQG3LSLQJLQIRUPDWLRQ
x 9HULI\VXSSO\DQGPDQLIROGJDVSUHVVXUHVVDWLVI\UHTXLUHPHQWVLQ
6HFWLRQ± FRUUHFWLIQHFHVVDU\
x &KHFNIRUORRVHRUPLVSODFHGMXPSHULIQRILHOGLQWHUORFNGHYLFHLV
LQVWDOOHG
x &KHFNWKHVHQVRUDQGZLULQJ5HSDLURUUHSODFHDVQHHGHG
x 7KHRXWOHWSUREHLVDGXDOHOHPHQWSUREHZLWK.DQG.
WKHUPLVWRUV$TXLFNWHVWLVWRPHDVXUHUHVLVWDQFHDQGYHULI\RQH
UHVLVWDQFHLVGRXEOHWKHRWKHU5HSODFHLIQHFHVVDU\
x 0HDVXUHWKHUHVLVWDQFHRIHDFKHOHPHQWRIWKHVHQVRUDQGFRPSDUH
WRWKHUHVLVWDQFHWDEOHEHORZ5HSODFHLIQHFHVVDU\
Dual HOHPHQWVHQVRU x
UHDGLQJVGRQRW
x
agree.
x
,QOHW6HQVRU
,QOHWVHQVRULV
GDPDJHGRUQRW
connected.
x
x
.
.
7HPS ƒ)
5HVLVWDQFH Ÿ
5HVLVWDQFH Ÿ
68
12555
25099
86
8025
16057
104
5279
10569
122
3563
7139
140
2463
4937
158
1739
3489
176
1253
2514
194
919
1845
212
685
1376
&KHFNWKHVHQVRUDQGZLULQJ5HSDLURUUHSODFHDVQHHGHG
7KHRXWOHWSUREHLVDGXDOHOHPHQWSUREHZLWK.DQG.
WKHUPLVWRUV$TXLFNWHVWLVWRPHDVXUHUHVLVWDQFHDQGYHULI\RQH
UHVLVWDQFHLVGRXEOHWKHRWKHU5HSODFHLIQHFHVVDU\
0HDVXUHWKHUHVLVWDQFHRIHDFKHOHPHQWRIWKHVHQVRUDQGFRPSDUH
WRWKHUHVLVWDQFHWDEOHEHORZ5HSODFHLIQHFHVVDU\
.
.
7HPS ƒ)
5HVLVWDQFH Ÿ
5HVLVWDQFH Ÿ
68
12555
25099
86
8025
16057
104
5279
10569
122
3563
7139
140
2463
4937
158
1739
3489
176
1253
2514
194
919
1845
212
685
1376
&KHFNWKHVHQVRUDQGZLULQJ5HSDLURUUHSODFHDVQHHGHG
0HDVXUH WKHUHVLVWDQFHRIWKHVHQVRUDQGFRPSDUHWRWKHUHVLVWDQFH
WDEOHEHORZ5HSODFHLIQHFHVVDU\
7HPS ƒ)
68
86
104
122
140
158
176
194
212
7DEOH 7URXEOHVKRRWLQJ(UURU&RGHV
7HPS ƒ&
20
30
40
50
60
70
80
90
100
5HVLVWDQFH
Ÿ
12555
8025
5279
3563
2463
1739
1253
919
685
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
(cont)
Error
%XUQHU$36
6ZLWFK
'HVFULSWLRQ
%XUQHUDLUSURYLQJ
VZLWFKFRQWDFWVDUH
open.
%XUQHU$36
6ZLWFK
%XUQHUDLUSURYLQJ
VZLWFKFRQWDFWVDUH
open.
NOTE: 1.25MM ±
2.002QO\
Burner1
3DUDVLWLF)ODPH
6HQVLQJIODPHRQ
EXUQHUSULRUWR
ignition.
Burner2
3DUDVLWLF)ODPH
6HQVLQJIODPHRQ
EXUQHUSULRUWR
ignition.
NOTE: 1.0MM ±
2.0MM 2QO\
7KHPD[LPXP
DWWHPSWVIRULJQLWLRQ
KDVRFFXUUHG
ZLWKRXWVHQVLQJ
IODPH
Burner1 Max
7ULDOV
Burner2 Max
7ULDOV
Burner1 Max
)ODPH/RVW
Burner2 Max
)ODPH/RVW
%XUQHU3URYHQ
+6,
7KHPD[LPXP
DWWHPSWVIRULJQLWLRQ
KDVRFFXUUHG
ZLWKRXWVHQVLQJ
IODPH
NOTE: 1.0MM ±
002QO\
7KHPD[LPXP
DOORZDEOH
RFFXUUHQFHVRIWKH
unit running and
ORVLQJIODPHVLJQDO
KDYHRFFXUUHG
7KHPD[LPXP
DOORZDEle
RFFXUUHQFHVRIWKH
unit running and
ORVLQJIODPHVLJQDO
KDYHRFFXUUHG
NOTE: 1.0MM ±
002QO\
%XUQHUSURYHQ+6,
IDLOHG
&RUUHFWLYH$FWLRQ
x &KHFNWKHZLULQJFRQQHFWLRQVWRWKHVZLWFK7KHZLUHVVKRXOGEH
FRQQHFWHGWRWKHFRPPRQDQGQRUPDOO\RSHQWHUPLQDOV
x &KHFNUHIHUHQFHKRVHDQGWXELQJFRQQHFWHGWRWKHSUHVVXUHVZLWFK
IRUEORFNDJHREVWUXFWLRQ
x )DXOW\VZLWFK± UHSODFHVZLWFK
x 9HULI\EORZHULVRSHUDWLQJ± UHSODFHLIQHFHVVDU\
x %ORZQEORZHUIXVH± UHSODFHIXVH)RQWKHFRQWUROERDUGIRU
EORZHU
x &KHFNWKHZLULQJFRQQHFWLRQVWRWKHVZLWFK7KHZLUHVVKRXOGEH
FRQQHFWHGWRWKHFRPPRQDQGQRUPDOO\RSHQWHUPLQDOV
x &KHFNUHIHUHQFHKRVHDQGWXELQJFRQQHFWHGWRWKHSUHVVXUHVZLWFK
IRUEORFNDJHREVWUXFWLRQ
x )DXOW\VZLWFK± UHSODFHVZLWFK
x 9HULI\ EORZHULVRSHUDWLQJ± UHSODFHLIQHFHVVDU\
x %ORZQEORZHUIXVH± UHSODFHIXVH)RQWKHFRQWUROERDUGIRU
EORZHU
x ,QVSHFW+6,DQGZLULQJIRUGDPDJHDQGFRQWLQXLW\5HSODFHLI
QHFHVVDU\.
