Gaggenau 481 763F 400 series fully integrated push-to-open backlit dishwasher Operating instructions

Add to my manuals
120 Pages

advertisement

Gaggenau 481 763F 400 series fully integrated push-to-open backlit dishwasher Operating instructions | Manualzz
*DJJHQDX
en-us Operating instructions
fr-ca
Notice d'utilisation
Dishwasher
DF480/DF481
2
en-us
Table of contents
en-us Oper a t i n g i n s t r u c t i o ns
(
(
Safety Definitions
6
IMPORTANT SAFETY INSTRUCTIONS
7
Risk of fire, electrical shock, or serious injury
GROUNDING INSTRUCTIONS
Safe Operation
Child Safety
Proper Care and Maintenance
ƒ
*
7
8
8
9
9
Causes of Damage
10
Getting Started
11
Appliance overview
Operating panel
Dishwasher interior components
Display indicators
Info button
Time setting
Switching on the appliance for the first time
Settings
11
12
12
12
12
12
13
13
Home Connect™ System
15
Setting up the app
Setting up Home Connect
WLAN |
Network login
Connect to App
Remote start button
Wi-Fi without a connection to the
Home Connect server
Remote diagnosis
15
15
15
15
15
16
+
Water softening system / special salt
Water hardness table
Adjusting the water softening system
Using special salt
Detergent with a salt component
Switching off water softening system
16
16
16
,
Rinse Aid
Adding rinse aid
Setting the amount of rinse aid used
Switching off rinse aid refill indicator
-
Loading the Dishwasher
Dishware material
Glass and silverware damage
Loading the racks
Recommended loading pattern
Loading the silverware basket
Rack accessories
Unloading the dishwasher
Adjusting the height of the rack
Upper rack with side levers
Removing/Installing third rack
Removing/Installing upper rack*
Removing/Installing lower rack
.
Detergent
18
18
18
19
19
19
20
20
21
22
23
25
25
26
26
27
28
29
Adding detergent
Combination detergent
29
30
Dishwasher Cycles
31
Dishwasher Cycle Options
32
Intensive Zone
Power
Half Load
Hygiene
Zeo Dry (Extra Dry with Zeolite)
Wash Cycle Information
32
32
32
32
32
32
/
0
16
17
17
17
17
3
en-us
1
Operating the Dishwasher
Protection against unintentional operation
Operating the touch buttons
Changing the settings
AquaSensor
Zeolite Drying
Time display
Opening the door
Sensor setting
Extra Dry
Eco forecast
Auto power off
Tone volume
Button volume
Child-proof lock
Greeting
Factory setting
Switching the appliance on
Delay start time
InfoLight ® *
Remaining time projection
EmotionLight
Wash cycle end
Switching off the appliance
Interrupting the wash cycle
Cancel a cycle (reset)
Changing the wash cycle
2
Care and Maintenance
Cleaning the dishwasher
Special salt and rinse aid
Filters
Spray arms
Drain pump
Preparing your unit for vacation
Winterizing your unit
4
34
34
34
34
34
35
35
35
35
35
35
35
36
36
36
36
36
36
36
36
37
37
37
37
37
37
37
38
38
38
39
40
41
41
41
3
Troubleshooting
Error message
Fault table
4
‡
42
42
Customer Service
49
Statement of Limited Product Warranty
49
What this Warranty Covers & Who it Applies to:
How Long the Warranty Lasts
Repair/Replace as Your Exclusive Remedy
Out of Warranty Product
Warranty Exclusions
How to Obtain Warranty Service
5
42
Installation and connection
Parts included
Safety instructions
Delivery
Technical specifications
Installation
Drain connection
Water supply connection
Hot water connection
Electrical connection
Removing the appliance
Transporting the appliance
Securing the appliance against frost
49
49
50
50
50
51
52
52
52
52
52
53
53
53
54
54
54
55
55
en-us
&RQJUDWXODWLRQVDQG7KDQN<RXIURP*DJJHQDXŠ
7KDQN\RXIRUVHOHFWLQJD*DJJHQDXGLVKZDVKHU<RXKDYHMRLQHGWKHPDQ\FRQVXPHUV
ZKRGHPDQGTXLHWDQGVXSHULRUSHUIRUPDQFHIURPWKHLUGLVKZDVKHUV
7KLVPDQXDOZDVZULWWHQZLWK\RXUVDIHW\DQGFRQYHQLHQFHLQPLQGDQGWKHLQIRUPDWLRQFRQWDLQHGKHUHLQLVYHU\LPSRUWDQW
:HKLJKO\UHFRPPHQGWKDW\RXUHDGWKLVPDQXDOEHIRUH\RXXVH\RXUGLVKZDVKHUIRUWKHILUVWWLPH
7ROHDUQHYHQPRUHDERXW\RXUGLVKZDVKHUDQGDYDLODEOHDFFHVVRULHVDVZHOODVPDQ\RWKHUWRSTXDOLW\
*DJJHQDXDSSOLDQFHVYLVLWRXUZHEVLWHDWZZZJDJJHQDXXVDFRP
3OHDVHFRQWDFWXVLI\RXKDYHDQ\TXHVWLRQVRUFRPPHQWV
*DJJHQDX
0DLQ6WUHHW6XLWH
,UYLQH&$
86$
3KRQH
LQIR#JDJJHQDXXVDFRP
ZZZJDJJHQDXXVDFRP
5
en-us
(
Safety Definitions
Safety Definitions
SafetyDfintos
9 WARNING
This indicates that death or serious injuries may
occur as a result of non-observance of this
warning.
9 CAUTION!
This indicates that minor or moderate injuries may
occur as a result of non-observance of this
warning.
NOTICE: This indicates that damage to the appliance
or property may occur as a result of non-compliance
with this advisory.
Note: This alerts you to important information and/or
tips.
6
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
( IMPORTANT SAFETY INSTRUCTIONS
This dishwasher is provided with Installation
Instructions and this Use and Care Manual.
Read and understand all instructions before
using the dishwasher.
This dishwasher is intended for use up to a
maximum altitude of 8,200 ft (2,500 meters)
above sea level.
To reduce the risk of fire, electrical shock,
or serious injury, observe the following:
Ri sk of f i r e, el ect r i cal shock, or ser i ous i nj ur y
9 WARNING
Risk of electrical shock or fire!
Electrical shock or fire could result if the
electrical supply for the dishwasher
covered in this manual is incorrectly
installed or if the dishwasher has been
improperly grounded. Do not use the
dishwasher covered in this manual unless
you are certain the electrical supply has
been correctly installed and the
dishwasher has been properly grounded.
9 WARNING
Risk of injury or death!
Misuse of the dishwasher can result in
serious injury or death. Do not use the
dishwasher in any way not covered in this
manual or for any purpose other than
those explained in the following pages.
9 WARNING
Risk of injury!
Severe injury and/or product damage
could result from the use of unauthorized
service technicians or non-original
replacement parts. All repairs must be
performed by an authorized service
technician using only original equipment
factory replacement parts.
9 WARNING
RIsk of explosion!
▯
Under certain conditions, hydrogen
gas may be produced in a hot water
system that has not been used for two
weeks or more. Hydrogen gas is
explosive. Before using a dishwasher
that is connected to a hot water system
that has been unused for two weeks or
longer, turn on all hot water faucets
and let the water flow from each for
several minutes. This will release any
accumulated hydrogen gas. As the gas
is explosive, do not smoke or use an
open flame during this time.
▯
When cleaning your dishwasher with
any cleaning agent, remove all
cookware, utensils or any foreign
material from inside. Some cleaning
agents are highly acidic and/or caustic
alkaline, which can cause hydrogen
gas to form if aluminum material is also
inside the dishwasher tub. Hydrogen
gas is explosive. Refer to the Care and
Maintenance section of the dishwasher
Use and Care manual for instructions on
how to properly clean your dishwasher.
7
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
9 WARNING
Health hazard!
Never use harsh chemicals to clean your
dishwasher. Some bleach-based products
can damage your dishwasher and may
present health hazards!
GROUNDING INSTRUCTIONS
This appliance must be grounded to a metal,
permanent wiring system or an equipment
grounding conductor must be run with the
circuit conductors and connected to the
equipment grounding terminal or lead on the
dishwasher. See the Installation Instructions
included with this dishwasher for more
information on electrical requirements.
9 WARNING
Risk of electric shock!
This appliance must be grounded. In the
event of a malfunction or breakdown,
grounding will reduce the risk of electric
shock by providing a path of least
resistance for electric current. This
appliance is equipped with a cord having
an equipment-grounding conductor.
Improper connection of the equipmentgrounding conductor can result in risk of
electric shock. Check with a qualified
electrician if you are in doubt whether the
appliance is properly grounded.
8
Safe Operation
Use this dishwasher only for its intended
function, which is the washing of household
dishware and kitchenware rated as dishwasher
safe.
Use only detergents or rinsing agents
recommended for use in a dishwasher, and
keep them out of the reach of children.
9 CAUTION!
When loading items to be washed:
■
Locate sharp items so they are not
likely to damage the door seal.
■
Load knives and other sharp utensils
with their HANDLES UP to reduce the
risk of cut-type injuries.
■
Do not wash plastic items unless they
are marked “dishwasher safe” or the
equivalent. For plastic items not so
marked, check the manufacturer’s
recommendations.
■
Do not operate your dishwasher unless
all enclosure panels are in place.
■
Do not tamper with or override
controls and interlocks.
Do not abuse, sit or stand on the door or dish
racks of the dishwasher.
9 WARNING
Risk of injury!
To avoid risk of injury, always use caution
when opening the door during or
following a wash cycle as hot water or
steam may escape. Do not fully open the
door until water noises have stopped and
steam has subsided.
9 IMPORTANT SAFETY INSTRUCTIONS
READ AND SAVE THESE INSTRUCTIONS
NSF/ANSI 184 Certified residential
dishwashers are not intended for licensed
food establishments.
Remove the dishwasher door to the washing
compartment when removing an old
dishwasher for service or discarding.
Ensure that you follow the safety instructions,
even when they are out of reach while
operating the appliance via the Home Connect
app. Also follow the instructions provided by
the app.
To avoid floor damage and possible mold
growth, do not allow wet areas to remain
around or under the dishwasher.
Child Safety
To reduce risk of injury, do not allow children
to play in or on the dishwasher.
When children become old enough to operate
the appliance, it is the responsibility of the
parents/legal guardians to ensure the children
are instructed in safe practices by qualified
persons.
Note: To avoid dishwasher damage, do not
allow water to remain in your dishwasher
systems through extended periods of freezing
temperatures. Freezing temperatures can
damage the water fill valve and potentially
other components of your dishwasher.
NOTICE: It is highly recommended for the
end user to become familiar with the
procedure to shut off the incoming water
supply and the procedure to shut off the
incoming power supply. See the Installation
Instructions or contact your installer for more
information.
Proper Care and Maintenance
9 WARNING
Risk of explosion!
Under certain conditions, hydrogen gas
may be produced in a hot water system
that has not been used for two weeks or
more. Hydrogen gas is explosive. Before
using a dishwasher that is connected to a
hot water system that has been unused
for two weeks or longer, turn on all hot
water faucets and let the water flow from
each for several minutes. This will release
any accumulated hydrogen gas. As the
gas is explosive, do not smoke or use an
open flame during this time.
Proposition 65 Warning:
This product may contain a chemical known to
the State of California, which can cause
cancer or reproductive harm. Therefore, the
packaging of your product may bear the
following label as required by California:
67$7(2)&$/,)251,$352326,7,21:$51,1*
:$51,1*
&DQFHUDQG5HSURGXFWLYH+DUPZZZ3:DUQLQJVFDJRY
9
en-us
Causes of Damage
Causes of Damage
ƒ
N OTICE: ▯Never use steam cleaning products to clean
your dishwasher. The manufacturer will not be liable
for the possible damages or consequences.
CauseofDamge
▯
To avoid possible dishwasher damage, do not use
harsh chemicals, abrasive cleaners, scouring pads
(metal or plastic), or abrasive cloths/paper towels to
clean your dishwashers exterior door panel. Your
dishwasher's exterior door panel can be damaged by
doing so.
▯
To avoid dishwasher damage, do not load the
dishwasher with paper products, plastic bags,
packing materials or anything other than normal,
dishwasher safe dishware and kitchenware.
▯
10
Protect your dishwasher from the elements. Protect
against freezing to avoid possible damage to the fill
valve. Damage caused by freezing is not covered by the
warranty.
Getting Started
en-us
Getting Started
*
A ppliance overview
GetingStared

67$57
K
PLQ
UHVHWVHF
VHF
W VHF
UHVHWVHF
The dotted lines show optional features which may or
may not be included with your dishwasher.
11
en-us
Getting Started
The numbers stated below refer to the overview images
on the previous page of this manual.
Display indicators
‹:‹‹
%
$
|
Operating panel
( On/Off button
0 Wash cycles**
8 Info button (
@ Digital display
H Rinse aid refill indicator
P Salt refill indicator
X Selection buttons
` Delay start / < button
--------
Info button (
T he Info button ( can be used to display additional wash
cycle information.
I nf o but on
1. Press the Info button (8.
2. Press the wash cycle button.
h Remote start / > buttton
Information on the selected wash cycle is indicated
on the display window at the top @.
)" Wash cycle options**
)* START button
** the wash cycles and options will vary by model
Dishwasher interior components
1" Interior light *
Cycle time remaining
Lights up when rinse aid is low
Lights up when salt is low
Lights up when wifi is connected
3. To leave, press Info button ( 8.
Time setting
W hen the appliance is switched on for the first time, the
time starts at 12:00 o’clock.
Ti me set i ng
1* Third rack
Set the time as follows:
12 Upper rack
1. Open the door.
1: Upper spray arm
1B Detergent tab tray
1J Intake opening
1R Zeolite outlet cover (zeolite container)
1Z Lower spray arm
2. Switch on ON/OFF switch (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
1b Dispenser for special salt
Scroll with < >
1j Filters
Set with - +
9" Silverware basket *
9* Lower rack
92 Rinse aid dispenser
9: Detergent dispenser
Leave with t 3 sec.
4. Keep pressing button > ` until the time setting is
indicated on the display window at the top @.
9B Lock for detergent dispenser
5. Make the setting with setting buttons + - X. If the
9J Rating plate
* optional feature which may or may not be included with
your dishwasher.
6. Press and hold the Info button (8 for 3 seconds.
selection buttons + - X are held down, the set
values are changed in 10-minute increments.
The selected setting has now been stored.
Note: If the appliance was disconnected from the power
supply for a prolonged period, the time starts at 12:00
o’clock. Set the time.
12
Getting Started
Switching on the appliance for the first
time
When you first turn on the dishwasher, you are taken
directly to the settings for switching on the appliance for
the first time. The following text is indicated on the
display window at the top @:
Scroll with < >
Set with + Leave with t 3 sec.
en-us
The required settings for switching on the appliance for
the first time are listed in the table below.
Change the setting as follows:
1. Keep pressing button > ` until the required setting
is displayed.
2. Make the selection with setting buttons + - X.
3. Press and hold the Info button (8 for 3 seconds.
The selected setting has now been stored.
Settings
Switching on the
appliance for the first
time
Language
Time format
Time setting
Water soft setting
Factory setting
Infotext
by pressing Info button (
American English
24h
12:00
°E 0 - 8 soft
Rinse aid setting
Level 5
Language selection.
12h or 24h.
Set the current time.
Setting water hardness. When using Multitabs, select the
lowest setting.
Amount of rinse aid affects drying.
--------
Settings
The dishwasher has been preset with certain settings
for your convenience. You can change these factory
setting.
Change the setting as follows:
4. Keep pressing button > ` until the required setting
is displayed.
5. Make the selection with setting buttons + - X.
6. Press and hold the Info button ( 8 for 3 seconds.
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
Setting
Factory setting
Time setting
Time format
Time display
Language
Water hardness
12:00
24h
Time
American English
°E0-8 Soft
Rinse aid disp.
Level 5
Sensor setting
Standard
Extra dry
Off
* depending on the features of your dishwasher
The chosen setting has now been stored.
You have the option of resetting all changed settings
back to the original factory settings.
Note: When you reset your dishwasher to the factory
settings, you are taken directly to the settings for
switching on the appliance for the first time.
Infotext
by pressing Info button
Set the current time.
12h or 24h.
Show end of wash cycle with display "Time" or "In hours".
Language selection.
Setting water hardness. When using Multitabs, select the
lowest setting.
Amount of rinse aid affects drying.
Adjusting water clarity detection for best cleaning results.
Improved drying for glasses and plasticware.
13
en-us
Getting Started
Setting
Factory setting
Eco forecast
Auto Power Off
Off
Off
EmotionLight
Front display *
Remaining time proj. *
On
On
On
Infolight *
Start Program
Tone volume
Button volume
Child-proof lock *
WLAN
Network login
On
Auto 130-150 °F
Level 2
Level 2
Off
on/off
Manual or
Autom./ WPS
Connect to App
Start with +
Greeting
On
Factory setting
Reset
* depending on the features of your dishwasher
Notes
▯
▯
--------
14
The “Network login” menu option is only available if
WLAN has been switched on.
The “Connect to App” menu option is only available if
a connection to the home network has been
established.
Infotext
by pressing Info button
Show the water and energy consumption.
Appliance automatically switches off at end of rinsing
process.
Interior light.
The front display can be selected.
While program is running, status information is projected
onto floor.
Light is projected to signal an active cleaning cycle.
When switching on, the last selected wash cycle appears.
Volume of signal at end of wash cycle.
Volume when using buttons.
Activated child-proof lock impedes opening of door.
Switch wireless network connection on or off.
Check WPS function on router. WLAN must be turned on for
this setting to appear.
No WPS function: Manual
WPS function: Automatic
Connect appliance to mobile terminal device. Appliance must
be connected to the network for this setting to appear.
When switching on the appliance, the brand logo can be
deselected.
Resetting to the factory setting.
Getting Started
Home Connect™ System
This dishwasher is Wi-Fi capable and can be remotely
controlled via a mobile device.
If your dishwasher does not connect to the home
network, you can also operate the dishwasher manually
by pressing the buttons.
Refer to appliance overview for the location of the
buttons. ~ "Appliance overview" on page 11
en-us
WLAN |
In the WLAN menu you can activate the wireless
network connection with “on” and deactivate it with
“off”.
Notes
▯
▯
If you have selected the Wi-Fi “off” setting, the
“Network login” and “Connect to App” settings are
not available.
Remote control of the appliance requires a stable
wireless network connection.
Setting up the app
Network login
To be able to operate the appliance via Home Connect,
the Home Connect app must be installed on your mobile
device.
In the “Network login” menu you can select between
“Automatic/WPS” and “Manual” to connect the
dishwasher to your home network. To do this, test the
WPS function on your router.
Observe the supplied Home Connect documents with
regard to this.
Follow the steps specified by the app to implement the
settings.
Setting up Home Connect
You can set your dishwasher by pressing the remote
start button h or proceed as follows:
1. Open the door.
2. Switch on the On/Off switch (.
3. Press Info button 8 for 3 seconds until the
Refer to Home Connect leaflet for detailed instructions.
Automatic: Connect to the home network using the WPS
function of your router.
Manual: Connect your mobile device to the Home
Connect network. The network settings are then
manually entered using the Home Connect App to
connect to your home network.
Following successful connection, the following text is
indicated on the display window at the top @:
“Network login successful”.
Note: The “Network login” menu item is not available
unless you have activated WLAN.
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with Setup 3 sec.
4. Keep pressing button > h until the required setting
is indicated on the display window at the top @.
5. Make the setting with setting buttons + - X. See
table in section
6. Press and hold the Info button 8 for 3 seconds.
Connect to App
The “Connect to App” menu option is not available
unless there was a connection to the home network.
The “Connect to App” setting establishes the link
between the dishwasher, App and your user account.
Following successful connection, the following text is
indicated on the display window at the top @:
“Connection to app successful”.
Refer to the Home Connect leaflet for further
information.
The chosen setting has now been stored.
15
en-us
Water softening system / special salt
Remote start button
Once the dishwasher is connected to the home network,
press the remote start button h to control the
dishwasher from your device.
If the dishwasher has still not logged into Home
Connect, access the Home Connect settings by
pressing the remote start button h.
Follow the directions in the supplied Home Connect
leaflet.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the
Remote Start buttonh, the operation will be paused.
Press the Remote Start button h again and close the
appliance door to resume control. Also see section
Notes
▯
▯
▯
▯
When the login process is complete, the Remote
Start button h goes out.
To activate the remote control, press the Remote
Start button h.
If the Home Connect Assistant was aborted during
start-up, press the Remote Start button h again.
If the connection to the router fails, | flashes on the
display.
Wi-Fi without a connection to the Home
Connect server ƒ
Y ou can use the Home Connect App to disconnect
from the Home Connect server.
+
Water softening system / special salt
T o ensure good rinsing results, the dishwasher requires
soft water, i.e. water which is low in lime, otherwise
limescale will be deposited on the utensils and interior
container. Tap water above 7° dH (1.2 mmol/l) must be
softened. The water is softened with special salt
(regeneration salt) in the water softening system
of the dishwasher. The setting and therefore the
required amount of salt depends on the degree of
hardness of your tap water (see following water
hardness table).
Wtaersoftnigsytem/spcila t
Water hardness table
:DWHU
+DUGQHVV
KDUGQHVV UDQJH
YDOXHƒ(
PPROO
6HWYDOXH
RQWKH
PDFKLQH
Ȣ
VRIW
Ȣ
Ȣ
VRIW
Ȣ
Ȣ
PHGLXP
Ȣ
Ȣ
PHGLXP
Ȣ
Ȣ
PHGLXP
Ȣ
Ȣ
KDUG
Ȣ
Ȣ
KDUG
Ȣ
Ȣ
KDUG
Ȣ
Wi- Fi wi t hout a con ect i on t o t he Home Con ect ser ver
The appliance is then locally connected to your mobile
device without any connection to the Home Connect
server.
Note: If you did not deactivate the connection to the
Home Connect server, check your Internet connection.
Remote diagnosis ~
C ustomer Service can use Remote Customer Service~
to access your appliance if you contact them.
Remot e di agnosi s
Notes
▯
▯
16
You have to confirm Customer Service access on
your appliance.
You can switch off Remote Customer Service ~
using the On/Off switch ( or deactivate Customer
Service access in the Home Connect App.
Water softening system / special salt
Adjusting the water softening system
Top off the salt as follows:
The amount of salt dispensed can be set from 0 to 62°E.
Salt is not required at the set value 0-8.
1. Undo the screw plug on the dispenser 1b.
2. Fill the dispenser with water (required only when
Set the softening system as follows:
1. Ask your local water utility company for the water
en-us
switching on the appliance for the first time).
3. Add salt as illustrated (do not use table salt or tablets).
hardness value of the tap water.
The water is displaced and runs out.
2. Required setting can be found in the water hardness
table.
3. Open the door.
4. Switch on ON/OFF switch (.
5. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
6. Keep pressing button > ` until the water hardness
For more information about buying dishwasher salt,
please contact Customer Service 1-800-944-2904.
is indicated on the display window at the top @.
7. Make the selection with setting buttons + - X.
8. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
Using detergents with salt component
I f combined detergents with a salt component
are used, special salt can usually be omitted up
to a water hardness of 21° dH (37° fH, 26° Clarke,
3.7 mmol/l). If the water hardness is over 21° dH, salt
must be used.
Det er gent wi t h a sal t compone t
Using special salt
As soon as the low salt indicator P lights up on the
digital display, salt should be topped off. Refilling the
salt dispenser should be done before switching on the
appliance. This ensures that extra salt water is washed
out and will not corrode the rinsing tank.
NOTICE: Detergent will destroy the water softening
system! Never pour detergent into the salt dispenser.
Switching off low salt indicator / water
softening system
I f the use of combined detergents with a salt
component impairs the low salt indicator P on the
control panel or the text on the display window at the
top @ (enough salt for x rinse cycles), the displays
can be switched off.
Swi t chi ng of wat er sof t eni ng syst em
Proceed as described under “Setting water softening
system” and set the value to 0-8. The water softening
system and salt refill indicator are now switched off.
17
en-us
,
Rinse Aid
3. Close the lid. Lid must be fully closed until it clicks in
Rinse Aid
order to seal.
A s soon as the low rinse aid indicator H lights up on
the control panel, rinse aid should be topped off.
The rinse aid is required for stain-free utensils and clear
glasses. Use only rinse aid which the manufacturer
designates as safe to use in domestic dishwashers.
Combined detergents with rinse aid component may be
used with soft to moderately hard water only (0-2 bands
on test strip or up to an °E value of 20). For moderately
hard to hard water (3 to 4 bands on test strip or °E value
of 21 or higher), rinse aid must be used.
RinseAd
Adding rinse aid
4. Wipe up any excess rinse aid that may have puddled
when the dispenser reservoir is full.
This prevents excessive frothing during the next wash
cycle. The indicator light will go out a few moments
after the dishwasher door is shut.
Tip: For easier pouring, remove lid from the rinse aid
bottle.
NOTICE: Do not fill the rinse aid dispenser 92 with
detergent. Doing so will damage the dishwasher.
Setting the amount of rinse aid used
NOTICE: To avoid oversudsing or clogging, do not
overfill the rinse aid dispenser 92. Wipe up any spills
with a damp cloth.
1. Open the rinse aid dispenser 92 by pressing on the
latch of the lid and pulling it open.
The amount of rinse aid to be dispensed can be set from
0 to 6. Set the amount of rinse aid to be dispensed to 5
to obtain a very good drying result. Do not change the
amount of rinse aid unless there are streaks or water
stains on the utensils. Set a lower level to avoid streaks.
Set a higher level to avoid water stains.
Set the amount of rinse aid as follows:
1. Open the door.
2. Press on ON/OFF button (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
2. Add liquid rinse aid to the dispenser 92 until it is
full. Do not overfill. Avoid spilling into air vent hole.
4. Keep pressing button > ` until the rinse aid
dispenser is indicated on the display window at the
top @.
5. Make the selection with setting buttons + - X.
6. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
Note: Do not change the amount of rinse aid unless
there are streaks (select lower setting) or water stains
(select higher setting) visible on the utensils.
PD[
BJS
WFOU
18
Loading the Dishwasher
Switching off rinse aid refill
indicator
If the use of combined detergents with a rinse aid
component impairs the low rinse aid indicator H on
the control panel (enough rinse aid for x rinse cycles),
the displays can be switched off.
Proceed as described under “Setting amount of rinse
aid” and select setting 0.
NOTICE: Using no rinse aid or setting the dispenser
to 0 may result in longer cycle times consuming more
energy and water. The higher temperatures can damage
fine china or glassware.
en-us
Loading the Dishwasher
-
D ishware material
LoadingtheDiswaher
Note: Before using your dishwasher for the first time,
check the information in this section. Some items are
not dishwasher-safe and should be hand washed; others
require special loading.
Recommended
Aluminum
Precaution
Colored anodized aluminum may
fade over time. Minerals in your
water may cause the aluminum to
darken or spot. This can usually
be removed with a soap-filled
steel wool pad.
China, Crystal,
Some hand-painted utensils may
Stoneware
discolor, fade or spot. Hand wash
these utensils. Position fragile
glassware so that it will not topple
over or come in contact with other
utensils during the wash cycle.
Glass
Make sure to use dishwashersafe glass. Milk glass may
discolor or become yellow.
Non-stick Coatings Apply a light coating of vegetable
oil to non-stick surfaces after
drying.
Plastics
Make sure the plasticware is
dishwasher-safe.
Stainless Steel,
Load these so they do not come
Sterling Silver and in contact with other metals,
Silver Plates
stainless steel dishwasher tank
walls or the inner door.
Not
Recommended
Acrylic
AdhesiveJoined Pieces
Bone-Handled
Utensils
Iron
Non-Dishware
Items
Pewter, Brass,
Bronze
Reason
Crazing or small cracks
throughout the acrylic, may occur.
Adhesives that join materials such
as plastic, wood, bone, steel,
copper, tin, etc. may loosen.
Handles may separate.
Iron will rust. Hand wash and dry
immediately.
Your dishwasher is intended for
use in cleaning ONLY standard
household dishware and
kitchenware.
These items will tarnish. Hand
wash and dry immediately.
19
en-us
Loading the Dishwasher
Glass and silverware damage
Loading the racks
Causes:
For best dishwashing results, observe the following
when loading the dishwasher:
▯
Glass type.
▯
Type of dishwasher detergent.
▯
Water temperature of the wash cycle.
▯
Do not pre-wash items with loosely attached food
soil.
▯
Remove all food particles, bones, toothpicks and
excessive grease.
▯
Pre-treat items having burned-on, baked-on or
starchy soils.
▯
Load dishes in the dishwasher racks so the insides
of bowls, pots and pans are facing the spray arms.
▯
Avoid nesting and contact points between dishes.
▯
Separate items of dissimilar metals. Use care to not
block movement of the spray arms.
▯
Only wash household dishware and kitchenware
rated as dishwasher-safe.
Recommendation:
▯
Use only glasses and porcelain which
the manufacturer designates as dishwasher-safe.
▯
Use a detergent which protects silverware.
▯
Use less intensive wash cycles and take glass and
silverware out of the dishwasher as soon as possible
after the wash cycle ends.
Refer to the Dishware Materials section for more
information about dishware suitability.
NOTICE: To avoid dishwasher damage, do not load
the dishwasher with paper products, plastic bags,
packing materials or anything other than normal,
dishwasher safe dishware and kitchenware.
Loading the upper rack
Ensure items do not protrude through the bottom of the
racks and block the spray arms.
Note: When pushing the upper rack 12 into the
dishwasher, push it until it stops against the back of the
tub so the upper rack spray arm 1: connects to the
water supply at the back of the tub. Do not push racks in
using the door.
Loading the lower rack
Place large items in the lower rack 9*. Load pots, pans
and bowls upside down. Do not block the vent hole with
tall baking sheets. Load these items on the right side of
the dishwasher.
20
Loading the Dishwasher
Recommended loading pattern
en-us
Lower rack - 10 place setting
Note: Folding the cup shelves down will allow the cups
to sit at an increased angle and reduce water pooling on
cup bottoms.