x &KHFN+6,E\XQSOXJJLQJWKHLJQLWRUUHPRYHIURPWKHV\VWHPDQG
PHDVXUHUHVLVWDQFH,WVKRXOGEHEHWZHHQŸ ŸLILWLVQRWLQ
WKLVUDQJHUHSODFHWKH+6,
x ,QVSHFW+6,DQGZLULQJIRUGDPDJHDQGFRQWLQXLW\5HSODFHLI
QHFHVVDU\
x &KHFN+6,E\XQSOXJJLQJWKHLJQLWRUUHPRYHIURPWKHV\VWHPDQG
PHDVXUHUHVLVWDQFH,WVKRXOGEHEHWZHHQŸ ŸLILWLVQRWLQ
WKLVUDQJHUHSODFHWKH+6,
x 9HULI\VXSSO\DQGPDQLIROGJDVSUHVVXUHVVDWLVI\UHTXLUHPHQWVLQ
6HFWLRQ± FRUUHFWLIQHFHVVDU\
x 9HULI\WKHSURSHULQWDNHDQGYHQWLQJ
x ,QVSHFWWKHEXUQHU
x 'XULQJLJQLWLRQVHH6HFWLRQYHULI\9$&DWJDVYDOYHDVVRFLDWHG
ZLWKWKH+6,
x 9HULI\VXSSO\DQGPDQLIROGJDVSUHVVXUHVVDWLVI\UHTXLUHPHQWVLQ
6HFWLRQ± FRUUHFWLIQHFHVVDU\
x 9HULI\WKHSURSHULQWDNHDQGYHQWLQJ
x ,QVSHFWWKHEXUQHU
x 'XULQJLJQLWLRQVHH6HFWLRQYHULI\9$&DWJDVYDOYHDVVRFLDWHG
ZLWKWKH+6,
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
%XUQHU3URYHQ
+6,
%XUQHUSURYHQ+6,
IDLOHG
NOTE: 1.0MM ±
002QO\
x
x
x
x
x
,QVSHFW+6,and ZLULQJIRUGDPDJHDQGFRQWLQXLW\5HSODFHLI
QHFHVVDU\
&KHFN+6,E\XQSOXJJLQJWKHLJQLWRUUHPRYHIURPWKHV\VWHPDQG
PHDVXUHUHVLVWDQFH,WVKRXOGEHEHWZHHQŸ ŸLILWLVQRWLQ
WKLVUDQJHUHSODFH WKH+6,
9HULI\VXSSO\DQGPDQLIROGJDVSUHVVXUHVVDWLVI\UHTXLUHPHQWVLQ
6HFWLRQ± FRUUHFWLIQHFHVVDU\
9HULI\WKHSURSHULQWDNHDQGYHQWLQJ.
&KHFNFRPEXVWLRQ
,QVSHFWWKHEXUQHU
,QVSHFWWKHKHDWH[FKDQJHU
,QVSHFW+6,DQGZLULQJIRUGDPDJHDQGFRQWLQXLW\5HSODFHLI
QHFHVVDU\
&KHFN+6,E\XQSOXJJLQJWKHLJQLWRUUHPRYHIURPWKHV\VWHPDQG
PHDVXUHUHVLVWDQFH,WVKRXOGEHEHWZHHQŸ ŸLILWLVQRWLQ
WKLVUDQJHUHSODFHWKH+6,
9HULI\VXSSO\DQGPDQLIROGJDVSUHVVXUHVVDWLVI\UHTXLUHPHQWVLQ
6HFWLRQ± FRUUHFWLIQHFHVVDU\
9HULI\WKHSURSHULQWDNHDQGYHQWLQJ.
&KHFNFRPEXVWLRQ
,QVSHFWWKHEXUQHU
,QVSHFWWKHKHDWH[FKDQJHU
,QVSHFW+6,DQGZLULQJIRUGDPDJHDQGFRQWLQXLW\5HSODFHLI
QHFHVVDU\
&KHFN+6,E\XQSOXJJLQJWKH LJQLWRUUHPRYHIURPWKHV\VWHPDQG
PHDVXUHUHVLVWDQFH,WVKRXOGEHEHWZHHQŸ ŸLILWLVQRWLQ
WKLVUDQJHUHSODFHWKH+6,
'XULQJWKH+6,:DUPXSVWDJHRILJQLWLRQVHH6HFWLRQYHULI\
9$&DWWKH+6,
%ORZQ+6,IXVH± UHSODFHIXVH)RQWKHFRQWUROERDUGIRU+6,
,QVSHFW+6,DQGZLULQJIRUGDPDJHDQGFRQWLQXLW\5HSODFHLI
QHFHVVDU\
&KHFN+6,E\XQSOXJJLQJWKHLJQLWRUUHPRYHIURPWKHV\VWHPDQG
PHDVXUHUHVLVWDQFH,WVKRXOGEHEHWZHHQŸ ŸLILWLVQRWLQ
WKLVUDQJHUHSODFHWKH+6,
'XULQJWKH+6,:DUPXSVWDJHRILJQLWLRQVHH6HFWLRQYHULI\
9$&DWWKH+6,
%ORZQ+6,IXVH± UHSODFHIXVH)RQWKHFRQWUROERDUGIRU+6,
Page 81
BRADFORD WHITE CORP.
Page 82
Time & Date
+RXU
Minute
Month
Day
<HDU
CH1
&+(QDEOH'LVDEOH
&+6HWSRLQW
&+3ULRULW\
&+&RQWURO0RGH
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH'HOD\2Q7LPH
&+6WDJH'HOD\2II7LPH
&+0LQLPXP6WDJH2Q7LPH
&+0LQLPXP6WDJH2II7LPH
&+3,'2Q+\VWHUHVLV
&+3,'2II+\VWHUHVLV
&+3URSRUWLRQDO*DLQ
&+,QWHJUDO7LPH
&+'HULYDWLYH7LPH
CH2
&+(QDEOH'LVDEOH
&+6HWSRLQW
&+3ULRULW\
&+&RQWURO0RGH
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH2))+\VWHUHVLV
&+6WDJH21+\VWHUHVLV
&+6WDJH'HOD\2Q7LPH
&+6WDJH'HOD\2II7LPH
&+0LQLPXP6WDJH2Q7LPH
&+0LQLPXP6WDJH2II7LPH
&+3,'2Q+\VWHUHVLV
&+3,'2II+\VWHUHVLV
In
st
al
le
r
31&+Boiler
10.G.1
LQFOXGLQJ/RZ7HPS
,QFOXGLQJ/RZ7HPS
U
se
r
10.G 3DUDPHWHU7DEOHV
Minimum
x
x
x
x
x
x
x
x
x
x
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
'LVDEOH
120 F
1
PID
0F
0F
0F
0F
0F
0F
0F
0F
VHFV
VHFV
VHFV
VHFV
0F
0F
0
0
0
(QDEOH
240 F
97
7HPS'LIIHUHQWLDO
10 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
VHFV
VHFV
VHFV
VHFV
21 F
21 F
32767
32767
32767
(QDEOH
180 F
60
7HPS'LIIHUHQWLDO
5F
5F
5F
5F
5F
5F
5F
5F
VHFV
VHFV
VHFV
VHFV
10 F
10 F
250
100
0
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
'LVDEOH
120 F
1
PID
0F
0F
0F
0F
0F
0F
0F
0F
VHFV
VHFV
VHFV
VHFV
0F
0F
(QDEOH
240 F
97
7HPS'LIIHUHQWLDO
10 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
VHFV
VHFV
VHFV
VHFV
21 F
21 F
(QDEOH
170 F
50
7HPS'LIIHUHQWLDO
5F
5F
5F
5F
5F
5F
5F
5F
VHFV
VHFV
VHFV
VHFV
20 F
20 F
x
x
x
x
x
x
Maximum
Default
Page 83
Minimum
Maximum
Default
x
x
x
0
0
0
32767
32767
32767
250
100
0
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
'LVDEOH
120 F
1
PID
0F
0F
0F
0F
0F
0F
0F
0F
0F
0F
VHFV
VHFV
VHFV
VHFV
0F
0
0
0
(QDEOH
200 F
97
7HPS'LIIHUHQWLDO
21 F
21 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
VHFV
VHFV
VHFV
VHFV
72 F
32767
32767
32767
'LVDEOH
180 F
90
7HPS'LIIHUHQWLDO
10 F
10 F
5F
5F
5F
5F
5F
5F
5F
5F
VHFV
VHFV
VHFV
VHFV
18 F
250
100
0
x
x
x
x
x
'LVDEOH
0F
0F
120 F
120 F
(QDEOH
120 F
100 F
240 F
240 F
(QDEOH
65 F
0F
180 F
120 F
x
x
x
x
x
x
x
x
x
x
x
x
x
120 F
0F
0F
120 F
0F
0F
1
0
0
0
120 F
7
7
240 F
21 F
21 F
240 F
21 F
21 F
97
32767
32767
32767
240 F
180 F
10 F
10 F
180 F
10 F
10 F
70
250
10
0
180 F
/RVVRI/HDG6HWXS
x
'LVDEOH
Boiler Internal
6HWSRLQW5HGXQGDQW
Lead
Boiler Internal
6HWSRLQW
+\EULG
+\EULG(QDEOH'LVDEOH
x
'LVDEOH
(QDEOH
'LVDEOH
Boiler continued
&+3URSRUWLRQDO*DLQ
&+,QWHJUDO7LPH
&+'HULYDWLYH7LPH
DHW
'+:(QDEOH'LVDEOH
'+:6HWSRLQW
'+:3ULRULW\
'+:&RQWURO0RGH
'+:3,'2Q+\VWHUHVLV
'+:3,'2II+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH'HOD\2Q7LPH
'+:6WDJH'HOD\2II7LPH
'+:0LQLPXP6WDJH2Q7LPH
'+:0LQLPXP6WDJH2II7LPH
'+:2IIVHW
'+:3URSRUWLRQDO*DLQ
'+:,QWHJUDO7LPH
'+:'HULYDWLYH7LPH
Outdoor
2XWGRRU5HVHW(QDEOH'LVDEOH
0D[LPXP$PELHQW7HPSHUDWXUH
0LQLPXP$PELHQW7HPSHUDWXUH
0D[LPXP:DWHU7HPSHUDWXUH
0LQLPXP:DWHU7HPSHUDWXUH
Cascade CH
$GGUHVV
'\QDPLF$GGUHVV
/RVW/HDG%DFNXS6HWSRLQW
/DJ2Q+\VWHUHVLV
/DJ2II+\VWHUHVLV
&DVFDGH&+6HWSRLQW
&DVFDGH&+2Q+\VWHUHVLV
&DVFDGH&+2II+\VWHUHVLV
&DVFDGH&+3ULRULW\
&DVFDGH&+3URSRUWLRQDO*DLQ
&DVFDGH&+,QWHJUDO7LPH
&DVFDGH&+'HULYDWLYH7LPH
&DVFDGH&+0D[LPXP/DJ7HPSHUDWXUH
Cascade Redundancy
U
se
r
In
st
al
le
r
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
x
x
x
x
x
x
BRADFORD WHITE CORP.