Lower rack - 12 place setting
Upper rack - 10 place setting
Upper rack - 12 place setting
Third rack - 10 place setting
Third rack - 12 place setting
21
en-us
Loading the Dishwasher
Loading the silverware basket
Suggested loading patterns
Place knives and sharp utensils with their handles up
and forks and spoons with their handles down. If large
or oddly-shaped items are loaded in the silverware
basket, be sure they do not nest together.
9 WARNING
Risk of injury!
The sharp points and edges of knives and other
sharp utensils can cause serious injury. Load
knives and other sharp utensils with edges down.
Do not allow children to handle or play near
knives and sharp utensils.
1
Salad fork
2
Teaspoon
3
Dinner fork
4
Knife
5
Tablespoon
6
Serving spoon
7
Serving fork
22
* optional feature which may or may not be included with
your dishwasher.
Loading the Dishwasher
en-us
Rack accessories
Cup shelves*
Third rack*
The cup shelves and the space underneath can be used
for small cups and glasses or for larger items of
silverware, such as wooden spoons or serving spoons
or forks. If you do not require the cup shelf, it can be
folded up.
The third rack 1* horizontally positions knives,
spatulas and other oversized tools for improved
cleaning and easier loading and unloading. Arrange
cutlery in third rack 1* as illustrated.
&/,&.
Adjust the height of the cup shelves as follows:
Depending on the features of your dishwasher, you can
fold down the side shelves to provide more room for
taller items of silverware. The front rows of prongs can
be folded down to provide room for wider handles.
1. Position the cup shelf vertically and pull upwards.
2. Push cup shelf at a slight angle downwards to the
required height (1, 2, or 3).
3. Engage cup shelf.
Cup shelf “clicks” into position.
* optional feature which may or may not be included with
your dishwasher.
&/,&.
* optional feature which may or may not be included with
your dishwasher.
23
en-us
Loading the Dishwasher
Flip tines*
Extra tall item sprinkler*
Depending on the features of your dishwasher, the tines
can be folded down. This facilitates arrangement of
pots, bowls and glasses..
Large trays or grills as well as large plates (gourmet
plates, pasta plates, dinner plates) can be cleaned with
this spray head.
Fold down the flip tines as follows:
Insert the spray head as follows:
1. Pull flip tine gently forward and release it from the
1. Remove upper rack 12.
notch (1).
2. Insert spray head as illustrated and turn to the right.
2. Push the flip tine downward to the desired
Spray head is engaged.
position (2).
To fold up, push flip tines into an upright position until
the holder engages in the notch.
* optional feature which may or may not be included with
your dishwasher.
Plastic item clips*
Light-weight plastic accessories (cups, lids, etc.) can be
held securely by the plastic item clips.
Notes
▯
Press the plastic item clip against the rack as shown
until it clicks.
▯
Keep the vent hole on the tub’s left side clear by
placing tall items such as plastic cutting boards and
tall baking sheets on the lower rack’s right side or
center.
Ensure that the dishwasher is always operated with
upper rack 12 or extra tall item sprinkler.
To ensure that the spray jet can reach all parts, arrange
the baking sheets as illustrated (max. 2 baking sheets
and 2 grills).
NOTICE: To avoid dishwasher damage, do not reinstall
the upper rack 12 without removing the extra tall item
sprinkler (B).
&/,&.
* optional feature which may or may not be included with
your dishwasher.
24
* optional feature which may or may not be included with
your dishwasher.
Loading the Dishwasher
en-us
Gastronorm insert *
H elps you stack several Gastronorm drawers, trays
or similar large flat utensils at an angle in the lower
rack.
Adjusting the height of the rack *
You can remove the insert if required.
Appliance height 32 in (81.5 cm)
Gast r on r mi nser t
I f required, the height of the upper rack 12 can be
adjusted to create more space for taller utensils either
in the upper or lower rack.
Adj ust i ng t he hei ght of t he r ack
With silverware
basket
Setting 1 max. ø
Setting 2 max. ø
Setting 3 max. ø
Upper rack
With third rack
Setting 1 max. ø
Setting 2 max. ø
Setting 3 max. ø
Upper rack
6.3 in (16 cm)
7 in (18.5 cm)
8.2 in (21 cm)
8.6 in (22 cm)
9.6 in (24.5 cm)
10.6 in (27 cm)
Lower rack
12.2 in (31 cm)
10.8 in (27.5 cm)
9.8 in (25 cm)
Lower rack
12.2 in (31 cm)
10.8 in (27.5 cm)
9.8 in (25 cm)
Appliance height 35 in (86.5 cm)
* optional feature which may or may not be included with
your dishwasher.
Unloading the dishwasher
When unloading the dishwasher, it is recommended to
unload the lower rack first. Next, unload the silverware
basket followed by the upper rack, and then the third
rack.
Note: Dishes are more likely to chip when unloading
before cooling.
With silverware
basket
Setting 1 max. ø
Setting 2 max. ø
Setting 3 max. ø
Upper rack
With third rack
Setting 1 max. ø
Setting 2 max. ø
Setting 3 max. ø
Upper rack
7 in (18 cm)
8 in (20.5 cm)
9 in (23 cm)
9.4 in (24 cm)
10.4 in (26.5 cm)
11.4 in (29 cm)
Lower rack
13.4 in (34 cm)
12 in (30.5 cm)
11 in (28 cm)
Lower rack
13.4 in (34 cm)
12 in (30.5 cm)
11 in (28 cm)
Arrange large plates up to a diameter of 12.2 in/13.4* in
(31/34* cm) in the lower basket 9* as illustrated.
* optional feature which may or may not be included with
your dishwasher.
25
en-us
Loading the Dishwasher
Upper rack with side levers
1. Pull out upper rack 12.
2. Hold the sides of the rack along the upper edge.
This prevents it from suddenly dropping.
Removing third rack 1*:
1. Pull out third rack all the way (1).
2. Lift front of the third rack out of the catch (2).
3. Pull out third rack forwards and lower (3).
3. To lower the upper rack; press in both levers on the
left and right on the outside of the rack. The upper
rack lowers.
4. To lift the upper rack; grip the sides of the upper rack
along the upper edge and lift.
5. Ensure that both sides of the upper rack are at the
same height.
6. Push in upper rack.
Removing/Installing third rack
Installing third rack 1*
1. Pull out third rack rails all the way (1).
2. Insert third rack (2). In doing so, note the position of
the detent pins (as illustrated in Step 2).
3. Lift third rack slightly and insert rear detent pins into
the lower locking hooks on the rails (3).
4. Lower third rack and press the front detent pins into
the notch (4). Third rack “clicks” into position.
5. Push in third rack.
26
Loading the Dishwasher
Removing/Installing upper rack *
en-us
Installing upper rack 12:
1. Pull out upper rack rails all the way (1).
2. Insert upper rack (2). In doing so, note the position
of the detent pins (as illustrated in Step 2).
3. Lift upper rack slightly and insert rear detent pins
into the locking hooks (3).
4. Lower upper rack and press into the front notch (4).
Upper rack “clicks” into position.
5. Push in upper rack.
Removing upper rack 12:
1. Pull out upper rack all the way (1).
2. Lift front of the upper rack out of the catch (2).
3. Pull out upper rack forwards and lower (3).
27
en-us
Loading the Dishwasher
Removing/Installing lower rack
Installing lower rack 9*:
1. Pull out lower rack rails all the way (1).
2. Insert lower rack into the rear holders (2).
3. Lower lower rack at the front and place in the front
holders (3).
4. Push in lower rack.
Removing lower rack 9*:
1. Pull out lower rack all the way (1).
2. Lift lower rack first out of the front and then out of
the rear holders (2).
28
Detergent
.
Detergent
U se only detergent specifically designed for
dishwashers. For best results, use fresh powdered
dishwashing detergent or detergent tabs.
Detrgn
NOTICE: To avoid damage to dishwasher or dishware:
▯
Do not use hand dishwashing products in your
dishwasher.
▯
Do not use too much detergent if your water is soft.
Using too much detergent with soft water may cause
etching in glassware and fine china.
▯
To best protect glassware, use a wash cycle with low
temperatures or a specific glass-care cycle
(depending on the model) and use a detergent that
includes etch protection.
Note: If you do not know the hardness of your water
supply, use 15 ml of detergent. Increase the amount if
necessary to the least amount required to get your
kitchenware clean.
en-us
3. Dosage: see manufacturer’s instructions on
the packaging. Use graduated detergent dispenser.
Usually 1¼ to 1½ tablespoons (20 ml–25 ml) are
adequate for normal soiling. If using tablets, one
tablet is adequate.
êWEVS
PO
êWEVS
PO
WEVS
PO
4. Close cover on the detergent dispenser.
Cover “clicks” into position.
&/,&.
Adding detergent
1. If the detergent dispenser 9: is still closed, actuate
locking bar 9B to open it.
2. Pour detergent into the dry detergent dispenser 9:
only. Do not overfill the detergent dispenser.
When using detergent tabs, lay them such that they
do not come in contact with the cover, insert a
detergent tab flat, not on its side.
Note:Do not place detergent tabs in the tab tray 1B.
Place tabs or other detergent forms directly in the
detergent dispenser 9:.
The detergent dispenser opens automatically at the
optimum time depending on the wash cycle. The
powder or liquid detergent is distributed in the
appliance and is dissolved, the detergent tab falls
into the detergent tab tray where it dissolves in
doses.
Tip: If the utensils are only lightly soiled, slightly less
than the indicated amount of detergent is usually
adequate.
Suitable detergents and care products can be
purchased online via our website or via customer
service (see back page).
29
en-us
Detergent
Combination detergent
Apart from conventional single function detergents, a
number of products are offered with additional
functions. These products contain not only the
detergent but also rinse aid and salt replacement
substances (3in1) and, depending on the combination
(4in1, 5in1, ...), additional components such as glass
protection or stainless steel cleaner. Combination
detergents function only up to a specific degree of
hardness (usually 21°dH). Over this limit salt and rinseaid must be added.
As soon as combined detergents are used, the rinse
programme is adjusted automatically to ensure the best
possible rinsing and drying result.
Notes
▯
▯
▯
▯
30
If you want to add more utensils after the wash cycle
has started, do not use the detergent tab tray 1B as
a handle for the upper rack. The detergent tab could
already be there and you will touch the partially
dissolved tab.
Do not place small parts for washing in the detergent
tab tray 1B; this prevents the detergent tab from
dissolving evenly.
You will obtain optimum rinsing and drying results
by using single function detergents and applying salt
and rinse aid separately.
If wash cycles are short, detergent tabs may not have
full cleaning effect due to different dissolving
properties and there may even be undissolved
detergent residue. It is recommended to use washing
powder for these wash cycles.
▯
▯
▯
▯
▯
The dosing of a detergent tab is adequate for the
“Intensive” wash cycle (for some models). When
using washing powder, you can apply some of this
cleaning agent to the inside of the appliance’s door.
Even if the rinse-aid and/or salt refill indicator is lit,
the rinse cycle will run correctly with combined
detergents.
If using detergents in a water-soluble protective
cover: Take hold of the cover with dry hands only
and put the detergent into an absolutely dry
detergent dispenser only, otherwise the detergent
may stick.
If you switch from combined detergents to single
function detergents, ensure that the water softening
system and amount of rinse aid have been set to
the correct value.
Biological/eco detergents: Detergent products
identified as “Bio” or “Eco” (to protect the
environment) usually use lower quantities of active
agents or completely dispense with certain
substances. The cleaning effect of such products
may occasionally be restricted.
Dishwasher Cycles
/
en-us
Dishwasher Cycles
N ote: In order to save energy, it is recommended to set
the Auto Power Off feature to “After one minute”.
DishwaerCycles
Wash cycle
AUTO
150 - 160° F
AUTO Wash
130 - 150° F
AUTO Delicate
113 - 122° F
Normal
(see note at bottom of
table)
1-Hour Wash
Quick Wash
Glass Care
Rinse

I
Recommended use
This cycle cleans items having baked-on or hard dried-on
food soils. These items may require soaking or hand
scouring.
This cycle is appropriate for mixed loads.
It is optimised according to the soiling with the aid of
sensors.
This cycle is appropriate for delicate dishwasher items.
It is optimised according to the soiling with the aid of
sensors.
Recommended for daily, regular or typical use to
completely wash a full load of normally soiled dishes.
Cleans freshly soiled dishes with easy to remove soils.
This cycle reduces cycle time while still including drying.
Cleans lightly soiled dishes with easy to remove food
soils.
A cycle for lightly soiled dishes which is ideal for
temperature sensitive dishes or silverware. In this cycle
the temperature is reduced to help prevent dishes from
becoming damaged. It is especially helpful to reduce a
cloudy or etched appearance on glasses.
Note: Some glasses are more prone to etching due to the
glass manufacturing process.
Use this cycle if you need to pre-rinse dishes to avoid
odors. Place unrinsed dishes inside the dishwasher and
select the Rinse cycle. Uses less water than hand rinsing
and very low energy.
Possible wash cycle option
all
all
all
all
Note: In order to obtain
optimal performance with
minimum energy
consumption, it is
recommended to disable all
available options and
settings, except Auto Power
Off
Intensive Zone
Power
Half Load
Note: The Energy Guide label was based on the Normal or Regular soil sensing cycle as follows: The unit was tested
without any rinse aid (liquid) in the rinse aid dispenser 92. A single dose of detergent was inserted into the
detergent dispenser 9:, with no detergent being used in the prewash. The unit was not subjected to truncated
testing per the definitions in the test procedure. We recommend that dish loads such as the one in the energy
certification test have the rack position set in the highest position.
31
en-us
Dishwasher Cycle Options
Hygiene Ü
Dishwasher Cycle Options
0
S ignificantly increases the temperature and holds that
high temperature until sanitation criteria are met. This
option is ideal for cleaning items such as dishwashersafe cutting boards and baby bottles.
Hygi en
I ntensive Zone Ï
DishwaerCycleOptions
P erfect for a mixed load. You can wash very soiled pots
and pans in the lower rack together with normally soiled
utensils in the upper rack. The spray pressure in the
lower rack is intensified, the rinsing temperature is
increased slightly.
I nt ensi ve Zone
Power ¥
Zeo Dry (Extra Dry with Zeolite) Ã
T he cycle time is reduced significantly in the Power
option. The energy consumption is increased by up to
30% due to more intensive heating.
Power
Z eolite provides optimal drying results for your
dishware.
Zeo Dr y ( Ext r a Dr y wi t h Zeol i t e)
Wash Cycle Information
Half Load §
I f you have only a few items to wash (e.g. glasses, cups,
plates), you can switch to “half load”. This will save
water, energy and time. It is recommended to put a little
less detergent in the detergent dispenser than for a full
load.
Hal f Load
AUTO*
AUTO
150-160°F Wash
130-150°F
110 - 135
105 - 129
Cycle time
in min.
Water cons. 18.6-24.2
in L (gal)
(4.9-6.4)
Wash temp. 151-160
in °F (°C)
(66-71)
Rinse temp. 151 (66)
in °F (°C)
Intensive Zone
Cycle time
125-150
in min.
Water cons. 18.6-24.2
in L (gal)
(4.9-6.4)
Rinse temp. 151 (66)
in °F (°C)
Power
Cycle time
100-120
in min.
Water cons. 16.3-20.5
in L (gal)
(4.3-5.4)
Rinse temp. 162 (72)
in °F (°C)
*sanitize
32
“Sanitized” will appear in the display window when
sanitation requirements are met. Using the Sanitize
option may also improve drying. There is an increase in
energy consumption.
To save energy, this dishwasher has EcoSense where
the sensors in the dishwasher automatically adjust the
cycle length, temperature and water changes based on
the amount of food soil and the incoming water
temperature. The “Smart Control” makes decisions that
can cause the cycle time and water usage to adjust
intermittently. Wash cycle times are based on 120°F
(49° C) water supply. If your household water supply is
different than 120°F (49° C), your dishwasher’s cycle
times may be impacted.
AUTO
Normal
Delicate
113-122°F
75 - 85
130 - 135
1-Hour
Wash
Quick
Wash
Glass
Care
Rinse
60
30
70
9
14.3 (3.8)
10.5 (2.8)
13 (3.4)
4.1 (1.1)
12.9-24.1
(3.4-6.4)
127-140
(53-60)
136 (58)
9.0-14.6
(2.4-3.9)
113-122
(45-50)
122 (50)
8.8-21
(2.3-5.5)
113-136
(45-58)
136 (58)
122 (50)
113 (45)
122 (50)
incoming
158 (70)
124 (51)
140 (60)
incoming
120-145
90-100
145-150
N/A
N/A
85
N/A
13.3-24.1
(3.5-6.4)
136 (58)
9.0-14.6
(2.4-3.9)
122 (50)
8.8-21
(2.3-5.5)
136 (58)
N/A
N/A
13 (3.4)
N/A
N/A
N/A
140 (60)
N/A
90-105
70-80
95-105
N/A
N/A
60
N/A
16.1-20.0
(4.3-5.3)
162 (72)
9.2-12.5
(2.4-3.3)
145 (63)
16.6-21.1
(4.4-5.6)
162 (72)
N/A
N/A
13.3 (3.5)
N/A
N/A
N/A
140 (60)
N/A
Dishwasher Cycle Options
Half Load
Cycle time
in min.
Water cons.
in L (gal)
Rinse temp.
in °F (°C)
Hygiene*
Cycle time
in min.
Water cons.
in L (gal)
Rinse temp.
in °F (°C)
Zeo Dry
Cycle time
in min.
Water cons.
in L (gal)
Rinse temp.
in °F (°C)
*sanitize
en-us
Normal
AUTO
AUTO*
AUTO
Delicate
150-160°F Wash
130-150°F 113-122°F
1-Hour
Wash
Quick
Wash
Glass
Care
Rinse
114
95-105
70-80
100-105
N/A
N/A
65
N/A
17.9 (4.7)
9.0-12.6
(2.4-3.9)
122 (50)
10.8-13.9
(2.9-3.7)
136 (58)
N/A
N/A
12 (3.2)
N/A
151 (66)
10.2-16.5
(2.7-4.4)
136 (58)
N/A
N/A
140 (60)
N/A
125-150
125-150
N/A
150-155
N/A
N/A
N/A
N/A
18.6-24.2
(4.9-6.4)
162 (72)
12.9-24.1
(3.4-6.4)
162 (72)
N/A
N/A
N/A
N/A
N/A
N/A
8.8-21
(2.3-5.5)
162 (72)
N/A
N/A
N/A
N/A
140-165
135-159
105-115
160-165
N/A
N/A
N/A
N/A
18.6-24.2
(4.9-6.4)
153 (67)
12.9-24.1
(3.4-6.4)
153 (67)
9.0-14.6
(2.4-3.9)
135 (57)
8.8-21
(2.3-5.5)
153 (67)
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
Note: Only sanitizing cycles have been designed to meet the requirements of Section 6 of the NSF/ANSI Standard
for Residential Equipment for soil removal and sanitization efficacy. There is no intention, either directly or indirectly,
to imply that all cycles have passed sanitization performance tests.
33
en-us
1
Operating the Dishwasher
Operating the Dishwasher
N ote: With hidden controls, the door must be opened
before changing settings and closed after changing
settings.
OpertaingheDiswaher
9 WARNING
Risk of injury!
To avoid risk of injury, always use caution when
opening the door during or following a wash cycle
as hot water or steam may escape. Do not fully
open the door until water noises have stopped
and steam has subsided.
Changing the settings
The dishwasher has been preset with certain settings
for your convenience. You can change these factory
settings.
Change the setting as follows:
1. Open the door.
2. Switch on On/Off button (.
3. Press Info button 8 for 3 seconds until the
following text is indicated in the digital display @:
Scroll with < >
Set with - +
Leave with Setup 3 sec.
Protection against unintentional
operation
Your dishwasher is equipped with a function that helps
to prevent unintentional operation (e.g. by children).
4. Keep pressing button > ` until the required setting
is indicated in the display window at the top @.
5. Make the selection with setting buttons + -X.
6. Press and hold the Info button 8 for 3 seconds.
After starting the dishwasher, the dishwasher door has
to be closed within 4 seconds, otherwise the operation
will be paused. There will be a signal on the control
panel advising you to press the Start button again and
close the door.
The chosen setting has now been stored.
This function will be activated when:
AquaSensor
▯
pressing Start to begin a wash cycle
▯
setting Delay time and pressing Start
▯
opening the door while Delay time is active
▯
opening the door during a wash cycle.
Note: This function cannot be deactivated.
Operating the touch buttons
Buttons are sensitive and should be touched gently.
Avoid any grease or food particles resting on the
buttons as they could activate the dishwasher.
Wiping and cleaning can also activate the dishwasher.
For best results, use bare, clean hands when touching
the buttons.
To clean the touch buttons wipe them with a dry or
slightly damp cloth.
34
Tip: If you change several settings, first make all
changes in succession. Now press the Info button 8
for 3 seconds. This saves all set values in the appliance.
The AquaSensor is an optical measuring device which
measures the cleanliness of the rinse water.
The AquaSensor is used according to the wash cycle. If
the AquaSensor is active, “clean” rinse water can be
transferred to the next rinse and water consumption can
be reduced by 0.8–1-5 gal (3–6 liters). If the rinse water
is not yet clear, the water is drained and is replaced with
fresh water. In the automatic wash cycles the
temperature and running time can also be adjusted to
the degree of soiling.
Operating the Dishwasher
Zeolite Drying
9 WARNING
Risk of burns!
Never touch the zeolite outlet cover 1R. It
becomes very hot during the cycle and could
cause burns if touched.
9 CAUTION!
Please ensure that the intake opening 1J is not
obstructed and do not place any temperaturesensitive dishware or utensils in the lower basket
at the rear right side above the zeolite outlet
cover 1R.
The appliance features a zeolite container. Zeolite is a
mineral which can store moisture and heat energy
and release them again.
During the washing step this heat energy is used to dry
the mineral and heat up the rinsing water.
During the drying phase moisture from the rinsing
compartment is stored in the mineral and heat energy
is released. This released heat energy is blown into
the rinsing compartment with dry air. This accelerates
and improves drying.
These processes therefore save a great deal of energy.
Time display
The wash cycle time is determined during the wash
cycle by the water temperature, the amount of dishes, as
well as the degree of soiling and may vary (depending
on the selected wash cycle). You can change the time
display into time of day or hours/minutes so that the
remaining cycle time of the wash cycle appears in the
display window “Finish at” (for example 15:20 o’clock)
or “Finish in” (for example 3:25 hours).
en-us
Sensor setting
The wash cycle sequence is optimized in Auto wash
cycles with the aid of sensors. The sensors adjust the
wash cycle strength of Auto wash cycles depending on
the amount and type of soiling. You can adjust the
sensitivity of the sensors in 3 stages.
Standard: This setting is recommend for daily regular or
typical use. This is the most energy efficient setting.
Sensitive: This setting adjusts the wash cycle strength
for the effective removal of food remnants, even if the
amount of soiling is low. The energy and water
consumption is increased accordingly.
Very sensitive: This setting adjusts the wash cycle
strength for difficult conditions of use, for example
firmly dried on food remnants. This setting is
recommended if using biological or eco detergents
which contain lower amounts of active agents. The
energy and water consumption is increased accordingly.
Extra Dry
The final rinse uses a higher temperature which
improves the drying result. The cycle time may increase
slightly. (Caution if utensils are delicate!) You can
switch the Extra Dry function on or off. There is a slight
increase in energy consumption.
Eco forecast
When Eco forecast is activated, the average water and
energy consumption of the selected wash cycle is
briefly displayed in the digital display @.
Auto power off
This setting determines the length of time the control
panel stays illuminated after the cycle is complete.
To save energy, the recommended setting is “after one
minute”.
Possible settings are:
Opening the door
▯
To open the door, press the upper middle part of the
door. The appliance opens automatically.
▯
If you have activated the child-proof lock, press twice in
quick succession at the upper middle part of the door.
▯
off: The appliance does not switch off automatically.
After one minute: The appliance switches off after
1 minute. This is the most energy efficient setting.
After two hours: The appliance switches off after
2 hours.
35
en-us
Operating the Dishwasher
Tone volume
Delay start time
The end of the wash cycle is indicated by a buzzer. You
can also change this setting.
You can delay the start of the wash cycle by up to
24 hours. Depending on the setting of the time display,
the end of cycle is indicated with “Finish in” (for
example 3h 25m) or “Finish at” (for example 15:20
hours).
Button volume
When you are operating the dishwasher, a signal
sounds whenever a button is pressed. You can control
the volume of the signal. If you do not like the button
volume, you can switch it off.
Child-proof lock *
T he dishwasher features an electronic child-proof lock.
The child-proof lock protects children from potential
hazards which the dishwasher poses.
Chi l d- pr o f l ock
You can switch the child-proof lock on or off. When the
child-proof lock is on, it is difficult to open the door.
* optional feature which may or may not be included with
your dishwasher.
1. Open the door.
2. Switch on On/Off switch (.
3. Select wash cycle 0.
4. Press Delay start button `.
5. Keep pressing the setting buttons + - X until the
displayed time corresponds with your requirements.
6. Press Start button )*, timer programming is
activated.
7. To delete the Delay start time, press Start button )*
for about 3 seconds.
8. Close the door.
When you switch on the dishwasher, the brand logo
appears. You can switch off the brand logo.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the Start
button, the operation will be paused. Press the Start
button again and close the appliance door.
Factory setting
InfoLight ® *
You can reset all settings to the factory setting.
* depending on the features of your dishwasher
Switching the appliance on
While the wash cycle is running, a light spot shines on
the floor under the appliance door.
Do not open the appliance door until the light point is
no longer visible on the floor.
If the appliance door is not completely closed, the light
spot flashes.
If the appliance is installed at eye-level, with flush
furniture front, the light point is not visible.
In darkened rooms, some light scattering may be visible.
This is normal and cannot be changed.
Greeting
1. Turn the water supply on fully.
2. Open the door.
3. Switch on On/Off switch (.
The Auto wash cycle has been preset as a default
whenever the appliance starts. This wash cycle
remains selected if no other wash cycle button 0
is pressed.
4. Press Start button )*.
5. Close the door.
Wash cycle sequence starts.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the Start
button, the operation will be paused. Press the Start
button again and close the appliance door.
36
You can switch the Infolight on or off.
Operating the Dishwasher
Remaining time projection
(Optical display while the wash cycle is
running) *
W hile wash cycle is running, an optical display
(additional cycle information) is indicated on the floor
under the appliance door. If the base panel is pulled
forwards or if the appliance is installed at eye-level with
flush furniture front, the display is not visible.
Remai ni ng t i me pr oj ect i on
en-us
Interrupting the wash cycle
9 CAUTION!
Expansion (overpressure) may cause the
appliance door to open and/or water to escape! If
the door was opened on an appliance which has a
hot water connection or is heated, always leave
the door ajar for several minutes and then close.
You can switch the optical display on or off.
* optional feature which may or may not be included with
your dishwasher.
EmotionLight
The EmotionLight 1" is on when the door is open
irrespective of whether the On/Off switch ( is
switched on or off. When the door is closed, the
EmotionLight is off. You can switch the EmotionLight on
or off.
Note: Note that when the door is open the EmotionLight
is automatically switched off after 1 hour.
Wash cycle end
The wash cycle has ended when “Finished” is indicated
on the digital display(s).
Switching off the appliance
Short time after the end of the wash cycle:
1. Press On/Off button (.
2. Remove the dishes when they have cooled down.
9 WARNING
Risk of injury!
To avoid risk of injury, always use caution when
opening the door during or following a wash cycle
as hot water or steam may escape. Do not fully
open the door until water noises have stopped
and steam has subsided.
1. Open the door.
2. Switch off On/Off switch (.
The LED’s go out. The wash cycle is saved.
3. To continue the wash cycle, switch on the On/Off
switch ( again.
4. Close the door.
Note: Your dishwasher is protected against
unintentional operation. If the appliance door remains
open for more than 4 seconds after pressing the Start
button, the operation will be paused. Press the Start
button again and close the appliance door.
Cancel a cycle (reset)
1. Open the door and press and hold the Start button
)* for approximately 3 seconds until the digital
display @ shows: "Program was terminated".
2. Close the door.
3. Wait about 1 minute while the dishwasher drains.
4. Open the door and press the On/Off switch (.
Changing the wash cycle
When the Start button ( has been pressed, the wash
cycle cannot be changed. The only way a wash cycle can
be changed is by terminating the wash cycle (Reset).
37
en-us
2
Care and Maintenance
Care and Maintenance
A regular inspection and maintenance of your machine
will help to prevent faults. This saves time and prevents
future problems.
CarendMaitenc
Cleaning the dishwasher
▯
Check rinsing compartment for grease and limescale
deposits.
If you find such deposits:
▯
Fill detergent dispenser 9: with detergent. Start
the appliance without utensils in the wash cycle with
the highest rinsing temperature.
9 WARNING
Health hazard due to detergents containing
chlorine!
Always use chlorine-free detergents.
▯
Regularly wipe the front of the appliance with a damp
cloth - water and a small amount of liquid soap is
adequate.
▯
For black stainless steel and anti-fingerprint
surfaces, use a soft, dry towel. For stubborn dirt, use
warm water diluted with a non-abrasive, mild
cleansing soap. Never use stainless steel polish.
▯
For stainless steel appliances (excluding black
stainless and anti-fingerprint), use a stainless steel
polish to seal and protect the surface.
▯
Clean the outer edges of the inside door panel
regularly to remove debris that may collect from
normal loading. If spots begin to appear on the
stainless steel, make sure the rinse aid dispenser is
full and functioning properly.
▯
Clean the door seal regularly with a damp cloth to
remove food particles that may collect from normal
loading and cause odor. A soiled door seal may not
seal properly.
38
NOTICE: ▯Never use a steam cleaner to clean your
dishwasher. The manufacturer is not liable for any
resulting damage.
▯
Do not use sponges as they could scratch the
surfaces.
▯
Do not use bleach-based wipes as they could
damage the surface or printing.
▯
Never use stainless steel polish on a black stainless
finish or anti-fingerprint surfaces.
9 WARNING
Use caution when removing parts for cleaning as
some debris may be sharp.