Minimum
/DJ0RGH(QDEOH'LVDEOH
+\EULG6HWSRLQW
+\EULG'LIIHUHQWLDO7HPSHUDWXUH
+\EULG'HOD\7LPH
3XPS&RQILJXUDWLRQ
x
x
x
x
'LVDEOH
82 F
0F
PLQ
%RLOHU3XPS&RQWURO
x
Auto
%RLOHU3XPS3RVW&LUFXODWLRQ
'+:3XPS&RQWURO
'+:3XPS3RVW&LUFXODWLRQ
x
x
x
VHFV
',VDEOH
VHFV
6\VWHP3XPS&RQWURO
x
',VDEOH
$XWR$OZD\V2Q
2II'XULQJ'+:
Auto
6\VWHP3XPS3RVW&LUFXODWLRQ
7HPSHUDWXUH/LPLWV
$XWR5HVHW%RLOHU2XWOHW/LPLW
0DQXDO5HVHW%RLOHU2XWOHW/LPLW
5HVHW'LIIHUHQWLDO
6WDJH/LPLW+\VWHUHVLV
External Control
x
VHFV
VHFV
VHFV
x
x
x
x
100 F
100 F
1F
0F
240 F
240 F
10 F
10 F
195 F
210 F
5F
2F
Control Mode
x
'LVDEOH
([WHQDO6HWSRLQW
Firing Rate
'LVDEOH
External Control Priority
0D[LPXP6HWSRLQW
0LQLPXP6HWSRLQW
0D[LPXP)LULQJ5DWH
0LQLPXP)LULQJ5DWH
'HPDQG0D[
'HPDQG0LQ
'HPDQG2Q
'HPDQG2II
Anti- Frost
x
x
x
x
x
x
x
x
x
1
120 F
120 F
0
0
97
240 F
240 F
10000
10000
20
180 F
120 F
10000
0
$QWL)URVW0RGH
x
'LVDEOH
3XPS2QO\3XPS Burner
3XPS2QO\
$QWL)URVW6HWSRLQW
$QWL)URVW+\VWHUHVLV
x
x
32 F
3F
120 F
10 F
40 F
5F
$QWL)URVW3XPS&RQWURO
x
1$
%RLOHU'+:
6\VWHP
Boiler
Warm Weather Shutdown
7HPSHUDWXUH0LQLPXP
7HPSHUDWXUH0D[LPXP
x
x
50 F
50 F
140 F
140 F
90 F
95 F
6KXWGRZQ
,PPHGLDWHO\
Boiler continued
U
se
r
In
st
al
le
r
Page 84
Maximum
Default
(QDEOH
181 F
21 F
PLQ
'LVDEOH
130 F
10 F
PLQ
$XWR$OZD\V2Q
2II'XULQJ'+:
VHFV
$XWR$OZD\V2Q
VHFV
Auto
VHFV
Auto
VHFV
)HDWXUH2SWLRQV
x
'LVDEOH
6KXWGRZQ
,PPHGLDWHO\
6KXWGRZQ$IWHU
'HPDQGLV6DWLVILHG
6XPPHU.LFN&+
6XPPHU.LFN'+:
6XPPHU.LFN6\VWHP
6XPPHU.LFN3HULRG
Anti- Short Cycle Time
&\FOH7LPH
7HPSHUDWXUH&RQYHUVLRQ
&RQYHUVLRQ8QLW
x
x
x
x
VHFV
VHFV
VHFV
PLQ
VHFV
VHFV
VHFV
PLQ
VHFV
VHFV
VHFV
PLQ
x
VHFV
VHFV
VHFV
x
&HOVLXV
Fahrenheit
Fahrenheit
x
Page 85
In
st
al
le
r
Boiler continued
U
se
r
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Minimum
BACnet
x
9600
Baudrate
x
0
$GGUHVV
1$
x
'HYLFH0RGHO1DPH
1$
x
'HYLFH2EMHFW1DPH
x
0
2EMHFW,QVWDQFH
x
VHFV
7LPHRXW
0L[LQJ9DOYH$QWL&RQGHQVLQJ /RZ7HPS0RGHOV21/<
0L[LQJ9DOYH$QWL&RQGHQVLQJ
x
'LVDEOH
(QDEOH'LVDEOH
0L[LQJ9DOYH$QWL&RQGHQVLQJ
x
120 F
7HPSHUDWXUH6HWSRLQW
0L[LQJ9DOYH$QWL&RQGHQVLQJ
x
0
Proportional Gain
0L[LQJ9DOYH$QWL&RQGHQVLQJ,QWHJUDO
x
0
7,PH
0L[LQJ9DOYH$QWL&RQGHQVLQJ'HULYDWLYH
x
0
7LPH
&RQGHQVLQJ$ODUP6HWSRLQW
0LQLPXP9ROWDJH2XWSXW
0D[LPXP9ROWDJH2XWSXW
&RQGHQVLQJ$ODUP'HOD\
&RQGHQVLQJ6KXWGRZQ'HOD\
6HUYLFH
6WDJH%XUQHU(QDEOH'LVDEOH
6WDJH%XUQHU(QDEOH'LVDEOH
6WDJH%XUQHU(QDEOH'LVDEOH
$SSOLFDEOHWR0000RQO\
6WDJH%XUQHU(QDEOH'LVDEOH
$SSOLFDEOHWR0000RQO\
Screen Settings
/LJKW7LPHRXW
$XWR/RFN7LPHRXW
x
x
Maximum
Default
76800
255
1$
1$
4194303
VHFV
76800
127
1$
1$
600000
VHFV
(QDEOH
(QDEOH
180 F
120 F
32767
250
32767
15
32767
0
x
x
x
x
x
100 F
P9
P9
PLQV
PLQV
120 F
P9
P9
PLQV
PLQV
110 F
P9
P9
PLQV
PLQV
x
x
'LVDEOH
'LVDEOH
(QDEOH
(QDEOH
(QDEOH
(QDEOH
x
'LVDEOH
(QDEOH
(QDEOH
x
'LVDEOH
(QDEOH
(QDEOH
x
x
VHFV
VHFV
VHFV
VHFV
VHFV
VHFV
BRADFORD WHITE CORP.