Special salt and rinse aid
Top off the salt and/or rinse aid as soon as the refill
indicators on the fascia P and H are lit.
Care and Maintenance
Filters
Cleaning intervals
Filter components
The filter system 1j is designed to minimize
maintenance while providing premium cleaning
performance and minimum energy consumption.
The filter system 1j consists of three parts.
$
%
&
A
Large Object Trap
Prevents objects that should not be placed in
your dishwasher from damaging the
dishwasher pump system or clogging your
household drain.
B
Flat Fine Filter
Prevents food particles from entering the
wash chamber and directs particles toward
the micro filter.
C
Micro Filter
Directs the smallest of particles to the
household plumbing drain.
en-us
Depending on use habits and water hardness, the filter
system will require some maintenance to sustain
premium cleaning performance.
Your filter system may need to be cleaned when:
▯
You notice food soils remaining on the filter system
or objects trapped in the Large Object Trap.
▯
A drop in cleaning performance or a gritty film forms
on the dishware.
When washing normally attached food soils that have
been scraped before loading, in a household that runs
the dishwasher every other day, your filter should be
cleaned:
Cleaning interval
3- 6 times a year
8-12 times a year
Usage
light to average use
heavy use
Note: Clean the filter after washing loads with large
amounts of food soils or loads with a heavy starch
content to maintain optimal performance.
39
en-us
Care and Maintenance
To check or clean the filter system:
1. After each wash cycle check the filters for residue.
5. Reinstall the filter system in reverse sequence and
lock into place by screwing the Large Object Trap
until the marking arrows align.
2. Unscrew the Large Object Trap as illustrated and
remove the entire filter system.
Spray arms
Limescale and contaminants in the rinsing water may
block nozzles and bearings on the spray arms 1:
and 1Z.
1. Check outlet nozzles on the spray arms
for blockages.
2. Unscrew the upper spray arm 1: (1) and remove
downwards (2).
3. Remove the lower spray arm 1Z upwards.
3. Remove the microfilter from the fine filter for easier
cleaning.
4. Rinse the filters under running water and use a soft
brush to clean.
Note:do not use abrasive brushes or steel wool, etc.,
as they may damage the filter.
40
4. Clean spray arms under running water.
5. Re-engage or screw on spray arms.
Care and Maintenance
Drain pump
en-us
7. Place pump cover in the original position (2) and
press down until it engages (3).
Large food remnants in the rinsing water not retained by
the filters may block the waste water pump. In this case:
9 WARNING
Use caution when removing parts for cleaning as
some debris may be sharp.
1. Disconnect the appliance from the power supply.
2. Take out upper rack 12 and lower rack 9*.
&OLFN
3. Remove the filters 1j.
4. Scoop out standing water - use a sponge if
necessary.
8. Place cover in the original position, press down and
engage.
5. Using a spoon, pry off the pump cover (as shown)
until it clicks, then grip the cover and pull upward
until it resists and then pull forward (1). Remove
cover completely.
9. Reinstall filters.
10. Re-insert racks.
Note: The drain pump will not work properly if the drain
pump cover is not snapped in completely until it clicks.
Preparing your unit for vacation
NOTICE: Before leaving for vacation during warmer
weather, besides turning off the main valve, also turn off
water supply at the nearest point to the dishwasher. Do
not leave soiled dishware in unit and leave door slightly
open. During colder weather, please follow the
instructions for winterizing your unit below.
Winterizing your unit
6. Check inner compartment and remove any foreign
objects.
9 WARNING
Use caution when removing parts for cleaning as
some debris may be sharp.
NOTICE: If your dishwasher will be unused for a
period of time in a location that experiences freezing
temperatures (holiday home or through a vacation
period), have your dishwasher winterized by a
professional service.
41
en-us
3
Troubleshooting
Error message
Troubleshooting
D ishwashers may occasionally exhibit problems that are
unrelated to a malfunction of the dishwasher itself. The
following information may help you with a dishwasher
problem without involving a repair professional.
Troubleshting
Note: If the appliance stops during dishwashing or does
not start for any obvious reason, first run the cancel
wash cycle function (Reset).
Some faults are indicated at the top of the display
window @ and on the front display * ): and possible
remedies are offered (for example Filter system soiled
(E22) -->Clean filters).
* optional feature which may or may not be included with
your dishwasher.
Fault table
9 WARNING
Improper repairs or use of non-original
replacement parts may cause considerable
damage and put the user at considerable risk!
Always have repairs carried out by authorized
technicians. If a component has to be replaced,
always use original replacement parts.
Fault
Error code “:‚‰ is lit.
Cause
Supply hose kinked.
Water supply turned off.
Water supply jammed or calcified.
Filter in the water supply blocked.
Error code “:‹ˆ is lit.
Error code “:‚ƒ is lit.
Error code “:ƒƒ is lit.
Error code “:ƒ… is lit.
42
Remedial action
Install supply hose without kinks.
Turn on the water supply.
Turn on the water supply.
Flow rate must be min. 10 l/min. when water
supply is open.
Switch off the dishwasher and pull out the
power supply plug. Turn off the tap.
Unscrew water connection.
Clean filter in the supply hose. Screw water
connection on again. Check for leaks.
Reconnect power supply. Switch on the
dishwasher.
Intake opening (on right inside of
Arrange dishes so that the intake opening is
dishwasher) covered by dishes.
not obstructed.
Heating element calcified or soiled.
Clean dishwasher with a dishwasher
cleaning agent or descaler. Operate the
dishwasher with water softening system and
check the setting.
Filters 1j are soiled or blocked.
Clean filters. ~ "Filters" on page 39
Waste-water hose kinked or blocked. Install hose without kinks, remove any
residue.
Siphon connection still sealed.
Check connection to siphon and open if
required.
Cover on the drain pump loose.
Lock cover correctly. ~ "Drain pump"
on page 41
Troubleshooting
Fault
Error code “:ƒ† is lit.
Error code “:ƒˆ is lit.
Cause
Drain pump blocked or cover on the
drain pump is not locked in position.
Supply voltage too low.
A different error code is
indicated on the digital display.
(“:‹‚ to “:„‹)
A technical fault has probably
occurred.
Home network is not loading.
Wi-Fi is not active on the router.
Wi-Fi display flashes
Connection to the home network is
not available.
Home Connect cannot be
Possible setting errors or a technical
implemented correctly.
fault.
Refill indicator for salt P and/ No rinse aid.
or rinse-aid H is lit.
No salt.
Sensor does not detect salt tablets.
Refill indicator for salt P and/ Refill indicator switched off.
or rinse-aid H is not lit.
There is still enough special salt/
rinse aid available.
Water is left in the dishwasher at Filter system or area under the filters
the end of the wash cycle.
1j is blocked.
Wash cycle has not ended yet.
Dishes not dry.
No or too little rinse aid in the
dispenser.
Wash cycle selected without drying.
Water collecting in depressions on
the dishes and silverware.
The combined detergent used has a
poor drying performance
extraDry to increase drying not
activated.
Dishes were removed too early or
drying process had not ended yet.
Plastic dishes not dry.
The eco rinse aid used has a limited
drying performance.
Inherent properties of plastic.
en-us
Remedial action
Clean pump and lock cover correctly.
~ "Drain pump" on page 41
Not a dishwasher fault, have the supply
voltage and electrical installation checked.
Switch off dishwasher with the On/Off
switch (. After a short time restart the
dishwasher.
If the problem recurs, turn off the tap and
pull out the power supply plug.
Call customer service and mention the error
code.
Check the wireless network connection of
your router.
Activate the wireless network on your router.
Observe the supplied documents and
support information for Home Connect.
Refill rinse aid.
Refill with dishwasher softener salt.
Use different dishwasher softener salt.
Activation/deactivation ~ ", Rinse Aid"
on page 18, ~ "+ Water softening system /
special salt" on page 16
Check refill indicator, levels.
Clean filters and area underneath.
Wait until wash cycle ends or reset.
Refill rinse aid.
Select wash cycle with drying.
~ "Dishwasher Cycles" on page 31
Arrange dishes in a sloping position,
arrange affected dishes as sloping as
possible.
Use different combination detergent with
better drying performance. Use of rinse aid
also increases the drying performance.
Activate extraDry. ~ "Dishwasher Cycle
Options" on page 32
Wait until wash cycle ends or wait until 30
min after wash cycle ends before removing
dishes.
Use a proprietary rinse aid. Eco products
may have limited effectiveness.
Plastics do not absorb heat and therefore
do not dry as well.
43
en-us
Troubleshooting
Fault
Silverware not dry.
Dishwasher interior wet after
rinse cycle.
Food soils on the dishes.
Cause
Silverware not arranged properly in
the silverware basket.
Silverware not arranged properly in
the third rack.
No dishwasher fault.
Dishes placed too closely together,
racks overfilled.
Spray arm rotation obstructed.
Spray arm nozzles are blocked.
Filters 1j dirty.
Filters 1j inserted incorrectly and/
or not engaged.
Rinse wash cycle too weak.
Dishwasher seems to run a long
time
44
Remedial action
Separate silverware if possible, prevent
contact points.
Arrange silverware properly and separate if
possible.
With “condensation drying”, steam
condenses into water droplets onto the
walls of the dishwasher tank. The steam
pressure inside the dishwasher pumps the
water out of the dishwasher.
Arrange dishes with adequate clearance
between them ensuring that the spray jets
can reach the surface of the dishes. Prevent
contact points.
Arrange dishes so that the spray arm can
rotate without obstruction.
Clean the spray arm nozzles. ~ "Care and
Maintenance" on page 38
Clean filters. ~ "Care and Maintenance"
on page 38
Insert and engage filters correctly.
Select a more intensive rinse cycle.
Increase sensitivity of the sensors.
Dishes precleaned too intensely;
Do not pre-rinse dishes. Remove only large
sensors therefore decide on weak
food soils.
wash cycle sequence. Stubborn
Increase sensitivity of the sensors.
soiling cannot be completely
Recommended wash cycle "Normal" or
removed.
Intensive.
Tall narrow containers in corner areas Do not lean hollow containers too much and
are not rinsed adequately.
do not place them in the corner area.
Upper rack 12 on right and left not Set upper rack to same height using side
set to same height.
levers.
Incoming water is not warm enough. Before starting a cycle, run hot water faucet
at the sink closest to the dishwasher.
Cycle time can vary due to soil and
Sensors in the dishwasher automatically
water conditions.
increase the cycle time to ensure a good
wash when heavy soil is detected.
Rinse aid dispenser 92 is empty.
Add rinse aid.
Dishwasher connected to cold water Verify dishwasher is connected to hot water
supply.
supply plumbing.
Note:Check the typical wash cycle
length.
Troubleshooting
Fault
Detergent residue.
Water stains on plastic parts.
Washable or water-soluble
coatings in the container or on
the door.
White, stubborn coatings;
limescale on the dishes,
container or door.
Cause
Detergent dispenser cover 9:
blocked by dishes and therefore does
not open fully.
Detergent dispenser cover 9:
blocked by the detergent tab.
Detergent tab used in the quick or
short wash cycle.
Dissolving time of the detergent is
not reached in the selected short
wash cycle.
Washing effect and dissolving
performance are reduced after a
prolonged storage time or detergent
is very lumpy.
Droplet formation on plastic surface
is physically unavoidable. After
drying, water stains are visible.
en-us
Remedial action
Dishes must not be placed above the
detergent tab tray 1B. These may block the
lid of the detergent dispenser and prevent it
from opening fully.
Do not place dishes or fragrance dispenser
in the detergent tab tray.
Detergent tab must be inserted flat and not
upright.
Dissolving time of detergent tab too long for
a quick or short wash cycle.
Use a detergent powder or select a more
intensive wash cycle.
Change detergent.
Use a more intensive wash cycle (more
water changes).
Arrange dishes in a sloping position.
Use rinse aid.
If required, increase softening setting.
Detergent substances are deposited. Change detergent brand.
These coatings cannot usually be
Clean dishwasher mechanically.
removed with chemicals (dishwasher
cleaner, ...).
If there is a “white coating” on the
Increase softening setting and change
container floor, the water softening
detergent if required.
system has been set very low.
Salt dispenser cover 1b not closed. Close salt dispenser cover correctly.
Only for glasses: Initial glass
See . ~ "Glass and silverware damage"
corrosion – can only apparently be
on page 20
wiped off.
Detergent substances are deposited. Change detergent brand.
These coatings cannot usually be
Clean dishwasher mechanically.
removed with chemicals (dishwasher
cleaner, ...).
Hardness range incorrectly set or
Set water softening system according to
water hardness greater than
instructions for use or top up salt.
8.9 mmol/l.
3 in 1 detergent or bio/eco detergent Set water softening system according to
not effective enough.
instructions for use or use separate
detergents (proprietary detergent, salt,
rinse aid).
Underdosing of detergent.
Increase detergent dosage or change
detergent.
Too weak rinse cycle selected.
Select a more intensive rinse cycle.
45
en-us
Troubleshooting
Fault
Tea or lipstick residue on the
dishes.
Cause
Too low rinsing temperature.
Too little or unsuitable detergent.
Dishes precleaned too intensely;
sensors therefore decide on weak
wash cycle sequence. Stubborn
soiling cannot be completely
removed.
Colored (blue, yellow, brown),
Film formation consisting of
difficult to remove to noningredients from vegetables (e.g.
removable coatings in the
cabbage, celery, potatoes, noodles,
dishwasher or on stainless steel ...) or the tap water (e.g. manganese).
dishes.
Film formation caused by metallic
components on silver or aluminum
silverware.
Colored (yellow, orange, brown), Film formation consisting of
easily removable deposits inside ingredients from food soils and
the dishwasher (mainly in the
substances from the tap water
floor area)
(limescale), “soapy”
Discoloration of the plastic parts Plastic parts inside the dishwasher
inside the dishwasher.
may become discolored during the
service life of the dishwasher.
Plastic parts discolored.
Too low rinsing temperature.
Remedial action
Select wash cycle with higher washing
temperature.
Use suitable detergent at correct dosage.
Do not pre-rinse dishes. Remove only large
food soils.
Increase sensitivity of the sensors.
Recommended wash cycle "Normal"
Can be partly removed with machine cleaner
or by mechanical cleaning. Coatings are
harmless.
Can be partly removed with machine cleaner
or by mechanical cleaning.
Check function of the water softening
system (refill with salt) or, if using combined
detergents (tablets), activate water
softening system. ~ "Water softening
system / special salt" on page 16
Discoloration is normal and will not impair
the function of the dishwasher.
Select wash cycle with higher washing
temperature.
Do not pre-rinse dishes. Remove only large
food soils.
Increase sensitivity of the sensors.
Recommended wash cycle "Normal"
Dishes precleaned too intensely;
sensors therefore decide on weak
wash cycle sequence. Stubborn
soiling cannot be completely
removed.
Removable streaks on glasses,
Too much rinse aid.
Set rinse aid amount to lower setting.
glasses with metallic appearance No rinse aid added or setting too low. Add rinse aid and check dosage
and silverware.
(recommended setting 4–5).
Detergent dispenser cover must not be
Detergent residue in the final rinse
obstructed by dishes.
wash cycle section. Detergent
dispenser cover blocked by dishes
Do not place dishes or fragrance dispenser
(cover does not open fully).
in the detergent tab tray.
Dishes precleaned too intensely;
Do not pre-rinse dishes. Remove only large
sensors therefore decide on weak
food soils.
wash cycle sequence. Stubborn
Increase sensitivity of the sensors.
soiling cannot be completely
Recommended wash cycle “Normal”
removed.
Initial or existing, irreversible
Glasses not dishwasher-proof, only
Use dishwasher-proof glasses.
clouding of glass.
suitable for dishwasher.
Avoid long steam phase (standing time after
wash cycle ends).
Use wash cycle at lower temperature.
Set water softening system according to the
water hardness (if required one setting
lower).
Use detergent with glass protection
component.
46
Troubleshooting
Fault
Rust spots on the silverware.
Dishwasher cannot be switched
on or operated.
Dishwasher does not start.
Cause
Silverware not adequately rustresistant. Knife blades are frequently
more severely affected.
Silverware will also rust if rusting
parts are rinsed at the same time (pan
handles, damaged utensil baskets,
etc.).
Salt content in the rinsing water too
high, as salt dispenser lock not
fastened firmly or salt was spilled
while being refilled.
Malfunction.
Power supply fuse may have been
blown or circuit breaker tripped.
Door may not be properly latched.
Unit may not be turned on.
Delay start may be engaged.
Child lock is activated.
The door may have been closed
without first selecting a cycle.
Power cord not inserted.
The water supply may not be
connected.
The dishwasher door has not been
shut properly.
The door has been open for more
than 4 seconds after pressing the
START button.
Wash cycle starts automatically.
You did not wait until wash cycle
ended.
en-us
Remedial action
Use corrosion-resistant silverware.
Do not wash rusting parts.
Fasten salt dispenser lock firmly or remove
spilled salt.
Disconnect dishwasher from the power
supply; pull out the power supply plug or
switch off the fuse. Wait at least 5 seconds,
then connect the dishwasher to the power
supply.
Replace blown fuse or reset tripped circuit
breaker.
Press the main power switch to turn unit on.
Shut door completely.
To reset, refer to “Delay start” section in this
manual.
Deactivate the child lock. Refer to “Child
Lock” section in this manual if applicable.
Select a cycle and close the door.
Ensure that the power cord is plugged all
the way into the back of the dishwasher and
into the socket. Check that the socket
functions.
Check and turn on water supply.
Close the door.
Press the START button again and close the
dishwasher door within 4 seconds (see
“Protection against unintentional
operation”).
Perform reset.
(see “Canceling the wash cycle“).
47
en-us
Troubleshooting
Fault
Door does not open.
Cause
Door is not set correctly.
Remedial action
Set the door correctly with the aid of the
installation instructions.
Child lock is activated.
Press twice in quick succession at the top
of the door in the middle.
Dishwasher is disconnected from the Check power supply plug and fuses.
power supply.
Attach supplied emergency release to upper
right and left of the furniture panel and open
the door by gently pulling the emergency
release.
Door and door seal dirty.
Door does not close.
Cover on the detergent
dispenser cannot be closed.
Detergent residue in the
detergent dispenser 9: or in
the detergent tab tray 1B.
Dishwasher stops in the wash
cycle or wash cycle is
interrupted.
Filling valves making striking
noises.
Knocking or rattling noise.
Unusual foam formation.
--------
48
Clean door and door seal with a damp cloth
and a little washing-up liquid.
Automatic door opening system not in After closing the door, wait one second until
home position.
it can be opened again.
Automatic door opening system not in After opening the door, wait one second
home position.
until it can be closed again.
Detergent dispenser or cover guide
Remove detergent residue.
blocked by sticky detergent residue.
Spray arms blocked by dishes,
Ensure that the spray arms can rotate freely.
therefore detergent is not rinsed out.
The detergent dispenser was damp
Pour detergent into the dry detergent
when filled.
dispenser only.
Door not closed properly.
Close the door.
Do not place dishes or fragrance
Check whether rear panel is being pressed
dispenser in the detergent tab tray.
in, e.g. by socket or by hose holder which
Upper rack presses against the door has not been removed.
and prevents door from being closed
securely.
Power and/or water supply
Restore power and/or water supply.
interrupted.
Depends on domestic installation, as No remedial action possible.
dishwasher is not defective. No effect
on dishwasher function.
Spray arm strikes the dishes, dishes Position dishes so that the spray arms do
not positioned correctly.
not strike the dishes.
If there is a low load, the water jets
Load the dishwasher with more dishes or
strike the washing tank directly.
distribute the dishes more evenly in the
dishwasher.
Light dishes move during the wash
Arrange light dishes securely.
cycle.
Handwash liquid in the rinse aid
Immediately refill rinse aid dispenser with
dispenser.
rinse aid.
Rinse aid spilled.
Remove rinse aid with a cloth.
Customer Service
4
Customer Service
Y our dishwasher requires no special care other than
that described in the Care and Maintenance section of
this manual. If you are having a problem with your
dishwasher, before calling for service please refer to the
Troubleshooting Guide section of the manual. If service
is necessary, contact your dealer or installer or an
authorized service center. Do not attempt to repair the
appliance yourself. Any work performed by unauthorized
personnel may void the warranty.
CustomerSvice
If you are having a problem with your dishwasher and
are not pleased with the service you have received,
please take the following steps until the problem is
corrected to your satisfaction:
‡
W hat this Warranty Covers & Who it
Applies to:
The limited warranty provided by BSH Home Appliances
(Gaggenau ® ) in this Statement of Limited Product
Warranty applies only to the Gaggenau appliance
(“Product”) sold to you, the first using purchaser,
provided that the Product was purchased:
▯
for your normal, household (non-commercial) use,
and has in fact at all times only been used for normal
household purposes;
▯
new at retail (not a display, “as is”, or previously
returned model), and not for resale, or commercial
use; and
▯
within the United States or Canada, and has at all
times remained within the country of original
purchase. The warranties stated herein apply only to
the first purchaser of the Product and are not
transferable.
service provider in your area.
website, www.gaggenau-usa.com
3. Call us at 877-442-4436
4. Write us:
®
Gaggenau
1901 Main Street, Suite 600
Irvine, CA 92614
USA
Please be sure to include your model information as
well as an explanation of the problem and the date it
started. You will find the model and serial number
information on the label located on the edge of the
dishwasher door. Please make a copy of your invoice
and keep it with this manual. The customer may be
required to show proof of purchase to validate warranty
coverage.
Statement of Limited Product Warranty
StaemnofLimtedProucWarnty
1. Contact your installer or the Gaggenau ® authorized
2. E-mail us from the customer service section of our
en-us
Gaggenau reserves the right to request proof of
purchase at the time any warranty claim is submitted to
confirm that the Product falls within the scope of this
limited product warranty.
Please make sure to return your registration card; while
not necessary to effectuate warranty coverage, it is the
best way for Gaggenau to notify you in the unlikely event
of a safety notice or product recall.
How Long the Warranty Lasts
Gaggenau warrants that the Product is free from
defects in materials and workmanship for a period of
seven hundred thirty (730) days (2 years) from the date
of purchase. The foregoing timeline begins to run upon
the date of purchase, and shall not be stalled, tolled,
extended, or suspended, for any reason whatsoever.
This Product is also warranted to be free from cosmetic
defects in material and workmanship (such as scratches
of stainless steel, paint/porcelain blemishes, chip,
dents, or other damage to the finish of the Product), for
a period of thirty (30) days from the date of purchase or
closing date for new construction. This cosmetic
warranty excludes slight color variations due to inherent
differences in painted and porcelain parts, as well as
differences caused by kitchen lighting, product location,
or other similar factors. This cosmetic warranty
specifically excludes any display, floor, “As Is”, or “B”
stock appliances.
49
en-us
Statement of Limited Product Warranty
Repair/Replace as Your Exclusive
Remedy
During this warranty period, Gaggenau or one of its
authorized service providers will repair your Product
without charge to you (subject to certain limitations
stated herein) if your Product proves to have been
manufactured with a defect in materials or workmanship.
If a reasonable number attempts to repair the Product
have been made without success, then Gaggenau will
replace your Product (upgraded models may be
available to you, in Gaggenau’s sole discretion, for an
additional charge). All removed parts and components
shall become the property of Gaggenau at its sole
option. All replaced and/or repaired parts shall assume
the identity of the original part for purposes of this
warranty and this warranty shall not be extended with
respect to such parts. Gaggenau’s sole liability and
responsibility hereunder is to repair manufacturerdefective Product only, using a Gaggenau-authorized
service provider during normal business hours. For
safety and property damage concerns, Gaggenau highly
recommends that you do not attempt to repair the
Product yourself, or use an unauthorized servicer;
Gaggenau will have no responsibility or liability for
repairs or work performed by a non-authorized servicer.
If you choose to have someone other than an authorized
service provider work on your Product, THIS WARRANTY
WILL AUTOMATICALLY BECOME NULL AND VOID.
Authorized service providers are those persons or
companies that have been specially trained on
Gaggenau products, and who possess, in Gaggenau’s
opinion, a superior reputation for customer service and
technical ability (note that they are independent entities
and are not agents, partners, affiliates or
representatives of Gaggenau). Notwithstanding the
foregoing, Gaggenau will not incur any liability, or have
responsibility, for the Product if it is located in a remote
area (more than 100 miles from an authorized service
provider) or is reasonably inaccessible, hazardous,
threatening, or treacherous locale, surroundings, or
environment; in any such event, if you request,
Gaggenau would still pay for labor and parts and ship
the parts to the nearest authorized service provider, but
you would still be fully liable and responsible for any
travel time or other special charges by the service
company, assuming they agree to make the service call.
50
Out of Warranty Product
Gaggenau is under no obligation, at law or otherwise, to
provide you with any concessions, including repairs,
pro-rates, or Product replacement, once this warranty
has expired.
Warranty Exclusions
The warranty coverage described herein excludes all
defects or damage that are not the direct fault of
Gaggenau, including without limitation, one or more of
the following:
▯
Use of the Product in anything other than its normal,
customary and intended manner (including without
limitation, any form of commercial use, use or
storage of an indoor product outdoors, use of the
Product in conjunction with air or water-going
vessels);
▯
Any party’s willful misconduct, negligence, misuse,
abuse, accidents, neglect, improper operation,
failure to maintain, improper or negligent installation,
tampering, failure to follow operating instructions,
mishandling, unauthorized service (including selfperformed “fixing” or exploration of the appliance’s
internal workings);
▯
Adjustment, alteration or modification of any kind;
▯
A failure to comply with any applicable state, local,
city, or county electrical, plumbing and/or building
codes, regulations, or laws, including failure to
install the product in strict conformity with local fire
and building codes and regulations;
▯
Ordinary wear and tear, spills of food, liquid, grease
accumulations, or other substances that accumulate
on, in, or around the Product;
▯
Any external, elemental and/or environmental forces
and factors, including without limitation, rain, wind,
sand, floods, fires, mud slides, freezing
temperatures, excessive moisture or extended
exposure to humidity, lightning, power surges,
structural failures surrounding the appliance, and
acts of God.
Statement of Limited Product Warranty
In no event shall Gaggenau have any liability or
responsibility whatsoever for damage to surrounding
property, including cabinetry, floors, ceilings, and other
structures or objects around the Product. Also excluded
from this warranty are Products on which the serial
numbers have been altered, defaced, or removed;
service visits to teach you how to use the Product, or
visits where there is nothing wrong with the Product;
correction of installation problems (you are solely
responsible for any structure and setting for the
Product, including all electrical, plumbing or other
connecting facilities, for proper foundation/flooring,
and for any alterations including without limitation
cabinetry, walls, floors, shelving, etc.); and resetting of
breakers or fuses.
en-us
How to Obtain Warranty Service
To obtain warranty service for your Product, you should
contact the nearest Gaggenau authorized service
center.
TO THE EXTENT ALLOWED BY LAW, THIS
WARRANTY SETS OUT YOUR EXCLUSIVE REMEDIES
WITH RESPECT TO PRODUCT, WHETHER THE
CLAIM ARISES IN CONTRACT OR TORT (INCLUDING
STRICT LIABILITY, OR NEGLIGENCE) OR
OTHERWISE. THIS WARRANTY IS IN LIEU OF ALL
OTHER WARRANTIES, WHETHER EXPRESS OR
IMPLIED. ANY WARRANTY IMPLIED BY LAW,
WHETHER FOR MERCHANTABILITY OR FITNESS
FOR A PARTICULAR PURPOSE, OR OTHERWISE,
SHALL BE EFFECTIVE ONLY FOR THE PERIOD THAT
THIS EXPRESS LIMITED WARRANTY IS EFFECTIVE.
IN NO EVENT WILL THE MANUFACTURER BE LIABLE
FOR CONSEQUENTIAL, SPECIAL, INCIDENTAL,
INDIRECT, “BUSINESS LOSS”, AND/OR PUNITIVE
DAMAGES, LOSSES, OR EXPENSES, INCLUDING
WITHOUT LIMITATION TIME AWAY FROM WORK,
HOTELS AND/OR RESTAURANT MEALS,
REMODELLING EXPENSES IN EXCESS OF DIRECT
DAMAGES WHICH ARE DEFINITIVELY CAUSED
EXCLUSIVELY BY BSH, OR OTHERWISE. SOME
STATES DO NOT ALLOW THE EXCLUSION OR
LIMITATION OF INCIDENTAL OR CONSEQUENTIAL
DAMAGES, AND SOME STATES DO NOT ALLOW
LIMITATIONS ON HOW LONG AN IMPLIED
WARRANTY LASTS, SO THE ABOVE LIMITATIONS
MAY NOT APPLY TO YOU. THIS WARRANTY GIVES
YOU SPECIFIC LEGAL RIGHTS, AND YOU MAY ALSO
HAVE OTHER RIGHTS WHICH VARY FROM STATE TO
STATE. No attempt to alter, modify or amend this
warranty shall be effective unless authorized in writing
by an officer of BSH.
51
en-us
5
Installation and connection
Installation and connection
Technical specifications
▯
T he dishwasher must be connected correctly, otherwise
it will not function properly. The specifications
for the inlet and outlet as well as the electrical
connected loads must correspond with the required
criteria as specified in the following paragraphs or in
the installation instructions.
Instal ionadcetion
Weight:
up to 132 lbs (60 kg)
▯
Voltage:
120 V, 60 Hz
▯
Install the appliance in the correct sequence:
Connected load:
1,440 W.
1. Checking appliance on delivery
▯
2. Installation
Circuit breaker:
12 A
3. Drainage connection
▯
Power input:
4. Tap water connection
5. Electrical connection
Parts included
If you have any complaints, contact the dealer from
whom you purchased the appliance or our customer
services department.
▯
Dishwasher
▯
User manual
▯
Installation instructions
▯
Quick reference guide*
▯
Warranty*
▯
Installation materials
▯
Steam guard plate*
▯
Rubber apron*
▯
Power cord
Off-mode / standby mode
Left-on mode
Networked standby
Duration of left-on mode
Time after which appliance
is switched to networked
standby mode
0.50 W
0.50 W
2.00 W
0 min
2 min
Complies with the latest regulations (EU) for energy
label and ecological design at the time of placing on
the market.
Additional functions and settings may increase
power input and times.