Time & Date
+RXU
Minute
Month
Day
<HDU
DHW1
'+:(QDEOH'LVDEOH
'+:6HWSRLQW
'+:3ULRULW\
'+:&RQWURO0RGH
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH'HOD\2Q7LPH
'+:6WDJH'HOD\2II7LPH
'+:0LQLPXP6WDJH2Q7LPH
'+:0LQLPXP6WDJH2II7LPH
'+:3,'2Q+\VWHUHVLV
'+:3,'2II+\VWHUHVLV
'+:3URSRUWLRQDO*DLQ
'+:,QWHJUDO7LPH
'+:'HULYDWLYH7LPH
DHW2
'+:(QDEOH'LVDEOH
'+:6HWSRLQW
'+:3ULRULW\
'+:&RQWURO0RGH
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH'HOD\2Q7LPH
In
st
al
le
r
10.G.2 +HDWHU LQFOXGLQJ/RZ7HPS
31&9
,QFOXGLQJ/RZ7HPS
U
se
r
Page 86
Minimum
x
x
x
x
x
x
x
x
x
x
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
1$
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
'LVDEOH
120 F
1
PID
0F
0F
0F
0F
0F
0F
0F
0F
VHFV
VHFV
VHFV
VHFV
0F
0F
0
0
0
(QDEOH
200 F
97
7HPS'LIIHUHQWLDO
10 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
VHFV
VHFV
VHFV
VHFV
21 F
21 F
32767
32767
32767
(QDEOH
140 F
60
7HPS'LIIHUHQWLDO
5F
5F
5F
5F
5F
5F
5F
5F
VHFV
VHFV
VHFV
VHFV
10 F
10 F
250
100
0
x
x
x
x
x
x
x
x
x
x
x
x
x
'LVDEOH
120 F
1
PID
0F
0F
0F
0F
0F
0F
0F
0F
VHFV
(QDEOH
200 F
97
7HPS'LIIHUHQWLDO
10 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
VHFV
(QDEOH
130 F
50
7HPS'LIIHUHQWLDO
5F
5F
5F
5F
5F
5F
5F
5F
VHFV
x
x
x
x
Maximum
Default
Page 87
In
st
al
le
r
Heater continued
U
se
r
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
'+:6WDJH'HOD\2II7LPH
'+:0LQLPXP6WDJH2Q7LPH
'+:0LQLPXP6WDJH2II7LPH
'+:3,'2Q+\VWHUHVLV
x
'+:3,'2II+\VWHUHVLV
x
'+:3URSRUWLRQDO*DLQ
'+:,QWHJUDO7LPH
'+:'HULYDWLYH7LPH
DHW3
x
'+:(QDEOH'LVDEOH
x
'+:6HWSRLQW
'+:3ULRULW\
'+:&RQWURO0RGH
x
'+:3,'2Q+\VWHUHVLV
x
'+:3,'2II+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH2))+\VWHUHVLV
'+:6WDJH21+\VWHUHVLV
'+:6WDJH'HOD\2Q7LPH
'+:6WDJH'HOD\2II7LPH
'+:0LQLPXP6WDJH2Q7LPH
'+:0LQLPXP6WDJH2II7LPH
'+:2IIVHW
'+:3URSRUWLRQDO*DLQ
'+:,QWHJUDO7LPH
'+:'HULYDWLYH7LPH
2XWGRRU 127$YDLODEOHRQ9ROXPH:DWHU8QLWV
&DVFDGH&+ 127$YDLODEOHRQ9ROXPH:DWHU8QLWV
Cascade DHW
$GGUHVV
'\QDPLF$GGUHVV
/RVW/HDG%DFNXS6HWSRLQW
/DJ2Q+\VWHUHVLV
/DJ2II+\VWHUHVLV
x
&DVFDGH'+:6HWSRLQW
&DVFDGH'+:2Q+\VWHUHVLV
&DVFDGH'+:2II+\VWHUHVLV
&DVFDGH'+:3ULRULW\
&DVFDGH'+:3URSRUWLRQDO*DLQ
&DVFDGH'+:,QWHJUDO7LPH
&DVFDGH'+:'HULYDWLYH7LPH
&DVFDGH'+:0D[LPXP/DJ7HPSHUDWXUH
Minimum
Maximum
Default
x
x
x
x
x
x
x
x
VHFV
VHFV
VHFV
0F
0F
0
0
0
VHFV
VHFV
VHFV
21 F
21 F
32767
32767
32767
VHFV
VHFV
VHFV
20 F
20 F
250
100
0
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
x
'LVDEOH
120 F
1
PID
0F
0F
0F
0F
0F
0F
0F
0F
0F
0F
VHFV
VHFV
VHFV
VHFV
0F
0
0
0
(QDEOH
200 F
97
7HPS'LIIHUHQWLDO
21 F
21 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
10 F
VHFV
VHFV
VHFV
VHFV
72 F
32767
32767
32767
(QDEOH
120 F
90
7HPS'LIIHUHQWLDO
10 F
10 F
5F
5F
5F
5F
5F
5F
5F
5F
VHFV
VHFV
VHFV
VHFV
18 F
250
100
0
x
x
x
x
x
x
x
x
x
x
x
x
x
120 F
0F
0F
120 F
0F
0F
1
0
0
0
120 F
7
7
200 F
21 F
21 F
200 F
21 F
21 F
97
32767
32767
32767
200 F
140 F
10 F
10 F
140 F
10 F
10 F
80
250
10
0
140 F
BRADFORD WHITE CORP.
Page 88
Heater continued
Cascade Redundancy
/RVVRI/HDG6HWXS
x
'LVDEOH
Boiler Internal
6HWSRLQW
Redundant Lead
%RLOHU,QWHUQDO6HW
point
+\EULG
+\EULG(QDEOH'LVDEOH
/DJ0RGH(QDEOH'LVDEOH
+\EULG6HWSRLQW
+\EULG'LIIHUHQWLDO7HPSHUDWXUH
+\EULG'HOD\7LPH
3XPS&RQILJXUDWLRQ
x
x
x
x
x
'LVDEOH
'LVDEOH
82 F
0F
PLQ
(QDEOH
(QDEOH
181 F
21 F
PLQ
'LVDEOH
'LVDEOH
130 F
10 F
PLQ
%RLOHU3XPS&RQWURO
x
Auto
$XWR$OZD\V2Q
2II'XULQJ'+:
Auto
%RLOHU3XPS3RVW&LUFXODWLRQ
'+:3XPS&RQWURO
'+:3XPS3RVW&LUFXODWLRQ
x
x
x
',VDEOH
VHFV
VHFV
$XWR$OZD\V2Q
VHFV
VHFV
Auto
VHFV
6\VWHP3XPS&RQWURO
x
',VDEOH
$XWR$OZD\V2Q
2II'XULQJ'+:
Auto
6\VWHP3XPS3RVW&LUFXODWLRQ
9DULSULPH 1RW$YDLODEOHRQ9ROXPH:DWHU8QLWV
7HPSHUDWXUH/LPLWV
$XWR5HVHW%RLOHU2XWOHW/LPLW
0DQXDO5HVHW%RLOHU2XWOHW/LPLW
5HVHW'LIIHUHQWLDO
6WDJH/LPLW+\VWHUHVLV
External Control
x
VHFV
VHFV
VHFV
x
x
x
x
100 F
100 F
1F
0F
200 F
200 F
10 F
10 F
180 F
190 F
5F
2F
Control Mode
x
'LVDEOH
([WHQDO6HWSRLQW
Firing Rate
'LVDEOH
External Control Priority
0D[LPXP6HWSRLQW
0LQLPXP6HWSRLQW
0D[LPXP)LULQJ5DWH
0LQLPXP)LULQJ5DWH
'HPDQG0D[
'HPDQG0LQ
'HPDQG2Q
'HPDQG2II
Anti- Frost
x
x
x
x
x
x
x
x
x
1
120 F
120 F
0
0
97
200 F
200 F
10000
10000
20
140 F
120 F
10000
0
$QWL)URVW0RGH
x
'LVDEOH
3XPS2QO\3XPS
& Burner
3XPS2QO\
$QWL)URVW6HWSRLQW
$QWL)URVW+\VWHUHVLV
x
x
32 F
3F
120 F
10 F
40 F
5F
$QWL)URVW3XPS&RQWURO
x
1$
%RLOHU'+:
6\VWHP
Boiler
:DUP:HDWKHU6KXWGRZQ 127$YDLODEOHRQ9ROXPH:DWHU8QLWV
Anti- Short Cycle Time
Page 89
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Heater continued
VHFV
VHFV
VHFV
&HOVLXV
Fahrenheit
Fahrenheit
9600
0
1$
1$
0
VHFV
76800
255
1$
1$
4194303
VHFV
76800
127
1$
1$
600000
VHFV
'LVDEOH
(QDEOH
(QDEOH
120 F
180 F
120 F
0
32767
250
x
0
32767
15
x
0
32767
0
x
x
x
x
x
100 F
P9
P9
PLQV
PLQV
120 F
P9
P9
PLQV
PLQV
110 F
P9
P9
PLQV
PLQV
x
x
'LVDEOH
'LVDEOH
(QDEOH
(QDEOH
(QDEOH
(QDEOH
x
'LVDEOH
(QDEOH
(QDEOH
x
'LVDEOH
(QDEOH
(QDEOH
x
x
VHFV
VHFV
VHFV
VHFV
VHFV
VHFV
x
&\FOH7LPH
7HPSHUDWXUH&RQYHUVLRQ
&RQYHUVLRQ8QLW
x
x
BACnet
x
Baudrate
x
$GGUHVV
x
'HYLFH0RGHO1DPH
x
'HYLFH2EMHFW1DPH
x
2EMHFW,QVWDQFH
x
7LPHRXW
0L[LQJ9DOYH$QWL&RQGHQVLQJ /RZ7HPS0RGHOV21/<
0L[LQJ9DOYH$QWL&RQGHQVLQJ
x
(QDEOH'LVDEOH
0L[LQJ9DOYH$QWL&RQGHQVLQJ7HPSHUDWXUH
x
6HWSRLQW
0L[LQJ9DOYH$QWL&RQGHQVLQJ3URSRUWLRQDO
x
Gain
0L[LQJ9DOYH$QWL&RQGHQVLQJ,QWHJUDO7,PH
0L[LQJ9DOYH$QWL&RQGHQVLQJ'HULYDWLYH
7LPH
&RQGHQVLQJ$ODUP6HWSRLQW
0LQLPXP9ROWDJH2XWSXW
0D[LPXP9ROWDJH2XWSXW
&RQGHQVLQJ$ODUP'HOD\
&RQGHQVLQJ6KXWGRZQ'HOD\
6HUYLFH
6WDJH%XUQHU(QDEOH'LVDEOH
6WDJH%XUQHU(QDEOH'LVDEOH
6WDJH%XUQHU(QDEOH'LVDEOH
$SSOLFDEOHWR0000RQO\
6WDJH%XUQHU(QDEOH'LVDEOH
$SSOLFDEOHWR0000RQO\
Screen Settings
/LJKW7LPHRXW
$XWR/RFN7LPHRXW
x
x
BRADFORD WHITE CORP.
Page 90
10.G.3 0RGEXV0HPRU\0DS
MODBUS
Address
0
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
7\SH
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
18
BitField
19
BitField
20
6
Bit
Read/Write
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E«E 5HDG2QO\
E
5HDG2QO\
E
5HDG2QO\
E«E 5HDG2QO\
5HDG2QO\
23
24
25
26
27
28
6
6
6
6
6
6
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
5HDG2QO\
29
6
5HDG2QO\
21
22
BitField
BitField
E
E
E
E
E
E
E
E
E
E«E
E
E
E
E
E
E
EE
Value
,QOHW7HPS
2XWOHW7HPS
1RWXVHG
'+:7HPS
6\VWHP,QOHW7HPS
6\VWHP2XWOHW7HPS
2XWGRRU7HPS
$X[7HPS
$X[7HPS
$X[7HPS
$X[7HPS
$X[7HPS
)ODPH6LJQDO
)ODPH6LJQDO
Analog Input 1
Analog Input 2
Analog Input 3
Analog Input 4
)ORZ6ZLWFK
/RZ:DWHU&XW2II
0DQ5HVHW+LJK/LPLW
3UHVVXUH6ZLWFK
+LJK*DV3UHVVXUH6ZLWFK
/RZ*DV3UHVVXUH6ZLWFK
)LHOG,QWHUORFN6ZLFWK
6SDUH6DIHW\&KDLQ6ZLFWK
1RWXVHG
'DPSHU,QWHUORFN6ZLFWK
6SDUH6ZLFWK
1RWXVHG
&XUUHQW'HPDQG6RXUFH
!1R'HPDQG
!$QWL6KRUW&\FOH
!6HUYLFH
!'+:
!6ODYH&DVFDGH
!([WHUQDO
!&+
!&+
!&+
!&+
! $QWLIURVW
Boiler Run Contact
$ODUDP&RQWDFW
'+:3XPS
6\VWHP3XPS
/RXYHU&RQWDFW
6SDUH&RQWDFW
6SDUH&RQWDFW
%RLOHU3XPS
6SDUH2XWSXW
1RWXVHG
1RWXVHG
9DOYH6WDJH
9DOYH6WDJH
1RWXVHG
9DOYH6WDJH
9DOYH6WDJH
1RWXVHG
$QDORJ2XWSXW
$QDORJ2XWSXW
$QDORJ2XWSXW
$QDORJ2XWSXW
1RWXVHG
1RWXVHG
%ORZHU6SHHG
!2II
!/RZ
! +LJK
MODBUS
Address
7\SH
30
6
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
6
6
6
6
6
6
6
8
8
8
8
8
8
8
8
8
8
8
8
8
6
6
6
8
8
8
8
8
8
8
8
8
6
64
6
65
8
66
8
67
8
68
8
69
8
70
8
71
8
72
8
Bit
Read/Write Value
%ORZHU6SHHG
5HDG2QO\ !2II
!/RZ
! +LJK
5HDG2QO\ +6,&XUUHQW
5HDG2QO\ +6,&XUUHQW
5HDG2QO\ %XUQHU3RZHU5DWLQJ
5HDG2QO\ %XUQHU3RZHU5DWLQJ
5HDG2QO\ /RFNRXW&RGH
5HDG2QO\ %ORFNLQJ&RGH
5HDG2QO\ 1RWXVHG
5HDG2QO\ '+:&DOO)RU+HDW
5HDG2QO\ &+&DOO)RU+HDW
5HDG2QO\ &+&DOO)RU+HDW
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ &DVFDGH&DOO)RU+HDW
5HDG2QO\ 9DOYH6WDJH&\FOHV