▯
Water pressure:
at least 7.25 PSI (0.5 bar), maximum 145 PSI (10
bar).
At a higher water pressure:
connect pressure-reducing valve ahead.
▯
Inlet rate:
minimum 2.65 gallons/minute (10 liters/minute)
* depending on the features of your dishwasher
▯
Cold water.
Hot water:
Maximum temperature 140° F (60 °C).
Safety instructions
Please refer to the Important Safety Instructions for
installation that are included in the separate Installation
Instructions for your appliance.
Delivery
Your dishwasher has been checked
thoroughly in the factory to ensure that it is in working
order. This may cause small water stains. These will
disappear after the first wash cycle.
52
Water temperature:
▯
Capacity:
12–15 place settings (depending on the features of
your dishwasher).
Installation and connection
Installation
Water supply connection
The required installation dimensions can be
found in the installation instructions. Level
the appliance with the aid of the height-adjustable feet.
Ensure that the appliance is situated
securely on the floor.
1. Fasten the water supply connection to the tap
▯
▯
A built-under or integrated appliance which is
installed subsequently as a free-standing appliance
must be secured to prevent it from overturning, e.g.
by screwing it to the wall or by installing it under a
continuous worktop which is screwed to adjacent
cupboards.
The appliance can easily be installed in a fitted
kitchen between wooden and plastic walls.
en-us
according to the installation instructions using
the enclosed parts.
Ensure that the water supply connection is not
kinked, crushed or twisted.
2. When replacing the appliance, always use a new
water supply hose.
Water pressure:
At least 7.25 PSI (0.5 bar), maximum 145 PSI (10 bar).
At a higher water pressure:
connect pressure-reducing valve ahead.
Inlet rate:
Drain connection
Minimum 2.65 gallons/minute (10 liters/minute)
1. The required work sequence can be
Water temperature:
found in the installation instructions. If required, fit
a siphon with a drain connection.
2. Connect the drain hose to the drain
Cold water.
Hot water:
Maximum temperature 140° F (60 °C).
connection of the siphon with the enclosed parts.
Ensure that the drain hose is not kinked, crushed
or twisted and that there is no cover
plate in the drainage to prevent the drain water from
flowing out!
53
en-us
Installation and connection
Hot water connection *
T he dishwasher can be connected to cold or hot water
up to max. 140° F (60 °C). Connection to hot water is
recommended if the hot water can be supplied by
energetically favourable means and from a suitable
installation, e.g. solar heating system with circulation
line. This will save energy and time. The “Hot water”
setting allows you to adjust your dishwasher optimally to
operation with hot water. It is recommended to have a
water temperature (temperature of the incoming water)
of at least 104° F (40 °C) and no more than 140° F
(60 °C). It is not recommended to connect the
appliance to hot water if the water is supplied from an
electric boiler.
Electrical connection
Hot wat er con ect i on
▯
Connect the appliance to an 120 V, 60 Hz alternating
current only, via a correctly installed outlet with
protective grounding conductor. See rating plate for
required fusing 9J.
▯
The outlet must be near the appliance and freely
accessible after the installation.
If the plug is not freely accessible, an allpole
disconnector with a contact opening of at least 3 mm
must be fitted on the installation side to satisfy the
relevant safety instructions.
▯
The connection may be modified by technicians only.
▯
A power cord extension may be purchased from
customer service only.
▯
Use only a residual current operated circuit-breaker
which features the symbol ‚. Only this extension
guarantees compliance with the currently valid
regulations.
▯
The appliance features a water damage protection
system. Please note the system will function only
when the power supply is connected.
To change the setting:
1. Open the door.
2. Switch on ON/OFF switch (.
3. Press Info button ( 8 for 3 seconds until the
following text is indicated on the display window at
the top @:
Scroll with < >
Set with - +
Leave with t 3 sec.
4. Keep pressing the button > ` until water
connection appears of the display window at the top
@.
5. Make the selection with setting buttons + -X.
6. Press and hold the Info button (8 for 3 seconds.
The chosen setting has now been stored.
* optional feature which may or may not be included with
your dishwasher.
Removing the appliance
Also observe the sequence of worksteps here.
1. Disconnect the appliance from the power supply.
2. Turn off the tap.
3. Undo the drain water and water supply connection.
4. Loosen fastening screws for the cabinet parts.
5. If fitted, remove the base panel.
6. Pull out the appliance, carefully pulling the hose
behind.
54
Installation and connection
en-us
Transporting the appliance
Securing the appliance against frost
Empty the dishwasher and secure loose parts.
If the appliance is in a room where there is a risk of frost
(e.g. holiday home), empty the appliance completely
(see “Transporting the appliance”).
Drain the appliance according to the following steps:
1. Turn on the tap.
2. Open the door.
3. Switch on ON/OFF button (.
4. Select wash cycle with the highest temperature.
The estimated wash cycle duration is indicated on
the digital display @.
5. Press START button )*.
6. Close the door.
Wash cycle sequence starts.
7. Open the door after approx. 4 minutes.
8. Press START button )* until “Program was
terminated”/“Ready in one minute.” is indicated at
the digital display @.
9. Close the door.
10. Open the door after approx. 1 minute.
The digital display @ indicates; “Finished”.
11. Switch off ON/OFF switch (.
12. Turn off the tap, disconnect supply hose and drain
water.
Note: Transport appliance upright only. This prevents
residual water from running into the machine control
and damaging the wash cycle sequence.
55
en-us
56
Installation and connection
Installation and connection
fr-ca
Table des matières
fr-ca Not i c e d' u t i l i s a t i o n
(
(
Indications de sécurité
60
CONSIGNES DE SÉCURITÉ IMPORTANTES
61
Risque d'incendie, de choc électrique,
ou de blessures graves
INSTRUCTIONS DE MISE À LA TERRE
Fonctionnement normal
Sécurité pour enfants
Entretien et maintenance corrects
ƒ
*
61
62
63
64
64
Causes de pannes
65
Mise en marche
66
Vue d'ensemble de l'appareil
Panneau de commande
Composants internes du lave-vaisselle
Indicateurs
Bouton Information
Réglage de l'heure
Première mise sous tension de l'appareil
Réglages
66
67
67
67
68
68
69
69
Home Connect™
71
Configurer l’app
Configuration de Home Connect
Wi-Fi |
Connexion au réseau
Connexion à l'application
Bouton de télédémarrage
Wi-Fi sans connexion au serveur Home Connect
Diagnostic à distance
71
71
71
71
71
72
72
72
Système d'adoucissement de l'eau / sels
73
Tableau de dureté de l'eau
Réglage du système d'adoucissement de l'eau
Utilisation des sels spéciaux
Détergent chargé en sels
Éteindre le système d'adoucissement de l'eau
73
73
74
74
74
+
,
Produit de rinçage
Ajout d'agent de rinçage
Réglage de la quantité de produit
de rinçage utilisé
Éteindre l'indicateur d'agent de remplissage
de rinçage
-
Chargement du lave-vaisselle
Matériaux lavables au lave-vaisselle
Dégâts causés à la verrerie et l'argenterie
Chargement des paniers
Mode de chargement recommandé
Chargement du panier à ustensiles
Accessoires de panier
Retrait de la vaisselle
Réglage de la hauteur du panier
Panier supérieur avec leviers latéraux
Retirer/installer le troisième panier
Retirer/installer le panier supérieur *
Retirez/installez le panier inférieur
.
Détergent
75
75
76
76
77
77
77
78
78
79
80
82
83
83
84
85
86
87
Ajout de détergent
Détergent multifonctionnels
87
88
Cycles du lave-vaisselle
89
Options de cycles du lave-vaisselle
90
/
0
Zone intensive
Puissance
Half Load (Chargement partiel)
Hygiène
Zeo Dry (Extra Dry avec Zéolite)
Informations sur le cycle de lavage
90
90
90
90
90
90
57
fr-ca
1
Installation and connection
Mise en marche du lave-vaisselle
Protection contre une opération involontaire
Utilisation des boutons tactiles
Modification des réglages
AquaSensor
Système de séchage zéolite
Affichage de l'heure
Ouvrir la porte
Sensor setting (réglage du capteur)
Extra Dry (extra sec)
Impact écologique
Auto power off (Arrêt automatique)
Volume de la sonnerie
Bouton de volume
Sécurité enfants
Message de bienvenue
Réglages d'usine
Mise sous tension de l'appareil
Temps de départ différé
InfoLight ® *
Projection du temps restant
EmotionLight
Fin du cycle de lavage
Mise hors tension de l'appareil
Interruption du cycle de lavage
Arrêt du cycle de lavage (réinitialisation)
Changement du cycle de lavage
2
Entretien et maintenance
Nettoyer le filtre du lave-vaisselle
Sels et agent de rinçage
Filtres
Bras gicleurs
Pompe pour eaux résiduaires
Rangement de l'appareil en cas d'inactivité
Préparation de l'appareil pour l'hiver
58
92
92
92
92
93
93
93
93
93
94
94
94
94
94
94
94
94
94
95
95
95
95
95
95
96
96
96
96
96
97
97
99
100
101
101
3
Dépannage
101
Message d'erreur
Tableau des défaillances
101
102
Service à la clientèle
111
4
‡
Déclaration de la garantie limitée du produit 111
Ce que couvre cette garantie et à
qui elle s'applique :
Durée de la garantie
Réparer/Remplacer, comme recours exclusif
Produit hors garantie
Exclusions de garantie
Comment bénéficier d'un service de garantie
5
Installation et raccordement
Pièces incluses
Consignes de sécurité
Livraison
Données techniques
Installation
Raccordement du boyau d'évacuation
Raccordement à l'eau courante
Raccordement d’eau chaude
Raccordement électrique
Dépose de l'appareil
Transport de l'appareil
Protection de l'appareil contre le gel
111
112
112
112
113
113
114
114
114
114
114
115
115
115
116
116
116
117
117
Installation and connection
fr-ca
Š
)pOLFLWDWLRQVHWPHUFLGH*DJJHQDX 0HUFLG·DYRLUFKRLVLXQODYHYDLVVHOOH*DJJHQDX9RXVUHMRLJQH]OHVQRPEUHX[FRQVRPPDWHXUVTXLH[LJHQWXQ
UHQGHPHQWVLOHQFLHX[HWVXSpULHXUG·XQODYHYDLVVHOOH
&HJXLGHDpWppFULWHQYXHGHODVpFXULWpHWGXF{WpSUDWLTXHHWO·LQIRUPDWLRQFRQWHQXHLFLHVWWUqVLPSRUWDQWH
1RXVUHFRPPDQGRQVGHOLUHFHJXLGHDYDQWG·XWLOLVHUOHODYHYDLVVHOOHODSUHPLqUHIRLV
3RXUHQFRQQDvWUHG·DYDQWDJHVXUOHODYHYDLVVHOOHHWOHVDFFHVVRLUHVGLVSRQLEOHVDLQVLTXHVXUOHVDXWUHV
DSSDUHLOV*DJJHQDXGHKDXWHTXDOLWpYLVLWHUOHVLWHZZZJDJJHQDXXVDFRP
3RXUWRXWHTXHVWLRQRXWRXWFRPPHQWDLUH
*DJJHQDX
0DLQ6WUHHW6XLWH
,UYLQH&$
86$
3KRQH
LQIR#JDJJHQDXXVDFRP
ZZZJDJJHQDXXVDFRP
59
fr-ca
(
Indications de sécurité
Indications de sécurité
Indiactosdeuécrit
9 AVERTISSEMENT
Ceci indique des risques de blessures graves ou
mortelles en cas de non-respect de cette mise en
garde.
9 ATTENTION !
Ceci indique des risques de blessures mineures
ou de gravité moyenne en cas de non-respect de
cette mise en garde.
AVIS : Ceci indique un risque d'endommagement de
l'appareil ou de biens en cas de non respect de ces
consignes.
Remarque : Ceci vous signale des informations et/ou
indications importantes.
60
9 CONSIGNES DE SÉCURITÉ IMPORTANTES
LISEZ ET CONSERVEZ CES INSTRUCTIONS
( CONSIGNES DE SÉCURITÉ IMPORTANTES
Ce lave-vaisselle est livré avec des instructions
de montage et ce Manuel d'utilisation et
d'entretien. Lisez et assurez-vous d'avoir bien
assimilé toutes les instructions avant d'utiliser
le lave-vaisselle.
Ce lave-vaisselle est conçu pour une utilisation
jusqu'à une altitude de 8 200 pieds (2 500 m)
au-dessus du niveau de la mer.
Pour réduire le risque d'incendie, de choc
électrique, ou de blessures graves,
respectez les consignes suivantes :
9 AVERTISSEMENT
Risque de blessures !
La réparation de l'appareil par des
techniciens d'entretien non qualifiés ou
l'utilisation de pièces de rechange non
originales peuvent causer des blessures
graves ou endommager l'équipement.
Tous les travaux de réparation doivent
être effectués par un technicien
d'entretien qualifié utilisant uniquement
des pièces de rechange d'origine.
Ri sque d' i ncendi e, de choc él ect r i que, ou de bl es ur es gr aves
9 AVERTISSEMENT
Risque de blessure ou de décès !
La mauvaise utilisation du lave-vaisselle
peut causer des blessures graves ou
mortelles. Évitez d'utiliser le lavevaisselle d'une manière non conforme aux
directives énoncées dans ce manuel ou à
d'autres fins que celles énoncées dans
les pages suivantes.
61
9 AVERTISSEMENT
Risque de choc électrique ou
d'incendie !
Un choc électrique ou un incendie peut
survenir si l'alimentation électrique du
lave-vaisselle décrit dans le présent
manuel est mal installée ou s'il n'est pas
correctement mis à la terre. Le lavevaisselle décrit dans ce manuel ne doit
pas être utilisé à moins d'être certain de
la bonne installation de l'alimentation
électrique et de la mise à la terre
correcte du lave-vaisselle.
9 CONSIGNES DE SÉCURITÉ IMPORTANTES
LISEZ ET CONSERVEZ CES INSTRUCTIONS
9 AVERTISSEMENT
Risque d'explosion !
▯
Sous certaines conditions, de
l'hydrogène gazeux peut se créer dans
un système d'eau chaude inutilisé
pendant deux semaines ou plus.
L'hydrogène gazeux est de nature
explosive. Avant d'utiliser un lavevaisselle connecté à un système d'eau
chaude inutilisé pendant deux
semaines ou plus, ouvrez tous les
robinets d'eau chaude et laissez l'eau
s'écouler pendant plusieurs minutes.
Tout l'hydrogène gazeux accumulé
sera ainsi évacué. Compte tenu de la
nature explosive du gaz, évitez de
fumer ou d'utiliser des flammes nues à
ce moment.
▯
Videz d'abord le lave-vaisselle de
l'équipement, des ustensiles et des
matières étrangères qu'il pourrait
contenir avant de le laver avec un
nettoyant quelconque. Certains
nettoyants sont hautement acides ou
caustiques, ce qui pourrait entraîner la
formation d'hydrogène gazeux si la
cuve du lave-vaisselle contient de
l'aluminium. L'hydrogène gazeux est de
nature explosive. Reportez-vous à la
section Soins et entretien du manuel
d'utilisation du lave-vaisselle pour des
instructions de nettoyage.
INSTRUCTIONS DE MISE À LA TERRE
Cet équipement doit être mis à la terre au
niveau d'un système de câblage permanent en
métal, ou un conducteur de mise à la masse
d'équipement doit être intégré aux
conducteurs d'alimentation et connecté au
terminal de mise à la masse de l'équipement
ou à la broche de raccordement du lavevaisselle. Voir la rubrique Instructions de
montage fournie pour avoir plus d'informations
sur les exigences électriques.
9 AVERTISSEMENT
Risque de choc électrique !
Cet appareil doit être mis à la terre. En
cas de dysfonctionnement, la mise à la
terre réduira le risque de choc électrique
en fournissant une voie de moindre
résistance au courant électrique. Cet
appareil est équipé d'un câble disposant
d'un conducteur de mise à la terre.
La mauvaise connexion du conducteur de
mise à la terre peut provoquer un risque
de choc électrique. En présence d'un
électricien qualifié, vérifiez, en cas de
doute, si l'appareil est correctement mis
à la terre.
9 AVERTISSEMENT
Risque pour la santè !
N'utilisez jamais des produits chimiques
agressifs pour nettoyer votre lavevaisselle. Certains produits contenant du
chlore peuvent endommager le lavevaisselle et présenter des risques pour la
santé!
62
9 CONSIGNES DE SÉCURITÉ IMPORTANTES
LISEZ ET CONSERVEZ CES INSTRUCTIONS
Fonctionnement normal
Utilisez ce lave-vaisselle uniquement aux fins
spécifiées, notamment le lavage de vaisselle et
d'ustensiles de cuisine indiqués comme
lavables au lave-vaisselle.
Utilisez uniquement des détergents ou des
produits de rinçage recommandés pour un
lave-vaisselle, puis tenez-les hors de la portée
des enfants.
9 ATTENTION !
Lors du chargement de vaisselle à laver :
■
identifiez les objets tranchants pour
éviter qu'ils n'endommagent le joint de
la porte.
■
les couteaux et autres ustensiles
tranchants doivent être placés debout,
les POIGNÉES EN HAUT, afin de
réduire le risque de coupures.
■
ne lavez pas les objets en plastique,
sauf s'ils portent l'inscription « lavable
au lave-vaisselle » ou une indication
équivalente. Pour les objets en
plastique ne portant pas cette
indication, consultez les
recommandations de leurs fabricants
respectifs.
■
évitez de mettre votre votre lavevaisselle en marche à moins que tous
les panneaux ne soient en place.
■
ne touchez pas ou ne passez pas outre
les commandes et verrouillages.
63
Évitez de vous asseoir, de vous appuyez ou
d'utiliser de manière abusive la porte ou les
paniers à vaisselle du lave-vaisselle.
9 AVERTISSEMENT
Risque de blessures !
Pour éviter des risques de blessures,
faites toujours attention lorsque vous
ouvrez la porte pendant ou après un
cycle de lavage car des rejets d'eau
chaude ou de vapeur peuvent survenir.
N'ouvrez pas complètement la porte avant
que les bruits d'eau n'aient cessés et que
la vapeur ne soit dissipée.
Les lave-vaisselle domestiques certifiés NSF/
ANSI 184 ne sont pas destinés aux
établissements de services alimentaires
agréés.
Assurez-vous de respecter les instructions de
sécurité, même lorsqu'elles ne sont pas
accessibles pendant le fonctionnement de
l'appareil par l'intermédiaire de l'application
Home Connect. Respectez également les
instructions fournies par l'application.
9 CONSIGNES DE SÉCURITÉ IMPORTANTES
LISEZ ET CONSERVEZ CES INSTRUCTIONS
Sécurité pour enfants
Pour réduire le risque de blessure, interdisez
aux enfants de jouer dans ou sur le lavevaisselle.
À l'âge adulte leur permettant d'utiliser la
machine, les enfants sont sous la
responsabilité de leurs parents/tuteurs légaux
qui doivent s'assurer qu'ils sont suffisamment
instruits sur les bonnes pratiques par des
personnes qualifiées.
Entretien et maintenance corrects
9 AVERTISSEMENT
Risque d’explosion !
Sous certaines conditions, de
l'hydrogène gazeux peut se créer dans un
système d'eau chaude inutilisé pendant
deux semaines ou plus. L'hydrogène
gazeux est de nature explosive. Avant
d'utiliser un lave-vaisselle connecté à un
système d'eau chaude inutilisé pendant
deux semaines ou plus, ouvrez tous les
robinets d'eau chaude et laissez l'eau
s'écouler pendant plusieurs minutes.
Tout l'hydrogène gazeux accumulé sera
ainsi évacué. Compte tenu de la nature
explosive du gaz, évitez de fumer ou
d'utiliser des flammes nues à ce moment.
Retirez la porte du lave-vaisselle menant au
compartiment de nettoyage lors du retrait d'un
ancien lave-vaisselle dans le cadre de
l'entretien ou de la mise au rebut.
Pour éviter d'endommager le plancher et la
propagation des moisissures, les alentours et
le dessous du lave-vaisselle ne doivent pas
rester humides.
Remarque : Afin de ne pas endommager le
lave-vaisselle, évitez de laisser l'eau pénétrer
dans les systèmes de votre appareil pendant
de longues périodes à des températures de
gel. Par temps de gel, la vanne de remplissage
d'eau ainsi que d'autres composants de votre
lave-vaisselle peuvent s'endommager.
AVIS : Il est vivement recommandé à
l'utilisateur final de se familiariser avec les
procédures d'arrêt de l'alimentation en eau
ainsi qu'avec les procédures d'arrêt de
l'alimentation électrique entrante. Consultez
les instructions de montage ou contactez votre
installateur pour de plus amples informations.
Avertissement issu de la proposition 65 :
Ce produit pourrait contenir un produit
chimique reconnu par l'État de la Californie
comme cancérigène ou ayant des effets nocifs
sur la reproduction. Par conséquent,
l'emballage de votre produit pourrait porter
l'étiquette suivante, comme requis par la
Californie :
$9(57,66(0(17,668('(/$352326,7,21â'(/ e7$7'(
/$&$/,)251,(â
$9(57,66(0(17
&DQFHUHWGRPPDJHVjODUHSURGXFWLRQ
ZZZ3:DUQLQJVFDJRY
64
Causes de pannes
ƒ
fr-ca
Causes de pannes
A VIS
Causedpn
▯
▯
▯
▯
N'utilisez jamais de nettoyants à vapeur pour laver
votre lave-vaisselle. Le fabricant n'est pas
responsable des conséquences ou des dommages
éventuels.
Pour éviter toute possibilité d'endommager le lavevaisselle, n'utilisez pas des produits chimiques
acides, des nettoyants abrasifs, des tampons à
récurer (métalliques ou plastiques), ou des éponges/
essuie-tout abrasifs pour nettoyer le panneau de
porte extérieure de votre lave-vaisselle. Ceci peut
endommager le panneau de porte extérieur de votre
lave-vaisselle.
Afin de ne pas endommager le lave-vaisselle, n'y
chargez pas d'objets en papier, de sacs en plastique,
de matériaux d'emballage ou autre chose que des
ustensiles ou articles de cuisine normaux.
Protégez votre lave-vaisselle des éléments. Protégez-le
du gel afin d'éviter d'endommager la soupape de
remplissage. Les dégâts causés par le gel ne sont pas
couverts par la garantie.
65
fr-ca
Mise en route
Mise en marche
*
V ue d'ensemble de l'appareil
Misenrout

67$57
K
PLQ
UHVHWVHF
VHF
W VHF
Les lignes pointillées indiquent des fonctions
facutlatives qui pourraient éventuellement être
comprises avec votre lave-vaisselle.
66
UHVHWVHF
Mise en route
Les numéros mentionnés ci-dessous font référence aux
images d'aperçu sur la page précédente du présent
manuel.
Panneau de commande
( Interrupteur Marche/Arrêt
0 Touches de programmation **
8 Bouton Information (
fr-ca
Indicateurs
‹:‹‹
%
$
|
Temps de cycle restant
S'allume lorsque la quantité de produit
de rinçage est faible
S'allume lorsque la quantité de sel est
faible
S'allume lorsque la connexion Wi-Fi est
établie
--------
@ Affichage digital
H Indicateur de remplissage de liquide de rinçage
P Indicateur de remplissage de sel
X Touches de réglage
` Bouton Delay start (démarrage différé) / <
h Bouton de télédémarrage / >
)" Fonctions supplémentaires **
)* Touche DÉMARRAGE
** le nombre de cycles de lavage et d'options dépend
du numéro du modèle en question
Composants internes du lave-vaisselle
1" Éclairage intérieur *
1* Troisième panier
12 Panier à vaisselle supérieur
1: Bras d'aspersion supérieur
1B Coupelle interceptrice des pastilles
1J Bouche d'entrée
1R Couvercle de sortie zéolite
(compartiment de zéolite)
1Z Bras d'aspersion inférieur
1b Réservoir de sel spécial
1j Filtres
9" Panier à couverts*
9* Panier à vaisselle inférieur
92 Réservoir de liquide de rinçage
9: Compartiment à détergent
9B Verrou de fermeture du compartiment à détergent
9J Plaque signalétique
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
67
fr-ca
Mise en route
Bouton Information (
Réglage de l'heure
L e bouton Information ( peut-être utilisé pour afficher
des informations supplémentaires sur le cycle de
lavage.
L orsque l'appareil est branché pour la première fois,
l'heure affichée est 12:00.
Bout on I nf or mat i on
1. Appuyez sur le bouton (8.
2. Appuyez sur le bouton de cycle de lavage.
Les informations concernant le cycle de lavage
sélectionné sont affichées dans la fenêtre
d'affichage supérieure @.
3. Pour sortir, appuyez sur le bouton Information ( 8.
Régl age de l ' heur e
Réglez l'heure comme suit :
1. Ouvrez la porte.
2. Appuyez sur le bouton MARCHE/ARRÊT (.
3. Appuyez sur le bouton Information ( 8 durant
3 secondes jusqu'à ce que le message suivant soit
affiché dans la fenêtre d'affichage supérieure @ :
Faites défiler avec < >
Choisissez avec - +
Maintenez durant t 3 sec.
4. Maintenez le bouton > ` enfoncé jusqu'à ce que
l'heure soit affichée dans la fenêtre d'affichage
supérieure@.
5. Effectuez le réglage à l'aide des boutons + - X. Si
vous maintenez les boutons de sélection + - X
enfoncés, les valeurs changent par palier de
10 minutes.
6. Appuyez et maintenez le bouton Information enfoncé
(8 pendant 3 secondes.
Les paramètres sélectionnés ont été sauvegardés.
Remarque : Si l'appareil a été déconnecté de
l'alimentation électrique pour une période prolongée,
l'heure affichée est 12:00. Réglez l'heure.
68
Mise en route
fr-ca
Première mise sous tension de
l'appareil
Les paramètres à définir lors de la première mise sous
tension de l'appareil sont énumérés dans le tableau cidessous.
Lorsque le lave-vaisselle est mis sous tension pour la
première fois, celui-ci vous invite à définir les
paramètres requis après une première mise sous
tension. Le message suivant est indiqué dans la fenêtre
d'affichage supérieure @ :
Changez les paramètres comme suit :
Faites défiler avec < >
Choisissez avec + Maintenez durant t 3 sec.
1. Appuyez sur le bouton > ` jusqu'à ce que le
paramètre désiré soit affiché.
2. Effectuez le réglage à l'aide des boutons + - X.
3. Appuyez et maintenez le bouton Information enfoncé
(8 pendant 3 secondes.
Les paramètres sélectionnés ont été sauvegardés.
Réglages
Première mise sous
tension de l'appareil
Langue
Format de l’heure
Réglage de l'heure
Réglage d'eau douce
Réglage du produit de
rinçage
Réglage d'usine
Texte informatif
en appuyant sur le bouton Info (
Français (Canada)
24 h
12.00
°E 0 à 8 douce
Sélection de la langue.
12 h ou 24 h
Réglage de l'heure actuelle.
Réglage de la dureté de l'eau.Si utilisation de pastilles tout
en 1, choisissez le réglage le plus bas.
La quantité de produit de rinçage utilisée affecte le séchage.
Niveau 5
--------
Réglages
Le lave-vaisselle a été configuré avec certains
paramètres pour votre confort. Il est possible de
modifier ces réglages d'usine.
Changez les paramètres comme suit :
1. Ouvrez la porte.
4. Appuyez sur le bouton > ` jusqu'à ce que le
paramètre désiré soit affiché.
5. Effectuez le réglage à l'aide des boutons + - X.
6. Appuyez et maintenez le bouton Information enfoncé
( 8 pendant 3 secondes.
2. Appuyez sur le bouton MARCHE/ARRÊT (.
Les paramètres sélectionnés ont été sauvegardés.
3. Appuyez sur le bouton Information ( 8 durant 3
Il est possible de restaurer les paramètres d'usine si
vous désirez réinitialiser tous les paramètres modifiés.
secondes jusqu'à ce que le message suivant soit
affiché dans la fenêtre d'affichage supérieure @ :
Faites défiler avec < >
Choisissez avec - +
Maintenez durant t 3 sec.
Réglage
Réglage d'usine
Réglage de l'heure
Format de l’heure
Affichage de l’heure
12.00
24 h
Heure
Langue
Français (Canada)
* selon les fonctions de votre lave-vaisselle
Remarque : Lorsque vous restaurez les paramètres
d'usine de votre lave-vaisselle celui-ci vous invite à
définir les paramètres comme s'il s'agissait d'une
première mise sous tension.
Texte informatif
en appuyant sur la touche Info
Réglage de l'heure actuelle.
12 h ou 24 h
Affichage de la fin du programme par la mention "prêt dans"
ou "prêt à".
Sélection de la langue.
69
fr-ca
Mise en route
Réglage
Réglage d'usine
Dureté de l'eau
°E0-8 douce
Distribution de produit de
rinçage
Réglage du capteur
Niveau 5
Extra sec
Pronostic eco
Auto Power Off
EmotionLight
Affichage frontal *
Project. temps restant *
Arrêt
Arrêt
Arrêt
marche
marche
marche
Infolight *
marche
Programme de départ
Auto 55 °C à 65° C
(130 à 150 °F)
Niveau 2
Niveau 2
Arrêt
Volume signal sonore
Volume des touches
Sécurité enfants *
Standard
Wi-Fi
Connexion au réseau
activé/désactivé
Manuelle ou
Autom./ WSP
Connexion à l'app
Démarrer avec +
Message de bienvenue
marche
Réglage d'usine
Réinitialiser
* selon les fonctions de votre lave-vaisselle
Remarques
▯
▯
--------
70
L'option de menu « connexion au réseau » n'est
disponible que si le Wi-Fi a été activé.
L'option de menu «°Connexion à l'application°» est
uniquement disponible si une connexion au réseau
local a été établie.
Texte informatif
en appuyant sur la touche Info
Réglage de la dureté de l'eau.Si utilisation de pastilles tout
en 1, choisissez le réglage le plus bas.
La quantité de produit de rinçage utilisée affecte le séchage.
Réglage de la détection de la clarté de l'eau pour de
meilleurs résultats de nettoyage.
Séchage amélioré pour les verres et la vaisselle en plastique.
Affiche la consommation d'eau et d'électricité.
Mise en veille de l'appareil à la fin du cycle.
Éclairage intérieur.
Il est possible de sélectionner l'affichage frontal.
Pendant le déroulement du programme, les informations
d'état sont projetées sur le sol.
Pour signaler un cycle en cours, un point lumineux est
projeté.
A l'allumage, le dernier programme choisi s'affiche.
Volume signal sonore en fin de programme.
Volume lors de l'utilisation des touches.
L'activation de la sécurité enfants empêche l'ouverture de la
porte.
Activer/désactiver la connexion réseau existante.
Vérifiez la fonction WPS du routeur. Le Wi-Fi doit être activé
pour que ce paramètre apparaisse.
Pas de fonction WPS : manuellement
Fonction WPS : automatique
Connectez l'électroménager à l'appareil mobile. L'appareil
doit être connecté au réseau pour que ce paramètre
apparaisse.
Il est possible de ne pas afficher le logo de la marque à
l'allumage de l'appareil.
Réinitialise les réglages usine.
Mise en route
Home Connect™
Ce lave-vaisselle est compatible Wi-Fi et peut être
commandé à distance via un terminal mobile.
Si vous ne branchez pas votre lave-vaisselle à votre
réseau domestique, vous pouvez l’utiliser manuellement
de manière conventionnelle à l’aide des touches.
Consultez l'aperçu de l'appareil pour situer les boutons.
~ "Vue d'ensemble de l'appareil" à la page 66
fr-ca
Wi-Fi |
Vous pouvez activer/désactiver la connexion au réseau
sans fil dans le menu Wi-Fi avec « activé » ou
« désactivé ».
Remarques
▯
▯
Si vous avec choisi le réglage Wi-Fi « désactivé », les
réglages « connexion au réseau » et « connexion à
l'application » ne seront pas disponibles.
La commande à distance du lave-vaisselle nécessite
une connexion sans fil stable.
Configurer l’app
Connexion au réseau
Afin d’utiliser l’appareil via Home Connect, l’app Home
Connect doit être installée sur votre terminal mobile.
Consultez les documents Home Connect fournis pour
plus de détails.
Dans le menu « connexion au réseau », vous pouvez
basculer entre « Autom./WPS » et « Manuel » pour la
connexion du lave-vaisselle au réseau. Pour ce faire,
vérifiez si votre routeur dispose d'une fonction WPS.
Suivez les étapes prescrites par l’app pour procéder aux
réglages.
Consultez le feuillet Home Connect pour des
instructions détaillées.
Configuration de Home Connect
Vous pouvez configurer votre lave-vaisselle en appuyant
sur le bouton de télédémarrage h ou en procédant
comme suit :
1. Ouvrez la porte.
2. Appuyez sur le bouton On/Off (Marche/Arrêt) (.
3. Appuyez sur la touche Info 8 durant 3 secondes
jusqu'à ce que le message suivant soit affiché dans
la fenêtre d'affichage supérieure @ :
Faites défiler avec < >
Choisissez avec -+
Quittez en appuyant sur Setup 3 sec.
4. Maintenez le bouton > h enfoncé jusqu'à ce que le
réglage requis soit affiché dans la fenêtre
d'affichage supérieure @.
5. Effectuez le réglage à l'aide des boutons + -
X.Consultez le tableau dans la section
6. Appuyez et maintenez la touche Info enfoncée 8
pendant 3 secondes.
Les paramètres sélectionnés ont été sauvegardés.
Automatique : connexion au réseau local à l'aide de la
fonction WPS du routeur.
Manuel : connexion de votre appareil mobile au réseau
Home Connect. Les réglages de réseau sont ensuite
saisis manuellement avec l'application Home Connect
pour la connexion à votre réseau local.
Une fois la connexion établie, le texte suivant devrait
apparaître à l'écran dans la partie supérieure @ :
« Connexion au réseau réussie ».
Remarque : L'option de menu « connexion au réseau »
n'est disponible que si le Wi-Fi a été activé.
Connexion à l'application
L'option de menu «°connexion à l'application°» est
uniquement disponible si une connexion au réseau local
a été établie.
Le paramètre « connexion à l'application » établit le lien
entre votre lave-vaisselle, l'application et votre compte
d'utilisateur.
Une fois la connexion établie, le texte suivant devrait
apparaître à l'écran dans la partie supérieure @ :
« Connexion au réseau réussie ».
Reportez-vous au feuillet Home Connect pour de plus
amples renseignements.
71
fr-ca
Mise en route
Bouton de télédémarrage
Une fois le lave-vaisselle branché au réseau
domestique, appuyez sur le bouton de télédémarrage
h pour commander le lave-vaisselle avec votre
appareil.
Si le lave-vaisselle n'est pas encore branché à Home
Connect, vous pouvez accéder aux réglages de Home
Connect en appuyant sur le bouton de télédémarrage
h.
Suivez les instructions fournies dans le feuillet Home
Connect.
Remarque : Votre lave-vaisselle est protégé contre les
mises en marche involontaires. Si la porte de l'appareil
reste ouverte durant plus de 4 secondes après que vous
ayez appuyé sur le bouton de télédémarrageh,
l'opération est suspendue. Appuyez de nouveau sur le
bouton de télédémarrage h et fermez la porte de
l'électroménager pour reprendre le contrôle. Consultez
également la section
Remarques
▯
▯
▯
▯
72
Une fois la connexion terminée, le bouton de
télédémarrage h s'éteint.
Pour activer de nouveau la télécommande, appuyez
sur le bouton de télédémarrage h.
Si l'assistant Home Connect a été fermé durant le
démarrage, appuyez de nouveau sur le bouton de
télédémarrage h.
Si la connexion au routeur échoue, | clignote à
l'écran.
Wi-Fi sans connexion au serveur Home
Connect ƒ
V ous pouvez interrompre la connexion au serveur
Home Connect via l'app Home Connect.
Wi- Fi sans con exi on au ser veur Home Con ect
L'appareil demeurera branché localement à votre
terminal mobile sans connexion au serveur Home
Connect.
Remarque : Si vous n'avez pas désactivé la connexion
au serveur Home Connect, vérifiez votre connexion
Internet.
Diagnostic à distance ~
L e service après-vente peut accéder à votre appareil via
le Diagnostic à distance ~ en cas de besoin.
Di agnost i c à di st ance
Remarques
▯
▯
Vous devez confirmer l'intervention du service aprèsvente sur votre appareil.
Vous pouvez désactiver le Diagnostic à distance ~
avec l'interrupteur MARCHE / ARRÊT ( ou
désactiver l'intervention du service après-vente dans
l'application Home Connect.
Système d'adoucissement de l'eau / sels
Système d'adoucissement de l'eau /
sels
+
A fin d'obtenir un bon rinçage, le lave-vaisselle a besoin
d'une eau douce, c.-à-d. d'une eau pauvre en calcaire, à
défaut de quoi des dépôts de calcaire se formeront sur
les ustensiles ainsi qu'à l'intérieur de bac de lavage..
L'eau courante au-dessus de 12,5 °fH (1.2 mmol/l) doit
être adoucie. L'adoucissement de l'eau s'obtient grâce
à des sels spéciaux (sels de régénération) déposés
dans le système d'adoucissement de l'eau du lavevaisselle. Le réglage et par conséquent la quantité de
sels spéciaux à déposer dépendent du niveau de dureté
de votre eau courante (voir le tableau de dureté de l'eau
ci-après).
Systèmed'aoiucsemntdl'eau/sl
fr-ca
Réglage du système d'adoucissement
de l'eau
La quantité de sels déposés peut être réglée de 0 à
62°E. Les sels ne sont pas requis pour les valeur de 0 à
8.
Réglez le système d'adoucissement comme suit :
1. Demandez le degré de dureté de votre eau courante
à votre fournisseur d'eau.
2. Le réglage à effectuer se trouve dans le tableau de
dureté de l'eau.
3. Ouvrez la porte.
4. Appuyez sur le bouton MARCHE/ARRÊT (.
5. Appuyez sur le bouton Information ( 8 durant 3
Tableau de dureté de l'eau
9DOHXUGH 1LYHDXGH
ODGXUHWp GXUHWp
GHO HDXƒ(
PPROO
secondes jusqu'à ce que le message suivant soit
affiché dans la fenêtre d'affichage supérieure @ :
'pILQLUOD
YDOHXUVXU
ODPDFKLQH
Ȣ
GRXFH
Ȣ
Ȣ
GRXFH
Ȣ
Ȣ
PR\HQQH
Ȣ
Ȣ
PR\HQQH
Ȣ
Ȣ
PR\HQQH
Ȣ
Ȣ
GXUH
Ȣ
Ȣ
GXUH
Ȣ
Ȣ
GXUH
Ȣ
Faites défiler avec < >
Choisissez avec - +
Maintenez durant t 3 sec.
6. Maintenez le bouton > ` enfoncé jusqu'à ce que la
dureté de l'eau soit affichée dans la fenêtre
d'affichage supérieure@.
7. Effectuez le réglage à l'aide des boutons + - X.
8. Appuyez et maintenez le bouton Information enfoncé
(8 pendant 3 secondes.
Les paramètres sélectionnés ont été sauvegardés.
73
fr-ca
Système d'adoucissement de l'eau / sels
Utilisation des sels spéciaux
Remplissez au maximum le réservoir à sels dès que
l'indicateur du niveau de sels P s'allume sur l'écran.
Remplissez toujours le réservoir au maximum avant de
mettre l'appareil sous tension. Cela permet d'assurer
l'évacuation immédiate du surplus d'eau salée,
prévenant ainsi le risque de corrosion dans le réservoir
de rinçage.
AVIS : Le détergent endommage le système
d'adoucissement de l'eau!Ne versez jamais de détergent
dans le distributeur de sels.
Remplissez les sels comme suit :
Utilisation de détergents chargés en
sels
S i vous utilisez un détergent chargé en sels, les sels
spéciaux ne sont pas requis si la dureté de l'eau ne
dépasse pas 375 ppm (37 °fH, 21 °dH, 26 °Clarke, 3,7
mmol/l). Si la dureté de l'eau dépasse 375 ppm, des
sels doivent être utilisés.
Dét er gent char gé en sel s
Éteindre l'indicateur de niveau bas de
sels/le système d'adoucissement de
l'eau
S i l'utilisation de détergents chargés en sels empêche
le bon fonctionnement de l'indicateur du niveau de sel
P sur le panneau de contrôle ou l'affichage du texte
sur la fenêtre d'affichage supérieure @ (suffisamment
de sels pour X rinçages), il est possible de désactiver
ces affichages.
Ét ei ndr e l e syst ème d' adouci s emnt de l ' eau
1. Retirez le bouchon à vis du distributeur 1b.
2. Remplissez le distributeur d'eau (opération requise
uniquement lors de la première mise sous tension de
l'appareil).
3. Ajoutez les sels tel qu'illustré (n'utilisez pas de sel de
table ou de comprimés).
L'eau est évacuée.
Pour en savoir plus sur l'achat de sels pour le lavevaisselle, veuillez contacter le service à la clientèle (1800-944-2904).
74
Procédez tel que décrit dans « Réglage du système
d'adoucissement de l'eau » et définissez la valeur entre
0 et 8. Le système d'adoucissement de l'eau et
l'indicateur de remplissage des sels sont maintenant
activés.
Produit de rinçage
,
fr-ca
2. Remplissez le distributeur 92 de produit de rinçage
Produit de rinçage
D ès que l'indicateur de niveau d'agent de rinçage
Hs'allume sur le panneau de contrôle, remplissez ce
dernier immédiatement. L'agent de rinçage est
nécessaire pour enlever les taches sur les ustensiles et
verres. N'utilisez qu'un agent de rinçage recommandé
par le constructeur comme étant sans risque pour une
utilisation avec un lave-vaisselle domestique. Vous
pouvez utiliser des détergents pourvus d'un agent de
rinçage avec de l'eau douce ou modérément dure
uniquement (0 à 2 sur une bandelette d'analyse ou
jusqu'à 114,2 mg/l). Avec de l'eau modérément dure à
dure (3 à 4 sur une bandelette d'analyse ou 119,91 mg/
l), il faut utiliser un agent de rinçage.
Produiteriançg
Ajout d'agent de rinçage
AVIS : Pour prévenir les excès de mousse ou
l'engorgement, ne remplissez pas le distributeur de
produit de rinçage au-delà de sa capacité 92. Essuyez
les débordement à l'aide d'un chiffon humide.
1. Ouvrez le distributeur de liquide de rinçage 92 en
appuyant sur le loquet du couvercle et en tirant sur
celui-ci.
liquide jusqu'à pleine capacité. Il ne doit pas
déborder. Évitez tout déversement dans le trou
d'aération.
PD[
3XUJHXU
G DLU
3. Fermez le couvercle. Le couvercle doit être
hermétiquement fermé jusqu'à l'encliquetage du
loquet, pour garantir son étanchéité.
4. Essuyez tout excédent de produit de rinçage déversé
lorsque le réservoir est plein.
Ceci évite la formation de mousse excessive lors du
prochain cycle de lavage. Le témoin lumineux
s'éteindra peu après la fermeture de la porte du lavevaisselle.
Conseil : Pour verser plus facilement, retirez le
couvercle de la bouteille de produit de rinçage.
AVIS : Ne pas remplir le distributeur de rinçage
auxiliaire 92 avec de la lessive. Sinon, vous pourriez
endommager le lave-vaisselle.
75
fr-ca
Produit de rinçage
Réglage de la quantité de produit de
rinçage utilisé
Éteindre l'indicateur d'agent de
remplissage de rinçage
La quantité d'agent de rinçage pouvant être distribuée
peut être réglée sur une valeur comprise entre 0 et 6.
Choisissez 5 pour obtenir un très bon rinçage. Ne
changez pas la quantité d'agent de rinçage, sauf si des
traces de calcaire ou des taches d'eau demeurent sur
les ustensiles. Choisissez une valeur inférieure pour
éviter les traces de calcaire. Choisissez une valeur
supérieure pour éviter les taches d'eau.
Si l'utilisation de détergents pourvus d'agent de rinçage
empêche le bon fonctionnement de l'indicateur de
niveau d'agent de rinçage bas H sur le panneau de
contrôle ou l'affichage du texte sur la fenêtre
d'affichage supérieure (suffisamment d'agent de
rinçage pour X rinçages), il est possible de désactiver
ces affichages.
Réglez la quantité d'agent de rinçage comme suit :
1. Ouvrez la porte.
2. Appuyez sur le bouton MARCHE/ARRÊT (.
3. Appuyez sur le bouton Information ( 8 durant 3
secondes jusqu'à ce que le message suivant soit
affiché dans la fenêtre d'affichage supérieure @ :
Faites défiler avec < >
Choisissez avec - +
Maintenez durant t 3 sec.
4. Maintenez le bouton > ` enfoncé jusqu'à ce que le
distributeur d'agent de rinçage soit affiché dans la
fenêtre d'affichage supérieure@.
5. Effectuez le réglage à l'aide des boutons + - X.
6. Appuyez et maintenez le bouton Information enfoncé
(8 pendant 3 secondes.
Les paramètres sélectionnés ont été sauvegardés.
Remarque : Ne changez pas la quantité d'agents de
rinçage, sauf si des traces de calcaire (sélectionnez une
valeur inférieure) ou des taches d'eau (sélectionne une
valeur supérieure) demeurent sur les ustensiles.
76
Procédez comme décrit dans « Réglage de la quantité
d'agents de rinçage » et sélectionnez0.
AVIS : En utilisant aucun produit de rinçage ou le
réglage du distributeur à 0 peut conduire à des durées
de cycle plus longues, ce qui consommera plus
d'énergie et plus d'eau. Les températures plus élevées
peuvent endommager la porcelaine fine ou la verrerie.
Chargement du lave-vaisselle
Chargement du lave-vaisselle
-
M atériaux lavables au lave-vaisselle
Chargemntdulvae-isl e
Remarque : Avant la première utilisation de votre lavevaisselle, vérifiez les informations énoncées dans la
présente rubrique. Certains objets ne peuvent pas être
lavés au lave-vaisselle et doivent l'être à la main ;
d'autres doivent être chargés de manière spéciale.
Recommandé
Aluminium
Porcelaine, cristal,
grès
Verre
Revêtements antiadhésifs
Plastiques
Acier inoxydable,
argent sterling et
métal argenté
Précaution
L'aluminium anodisé et coloré
peut se décolorer au fil du temps.
Les minéraux présents dans l'eau
peuvent ternir ou tacher
l'aluminium. En général, ils sont
éliminés à l'aide d'un tampon en
laine d'acier imbibé de savon.
Certains ustensiles peints à la
main peuvent se décolorer ou se
tacher. Lavez ces ustensiles à la
main. Positionnez la verrerie
fragile de manière à ce qu'elle ne
bascule pas ou n'entre pas en
contact avec d'autres ustensiles
au cours du cycle de nettoyage.
Assurez-vous d'utiliser du verre
lavable au lave-vaisselle. Le verre
de lait peut se décolorer ou
jaunir.
Appliquez une légère couche
d'huile végétale aux surfaces antiadhésives après séchage.
Assurez-vous que les articles
plastiques sont lavables au lavevaisselle.
Chargez ces objets de manière à
ce qu'ils n'entrent pas en contact
avec d'autres métaux, les parois
de la cuve du lave-vaisselle en
acier inoxydable ou la porte
intérieure.
Non
Recommandé
Acrylique
fr-ca
Raison
Des craques ou de petites
fissures peuvent survenir sur
l'acrylique.
Pièces
Les adhésifs permettant
assemblées par un d'assembler des matériaux
adhésif
comme le plastique, le bois, l'os,
l'acier, le cuivre, l'étain, etc.
peuvent perdre en adhérence.
Ustensiles à
Les poignées peuvent se séparer.
poignée en os
Fer
Le fer va rouiller. Lavez à la main
et séchez immédiatement.
Articles autres que Votre lave-vaisselle est destiné au
la vaisselle
nettoyage de vaisselle et
d'articles de cuisine standards
UNIQUEMENT.
Potin, laiton,
Ces articles terniront.Lavez à la
bronze
main et séchez immédiatement.
Dégâts causés à la verrerie et
l'argenterie
Causes :
▯
Type de verrerie.
▯
Type de détergent pour lave-vaisselle.
▯
Température de l'eau du cycle de lavage.
Recommandations :
▯
Veuillez n'utiliser que de la verrerie et de la
porcelaine ayant été désignées par le fabricant
comme pouvant être lavées au lave-vaisselle.
▯
Utilisez un détergent qui protège l'argenterie.
▯
Utilisez des cycles de lavage moins intensifs et
sortez la verrerie et l'argenterie du lave-vaisselle dès
que possible une fois le cycle de lavage terminé.
77
fr-ca
Chargement du lave-vaisselle
Chargement des paniers
Mode de chargement recommandé
Pour obtenir les meilleurs résultats, respectez les
instructions suivantes lors du chargement de la
vaisselle :
Remarque : Le repliage des étagères à tasses permet
aux tasses d'être disposée selon un angle accru et de
réduire les accumulations d'eau au fond de celles-ci.
▯
Les articles avec de légères incrustations de résidus
alimentaires ne doivent pas être pré-lavés.
▯
Retirez toutes les particules d'aliments, os, curedents et excès de graisse.
▯
Pré-lavez les articles souillés par les matières
brûlées, cuites ou féculeuses.
▯
Chargez les plats dans les paniers du lave-vaisselle
de telle sorte que les parois internes des bols,
chaudrons et casseroles font face aux bras gicleurs.
▯
Évitez l'emboîtement et les points de contact entre
les plats.
▯
Séparez les objets à base de métaux différents.
Veillez à ne pas bloquer les bras gicleurs.
▯
Lavez uniquement la vaisselle et les articles de
cuisine indiqués comme lavables au lave-vaisselle.
Panier inférieur - 12 emplacements
Panier supérieur - 12 emplacements
Reportez-vous à la rubrique Matériaux lavables au
lave-vaisselle pour plus d'informations sur la
vaisselle adaptée.
AVIS : Afin de ne pas endommager le lave-vaisselle,
n'y chargez pas des objets en papier, des sacs en
plastique, des matériaux d'emballage ou tout article
autre qu'un article normal, de la vaisselle ou des
ustensiles de cuisine lavables au lave-vaisselle.
Chargement du panier supérieur
Assurez-vous que les articles ne saillent pas du fond
des paniers et ne bloquent les bras gicleurs.
Remarque : Lors de l'insertion du panier
supérieur 12 dans le lave-vaisselle, poussez-le jusqu'à
ce qu'il se bute contre la paroi arrière du bac à laver.
Ainsi, le bras gicleur du panier supérieur 1: se
connecte à l'alimentation en eau à l'arrière du bac à
laver. Ne poussez pas les paniers à l'aide de la porte.
Chargement du panier inférieur
Placez les objets volumineux dans le panier
inférieur 9*. Chargez les chaudrons, casseroles et
bols à l'envers. Ne bloquez pas le trous de ventilation
avec de grandes plaques à pâtisserie. Chargez ces
objets du côté droit du lave-vaisselle.
78
Troisième panier - 12 emplacements
Chargement du lave-vaisselle
Panier inférieur - 10 emplacements
fr-ca
Chargement du panier à ustensiles
Les couteaux et ustensiles tranchants doivent être
placés avec les poignées en haut, les cuillères et
fourchettes avec les poignées en bas. Si des objets
volumineux ou aux formes irrégulières sont chargés
dans le panier à ustensiles, veillez à ce qu'ils ne
s'entassent pas.
9 AVERTISSEMENT
Panier supérieur - 10 emplacements
Risque de blessures !
Les points et bords tranchants des couteaux et
autres ustensiles coupants peuvent causer des
blessures graves. Lors du chargement, les
pointes des couteaux et autres ustensiles
tranchants doivent être tournés vers le bas. Les
enfants ne doivent pas utiliser ou jouer près des
couteaux et ustensiles tranchants.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
Troisième panier - 10 emplacements
79
fr-ca
Chargement du lave-vaisselle
Accessoires de panier
Profils de chargement suggérés
Troisième panier*
1
Fourchette à salade
2
Cuillère à café
3
Fourchette de table
4
Couteau
5
Cuillère à soupe
6
Cuillère à servir
7
Fourchette à servir
Le troisième panier 1* permet de placer
horizontalement les couteaux, spatules et autres outils
de grande taille pour un meilleur nettoyage et un
chargement et déchargement faciles. Disposez la
coutellerie dans le troisième panier 1* tel qu'illustré.
En fonction des caractéristiques de votre lave-vaisselle,
vous pouvez replier les étagères latérales pour libérer
de l'espace pour les articles d'argenterie de taille plus
imposante. Les rangées de séparateurs à l'avant
peuvent être repliées afin de libérer de l'espace pour
les poignées plus larges.
&/,&.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
80
Chargement du lave-vaisselle
fr-ca
Étagère à tasses*
Dents rabattables*
Les étagères à tasses ainsi que l'espace qui se trouve
sous celles-ci peuvent être utilisés pour les petites
tasses et les verres, ainsi que les articles d'argenterie
plus grands, comme les cuillères en bois, les cuillères
et les fourchettes à servir. Si vous n'avez pas besoin de
l'étagère à tasses, celle-ci peut être repliée.
Selon les caractéristiques de votre lave-vaisselle, les
dents peuvent être rabattues Ceci facilite la disposition
des chaudrons, des bols et des verres.
Rabattez les dents comme suit :
1. Tirez légèrement la dent rabattable vers vous et
libérez-la de son encoche (1).
2. Poussez la dent rabattable vers le bas à la position
&/,&.
désirée (2).
Ajuster la hauteur de l'étagère à tasses comme suit :
1. Placez l'étagère dans une position verticale et tirez
vers le haut.
2. Poussez l'étagère vers le bas avec un léger angle
jusqu'à la hauteur désirée (1, 2, ou 3).
3. Insérer l'étagère à tasses.
L'étagère s'encliquette dans sa position.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
Pour les élever, poussez les peignes rabattables dans
une position verticale jusqu'à ce que le support
s'encliquette dans l'encoche.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
Pinces pour objets en plastique*
Les pinces pour objets en plastique permettent
d'accrocher fermement les accessoires de plastique
légers (gobelets, couvercles, etc.).
Pressez la pince pour objets en plastique contre le
panier tel qu'indiqué, jusqu'à ce qu'il s'encliquette.
&/,&.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
81
fr-ca
Chargement du lave-vaisselle
Gicleur pour objets extra hauts*
Les plateaux, les grilles ainsi que les grandes assiettes
(plats à pâtes, assiettes creuses, assiettes à dîner)
peuvent être nettoyés avec cette tête de lavage.
Insérez la tête de lavage comme ceci :
Pièce pour récipients Gastro Norm*
C ette pièce vous permet d'empiler plusieurs récipients
Gastro Norm ou ustensiles plats similaires selon un
certain angle sur le panier inférieur.
Pi èce pour r éci pi ent s Gast r o Nor m
Vous pouvez retirer cette pièce au besoin.
1. Retirez le panier supérieur 12.
2. Insérez la tête de lavage comme montré dans
l'illustration et tournez-la vers la droite.
La tête de lavage est maintenant engagée.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
Retrait de la vaisselle
Remarques
▯
▯
Gardez dégagé l'orifice de ventilation sur le côté
gauche de la cuve à détergent en plaçant les articles
de grande taille comme les planches à découper en
plastique et les grandes plaques à pâtisserie au
centre ou sur le côté droit du panier inférieur.
Assurez-vous que le lave-vaisselle est toujours utilisé
avec le panier supérieur 12 ou la tête de nettoyage
pour très grands objets.
Pour vous assurer que le jet de la tête de nettoyage
atteigne tous les éléments, disposez les plaques à
pâtisserie suivant l'illustration (2 plaques à pâtisserie et
2 grilles au maximum).
AVIS : Pour éviter d'endommager le lave-vaisselle, ne
remontez pas le panier supérieur 12 sans avoir retiré
le gicleur pour objets très grands(B).
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
82
Lors du retrait de la vaisselle, il est recommandé de
décharger le panier inférieur au préalable. Ensuite,
déchargez le panier à couverts suivi par le panier
supérieur et le 3ème panier.
Remarque : Les plats sont plus susceptibles de
s'ébrécher lorsqu'ils sont déchargés avant d'être
refroidis.
Chargement du lave-vaisselle
Réglage de la hauteur du panier *
A u besoin, la hauteur du panier supérieur 12 peut
être ajustée pour libérer plus d'espace pour les
ustensiles de grande taille, dans le panier supérieur
comme inférieur.
Régl age de l a haut eur du pani er
fr-ca
Disposez les plats et assiettes d'un diamètre compris
entre 31 et 34 cm (12,2 po - 13,4 po) dans le panier
inférieur 9* tel qu'illustré.
Hauteur de l'appareil 81,5 cm (32 po)
Avec panier à
couverts
Configuration 1
ø max.
Configuration 2
ø max.
Configuration 3
ø max.
Panier
supérieur
22 cm
(8,6 po)
Panier inférieur
31 cm
(12,2 po)
24,5 cm
(9,6 po)
27,5 cm
(10,8 po)
27 cm
(10,6 po)
25 cm
(9,8 po)
Avec le troisième Panier
panier
supérieur
Configuration 1
16 cm
(6,3 po)
ø max.
Configuration 2
18,5 cm
(7 po)
ø max.
Configuration 3
21 cm
(8,2 po)
ø max.
Panier inférieur
31 cm
(12,2 po)
27,5 cm
(10,8 po)
25 cm
(9,8 po)
Panier supérieur avec leviers latéraux
Hauteur de l'appareil 86,5 cm (32 po)
Avec panier à
couverts
Configuration 1
ø max.
Configuration 2
ø max.
Configuration 3
ø max.
Panier
supérieur
24 cm
(9,4 po)
Panier inférieur
1. Sortez le panier supérieur12.
2. Saisissez les côtés du panier par le bord supérieur.
34 cm
(13,4 po)
26,5 cm
(10,4 po)
30,5 cm
(12 po)
29 cm
(11,4 po)
28 cm
(11 po)
Avec le troisième Panier
panier
supérieur
Configuration 1
18 cm
(7 po)
ø max.
Configuration 2
20,5 cm
(8 po)
ø max.
Configuration 3
23 cm
(9 po)
ø max.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
Ceci permet d'éviter toute chute soudaine.
3. Pour abaisser le panier supérieur, appuyez sur les
deux leviers à gauche et à droite à l'extérieur de
celui-ci. Le panier supérieur s'abaisse.
Panier inférieur
34 cm
(13,4 po)
30,5 cm
(12 po)
28 cm
(11 po)
4. Pour soulever le panier supérieur, saisissez-le par les
côtés de son bord supérieur.
5. Assurez-vous que les deux côtés du panier supérieur
sont à la même hauteur.
6. Insérez le panier supérieur en le poussant.
83
fr-ca
Chargement du lave-vaisselle
Retirer/installer le troisième panier
Installez le troisième panier 1*
1. Sortez les glissières du troisième panier jusqu'au
bout (1).
2. Insérez le troisième panier (2). Ce faisant, remarquez
la position des crans (tel qu'illustré à l'étape 2).
3. Soulevez légèrement le troisième panier, puis
insérez les crans à l'arrière dans les crochets de
verrouillage inférieurs des rails (3).
4. Abaissez le troisième panier, puis appuyez sur les
crans à l'avant (4). Le troisième panier s'encliquette
alors dans sa position.
5. Insérez le troisième panier en le poussant.
Retirez le troisième panier 1* :
1. Sortez le troisième panier jusqu'au bout (1).
2. Soulevez l'avant du troisième panier hors de
l'encoche (2).
3. Sortez le troisième panier et abaissez-le (3).
84
Chargement du lave-vaisselle
Retirer/installer le panier supérieur *
fr-ca
Installez le panier supérieur 12 :
1. Sortez les glissières du panier supérieur jusqu'au
bout (1).
2. Insérez le panier supérieur (2). Ce faisant,
remarquez la position des crans (tel qu'illustré à
l'étape 2).