5HDG2QO\ 9DOYH6WDJH&\FOHV
5HDG2QO\ 9DOYH6WDJH&\FOHV
5HDG2QO\ 9DOYH6WDJH&\FOHV
5HDG2QO\ %RLOHU3XPS&\FOHV
5HDG2QO\ '+:3XPS&\FOHV
5HDG2QO\ 6\VWHP3XPS&\FOFHV
5HDG2QO\ $YHUDJH2XWOHW7HPS
5HDG2QO\ 0D[2XWOHW7HPS
5HDG2QO\ 0LQ2XWOHW7HPS
5HDG2QO\ $YHUDJH)LULQJ7LPH
5HDG2QO\ 0D[)LULQJ7LPH
5HDG2QO\ 0LQ)LULQJ7LPH
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
0RGXODWLRQ6HQVRU
!1RQH
!2XWOHW
5HDG2QO\ !'+:
!6\VWHP
!,QOHW
!)OXH
! 6\V UHWXUQ
5HDG2QO\ $FWLYDWH6HUYLFH
6ODYH6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
5HDG2QO\ 6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
5HDG2QO\ 6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
5HDG2QO\ 6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
Page 91
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
MODBUS
Address
7\SH
73
8
74
8
75
8
76
8
77
8
78
8
79
8
80
8
81
82
83
84
85
86
87
88
89
90
91
92
«
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
8
6
8
8
8
8
8
8
8
8
8
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
6
Bit
Read/Write Value
5HDG2QO\ 6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
5HDG2QO\ 6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
5HDG2QO\ 6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
5HDG2QO\ 6ODYH)LULQJ5DWH
0DVWHU6WDWH
!1RW3UHVHQW
5HDG2QO\ !1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
5HDG2QO\ 0DVWHU)LULQJ5DWH
5HDG2QO\ 1RWXVHG
5HDG2QO\ $FWLYH&+6HWSRLQW
5HDG2QO\ %XUQHU6WDWXV
5HDG2QO\ %XUQHU6WDWXV
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
5HDG2QO\ %RLOHU3XPS6WDWXV
5HDG2QO\ 0DVWHU'HPDQG
5HDG2QO\ %XUQHU5XQ7LPH
5HDG2QO\ %XUQHU5XQ7LPH
5HDG2QO\ 1RWXVHG
5HDG2QO\ 1RWXVHG
Read/Write &+(QDEOH'LVDEOH
Read/Write &+6HWSRLQW
Read/Write &+3
Read/Write &+,
Read/Write &+'
Read/Write &+(QDEOH'LVDEOH
Read/Write &+6HWSRLQW
Read/Write &+3
Read/Write &+,
Read/Write &+'
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write '+:(QDEOH'LVDEOH
Read/Write '+:6HWSRLQW
Read/Write '+:3
Read/Write '+:,
Read/Write '+:'
Read/Write 1RWXVHG
Read/Write 1RWXVHG
Read/Write &DVFDGH6HWSRLQW
Read/Write &DVFDGH3
MODBUS
Address
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
7\SH
6
6
6
6
6
6
6
6
6
6
6
6
8
6
6
6
6
6
6
6
6
6
6
Bit
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Read/Write
Value
&DVFDGH,
&DVFDGH'
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
+\EULG6HWSRLQW
+\EULG'LIIHUHQWLDO7HPS
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
$QWL&RQGHQV(QDEOH
$QWL&RQGHQV7HPS
$QWL&RQGHQV3
$QWL&RQGHQV,
$QWL&RQGHQV'
'+:GHPDQG
&+GHPDQG
&+GHPDQG
1RWXVHG
1RWXVHG
3DUDPHWHUVHQDEOH
BRADFORD WHITE CORP.
Page 92
10.G.4 %$&QHW06730HPRU\0DS
BacNet
Address
BacNet
7\SH
0
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
18
AI
19
AI
20
AI
21
22
AI
AI
23
24
25
26
27
28
AI
AI
AI
AI
AI
AI
29
AI
30
AI
Bit
Value
,QOHW7HPS
2XWOHW7HPS
1RWXVHG
'+:7HPS
6\VWHP,QOHW7HPS
6\VWHP2XWOHW7HPS
2XWGRRU7HPS
$X[7HPS
$X[7HPS
$X[7HPS
$X[7HPS
$X[7HPS
)ODPH6LJQDO
)ODPH6LJQDO
Analog Input 1
Analog Input 2
Analog Input 3
Analog Input 4
E
)ORZ6ZLWFK
E
/RZ:DWHU&XW2II
E
0DQ5HVHW+LJK/LPLW
E
3UHVVXUH6ZLWFK
E
+LJK*DV3UHVVXUH6ZLWFK
E
/RZ*DV3UHVVXUH6ZLWFK
E
)LHOG,QWHUORFN6ZLFWK
E
6SDUH6DIHW\&KDLQ6ZLFWK
E«E 1RWXVHG
E
'DPSHU,QWHUORFN6ZLFWK
E
6SDUH6ZLFWK
E«E 1RWXVHG
&XUUHQW'HPDQG6RXUFH
!1R'HPDQG
!$QWL6KRUW&\FOH
!6HUYLFH
!'+:
!6ODYH&DVFDGH
!([WHUQDO
!&+
!&+
!&+
!&+
! $QWLIURVW
E
Boiler Run Contact
E
$ODUDP&RQWDFW
E
'+:3XPS
E
6\VWHP3XPS
E
/RXYHU&RQWDFW
E
6SDUH&RQWDFW
E
6SDUH&RQWDFW
E
%RLOHU3XPS
E
6SDUH2XWSXW
E«E 1RWXVHG
E
1RWXVHG
E
9DOYH6WDJH
E
9DOYH6WDJH
E
1RWXVHG
E
9DOYH6WDJH
E
9DOYH6WDJH
EE 1RWXVHG
$QDORJ2XWSXW
$QDORJ2XWSXW
$QDORJ2XWSXW
$QDORJ2XWSXW
1RWXVHG
1RWXVHG
%ORZHU6SHHG
!2II
!/RZ
! +LJK
%ORZHU6SHHG
!2II
!/RZ
! +LJK
Unit
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[uA]
[uA]
>PY@
>PY@
>PY@
>PY@
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
ELW
>P9@
>P9@
>P9@
>P9@
>USP@
>USP@
BacNet
Address
BacNet
7\SH
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
64
AI
65
AI
66
AI
67
AI
68
AI
69
AI
70
AI
71
AI
72
AI
73
AI
74
AI
Bit
Value
Unit
+6,&XUUHQW
+6,&XUUHQW
%XUQHU3RZHU5DWLQJ
%XUQHU3RZHU5DWLQJ
/RFNRXW&RGH
%ORFNLQJ&RGH
1RWXVHG
'+:&DOO)RU+HDW
&+&DOO)RU+HDW
&+&DOO)RU+HDW
1RWXVHG
1RWXVHG
&DVFDGH&DOO)RU+HDW
9DOYH6WDJH&\FOHV
9DOYH6WDJH&\FOHV
9DOYH6WDJH&\FOHV
9DOYH6WDJH&\FOHV
%RLOHU3XPS&\FOHV
'+:3XPS&\FOHV
6\VWHP3XPS&\FOFHV
$YHUDJH2XWOHW7HPS
0D[2XWOHW7HPS
0LQ2XWOHW7HPS
$YHUDJH)LULQJ7LPH
0D[)LULQJ7LPH
0LQ)LULQJ7LPH
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
0RGXODWLRQ6HQVRU
!1RQH
!2XWOHW
!'+:
!6\VWHP
!,QOHW
!)OXH
! 6\V UHWXUQ