3. Soulevez légèrement le panier, supérieur, puis
insérez les crans à l'arrière dans les crochets de
verrouillage (3).
4. Abaissez le panier supérieur, puis appuyez sur
l'encoche à l'avant (4). Le panier supérieur
s'encliquette alors dans sa position.
5. Insérez le panier supérieur en le poussant.
Retirez le panier supérieur 12 :
1. Sortez le panier supérieur jusqu'au bout (1).
2. Soulevez l'avant du panier supérieur hors de
l'encoche (2).
3. Sortez le panier supérieur et abaissez-le (3).
85
fr-ca
Chargement du lave-vaisselle
Retirez/installez le panier inférieur
Installez le panier inférieur 9* :
1. Sortez les glissières du panier inférieur jusqu'au
bout (1).
2. Insérez le panier inférieur dans les supports à
l'arrière (2).
3. Soulevez le panier supérieur, par le devant et
positionnez-le dans les support de devant (3).
4. Insérez le panier inférieur en le poussant.
Retirez/installez le panier inférieur 9* :
1. Sortez le panier inférieur jusqu'au bout (1).
2. Soulevez le panier supérieur, d'abord par le devant,
puis par l'arrière (2).
86
Détergent
.
Détergent
U tilisez uniquement un détergent spécialement conçu
pour les lave-vaisselle. Pour de meilleurs résultats,
utilisez un détergent pour lave-vaisselle en poudre ou
des comprimés détergents.
Détergn
AVIS : Pour éviter d'endommager le lave-vaisselle :
▯
évitez d'utiliser des détergents pour vaisselle à la
main dans votre lave-vaisselle.
▯
N'utilisez pas trop de détergent si l'eau utilisée est
douce. L'utilisation d'une quantité excessive de
détergent avec une eau douce peut rayer la verrerie
et la porcelaine fine.
▯
Pour mieux protéger le verre, utilisez un cycle de
nettoyage avec une température peu élevée ou un
cycle conçu spécifiquement pour le verre (selon le
modèle) et utilisez un détergent avec une protection
contre les marquages.
Remarque : Si vous ignorez la dureté de votre eau,
utilisez 15 ml de détergent. Si nécessaire, ajoutez la
quantité minimale nécessaire au nettoyage impeccable
de vos ustensiles de cuisine.
fr-ca
3. Dosage : voir les instructions du fabricant sur
l’emballage. Utilisez un distributeur de détergent
gradué.
1¼ à 1½ cuillères à soupe (20 ml–25 ml) suffisent
pour un degré de saleté normal. Si vous utilisez des
comprimés, un seul suffit.
êWEVS
PO
êWEVS
PO
WEVS
PO
4. Fermez le couvercle du distributeur de détergent.
Le couvercle s'encliquette dans sa position.
&/,&.
Ajout de détergent
1. Si le distributeur de détergent 9: demeure fermé,
actionnez la barre de verrouillage 9B pour l'ouvrir.
2. Ne versez du détergent que dans le distributeur de
détergent sec9:. Ne remplissez pas le distributeur
de détergent outre mesure.
En cas d'utilisation de comprimés détergents,
placez-les de telle sorte qu'ils n'entrent pas en
contact avec le couvercle. Insérez-les à plat et non
sur leur côté.
Remarque : Ne placez pas les comprimés
détergents dans le compartiment à détergent 1B.
Placez les comprimés ou d'autres formes de
détergent directement dans le distributeur de
détergent 9:.
Le distributeur de détergent s'ouvre
automatiquement au moment opportun selon le cycle
de lavage. Le détergent liquide ou en poudre est
dispersé dans l'appareil et dissout, les comprimés
détergents tombent dans le bac à détergent où ils se
dissolvent progressivement.
Conseil : Si les ustensiles sont peu souillés, une
quantité de détergent légèrement inférieure à celle
recommandée est suffisante.
Vous pouvez acheter les détergents et les produits
d'entretien appropriés via notre site Internet ou notre
service à la clientèle (voir au dos du manuel).
87
fr-ca
Détergent
Détergent multifonctionnels
En plus des détergents conventionnels, il existe des
produits multifonctionnels. Ces produits contiennent
non seulement du détergent, mais aussi un agent de
rinçage et des substances qui remplacent les sels (3 en
1), ou selon leur composition (4 en 1, 5 en 1, etc.), un
agent de protection contre les taches sur les verres ou
encore un nettoyant pour les ustensiles en acier
inoxydable. Les détergents combinés ne fonctionnent
que jusqu'à un certain degré de dureté de l'eau
(généralement 375 ppm). Pour une dureté supérieure,
des sels ainsi qu'un agent de rinçage doivent être
utilisés.
Le programme de rinçage est ajusté automatiquement
dès l'utilisation de détergents combinés pour assurer le
meilleur rinçage est le meilleur séchage possibles.
▯
▯
▯
▯
Remarques
▯
▯
▯
▯
88
Si vous souhaitez ajouter davantage d'ustensiles une
fois le cycle de nettoyage démarré, n'utilisez pas le
compartiment 1B à comprimés détergents comme
poignée du panier supérieur. Il se peut que le
comprimé partiellement dissout s'y trouve déjà et
que vous le touchiez.
Ne placez pas de petits éléments à laver dans le
compartiment à comprimés détergents 1B, car ceci
empêche le comprimé de se dissoudre
convenablement.
Vous obtiendrez les meilleurs résultats de rinçage et
de séchage en utilisant des détergents classiques,
ainsi que de sels et un agent de rinçage de manière
séparée.
▯
Si les cycles de lavage sont courts, les comprimés
détergents peuvent ne pas avoir assez de temps pour
agir convenablement en raison de leur forme soluble.
Des résidus de détergent peuvent même subsister à
la fin du cycle. Il est recommandé d'utiliser une
poudre détergente pour ces cycles de lavage.
Le dosage d'un comprimé détergent est suffisant
pour un cycle de lavage « Intensif » (pour certains
modèles). Lorsque vous utilisez de la poudre
détergente, vous pouvez en appliquer à l'intérieur de
l'appareil.
Même si l'indicateur de recharge de sels/d'agent de
rinçage est allumé, le cycle de rinçage s'effectuera
correctement avec les détergents combinés.
Si vous utilisez un détergent avec une pellicule
soluble dans l'eau : saisissez le détergent avec les
mains sèches et placez-le dans un distributeur de
détergent parfaitement sec, sans quoi le détergent
risque de coller.
Si vous passez de détergents combinés à des
détergents classiques, assurez-vous que la valeur du
système d'adoucissement de l'eau et la quantité
d'agent de rinçage ont été réglés en conséquence.
Détergents bio/écologiques : un détergent désigné
comme « bio » ou « écologique » (respectueux de
l'environnement) contient généralement une quantité
moindre d'agents actifs ou est même parfois
complètement exempt de certaines substances. Le
pouvoir nettoyant de ces produits peut parfois être
moindre.
Cycles du lave-vaisselle
/
fr-ca
Cycles du lave-vaisselle
R emarque : Afin d'économiser de l'énergie, il est
recommandé de régler l'option Arrêt automatique sur
« Après 1 minute ».
Cyclesduva-isel
Cycle de nettoyage
Usage recommandé
AUTO
65 - 70 °C
Ce cycle de lavage nettoie les objets ayant servi à une
cuisson au four, ou ceux souillés avec des aliments collés,
durs et séchés. Il peut être nécessaire de laisser tremper
ou de frotter préalablement ces ustensiles.
Ce cycle convient aux chargements composés
d'ustensiles souillés à des degrés divers.
Il est optimisé selon le degré de souillure grâce à l'aide
des capteurs.
Ce cycle convient aux ustensiles délicats.
Il est optimisé selon le degré de souillure grâce à l'aide
des capteurs.
Recommandé pour une utilisation quotidienne, régulière
ou typique pour le lavage complet d'un chargement plein
de vaisselle à souillure normale.
Lavage AUTO
55 - 65 °C
AUTO délicat
45 - 50 °C
Normal
(voir la note au bas du
tableau)
Lavage d'1 heure
Lavage rapide
Verre
Rinçage

I
Option du cycle de
nettoyage possible
tout
tout
tout
tout
Remarque : Pour obtenir un
rendement optimal avec une
consommation minimale
d'énergie, il est recommandé
de désactiver toutes les
options et tous les
paramètres disponibles à
l'exception de l'option Arrêt
automatique.
Nettoie les plats fraîchement souillés et faciles à nettoyer. Ce cycle a une durée réduite, mais il comprend malgré
tout un cycle de séchage.
Nettoie les plats légèrement souillés et faciles à nettoyer. Un cycle pour les plats légèrement souillés, idéal pour les
plats ou l'argenterie sensibles à la température. Pour ce
cycle, la température est réduite pour éviter
d'endommager des ustensiles. Il est particulièrement utile
pour éviter de ternir ou d'ébrécher les verres.
Remarque : Certains verres sont plus susceptibles d'être
ébréchés que d'autres en raison de leur procédé de
fabrication.
Utilisez ce cycle si vous désirez faire un rinçage préalable
de vos plats afin d'éviter les odeurs. Placez les plats non
rincés dans le lave-vaisselle et sélectionnez le cycle
Rinçage. Utilisez moins d'eau que le nécessite un lavage
manuel et une puissance très faible.
Zone intensive
Puissance
Half Load (Chargement
partiel)
Remarque : L'étiquetage Energy Star se base sur le cycle de détection du niveau de saleté Normal ou Régulier
comme suit : l'unité a été avec un distributeur de produit de rinçage (liquide) vide92. Une seule dose de détergent a
été introduite dans le distributeur de détergent 9:, aucun détergent n'étant utilisé dans le cycle de prélavage.
L'appareil n'a pas été soumis à un processus d'essai tronqué tel que stipulé par les définitions décrites dans la
procédure d'essai. Nous recommandons, pour les chargements de vaisselle tel que celui décrit dans le test de
certification en matière de performance énergétique, que le panier soit placé à la position la plus élevée.
89
fr-ca
Options de cycles du lave-vaisselle
Options de cycles du lave-vaisselle
0
Hygiène Ü
A ugmente significativement la température et la
maintien jusqu'à la satisfaction des critères de
désinfection.Cette option est idéale pour le lavage
d'articles tels que des planches à découper et des
biberons qui vont au lave-vaisselle.
Hygi ène
Z one intensive Ï
Optionsdecylsuvae-isl e
I déal pour un chargement mixte. Vous pouvez nettoyer
les chaudrons et les poêles fortement souillés dans le
panier inférieur avec des ustensiles souillés
normalement dans le panier inférieur. La pression du jet
dans le panier inférieur est augmentée et la température
de séchage est légèrement plus élevée.
Zone i nt ensi ve
Puissance ¥
L a durée du cycle est réduite de manière significative
en choisissant l'option Puissance. La consommation
énergétique est augmentée de 30 % en raison du
chauffage intense.
« Sanitized » (Désinfecté) apparaîtra à l'écran une fois
les critères de désinfection remplis. Cette option peut
également améliorer le séchage. Elle fait aussi
augmenter légèrement la consommation d'énergie.
Zeo Dry (Extra Dry avec Zéolite) Ã
Pui s ance
Half Load (Chargement partiel) §
S i vous n'avez que peu de vaisselle à laver (des verres,
des tasses et des assiettes) vous pouvez choisir l'option
Chargement partiel. Ceci permettra d'économiser de
l'eau, de l'énergie et du temps. Il est recommandé
d'utiliser légèrement moins de détergent que pour un
chargement complet.
Hal f Load ( Char gemnt par t i el )
AUTO*
Lavage
65 - 71 °C
AUTO
(150-160 °F) 55 - 65 °C
(130-150 °F)
Temps de cycle 110 - 135
105 - 129
en min.
Consom. d'eau 18,6-24,2
12,9-24,1
en L (gal)
(4,9-6,4)
(3,4-6,4)
Temp. de
151-160
127-140
nettoyage en
(66-71)
(53-60)
°C (°F)
Temp. de
151 (66)
136 (58)
rinçage en °F
(°C)
Zone intensive
Temps de cycle 125-150
120-145
en min.
Consom. d'eau 18,6-24,2
13,3-24,1
en L (gal)
(4,9-6,4)
(3,5-6,4)
Temp. de
151 (66)
136 (58)
rinçage en °F
(°C)
*désinfecter
90
Zeo Dr y ( Ext r a Dr y avec Zéol i t e)
Z éolite permet un séchage optimal de votre vaisselle.
Informations sur le cycle de lavage
Pour économiser de l'énergie, ce lave-vaisselle dispose
d'un système EcoSense dans lequel les capteurs du
lave-vaisselle ajustent automatiquement les variations
de longueur, de température et d'eau du cycle en
fonction du niveau de souillure alimentaire et de la
température de l'eau entrante. Les décisions prises par
le « Contrôle intelligent » peuvent causer un ajustement
intermittent du temps et de l'eau utilisée pour le cycle.
Les temps du cycle de lavage sont définis en fonction
température d'alimentation en eau de 120°F (49° C). Si la
température d'alimentation en eau de votre maison est
autre que 120°F (49° C), les temps de cycle de votre
lave-vaisselle peuvent être affectés.
AUTO délicat Normal
45 - 50 °C
(113-122 °F)
Lavage
Lavage
d'1 heure rapide
Verre
Rinçage
75 - 85
130 - 135
60
70
9
9,0-14,6
(2,4-3,9)
113-122
(45-50)
8,8-21
(2,3-5,5)
113-136
(45-58)
14,3 (3,8) 10,5 (2,8) 13 (3,4)
4,1 (1,1)
122 (50)
113 (45)
122 (50)
entrant
122 (50)
136 (58)
158 (70)
124 (51)
140 (60)
entrant
90-100
145-150
S/O
S/O
85
S/O
9,0-14,6
(2,4-3,9)
122 (50)
8,8-21
(2,3-5,5)
136 (58)
S/O
S/O
13 (3,4)
S/O
S/O
S/O
140 (60)
S/O
30
Options de cycles du lave-vaisselle
AUTO délicat Normal
Lavage
AUTO*
45 - 50 °C
AUTO
65 - 71 °C
(113-122 °F)
(150-160 °F) 55 - 65 °C
(130-150 °F)
Puissance
Temps de cycle 100-120
en min.
Consom. d'eau 16,3-20,5
en L (gal)
(4,3-5,4)
Temp. de
162 (72)
rinçage en °F
(°C)
Half Load (Demi-charge)
Temps de cycle 114
en min.
Consom. d'eau 17,9 (4,7)
en L (gal)
Temp. de
151 (66)
rinçage en °F
(°C)
Hygiène
Temps de cycle 125-150
en min.
Consom. d'eau 18,6-24,2
en L (gal)
(4,9-6,4)
Temp. de
162 (72)
rinçage en °F
(°C)
Zeo Dry
Temps de cycle 140-165
en min.
Consom. d'eau 18,6-24,2
en L (gal)
(4,9-6,4)
Temp. de
153 (67)
rinçage en °F
(°C)
*désinfecter
fr-ca
Lavage
Lavage
d'1 heure rapide
Verre
Rinçage
S/O
90-105
70-80
95-105
S/O
S/O
60
16,1-20,0
(4,3-5,3)
162 (72)
9,2-12,5
(2,4-3,3)
145 (63)
16,6-21,1
(4,4-5,6)
162 (72)
S/O
S/O
13,3 (3,5) S/O
S/O
S/O
140 (60)
S/O
95-105
70-80
100-105
S/O
S/O
65
S/O
10,2-16,5
(2,7-4,4)
136 (58)
9,0-12,6
(2,4-3,9)
122 (50)
10,8-13,9
(2,9-3,7)
136 (58)
S/O
S/O
12 (3,2)
S/O
S/O
S/O
140 (60)
S/O
125-150
S/O
150-155
S/O
S/O
S/O
S/O
12,9-24,1
(3,4-6,4)
162 (72)
S/O
S/O
S/O
S/O
S/O
S/O
8,8-21
(2,3-5,5)
162 (72)
S/O
S/O
S/O
S/O
135-159
105-115
160-165
S/O
S/O
S/O
S/O
12,9-24,1
(3,4-6,4)
153 (67)
9,0-14,6 (2,4- 8,8-21
3,9)
(2,3-5,5)
135 (57)
153 (67)
S/O
S/O
S/O
S/O
S/O
S/O
S/O
S/O
Remarque : Seuls les cycles de désinfection ont été conçus de manière à respecter les exigences de la Section 6 de
la norme NSF/ANSI relative aux Équipements à usage résidentiel destinés à l'élimination de salissures et à la
désinfection efficace.À cet effet, aucune indication ne spécifie, directement ou indirectement, que tous les cycles ont
passé avec succès les tests de performance en matière d’assainissement.
91
fr-ca
1
Mise en marche du lave-vaisselle
Mise en marche du lave-vaisselle
Utilisation des boutons tactiles
Misenmarchedulva-isel
Les boutons sont sensibles et doivent être légèrement
touchés. Évitez que la graisse ou les particules
d'aliments ne se déposent sur les boutons, cela peut
activer le lave-vaisselle.
9 AVERTISSEMENT
L'essuyage et le nettoyage peuvent également activer le
lave-vaisselle. Pour un rendement optimal, touchez les
boutons avec des mains nues et propres.
R emarque : Avec les fonctions masquées, la porte doit
être ouverte avant le changement des réglages et
fermée une fois ces réglages effectués.
Risque de blessures !
Pour éviter des risques de blessures, faites
toujours attention lorsque vous ouvrez la porte
pendant ou après un cycle de lavage car des
rejets d'eau chaude ou de vapeur peuvent
survenir. N'ouvrez pas complètement la porte
avant que les bruits d'eau n'aient cessés et que la
vapeur ne soit dissipée.
Pour nettoyer les boutons tactiles, essuyez-les avec un
chiffon sec ou légèrement humide.
Modification des réglages
Le lave-vaisselle a été configuré avec certains réglages
pour votre confort. Il est possible de modifier ces
réglages usine.
Changez les réglages comme suit :
Protection contre une opération
involontaire
1. Ouvrez la porte.
Votre lave-vaisselle est équipé d'une fonction qui aide à
empêcher toute utilisation involontaire (par exemple par
des enfants).
3. Appuyez sur la touche Info 8 durant 3 secondes
Après le démarrage du lave-vaisselle, la porte doit être
fermée dans les 4 secondes qui suivent ou l'opération
sera interrompue. Un signal apparaîtra alors sur le
panneau de contrôle, vous invitant à appuyer de
nouveau sur le bouton Départ et à fermer la porte.
Cette fonction s'active lorsque :
▯
vous appuyez sur Départ pour lancer un cycle de
lavage
▯
vous réglez le Départ différé et appuyez sur Départ
▯
vous ouvrez la porte alors que le Départ différé est
enclenché
▯
vous ouvrez la porte au cours d'un cycle de lavage
2. Appuyez sur le bouton Marche/Arrêt (.
jusqu'à ce que le message suivant soit affiché dans
l'affichage digital @ :
Faites défiler avec < >
Choisissez avec - +
Quittez en appuyant sur Setup 3 sec.
4. Maintenez le bouton > ` enfoncé jusqu'à ce que le
réglage requis soit affiché dans la fenêtre
d'affichage supérieure @.
5. Effectuez le réglage à l'aide des boutons + -.X.
6. Appuyez et maintenez la touche Info enfoncé 8
pendant 3 secondes.
Les réglages sélectionnés ont été sauvegardés.
Remarque : Il est impossible de désactiver cette
fonction.
92
Conseil : Si vous souhaitez modifier plusieurs réglages,
commencez par les modifier un par un. Appuyez ensuite
sur la touche Info 8 durant 3 secondes. Ceci
sauvegarde toutes les valeurs définies dans l'appareil.
Mise en marche du lave-vaisselle
AquaSensor
L 'AquaSensor est un outil de mesure optique qui évalue
la propreté de l'eau de rinçage.
AquaSensor
L'AquaSensor est utilisé en fonction du cycle de lavage.
Si l'AquaSensor est activé, l'eau de rinçage « propre »
peut être réutilisée pour le prochain rinçage et la
consommation d'eau peut ainsi être réduite de 0,8 à
1,5 gal (3 à 6 litres). Si l'eau de rinçage n'est pas
encore propre, celle-ci est évacuée et remplacée par de
l'eau claire. Pour les cycles de lavage automatiques, la
température ainsi que la durée du cycle peuvent
également être ajustées en fonction du degré de
souillure.
Système de séchage zéolite
9 AVERTISSEMENT
Risque de brûlures !
Ne touchez jamais le couvercle de sortie zéolite
1R. Il peut devenir très chaud durant le cycle et
pose un risque de brûlure.
9 ATTENTION !
Assurez-vous que la bouche 1J d'entrée n'est
pas obstruée et ne placez pas de vaisselle ou
d'ustensiles sensibles à la température dans le
panier inférieur droit à l'arrière, au-dessus du
couvercle de sortie zéolite 1R.
L'appareil comprend un compartiment à zéolite.Le
zéolite est un cristal pouvant capturer l'humidité et
l'énergie thermique avant de les relâcher.
Durant l'étape de nettoyage, cette énergie thermique
est utilisée pour sécher le cristal et faire monter la
température de l'eau de rinçage.
Durant le séchage, l'humidité dans le compartiment de
rinçage est conservée dans le cristal, qui dégage de
l'énergie thermique. Cette énergie thermique est
ensuite soufflée dans le compartiment de rinçage avec
de l'air sec.Cela accélère et améliore le séchage.
fr-ca
Affichage de l'heure
La durée du cycle de lavage est déterminée par la
température de l'eau lors du cycle de lavage, la quantité
de vaisselle, ainsi que son degré de souillure. Elle peut
aussi varier selon le cycle de lavage choisi. Vous pouvez
choisir d'afficher l'heure ou les heure/minutes restantes
(« Fin à 15:20 » ou « Fin dans 3:25 », par exemple) avant
la fin du cycle dans la fenêtre d'affichage.
Ouvrir la porte
Pour ouvrir la porte, appuyez sur la partie centrale de
celle-ci. L'appareil s'ouvre automatiquement.
Si vous avez activé la sécurité enfants, appuyez deux
fois rapidement sur la partie centrale haute de la porte.
Sensor setting (réglage du capteur)
La séquence des cycles de lavage Auto est optimisée
grâce aux capteurs. Ceux-ci ajustent la puissance des
cycles de lavage Auto selon le degré et le type de
souillure. Vous pouvez régler la sensibilité des capteurs
selon 3 niveaux.
Standard : ce réglage est recommandé pour un usage
quotidien, régulier ou normal. C'est le réglage le plus
éconergétique.
Sensitive (sensible) : ce réglage ajuste la puissance du
cycle de lavage pour éliminer efficacement les restes de
nourriture, même si le degré de souillure est faible. La
consommation en énergie et en eau est ajustée en
conséquence.
Very sensitive (très sensible) : ce réglage ajuste la
puissance du cycle de lavage pour éliminer les
souillures les plus tenaces, comme les restes de
nourriture séchés. Ce réglage est recommandé si vous
utilisez des détergents biologiques ou écologiques, qui
contiennent une quantité moindre d'agents actifs. La
consommation en énergie et en eau est ajustée en
conséquence.
Ces processus vous permettent donc d'économiser du
temps.
93
fr-ca
Mise en marche du lave-vaisselle
Extra Dry (extra sec)
Le rinçage final utilise une température supérieure qui
améliore le résultat de séchage. La durée du
programme peut augmenter légèrement. (Faites
attention avec les ustensiles délicats!) Vous pouvez
activer/désactiver la fonction Extra Dry (extra sec), qui
fait augmenter légèrement la consommation d'énergie.
Sécurité enfants *
L e lave-vaisselle est équipé d'un système de sécurité
enfants. Ce système empêche les enfants d'être
exposés aux divers dangers que représente le lavevaisselle.
Sécur i t é enf ant s
Vous pouvez activer ou désactiver cette fonction.
Lorsque la sécurité enfant est activée, il est plus
difficile d'ouvrir la porte.
Impact écologique
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
Lorsque la fonction Impact écologique est activée, la
consommation d'eau et énergétique moyenne du cycle
de lavage sélectionné est affichée un court instant dans
l'affichage digital @.
Message de bienvenue
Auto power off (Arrêt automatique)
Lorsque vous mettez le lave-vaisselle sous tension, le
logo de la marque apparaît. Vous pouvez désactiver
l'affichage du logo de la marque.
Ce réglage détermine la durée d'illumination du tableau
de commande une fois le cycle terminé.
Réglages d'usine
Pour économiser de l'énergie, le paramètre
recommandé est « After one minute » (après une
minute).
Vous pouvez restaurer les réglages d'usine pour tous
les paramètres.
Voici les réglages possibles :
Mise sous tension de l'appareil
▯
▯
▯
off (arrêt) : l'appareil ne s'éteint pas
automatiquement.
After one minute (après une minute) : l'appareil s'éteint
après 1 minute. C'est le réglage le plus
éconergétique.
After two hours (après deux heures) : l'appareil s'éteint
après 2 heures.
Volume de la sonnerie
La fin du cycle de lavage est indiquée par un signal
sonore. Vous pouvez également modifier ce paramètre.
Bouton de volume
Un signal sonore est émis lorsque vous appuyez sur un
bouton du lave-vaisselle. Vous pouvez contrôler le
volume de ce signal sonore. Si vous ne souhaitez pas
avoir de signal sonore, vous pouvez le désactiver.
94
1. Ouvrez le robinet à fond.
2. Ouvrez la porte.
3. Appuyez sur le bouton On/Off (Marche/Arrêt) (.
Le cycle Auto été défini par défaut au démarrage de
l'appareil. Ce cycle de lavage est sélectionné si vous
n'appuyez sur aucun autre bouton 0.
4. Appuyez sur le bouton Start (Démarrer) )*.
5. Fermez la porte.
Le cycle de lavage démarre.
Remarque : Votre lave-vaisselle est protégé contre les
mises en marche involontaires. Si la porte de l'appareil
reste ouverte durant plus de 4 secondes après que vous
ayez appuyé sur le bouton Démarrer, l'opération est
suspendue. Appuyez de nouveau sur le bouton
Démarrer et fermez la porte de l'appareil.
Mise en marche du lave-vaisselle
Temps de départ différé
Vous pouvez retarder le départ du cycle de lavage
jusqu'à 24 heures. Selon le réglage de l'affichage de
l'heure, la fin du cycle est indiquée par « Fin
dans (3h25min, par exemple) » ou « Fin à (15:20, par
exemple).
1. Ouvrez la porte.
2. Appuyez sur le bouton On/Off (Marche/arrêt) (.
3. Sélectionnez le cycle de lavage 0.
fr-ca
Projection du temps restant (affichage
lors du cycle de lavage) *
D urant le cycle de lavage, des informations
supplémentaires sur le cycle sont projetées au sol, en
face de l'appareil. Si le panneau du socle est vers
l'avant ou si l'appareil est installé à la hauteur des yeux
avec têtière affleurante, l'affichage ne sera pas visible.
Pr oj ect i on du t emps r est ant
Vous pouvez activer ou désactiver cet affichage.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
4. Appuyez sur le bouton Delay start (Départ différé)
`.
5. Continuez à appuyer sur les boutons de réglage + -
X jusqu'à l'obtention du délai désiré.
6. Appuyez sur le bouton Start (démarrer) )*, le
démarrage différé est activé.
7. Pour effacer le temps de Départ différé appuyez sur
le bouton Start (démarrer) )* pendant environ
3 secondes.
EmotionLight
L'EmotionLight 1" (lumiere d'ambiance) s'allume
lorsque la porte est ouverte, que l'appareil soit en
marche ou à l'arrêt (. Lorsque la porte est fermée,
l'EmotionLight est éteinte. Vous pouvez choisir d'activer
ou de désactiver l'EmotionLight.
Remarque : Veuillez remarquer que l'EmotionLight
s'éteint automatiquement après 1 heure si la porte est
ouverte.
8. Fermez la porte.
Remarque : Votre lave-vaisselle est protégé contre les
mises en marche involontaires. Si la porte de l'appareil
reste ouverte durant plus de 4 secondes après que vous
ayez appuyé sur le bouton Démarrer, l'opération est
suspendue. Appuyez de nouveau sur le bouton
Démarrer et fermez la porte de l'appareil.
Fin du cycle de lavage
InfoLight ® *
Peu de temps après la fin du cycle de nettoyage :
* selon les fonctions de votre lave-vaisselle
1. Appuyez sur le bouton On/Off (Marche/Arrêt) (.
Durant le cycle de lavage, un point lumineux est projeté
au sol, sous la porte de l'appareil.
N'ouvrez pas la porte de l'appareil avant que le point ait
disparu.
Si la porte de l'appareil n'est pas complètement fermée,
le point lumineux clignote.
Si l'appareil est installé à la hauteur des yeux avec
meuble affleurant, le point lumineux ne sera pas visible.
Dans des pièces sombres, une certaine diffusion de
lumière peut être visible. Ceci est normal et ne peut pas
être modifié.
Vous pouvez activer ou désactiver le Infolight.
Le cycle de nettoyage est terminé lorsque « Terminé »
apparaît sur l'affichage digital @.
Mise hors tension de l'appareil
2. Fermez l'approvisionnement en eau.
3. Sortez la vaisselle lorsque ceux-ci ont refroidi.
9 AVERTISSEMENT
Risque de blessures !
Pour éviter des risques de blessures, faites
toujours attention lorsque vous ouvrez la porte
pendant ou après un cycle de lavage car des
rejets d'eau chaude ou de vapeur peuvent
survenir. N'ouvrez pas complètement la porte
avant que les bruits d'eau n'aient cessés et que la
vapeur ne soit dissipée.
95
fr-ca
Entretien et maintenance
Interruption du cycle de lavage
9 ATTENTION !
2
Entretien et maintenance
U ne inspection régulière et une maintenance de votre
appareil vous aideront à prévenir d'éventuelles pannes.
Ceci vous permet de sauver du temps et de parer à de
nouveaux problèmes.
Entrei tmaintec
Une pression trop excessive peut provoquer
l'ouverture de la porte et le ruissellement d'eau!
Si la porte a été ouverte et que celle-ci est
chaude ou que le raccordement est chaud,
laissez-la toujours entrouverte quelques minutes,
puis fermez-la.
Nettoyer le filtre du lave-vaisselle
▯
1. Ouvrez la porte.
2. Appuyez sur le bouton On/Off (Marche/Arrêt) (.
Les DEL s'éteignent. Le cycle de lavage a été
sauvegardé.
Recherchez dans le compartiment de rinçage
d'éventuelles traces de graisse ou de calcaire.
Si vous trouvez de tels dépôts :
▯
Remplissez le distributeur 9: de détergent. Lancez
un cycle de lavage sans aucun ustensile, à la
température la plus élevée possible.
3. Pour poursuivre le cycle, appuyez de nouveau sur le
bouton On/Off (Marche/Arrêt) (.
9 AVERTISSEMENT
4. Fermez la porte.
Remarque : Votre lave-vaisselle est protégé contre les
mises en marche involontaires. Si la porte de l'appareil
reste ouverte durant plus de 4 secondes après que vous
ayez appuyé sur le bouton Démarrer, l'opération est
suspendue. Appuyez de nouveau sur le bouton
Démarrer et fermez la porte de l'appareil.
Arrêt du cycle de lavage
(réinitialisation)
Risques pour la santé des détergents
contenant du chlore !
N'utilisez que des détergents sans chlore.
▯
Essuyez régulièrement le devant de l'appareil à l'aide
d'un chiffon légèrement humide; de l'eau et un peu
de savon liquide suffisent.
▯
Pour l'acier inox noir et les surfaces anti-empreintes,
utilisez un linge doux et sec.Pour la saleté tenace,
utilisez de l'eau tiède diluée avec du savon doux, non
abrasif. N'utilisez jamais de produit à polir pour inox.
▯
Avec des électroménagers en acier inoxydable (sauf
ceux en acier inox noir et les surfaces antiempreintes), utilisez un produit à polir pour acier
inoxydable pour sceller et protéger la surface.
▯
Nettoyez régulièrement les bords extérieurs du
panneau intérieur de la porte afin d'éliminer les
résidus déposés lors du chargement normal. Si des
taches apparaissent sur l'acier inoxydable, assurezvous que le distributeur de produit de rinçage est
rempli et fonctionne correctement.
▯
Nettoyez régulièrement le joint de la porte avec un
chiffon légèrement humide afin d'éliminer les
particules alimentaires déposées lors du chargement
normal et qui peuvent causer des odeurs. Un joint de
porte souillé peut empêcher le bon verrouillage de
celle-ci.
1. Ouvrez la porte, appuyez sur le bouton Start
(Démarrer) )* et maintenez-le enfoncé durant
environ 3 secondes, jusqu’a le message «
Programme arrêté » apparaît sur l'affichage digital
@.
2. Fermez la porte.
3. Attendez environ 1 minute tandis que le lave-vaiselle
s’évacue.
4. Ouvrez la porte et appuyez sur le bouton On/Off
(Marche/Arrêt) (.
Changement du cycle de lavage
Après avoir appuyé sur la touche Start )*, il est
impossible de changer de cycle de lavage. Un
changement de cycle de lavage n’est possible que via
l’abandon d’un cycle de lavage (Réinitialisation (Reset)).
96
Entretien et maintenance
AVIS : ▯N'utilisez jamais un nettoyeur à vapeur pour
laver votre lave-vaisselle. Le fabricant ne sera en
aucun cas responsable des dégâts causés.
▯
Évitez d'utiliser des éponges, elles pourraient rayer
les surfaces.
▯
N'utilisez pas de lingettes à base d'eau de javel, elles
pourraient endommager la surface ou l'impression.
▯
N'utilisez pas de produit à polir pour l'acier
inoxydable sur des surfaces en acier inox noir ou
anti-empreintes.
fr-ca
Filtres
Éléments de filtrage
Le système de filtration 1j est constitué de trois
éléments.
$
%
9 AVERTISSEMENT
Faites preuve de prudence lorsque vous
démontez les pièces pour le nettoyage, car
certains débris peuvent être tranchants.
&
A
Filtre à gros éléments
Il empêche les objets qui ne devraient pas
être placés dans votre lave-vaisselle
d'endommager le système de pompage du
lave-vaisselle ou d'obstruer le système
d'évacuation de votre maison.
B
Filtre fin plat
Il empêche les particules d'aliments d'entrer
dans la chambre de lavage et dirige ces
particules vers le micro-filtre.
C
Micro-filtre
Il dirige les particules les plus petites vers le
système de plomberie de la maison.
Sels et agent de rinçage
Rechargez les sels et/ou l'agent de rinçage dès que les
indicateurs de recharge P s'allument sur la façade
H de l'appareil
97
fr-ca
Entretien et maintenance
Intervalles de nettoyage
Pour vérifier ou nettoyer le système de filtration :
Le système de filtration 1j est conçu de manière à
minimiser l'entretien tout en assurant un rendement de
nettoyage élevé et une faible consommation d'énergie.
1. Recherchez des traces de résidus dans les filtres
Selon les habitudes d'utilisation et la dureté de l'eau, le
système de filtration nécessite un certain entretien afin
de garder son efficacité.
après chaque cycle de lavage.
2. Dévissez le filtre à gros éléments tel qu'illustré et
retirez tout le système de filtration.
Vous pouvez nettoyer le système de filtration :
▯
▯
lorsque vous y trouvez des résidus d'aliments ou si
des éléments sont retenus dans le filtre à gros
éléments.
En cas de baisse d'efficacité ou si un film granuleux
se forme sur la vaisselle.
En cas de nettoyage de résidus alimentaires à
incrustation normale raclés avant l'insertion de la
vaisselle dans l'appareil, dans un ménage où le lavevaisselle fonctionne un jour sur deux, le filtre de
l'appareil doit être nettoyé :
Intervalle de
nettoyage
3 à 6 fois par an
8 à 12 fois par an
Utilisation
usage léger à moyen
usage intensif
Remarque : Nettoyez le filtre après le lavage d'une
vaisselle à grande quantité de résidus alimentaires ou
d'une vaisselle à forte teneur en fécule afin de garder un
rendement optimal.
98
3. Retirez le microfiltre du filtre fin pour faciliter le
nettoyage.
Entretien et maintenance
4. Rincez les filtres sous l'eau courante et frottez-le
avec une brosse souple.
fr-ca
Bras gicleurs
Le calcaire et des contaminants dans l'eau de rinçage
peuvent bloquer les buses ainsi que les articulations
des bras de pulvérisation 1: et 1Z.
1. Recherchez d'éventuelles obstructions des buses au
bout des bras de pulvérisation.
2. Dévissez le bras de pulvérisation supérieur 1: (1)
et retirez-le en tirant vers le bas (2).
3. Retirez le bras de pulvérisation inférieur 1Z en le
tirant vers le haut.
Remarque : n'utilisez pas de brosse abrasive ou de
laine d'acier, etc., car elles pourraient endommager
le filtre.
5. Remontez le système de filtration dans l'ordre
inverse et fixez le filtre à gros éléments en le vissant
jusqu'à ce que les flèches de marquage soient
alignées.
4. Nettoyez les bras de pulvérisation à l'eau claire.
5. Remontez les bras de pulvérisation.
99
fr-ca
Entretien et maintenance
Pompe pour eaux résiduaires
6. Contrôlez le compartiment interne et éliminez tout
De gros résidus alimentaires présents dans l'eau de
rinçage et non retenus par les filtres peuvent obstruer la
pompe pour eaux résiduaires. Dans ce cas :
9 AVERTISSEMENT
objet étranger.
Soyez prudent lorsque vous démontez les pièces
pour le nettoyage, car certains débris peuvent
être tranchants.
9 AVERTISSEMENT
Soyez prudent lorsque vous démontez les pièces
pour le nettoyage, car certains débris peuvent
être tranchants.
7. Placez le couvercle de la pompe à sa position initiale
(2), appuyez jusqu'à ce qu'il s'encliquette(3).
1. Débranchez l'appareil du réseau électrique.
2. Sortez le panier supérieur 12 ainsi que le panier
inférieur 9*.
3. Retirez les filtres 1j.
4. Videz l'eau résiduelle avec un récipient approprié -
utilisez une éponge au besoin.
5. À l'aide d'une cuillère, débloquez le couvercle de la
pompe (tel qu'illustré) jusqu'à entendre un clic,
saisissez-le ensuite et tirez-le jusqu'à ce qu'une
légère résistance se fasse sentir, puis tirez-le vers
l'avant (1). Retirez complètement le couvercle.
&OLFN
8. Placez le couvercle à sa position initiale, appuyez et
bloquez-le.
9. Remontez les filtres.
10. Replacez les paniers.
100
Remarque : La pompe de vidange ne fonctionnera pas
correctement si elle n'est pas totalement insérée,
jusqu'à ce qu'elle émette un « clic ».
Dépannage
Rangement de l'appareil en cas
d'inactivité
AVIS : Par temps chaud, avant d'aller en vacances, en
plus de l'arrêt de la vanne principale, arrêtez également
l'alimentation en eau au point le plus proche du lavevaisselle. Ne pas laisser la vaisselle sale dans l'appareil
et laisser la porte légèrement ouverte. Par temps froid,
veuillez respecter les instructions suivantes relatives à
la préparation de l'appareil pour l'hiver.
Préparation de l'appareil pour l'hiver
AVIS : En cas d'inutilisation de votre lave-vaisselle
pour une période dans un emplacement aux
températures hivernales (maison de vacances ou
pendant une période de vacances), faites préparer votre
lave-vaisselle pour l'hiver par un personnel qualifié.
3
fr-ca
Dépannage
L es lave-vaisselle peuvent occasionnellement présenter
des problèmes sans rapport avec un dysfonctionnement
dudit lave-vaisselle. Les informations suivantes peuvent
vous aider à résoudre un problème afférent au lavevaisselle sans la nécessité de recourir à un
professionnel.
Dépange
Remarque : Si l'appareil s'arrête en cours de lavage,
ou s'il ne se met pas en route pour une raison
quelconque, lancez un cycle d'annulation
(Réinitialisation) en premier lieu.
9 AVERTISSEMENT
Des réparations inadaptées ou l'utilisation de
pièces qui ne sont pas d'origine peuvent
provoquer des dégâts considérables et mettre
en danger l'utilisateur !
Faites effectuer toute réparation par un
technicien qualifié. Si un élément doit être
remplacé, utilisez toujours des pièces d'origine.
Message d'erreur
Certaines défaillances sont indiquées dans la partie
supérieure de la fenêtre d'affichage @ ainsi que sur
l'affichage frontal*):. Des solutions possibles à ces
problèmes sont fournies (par exemple : Système de
filtration souillé (E22) --> Nettoyez les filtres).
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
101
fr-ca
Dépannage
Tableau des défaillances
Erreur
Le code d'erreur “:‚‰ est
allumé.
Cause
Le tuyau d'alimentation est coudé.
L'approvisionnement en eau est
coupée.
L'approvisionnement en eau est
bouchée ou calcifiée.
Le filtre du tuyau d'alimentation en
eau est bloqué.
Le code d'erreur “:‹ˆ est
allumé.
Le code d'erreur “:‚ƒ est
allumé.
Le code d'erreur “:ƒƒ est
allumé.
Le code d'erreur “:ƒ… est
allumé.
Le code d'erreur “:ƒ† est
allumé.
Le code d'erreur “:ƒˆ est
allumé.
102
L'ouverture de l'arrivée d'eau (sur le
côté intérieur droit de l'appareil) est
obstruée par de la vaisselle.
Résistance de chauffe souillée ou
entartrée.
Les filtres 1j sont souillés ou
obstrués.
Le tuyau d'évacuation d'eau usée est
coudé ou obstrué.
Le raccord du siphon est scellé.
Le couvercle de la pompe de
drainage est mal fermé.
La pompe de drainage est obstruée
ou le couvercle de la pompe de
drainage est mal fermé.
La tension d'alimentation est trop
faible.
Solution
Installez le tuyau d'alimentation sans
coudes.
Allumez l'approvisionnement en eau.
Allumez l'approvisionnement en eau.
Le débit doit être de 10 l/min lorsque
l'approvisionnement en eau est ouverte.
Mettez le lave-vaisselle hors tension et
débranchez la fiche d'alimentation. Fermez
le robinet. Débranchez le tuyau.
Nettoyez le filtre du tuyau d'alimentation en
eau. Raccordez le tuyau. Vérifiez la
présence d'éventuelles fuites. Rebranchez
l'appareil au réseau électrique. Démarrez le
lave-vaisselle.
Disposez la vaisselle de manière à ce
qu'elle n'obstrue pas l'arrivée d'eau.
Nettoyez le lave-vaisselle à aide d'un produit
de nettoyage pour lave-vaisselle ou d'un
détartrant. Utilisez le lave-vaisselle avec le
système d'adoucissement de l'eau et vérifiez
son réglage.
Nettoyez les filtres. ~ "Filtres"
à la page 97
Installez le flexible d'alimentation sans
coudes et retirez les résidus.
Examinez le raccord du siphon et ouvrez-le
au besoin.
Fermez-le convenablement. ~ "Pompe
pour eaux résiduaires" à la page 100
Nettoyez la pompe et fermez le couvercle
convenablement ~ "Pompe pour eaux
résiduaires" à la page 100
Il ne s'agit pas d'une défaillance du lavevaisselle. Faites vérifier la tension et
l'installation électrique.
Dépannage
Erreur
Un code d'erreur différent est
affiché sur l'affichage digital.
(“:‹‚ à “:„‹)
Cause
Une défaillance technique a
probablement eu lieu.
Le réseau domestique ne charge Le Wi-Fi n'est pas activé sur le
pas.
routeur.
L'affichage Wi-Fi clignote
La connexion au réseau domestique
n'est pas disponible.
Home Connect ne peut pas être Il peut s'agir d'erreurs de réglage
installé correctement.
éventuelles ou d'une défaillance
technique.
L'indicateur de remplissage de
Pas d'agent de rinçage.
sels P et/ou d'agent de
Pas de sels.
rinçage H est allumé.
L'indicateur de remplissage de
sels P et/ou d'agent de
rinçage H n'est pas allumé.
Il reste de l'eau dans le lavevaisselle à la fin du cycle de
lavage.
fr-ca
Solution
Mettez l'appareil hors tension en appuyant
sur le bouton Marche/Arrêt (. Après un
court moment, remettez le lave-vaisselle
sous tension.
Si le problème persiste, fermez le robinet et
débranchez la prise d'alimentation.
Appelez le service à la clientèle et
mentionnez le code d'erreur.
Vérifiez la connexion du réseau sans fil de
votre routeur.
Activez le réseau sans fil sur votre routeur.
Observez les documents fournis et les
informations d'assistance relatives à Home
Connect.
Remplissez l'agent de rinçage.
Remplissez avec du sel adoucisseur pour
lave-vaisselle.
Le capteur ne détecte pas les
Utilisez un sel adoucisseur pour lavecomprimés de sels.
vaisselle différent.
L'indicateur de remplissage est
Activation/désactivation ~ ", Produit de
rinçage" à la page 75, ~ "+ Système
éteint.
d'adoucissement de l'eau / sels"
à la page 73
Il reste encore suffisamment de sels/ Vérifiez le niveau des indicateurs de
d'agent de rinçage.
remplissage.
Le système de filtration ou l'espace
Nettoyez les filtres ainsi que la zone se
sous les filtres 1j est obstrué.
trouvant sous ces derniers.
Le cycle de lavage n'est toujours pas Attendez la fin du cycle de lavage ou la
terminé.
réinitialisation de ce dernier.
103
fr-ca
Dépannage
Erreur
La vaisselle n'est pas sèche.
Cause
Distributeur d'agent de rinçage vide
ou insuffisamment rempli.
Cycle de lavage sélectionné sans
séchage.
Il reste de l'eau dans les creux de la
vaisselle et de l'argenterie.
Le détergent tout-en-un a des
propriétés de séchage médiocres
La vaisselle en plastique n'est
pas sèche.
L'argenterie n'est pas sèche.
L'intérieur de l'appareil est
humide après le cycle de
rinçage.
104
Solution
Remplissez l'agent de rinçage.
Sélectionnez un cycle de lavage avec
séchage. ~ "Cycles du lave-vaisselle"
à la page 89
Disposez la vaisselle de façon inclinée, en
particulier celle qui présente des dépôts
d'eau une fois le cycle de lavage terminé.
Utilisez un autre détergent tout-en-un avec
de meilleures propriétés de séchage.
L'utilisation d'un agent de séchage améliore
également celui-ci.
extraSec pour améliorer le séchage
Activez extraSec. ~ "Options de cycles du
non activé.
lave-vaisselle" à la page 90
La vaisselle a été retirée trop tôt ou le Attendez la fin du cycle de lavage ou
séchage n'est pas encore terminé.
attendez 30 minutes après la fin de celui-ci
avant de retirer la vaisselle.
L'agent de rinçage écologique a des Utilisez un agent de rinçage classique. Les
propriétés de séchage médiocres.
produits écologiques peuvent avoir une
efficacité limitée.
Le plastique a des propriétés
Les matières plastiques n'absorbent pas la
inhérentes.
chaleur et, par conséquent, ne sèchent pas
aussi bien.
L'argenterie n'est pas disposée
Séparez l'argenterie si possible, ceci afin
correctement dans le panier prévu à d'éviter les points de contact.
cet effet.
L'argenterie n'est pas disposée
Disposez l'argenterie correctement et
correctement dans le troisième
séparez-la si possible.
panier.
Il ne s'agit pas d'une défaillance du
Avec « Séchage par condensation », la
lave-vaisselle.
vapeur se condense en gouttelettes d'eau
sur les parois du réservoir du lave-vaisselle.
La pression de la vapeur à l'intérieur du
lave-vaisselle pompe l'eau hors du lavevaisselle.
Dépannage
Erreur
Traces de nourriture sur la
vaisselle.
Cause
Pas assez d'espace entre les
éléments, panier surchargé.
La rotation du bras de pulvérisation
est entravée.
Les buses du bras de pulvérisation
sont bouchées.
Filtres 1j encrassés.
Filtres 1j mal insérés et/ou non
insérés.
Cycle de rinçage trop faible.
Le lave-vaisselle semble
fonctionner trop longtemps
fr-ca
Solution
Disposez la vaisselle de manière adéquate
en laissant suffisamment d'espace entre les
éléments afin que les jets d'eau puissent
atteindre toute leur surface. Évitez les
points de contact.
Disposez la vaisselle de sorte que le bras
de pulvérisation puisse tourner sans
entrave.
Nettoyez les buses du bras de pulvérisation.
~ "Entretien et maintenance" à la page 96
Nettoyez les filtres. ~ "Entretien et
maintenance" à la page 96
Insérez les filtres correctement.
Choisissez un cycle de rinçage plus fort.
Augmentez la sensibilité des capteurs.
Le prélavage a enlevé la majorité des N'effectuez pas de rinçage préalable des
souillures, les capteurs ont alors
plats. Ne retirez que le plus gros des
choisi de lancer un cycle de lavage
souillures.
léger. Des souillures tenaces sont
Augmentez la sensibilité des capteurs.
impossibles à enlever.
Le cycle de lavage « Normal » ou Intensif est
recommandé.
Les récipients longs et étroits ne sont Ne placez pas les récipients étroits et creux
pas bien rincés lorsqu'ils sont dans
de manière trop oblique et ne les placez pas
les coins du panier.
dans les coins.
Le panier supérieur 12 n'est pas à Repositionnez le panier supérieur de
la même hauteur à gauche et à droite. manière horizontale à l'aide des leviers
latéraux.
L'eau entrante n'est pas assez
Avant de démarrer un cycle, ouvrez le
chaude.
robinet d'eau chaude au niveau de l'évier le
plus proche du lave-vaisselle.
Le temps de cycle peut varier en
Les capteurs dans le lave-vaisselle
raison de l'état de souillure et de
augmentent automatiquement le temps du
l'eau.
cycle pour assurer un bon lavage lorsque la
souillure est détectée.
Le distributeur de 92 produit de
Ajoutez le produit de rinçage.
rinçage est vide.
Lave-vaisselle connecté à
Vérifiez que le lave-vaisselle est connecté à
l'alimentation en eau froide.
la plomberie d'alimentation en eau chaude.
Remarque : Vérifiez
la
durée
spécifique du cycle de lavage.
105
fr-ca
Dépannage
Erreur
Résidus de détergent.
Taches d'eau sur les parties en
plastique.
Dépôt de pellicules solubles à
l'intérieur de l'appareil ou sur la
porte.
106
Cause
Le couvercle du distributeur 9: de
détergent est bloqué par la vaisselle
et ne peut pas s'ouvrir complètement.
Le couvercle du distributeur à
détergent 9: est bloqué par le
comprimé détergent.
Comprimés détergents utilisés dans
le cycle de lavage court ou rapide.
Les comprimés détergents n'ont pas
le temps de se dissoudre
complètement dans le cycle de
lavage court ou rapide.
Les propriétés de nettoyage et de
dissolution sont réduites après un
temps d'entreposage prolongé ou si
le détergent est en morceaux.
La formation de gouttelettes sur les
surfaces en plastique est
physiquement impossible à éviter.
Des traces d'eau sont visibles après
le séchage.
Solution
La vaisselle ne doit pas être placée audessus du compartiment détergent1B.
Cela peut bloquer le couvercle du
distributeur de détergent et l'empêcher de
s'ouvrir complètement.
Ne placez pas de vaisselle ou de
distributeur de parfum dans le
compartiment à détergent.
Le comprimé détergent doit être déposé à
plat et non sur le côté.
Le temps de dissolution des comprimés
détergents est trop long pour un cycle de
lavage court.
Utilisez un détergent en poudre ou
sélectionnez un cycle de lavage plus fort.
Changez de détergent.
Utilisez un cycle de lavage plus fort (avec
davantage de changements d'eau).
Disposez la vaisselle de manière inclinée.
Utilisez un agent de rinçage.
Au besoin, sélectionnez une valeur
d'adoucissement de l'eau plus élevée.
Dépôt de substances du détergent.
Changez de marque de détergent.
Ces dépôts ne peuvent généralement Nettoyez le lave-vaisselle mécaniquement.
pas être retirés à l'aide de produits
chimiques (nettoyant pour lavevaisselle etc.).
Choisissez une valeur plus élevée et
Si une « pellicule blanche » est
présente dans le fond de l'appareil, le changez de détergent si besoin.
système d'adoucissement de l'eau a
été réglé sur une valeur trop faible.
Le couvercle du distributeur à sel
Fermez convenablement le couvercle du
1b n'est pas fermé.
distributeur à sel.
Uniquement pour le verre : les débuts Consultez . ~ "Dégâts causés à la verrerie
de corrosion sur le verre ne peuvent et l'argenterie" à la page 77
être qu'essuyés en apparence.
Dépannage
Erreur
Dépôts calcaires blancs et
tenaces sur la vaisselle, les
parois ou la porte.
Cause
Dépôt de substances du détergent.
Ces dépôts ne peuvent généralement
pas être retirés à l'aide de produits
chimiques (nettoyant pour lavevaisselle etc.).
Le réglage de la dureté de l'eau est
incorrect ou la dureté de l'eau est
supérieure 800 ppm.
Le détergent biologique/écologique
3 en 1 n'est pas assez efficace.
Sous-dosage du détergent.
Résidus de thé ou de rouge à
lèvres sur la vaisselle.
Pellicules colorées (bleu, jaune,
marron) difficiles ou impossibles
à enlever dans le lave-vaisselle
ou sur la vaisselle en acier
inoxydable.
Dépôts colorés (jaune, orange,
marron) à l'intérieur du lavevaisselle (principalement au
fond) faciles à enlever.
Décoloration des pièces en
plastique à l'intérieur du lavevaisselle.
Le cycle de rinçage sélectionné est
trop faible.
La température de rinçage est trop
basse.
Pas assez de détergent ou détergent
inapproprié.
Le prélavage a enlevé la majorité des
souillures, les capteurs ont alors
choisi de lancer un cycle de lavage
léger. Des souillures tenaces sont
impossibles à enlever.
Pellicule formée à partir de légumes
(chou, céleri, pommes de terre,
pâtes, etc.) ou de l'eau du robinet
(manganèse).
Leur formation peut être causée par
des éléments métalliques sur de
l'argent ou de l'argenterie en
aluminium.
Pellicules savonneuses formées à
partir de souillures et de substances
provenant de l'eau du robinet
(calcaires).
Les pièces en plastique à l'intérieur
du lave-vaisselle peuvent se
décolorer au fil de l'utilisation de
celui-ci.
Pièces en plastique décolorées. La température de rinçage est trop
basse.
Le prélavage a enlevé la majorité des
souillures, les capteurs ont alors
choisi de lancer un cycle de lavage
léger. Des souillures tenaces sont
impossibles à enlever.
fr-ca
Solution
Changez de marque de détergent.
Nettoyez le lave-vaisselle mécaniquement.
Réglez le système d'adoucissement de l'eau
selon les instructions ou remplissez les
sels.
Réglez le système d'adoucissement de l'eau
selon les instructions ou utilisez des
détergents séparés ( détergent de marque,
sel, agent de rinçage).
Augmentez la quantité de détergent ou
changez de détergent.
Choisissez un cycle de rinçage plus fort.
Sélectionnez un cycle de lavage avec une
température supérieure.
Utiliser un détergent et un dosage
appropriés.
N'effectuez pas de rinçage préalable des
plats. Ne retirez que le plus gros des
souillures.
Augmentez la sensibilité des capteurs.
Le cycle de lavage « Normal » est
recommandé
Peut-être partiellement retirée avec un
nettoyant pour lave-vaisselle ou par
nettoyage à la main. Ces pellicules sont
sans danger.
Peut-être partiellement retirée avec un
nettoyant pour lave-vaisselle ou par
nettoyage à la main.
Vérifiez le bon fonctionnement du système
d'adoucissement de l'eau (remplissez les
sels) ou, si vous utilisez un détergent touten-un (comprimés), activez le système
d'adoucissement de l'eau. ~ "Système
d'adoucissement de l'eau / sels"
à la page 73
Cette décoloration est normale et
n'empêchera pas le lave-vaisselle de
fonctionner correctement.
Sélectionnez un cycle de lavage avec une
température supérieure.
N'effectuez pas de rinçage préalable des
plats. Ne retirez que le plus gros des
souillures.
Augmentez la sensibilité des capteurs.
Le cycle de lavage « Normal » est
recommandé
107
fr-ca
Dépannage
Erreur
Cause
Taches amovibles sur les verres, Trop d'agent de rinçage.
verres et argenterie avec une
apparence métallique.
Pas d'agent de rinçage ou valeur
définie trop faible.
Résidus de détergent déposés au
cours du cycle de rinçage final. Le
couvercle du distributeur de
détergent est bloqué par la vaisselle
et ne peut pas s'ouvrir complètement.
Solution
Réglez la quantité d'agent de rinçage à une
valeur moins élevée.
Ajoutez de l'agent de rinçage et vérifiez le
dosage (valeurs recommandées 4 ou 5).
Le couvercle du distributeur de détergent
ne doit pas être bloqué par la vaisselle.
Ne placez pas de vaisselle ou de
distributeur de parfum dans le
compartiment à détergent.
Le prélavage a enlevé la majorité des N'effectuez pas de rinçage préalable des
souillures, les capteurs ont alors
plats. Ne retirez que le plus gros des
choisi de lancer un cycle de lavage
souillures.
léger. Des souillures tenaces sont
Augmentez la sensibilité des capteurs.
impossibles à enlever.
Le cycle de lavage « Normal » est
recommandé
Verres ternis de manière
Verres non adaptés au lavage en lave- Utilisez des verres adaptés au lavage en
irréversible.
vaisselle.
lave-vaisselle.
Évitez l'exposition prolongée à la vapeur
(phase ayant lieu une fois le cycle de lavage
terminé).
Utilisez un cycle de lavage à basse
température.
Réglez le système d'adoucissement de l'eau
selon la dureté de l'eau (choisissez une
valeur inférieur d'un point si besoin).
Utilisez un détergent contenant un agent qui
protège le verre.
Points de rouille sur l'argenterie. L'argenterie résiste mal à la rouille.
Utilisez de l'argenterie résistante à la
Les lames des couteaux sont
corrosion.
fréquemment plus sévèrement
touchées.
Ne lavez pas les éléments rouillés.
L'argenterie rouillera également si
des parties rouillées sont rincées en
même temps (poignées de
casseroles, paniers à ustensiles
endommagés, etc.).
Trop de sels dans l'eau de rinçage, à Fermez le couvercle du distributeur
cause du couvercle du distributeur de convenablement ou retirez les sels versés à
sel qui n'a pas été fermé
côté.
convenablement ou parce que des
sels ont été versés à côté lors du
remplissage.
L'appareil ne peut pas être mis
Erreur.
Débranchez le lave-vaisselle du réseau
sous tension ou il ne fonctionne
électrique, débranchez la fiche secteur ou
pas.
retirez le fusible. Attendez au moins
5 secondes, puis rebranchez l'appareil au
réseau électrique.
108
Dépannage
Erreur
Cause
Le lave-vaisselle ne démarre pas Le fusible d'alimentation a peut-être
sauté ou le disjoncteur s'est
déclenché.
La porte peut ne pas être
correctement verrouillée.
L'unité peut ne pas être allumée.
Le Départ différé peut être activé.
La sécurité enfants est activée.
La porte a probablement été fermée
sans que le cycle ne soit
préalablement sélectionné.
Cordon d'alimentation non inséré.
Le lave-vaisselle n'est peut-être pas
connecté à l'alimentation en eau.
La porte du lave-vaisselle n'a pas été
fermée correctement.
La portée est restée ouverte durant
plus de 4 secondes après avoir
appuyé sur le bouton Départ.
Le cycle de lavage démarre
automatiquement.
Vous n'avez pas attendu la fin du
cycle de lavage.
La porte ne s'ouvre pas.
La porte n'est pas installée
convenablement.
La sécurité enfants est activée.
Le lave-vaisselle est débranché de la
prise d'alimentation.
fr-ca
Solution
Remplacez le fusible ayant sauté ou
réenclenchez le disjoncteur qui a sauté.
Appuyez sur l'interrupteur d'alimentation
principale pour la mettre sous tension.
Fermez complètement la porte.