$FWLYDWH6HUYLFH
6ODYH6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
>P$@
>P$@
>@
>@
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
>F\FOHV
[C]/[F]
[C]/[F]
[C]/[F]
[h]
[h]
[h]
@
@
@
@
@
@
@
@
@
@
@
@
@
Page 93
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
BacNet
Address
BacNet
7\SH
75
AI
76
AI
77
AI
78
AI
79
AI
80
AI
81
82
83
84
85
86
87
88
89
90
91
92
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
AI
0
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
AV
Bit
Value
6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
6ODYH)LULQJ5DWH
6ODYH6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
6ODYH)LULQJ5DWH
0DVWHU6WDWH
!1RW3UHVHQW
!1RW$YDLODEOH
!$YDLODEOH
!5XQQLQJ
! /RFNHG 2XW
0DVWHU)LULQJ5DWH
1RWXVHG
$FWLYH&+6HWSRLQW
%XUQHU6WDWXV
%XUQHU6WDWXV
1RWXVHG
1RWXVHG
1RWXVHG
%RLOHU3XPS6WDWXV
0DVWHU'HPDQG
%XUQHU5XQ7LPH
%XUQHU5XQ7LPH
1RWXVHG
1RWXVHG
&+(QDEOH'LVDEOH
&+6HWSRLQW
&+3
&+,
&+'
&+(QDEOH'LVDEOH
&+6HWSRLQW
&+3
&+,
&+'
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
'+:(QDEOH'LVDEOH
'+:6HWSRLQW
'+:3
'+:,
'+:'
1RWXVHG
1RWXVHG
&DVFDGH6HWSRLQW
&DVFDGH3
&DVFDGH,
&DVFDGH'
1RWXVHG
1RWXVHG
1RWXVHG
1RWXVHG
+\EULG6HWSRLQW
+\EULG'LIIHUHQWLDO7HPS
1RWXVHG
Unit
[h]
[h]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
[C]/[F]
BacNet
Address
BacNet
7\SH
38
39
40
41
42
43
44
45
0
1
2
3
4
AV
AV
AV
AV
AV
AV
AV
AV
BV
BV
BV
BV
BV
Bit
Value
1RWXVHG
1RWXVHG
1RWXVHG
$QWL&RQGHQV(QDEOH
$QWL&RQGHQV7HPS
$QWL&RQGHQV3
$QWL&RQGHQV,
$QWL&RQGHQV'
'+:GHPDQG
&+GHPDQG
&+GHPDQG
1RWXVHG
1RWXVHG
Unit
[C]/[F]
[C]/[F]
3DQHO-DFNHW5HDU)LOWHU(QFORVXUH
3DQHO-DFNHW7RS
3DQHO-DFNHW7RS/HIW
3DQHO-DFNHW7RS5LJKW
$OFRYH$VVHPEO\ WRXFKVFUHHQDQGSDQHO 7RXFKVFUHHQ
3ODWH*DV3LSH6HDO
3ODWH&RYHU:LULQJ
3ODWH9HQW
&RYHU9HQW3ODWH
3ODWH&RYHU)LOWHU
&ROODU9HQW
Air Filter
$
$
16
3XPS+RXVLQJ&RYHU
3DQHO-DFNHW5HDU
'
3DQHO-DFNHW)URQW5LJKW
7ULP-DFNHW)URQW
3DQHO-DFNHW)URQW/HIW
3XPS+RXVLQJ5LJKW6LGH
3XPS+RXVLQJ/HIW6LGH
3DQHO-DFNHW)URQW
%
&
3DQHO-DFNHW6LGH5LJKW
$
3DQHO-DFNHW6LGH/HIW
6HH)LJXUHRQSDJH
6KHHW0HWDO&RPSRQHQWV
'HVFULSWLRQ
,WHP
11.B 3DUWV/LVW
&
&
&
&
R2014700
&
&
&
&
&
(
&
&
&
&
&
&
&
&
&
R2014700
&
&
&
&
&
(
&
&
&
&
&
&
750
500
&
6L]H
6L]H
&
&
&
&
R2014700
&
&
&
&
&
(
&
&
&
&
&
&
1000
6L]H
&
&
&
&
R2014700
&
&
&
&
&
&
(
&
&
&
&
&
&
1250
6L]H
&
&
&
&
R2014700
&
&
&
&
&
&
(
&
&
&
&
&
&
&
&
&
1500
6L]H
&
&
&
&
R2014700
&
&
&
&
&
&
(
&
&
&
&
&
&
&
&
&
1750
6L]H
&
&
&
&
R2014700
&
&
&
&
&
&
(
&
&
&
&
&
&
&
&
&
2000
6L]H
7RRUGHURUSXUFKDVHSDUWVIRUWKH%UDGIRUG:KLWH&RSSHU%UXWHOOFRQWDFW\RXUQHDUHVW%UDGIRUG:KLWHGHDOHURUGLVWULEXWRU,IWKH\FDQQRWVXSSO\\RX
ZLWKZKDW\RXQHHGFRQWDFW&XVWRPHU6HUYLFH VHHEDFNFRYHUIRUDGGUHVVWHOHSKRQHDQGID[QXPEHUV 11.A General Information
2QO\JHQXLQH%UDGIRUG:KLWHUHSODFHPHQWSDUWVVKRXOGEHXVHG
SECTION 11 5HSODFHPHQW3DUWV
Page 94
BRADFORD WHITE CORP.
&RYHU&KDPEHU)URQW5LJKW
,JQLWRU+RW6XUIDFHZLWK*DVNHW
7LOH6LGH 5LJKWDQG/HIW 7LOH)URQW
7LOH)URQW&HQWHU
'RRU&KDPEHU$FFHVV
&RYHU&KDPEHU)URQW/HIW
%
&RYHU&KDPEHU
'LYLGHU/RZHU&KDPEHU)URQW
%
7LOH)URQW5LJKW6LGH
'LYLGHU8SSHU&KDPEHU)URQW
$
'LYLGHU&KDPEHU)URQW
$
%UDFNHW&KDPEHU)URQW5LJKW
%UDFNHW&KDPEHU)URQW/HIW
%UDFNHW&KDPEHU)URQW
7LOH)URQW/HIW6LGH
([KDXVW3OHQXP
&KDPEHU6LGH7RS
&KDPEHU$VVHPEO\5LJKW%RWWRP
&KDPEHU7RS
&KDPEHU$VVHPEO\/HIW%RWWRP
&KDPEHU5HDU
&KDPEHU/HIW6LGH)URQW
&KDPEHU5LJKW6LGH)URQW
%
&KDPEHU)URQW
$
%DVH$VVHPEO\
6HH)LJXUHRQSDJH
,QWHUQDO&RPSRQHQWV
'HVFULSWLRQ
,WHP
7
7
&
&
&
&
&
&
&
&
&
&
&
&
7
7
7
&
&
&
&
&
&
&
&
&
&
&
&
&
750
500
&
6L]H
6L]H
7
7
7
&
&
&
&
&
&
&
&
&
&
&
&
&
&
1000
6L]H
7
7
7
7
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
1250
6L]H
7
7
7
7
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
1500
6L]H
7
7
7
7
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
1750
6L]H
7
7
7
7
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
&
2000
6L]H
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 95
7LOH5HDU
7LOH5HDU/HIW6LGH
7LOH5HDU5LJKW6LGH
7LOH5HDU&HQWHU
7LOH%RWWRP
7LOH%RWWRP/HIW6LGH
7LOH%RWWRP5LJKW6LGH
7LOH%RWWRP&HQWHU
+HDW([FKDQJHU&RPSRQHQWV
$
%
$
%
*DVNHW)ODQJH
)ODQJH&DVW,URQ
)ODQJH%URQ]H
5HOLHI9DOYH%RLOHU36,
&RYHU,Q2XW*ODVV/LQHG&DVW,URQ
&RYHU,Q2XW%URQ]H
:HOO7HPSHUDWXUH&RQWURO
*DVNHW+HDGHU
:DWHU%DUULHU,QOHW
+HDW([FKDQJHU&XSUR1LFNHO
:DWHU%DUULHU,QOHWRXWOHW
+HDW([FKDQJHU&RSSHU
6HH)LJXUHRQSDJH
'HVFULSWLRQ
,WHP
$
6
5(
6
5
5
7
7
$
6
5(
6
5
5
7
7
7
7
750
500
6L]H
6L]H
6L]H
$
6
5(
6
5
5
7
7
7
7
1000
6L]H
$
6
5(
6
5
5
7
7
7
7
7
7
1250
6L]H
$
6
5(
6
5
5
7
7
7
7
7
7
1500
6L]H
$
6
5(
6
5
5
7
7
7
7
7
7
1750
6L]H
$
6
5(
6
5
5
7
7
7
7
7
7
2000
Page 96
BRADFORD WHITE CORP.