Pour le réinitialiser, veuillez vous référer à la
rubrique « Départ différé » de ce manuel.
Désactivez la sécurité enfants. Veuillez vous
référer à la rubrique « Sécurité enfants » de
ce manuel, si besoin.
Sélectionnez un cycle et fermez la porte.
Assurez-vous que le cordon d'alimentation
est branché entièrement à la prise et
raccordé à l'arrière du lave-vaisselle.
Vérifiez que la prise fonctionne.
Vérifiez et rétablissez l'approvisionnement
en eau.
Fermez la porte.
Appuyez à nouveau sur le bouton Départ et
fermez la porte du lave-vaisselle dans les
4 secondes qui suivent (voir « Protection
contre les utilisations non désirées »).
Effectuez une réinitialisation.
(voir « Annulation du cycle de lavage »).
Installez la porte correctement à l'aide des
instructions d'installation.
Appuyez deux fois rapidement sur la partie
centrale du haut de la porte.
Vérifiez la prise d'alimentation et les
fusibles.
Raccordez le dispositif de déverrouillage de
secours à gauche et à droite de la partie
supérieure de l'appareil et ouvrez la porte
en tirant doucement sur le dispositif de
déverrouillage de secours.
Porte et joints de porte souillés.
Nettoyez la porte et le joint de porte à l'aide
d'un tissu humide légèrement imbibé de
produit de nettoyage.
Le système de fermeture automatique Après avoir fermé la porte, attendez une
de la porte n'est pas dans la position seconde avant de pouvoir l'ouvrir à nouveau.
de départ.
109
fr-ca
Dépannage
Erreur
La porte ne ferme pas.
Cause
Le système de fermeture automatique
de la porte n'est pas dans la position
de départ.
Le couvercle du distributeur de Le distributeur de détergent ou le
détergent ne peut être fermé.
guide de son couvercle est bloqué
par des résidus collants de
détergent.
Résidus de détergent dans le
Les bras de pulvérisation sont
distributeur de détergent 9: ou bloqués par la vaisselle et le
dans le compartiment à
détergent ne peut être rincé.
comprimé détergent 1B.
Le distributeur de détergent était
humide lors du remplissage.
Le lave-vaisselle s'arrête en
La porte n'est pas fermée
cours de cycle de lavage ou ce
correctement.
dernier est interrompu.
Ne placez pas de vaisselle ou de
distributeur de parfum dans le
compartiment à détergent.
Le panier supérieur appuie contre la
porte et l'empêche de fermer
correctement.
Coupure d'alimentation électrique et/
ou d'eau.
Les valves de remplissage font
Cela dépend de l'installation
un bruit de contact.
domestique et ne constitue pas une
défaillance du lave-vaisselle. Cela
n'affecte pas le fonctionnement du
lave-vaisselle.
Bruits de chocs ou de casse.
Le bras de pulvérisation heurte la
vaisselle, celle-ci n'est pas disposée
correctement.
Si ces bruits surviennent alors que le
chargement est léger, il s'agit alors
des jets d'eau qui touchent la cuve de
lavage.
La vaisselle légère bouge durant le
cycle de lavage.
Formation de mousse
Nettoyez manuellement le liquide
inhabituelle.
dans le distributeur d'agent de
rinçage.
Rincez l'agent de rinçage ayant
débordé.
--------
110
Solution
Après avoir ouvert la porte, attendez une
seconde avant de pouvoir la fermer à
nouveau.
Retirez les résidus de détergent.
Assurez-vous que les bras de pulvérisation
peuvent tourner librement.
Ne versez du détergent que dans le
distributeur de détergent sec.
Fermez la porte.
Vérifiez si le panneau arrière est
éventuellement comprimé, par exemple par
une prise ou un support de flexible n'ayant
pas été retiré.
Rétablissez l'alimentation électrique ou
d'eau.
Pas de solution.
Disposez la vaisselle de manière à ce que le
bras de pulvérisation ne la touche pas.
Chargez davantage le lave-vaisselle ou
disposez la vaisselle de manière plus
uniforme dans celui-ci.
Disposez la vaisselle légère de manière
sûre.
Remplissez immédiatement le distributeur
d'agent de rinçage.
Retirez l'agent de rinçage à l'aide d'un tissu.
Service à la clientèle
4
Service à la clientèle
V otre lave-vaisselle ne nécessite pas d'entretien autre
que les mesures décrites dans la rubrique Entretien et
maintenance du présent manuel. En cas de défaillance
de votre lave-vaisselle, veuillez vous référer à la rubrique
Guide de dépannage du présent manuel, avant de
contacter le service client. Si la maintenance est
nécessaire, contactez votre revendeur ou installateur,
ou un centre de service agréé. N'essayez pas de réparer
votre appareil vous-même. Tout travail effectué par un
personnel non autorisé peut annuler la garantie.
fr-ca
Déclaration de la garantie limitée du
produit
‡
Servicàlacientèl
En cas de problème avec votre lave-vaisselle et si vous
n'êtes pas satisfait du service que vous avez reçu,
veuillez suivre les étapes suivantes jusqu'à ce que le
problème soit résolu à votre entière satisfaction :
C e que couvre cette garantie et à qui
elle s'applique :
Déclrationdelagrntiel mitéeduproit
La garantie limitée fournie par BSH Home Appliances
(Gaggenau ® ) dans cet énoncé de garantie limitée
s’applique seulement à l'appareil Gaggenau (le
« Produit ») qui vous a été vendu à titre de premier
acheteur, dans la mesure que le produit a été acheté :
▯
pour vos besoins, personnels (non-commerciaux), et
qu'il a été utilisé, à tout moment, à des fins familiales
normales ;
▯
neuf au détail (pas en tant qu'objet exposé, « en
l'état », ou un modèle précédemment retourné), et
non pour la revente, ou pour une utilisation
commerciale ; et
▯
aux États-Unis ou au Canada, et est en tout temps
demeuré dans le pays d'achat. Les garanties
mentionnées dans le présent manuel s'appliquent
uniquement au premier acquéreur du Produit et ne
sont pas transférables.
1. Contactez votre installateur ou le Fournisseur de
services agréé Gaggenau
®
de votre région.
2. Envoyez-nous un courriel à partir de la rubrique de
service à la clientèle de notre site Internet,
www.gaggenau-usa.com
3. Contactez-nous au 877-442-4436
4. Écrivez-nous :
Gaggenau ®
1901 Main Street, Suite 600
Irvine, CA 92614
USA
Veuillez vous assurer d'indiquer les informations
relatives à votre modèle ainsi qu'une explication du
problème et la date à laquelle celui-ci a débuté. Vous
trouverez les informations relatives au modèle et au
numéro de série sur l'étiquetage se trouvant à
l'extrémité de la porte du lave-vaisselle. Veuillez faire
une copie de votre facture et conservez-la avec ce
manuel. Pour bénéficier du service de garantie, il peut
être demandé au client de présenter une preuve d'achat
de l'équipement.
Gaggenau se réserve le droit d’exiger une preuve
d’achat à chaque réclamation au titre de la garantie afin
de confirmer que le Produit tombe dans le champ
d’application de la présente garantie limitée.
Assurez-vous de retourner votre carte d'enregistrement ;
alors qu'il n'est pas nécessaire d'effectuer une
couverture de garantie, il s'agit toutefois du meilleur
moyen pour Gaggenau de vous contacter en cas
d'émission d'un avis de sécurité ou d'un rappel de
produit.
111
fr-ca
Déclaration de la garantie limitée du produit
Durée de la garantie
Gaggenau garantit que le Produit est exempt de défauts
matériels et de défauts de production pour une période
de sept cent trent (730) jours (2 ans) à compter de la
date d'achat. La période susmentionnée commence à
partir de la date d'achat et ne saurait être limitée,
prolongée, ou interrompue pour quelque raison que ce
soit.
Ce Produit est également garanti contre tout défaut de
matériau et de fabrication apparent (tels les éraflures
sur l'acier inoxydable, les défauts d'aspect de la
peinture ou de la porcelaine, les ébréchures, les
bosselures, ou autres dégâts au fini du Produit),
pendant une période de trente (30) jours à compter de
la date d'achat ou de la date de clôture pour une
nouvelle construction. Cette garantie relative à
l'apparence exclut les légères variations de couleur
découlant des différences inhérentes aux pièces
peintes et en porcelaine, ainsi que découlant des
différences causées par l'éclairage de cuisine,
l'emplacement du produit ou d'autres facteurs
similaires. Cette garantie relative à l'apparence exclut
plus particulièrement tout appareil électroménager en
exposition, de plancher, « En l'état » ou de stock « B ».
Réparer/Remplacer, comme recours
exclusif
Pendant cette période de garantie, Gaggenau ou l'un de
ses fournisseurs de services agréés réparera
gratuitement votre Produit (sujet à certaines restrictions
susmentionnées) si celui-ci présente des défauts
matériels ou de fabrication. Si des tentatives de
réparation du Produit ont été entreprises, sans succès
toutefois, alors Gaggenau remplacera votre Produit (des
modèles améliorés peuvent être mis à votre disposition,
à la seule discrétion de Gaggenau, moyennant frais
supplémentaires). Toutes les pièces et tous les
composants retirés demeurent la propriété de
Gaggenau à sa seule discrétion. Toutes les pièces
remplacées et/ou réparées doivent assumer l'identité
de la pièce originale aux fins de la présente garantie et
cette dernière ne doit pas être prolongée en
considération de telles pièces. La seule responsabilité
de Gaggenau, en vertu des présentes, se limite à la
réparation des Produits défectueux au départ de l'usine,
par le biais d'un fournisseur de services Gaggenau
pendant les heures de travail normales. Pour des
considérations de sécurité et d'endommagement de
propriétés, Gaggenau vous recommande vivement de ne
pas essayer de réparer le Produit vous-même, ni de faire
appel à un agent d'entretien non autorisé ; Gaggenau
n'est en aucun cas responsable des réparations ou des
travaux effectués par un agent non qualifié. Si vous
faites appel à un agent d'entretien autre qu'un
fournisseur de services agréé pour la réparation de
112
votre Produit, CETTE GARANTIE EST AUTOMATIQUEMENT
ANNULÉE. Les fournisseurs de service agréés désignent
ces personnes ou entreprises ayant reçu des formations
spéciales sur les produits Gaggenau, et qui ont, de
l'avis de Gaggenau, une très bonne réputation en
matière de service à la clientèle et d'aptitude technique
(notez qu'elles sont des entités indépendantes et non
des agents, partenaires, sociétés affiliées ou
représentants de Gaggenau). Nonobstant ce qui
précède, Gaggenau n'encourra aucune responsabilité
pour le Produit si ce dernier est utilisé dans une zone
éloignée (à plus de 100 miles d'un fournisseur de
services agréé) ou s'il se trouve dans un environnement
raisonnablement inaccessible, à risque, menaçant, ou
hostile ; à cet effet, Gaggenau se chargera, à la
demande, du paiement des travaux et pièces, et les
enverra au fournisseur de services agréé le plus proche
de votre localité, mais vous serez entièrement
responsable des frais de déplacement ou d'autres frais
spéciaux encourus par l'entreprise de services, en
espérant qu'elle accepte d'intervenir pour la réparation.
Produit hors garantie
Gaggenau n'est pas tenu, légalement ou autrement, de
faire des concessions, y compris des réparations, des
partages de frais ou un remplacement du Produit une
fois que cette garantie a expirée.
Déclaration de la garantie limitée du produit
Exclusions de garantie
La couverture de garantie décrite dans le présent
manuel exclut tous les défauts ou dommages dont
Gaggenau n'est pas directement responsable, y
compris, sans pour autant s'y limiter, l'un ou plusieurs
des points suivants :
▯
L'utilisation du Produit dans des conditions
anormales ou inhabituelles, (y compris, de façon non
exhaustive, toute forme d'utilisation commerciale,
l'utilisation ou le stockage à l'extérieur d'un produit
destiné à un usage interne, l'utilisation du Produit
conjointement à des réservoirs d'air ou d'eau
courante) ;
▯
Une faute intentionnelle d'un tiers, la négligence, la
mauvaise utilisation, l'utilisation abusive, des
accidents, l'exploitation inadéquate, le manque
d'entretien, la mauvaise installation, la falsification,
le non respect des instructions d'utilisation, la
manipulation sans précaution, les réparations non
autorisées ( y compris les réparations effectuées par
l'utilisateur ou l'étude du fonctionnement interne de
la machine par celui-ci) ;
▯
Réglage, modification ou altération de tout type ;
▯
Le non-respect des codes, règlements ou lois locaux,
étatiques ou départementaux applicables au système
électrique, à la plomberie et/ou aux bâtiments, y
compris la non-installation du produit conformément
aux règlements et codes de sécurité locaux
applicables au bâtiment et à la prévention des
incendies ;
▯
L'usure et la détérioration normales, les
déversements d'aliments et de liquides, les
accumulations de graisses ou d'autres substances
sur, dans ou autour du Produit ;
▯
Les forces et facteurs externes, élémentaires et/ou
environnementaux, y compris, mais sans limitation, la
pluie, le vent, le sable, les inondations, les incendies,
coulées de boue, températures de gel, moisissures
excessives ou l'exposition prolongée à l'humidité, la
foudre, les surtensions, défaillances de structure
autour de l'appareil, et catastrophes naturelles.
Gaggenau ne saurait en aucun cas être tenu pour
responsable de de tout dommage sur les propriétés
adjacentes, notamment les armoires, planchers,
plafonds et autres structures ou objets se trouvant aux
alentours du Produit. Également exclus de la garantie
sont les Produits dont les numéros de série ont été
modifiés, effacés ou enlevés ; appels de service pour
enseigner le fonctionnement du Produit ou les visites
pour lesquelles aucun problème avec le Produit n'a été
détecté ; correction de problèmes d’installation (le
consommateur est seul responsable pour toute
fr-ca
structure et tout réglage du Produit, incluant
l’électricité, la plomberie et autres connexions
nécessaires, pour une fondation/plancher approprié, et
pour toute modification incluant, sans limitation,
armoires, murs, planchers, tablettes, etc.) et la remise
de disjoncteurs ou le remplacement de fusibles.
DANS LA MESURE OÙ LA LOI L'AUTORISE, CETTE
GARANTIE DÉFINIT VOTRE RECOURS EXCLUSIF
QUANT AU PRODUIT, QUELLE QUE SOIT LA NATURE
DE LA DÉCLARATION, QU'IL S'AGISSE D'UN
CONTRAT OU D'UN PRÉJUDICE (INCLUANT LA
RESPONSABILITÉ ABSOLUE OU LA NÉGLIGENCE)
OU AUTREMENT. CETTE GARANTIE REMPLACE
TOUTE AUTRE GARANTIE, EXPRESSE OU ÉCRITE.
TOUTE GARANTIE IMPLICITEMENT VISÉE PAR LA
LOI, DE QUALITÉ MARCHANDE OU D'ADÉQUATION
POUR UN USAGE PARTICULIER, OU AUTREMENT NE
SERA EFFECTIVE QUE POUR LA PÉRIODE DE
VALIDITÉ DE LA PRÉSENTE GARANTIE. LE
FABRICANT NE SERA EN AUCUN CAS
RESPONSABLE DE TOUTE « PERTE COMMERCIALE »
IMMATÉRIELLE, PARTICULIÈRE, ACCESSOIRE,
INDIRECTE, ET/OU DES DOMMAGES PUNITIFS, DES
PERTES OU DES DÉPENSES, Y COMPRIS, SANS
LIMITATION, L'ABSENCE AU TRAVAIL, LES FRAIS
D'HOTÊLS ET/OU DE REPAS PRIS AU RESTAURANT,
LES DÉPENSES DE RESTRUCTURATION EN SUS
DES DOMMAGES DIRECTEMENT CAUSÉS PAR BSH,
OU AUTREMENT. CERTAINS ÉTATS N'AUTORISENT
PAS L'EXCLUSION OU LA LIMITATION DES
DOMMAGES IMMATÉRIELS OU ACCESSOIRES ET
D'AUTRES N'AUTORISENT PAS LES LIMITATIONS
SUR LA DURÉE DE LA GARANTIE IMPLICITE, IL EST
DONC POSSIBLE QUE LES RESTRICTIONS
SUSMENTIONNÉES NE VOUS CONCERNENT PAS.
CETTE GARANTIE VOUS ACCORDE DES DROITS
SPÉCIFIQUES LÉGAUX, LESQUELS PEUVENT
VARIER D'UN ÉTAT À L'AUTRE. Aucune modification,
changement ou amendement de cette garantie ne peut
entrer en vigueur sans le consentement écrit autorisé
par un officier de Gaggenau.
Comment bénéficier d'un service de
garantie
Pour obtenir un service sous garantie pour votre
Produit, contactez le centre de service autorisé
Gaggenau le plus proche de chez vous.
113
fr-ca
5
Installation et raccordement
Installation et raccordement
L e lave-vaisselle doit être raccordé correctement sous
peine de ne pas fonctionner convenablement. Les
caractéristiques d'arrivée et d'écoulement d'eau, ainsi
que la puissance raccordée doivent correspondre aux
critères requis énoncés dans le paragraphe suivant ou
détaillés dans les instructions d'installation.
Instal ionetracdment
Installez l'appareil en suivant les étapes dans cet
ordre :
Livraison
Votre lave-vaisselle a été inspecté minutieusement à
l'usine afin d'en assurer un état de fonctionnement
impeccable. Pour cette raison, de petites taches d'eau
peuvent être présentes. Celles-ci disparaîtront au
premier lavage.
Données techniques
▯
1. Inspectez l'appareil à sa réception
2. Installation
jusqu'à 60 kg (132 lbs)
▯
3. Raccordement de l'évacuation
4. Raccordement à l'eau courante
▯
Pièces incluses
Lave-vaisselle
▯
Manuel d'utilisation
▯
Instructions d'installation
▯
Guide de référence rapide*
▯
Garantie*
▯
Matériel d'installation
▯
Rabat antivapeur*
▯
Tablier de caoutchouc*
▯
Cordon d'alimentation
Veuillez vous référer aux Consignes importantes de
sécurité pour l'installation, incluses dans le manuel
séparé Consignes d'installation, compris avec votre
lave-vaisselle.
114
Disjoncteur :
12 A
▯
Consommation énergétique :
État éteint/mode veille
État non éteint (veille)
Veille avec maintien de la
connexion au réseau
Durée de l’état non éteint
Durée après laquelle
l’appareil est mis en veille
avec maintien de la
connexion au réseau
0,50 W
0,50 W
2,00 W
0 min
2 min
Répond aux règlements (UE) actuels pour le label
énergétique et l’écoconception au moment de la
mise en circulation.
Les fonctions additionnelles et les réglages peuvent
influer sur la consommation énergétique et les
indications de temps.
*dépend de l'équipement de votre lave-vaisselle
Consignes de sécurité
Puissance raccordée :
1 440 W.
▯
▯
Tension :
120 V, 60 Hz
5. Raccordement électrique
En cas de réclamation, contactez votre revendeur ou
notre service après-vente.
Poids :
▯
Pression d'eau :
7,25 PSI (0,5 bar) minimum, 145 PSI (10 bar)
maximum.
Si la pression d'eau est supérieure :
raccordez la soupape de réduction de pression en
amont.
Installation et raccordement
▯
▯
▯
Débit d'entrée :
Raccordement à l'eau courante
2,65 gallons/minute (10 litres/minute) minimum
1. Connectez le raccord d'eau courante au robinet en
Température de l'eau :
suivant les instructions d'installation et en utilisant
les pièces fournies.
eau froide.
Eau chaude :
Température maximale de 60 °C (140 °F).
Assurez-vous que le raccord à l'arrivée l'eau courante
n'est pas coudé, compressé ou tordu.
Capacité :
2. Lors du remplacement de l'appareil, utilisez toujours
configurations de 12 à 15 emplacements (dépend de
l'équipement de votre lave-vaisselle)
Pression d'eau :
Installation
Les dimensions requises pour l'installation se trouvent
dans les instructions d'installation. Mettez l'appareil à
niveau à l'aide des pieds ajustables. Assurez-vous que
l'appareil est posé de manière sûre.
▯
▯
fr-ca
Un appareil encastré ou intégré par la suite de façon
autostable doit être fixé (en le vissant au mur, ou en
l'installant sous un plan de travail fixe, lui-même vissé
aux placards adjacents) de manière sûre, ceci afin de
l'empêcher de se retourner
un nouveau flexible d'arrivée d'eau.
7,25 PSI (0,5 bar) minimum, 145 PSI (10 bars)
maximum.
Si la pression d'eau est supérieure :
raccordez la soupape de réduction de pression en
amont.
Débit d'entrée :
2,65 gallons/minute (10 litres/minute) minimum
Température de l'eau :
eau froide.
Eau chaude :
Température maximale de 60 °C (140 °F).
L'appareil peut être facilement installé entre des
cloisons en bois et en plastique d'une cuisine
aménagée.
Raccordement du boyau d'évacuation
1. Les étapes à suivre pour le raccordement se trouvent
dans les instructions d'installation. Au besoin,
installez un siphon avec un raccord d'évacuation.
2. Raccordez le flexible d'évacuation au raccord
d'évacuation du siphon avec les pièces fournies.
Assurez-vous que le boyau d'évacuation n'est pas
coudé, compressé ou tordu, et que le système
d'évacuation n'est pas obstrué!
115
fr-ca
Installation et raccordement
Raccordement d’eau chaude *
L e lave-vaisselle peut être raccordé à une arrivée d'eau
froide ou chaude jusqu'à 60 °C (140 °F). Le
raccordement à l'eau chaude est recommandé si celle-ci
peut être fournie par un moyen plus économique en
énergie et par une installation adaptée, comme un
chauffe-eau solaire avec circuit de circulation. Ceci
permet d'économiser de l'énergie et du temps. Le
réglage « Eau chaude » vous permet d'ajuster au mieux
le fonctionnement de votre lave-vaisselle avec une
arrivée d'eau chaude. Il est recommandé d'avoir une
arrivée d'eau chaude à une température minimum de
40 °C (104 °F) et ne dépassant pas 60 °C (140 °F). Il
est déconseillé de raccorder l'appareil à une arrivée
d'eau chaude si celle-ci est fournie par un chauffe-eau
électrique.
Raccordement électrique
Rac or demnt d’ eau chaude
Pour changer le réglage :
▯
Raccordez l'appareil au courant alternatif d'une
tension de 120 V et d'une fréquence de 60 Hz via
une prise de courant correctement installée et mise
à la terre. Consultez la plaque signalétique pour
connaître le type de fusible qui convient9J.
▯
La prise de courant doit se situer à proximité de
l'appareil et être facilement accessible après
installation.
Si la prise n'est pas librement accessible, un
commutateur omnipolaire avec une ouverture des
contacts de 3 mm minimum doit être monté sur le
côté de l'installation pour satisfaire aux exigences de
sécurité.
▯
La modification du raccordement ne doit être
effectuée que par un technicien qualifié.
▯
Une extension de câble peut-être achetée,
uniquement auprès du service à la clientèle.
▯
Utilisez uniquement un disjoncteur différentiel
comprenant ce symbole ‚. Seul cette extension
garantit la conformité avec les réglementations
applicables actuellement.
▯
Cet appareil dispose d'un système de protection
contre les dégâts des eaux. Veuillez remarquer que
ce système fonctionnera uniquement si l'appareil est
raccordé au réseau électrique.
1. Ouvrez la porte.
2. Appuyez sur le bouton MARCHE/ARRÊT (.
3. Appuyez sur le bouton Information (8 durant 3
secondes jusqu'à ce que le message suivant soit
affiché dans la fenêtre d'affichage supérieure @:
Faites défiler avec < >
Choisissez avec - +
Maintenez durant t 3 sec.
4. Maintenez le bouton > ` enfoncé jusqu'à ce que le
raccordement à l'eau soit affiché dans la fenêtre
d'affichage supérieure@.
5. Effectuez le réglage à l'aide des boutons + -.X.
6. Appuyez et maintenez le bouton Information enfoncé
(8 pendant 3 secondes.
Les paramètres sélectionnés ont été sauvegardés.
* option facultative qui peut être ou ne pas être incluse
avec votre lave-vaisselle.
Dépose de l'appareil
Suivez les étapes de dépose décrites ci-après.
1. Débranchez l'appareil du réseau électrique.
2. Fermez le robinet.
3. Défaites le raccordement entre l'évacuation et
l'arrivée d'eau
4. Desserrez les vis de serrage des pièces du cabinet.
5. Si celui-ci est monté, retirez le panneau de socle.
6. Sortez l'appareil, tirez avec précaution sur le flexible
à l'arrière.
116
Installation et raccordement
fr-ca
Transport de l'appareil
Protection de l'appareil contre le gel
Videz le lave-vaisselle et sécurisez les pièces mobiles.
Si l'appareil se trouve dans une pièce dans laquelle il
existe un risque de gel (comme une maison de
vacances), videz complètement l'appareil (voir
« Transport de l'appareil »).
Videz l'appareil de son eau en suivant les étapes
suivantes :
1. Ouvrez le robinet.
2. Ouvrez la porte.
3. Appuyez sur le bouton MARCHE/ARRÊT (.
4. Sélectionnez le cycle de lavage avec la plus haute
température possible.
La durée estimée du cycle de lavage est indiquée sur
l'affichage digital @.
5. Appuyez sur le bouton DÉMARRER )*.
6. Fermez la porte.
Le cycle de lavage démarre.
7. Ouvrez la porte après environ 4 minutes.
8. Appuyez sur le bouton DÉMARRER )* jusqu'à ce
que s'affichent « Programme annulé », puis « Prêt
dans une minute » dans l'affichage digital @.
9. Fermez la porte.
10. Ouvrez la porte après environ 1 minute.
L'affichage digital @ indique « Terminé ».
11. Appuyez sur le bouton MARCHE/ARRÊT (.
12. Fermez le robinet, déconnectez le boyau
d'alimentation et évacuez l'eau.
Remarque : En le transportant, tenez l'appareil debout,
à la verticale. Cela empêche l'eau résiduelle de couler à
l'intérieur de l'appareil et d'endommager son cycle de
lavage.
117
fr-ca
118
Installation et raccordement
:L)LŠ0RGXOH
)&&,&
6WDWHPHQWV
0RGHO&20
)&&,'$+(6&20
,&&20
7KH+RPH&RQQHFWPRGXOHLVDFRPPXQLFDWLRQ
GHYLFHGHVLJQHGWRSURYLGHFRPPXQLFDWLRQEHWZHHQ
DSSOLDQFHVDQGVPDUWGHYLFHV
7KLVPRGXOHLVLQWHJUDWHGDWWKHIDFWRU\XQGHUGLUHFWFRQWURORI%6++RPH
$SSOLDQFHV&RUSRUDWLRQDQGLVQRWXVHUVHUYLFHDEOHRUXSJUDGDEOH
$WOHDVWFPVHSDUDWLRQGLVWDQFHVKRXOGEHPDLQWDLQHGIURPGHYLFHWRXVHU
)&&&203/,$1&(67$7(0(17
&$87,21&KDQJHVRUPRGLILFDWLRQVQRWH[SUHVVO\DSSURYHGFRXOGYRLG\RXUDXWKRULW\WRXVH
WKLVHTXLSPHQW
7KLVGHYLFHFRPSOLHVZLWK3DUWRIWKH)&&5XOHV2SHUDWLRQWRWKHIROORZLQJWZRFRQGLWLRQV
7KLVGHYLFHPD\QRWFDXVHKDUPIXOLQWHUIHUHQFHDQG WKLVGHYLFHPXVWDFFHSWDQ\
LQWHUIHUHQFHUHFHLYHGLQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHGRSHUDWLRQ
,1'8675<&$1$'$67$7(0(17
7KLVGHYLFHFRPSOLHVZLWK,QGXVWU\&DQDGDOLFHQFHH[HPSW566VWDQGDUG V 2SHUDWLRQLV
VXEMHFWWRWKHIROORZLQJWZRFRQGLWLRQV WKLVGHYLFHPD\QRWFDXVHLQWHUIHUHQFHDQG WKLV
GHYLFHPXVWDFFHSWDQ\LQWHUIHUHQFHLQFOXGLQJLQWHUIHUHQFHWKDWPD\FDXVHXQGHVLUHG
RSHUDWLRQRIWKHGHYLFH
2SHUDWLRQLQWKHEDQG0+]LVRQO\IRULQGRRUXVHWRUHGXFHWKHSRWHQWLDOIRUKDUPIXO
LQWHUIHUHQFHWRFRFKDQQHOPRELOHVDWHOOLWHV\VWHPV
/HSUpVHQWDSSDUHLOHVWFRQIRUPHDX[&15G ,QGXVWULH&DQDGDDSSOLFDEOHVDX[DSSDUHLOVUDGLR
H[HPSWVGHOLFHQFH/ H[SORLWDWLRQHVWDXWRULVpHDX[GHX[FRQGLWLRQVVXLYDQWHV O DSSDUHLO
QHGRLWSDVSURGXLUHGHEURXLOODJHHW O XWLOLVDWHXUGHO DSSDUHLOGRLWDFFHSWHUWRXWEURXLOODJH
UDGLRpOHFWULTXHVXELPrPHVLOHEURXLOODJHHVWVXVFHSWLEOHG HQFRPSURPHWWUHOH
IRQFWLRQQHPHQW
/DEDQGH0+]HVWUpVHUYpVXQLTXHPHQWSRXUXQHXWLOLVDWLRQjO LQWpULHXUDILQGH
UpGXLUHOHVULVTXHVGHEURXLOODJHSUpMXGLFLDEOHDX[V\VWqPHVGHVDWHOOLWHVPRELOHVXWLOLVDQWOHV
PrPHVFDQDX[
‹%6++RPH$SSOLDQFHV&RUSRUDWLRQ
9001422331
(9909)
*9001422331*
*DJJHQDX
0DLQ6WUHHW6XLWH
,UYLQH&$
86$
3KRQH*$**(1$8
LQIR#JDJJHQDXXVDFRP
ZZZJDJJHQDXXVDFRP

advertisement

Was this manual useful for you? Yes No
Thank you for your participation!

* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project

Related manuals

Download PDF

advertisement