%DIÀH'LIIXVHU3XPS,QOHW
3UHVVXUH6ZLWFK
%ORZHU
:HOGPHQW%ORZHU0RXQW
'DPSHU'XFW$VVHPEO\%ORZHU
&
+LJK/LPLW0DQXDO5HVHW%RLOHU
+LJK/LPLW0DQXDO5HVHW+HDWHU)0D[ (
5HOD\3XPS 6367 (
5(
(
5(
(
%RDUG&RQWURO&RPPHUFLDO
+LJK/LPLW$XWR5HVHW%RLOHU
%UDFNHW0RXQWLQJ6DIHW\
&
&
+LJK/LPLW$XWR5HVHWKHDWHU)0D[
%UDFNHW3&%0RXQWLQJ&RQWUROV
%UDFNHW7HUPLQDO6WULS&RQWUROV
&
&
$
5(
6
5
5
5$
5(
(
(
5(
(
5(
(
&
&
&
&
&
$
5(
6
5
5
5$
5(
5$
750
500
5$
6L]H
6L]H
%UDFNHW%DVH&RQWUROV
6HH)LJXUHRQSDJH
(OHFWULFDO&RPSRQHQWV
3XPS$GDSWHU%URQ]H
3XPS+RXVLQJ*ODVVOLQHG&DVW,URQ
3XPS$GDSWHU*ODVVOLQHG&DVW,URQ
/RZ:DWHU&XWRII
*DXJH7HPSHUDWXUH3UHVVXUH
)ORZ6ZLWFK
3XPS+RXVLQJ%URQ]H
7HH$GDSWHU2XWOHW%URQ]H
*DVNHW3XPS$GDSWHU
7HH$GDSWHU2XWOHW&DVW,URQ
5HOLHI9DOYH:DWHUKHDWHU36,
'HVFULSWLRQ
,WHP
6L]H
(
(
5(
(
5(
(
&
&
&
&
&
$
5(
6
5
5
5$
5(
5$
1000
6L]H
(
(
5(
(
5(
(
&
&
&
&
&
&
$
5(
6
5
5
5$
5(
5$
1250
6L]H
(
(
5(
(
5(
(
&
&
&
&
&
&
$
5(
6
5
5
5$
5(
$
1500
6L]H
(
(
5(
(
5(
(
&
&
&
&
&
&
$
5(
6
5
5
5$
5(
$
1750
6L]H
(
(
5(
(
5(
(
&
&
&
&
&
&
$
5(
6
5
5
5$
5(
$
2000
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 97
7HUPLQDO%XV 3RVLWLRQ 7UDQVIRUPHU
&LUFXLW%UHDNHU
6ZLWFK5RFNHU PDLQSRZHU QRWVKRZQ
9DOYH%DOO
9
&
E2343300
(
(
9
&
E2343300
(
(
(
750
500
(
0RGHO
0RGHO
%XUQHU0DQLIROG$VV\%XUQHUV5LJKW1DW
%XUQHU0DQLIROG$VV\%XUQHUV/HIW1DW
%XUQHU0DQLIROG$VV\%XUQHUV5LJKW1DW
%XUQHU0DQLIROG$VV\%XUQHUV/HIW1DW
%XUQHU0DQLIROG$VV\%XUQHUV5LJKW/3
%XUQHU0DQLIROG$VV\%XUQHUV/HIW/3
%XUQHU0DQLIROG$VV\%XUQHUV5LJKW/3
%XUQHU0DQLIROG$VV\%XUQHUV/HIW/3
9DOYH*DV&RPELQDWLRQ
9DOYH0DQXDO6KXWRII
2UL¿FH*DV1DWXUDO
/
9
9
&
&
&
&
/
9
9
&
&
&
&
1RWH%XUQHU0DQLIROG$VVHPEOLHVFRQWDLQLWHPQXPEHUVWKURXJK
Burner Trays
0DQLIROG*DV6XSSO\
6HH)LJXUHRQSDJH
*DV7UDLQ&RPSRQHQWV
'HVFULSWLRQ
,WHP
/
9
9
&
&
&
&
9
&
E2343300
(
(
(
1000
0RGHO
(
1500
0RGHO
(
1750
0RGHO
(
2000
0RGHO
/
9
9
&
&
&
&
9
&
E2343300
/
9
9
&
&
&
&
&
&
&
&
9
&
E2343300
/
9
9
&
&
&
&
&
&
&
&
9
&
E2343300
/
9
9
&
&
&
&
9
&
E2343300
( [ ( [ ( [ ( [
(
(
(
(
(
1250
0RGHO
Page 98
BRADFORD WHITE CORP.
%XUQHU7UD\%XUQHUV
*DVNHW%XUQHU7UD\%XUQHU
*DVNHW%XUQHU7UD\%XUQHU
*DVNHW7DSH55%DVH *DVNHW7DSH)W$LU&KDPEHU $
%XUQHU7UD\%XUQHUV
%XUQHU0DQLIROG%XUQHUV/HIW
%XUQHU0DQLIROG%XUQHUV/HIW
%XUQHU0DQLIROG%XUQHUV5LJKW
%XUQHU0DQLIROG%XUQHUV5LJKW
2UL¿FH*DV3URSDQH
'HVFULSWLRQ
,WHP
5
5
6
/
/
/
5
5
6
/
/
/
/
750
500
/
0RGHO
0RGHO
5
5
6
/
/
/
/
1000
0RGHO
5
5
6
/
/
/
/
1250
0RGHO
5
5
6
6
/
/
/
/
/
/
/
1500
0RGHO
5
5
6
6
/
/
/
/
/
/
/
1750
0RGHO
5
5
6
/
/
/
/
2000
0RGHO
COPPER BRUTE II (500 - 2000) INSTALLATION AND OPERATING INSTRUCTIONS
Page 99
Page 100
11.C 3DUWV,OOXVWUDWLRQV
Figure 36. 6KHHW0HWDO&RPSRQHQWV
BRADFORD WHITE CORP.
BRADFORD WHITE CORP.
Page 102
6HHSXPSFKDUWEHORZ
IRUSXPSQXPEHUV
&RSSHU%UXWHOO:DWHU+HDWHUZLWK7$&23XPS
TACO 380331
&RSSHU%UXWHOO+\GURQLF%RLOHU
6,=(
500
750
1000
1250
1500
1750
2000
TACO380331
A2117201
A2117201
A2117202
A2117202
A2117203
A2117203
A2117204
B&G380331
A2121803
A2121803
A2121802
A2121802
A2121801
A2121801
A2121800
Figure 38. +HDW([FKDQJHU&RPSRQHQWV
6,=(
6RIW:DWHU
1RUPDO:DWHU
+DUG:DWHU
500
750
1000
1250
1500
1750
2000
A2117201
A2117201
A2117201
A2117201
A2117201
A2117203
A2117204
A2117201
A2117201
A2117202
A2117202
A2117203
A2117203
A2117204
A2117203
A2117203
A2117203
A2117203
A2117203
A2117203
A2117204
&RSSHU%UXWHOO:DWHU+HDWHUZLWK% *3XPS
B&G 380331
6,=(
6RIW:DWHU
1RUPDO:DWHU
+DUG:DWHU
500
750
1000
1250
1500
1750
2000
A2121803
A2121803
A2121803
A2121803
A2121803
A2121801
A2121800
A2121803
A2121803
A2121802
A2121802
A2121801
A2121801
A2121800
A2121801
A2121801
A2121801
A2121801
A2121801
A2121801
A2121800
&233(5%587(,, 1RWHV
+/:
+$
%UDGIRUG:KLWH&RUSUHVHUYHVWKHULJKWWRFKDQJHVSHFL¿FDWLRQVFRPSRQHQWVIHDWXUHVRUWRGLVFRQWLQXHSURGXFWVZLWKRXWQRWLFH
$PEOHU3$
7HFK6HUYLFH /DID\HWWH6W
6HUYLFH3DUWV
0LGGOHYLOOH0,
:DUUDQW\ :DUUDQW\6HUYLFH
ZZZ%UDGIRUG:KLWHFRP
/LWKRLQ86$‹%UDGIRUG:KLWH'RFXPHQW$
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement