HERRAMIENTAS DE TÉCNICOS Y TALLER
HERRAMIENTAS DE TÉCNICOS Y TALLER
Nociones generales
400
Comprobadores y medidores especiales
402
Servicio de batería
430
Aire acondicionado y sistema de enfriamiento
437
Productos para debajo del automóvil
452
Soldadura
483
Iluminación
495
Equipo de taller
501
Limpieza y seguridad
569
399
HERRAMIENTAS DE TÉCNICOS Y TALLER
SNAP-ON LE OFRECE
DOS PALABRAS:
TIEMPO. DINERO.
Ya sea propietario de un taller o técnico, Snap-on tiene
soluciones de productividad para ahorrarle tiempo y
para ayudarlo a aumentar los ingresos.
Equipo para el taller.
Contar con equipos de taller de Snap-on® significa que su
taller será más productivo, lo que lo ayudará a obtener una
mayor rentabilidad. Expanda las capacidades actuales de su
taller y mantenga el negocio donde debe estar, con usted.
J]f\aea]flg\]dYafn]jkaf2=d]imahg\]lYdd]j\]KfYh%gf
se paga solo. Desde las soldadoras fabricadas para resistir
ambientes de taller severos hasta los cargadores de batería
que realizan una variedad de funciones, Snap-on se destaca
de las demás marcas de la industria.
AffgnY[af2EYfla]f]Ykmk[da]fl]kÇ]d]kYkmlYdd]j$qYim]
g^j][]k]jna[agkhYjYdgkYmlgenad]kqn]`[mdgk\]k]jna[ag
pesado del pasado, del presente y del futuro con el equipo
más actualizado que se encuentra disponible.
9ehdalm\2;m~flge~k\an]jkgkk]Yfdgkj][mjkgk$]fkm
taller podrá manejar mayor cantidad de trabajos. Expandir
sus servicios atrae negocios. Elija productos para satisfacer
kmkf][]ka\Y\]k$qkmnakaf$]flj]dYk**[Yl]_gjYk\]
productos de equipos de taller.
HERRAMIENTAS DE TÉCNICOS Y TALLER
Conceptos fundamentales para el técnico.
De el primer paso para dominar la tecnología mientras
desarrolla su potencial y aumenta su productividad.
LjYZYb]\]eYf]jYe~kafl]da_]fl]2=phYf\Ykmk
[YhY[a\Y\]k[gfmfY[gZ]jlmjY[gehd]lY\]dkakl]eY&QY
sea que usted necesite un multimedidor, un osciloscopio
de inspección con video o un dispositivo de detección de
ruidos, Snap-on®d]g^j][]dgim]Zmk[Y&
LjYZYb]e~kj~ha\g2DYk`]jjYea]flYkqdgk]imahgk
de taller y tecnología de Snap-on acortan el tiempo de
hj]hYjY[afq\]ljYZYbg$qg^j][]fdYhgkaZada\Y\\]
_YfYje~k\af]jg&
LjYZYb]\]eYf]jYe~kk]_mjY2LjYZYb][gf]imahgk\]
k]_mja\Y\im]Y`gjjYfla]ehg&<]k\]Yfl]gbgk`YklY
_mYfl]k$[Yk[gk\]kgd\Yjqe~k[YjYk$hjglbYk]mkl]\q
hjgl]bYkmj]flYZada\Y\&
COMPROBADORES Y MEDIDORES ESPECIALES
Mejore sus sentidos.
Mida y detecte.
Ya sea que se trate de analizar un problema con más
atención con un videoscopio, detectar el más leve ruido
de un motor con un dispositivo acústico o diagnosticar
un problema eléctrico complejo con un multimedidor,
Snap-on® le brinda la capacidad de visualizar, escuchar y
analizar. Proporcionan precisión y resultados exactos que
usted puede ofrecer a sus clientes con confianza.
Los problemas se presentan de diferentes maneras.
Snap-on ayuda a reducir el tiempo y el esfuerzo que
lleva encontrar la fuente, ya sea que el problema esté
relacionado con amperios, voltios, HC, CO2, CO, O2, NOx,
grados, conexiones a tierra, circuitos cortos o abiertos,
watts, rpm, decibeles, compresión, escapes o vacío del
cilindro.
402
PRUEBAS Y ELECTRÓNICA
Na\]gk[ghagk
BK6000
BK6000 Boroscopio digital para grabación fija/de video.
s'RABAYREPRODUCEIMÉGENESFIJASYPELÓCULASCORTASDEVIDEO
s,APANTALLADEOFRECEUNAIMAGENAMPLIAYUNZOOMDIGITAL
DOSVECESSUPERIOR
s*UEGODEBATERÓASDEIONESDELITIORECARGABLES
s3EPUEDEPONERENFUNCIONAMIENTOEL"+MIENTRASSECARGALABATERÓA
s)NTERFAZMULTILINGàEFÉCILDEUSAR
s-INICONECTOR53"PARACARGARIMÉGENESYVIDEOS
s2ANURADETARJETA3$(#EXTERNA
s%LMANGODECONTROLSEDESENGANCHAPARABRINDARMAYORMANIOBRALIDAD
s4OMADEENTRADADESONIDOPARAGRABARCOMENTARIOSCONCONEXIØN
OPCIONALDEAURICULARESYMICRØFONO
!PLICACIONES"+"+
s)DEALPARAMOTORESAIREACONDICIONADOTRABAJOSDEBAJODELTABLERO
DESUSPENSIØNYDETRANSMISIØN
s)NSPECCIONELOSDIÉMETROSINTERNOSDECILINDROSYLASVÉLVULAATRAVÏS
DELORIFICIODEBUJÓA
s#ONTROLEELDESGASTEDELENGRANAJEENLOSDIFERENCIALESYENLAS
TRANSMISIONESMANUALES
s6ERIFIQUEQUELOSPANELESDELASPUERTASINTERNASYDECARROCERÓANO
TENGANFALLASDEFECTOSNIDA×OSOCULTOS
s)NSPECCIONEDEBAJODELTABLEROPARACONTROLARELFUNCIONAMIENTODELAS
INSTALACIONESELÏCTRICASELACCIONADORDEL(6!#YLAVERIFICACIØNDELCØDIGODERADIO
s$ETECTEPÏRDIDASDEFLUIDOSSINUNALÓNEADEVISTADIRECTA
BK5500-7
BK5500-9
Pieza No.
Descripción
BK5500-1
BK5500-2
BK5500-6
BK5500-7
BK5500-8
BK5500-9
Dispositivo de imagen de 36" (cabeza de 8.5 mm)
Espejo e imán
Caja moldeada neumáticamente
Dispositivo de imagen de 72" (cabeza de 8.5 mm)
Cable de salida de video
Dispositivo de imagen de 120" (cabeza de 8.5 mm)
Dispositivo de imagen de luz azul/UV de 36"
(cabeza de 8.5 mm)
Dispositivo de imagen doble (cabeza en mm)
Dispositivo de imagen con visor de 36"
(cabeza de 5.5 mm)
Grabadora de video digital
Batería de iones de litio
Gancho en forma de S
Caja moldeada neumáticamente
Cargador de batería
Auriculares y micrófono
Cable USB
Soporte
(4) Baterías AA
Garantía
Manual de instrucciones
BK5500-10
BK5500-12
BK5500-13
BK5500-14
BK6000-1
BK6000-2
BK6000-6
BK6000-10
BK6000-11
BK6000-12
BK6000-13
—
—
—
ADVERTENCIA
BK5500-10
BK5500
BK5500 Osciloscopio de inspección con video.
sÂNICOBOTØNDEENCENDIDOAPAGADOEINDICADORDEBATERÓA
s#ONVENIENTECONTROLMANUALDELAINTENSIDADDELUZ,%$
s,APANTALLA,#$ACOLORDEBRINDAUNAIMAGENMÉSGRANDE
QUELOSBOROSCOPIOSCONPIEZAOCULAR
BK6000/BK5500 Características compartidas.
s,ACABEZADELDISPOSITIVODEIMAGENDEMMDEDIÉMETROCABE
ENLAMAYORÓADELOSORIFICIOSDEBUJÓAS
s,%$DEALTAINTENSIDADQUEDIRIGENLALUZHACIADONDESELANECESITA
s%JEMANEJABLEDEDELARGOPARAMAYORALCANCE
s2ADIODOBLADOCONEJEDEPARAMAYORFLEXIBILIDAD
s2ESOLUCIØNDEPANTALLADEX
s2ESOLUCIØNDELDISPOSITIVODEIMAGENDEXCUANDOEL
PUERTODESALIDADEVIDEOESTÉCONECTADOAUNMONITOREXTERNO
s2ANGODEFOCODEACERCAMIENTODEA
s%LCONECTORDECAMBIORÉPIDOPERMITEUTILIZARLOSDISPOSITIVOSDE
IMAGENDEUSOESPECIALDELARGOOPCIONAL
s3OPORTEYCOLGADORINTEGRADOSPARAPOSICIONESFLEXIBLES
BK5500-12
Incluido con
BK5500
Incluido con
BK6000
s
s
s
s
BK5500-13
BK5500-14
Accesorio para
BK5500
Accesorio para
BK6000
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
2 años
2 años
s
s
Fgmlada[]]fYeZa]fl]k[gfnYhgj]phdgkang
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
403
PRUEBAS Y ELECTRÓNICA
Multimedidores digitales
Seleccione el medidor según sus necesidades
7 años de garantía limitada
VERIFIQUE CUÁLES SON SUS NECESIDADES
Especificaciones
Certificado del modelo de
calibración
Conteo en pantalla
VCA
VCC
Precisión de CC básica
Amp. CA
Microamp.
Amp. CC
RMS verdadera (Media
cuadrática)
Resistencia
Capacitancia
Frecuencia
Gráfico de barras analógico
Rango automático
Retención de datos
Mín./Máx.
Iluminación de fondo
Apagado automático
RPM (*opc.)
Nivel de disparo ajustable
Circuito de reducción de ruido
Temperatura (*opc.)
Servicio/reposo
Ancho de pulso en mS
Salida comp. (USB)
Integra la lista de CE o UL
Clasificación CAT
Puerta de baterías y fusibles
fácil de abrir
Captura de fallas
Filtro de paso bajo (LPF)
Identificador de fusible
quemado
Dimensiones (con bota),
pulgadas
Caja
Fusibles de reemplazo
EEDM596DK
EEDM525D
EEDM504D
EEDM596DCRT
—
EEDM504DCRT
—
40,000
750
1,000
0.10%
10
Sí
10
4,000
750
1,000
0.50%
10
Sí
10
4,000
750
1,000
0.50%
10
Sí
10
2,000
750
1,000
0.50%
10
Sí
10
Sí
Sí
—
—
40M Ohm
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí, incluido
CE, cULus 61010-1
CATII 750 VCA CATIII 1000 VCC
CATIII 600 VOLTIOS CA/CC
40M Ohm
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
EEDMRPMG*
—
—
Sí
Servicio solamente
—
—
CE, cULus 61010-1
CATII 750 VCA CATIII 1000 VCC
CATIII 600 VOLTIOS CA/CC
40M Ohm
Sí
Sí
Sí
Sí
Sí
Sí
—
Sí
EEDMRPMG*
—
—
EEDM506C*
Servicio solamente
—
—
CE, cULus 61010-1
CATII 750 VCA CATIII 1000
VCCCATIII 600 VOLTIOS CA/CC
20M Ohm
—
—
—
—
Sí
—
—
—
EEDMRPMG*
—
—
EEDM506C*
—
—
—
CE, cULus 61010-1
CATII 750 VCA CATIII 1000 VCC
CATIII 600 VOLTIOS CA/CC
Sí
Sí
Sí
Sí
Sí
Sí
—
Sí
—
—
—
—
Sí
7
3/4
x3
3/4
Sí
x1
1/2
MT586BK1
EEDM5O4B1
EEDM504B2
7
3/4
x3
3/4
Sí
x1
1/2
MT586BK1
EEDM525D6
EEDM525D7
7
3/4
x3
3/4
Sí
x1
1/2
EEDM503B3
EEDM5O4B1
EEDM504B2
SOPORTE TÉCNICO
7
3/4
x 3 3/4 x 1 1/2
—
EEDM5O3B2
EEDM504B2
Certificado y en lista de UL
1-888-382-6522
404
EEDM503D
www.snapon.com/shoptools
PRUEBAS Y ELECTRÓNICA
Emdlae]\a\gj]k\a_alYd]k
7 años de garantía
limitada en medidores
Snap-on
®
5 años de garantía
limitada en medidores
Blue-Point
®
VERIFIQUE CUÁLES SON SUS NECESIDADES
EEDM604C
EEDM695C
MT454C
MT501C
MT574C
MT574CRT
MT574CCRT
4,000
600
600
0.30%
400 ma
—
400 ma
Sí
Sí
—
—
—
(más conductancia)
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
EEDMRPMG*
—
—
MT586B
—
Sí
—
CE, cULus 61010-1
CATIII 1,000 V
CAT IV 600 V
(más conductancia)
Sí
Sí
Sí
Sí
Sí
Sí
Sí
Sí
EEDM512B1*
Sí
Sí
MT586B1
Sí
Sí
opcional
CE, cULus 61010-1
CATIII 1,000 V
CAT IV 600 V
40M Ohm
—
—
—
Sí
—
—
—
Sí
—
—
—
—
—
—
—
CE, cULus 3111
2K Ohm
—
—
—
—
Sí
—
—
—
EEDMRPMG*
—
—
EEDM506C*
—
—
—
CE, cULus 3111
40M Ohm
—
—
—
Sí
Sí
Sí
—
Sí
EEDMRPMG*
—
—
EEDM506C*
—
—
—
CE, cULus 3111
Certificado del modelo
de calibración
Conteo en pantalla
VCA
VCC
Precisión de CC básica
Amp. CA
Microamp.
Amp. CC
RMS verdadera (Media
cuadrática)
Resistencia
Capacitancia
Frecuencia
Gráfico de barras analógico
Rango automático
Retención de datos
Mín./Máx.
Iluminación de fondo
Apagado automático
RPM (*opc.)
Nivel de disparo ajustable
Circuito de reducción de ruido
Temperatura (*opc.)
Servicio/reposo
Ancho de pulso en mS
Salida comp. (USB)
Integra la lista de CE o UL
CATIII 600 voltios
CATIII 600 voltios
CATIII 600 voltios
Clasificación CAT
Sí
Sí
—
—
—
Sí
—
Sí
Sí
—
Sí
—
—
—
—
—
—
—
—
—
3 13/16 x 8 x 2 13/32
3 13/16 x 8 x 2 13/32
6x3x2
6x3x2
6x3x2
MT586BK1*
EEDM604C1
EEDM604C2
MT586BK1*
EEDM604C1
EEDM604C2
—
—
—
—
—
EEDM504B1
—
—
—
—
50,000
1,000
1,000
0.05%
10
Sí
10
50,000
1,000
1,000
0.05%
10
Sí
10
4,000
600
600
0.50%
—
—
—
2,000
600
600
0.75%
—
—
—
Especificaciones
Puerta de baterías y fusibles fácil
de abrir
Captura de fallas
Filtro de paso bajo (LPF)
Identificador de fusible quemado
Dimensiones (con bota), pulgadas
Caja (*opcional)
Fusibles de reemplazo
SOPORTE TÉCNICO
Certificado y en lista de UL
1-888-382-6522
ADVERTENCIA
Fgmlada[]]fYeZa]fl]k[gfnYhgj]phdgkang
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
405
PRUEBAS Y ELECTRÓNICA
Accesorios del multimedidor digital
EETA501C
EETA501C Sonda de amperaje prensil.
s-IDELASCORRIENTES#!Y##SUPERIORESA
AMPSINABRIRELCIRCUITO
s)DEALPARAMEDIRLAALIMENTACIØNDECORRIENTE
DEARRANQUEAMPYDECORRIENTEAUTOMOTRIZ
s3EUTILIZACONMULTIMEDIDORESDIGITALESQUE
TIENEN6YRANGOSDEM6#!Y##
s2ANGOAAMPENM6#!O##
AAMPEN6#!O##
EETA502C Sonda de amperaje prensil.
s3IMILARA%%4!#EXCEPTOQUEELRANGOES
DEAAMP#!O$#
EETA502C
EETA503C
EEMD5030
EEDMRPMG
EETA503C Adaptador de corriente baja.
s!DAPTADORDECORRIENTEBAJA#!##PARA
MULTIMEDIDORESDIGITALESCONRANGOM6##Y
M!MPDEIMPEDANCIA
s-IDELAALIMENTACIØNDECORRIENTEPARÉSITAEN
ELCABLEDELABATERÓACUANDOLALLAVEESTÉEN
POSICIØNOFFAPAGADOPARAINDICARLASFALLASDE
LOSCOMPONENTESOLOSCORTOS
s-IDERÉPIDAMENTELAALIMENTACIØNDELCIRCUITO
DERIVADOPARAAISLARELÉREADELPROBLEMA-IDE
ENFORMASEGURALAALIMENTACIØNDECORRIENTE
DELASBOMBASDECOMBUSTIBLEELÏCTRICAS
s-IDEDEM!MPAAMP
EEDM5030 Adaptador de presión.
s-IDELAPRESIØNDESDEAPSIYELVACÓODE
AIN(G
s,ASALIDAESDEM6##PORPSIOIN(G
s)DEALPARAMEDIRLATRANSMISIØNOLAPRESIØNHIDRÉULICA
s!CCESORIO.04DEENELTRANSDUCTORDEPRESIØN
s3ENSORCOMPATIBLEPARAAIREOLÓQUIDO
s#ABLEDEDELARGO
EEDMRPAdaptador de RPM de motor
de gasolina MG.
s)DEALPARAAPLICACIONESDEMOTORDEGASOLINA
PEQUE×ODEYTIEMPOSCONUNSOLOCILINDRO
s3EUTILIZACONCUALQUIERMULTIMEDIDORDIGITAL
QUETENGARANGOSDE##M6PARAMEDIRLAS
20-DELMOTORDEGASOLINA
s%NCHUFEELADAPTADORENELMULTIMEDIDORDIGITAL
CONFIGURELAFUNCIØNDE##M6SUJETEELCABLE
SOBREELCAPUCHØNDELASBUJÓASDELMOTORY
MULTIPLIQUELALECTURAPOR
s%LRANGOESDEARPM
s,ASALIDAESDEM6##POR20s5TILIZABATERÓADE6INCLUIDA
EEDMRPMD
EEDM5997
EEDMDVA
EEDM5830
EETA106B
EEDMRPMD Adaptador de RPM de
motor diesel.
s)DEALPARAAPLICACIONESDEMOTORESDIESELPEQUE×OS
s-IDELAS20-DELMOTORDIESEL
s%NCHUFEELADAPTADORENELMULTIMEDIDORDIGITAL
CONFIGURADOEN)0CONECTEELTRANSDUCTORALA
LÓNEADECOMBUSTIBLEQUECONDUCEAUNINYECTORY
LEALAS20-ENELMEDIDOR
s%LRANGOESDEA20s,ARESOLUCIØNESDE20-5TILIZAUNABATERÓA
DE6INCLUIDA
EEDM5997 Adaptador de RPM de
multimedidor digital.
s0ARAMOTOCICLETASMOTORESFUERADEBORDA
VEHÓCULOSPARANIEVEY!46VEHÓCULOTODO
TERRENOCONPROTECCIØNDEENCENDIDOLIMITADA
OSINPROTECCIØNDEENCENDIDO
s3EUTILIZACONMOTORESDEØTIEMPOS
s%LCIRCUITOINTERNOFILTRAELRUIDO
s%LCAPTADORPRESENTADOSBOBINASENDERIVACIØN
PARAAYUDARAELIMINARLOSERRORESENLOS
ENCENDIDOSDEPOLARIDADNEGATIVA
EEDMDVA Adaptador de voltaje directo.
s#ONVIERTELASSE×ALESDEPULSODEENCENDIDODE
MOTORESDEEMBARCACIONESFUERADEBORDADE
MOTOCICLETASYDEOTROSMOTORESPEQUE×OSEN
SE×ALESDEVOLTAJEDE##
s%LADAPTADORAYUDAAIDENTIFICARPROBLEMASEN
ELENCENDIDOSECUNDARIOTALESCOMOFALLASEN
PAQUETESDEBOBINASINDIVIDUALESOBUJÓASEN
MALESTADO
EEDM5830 Adaptador de amperaje.
s0ERMITEQUELOSMULTIMEDIDORESDIGITALES
MIDANCONEXACTITUDHASTA!MP#!##AL
CONVERTIRLASE×ALAMILIVOLTIOS
s-IDELAALIMENTACIØNDECORRIENTEDELOS
CIRCUITOSINDIVIDUALESDELACAJADEFUSIBLESEN
AUTOMØVILESCAMIONESYAUTOBUSES
s-IDELACARGAPARÉSITAENLABATERÓA
s.OREQUIERESUMINISTROELÏCTRICOINTERNONIEXTERNO
s%LRANGOESDEA!MP
EETA106B Captador inductivo– Blue-Point®.
s%LCAPTADORNOINTRUSIVOSEDESLIZASOBRESOBRE
ELCABLEDELABUJÓADEENCENDIDOSECUNDARIOY
SECIERRAPARACONEXIONESRÉPIDASSINCONECTAR
DIRECTAMENTEALCIRCUITODEENCENDIDO
s3EUTILIZANENLAMAYORÓADELOSMOTORESC
SISTEMASDEENCENDIDODEYCICLOS
INCLUIDOSMOTORESPEQUE×OSYSISTEMASDE
CHISPASDEDESECHO
Sondas de temperatura y adaptadores
EETH501C
EETH502B
EEDM506D
406
EETH503B
EEDM506D Adaptador de temperatura.
s!×ADECAPACIDADESDETEMPERATURAALOSMULTIMEDIDORESQUENOTIENENFUNCIONESDE
TEMPERATURAINCORPORADAS
s/FRECEMEDICIONESDOBLESDETEMPERATURAYTEMPERATURADIFERENCIALPARALOSMULTIMEDIDORES
s%LRESULTADOEQUIVALEAM6PORGRADO
s3EUTILIZACONCUALQUIERMULTIMEDIDORCONRANGOSDEM6##YO6##
s0ROPORCIONALECTURASDE&A&)NCLUYEDOSSONDASDETEMPERATURATIPO+CON
CUENTAS,UZINDICADORADEBATERÓABAJA0RECISIØN¢DELAESCALACOMPLETAUNDÓGITO
EETH501C Sonda de temperatura.-IDELATEMPERATURAENFLUIDOSYMATERIALESBLANDOS
EETH502B Sonda de temperatura.-IDELATEMPERATURADESUPERFICIE0UNTADE
EETH503B Sonda de temperatura.-IDELATEMPERATURAAMBIENTE0UNTADE
www.snapon.com/shoptools
PRUEBAS Y ELECTRÓNICA
;YZd]k'kgf\Yk\]hjm]ZY
MTTL501 Extensión de sonda.
s%XTENSIØNDESONDADE"PARA
%%$-"
s,LEGAALOSCONECTORESQUESE
ENCUENTRANDEBAJODELTABLEROO
ENLAPARTEPROFUNDADEL
COMPARTIMIENTODELMOTOR
s,OSGANCHOSTIPOCOCODRILO
NOINCLUIDOSSEENROSCANENLOS
EXTREMOSDELASONDA
s4OTALMENTEAISLADAPARASEGURIDAD
DELUSUARIO
EEDM504B3 Juego de cables de
prueba con ganchos tipo cocodrilo.
s*UEGODECABLESDEPRUEBAESTÉNDAR
CUBIERTOSCONVINILOYCONGANCHOSTIPO
COCODRILOAROSCAPARANECESIDADES
BÉSICASDEPRUEBADEAPLICACIONES
s,OSPROTECTORESDESONDAAROSCA
EVITANQUEELEJEDESONDAMETÉLICOLO
TOQUEDURANTELAPRUEBAPORSEGURIDAD
RETIRELOSPROTECTORESCUANDOUTILICELOS
GANCHOSTIPOCOCODRILOOLOSADAPTADORES
MTTL7005PK Retrosondas.
s#ØDIGODECOLORESPARAUNAFÉCIL
IDENTIFICACIØN
s,ASSONDASNOINTRUSIVASSEDESLIZAN
DETRÉSDELOSTERMINALES
s,OSEXTREMOSMODULARESSEADHIEREN
RÉPIDAMENTE
MTTL501
TL4A Cables de prueba de
multimedidores.
s,OSCABLESDEPRUEBADEALTOGRADO
OFRECENUNAEXCELENTEMEMORIADE
BOBINAYSEPUEDENUTILIZARCONLOS
MEDIDORESDEPRUEBAMÉSCONOCIDOS
s,OSCONDUCTORESUSANELCONCEPTO
hCAMADECLAVOSvSONDAPERFORADORA
DECABLEYPUNTASTIPOCOCODRILOTODO
ENUNO
ADVERTENCIA
MTTL504
MTTL5041 Fusibles de 5 amp.
s0AQUETEDEFUSIBLESDEAMPDE
REEMPLAZOPARALOSCABLESDEPRUEBACON
FUSIBLES-44,
EEDM504B3
MTTL7005PK
TL2A Juego de cables de prueba.
s%LPARDECABLESDEPRUEBADEALTO
GRADOENCAJAENTODOSLOSMEDIDORES
CONCLAVIJASCONENCHUFESTIPO
BANANAESTÉNDAR
s,ASSONDASDEESTÓMULONODESLIZABLES
TIENENPUNTASDEACEROINOXIDABLE
s,OSCABLESENBOBINASEESTIRANMÉSDE
s,OSGANCHOSTIPOCOCODRILOAROSCA
CONVIERTENLOSCONDUCTORESENCABLES
DEPUENTE
TL3A Cables de prueba.
s0ARDECONDUCTORESDEPUENTEDE
SERVICIOPESADO
s3EUTILIZANPARACONECTARUNAFUENTE
DEALIMENTACIØNOUNACONEXIØNA
TIERRAPARAPROBARUNAINSTALACIØNEN
ELAUTOMØVIL
s,OSGANCHOSTIPOCOCODRILODESERVICIO
PESADOUSANELCONCEPTOCAMADECLAVOS
s,OSTORNILLOSDELENCHUFETIPOBANANA
PERMITENUSARLOCONLAMAYORÓADELOS
MULTIMEDIDORES
MTTL504 Cables de prueba con fusible.
s,OSCABLESDEPRUEBACONFUSIBLEDE"
AYUDANAPROTEGERDEDA×OSELÏCTRICOSALOS
MULTIMEDIDORESDIGITALESSINFUSIBLE
s/FRECENPROTECCIØNADICIONALCUANDOSE
MIDEALTOVOLTAJE
s)NCLUYEELJUEGODECABLESDEPRUEBA
CONGANCHOSTIPOCOCODRILOYFUSIBLES
ADICIONALES
s%LLARGOTOTALESDE
TL2A
TL3A
TL4A
EETA107B Cable de prueba protegido.
s,OSCABLESDEPRUEBAPROTEGIDOSBLOQUEANLA
INTERFERENCIADELAFRECUENCIADERADIO2&)
s,OSCABLESDEgSONRESISTENTESALCALORY
ALACEITE
EETA107B
EETA108B Cable de prueba protegido.
s,OSCABLESDEPRUEBAPROTEGIDOSBLOQUEANLA
INTERFERENCIADELAFRECUENCIADERADIO2&)
s,OSCABLESDEgSONRESISTENTESALCALOR
YALACEITE
EETA108B
MTTL502 Sondas de prueba de
perforación del aislamiento.
s5TILICELASSONDASENLOSEXTREMOSROSCADOS
DELASONDA
s3EINCLUYENADAPTADORESTIPOBANANAPARA
QUESEPUEDANUTILIZARLASSONDASENLOS
JUEGOSDECABLESCONENCHUFESTIPOBANANA
MTTL502
TLS7B Juego de cables de
prueba y adaptador.
s,ASSONDASDESUJECIØNRÉPIDAY
LOSMINIGANCHOSTIPOCOCODRILO
PRESIONANELJUEGODECABLES
CUBIERTOSDE06#RECTOS
s,OSGANCHOSAROSCALOSTAPONES
ESTÉNDARYLOSGANCHOSTIPOCOCODRILO
SEENROSCANENLOSEXTREMOSDE
LASONDA
s"RINDAUNJUEGOECONØMICOPARA
REALIZARDIFERENTESPRUEBAS
MT300 Juego de cables de prueba.
s,OSCABLESDEPRUEBACODIFICADOS
ENCOLORESAYUDANAREDUCIR
LASPOSIBILIDADESDECONEXIONES
ERRØNEAS
s3EUTILIZANCOMOCABLESDEPRUEBA
CABLESDEPUENTEOPARAELIMINAR
COMPONENTESCUANDOSELLEVAN
ACABOPRUEBASDELSISTEMA
DEENCENDIDO
s#ADACABLETIENEUNALONGITUDDEg
MT301A Juego de cables
de prueba.
s#ONTIENECONDUCTORESDEPUENTEDE
Yg
s3EUTILIZANCOMOCABLESDEEXTENSIØN
OPARAELIMINARCOMPONENTESCUANDO
SEPRUEBAELENCENDIDO
Fgmlada[]]fYeZa]fl]k[gfnYhgj]phdgkang
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
TLS7B
MT300
MT301A
407
PRUEBAS Y ELECTRÓNICA
Cables de prueba
Cables de prueba
de alto grado (para
multimedidores digitales)
MTTL600
MTTL500
MTTL500 Juego de cables de prueba.
s,ASSONDASINTERCAMBIABLESOFRECENUNAGAMAMÉSAMPLIADEPOSIBILIDADESDEPRUEBA
s,OSCABLESDEPRUEBADEDELARGODEÉNGULORECTOESTÉNFABRICADOSCON
ALAMBRESÞPERFLEXIBLEDESILICONACONDOBLEAISLAMIENTO
s'ANCHOSCONRESORTEPARAUTILIZARENALAMBRESDESNUDOSDECALIBREY
MÉSPEQUE×OS
s'ANCHOSTIPOCOCODRILOPARASUJETARLOSAPERNOSYCONDUCTORESDEALAMBREGRANDES
s4ERMINALESDEHORQUILLAPARAUTILIZARENBLOQUESDETERMINALESYPUNTASPARA
PROBARLOSEXTREMOSDELOSALAMBRES
Pieza No.
MTA20
MTA24
MTA75
MTA80
MTA85
MTTL7001
MTTL7002
MTTL7003
MTTL7004
MTTL7005
Descripción
MTTL500
Puntas - modular
Cubierta de silicona para cables de
prueba - modular
Ganchos tipo cocodrilo - mediano - modular
Ganchos con resorte - modular
Ganchos tipo cocodrilo - servicio
pesado - con bridas
Cubierta de silicona para cables de
prueba - roscada
Enchufes tipo banana - a rosca
Ganchos tipo cocodrilo - grande - modular
Puntas de contacto de perforación
de aislamiento - modular
Adaptadores de retrosonda - aguja - modular
s
s
s
s
s
TL616AO
TL624AG
MTTL600
MTTL700
s
s
s
s
s
s
s
s
s
MTTL600 Juego de cables de prueba.
s)NCLUYEADAPTADORESDEENCHUFETIPOBANANAAROSCAADAPTADORESDERETROSONDA
DEAGUJAGANCHOSTIPOCOCODRILOGRANDESYPUNTASDECONTACTODEPERFORACIØN
DEAISLAMIENTO
MTTL700 Juego de cables de prueba.
s)NCLUYEADAPTADORESDEENCHUFETIPOBANANAAROSCAADAPTADORESDERETROSONDA
DEAGUJAGANCHOSTIPOCOCODRILOGRANDESYPUNTASDECONTACTODEPERFORACIØN
DEAISLAMIENTO
s,OSCABLESDEPRUEBACONPUNTASINTERCAMBIABLESSONDEDELARGO
s%LALAMBREDESILICONACONDOBLEAISLAMIENTOESRESISTENTEALCALORYALFUEGO
YESFLEXIBLEENCONDICIONESDEFRÓOEXTREMO
MTA70 Juego de ganchos tipo cocodrilo.
s'ANCHOSTIPOCOCODRILOAROSCAPARAUTILIZARCON%%$-"
s.OUTILICECON-4!
MTTL505
TL648AR
Conductores de puente de alta visibilidad
Serie TL de conductores de puente de alta visibilidad.
s,OSCABLESDEPRUEBADEALTOGRADOOFRECENLAMÉSALTARESISTENCIA
ALCALORYALACEITEYUNAEXCEPCIONALMEMORIADEBOBINA
s,OSCONDUCTORESUTILIZANELCONCEPTOhCAMADECLAVOSvEXTRAÓBLE
s$ESPUÏSDELAREMOCIØNELEXTREMODELASONDACONROSCADE
BRONCEDEPERMITEELUSODEOTROSACCESORIOS
TL616AO Cables de prueba.#OLORANARANJADODEALTA
VISIBILIDADDEgDELARGOEXTENDIDO
TL624AG Cables de prueba.#OLORVERDEDEALTAVISIBILIDADDE
gDELARGOEXTENDIDO
TL648AR Cables de prueba. #OLORROJODEALTAVISIBILIDADDE
gDELARGOEXTENDIDO
MTTL700
MTA70
MTTL505 Juego de cable de captura.
s,OSCABLESDECAPTURASEDESLIZANPORELALAMBREDEAMARREOPORLOSEXTREMOS
DETERMINALESENÉREASESTRECHAS
s3ERECOMIENDAUTILIZARCONELJUEGODECABLESDEPRUEBAMODULAR-44,O
-44,CONLOSADAPTADORESDEENCHUFETIPOBANANAAROSCA-44,
s3EUTILIZACONCUALQUIERJUEGODECABLESDEPRUEBAAROSCACONLOS-44,
s'RACIASALOSAGARRESDEDEDOYALAPOSICIØNDELÏMBOLOELTÏCNICOPUEDE
COLOCARLASMORDAZASDEMANERACONTROLADAINCLUSOBAJOCONDICIONESEXTREMAS
s,APRESIØNDEAGARREDELASMORDAZASAGARRADEMANERASEGURAELTERMINALOEL
CABLEAPUNTADO
s%LÏMBOLOYELAGARREDEDEDOPERMITENLAAPERTURAMÉXIMADELAMORDAZACON
LAPRESIØNMÓNIMAPARALOGRARUNACOLOCACIØNIDEALYUNCONTACTOCORRECTO
s3EGURIDAD#!4)))6CAPACIDADDE!MP%NLISTADEC5,US
Y)%#
TLR6B
TLBR6B
Adaptadores de prueba del circuito intrusivo
s!DAPTADOREShCAMADECLAVOSvDEALTACALIDADQUEPENETRANELCABLE
s%STOSGANCHOSTIPOCOCODRILOPERMITENPROBARELCIRCUITOCUANDONOSE
DESEAUTILIZARUNARETROSONDAOCUANDOÏSTANORESULTAPRÉCTICA
TLB6B Adaptador.'ANCHODEPRUEBACONNARIZRECTAYBOTANEGRA
TLR6B Adaptador.'ANCHODEPRUEBACONNARIZRECTAYBOTAROJA
TLBL6B Adaptador.'ANCHODEPRUEBACONNARIZRECTAYBOTAAZUL
TLBB6B Adaptador.'ANCHODEPRUEBACONNARIZDOBLADAAªYBOTANEGRA
TLBR6B Adaptador.'ANCHODEPRUEBACONNARIZDOBLADAAªYBOTAROJA
TLBBL6B Adaptador.'ANCHODEPRUEBACONNARIZDOBLADAAªYBOTAAZUL
YA1175KIT
Cables de prueba retráctiles–Blue-Point®
YA1175KIT Juego de cables de prueba retráctiles.
)NCLUYE9!
s#ABLESDEPRUEBARETRÉCTILESSONDAS9!PARGANCHOSTIPO
COCODRILO9!PARYGANCHOSCONRESORTE9!PAR
s,OSCABLESDEPRUEBARETRÉCTILESSEEXTRAENYPERMANCENENELLARGODESEADO
s6UELVAAENROLLARLOSCABLESDEPRUEBACUANDONOLOSUTILICEPARA
QUEELALMACENAMIENTOSEACOMPACTO
s(ILODECOBREDECALIBREYPUNTASINTERCAMBIABLES
408
Adaptador de batería
TLS4A
Adaptador de batería TLS4A.
s5NADAPTADORESTILOENCENDEDORDECIGARRILLOSDE6SUMINISTRAPOTENCIAALOS
COMPROBADORESDECIRCUITOSYMONITORESASÓCOMOTAMBIÏNALAMAYORÓADELOS
DISPOSITIVOSDE6COMOTELÏFONOSPARAAUTOSYLUCES
s,OSGANCHOSTIPOCOCODRILOCUBIERTOSDECOBRECONAGARRADERASDEVINILOSE
COLOCANENLASTERMINALESDEBATERÓA
s#ABLEDEgDELARGO
www.snapon.com/shoptools
PRUEBAS Y ELECTRÓNICA
;gehjgZY\gj]k\][aj[malgk
CT4G
;gehjgZY\gj]k\][aj[malg\].q)*ngdlagk
CT4G Comprobador de circuitos.
s3EPUEDEUTILIZARPARADETECTARPOTENCIA
CONEXIØNATIERRAYPARAENCONTRAR
CORTOCIRCUITOSYFALLAS
s#ABLEDEgGANCHOTIPOCOCODRILOAISLADO
SONDAAISLADADEDELARGO
s,ARGOTOTALDE
s5TILIZAFOCO
EECT301B
EECT301B Comprobador de circuitos.
s!LIMENTADOPORELENCHUFEDELVEHÓCULOO
LOSADAPTADORESDEBATERÓA4,3Y4,3
s%L,%$ROJOINDICALAPOTENCIAEL,%$VERDE
INDICALACONEXIØNATIERRA
sVOLTIOSSOLAMENTE
CTS42V
;gehjgZY\gj]k\][aj[malgk]kh][aYd]k
CTS42V Comprobador de
circuitos–Blue-Point.
s%NCUENTRARÉPIDAMENTECABLESROTOSFUSIBLES
QUEMADOSINTERRUPTORESDA×ADOSYMÉS
s#APACIDADDECARGADECORRIENTECONTROLADA
PORMICROPROCESADORPARAPRUEBASDE
ALIMENTACIØNYDECONEXIØNATIERRA
s,AUNIDADPRESENTATODASLASVENTAJESDE
UNALUZINCANDESCENTEDEPRUEBAYESAPTA
PARACOMPUTADORAYAIRBAG
s&AROSDELANTEROS,%$SÞPERBRILLANTESPARA
TRABAJARDEBAJODELTABLERODEBAJODELCAPØ
ODETRÉSDELOSPANELESDELAPUERTA
s%LTONOAUDIBLESDOBLEYEL,%$BICOLOR
INDICANLAPOTENCIALACONEXIØNATIERRAOLOS
CIRCUITOSABIERTOS
sVOLTIOS
EECT100
EECT100 Comprobador de
circuitos–Blue-Point®.
s#OMPROBADORDECIRCUITOSBÉSICO
s,UZAZULREEMPLAZABLE%%#4
CT24E
ADVERTENCIA
CT2 Comprobador de
circuitos miniatura.
s0ARAUNFÉCILACCESOAÉREASESTRECHAS
s3ONDADEDELARGO
s#ABLEDEgDEDELARGOTOTAL
s5TILIZAFOCO
EECT314A
EECT314A Comprobador de
circuitos multivoltaje.
s#OMPATIBLECONLOSACTUALESSISTEMASDE
YVOLTIOS
s3EGUROPARACIRCUITOSDEBAJACORRIENTE
DADOQUEELCOMPROBADORSØLOCONSUME
M!MPA6
s)DENTIFICACIØNDEVOLTAJEAUTOMÉTICACON
SISTEMASDE,%$AZULPARA6Y,%$ROJO
PARA6
EECT313A
EECT313A Juego de prueba
de terminal.
s%LSISTEMANOINVASIVOPRUEBALOSSISTEMAS
DEY6SINDA×ARELCONECTOR
s,ASPUNTASADAPTADASALTERMINAL
GARANTIZANUNACONEXIØNELÏCTRICAY
MECÉNICASEGURA
s,ASPUNTASDESONDADEGOMAFLEXIBLE
EVITANDA×OSYPERMITENACCEDERA
ESPACIOSESTRECHOS
s5TILIZAFOCO
CTN10001
CT24E Comprobador de circuitos.
s#OMPROBADORDECIRCUITOSPARASISTEMAS
DE6Y6
s5TILIZAFOCO
CT2
EECT300BR
EECT300BR Comprobador de circuitos.
s3IMILARA#4'
s%LCABLEDELABOBINAROJOSEEXTIENDEHASTAg
s5TILIZAFOCO
EECT300BG Comprobador de circuitos.
s#ABLEDEBOBINAVERDE
EECT300BO Comprobador de circuitos.
s#ABLEDEBOBINAANARANJADO
YA11167
YA11167 Caja de derivación
OBD-II–Blue-Point.
s/FRECEUNFÉCILACCESOALOSTERMINALES
/"$))YFACILITALACONEXIØNCONLA
HERRAMIENTADEBÞSQUEDA
s.OESNECESARIOADIVINARCUÉLESEL
TERMINALQUETIENESONDA
s%VITAQUELOSTERMINALESDELVEHÓCULOSE
DA×ENCONLASSONDAS
s,ASSONDASDELCOMPROBADORSECONECTAN
DEMANERASEGURAPARAQUEPUEDAREALIZAR
ELDIAGNØSTICOCONLIBERTAD
s.OTENDRÉQUEARRASTRARSEDEBAJODELTABLERO
s)DEALPARADIAGNOSTICARENLACESDE
COMUNICACIØNQUENOFUNCIONAN
CORRECTAMENTE
EEDMRACKM
CTN10001 Comprobador de circuito. EEDMRACKM
s5NIDADINALÉMBRICASINCABLEATIERRA
s0RÉCTICOSOPORTEPARASOSTENER
s)NDICADOR,%$ROJOYSE×ALSONORAPARA
COMPROBADORESDECIRCUITOSJUEGOSDE
VERIFICARLAPOTENCIA
CABLESDELMULTIMEDIDORDIGITALABRAZADERAS
s!PTOPARACOMPUTADORAYAIRBAG
DEAMPSSONDASDETEMPERATURAYOTROS
s'AMADE6##
ACCESORIOSPARAMULTIMEDIDORES
s0UEDENMONTARSEENLAPAREDCONTORNILLOS
OCOLOCARSESOBREARMARIOSRODANTESCONUN
BLOQUEMAGNÏTICO
Fgmlada[]]fYeZa]fl]k[gfnYhgj]phdgkang
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
409
PRUEBAS Y ELECTRÓNICA
Comprobadores de circuitos
CTS2
Comprobadores de continuidad
CTS2 Comprobador de continuidad
de voltios.
s3EUTILIZACOMOUNCOMPROBADORDECIRCUITOS
CONVENCIONALOALCAMBIARELINTERRUPTOR
COMOCOMPROBADORDECONTINUIDADPARA
DETECTARPROBLEMASDEENCENDIDODECABLES
DEALIMENTACIØNOCONEXIØNATIERRAFALLIDOSY
FUSIBLESQUEMADOS
s0RUEBAUNAGAMADEVOLTAJEDE##DEA6
s,AESCALA,%$ENFUNCIONAMIENTOSUMINISTRA
PRUEBASPRECISASDELASALIDADELALTERNADOR
EEFB315
EEFB315 Juego de fusibles Max
Buddy™–Blue-Point.
s#APACIDADDEPRUEBADE-!8)CIRCUITOSDE
HASTAAMP
s4AMBIÏNFUNCIONACON-).)CIRCUITOSY
CIRCUITOS!4#INCLUYEADAPTADORES
s,AUNIDADCUENTACONFUNCIONESDESOSTÏN
DEPICOYFUNCIØNCERODEUNAPULSACIØN
s3EUTILIZAENCIRCUITOSDEFRENOS
ANTIBLOQUEOCIRCUITOSDEESTÏREOSDE
AUTOMØVILESCIRCUITOSDEDISTRIBUCIØN
DEPOTENCIACIRCUITOSDERIVADOSDE
EMBARCACIONESYAUTOMØVILESCIRCUITOS
DELDESEMPA×ADORDEVENTANASTRASERAS
CIRCUITOSDERIVADOSDE##DEENERGÓASOLAR
CIRCUITOSDECONTROLDETRACCIØNCIRCUITOS
DELCONTROLADORDECARGASOLARYCIRCUITOS
DEEQUIPOSDESERVICIOPESADO
s!MPSAMPDE##
s2ESOLUCIØN!MP
s0RECISIØNDELECTURADÓGITOS
MT1009A
Amperímetros inductivos
MT1009A Juego de amperímetros
inductivos (2 pzas.).
s,OSMEDIDORESNONECESITANCONEXIØNDIRECTA
s3IMPLEMENTECOLOQUEELMEDIDORGUÓAENEL
CABLEDELAPIEZAQUESEESTÉPROBANDOYTOME
LALECTURA
s,APOLARIDADDELCABLENOAFECTALALECTURAYA
QUELAAGUJASEMUEVEENAMBASDIRECCIONES
s-EDIDORESINDIVIDUALESPARAMEDIRLACORRIENTE
DEALTERNADORYDEARRANQUE
EEFB310
EEFB310 Fusible Buddy® Juego de
comprobación profesional–Blue-Point®.
s%XCELENTEHERRAMIENTAPARALEERLACORRIENTE
DEAMPERAJEDELCIRCUITOYPARALOCALIZAR
PROBLEMASDEHASTAAMP
s)NCLUYEMEDIDORCONFUNCIONESDEPRUEBA
INTERCAMBIABLES0RUEBADECORRIENTEDEL-).)
CIRCUITODEAMPPRUEBADECORRIENTEDEL
CIRCUITO!4#DEAMPYPRUEBADECORRIENTE
DEUSOMULTIPLEDEAMP
s3EENCHUFADIRECTAMENTEENDADOSDE-).)
FUSIBLESYFUSIBLES!4#
s%LFUSIBLEORIGINALSEREEMPLAZAENLÓNEAPOR
LOCUALELCIRCUITOCONTINÞAPROTEGIDO
s'AMADEMEDICIØNAMP6##n
SEGUNDOS
s0RECISIØN¢DELECTURA
s2ESOLUCIØNM!MP
YA111KIT
Localizador de cortocircuitos
YA111KIT Juego enchufes de
cortocircuito del relé–Blue-Point.
s,OSENCHUFENCIERRANPORLOGENERALCONTACTOS
ABIERTOSYDETERMINANINMEDIATAMENTECUÉLES
LAPARTEDELCIRCUITODESALIDAQUENOFUNCIONA
CORRECTAMENTE
s.OESNECESARIOADIVINARCUÉLESLATERMINALEN
CORTOCIRCUITO
s2EDUCESIGNIFICATIVAMENTEELTIEMPODE
DIAGNØSTICO
s%LJUEGOESAPTOPARATODOSLOSVEHÓCULOSQUE
UTILIZANRELÏSESTÉNDARDEYPASADORES
s.OSEDA×AELDADODELRELÏALREALIZARPRUEBAS
YA111-10 Enchufe de cortocircuito del relé.
s!MP
YA111-15 Enchufe de cortocircuito del relé.
s!MP
YA111-20 Enchufe de cortocircuito del relé.
s!MP
YA8006
Protectores de fusibles
YA8005 Juego maestro de
protectores de fusible–Blue-Point.
s%LCONECTORALACAJADEFUSIBLESTIPODUAL
CONCABLEDEgLEPERMITEMOVERSE
ALREDEDORDELVEHÓCULOYPROBARLOSCABLES
PARADETECTARSIHAYUNCORTOCIRCUITO
s.OSEDESPERDICIANFUSIBLES
s)NCLUYE%MPU×ADURASDEREAJUSTEDE
DISYUNTORESDEY!MPMØDULO
DEALERTASONORAYADAPTADORESPARAFUSIBLES
s3EUTILIZANENLAINSTALACIØNDERADIOS
REPRODUCTORESDE#$DETECTORESDE
RADARESYOTROSEQUIPOSACCESORIOS
YA8005 Juego de protectores de fusible–Blue-Point.
s%LCONECTORALACAJADEFUSIBLESTIPODUALCONCABLEDEgLEPERMITEMOVERSEALREDEDORDEL
VEHÓCULOYPROBARLOSCABLESPARADETECTARSIHAYUNCORTOCIRCUITO
s)NCLUYE%MPU×ADURASDEREAJUSTEDEDISYUNTORESDEY!MP
s3EUTILIZANENLAINSTALACIØNDERADIOSREPRODUCTORESDE#$DETECTORESDERADARESYOTROS
EQUIPOSACCESORIOS
AccesoriosYA8005-EXT Cable de extensión de 10'.
s#ABLEDEEXTENSIØNDEg
YA8005-11 Adaptador de alerta sonora.
s-ØDULODESONIDODEALERTASONORA
410
www.snapon.com/shoptools
YA8005
PRUEBAS Y ELECTRÓNICA
;gehjgZY\gj]k\][aj[malgk
TLT8003
YA7900A
YA7900AP
TLT5
;gehjgZY\gj]k\]dYjfk\]dj]egdim]q
Y\YhlY\gj]k–:dm]%Hgafl®
YA7900A Comprobador liviano de remolque universal móvil.
s,AUNIDADCUENTACONCARACTERÓSTICASYCAPACIDADESDEPRUEBALIVIANADE
REMOLQUECOMPLETASCONDIAGNØSTICOENLAPLACAENELLUGAR
s#ONUNABATERÓADEAUTOMØVILDE6UNTÏCNICOPUEDECONECTAREL
COMPROBADORALREMOLQUEYENCENDERTODOSLOSSISTEMASDEILUMINACIØN
MIENTRASREALIZAELDIAGNØSTICOSOBREPROBLEMASELÏCTRICOSENLOSFRENOSLAS
SE×ALESDEGIROLOSSISTEMASDEFUNCIONAMIENTOYDELUCESDESEGURIDAD
s%LCONTROLREMOTODE2&PERMITEREALIZARPRUEBASCOMPLETASAMÉSDE
gELTÏCNICOPUEDECAMINARCONLIBERTADALREDEDORDEUNREMOLQUEDE
CUALQUIERTAMA×OMIENTRASCONTROLAPORCOMPLETOLASECUENCIADEPRUEBA
s,ACARACTERÓSTICADE#ICLOAUTOMÉTICOSEENCIENDECONTINUAMENTEYCAMBIAA
CADACIRCUITODURANTESEGUNDOSPARADISMINUIRELTIEMPODEINSPECCIØN
SOPORTE TÉCNICO
1-888-786-7899
Características:
s)NDICADORAUTOMÉTICO
s)NDICADORDESOBRECARGA
s)NDICADORDEVOLTAJE
s)NDICADORDECIRCUITOABIERTO
s)NDICADORESDECIRCUITO
s)NDICADORDEPOLARIDADINVERSA
s-EDIDORDEAMPCONILUMINACIØN s#ONEXIØNATIERRADELCHASIS
s&USIBLEDEAMP
DEFONDO
s%NTRADADECARGADORDEGOTEODEAMP s)NTERRUPTORDESELECCIØNDE
ALIMENTACIØN
s%NTRADADEPOTENCIAÞNICADEAMP
s$ADODEPASADORESREDONDOSPARA s.EUMÉTICOSDE
REMOLQUE
YA7900AP Comprobador liviano de remolque universal móvil.
s)GUALQUE9!!CONPRUEBAINCORPORADAPARALOSSISTEMASDE
FRENOSNEUMÉTICOSDELREMOLQUE
YA7900A-PKIT Juego de complemento de prueba para
el sistema de frenos.
s0ERMITEALOSPROPIETARIOSDEL9!!ORIGINALAGREGARASUS
UNIDADESCAPACIDADESDEPRUEBAPARAELSISTEMADEFRENOS
s!CTUALIZALASUNIDADES9!!A9!!0
YA7900A-1 Cable de pasador redondo.
s%LCABLEDEPASADORESREDONDOSTIENEPIESDELARGO
YA7900A-2 Cable de conexión a tierra del chasis.
s%LCABLEDECONEXIØNATIERRADELCHASISTIENEPIESDELARGO
Adaptador YA7900A-3.
s!DAPTADORPASADORESREDONDOSAPASADORESPLANOS
YA7900A-4 Control remoto.
s)NALÉMBRICO
TLT8000
TLT6
TLT7
TLT8003 Adaptador del enchufe del remolque.
s#ONVIERTELAALIMENTACIØNDEVOLTIOSQUESEENCUENTRAENLAPARTE
POSTERIORDELDADODEUNCAMIØNOREMOLQUE356ENUNAPOTENCIADE
SALIDADOBLEDEVOLTIOS
s!LIMENTAELEQUIPODEPRUEBADEVOLTIOSELEQUIPODECARGAYLAS
LUCESDETRABAJODELTALLER
s3EUTILIZACONFINESRECREATIVOSCOMOPONERENFUNCIONAMIENTOBOMBAS
DEAIRERADIOSO46MIENTRASCOCINACERCADELAUTOMØVILYACAMPA
s3EENCHUFAENCUALQUIERCONEXIØNDEREMOLQUECONPASADORESTIPOESPADA
TLT8000 Adaptador de remolque de 3 pasadores.
s!DAPTALACONEXIØNDEPASADORESALASCONEXIONESDEPASADORES
REDONDOSYDEPASADORES
s4APONESSELLADOSPARAEVITARQUELOSRESIDUOSDELACALLECORROANLASCONEXIONES
s!GARRECONALASPARAFÉCILINSTALACIØNYEXTRACCIØN
s3EUTILIZAENCAMIONESDESERVICIOMEDIANOYLIVIANOCAMIONETASDE
YTONELADASCASASRODANTESYOTRASAPLICACIONESDESERVICIOPESADO
TLT5 Comprobador del arnés del remolque.
s,OCALIZAFÉCILMENTELOSPROBLEMASELÏCTRICOSENELVEHÓCULOREMOLCADO
s#ONTROLALOSDOSCONECTORESDEREMOLQUEPLANOSDEYPASADORES
CONLUCESINDICADORAS,%$
s0RUEBALASSE×ALESDEGIRODEIZQUIERDAYDERECHALASLUCESDEFRENO
YLASLUCESDEFUNCIONAMIENTO
TLT6 Comprobador del arnés del remolque.
s#ONTROLALOSCONECTORESDEREMOLQUEREDONDOSDEPASADORESCON
LUCESINDICADORAS,%$
s#UENTACONLASMISMASAPLICACIONESQUE4,4
TLT7 Comprobador del arnés del remolque.
s#ONTROLALOSCONECTORESDEREMOLQUEREDONDOSDEPASADORESCON
LUCESINDICADORAS,%$
s#UENTACONLASMISMASAPLICACIONESQUE4,4
YA3179B
YA3179B Seguidor de circuitos.
s3EGUIDORDECIRCUITOSCONPASADORREDONDOPARASEMIRREMOLQUES
s0RUEBAELENCHUFEYELCABLEDELSEMIRREMOLQUE
s%XTREMOSMACHOYHEMBRAPARAQUEELTÏCNICOPUEDAAISLAR
CUALQUIERFALLAENELREMOLQUEOELCABLE
s0UEDEREPARARCORTOCIRCUITOSDEMANERATEMPORALENELTALLEROENLARUTA
s)NCLUYELENGàETASDEPUENTEYTERMINALDEREEMPLAZO
MTAC110
K]fkgj\]ngdlYb];9EL9;))(
Sensor de voltaje CA MTAC110.
s%LSENSORDE#!NOINTRUSIVODETECTAVOLTAJESDEA6#!
s3EUTILIZAPARAASEGURARQUENOHAYACORRIENTEANTESDETRABAJARENUNCIRCUITO
s$ESLICELAPUNTADELASONDAALOLARGODEUNCABLEAISLADOCERCADEUN
TOMACORRIENTEOCERCADEUNDISYUNTORYLAPUNTABRILLARÉSIHAYVOLTAJEPRESENTE
ADVERTENCIA
;]haddgk]d[lja[gk
AC41C
AC41C Cepillo con dado de luces guía.
s#ERDASDURASDEACERODECARBONORÓGIDO
sDELARGO
Fgmlada[]]fYeZa]fl]k[gfnYhgj]phdgkang
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
411
PRUEBAS Y ELECTRÓNICA
Analizadores de gas manuales
HHGA-9
HHGA-8
HHGA-8 Sonda
de escape para
motocicletas.
tSonda de escape opcional
para motocicletas para
analizadores de gas de la
serie HHGA
HHGA4X
HHGA4X Juego de analizadores de gas manuales.
tEl analizador de 5 gases prueba las emisiones de escape del
vehículo para detectar óxido de nitrógeno (NOx), monóxido de
carbono (CO), hidrocarburos (HC), dióxido de carbono (CO2), oxígeno
(O2) y AFR/LAMDA
tBrinda una funcionalidad ideal para el trabajo de diagnóstico, la
prueba de precumplimiento y el servicio a vehículos según las
especificaciones del fabricante.
tAyuda a diagnosticar problemas del motor y fallas en el conversor catalítico
tComandos en pantalla en 8 idiomas
tPuede utilizar CA ó 12 V
tCompletamente portátil e ideal para las pruebas en la ruta
tEl imán en el analizador y en la impresora permite colocarlo casi en
cualquier lugar
tImprima los registros en impresora infrarroja
SOPORTE TÉCNICO
1-888-717-1333
HHGA-9 Sonda de escape
de cinco gases.
tSonda de escape de 5 gases para
analizadores de gas de la serie HHGA
HHGA-11 Filtros.
tFiltros para analizadores de gas de
la serie HHGA
HHGA-16
HHGA-17
HHGA-16 Adaptador
de CA.
tDiseñado para utilizar en
el área de servicio
HHGA-17 Adaptador de 12V.
tDiseñado para utilizar en el área
de servicio o en la ruta
HHGA-18 Rollo de papel.
tRollo de papel de repuesto para
impresora infrarroja HHGA-5
HHGA-5
HHGA-5 Impresora infrarroja.
tImpresora infrarroja para analizadores de gas de la serie HHGA
Analizador de monóxido de carbono
MT706A Analizador de monóxido de carbono–Blue-Point®.
s#ONTROLAYPRUEBALOSAJUSTESQUEAFECTANLASEMISIONESDE
monóxido de carbono de los vehículos a gasolina, los elevadores de
horquilla a propano y otros equipos de estilo de combustión
s,AINDICACIØNDEFLUJOADVIERTESOBREELFLUJODEEMISIONES
restringidas debido a líneas obstruidas o pellizcadas
sPantalla con proyección posterior para facilitar la lectura con luz tenue
s,AGAMAESDEADE#/APROX00-
s%LTIEMPODERESPUESTAESELDELALECTURAENMENOSDE
60 segundos
s#UMPLECONNORMAS#%
SOPORTE TÉCNICO
MT706A
1-888-382-6522
Detectores de fugas
ACT790 Detector de gas combustible. Busca pérdidas en los sistemas de escape y
de combustible y además verifica la integridad de los contenedores de almacenamiento. Los
componentes detectables incluyen acetileno, isobutano (R600a), metano, etano (R170), propano
(R290), hidrógeno, acetona, metanol y gasolina. La sonda es de 17" de largo. Utiliza (4) pilas
alcalinas “AA”. Cumple con SAEJ1627 y está diseñada para cumplir con SAEJ2791. Longitud de la
carrocería de 10 3/8". Incluye caja de almacenamiento.
s)NDICADORNUMÏRICODELTAMA×ODELAPÏRDIDA s4RESNIVELESDESENSIBILIDAD
s&UNCIØNDEOPERACIØNSILENCIOSAAUTOMÉTICA sIndicador visual y luminoso (LED) de pérdida en la sonda
s#ALIBRACIØNAUTOMÉTICA
s3ENSORDEVIDAPROLONGADA
s#ØMODAEMPU×ADURADENEOPRENO
sCaja de instrumentos moldeada por inyección de alto impacto
s#ONCERTIFICADODESEGURIDADINTRÓNSECA
s2 años de garantía para el detector y 2 años para el sensor
ACT790
412
www.snapon.com/shoptools
PRUEBAS Y ELECTRÓNICA
<]l][lgj]k\]^m_Yk
EELD100
EELD302B
EELDCOVER
E~imafYk<aY_fgkla[Kegc]TM
EELD302B Máquina de humo de diagnóstico (EVAP).
s,AMÉQUINADEHUMODEDIAGNØSTICOCONEMISIONESEVAPORATIVAS
OFRECEPRUEBASDESISTEMA%6!0TOTALMENTEAUTOMÉTICASY
APLICACIONESDEUSOGENERAL
s,AESTELADECONDENSACIØNYOLATINTAFLUORESCENTESE×ALALASPÏRDIDAS
s,AUNIDADESTÉMÉSSEGURACONNITRØGENONITRØGENOOPCIONAL
s5TILIZALASOLUCIØNPRODUCTORADEHUMOSINOLOR%%,$!5LTRA4RACE©
s,AUNIDADSEENTREGATOTALMENTECARGADACONLASOLUCIØNDEHUMO
Aplicaciones EELD302B y EELD100:
s0ÏRDIDASDEACEITEs6ÉLVULA%'2s0ÏRDIDASDEAIREYAGUA
s-ANGUERASYVÉLVULASDE0#6s#ONJUNTODEPURIFICADORDEAIRE
s-EDIDORDEFLUJODEAIREMASIVOs)NTERRUPTORESDEVACÓO
s'RAMPASSUELTASs%JEDELCUERPODELREDUCTORs$IAFRAGMAS
s6ÉLVULASDEAIREs3ENSORES-APs-ÞLTIPLESDEESCAPE
s4UBOSDEESCAPEYSILENCIADORESs-ANGUERASDEVACÓO
s*UNTASDEENTRADAs#ONDUCTOSDEAIRE
s*UNTADEBASEDECARBURADORs!NILLOS/DELINYECTOR
Especificaciones
EELD100 Máquina de humo de diagnóstico (EVAP).
s-ÉQUINADEHUMODEUSOGENERAL
EELDCOVER Cubierta.
s#UBIERTAOPCIONALPARA%%,$"Y%%,$
Accesorios estándar EELD302B y EELD100:
EELD301A2*UEGODEENCHUFESDETAPØN
EELD301A3!DAPTADORCØNICODEESCAPE
EELD301A4!DAPTADORDEPÏRDIDADEAIREAGUA
EELD301A5,UZDEPUNTOHALØGENA
EELD302A1-ANGUERADENITRØGENOOPCIONALEN%%,$
EELD302A2!DAPTADORDELPUERTO%6!0SERVICIOESTÉNDAR
EELD302A3!DAPTADORDELPUERTO%6!0SERVICIO&ORDOPCIONAL
EN%%,$
EELD302A4(ERRAMIENTAPARANÞCLEODEVÉLVULAS3CHRADER
EELD302B
EELD100
Suministro eléctrico
12 VCC
12 VCC
Consumo de energía
15 amp.
15 amp.
Volumen de suministro
10l/min
10l/min
Largo lineal/suministro de humo, pies (mm)
10 (3)
10 (3)
Largo lineal/suministro eléctrico, pies (mm)
10 (3)
10 (3)
Largo lineal/arranque remoto, pies (mm)
10 (3)
10 (3)
Peso, lb. (kg)
Medidas, pulgadas (mm)
21 (9.5)
19 (8.6)
17 de alto x 16 de largo x 12 de ancho (431 de alto x 406 13 de alto x 13 de largo x 12 de ancho (305 de alto x 330
de largo x 254 de ancho)
de largo x 254 de ancho)
Máquinas de vapor Diagnostic Smoke - Comparación de características
EELD302B
EELD100
Tecnología de vapor STAR Diagnostic Smoke desarrollada junto con Ford Motor Co., GM y Chrysler (Aprobada por la mayoría de los OEM* más importantes)
s
s
Solución de colorante UltraTraceUV® la ÚNICA solución de colorante aprobada por cualquier OEM. No dañará el depósito de carbón activado, la válvula ORVR,
las válvulas de purga, los conversores catalíticos, los sensores de O2, los sellos o las juntas y no anulará la garantía* de fábrica del vehículo
s
s
Diseñada con una válvula de seguridad electrónica que corta automáticamente el flujo de aire al sistema EVAP del vehículo cada vez que la máquina
se apaga. Esto evita que los vapores de la gasolina puedan salir continuamente del sistema EVAP e invadir su área de trabajo*
Cumple con las especificaciones si el OEM exige que el nitrógeno produzca el humo cuando prueba el sistema EVAP*
Capacidades para prueba de flujo*
Caída de presión**
Accesorios compartidos: 1 adaptador cónico de escape, adaptador del puerto de luz de punto, juego de enchufes de tapón, folleto con sugerencias técnicas
Accesorios adicionales: manguera en bobina de nitrógeno de 25', 2 adaptadores cónicos de escape
Capacidades de prueba de dos fases; primero verifica pérdidas de 0.040 y 0.020 con una simple prueba de aprobado/desaprobado de 2 minutos
Calibración de orificio interno de 0.040" para vehículos modelo 1999 y anteriores
Calibración de orificio interno de 0.020" para vehículos modelo 2000 y posteriores
Estándar de pérdida incorporado para actualizar en el "futuro"
Modos de prueba del OEM: fase uno y fase dos.
Almohadilla sensible del microprocesador para una operación rápida y fácil del comprobador
Dos años de garantía.
3 años de garantía.
*La mayoría de los OEM ahora requieren esta característica.
**EELD302B no necesita esta característica porque tiene los modos de prueba del OEM para la fase uno y dos
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
ADVERTENCIA
s
s
SOPORTE TÉCNICO
1-800-901-1988
Fgmlada[]]fYeZa]fl]k[gfnYhgj]phdgkangMk]kdg]f~j]YkZa]fn]fladY\Yk
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
413
PRUEBAS Y ELECTRÓNICA
Accesorios para el detector de fugas
EELDGASCAP1
EELD302010
EELD302REG
EELD301A1
EELD302CART
EELDGASCAP1 Adaptador de cuello de llenado del
depósito de combustible–Blue-Point®.
s3ECONECTARÉPIDAMENTEACASITODOSLOSCUELLOSDELLENADO
s.ONECESITARÉMÉSLASCOSTOSASJUNTASDEREEMPLAZO
s3EADAPTAATODOSLOSTAMA×OSLOSNUEVOSMODELOSDEVEHÓCULOS
PUEDENSUFRIRMODIFICACIONES
EELD302CART Carro–Blue-Point.
s%LEXCLUSIVOCARROCONRECUBRIMIENTODEPOLVONEGROPARASERVICIO
PESADOSOSTIENELA%%,$"O%%,$DEMANERASEGURAENSU
LUGARPARAMOVERLAFÉCILMENTEENELÉREADESERVICIO
s,ABANDEJAESPECIALMENTEDISE×ADATRANSPORTAELTANQUEDE
NITRØGENOOPCIONAL
EELD302REG Regulador del flujo de gas–Blue-Point.
s%LREGULADORDE03)PREAJUSTADOGARANTIZALAPRESIØNDE
OPERACIØNCORRECTAPARACUALQUIERMÉQUINADEHUMO
s3ECONECTAFÉCILMENTEALTUBODENITRØGENOOPCIONAL
EELDGASCAP Adaptador de cuello de llenado del
depósito de combustible.
s0AQUETEDE%%,$'!3#!0
EELDGASCAPBMW Adaptador de cuello de llenado del
depósito de combustible.
s%XCLUSIVOPARA"-7
EELD302010 Juego de actualización, 0.010.
s3IGALASINSTRUCCIONESPARAINSTALARESTEJUEGOENSUMÉQUINADEHUMO%%,2"
s,AMÉQUINADEHUMO%%,$"MEDIRÉLASFUGASDE
s)NCLUYECONJUNTODELSOLENOIDEANILLOS/YORIFICIO
/+EEFEEELD301A1 Solución de humo UltraTraceUV®.
s3OLUCIØNPRODUCTORADEHUMOSINOLOR5LTRA4RACE56©PARAUSARCONLAS
MÉQUINASDEHUMO%%,$!%%,$"
s"OTELLAÞNICADEONZ
Medidores especiales y comprobadores pequeños
Medidores digitales tipo tenaza de CA/CC
RELAYTEST1
Comprobador de relé automotriz
RELAYTEST1 Comprobador de relé automotriz.
s0RUEBEENFORMARÉPIDAYPRECISALOSRELÏSELECTROMECÉNICOSDETERMINALY
UTILIZADOSENMUCHOSAUTOMØVILESNACIONALESEIMPORTADOS
s)NTERROGARÉEIDENTIFICARÉUNACONFIGURACIØNTERMINALDERELÏ
DESCONOCIDAYLUEGOAUTOCONFIGURARÉSUPROPIOCIRCUITOINTERNOPARA
DESEMPE×ARTODASLASFUNCIONESDEPRUEBAREQUERIDASENFORMA
AUTOMÉTICA
s3EPUEDEUTILIZARPARAREALIZARLASSIGUIENTESPRUEBASRESISTENCIADE
BOBINADISPOSITIVODESUPRESIØNDESOBRETENSIØNRESISTORODIODO
INTEGRIDADDECONTACTOABIERTOCERRADOPRUEBASCÓCLICASDECONTACTO
PARALADETECCIØNDEFALLASINTERMITENTESCONTINUIDADDECONTACTO
CARGADACONTACTOSDERELÏSABIERTOSOCERRADOSYTIEMPOPARA
CONTACTARELCIERREYLAAPERTURA
s,AUNIDADINDICAAUTOMÉTICAMENTELOSRESULTADOSDELASPRUEBASCON
UNASERIEDELUCESDERENDIMIENTOROJASVERDESYAMARILLAS
YA76562
414
EEDM575D Medidor digital tipo tenaza.
s5NMEDIDOR2-3COMPLETOQUEOFRECEMEDICIONES
PRECISASDECORRIENTENOLINEAL
s$ISE×ADOPARAMEDIRCORRIENTEDEARRANQUEDEHASTA
AMPALIGUALQUEVOLTIOSRESISTENCIAYFRECUENCIA
s3EUTILIZAPARADIAGNOSTICARSENSORESDEVELOCIDADDE
LASRUEDASSE×ALESDECONTROLDEINYECTORESSALIDAS
DEÉRBOLESDELEVAYCIGàE×ALESYPARAPROBARCABLES
CONEXIONESYFUSIBLES,APANTALLA,#$YELGRÉFICODE
BARRAANALØGICOMEJORANLAVISTADECAMBIOSRÉPIDOS
DELASE×AL
s'RABAVALORESMÉXIMOSYMÓNIMOSDECORRIENTE2-3
FRECUENCIAYOTRASMEDICIONESCONLAFUNCIØN
-ÓN-ÉX2EG
s#UMPLECONLASNORMASDESEGURIDADDE5,)%#
EEDM575D YC5,US
s)NCLUYECABLESDEPRUEBASONDASDETEMPERATURA
CAJADETRANSPORTEBLANDABATERÓAYMANUALDE
INSTRUCCIONES
Especificaciones
Conteo en pantalla
Amp. CA
VCA
Amp. CC
VCC
Precisión de CC básica
Frecuencia
Resistencia, ohms
Dimensiones, (L x Anc. x Alt.) pulgadas
EEDM575D
11,000
400
600
400
600
0.5%
10 KHz
110 M
10" x 1 3/8" x 2 1/2"
Sonda de bobina sobre bujía (COP)
YA76562 Sonda de encendido rápido–Blue-Point.
s6ERIFICARÉPIDAMENTEELENCENDIDODEUNABOBINAENLABOBINADE
ENCENDIDODEBUJÓA#/0YENLABUJÓA
s%LIMINALANECESIDADDEUTILIZARODESARMARLOSALAMBRESDEBOBINA
DELARETROSONDAPARACOMPROBARELCONECTORDELABOBINAYLABUJÓA
s0ULGARDESENSIBILIDADVARIABLE63PARAREALIZARUNDIAGNØSTICOMÉS
PRECISOYTENERMAYORCOBERTURADEAPLICACIONES
s,%$INDICADORESSÞPERBRILLANTESEN+6Y!2#
www.snapon.com/shoptools
PRUEBAS Y ELECTRÓNICA
=kl]lgk[ghagk
<]l][lYj~ha\Ye]fl]]dgja_]f\]djma\gg\]dYknaZjY[agf]khjgn]fa]fl]k\]\]ZYbg\]d[Yh$\]\]ZYbg\]dYmlg
q\]dafl]jagj\]dn]`[mdg&Dgk.[YfYd]kk]d][[agfYZd]kh]jeal]f[gdg[Yjdgkk]fkgj]k]f\a^]j]fl]kdm_Yj]khYjY
\]l][lYjjma\gk]f]d[gbaf]l]$]d]f_jYfYb]$]deglgj$dYkmkh]fkaf$]dY[[]kgjag\]d[mY\jgqjma\gk\]dna]flg&
6ISORDEFORMADEONDAOFRECEUNA
REPRESENTACIØNVISUALDELASE×ALSONORA
=d][ljfa[gk
LD6900
LD6900 Unidad de diagnóstico THEBIS™.
s$EBAJODELCHASISJUNTASDELDIFERENCIAL6#CAJASDETRANSMISIØN
TRANSFERENCIAJUNTASUNIVERSALESMÉSCOJINETESENGRANAJESY
SUSPENSIONES
s$EBAJODELCAPØINYECTORESDECOMBUSTIBLEDEFECTUOSOSESCAPESDE
VACÓOVÉLVULASYFILTROSRUIDOSOS
s#ARROCERÓARUIDOSDELVIENTOYDELAVENTILACIØNTABLEROSYPANELES
DEINSTRUMENTOS
s&UNCIONACOMODETECTORELECTRØNICODERUIDOSYVIBRACIONESY
UTILIZALASCONEXIONESDELAABRAZADERAINDUCTIVAOELMICRØFONODE
VENTILACIØN
s&UNCIONACOMOUNESTETOSCOPIOELECTRØNICOYUTILIZALASCONEXIONES
DELAVARILLADEAUDICIØNYDELASONDADECONTACTO
s,OSARCHIVOSGRABADOSSEALMACENANENLATARJETADEMEMORIA53"
INCLUIDAPARAPODERREPRODUCIRLOSFÉCILMENTEENLA0#
YA6890KT Detector de ruidos y chirridos–Blue-Point®.
s$ETECTARÉPIDAMENTEELORIGENYLAUBICACIØNDELOSRUIDOSPROVENIENTES
DEDEBAJODELCHASISDEBAJODELCAPØDELATRANSMISIØNDELAJUNTADE
DIFERENCIAL6#DELOSINYECTORESDECOMBUSTIBLEYCOJINETESDEFECTUOSOS
DELOSENGRANAJESYDELASPIEZASDELASUSPENSIØN
s!YUDAADETECTARYAISLARCHIRRIDOSVIBRACIONESCRUJIDOShRUIDOSvDEL
CAPØGOLPETEOSYRUIDOSSORDOS
s,OSTRANSMISORESINALÉMBRICOSPRESENTANUNCUERPOMAGNÏTICOCON
GANCHOVERSÉTIL
s%LRECEPTORDECANALINALÉMBRICOAÓSLASEISUBICACIONESDIFERENTES
DETRANSMISORES
s,ASLUCES,%$INDICANLAFUERZADELASE×ALDELCANALACTIVO
s%LBOTØNILUMINADOINDICAELCANALACTIVOALINSTANTE
YA6895 Transmisor (canal 5)–Blue-Point.
s4RANSMISOROPCIONALPARA9!+4&UNCIONAENELCANAL
YA6896 Transmisor (Canal 6)–Blue-Point.
s4RANSMISOROPCIONALPARA9!+4&UNCIONAENELCANAL
YA6930 Estetoscopio electrónico del motor–Blue-Point.
s%LESTETOSCOPIOELECTRØNICOAMPLIFICAELSONIDODURANTEELDIAGNØSTICO
OLAVERIFICACIØNDELFUNCIONAMIENTOCORRECTODELVEHÓCULO
s,ASONDADECONTACTOSEUTILIZAPARADETECTARCOJINETESDEFECTUOSOS
INYECTORESCHIRRIDOSGOLPETEOSYMÉS
s)NTERRUPTORDESELECCIØNDEMODOCONINDICADOR,%$PARA
INTERCAMBIARFÉCILMENTEENTRELASFUNCIONESDELESTETOSCOPIOYLAS
FUNCIONESDELASONDADECONTACTO
s,AFUNCIØNDECANCELACIØNDERUIDOSELIMINAELRUIDODEFONDO
s*UEGODEAURICULARESTIPOESTUDIOINALÉMBRICOS
s6ARILLAFLEXIBLEDESMONTABLECONPUNTA,%$ILUMINADA
s#ONTROLDEVOLUMENGIRATORIO
ADVERTENCIA
&ILTRODEPASODEBANDAELIMINALOSRUIDOSDE
FONDONODESEADOS
YA6890KT
YA6895
YA6895
YA6930
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
415
PRUEBAS Y ELECTRÓNICA
Estetoscopios
Electrónicos
YA6910
YA6920
YA6800
YA6800 Estetoscopio electrónico–Blue-Point®.
s0RESENTANIVELESDECONFIGURACIONESDECONTROLDESONIDOCONTROL
DETONO!"CONTROLESDEVOLUMENALTOYBAJOYPOSICIØNPARA
COMPROBARLABATERÓAENLAPALANCADECONTROL
s4IENEUNMICRØFONOSÞPERSENSIBLEENLAPARTESUPERIORCONECTADOAUNEJE
FLEXIBLEDEPARAUNFÉCILACCESOALASÉREASDIFÓCILESDEALCANZAR
s,ALUZ,%$SE×ALACUÉNDOESTÉENCENDIDOELINTERRUPTORLOSAUDÓFONOS
BLOQUEANELRUIDOEXTERIOR
s#ONTROLESDEVOLUMENAJUSTABLES
YA6910 Mini estetoscopio electrónico–Blue-Point.
s,APRÉCTICAHERRAMIENTADEDIAGNØSTICOPUEDELOCALIZARELRUIDOPROVOCADO
PORSOPORTESDEFECTUOSOSBUJESINYECTORESDECOMBUSTIBLESUCIOS
ESCAPESDEAIREYAGUAVÉLVULASYFILTROSRUIDOSOS
s0ERMITEQUEELUSUARIOCONTROLELOSENGRANAJESCOJINETESY
COMPONENTESDELASUSPENSIØNSOMETIDOSACARGAPARAPODER
DETECTARLOSPROBLEMASDEMANERAMÉSPRECISA
s,ASABRAZADERASDELSENSORAYUDANADETECTARRUIDOSENLASPRUEBAS
DEMANEJOSQUENOSEPUEDENREPRODUCIRENELÉREADETRABAJO
s,APUNTADELSENSORMONTADAENELEJEFLEXIBLEDEPERMITELLEGARA
ÉREASDIFÓCILESDEALCANZAR
s,ASONDADEMETALINDUCTIVADEPERMITEQUEELUSUARIODETECTEEL
ORIGENDELRUIDOODELAVIBRACIØN
s%LMICRØFONOSÞPERSENSIBLEPROPORCIONAUNAGAMACOMPLETADESONIDOS
s%LCONTROLDEVOLUMENGIRATORIOPERMITEREALIZARAJUSTESFÉCILMENTE
YA6920 Estetoscopio electrónico para embarcaciones–Blue-Point.
s%XCLUSIVODISPOSITIVODEDIAGNØSTICODEAUDICIØNDISE×ADOPARA
DETECTARCHIRRIDOSVIBRACIONESYOTROSRUIDOSMOLESTOSENCASITODOS
LOSNAVÓOSYEMBARCACIONESCONMOTORESDENTROOFUERADEBORDA
s0RUEBADERUIDOSYVIBRACIONESARMØNICASENCOJINETESDEBAJODE
LASÉREASDELTABLEROCABLESDECONTROLINYECTORESDECOMBUSTIBLES
ARMARIOSYCOMPARTIMIENTOSALTERNADORESINTERRUPTORESBOMBAS
CUADROSFINALESENGRANAJESDEDIRECCIØNCAJADECAMBIOSBOMBAS
DEDIRECCIØNPLATAFORMASYCOMPRESORES
s%LARNÏSDECORDØNPARACABLERESISTENTEALAGUADEPIESDELARGO
PERMITEQUEELUSUARIODETECTEPROBLEMASENÉREASDIFÓCILESDEALCANZAR
sGRAMPASDELSENSORDEACEROINOXIDABLECARGADASCONRESORTEYCON
CØDIGODECOLORESCONUNMICRØFONOSÞPERSENSIBLEINCORPORADOEN
LASPUNTASPARAUNAØPTIMADETECCIØNDESONIDOS
s,OSAURICULARESPROFESIONALESDESERVICIOPESADOBLOQUEANLOSSONIDOSNODESEADOS
De mecánico
MST100
GA111D
416
MST100 Estetoscopio telescópico de mecánico.
s%LEJEDEACEROINOXIDABLESEEXTIENDEAUNALONGITUDTOTALDE
PARAUNFÉCILACCESOALASÉREASDIFÓCILESDEALCANZAR
s,ACÉMARADESONIDODEALUMINIOPRODUCEUNSONIDOMÉSNATURAL
QUELASCÉMARASDEPLÉSTICO
s%LTUBOFLEXIBLEALAURICULARAYUDAALPOSICIONAMIENTO
s%LEJERÓGIDOSEEXTIENDEYMANTIENELASMANOSLEJOSDELCALORYDE
LASPARTESMOVIBLES
s%LAURICULARSUAVEYCØMODOESREEMPLAZABLE
s#ØMODAEMPU×ADURADEAGARREBLANDO
s,ASONDASEINVIERTEPARAENTRARENLAPARTEINTERNADELACÉMARA
PARAUNALMACENAMIENTOCOMPACTOYSEGURO
s,ONGITUDCERRADACONLASONDAINVERTIDA
s,ONGITUDCERRADA
s,ONGITUDEXTENDIDA
GA111D Estetoscopio de mecánico.
s5BICACUALQUIERSONIDODELMOTORCOMORUIDOSDECOJINETESGOLPETEOS
CHIRRIDOSENELVENTILADOROLABOMBADEAGUAYENLOSBALANCINESDEVÉLVULA
s$IAFRAGMAAMPLIFICADORDESONIDOYSONDADEPARALOCALIZARPROBLEMAS
www.snapon.com/shoptools
PRUEBAS Y ELECTRÓNICA
L]jee]ljgkaf^jYjjgbgk
=klgkl]jee]ljgkaf^jYjjgbgk[gfljgdYf]f^gjeYk]_mjYdgkeYl]jaYd]k[Yda]fl]k$h]da_jgkgkg\a^[ad]k
\]Yd[YfrYjkaf[gflYeafYjfa\YYjdYkmh]j^a[a]&Kaehd]e]fl]Yhmfl]YdZdYf[g$laj]\]d_Yladdg$d]YdY
l]eh]jYlmjY]fdYhYflYddY\]D;<[gfhjgq][[afhgkl]jagj&
Aplicaciones:
s Localización de restricciones en el núcleo del radiador.
s Inspección de los problemas de control de escape y emisiones
s Medición de las temperaturas del conversor catalítico
s Diagnóstico de los múltiples de escapes para problemas de
combustión
s Medición de las temperaturas de las llantas
s Medición de las temperaturas de la pista de carrera
s Medición de la temperatura de cojinetes, rotores, tambores o frenos
para verificar que no existan problemas potenciales
Características
RTEMPB4
s HVCA: Se utiliza para equilibrar la temperatura del ambiente,
verificar registros de suministro/retorno de trabajo en conductos,
controlar trampas de vapor, el rendimiento del horno y, además, se
utiliza en auditorías de energía
s Verificación de temperaturas de cojinetes, rotores, frenos y tambores
s Seguridad de alimentos: para llevar a cabo mediciones de temperatura
HaCCP en las dársenas de recepción, tomar temperaturas de cocción,
verificar temperaturas altas y estables, asegurar temperaturas de
almacenamientos en freezers, estufas y gamas
RTEMPB120
-67º a 428ºF (-55º a 220ºC)
-7º a 248ºF (-22º a 120ºC)
Rango de temperatura
Para seleccionar ºF o °C
Para seleccionar ºF y ºC
Pantalla de temperatura
0.5 segundos
Menos de 0.5 segundos
Tiempo de respuesta
Ajustable, establecido en 0.95
Preestablecido en 0.95
Emisividad
Batería de litio de 3 V (Incluida)
Batería CR2032
Potencia
±2% de lectura
2% de lectura ó ±3.5ºF, el que sea mayor
Precisión
1:1
1.3:1
Relación de distancia al punto
Rango de operación del
32º a 104ºF (0° a 40°C)
32º a 104ºF (0° a 40°C)
ambiente
—
—
Caja de protección
Características
Rango de temperatura
Pantalla de temperatura
Tiempo de respuesta
Emisividad
Potencia
RTEMPB2A
0º a 500ºF (-18º a 260ºC)
1ºF ó 0.5ºC
500 mSec, 95% de respuesta
Preestablecido en 0.95
Batería alcalina o de NiCad de 9 V
±2% de lectura ó ±1ºC (±2ºF)
6:1
32º a 105ºF
32º a 120ºF (0° a 50°C)
Caja de almacenamiento
Opcional (RTEMPBPK)
RTEMPB5
RTEMP25PB
RTEMP30PBA
RTEMP60PBA
-76º a 1.400ºF (-60º a 760ºC)
Para seleccionar ºF y ºC
1 segundo
Ajustable, establecido en 0.95
(2) Baterías AAA
-25º a 999ºF (-32º a 535ºC)
Para seleccionar ºF y ºC
Más de 0.5 segundos (95% de lectura)
Preestablecido en 0.95
Batería alcalina o de NiCad de 9V
-32º a 545ºC (-25º a 950ºF)
0.2ºC (0.5ºF)
500 mSec.
Preestablecido en 0.95
Batería alcalina o de NiCad de 9V
-32º a 600ºC (-25º a 1,100ºF)
0.2ºC (0.5ºF)
500 mSec.
Ajustable digitalmente de 0.1 a 1.0
Batería alcalina o de NiCad de 9V
±1% de lectura
(-25 a -15°F/-32 a -26°C) ±5°F (±3°C)
(-15 a -0°F/-26 a -18°C) ±4°F (±2.5°C)
(0 a 73°F/-18 a 23°C) ±3°F (±2°C)
(73 a 950°F/23 a 510°C) ±1% de lectura o
±2°F(±1°C), el que sea mayor
(Superior a 950°F/510°C) ±1.5% de lectura
±1% de lectura ó ±1ºC (±2ºF)
±1% de lectura ó ±1ºC (±2ºF)
30:1
Optimizado para usar a 8"; Aprox. 16:1 en
el punto de enfoque
12:1
30:1
32º a 104ºF (0° a 40°C)
32º a 120ºF (0° a 50°C)
0º a 50ºC (32° a 120°F)
0º a 50ºC (32° a 120°F)
Caja de almacenamiento
Caja de almacenamiento
Caja rígida de protección
Caja rígida de protección
Precisión
Relación de distancia al punto
Rango de operación del
ambiente
Caja de protección
RTEMPB3A
-58º a 932°F (-20° a 500°C)
Para seleccionar ºF y ºC
0.5 segundos
0.98
Batería alcalina o de NiCad de 9 V
±2% de lectura o ±2ºC (±4ºF)
12:1
RTEMPBPK Caja de transporte. Caja de transporte compacta y resistente con muñequera (opcional).
RTEMP60EX Sonda de contacto. Sonda de contacto opcional para termómetro infrarrojo RTEMP60PBA.
ADVERTENCIA
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
417
PRUEBAS Y ELECTRÓNICA
Tacómetros
adaptadoresde
contacto
EEDMRPM500
EEDMTACH1
EEDMTACH1 Tacómetro digital.
s4ACØMETROCOMBINADODECONTACTOSINCONTACTOCONLECTURA-ÓNIMA
-).,ECTURAMÉXIMA-!8YÂ,4)-!OACTUAL
s,AOPERACIØNSINCONTACTOUTILIZAUNSENSORFOTOELÏCTRICOYUNACINTA
REFLECTANTEINCLUIDA
s,ASMEDICIONESDECONTACTOSETOMANCONDELOSADAPTADORES
DECONTACTOENFORMADECONORUEDACØNCAVAORUEDAGRANDE
s,OSDATOSVIGENTESPERMANECERÉNHASTAQUESETOMELASIGUIENTELECTURA
s,ASCIFRASPERMANECERÉNENLAMEMORIAHASTAQUESETOMELA
SIGUIENTELECTURA
Gamas:
&OTOTACØMETRO
20-
4ACØMETRODECONTACTO 20-
6ELOCIDADDESUPERFICIE PIESMINØMMIN
MTTACH1A1 Cinta para fotografías.
#INTAREFLECTANTEPARAFOTOGRAFÓASPARAELTACØMETRO%%$-4!#(
EEDMRPMD500
EEDMRPM500 Tacómetro digital (motores a gasolina).
s3EUTILIZAPARALEERDIGITALMENTELAS20-ENMOTORESAGASOLINADE
ØTIEMPOSDEUNSOLOCILINDRO
s)NCLUYELACAPACIDADDEELEGIRENTREMOTORESDEØTIEMPOSY
SISTEMASDEENCENDIDODEØCHISPAS
s,AUNIDADOFRECELECTURAS-·.-­8CONUBICACIONESDE
ALMACENAMIENTOPARAGUARDARLASLECTURASPARAREFERENCIAFUTURA
s%LRANGOESDEA20s5TILIZABATERÓADE6INCLUIDA
s,ASDIMENSIONESTOTALESSONXX
EEDMRPMD500 Adaptador de motor diesel.
s!DAPTADORDEMOTORDIESELOPCIONALPARAELTACØMETRODIGITAL
%%$-20-
s3EUTILIZAENMOTORESDIESELSOLAMENTE
s%LRANGOESDEA20-
Medidor de sincronización diesel
MT257B Adaptador de pulso diesel–Blue-Point®.
s#OMPRUEBALASINCRONIZACIØNDELINYECTOROLAS20-DELMOTOR
ENMOTORESDIESELEQUIPADOSCONLÓNEASEXTERNASDEINYECCIØNDE
COMBUSTIBLEFABRICADASENACERODEØMM
s0ERMITEELUSODELASLUCESDESINCRONIZACIØNDEPERCEPCIØNINDUCTIVO
PARAPROBARLASINCRONIZACIØNDELMOTOR
s.
OESAPTOPARAMOTORESDIESELCONSISTEMASDECOMBUSTIBLEDERIELCOMÞN
Luces de sincronización
EETL500
EETL5568
MT125A
418
MT257B
EETL500 - Analizador de la luz de sincronización y del
sistema de encendido
s$ETECTEPROBLEMASDEMANEJABILIDADDELSISTEMADEENCENDIDO
s)NSPECCIONEYAJUSTELASINCRONIZACIØNDEENCENDIDOENLOSSISTEMASDE
ENCENDIDOCONVENCIONALES$)3YDEPOSTVENTACONPANTALLADIGITAL
s,EALASLECTURASDELTACØMETRO20-AJUSTELASCONFIGURACIONES
DEREPOSOªAªCILYCONFIGURELASINCRONIZACIØNDEENCENDIDO
BÉSICAYELAVANCERETARDOGENERALªAª
s-IDAELENCENDIDOMÓNIMOYMÉXIMOENK6KILOVOLTIOSDECADA
CILINDROYCONTROLEELTIEMPODECOMBUSTIØNDELACHISPADECADA
EVENTODEENCENDIDOENMSMILISEGUNDOS
s)NSPECCIONERÉPIDAMENTEELESTADODELABATERÓAYELSISTEMADECARGA
ALOBSERVARELESTADODELOS,%$ROJOSAMARILLOSYVERDES
EETL5568 Luz de sincronización digital–Blue-Point.
s,ALUZDESINCRONIZACIØNMULTIFUNCIØNFUNCIONAENTODOSLOSSISTEMAS
DEENCENDIDOCONVENCIONALESYSINDISTRIBUIDOR
s/MITALASLECTURASDELTACØMETROSOBRELASPRUEBASDELCIRCUITODE
HASTA20s#ONTROLECONFIGUREYAJUSTEELAVANCEYRETARDODEENCENDIDODEªAª
s-IDAYAJUSTEELREPOSOPARAELENCENDIDODEªAªCILINDROS
s-IDALABATERÓAYELVOLTAJEDECARGADEAVOLTIOS
s,APANTALLADOBLECONPROYECCIØNPOSTERIORPERMITEVERCONMÉSNITIDEZ
ELTACØMETROYLALECTURADEAVANCEDEENCENDIDO
s%LBARRILQUECAMBIADEÉNGULOPERMITELLEGARFÉCILMENTEALASMARCAS
DELCRONØMETROYDISTINGUIRLASCONCLARIDAD
MT125A Luz de sincronización con autopotencia.
s,ALUZDESINCRONIZACIØNCONAUTOPOTENCIAPOSEEUNCAPTADORINDUCTIVODEg
s&IJACIØNRÉPIDAENCABLESDEBUJÓASENMOTOCICLETASMOTORESDEEMBARCACIONES
VEHÓCULOSPARANIEVEJETSKISPEQUE×OSMOTORESYOTROSEQUIPOSQUENOTIENEN
UNAFUENTEDEALIMENTACIØNDEBATERÓASDEFÉCILACCESO
s3EPUEDEUTILIZARTAMBIÏNPARAAPLICACIONESENAUTOMØVILES
s%LINTERRUPTORDEENCENDIDOAPAGADOSEENCUENTRAALNIVELDELPULGAR
www.snapon.com/shoptools
PRUEBAS Y ELECTRÓNICA
;gehmlY\gjY'@]jjYea]flYk]d[lja[Yk
YA960
YA961
TLM12AO
YAGM1
EECS5MEM
TLM12AO Fuente de energía para
memoria de computadora.
s'UARDALAMEMORIADELASCOMPUTADORASDERELOJES
YA960 Fuente de energía para
configuraciones de radios y sistemas de inyección
de combustible
memoria de computadora.
sEvita la pérdida de memoria en radios, relojes, s3IMPLEMENTEENCHUFEALENCENDEDORDECIGARRILLOS
luego conecte las grampas de la batería en la
trabas de puertas y computadoras digitales
batería de repuesto
cuando se desconecta la batería del vehículo
s3EENCHUFAENELDADODELENCENDEDORDE EECS5MEM Cable de memoria OBDII de 5'.
cigarrillos
sUtilice junto con un arrancador para conservar las
s&UNCIONACONUNABATERÓADE6PARA
configuraciones electrónicas y los códigos del vehículo
guardar las "memorias" activas durante
mientras la batería del vehículo esté desconectada
cuatro horas continuas
s#ONVIERTECUALQUIERARRANCADORCONPUERTODE6
s5TILICE9!CONPRODUCTOS#HRYSLER
en una fuente de energía para memoria
YA961 Fuente de energía para
s#ONECTORDEINTERFAZENTREELARRANCADORYELPUERTO
memoria de computadora.
OBD II del vehículo
s&UNCIONAENFORMASIMILARA9!EXCEPTO
s%VITALAPÏRDIDADEMEMORIAELECTRØNICACUANDOSE
que la fuente de alimentación es de 120 VCA
desconecta la batería del vehículo
s3IRVEPARATODOSLOSVEHÓCULOS
sEl LED confirma si se conectó correctamente al puerto OBD II
>m]fl]k\]]f]j_YhYjY
e]egjaYk\][gehmlY\gjYk
FZ4B
@]jjYea]flYkhYjYj]klYZd][]j
dYdmr\]k]jna[ag'YajZY_
YAGM1 Herramienta para liberar
la airbag.
s,AHERRAMIENTALIBERARÉENFORMA
rápida y fácil los resortes de retención
para extraer el módulo SIR en ciertos
vehículos GM de último modelo
s,ASAPLICACIONESINCLUYENMINIVANSY
camiones Cadillac, Buick Park Avenue,
Pontiac Grand Am
@]jjYea]flYk]d[lja[Yk
YA9811
GMSTB25
FZ7A
@]jjYea]flYkhYjY^mkaZd]k
@]jjYea]flYkhYjY]dafl]jjmhlgjemdla^mf[af\]?E
FZ4B Pinzas para fusibles. Las pinzas Delrin extraen fusibles
de hasta 15/16" de diámetro. Un gancho de 1/8" en la empuñadura
extrae fusibles cortos. Las pinzas son altamente aislantes y
resistentes al aceite, al agua y a las temperaturas de hasta 300°F.
Posee topes manuales para evitar el deslizamiento.
FZ7A Pinzas para fusibles. Las pinzas de nilón extraen
cables de alta tensión y fusibles de cartucho de 15/16" hasta 1"
de diámetro. Posee ganchos en las empuñaduras y mordazas. Las
pinzas son altamente aislantes y resistentes al aceite, al agua y a las
temperaturas de hasta 300°F. Posee topes manuales para evitar el
deslizamiento.
YA9811 Pinza para relés y fusibles. Retira/instala conectores
de relés y fusibles. Diseñada para acceder a áreas restringidas.
El diseño de unión deslizable permite usarla en una variedad de
tamaños. La punta revestida agarra firmemente el borde del relé o
fusible. Acabado industrial negro con empuñaduras rojas de agarre
acolchonado. 8" de largo.
GMSTB25 Herramienta para el interruptor
multifunción de GM. Reduce el tiempo que lleva reemplazar
el interruptor multifunción (interruptor de señal de giro/graduación
de luz/limpiaparabrisas). La herramienta cuenta con una llave de
broca de 1/4" de bajo perfil con una broca T25 Ball Torx® que
permite tener un mejor control y llegar a áreas restringidas. Retire/
instale con facilidad el interruptor multifunción de los vehículos
GM. Permite instalar y retirar el interruptor multifunción sin tener
que sacar la airbag, el volante ni el resorte del reloj. La acción de
trinquete reversible facilita el ajuste/afloje. Tratamiento térmico para
mayor resistencia y durabilidad. Enchapado en cromo para una mejor
apariencia y mayor resistencia al desgaste. La retención magnética
de brocas permite reemplazar las brocas fácilmente. Visite www.
snapon.com para obtener una lista completa de las aplicaciones.
GA500A Herramienta para terminal de cables–Blue-Point®.
Remueve los cables planos y redondos de los bloques de terminales sin
dañarlos. Las 6 estaciones se ajustan a casi todos los tamaños.
YA500GM Herramienta para terminal de cables. Para
servicios en conectores de cable en vehículos de GM y la mayoría de
los productos AMC controlados por computadora.
YA13120 Separador de conectores eléctricos. Desconecta
los conectores eléctricos sin dañarlos. Extremo doble para adecuarse a
los distintos ángulos de acceso. Fácil de utilizar. Sólo enganche la punta
de la herramienta detrás del gancho del conector y tire o empuje para
desconectar. Funciona en juego de protección contra la intemperie y en
otros conectores eléctricos de automóviles.
ADVERTENCIA
@]jjYea]flYkhYjYl]jeafYd]k
YA500GM
GA500A
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
YA13120
419
SISTEMAS DE COMBUSTIBLE Y MOTOR
Herramientas eléctricas
SGTT106A
TT600
Herramientas para terminales
TT12KT
TT600 Juego de herramientas para terminal. Incluye
6 herramientas para remover terminales de los bloques de arneses: soporte
del pasador, sonda cuadrada, sonda de cuña, sonda cilíndrica, sonda plana,
y sonda con gancho. Las herramientas se entregan en una bolsa de vinilo.
TT12KT Juego de herramientas para terminales de cable /
GM C3. Las aplicaciones incluyen la mayoría de los GM y otros terminales
y conectores de computadoras nacionales. Empuñaduras individuales para
un fácil acceso a lugares difíciles. Diseñado para terminales para intemperie
y pack-con con una hoja plana para abrir los conectores y horquilla para
conectores ALDL para acceder a los códigos de desperfectos. Codificado
por color: Empuñadura roja para GM y verde para las herramientas para
terminales de cable. Incluye caja de almacenamiento moldeada.
TT1201 Herramienta para terminales de 3.3 mm X 28 mm
TT1202 herramienta cuadrada para terminales, 1.4 mm X 28 mm
TT1203 herramienta plana para terminales, 1.5 mm X 24.75 mm
TT1204 herramienta plana para terminales, 2.0 mm X 22 mm
TT1205 Herramienta tipo horquilla para terminales, 8.0 mm X 24 mm
TT1206 destornillador plano de 3/16 pulg. X 1.0 pulg.
TT1207 herramienta tubular para terminales, 3.3 mm X 28 mm
TT1208 herramienta tubular para terminales, 4.3 mm X 13 mm
TT1209 herramienta tubular para terminales, 3.75 mm X 13 mm
TT1210 terminal tubular de 3 mm X 13 mm
TT1211 herramienta de 2 hojas planas para terminal, 3 mm
TT1212 herramienta de 2 hojas planas para terminal, 1.6 mm
TT1213 caja moldeada neumáticamente
El juego incluye estas herramientas
terminales de cables (empuñadura
para terminales del sistema C3 GM
verde):tubular, 3.30 x 28.0 mm
(empuñadura roja):
tubular, 4.30 x 13.0 mm tubular,
tubular, cargada con resorte, 3.3 x 28 3.75 x 13.0 mm tubular, 3.00 x
mm hoja cuadrada, 1.4 x 19.00 mm 13.0 mm hoja plana doble, 3.0
hoja plana, 1.5 x 24.75 mmhoja plana, mm hoja plana doble, 1.6 mm
2.0 x 23.00 mm hoja tipo horquilla,
8.0 x 24.00 mm destornillador de
hoja plana,3/16" x 1.00" El juego
incluye estas herramientas para
GOFER1A
GOFER4A
Herramientas para instalar cables
GOFER1A Herramienta para instalar cables. Diseñada para
instalar cables con rapidez en sistemas de estéreos, sistemas de alarmas,
teléfonos celulares, mangueras de vacío y línea de suministro de aire de los
amortiguadores. Una boquilla de forma cónica retiene el cable cuando se
enroscan los cables. Tirará o empujará los cables a través de las aberturas.
GOFER4A Cintas de sostén. Cintas de sostén sujetadoras de
Velcro® de 1/2" de ancho por 8" de largo. Se usa para organizar y colgar
herramientas en el taller o para separar o retener mangueras o cables
durante el servicio del motor. También es útil para separar el cableado
durante la prueba, para sostener juntos el osciloscopio y el cable del
medidor, o para un gran número de otras aplicaciones. Se incluyen
12 cintas de 8 colores diferentes.
420
SGTT110
Herramientas de agarre blando para terminales
Remueve fácilmente los terminales de los conectores eléctricos que
se encuentran en los vehículos nacionales (E.E. U.U.) e importados de
mediados de los '90 y posteriores. Las herramientas para terminales
incorporan un diseño de acero inoxidable con empuñaduras de
“agarre blando” ergonómicas.
SGTT1A Herramienta de agarre blando para
terminales. Utilice en PCM y arneses de transmisión de Chrysler,
Hyundai, Kia y Mitsubishi. 4 13/16" de largo.
SGTT2A Herramienta de agarre blando para terminales.
Tiene una hoja estrecha sólida con punto de apoyo para un acceso más
fácil a las lengüetas de liberación que se encuentran en los bloques de
terminales más modernos. Herramienta de liberación de uso general
para vehículos nacionales e importados. 5 1/8" de largo.
SGTT3A Herramienta de agarre blando para
terminales. Para usar en sensores que se encuentran debajo del
capó, tales como los sensores de temperatura del líquido refrigerante
y de posición del reductor. Para utilizar en Ford, GM (incluyendo
Cadillac), Chrysler, Mitsubishi y Hyundai. 4 13/16" de largo.
SGTT4A Herramienta de agarre blando para
terminales. Para abrir arneses de cable y lograr un fácil acceso a
las aplicaciones de localización de desperfectos y reemplazo. Sigue
fácilmente el revestimiento de la ranura del arnés sin perforar los
cables internos. 4 3/8" de largo.
SGTT5A Herramienta de agarre blando para terminales.
Para usar en ECU ABS de 55 pines en Ford, GM, Jaguar, Jeep, Volvo,
VW, BMW, Hyundai, Kia y Mercedes. 4 13/16" de largo.
SGTT6A Herramienta de agarre blando para terminales.
Para usar en ECU ABS de 35 pines en Audi, BMW, Chrysler, Ford, GM,
Infiniti, Isuzu, Jaguar, Mazda, Mercedes, Mitsubishi, Nissan, Porsche,
Subaru, Saab, Volvo y VW. 4 13/16" de largo.
SGTT7 Herramienta de agarre blando para terminales.
Aplicaciones: Módulos de control del tren de potencia (PCM) en Acura,
Audi, Chrysler, Ford, Hyundai, Jaguar, Kia, Mercedes, Mazda, Toyota y
Volkswagen. 4 27/32" de largo.
SGTT8 Herramienta de agarre blando para terminales.
Aplicaciones: Módulos de control del tren de potencia (PCM) Acura,
Audi, Buick, Chrysler, Ford, GM, Honda, Jaguar, Mercedes, Mazda,
Toyota y Volkswagen. 4 27/32" de largo.
SGTT9 Herramienta de agarre blando para terminales.
Aplicaciones: Módulos de control del tren de potencia (PCM) en Acura,
Audi, Chrysler, Jaguar, Hyundai, Kai, Mercedes, Toyota y Volkswagen.
4 27/32" de largo.
SGTT10 Herramienta de agarre blando para terminales.
Aplicaciones: Ganchos de conectores abiertos y flancos de ganchos en
Acura, Audi, Chrysler, Honda, Mercedes y Volkswagen. 4 27/32" de largo.
SGTT106A Juego de herramientas de agarre blando para
terminales. Incluye de SGTT1A a SGTT6A (6 piezas) en bolsa de juego.
SGTT110 Juego de herramientas de agarre blando
para terminales. Se incluye de SGTT1A a SGTT10 (10 pzas.) en
bandeja de almacenamiento.
www.snapon.com/shoptools
SISTEMAS DE COMBUSTIBLE Y MOTOR
Bm]_gk\][YdaZjY\gj]k\][gehj]kafqY\YhlY\gj]k
MT308M
EEPV303B
Bm]_gk\][YdaZjY\gj]k\][gehj]kaf
s$ESTINADOALUSOENMOTORESAGASOLINACONENCENDIDOPORCHISPAS
QUENOEXCEDENPSIDECOMPRESIØN
s5TILIZAADAPTADORESDEMANGUERAQUESEENROSCANENELHUECODEBUJÓAY
SECONECTANENELACOPLADORRÉPIDODELAMANGUERADELCALIBRADOR
s-ANTIENELALECTURADEPRUEBADECOMPRESIØNMÉSALTAYSEREINICIA
ENCEROCONUNAVÉLVULADEDESCARGACONBOTØNPULSADOR
s%LCALIBRADORMUESTRALAPRESIØNDELCILINDROINDIVIDUAL
s2ANGODEPRUEBAPSIK0AENINCREMENTOSDE
PSIK0A
9\YhlY\gj]k\][YdaZjY\gj]k\][gehj]kaf
MT308M Juego de calibrador de compresión.
s0RUEBAAUTOSYCAMIONESÞLTIMOMODELOCONABERTURASDEBUJÓASDE
DIFÓCILACCESO
s%LCONJUNTODELCALIBRADORINCLUYEUNMANØMETRODEDE
DIÉMETROYUNAMANGUERAFLEXIBLEDECONACOPLADORRÉPIDO
EEPV303B Juego de calibrador de compresión para
motocicletas.
s0RUEBAMOTOCICLETASYVEHÓCULOSRECREATIVOSCONABERTURASDEBUJÓAS
DEDIFÓCILACCESO
s%LCONJUNTODELCALIBRADORINCLUYEUNCALIBRADORDEDEDIÉMETRO
YUNAMANGUERAFLEXIBLEDECONUNACOPLADORRÉPIDO
sDELARGOAMENOSQUESEINDIQUELOCONTRARIO
s!DAPTADORDEALCANCEESTÉNDARTANTOPARAASIENTOSCONAGUJEROS
PARABUJÓASPLANOSCOMOAHUSADOSELLARGOALCANCESEUSAPARAEL
SERVICIODEMOTORESDEMOTOCICLETAS
EEPV305A
EEPV305A Adaptador
de calibrador de
compresión.
t!LCANCELARGO-XDE
INCLINACIØN
MT26J200R
MT26J200R Adaptador de
calibrador de compresión.
t!LCANCELARGO-XDE
INCLINACIØN
MT26J300R
MT26J400
MT26J300R Adaptador
MT26J400 Adaptador de
de calibrador de
calibrador de compresión.
compresión.
t!LCANCEESTÉNDAR-XDE
t!LCANCELARGO-XDE
INCLINACIØN
INCLINACIØN
EAK0259L02A
EEPV306A
EAK0259L02A Adaptador EEPV306A Adaptador
de calibrador de
de calibrador de
compresión.
compresión.
t!LCANCELARGO-XDE t!LCANCELARGO-XDE
INCLINACIØNPARAMOTORES
INCLINACIØN
4RITON©DE,&ORD
sDELONGITUD
;YdaZjY\gj\][gehj]kaflahg[fa[g
MT27C Calibrador de compresión tipo cónico.
t%LCUADRANTETIENEUNAESCALADEAPSIENINCREMENTOS
DEPSIAK0AENINCREMENTOSDEK0AYESTÉ
ESPECIALMENTEDISE×ADOPARALOS67DELTIPO)
s%LVÉSTAGOCOMPENSADOELIMINALOSPROBLEMASPORACCESOLIMITADO
s,AVÉLVULADEVERIFICACIØNESTÉUBICADAENLAPARTEINFERIORDELA
UNIDADPARAEVITARINTERFERENCIASCONLASPLANCHASDEMETAL
DEENFRIAMIENTO
MT27BR Juego de servicio.
t)NCLUIDOCONELCALIBRADOR-4#
s#ONTIENEPUNTACØNICAVÉLVULAYANILLODESELLADOENBOLSA
DECORDONES
ADVERTENCIA
EEPV304A
EEPV304A Adaptador de
calibrador de compresión.
t!LCANCEESTÉNDAR-XDE
INCLINACIØN
EEPV307A
EEPV307A Adaptador de
calibrador de compresión.
s3EAPLICAPRINCIPALMENTEENLOS
MOTORES4RITONDE&ORDSEGUNDA
GENERACIØNMODELOY
POSTERIORES
s0RUEBALACOMPRESIØNDELCILINDRO
DEHASTAPSI
s,ASAPLICACIONESADICIONALES
INCLUYEN-ERCEDESLAMAYORÓA
DEMODELOS6YALGUNOS6MÉS
NUEVOSQUELOSMODELOS
.ISSAN,YPOSTERIORES
MÉS4OYOTA3CION,Y
POSTERIORES
MT27C
Fg]phgf_Y]d[geZmklaZd]YddYeYk$[`akhYkmgljYk^m]fl]k\]]f[]f\a\g
Mk]kdg]f~j]YkZa]fn]fladY\YkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
421
SISTEMAS DE COMBUSTIBLE Y MOTOR
Compresión diesel
MT33C Calibrador de
compresión diesel.
tEl cuadrante tiene una escala de
9 a 800 psi y de 0 a 5,500 kPa
sEl calibrador incluye manguera de
18" con válvula de descarga
Adaptadores de compresión Tipo inyector
M3540A
M3543A
M3542A
M3571
M3572
M3574
M3584
M3585
MT33C
EEPV313A Adaptador de calibrador de compresión diesel.
tPara motores diesel Cummins 24 válvulas de 5.9L más Cummins
ISB y ISBE de 5.9L para Dodge, modelos 1998 a 2002
M3540A Adaptador de compresión.
tPara motores diesel Cummins de 855 pulg. cúb. y NH 903 V8 y L10
M3543A Adaptador de calibrador de compresión diesel.
tPara motores diesel Detroit 53, 71, 92 y 8.2L
M3542A Adaptador de calibrador de compresión diesel.
tPara motores diesel Volkswagen, Mercedes Benz, Volvo y Audi 5000
de M24 x 2.0
M3571 Adaptador de calibrador de compresión diesel.
tPara inyectores de 21 mm e inyectores tipo Bosch en los siguientes
motores diesel: Allis Chalmers 433, 649 y 670, Allis/Fiat de
3 cilindros, John Deere 404, 466, 531 y 619, Navistar 361 y 407,
Perkins 4,203, 4,236, 4,248, 6,354 y 8,540, Wisconsin Engine 340,
350, 430, 660, 670, 750, 860 y 1000, White Engine D2000, D2300,
D3000, D3400 y D4800, Mack 673, 674, 675, 864, 865 y 866,
motores diesel Waukesha, motores diesel de tractores Ford, Scania
DN11 y DS11
M3572 Adaptador de calibrador de compresión
diesel.
tPara inyectores tipo lápiz en los siguientes motores diesel: Serie
Caterpillar 3208 y 1100, Serie Case 70, 188 y 207, los primeros
John Deere de la serie 300, 400 y 500, 276, 404 y 531
M3574 Adaptador de calibrador de compresión
diesel.
tPara inyectores de 17 mm en motores diesel de Navistar DT466 y
9L, 312, 360, 414, 436 y 446
M3584 Adaptador de compresión.
tPara motores diesel Case/Cummins serie “B” de 2.9L, 3.9L y 5.9L
M3585 Adaptador de compresión.
tPara motores diesel Case/Cummins serie “C” de 8.3L
M3569
EEPV317A
EEPV315A
EEPV314A
EEPV312A
M3545B
EEPV313A
M3570
M3565A
M3564
M3566
M3576
Adaptadores de compresión - Estilo bujía incandescente
sTodos los adaptadores tipo bujía incandescente, serie “M”, más el
adaptador EEPV312A requieren el uso del acoplador rápido M3569
o M3570
sEEPV314A, EEPV315A y EEPV317A no requieren el uso de un
acoplador rápido
EEPV312A Adaptador de compresión de bujía incandescente.
tPara motores diesel GM Duramax 6600 e Isuzu de 6.6L
EEPV314A Adaptador de compresión de bujía incandescente.
tPara motores diesel Powerstroke de 7.3L de Ford/Navistar
EEPV315A Adaptador de compresión de bujía incandescente.
tPara motores diesel de 1.9L TDI de Volkswagen
EEPV317A Adaptador de compresión de bujía incandescente.
tPara motores Ford Powerstroke de 6.0L y Navistar/International de
6.0L VT365E con una bujía incandescente de 14M x 1.25
M3545B Adaptador de compresión de bujía incandescente.
tPara motores diesel GM de 4.3L y 5.7L más Navistar de 6.9L y 7.3L
sEl núcleo de la válvula de reemplazo es M3545A4
sSe debe usar junto con el calibrador de compresión MT33C y los
acopladores rápidos M3569 o M3570
Estilo bujía incandescente
422
M3569 Acoplador rápido.
tCompensado a 45°
M3570 Acoplador rápido.
tCompensado a 90°
M3564 Adaptador de compresión de bujía incandescente.
tPara motores diesel GM de 6.2L y 6.5L
M3565A Adaptador de compresión de bujía incandescente.
tPara motores diesel Isuzu de 1.8L y 2.2L y Toyota de 1.8L
M3566 Adaptador de compresión de bujía
incandescente.
tPara motores diesel Toyota y Nissan de 2.2L, más motores diesel
Mitsubishi de 2 y 3 cilindros
M3576 Adaptador de compresión de bujía incandescente.
tPara motores BMW de 2.4L usados en Lincoln de 1984 y 1985, en
los modelos Mark VII y Continental; motores de Peugeot 1978 a 1984
de 2.0L y 2.3L; motores VW, Audi y Volvo de 1.5L, 1.6L, 2.0L y 2.6L
Adaptadores
Pieza No.
Rosca
EEPV312A
EEPV314A
EEPV315A
M3545B
M3564
M3565A
M3566
M3576
M3577
M10 X 1.25
M10 X 1.0
M10 X 1.0
M10 X 1.0
M10 X 1.0
M10 X 1.25
M10 X 1.25
M12 X 1.25
M10 X 1.25
A pulgadas
(mm)
4.12 (104.65)
3.33 (84.58)
2.05 (52.07)
1.78 (45.20)
2.46 (62.48)
2.50 (63.50)
1.96 (49.78)
1.77 (44.95)
2.19 (55.62)
www.snapon.com/shoptools
B pulgadas
(mm)
3.00 (76.20)
2.78 (70.61)
1.50 (38.10)
1.06 (26.92)
.79 (20.00)
1.61 (26.92)
1.27 (32.26)
1.08 (27.43)
1.50 (38.10)
Cpulgadas D pulgadas
(mm)
(mm)
2.50 (63.50) .320 (8.13)
2.31 (58.67) .315 (8.00)
1.03 (26.16) .315 (8.00)
.38 (9.65)
.385 (9.77)
.25 (6.35)
.325 (8.25)
.866 (21.99) .320 (8.13)
.39 (9.14)
.315 (8.00)
.300 (7.62) .305 (7.75)
.59 (14.98) .317 (8.05)
E (Hex.)
12 mm
10 mm
10 mm
3/8 pulg.
3/8 pulg.
12 mm
12 mm
12 mm
12 mm
SISTEMAS DE COMBUSTIBLE Y MOTOR
;YdaZjY\gjq[gehjgZY\gj\]]k[Yh]\][adaf\jg'nY[g]feglgj
EEPV309A
EEPV309A Comprobador de fugas de cilindro.
t Para usar en todos los motores nacionales e importados
s El manómetro de entrada muestra la presión de aire de entrada
para una adecuada configuración de la prueba de fugas del cilindro
y para resultados precisos
s El rango del manómetro es de 0-100 psi (0-700 kPa) en
incrementos de 2 psi (20 kPa)
s El calibrador de fugas del cilindro muestra la fuga como un
porcentaje de presión de entrada con distinción de tres zonas: alta,
moderada y baja
EEPV311A Juego de manómetro de
presión de vacío.
s Para casi todas las necesidades básicas de
comprobación de presión de vacío en el taller
s Realiza pruebas de vacío en motores de
gasolina y pruebas de presión de escapes
traseros en aplicaciones con sensor
de oxígeno
s Prueba los accesorios de vacío y los
dispositivos de control de emisión, tales
como los sistemas de purga de cilindros
de válvulas EGR, interruptores de aire y
válvulas derivadoras, válvulas de retardo
y verificación de vacío, controles de aire
acondicionado y de calefacción y sistemas
de control de crucero
s La cara del calibrador es multicolor con escalas
de pulg., Hg., psi, kPa negativo y positivo
EEPV308A
MT37A
EEPV308A Juego de manómetro para transmisión automática.
t Para usar en todos los vehículos de los principales fabricantes
nacionales e importados
t El juego incluye dos conjuntos de manómetros para rangos de
alta y baja presión, más 9 adaptadores para probar diferentes
transmisiones automáticas
t Se incluyen cuatro accesorios especiales para conectar los puertos de
pruebas de difícil acceso en áreas que requieren de ángulos de 45˚ ó 90˚.
El conjunto de manómetro de alta presión (presión superior a 0-500 psi/03,500 kPa protegida hasta 1,500 psi) incluye un manómetro de 3 1/2" de
diámetro y una manguera flexible de 10" con acople para líquidos
t El conjunto de manómetro de baja presión (0-100 psi) incluye un
manómetro de 2 1/2" de diámetro y una manguera de 6' flexible con
acople para líquidos
YA4000B Juego de comprobación automotriz–Blue-Point®
s'ENERAVACÓOOPRESIØNALGIRARUNINTERRUPTOR
s$ISE×OERGONØMICOCØMODO
s,IBERACIØNDEVACÓOPRESIØNMEDIANTEDISPAROCONUNDEDO
s#ALIBRADORDEPRESIØNVACÓODELTIPODIAFRAGMADURADEROYPRECISO
Incluye:
sBomba de vacío/presión portátil con calibrador compuesto de 2" y
capuchón de goma
sBotella de líquidos de 12 onzas con tapas de transferencia y
almacenamiento de líquidos más un tubo de aspiración de líquidos
sSeis adaptadores ahusados para conectar tubos de 0.09" a 1/2" de
$)ADAPTADORDECOPAGOMA
s$OSTAPONESDEMÞLTIPLEAHUSADOS
s$OSADAPTADORESDETORNILLOSDEPURGAUNIVERSALES
sENCHUFESDETAPØNDEVACÓOADAPTADOR4DELÓNEADEVACÓO
s$OSTUBOSDECONEXIØNDE$)XDELARGOCONCONECTORDE
cambio rápido
s!DAPTADORDETUBODE$)X$)
s4UBODEPRUEBADEVACÓODE$)XDELARGO
s*UEGODERECARGADECILINDROMAESTRO
SVT270P Bomba de vacío y calibrador.
tEl calibrador tiene una escala de mercurio de 0 a 30" (0 a 76 cm)
s#ONSTRUCCIØNDEALUMINIOCONMANGODEPISTOLAPARARETROCESOPARA
operación con una sola mano
s3EENGANCHADIRECTAMENTEENLAUNIDADQUESEESTÉPROBANDOO
con uno de sus adaptadores
s#AJADEALMACENAMIENTO3640
ADVERTENCIA
EEPV311A
MT37A Juego de manómetro de aceite.
t Para usar en motores diesel y a gasolina
t Incluye adaptadores estándar y métricos para la mayoría de los
motores de autos, camiones, tractores y vehículos familiares
nacionales e importados
t Cuenta con manómetro brillante de fácil lectura con bota de protección verde
s)NCLUYE#ONJUNTODEMANØMETRODEPSIK0A
Conjunto de
adaptador de manguera (1/8-27 a M12 x 1.5)
Adaptador (1/8-27 a 1/4-18)
Adaptador (1/8-27 a M14 x 1.5)
Adaptador (1/8-27 a 3/8-18)
Codo macho-hembra
Adaptador (1/8-27 a 1/8-28 BSPT) Manguito grande de 2"
Adaptador (1/8-27 a M10 x 1.0) Acople
:geZYk\]nY[gq[gehjgZY\gj]k
YA4000B
Aplicaciones:
s!FINACIONESYDIAGNØSTICOSDEDESEMPE×ODELMOTORRELACIONADO
con el vacío la presión
s0URGADEFRENOS
s4RANSFERENCIAEVACUACIØNYMUESTRARIODELÓQUIDOS
SVT270P
Fg]phgf_Y]d[geZmklaZd]YddYeYk$[`akhYkmgljYk^m]fl]k\]]f[]f\a\g
Mk]kdg]f~j]YkZa]fn]fladY\YkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
423
SISTEMAS DE COMBUSTIBLE Y MOTOR
Inyección de combustible
EEFI500
EEFI500CORE
EEFI50030
Juegos de adaptadores serie EEFI
EEFI500 Juego maestro de manómetro para inyección de combustible.
s0RUEBALAPRESIØNDEINYECCIØNDECOMBUSTIBLEENIMPORTANTESSISTEMASDE
COMBUSTIBLEDEMÞLTIPLESPUERTOSDEMODELOSDE%%55%UROPAY!SIA
s5NACONVENIENTEETIQUETAMUESTRALAIMAGENDELOSCOMPONENTESLOSNÞMEROSDE
PIEZAYLASAPLICACIONESPARASURÉPIDAYFÉCILIDENTIFICACIØNYALMACENAMIENTO
s%LMANUALDELUSUARIOINCLUYEILUSTRACIONESDELASCONEXIONESDEPRUEBAYTABLAS
DEAPLICACIONES
s#ONTIENEUNCOLECTOREN4CONVÉLVULADECIERREUNCONJUNTODECALIBRADORDE
DEDIÉMETROCONVÉLVULADEPURGAYLOSADAPTADORESNECESARIOSPARAPROBARLAMAYORÓA
DELOSSISTEMASDEINYECCIØNDECOMBUSTIBLE
s,ACAJACONTAPAREMOVIBLEPERMITEUNALMACENAMIENTOCONVENIENTEENCAJONESDE
DEPROFUNDIDADPARATENERFÉCILACCESO
s)NCLUYE%%&)#/2%Y%%&)!$$
EEFI500CORE Juego central de manómetro para inyección de combustible.
s0ARANECESIDADESDESERVICIOBÉSICODEPRESIØNDEINYECCIØNDECOMBUSTIBLE
s,OSCOMPONENTESINDIVIDUALESOELJUEGO%%&)!$$PUEDENADQUIRIRSEPARA
COMPLETARELJUEGOMAESTRO
s)NCLUYE
%%&)CALIBRADORYCONJUNTODEMANGUERACONVÉLVULADEPURGA
%%&)CONJUNTODEMANGUERAESTÉNDARTIPO3CHRADER#HRYSLER'--"
0ORSCHE3AABY3ATURN
%%&)#ONJUNTODEMANGUERAPEQUE×OTIPO3CHRADER"-7&ORD*AGUAR+IA
,INCOLN-AZDA-ERCURY-INI6OLVOY67
%%&)ADAPTADORESTÉNDARENÉNGULORECTOTIPO3CHRADER#HRYSLER'--"
0ORSCHE3AABY3ATURN
-%%&)ADAPTADORPEQUE×OENÉNGULORECTOTIPO3CHRADER"-7&ORD*AGUAR+IA
,INCOLN-AZDA-ERCURY-INI67Y6OLVO
-%%&)ADAPTADOREN4CONMANGUERASDEYDEDIÉMETROY
ABRAZADERAS#HRYSLER)NFINITI)SUZU-AZDA.ISSAN3ATURNY3UZUKI
%%&)MANGUERASYABRAZADERASDEREEMPLAZO%%&)JUEGODESERVICIODE
REPUESTOSPARA%%&)A%%&)
EEFI500ADD Juego
s#OMBINALOSCOMPONENTESDELJUEGO%%&)!$$CONELJUEGO%%&)#/2%PARA
FORMARELJUEGOMAESTRODEMANØMETROPARAINYECCIØNDECOMBUSTIBLE%%&)
EEFI50030 Adaptador universal de presión de combustible.
s0ERMITEQUELOSPROPIETARIOSDELOSMANØMETROSDECOMBUSTIBLEDELASERIE-4
%%&)Y%%&)AUMENTENLASAPLICACIONESALUTILIZARLOSCOMPONENTESDELJUEGO
MAESTRODEPRESIØNPARAINYECCIØNDECOMBUSTIBLE%%&)
Pieza No.
Descripción
EEFI5008
EEFI5009
EEFI50010
EEFI50011
EEFI50012
EEFI50013
EEFI50014
EEFI50015
EEFI50016
EEFI50017
EEFI50018
EEFI50019
EEFI50020
EEFI50021
EEFI50022
EEFI50023
EEFI50024
EEFI50025
EEFI50026
Conjunto de mangueras en T - Conector rápido de 3/8
Conector rápido doble macho de 3/8 - GM
Acople de traba macho de 5/8 - Ford, Mazda
Acople de traba hembra de 5/8 - Ford, Mazda
Conector rápido macho de 5/16 - Acura, Chrysler, Ford, Mazda, Toyota
Conector rápido hembra de 5/16 - Acura, Chrysler, Ford, Mazda, Toyota
Adaptador de manguera macho de 5/16 - BMW, Chrysler, Infiniti, Nissan, VW
Adaptador de manguera de 5/16 - BMW, Chrysler, Infiniti, Nissan, VW
Macho abocardado invertido M14 x 1.5- Geo, Infiniti, Toyota
Hembra abocardado invertido M14 x 1.5- Geo, Infiniti, Toyota
De asiento de bola hembra M14 x 1.5 - Audi, Hyundai, Jaguar, Land Rover, Porsche, Volvo, VW
De asiento de bola macho M14 x 1.5 - Audi, Hyundai, Jaguar, Land Rover, Porsche, Volvo, VW
Adaptador de anillo "O" de 16 mm- Hyundai, Mitsubishi
Adaptador de anillo "O" de 11 mm- Infiniti, Kia, Mitsubishi, Nissan
Adaptador de pulso para amortiguador M12 x 1.0- Acura, Honda
Adaptador de perno tipo banjo M12 x 1.5- Audi, Porsche, Saab
Adaptador de perno tipo banjo M12 x 1.25- Honda, Hyundai, Isuzu, Lexus, Toyota
Adaptador de filtros M6 x 1.0- Acura, Honda
Juego de servicio de repuestos para adaptadores 5009 a 50025
Limpiadores del sistema de combustible de uso general
424
EEFI5CLEANER
EEFI5CLEANER Limpiador del sistema de inyección de combustible.
s,IMPIALOSDEPØSITOSDELOSINYECTORESDECOMBUSTIBLEELRIELDECOMBUSTIBLEYLAS
VÉLVULASDEENTRADAPARARESTAURARELRENDIMIENTODELMOTORDISMINUIRLASEMISIONESY
RESTAURARLASUAVIDADDELAMARCHAENVACÓO
s%LLIMPIADORESTILOCILINDROACEPTAELLIMPIADORPREFERIDOOREQUERIDOPARASISTEMASDE
INYECCIØNDECOMBUSTIBLESEVENDEPORSEPARADO
s6ERIFIQUELAPRESIØNDECOMBUSTIBLEDELVEHÓCULOCONUNMANØMETRODERECHOY
ESTABLEZCAFÉCILMENTELAPRESIØNDELIMPIEZACONELMANØMETROIZQUIERDO
s,AMANGUERATRENZADADEACEROINOXIDABLE4EFLON®ESRESISTENTEALOSSOLVENTES
s3ECUELGACONVENIENTEMENTEDEBAJODELCAPØCONUNACADENACENTRAL
s%SCOMPATIBLECONLOSADAPTADORESDELASERIE%%&)QUESEVENDENPORSEPARADO
s#ONSULTEELMANUALDELUSUARIOPARAOBTENERMÉSDETALLESSOBRELAFABRICACIØNDELVEHÓCULO
www.snapon.com/shoptools
SISTEMAS DE COMBUSTIBLE Y MOTOR
Kakl]eYk\][geZmklaZd]
@]jjYea]flYk\]k]jna[agk]kh][aYd]k
YA76462
FIH500
FIH500 Herramienta de desconexión del módulo de
combustible.
tHerramienta de desconexión del módulo de combustible GM para
vehículos GM modelo 1998 y posteriores. Camionetas grandes,
Suburbans y Tahoes
s%LDISE×ODEDOSPIEZASPERMITEUNFÉCILACCESOALOSCONECTORES
sColoque el extremo adecuado en el conector, rote y agregue la otra
mitad para desconectar el módulo
s3EAJUSTAALOSTAMA×OSDECONECTORDEY
s,OSSEGMENTOSDELAHERRAMIENTASEPUEDENENGANCHARPARAUN
ALMACENAMIENTOMÉSPRÉCTICO
SOPORTE TÉCNICO
YA76462 Sonda universal rápida de inyección de
combustible electrónica (EFI).
s$ETECTARÉPIDAMENTELASFUNCIONESDELINYECTORDECOMBUSTIBLE
electrónico en cualquier motor de gasolina o diesel
s %SPECÓFICAMENTEDISE×ADOPARADETECTARVIBRACIONESEMITIDASCUANDO
el inyector electrónico se enciende
s No es necesario buscar alambres del inyector para probarlo en el conector
s No es necesario extraer el inyector para probarlo
s INCLUYEESTROBOSCOPIOCON,%$BRILLANTEPUNTADESONDAREMOVIBLEDE
GUÓADELUSUARIOOPERACIØNDEBATERÓAYRUEDAPARAPULGARSENSIBLE
1-800-342-5080
;YjZmjY\gj
@]jjYea]flYkhYjYYbmkl]\]d[YjZmjY\gj
2006IT Juego para ajuste del carburador.
Incluye: 3%3%34-4-!4-
TM64
TM65
2006IT
TM615
S6137E Destornillador de cabeza hexagonal para
ajuste en vacío.
s0ARA#HRYSLERDEYPOSTERIORES
s%LMANGOHEXAGONALDEESDEDELARGO
s$ADOCONACABADODENÓQUELCROMO
sDE$%
s"ROCADEACABADOINDUSTRIALCONCUADRODE
S6138E Mango para ajuste en vacío.
S6137E
s0ARACARBURADORESDERETROALIMENTACIØN&ORD
s$%DE
s#UADRODE
s,ABROCATIENEUNAPUNTAPLANADEX
DEDELARGO
s$ADOCONACABADODENÓQUELCROMOBROCADE
S6138E
acabado industrial
S6139 Dado “D” doble paraajuste del carburador.
s4ORNILLODEAJUSTEENVACÓOPARA'sMMDELARGODELPLANODEYPOSTERIORES
s#UADRODE
s%L$%DELEXTREMODELCUADROESDE
sDELARGO s!CABADODENÓQUELCROMO
TM64 Herramienta de ajuste rígida.
S6139
s#ONCODORÓGIDOENLUGARDELACARACTERÓSTICAFLEXIBLE
s3EUTILIZACONMANGOSDECARBURADORPARAHACERLOSAJUSTESDEL
carburador y puesta a punto
s%JERÓGIDO
s,ARGOTOTALDECUADRODE
TM65 Herramienta de ajuste flexible.
s%XTREMODEVÉSTAGOFLEXIBLEPARATRABAJARENÉREASRESTRINGIDAS
s,ARGOTOTALDECUADRODE
s)DEALPARATRABAJARENESPACIOSESTRECHOS cuando se reparan
distribuidores tipo ventana
s,ASMARCASDELAPERILLALE
permiten contar los giros
TM615 Mango flexible.
s#UADRODE
s$ISE×ADOPARATRABAJARENELCARBURADOR%STEMANGOTAMBIÏN
permite acceder a distribuidores embutidos
s#UADRODEENELEXTREMODEUNVÉSTAGODEACERODERESORTE
RESISTENTEPEROFLEXIBLE
sDELARGO
s0ARAAPLICACIONESDEBAJOTORQUE
s)DEALPARAACCEDERATORNILLOSDEAJUSTEEMBUTIDOS
s%LLARGODELCABLEESDEELLARGOTOTALESDE
TM83A Destornilladores de hoja retráctil
para carburadores.
s#UADRODE
s0ARAUSARCON4-O4-YOTRASEMPU×ADURASCON
TM83A
CUADROCUADRADODE
s,ASHOJASSERETRAENENLAPAREDEXTERNADELDADOPARAAUTOCENTRARSE
s!CABADODENÓQUELCROMO
s(OJADEX
TM84 Destornillador de hoja retráctil para
carburadores.
s#UADRODE
s0ARAUSARCON4-O4-YOTRASEMPU×ADURASCONCUADRO
TM84
CUADRADODE
s,ASHOJASSERETRAENENLAPAREDEXTERNADELDADOPARAAUTOCENTRARSE
s!CABADODENÓQUELCROMO
s(OJADEX
TM85 Destornillador de hoja retráctil para
carburadores.
s#UADRODE
s0ARAUSARCON4-O4-YOTRASEMPU×ADURASCONCUADRO
TM85
CUADRADODE
s,ASHOJASSERETRAENENLAPAREDEXTERNADELDADOPARAAUTOCENTRARSE
s!CABADODENÓQUELCROMO
s(OJADEXPARAAJUSTARCARBURADORES1UADRAJETÞLTIMOMODELO
TAM3E Mango métrico con cabeza hexagonal.
s5SADOPARAHACERAJUSTESDEMONØXIDODECARBONOEN$ASHER
!UDIY6OLVOHASTA&IATY3AABY
s"ROCADEMMCUADRODE
sDELARGO
TAM3E
s!CABADODENÓQUELCROMO
ACT1370
@]jjYea]flYkhYjYk]jna[ag\]d[YjZmjY\gj
ACT1370 Juego de desconexión.
s3EINCLUYEUNCONVENIENTEORGANIZADORPLÉSTICO
s%SÞTILPARALOSACOPLESDERESORTEDELOSSISTEMASDEAIRE
ACONDICIONADOCOMOASÓTAMBIÏNPARALOSCONECTORESDEEMPUJEY
traba en el radiador y en líneas de transmisión
s)NCLUYEHERRAMIENTASPARADESCONECTARLOSACOPLESDERESORTEEN
LASLÓNEASDEAIREACONDICIONADODE&ORD'-Y#HRYSLER
s4RABAJAENLÓNEASDECOMBUSTIBLEYPUEDEUTILIZARSECOMOCONECTOR
DEEMPUJEDETRABAENRADIADORESYLÓNEASDETRANSMISIØN
s,OSTAMA×OSINCLUIDOSSONY
ADVERTENCIA
GA467
GA467 Extractores de pasador.
s0ARAREMOVEROINSTALARPASADORESDECARBURADORYTRABAJARCON
grampas “C”
s%LGANCHODELEXTRACTORSERETRAEENELBASTIDORCUANDONOESTÉENUSO
sDELARGO
Fgmk]`]jjYea]flYk\]eYfg[jgeY\Ykg\]Y[YZY\gaf\mkljaYd[gf`]jjYea]flYk\]aehY[lg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
425
SISTEMAS DE COMBUSTIBLE Y MOTOR
Sistemas de combustible
Herramientas para entrada de combustible/filtro de
combustible/bomba de combustible
YA997 Llave de filtro de combustible con empuñadura giratoria.
s$ISE×ADAPARAACCEDERAFILTROSDECOMBUSTIBLEDEDIFÓCILACCESO
s3EAJUSTAAFILTROSDECOMBUSTIBLEDEA
FIH940 Herramienta para remover la bomba de
combustible del depósito de combustible.
s%XTRAELOSANILLOSDERETENCIØNPLÉSTICOSDELABOMBADECOMBUSTIBLE
s%LDISE×OAJUSTABLEUNIVERSALSEADAPTAALAMAYORÓADELOSANILLOSDE
RETENCIØNPLÉSTICOS
s%VITAQUESEDA×EELANILLODERETENCIØNORIGINALDELABOMBA
s0ARAUSARCONCUADRODEEXTENSIØNDEYTRINQUETE
s3ELAUTILIZAPARAREINSTALARELANILLODERETENCIØNANTIGUO
YA997
FIH940
FID8838A
Comprobadores del arnés del inyector
FID8838A Juego de comprobadores del arnés del inyector.
s3EENCHUFAALARNÏSDESOLENOIDEPARAIDENTIFICARFALLASENEL
FUNCIONAMIENTODELSISTEMAELÏCTRICOODECOMBUSTIBLE
s)NCLUYECOMPROBADORESYUNAEXTENSIØNDEARNÏSDELINYECTOREN
CAJADEALMACENAMIENTO
FID8320 Comprobador del arnés del inyector.
s0ARAMODELOS'-4")YUSADOSEN
DIVERSOSAUTOSYCAMIONES
FID8329 Comprobador del arnés del inyector.
s0ARAINYECTORES"OSCH0&)UTILIZADOSENDIVERSOSVEHÓCULOS'-&ORD
Y#HRYSLERCON0&)
FID8330 Comprobador del arnés del inyector.
s0ARASISTEMAS&ORD4")
FID8339 Comprobador del arnés del inyector.
s0ARAINYECTORES'--ULTECYLOSINYECTORES“ALIMENTADOSDESDEEL
FONDOvUTILIZADOSENVEHÓCULOS“*vY“,vDE,DECUATROCILINDROS
DEA
FID8340 Comprobador del arnés del inyector.
s0ARAMOTORESDECAMIONES3#0)DE'-DE,6,6Y,
6YPOSTERIORESMÉS,6,6Y,6Y
POSTERIORES
FID9210 Comprobador del arnés del inyector.
t$ISE×ADOPARASISTEMAS'EO4")YPOSTERIORES
FID8838A1 Comprobador del arnés del inyector.
s0ARAINYECTORES'--ULTECQUESEENCUENTRANENLOSMOTORES,
DECILINDROSDE)NTRIGUEY#UTLASSDE/LDSMOBILE#AVALIERY-ALIBU
DE#HEVROLET3UNFIREDE0ONTIACDEYPOSTERIORES
FID8838A2 Comprobador del arnés del inyector.
s0ARAINYECTORES"OSCHUTILIZADOSENMOTORES#ADILLACDE,6Y
MOTORES/LDSMOBILEDE,6DEYPOSTERIORES
FID8838A3 Extensión del arnés del inyector.
s,ÓNEADEEXTENSIØNDELARNÏSDELINYECTORPARATODOSLOS
COMPROBADORESDELARNÏSDELINYECTORSERIE&)$
s0ARAUSARCUANDOELINYECTORSEENCUENTRAENUNAPOSICIØNMÉSBAJA
ENELCOLECTORMÞLTIPLEOENLACULATADELCILINDRO
FID8838A4 Caja plástica.
t#AJADEALMACENAMIENTOPARAELJUEGODECOMPROBADORESDELARNÏS
DELINYECTOR&)$!
Pinzas para interrumpir el flujo / estrangular mangueras–Blue-Point®
YA965
HCP7A
HCP10A
YA2850A
HCP6A
FPP17
YA965 Pinzas para estrangular mangueras.
s%LIMINALANECESIDADDEDRENARELSISTEMADEREFRIGERACIØNCUANDOSE
REPARAELTERMOSTATOOLABOMBADEAGUA
s3EUTILIZAPARAPARAESTRANGULARLAMANGUERADECONTROLDEEMISIØN
LÓNEASDEFRENOFLEXIBLESYLÓNEASDECOMBUSTIBLECONMANGUERADEGOMA
s,AMORDAZAGIRAPARAUNAGARREPOSITIVO
YA2850A Pinzas para estrangular mangueras.
s0ARADIAGNOSTICARPROBLEMASQUENECESITENQUESECIERREN
TEMPORALMENTELÓNEASDECOMBUSTIBLEDEVACÓOYDEAIREYASEANDE
GOMAOPLÉSTICAS
s3ELLALÓNEASENFORMAEFECTIVASINTENERQUEDESCONECTARLAS
s*UEGODE
426
HCP6A Pinzas para estrangular mangueras.
s0ARASELLARMANGUERASDETAMA×OSDEA
s4AMBIÏNSEUTILIZAENLÓNEASDEFRENOSLÓNEASDECOMBUSTIBLEY
MANGUERADEVACÓO
sDELARGOHCP7A Pinzas para estrangular mangueras.
s0ARASELLARMANGUERASDETAMA×OSDEA
s4AMBIÏNSEUTILIZAENMANGUERASDECALEFACCIØNYLÓNEASDEVACÓO
sDELARGO
HCP10A Pinzas p/pellizcar mangueras.
s0ARASELLARMANGUERASDETAMA×OSDEA
s4AMBIÏNSEUTILIZAENMANGUERASDERADIADOR
sDELARGO
HCP3KT Juego de pinzas para pellizcar mangueras.
s(#0!(#0!Y(#0!vvvENBOLSADEALMACENAMIENTO
FPP17 Pinzas para estrangular mangueras.
s)DEALPARAAPLICACIONESDECAMIONESTRACTORES
s%STRANGULARÉPIDAYFÉCILMENTELASLÓNEASDEVACÓOMANGUERASDE
AGUAETC
s%LEJESEMIRÓGIDODEPERMITEELUSOPREPOSICIONADOCONUNASOLA
MANO
s,OSMANGUITOSDEABRAZADERADEACERODESERVICIOPESADORECIBEN
UNTRATAMIENTOTÏRMICOA2#PARAOFRECERUNAGARREFUERTE
s%LTRINQUETEDEDIENTESFINOSPERMITEUNAGARREPRECISOYSETRABA
PARAFACILITARELUSO
s"ARRADETRACCIØNYLATRABAMANUALFABRICADASENACEROALCARBØN
DEALTACALIDADPARAUNAMAYORVIDAÞTILDELAHERRAMIENTA
s!BERTURADEMORDAZADEPARAUTILIZARENUNAAMPLIAGAMADE
APLICACIONES
www.snapon.com/shoptools
SISTEMAS DE COMBUSTIBLE Y MOTOR
Kakl]eYk\][geZmklaZd]
@]jjYea]flYkhYjY\]k[gf][lYjdYdf]Y\][geZmklaZd]
Juegos de herramientas para liberar los acoples de la
línea de combustible.
s$ISE×ADOPARADARSERVICIOAACOPLESDECONEXIØNRÉPIDOS
ESPECIALESQUESEENCUENTRANENLASLÓNEASDEALIMENTACIØNY
retorno de combustible ubicadas en el motor
FIH9055 Juego de herramientas para liberar los
acoples de la línea de combustible.
Incluye una herramienta FIH9055-1 y una herramienta
FIH9055-2 PARALALÓNEADECOMBUSTIBLEDE'-
FIH9056 Juego de herramientas para liberar los
acoples de la línea de combustible.
Incluye una herramienta FIH9056-1YUNAHERRAMIENTA
FIH9056-2PARAACOPLADORESDECONEXIØNRÉPIDADE
COMBUSTIBLEYAIREACONDICIONADOENLAMAYORÓADELOSÞLTIMOS
MODELOSDEVEHÓCULOS&ORDY-AZDA.AVAJO
YA9457 Juego de herramientas para la desconexión
de la línea de combustible.
s$ISE×ADOPARAALCANZARYTENERACCESOALOSACOPLADORESDELALÓNEA
de combustible
s0ARAUSARENLOSMOTORESDE'-#ADILLAC.ORTHSTARDEY
POSTERIORESYCAMIONES&ORDDELASERIE%Y&YPOSTERIORES
sIncluye YA9457-1YYA9457-2
LDTF2 Herramienta para desconectar la línea de
combustible.
s$ESCONECTALALÓNEADECOMBUSTIBLEDELFILTRODECOMBUSTIBLEEN
MOTORESDE,DE3UBURBAN4AHOE9UKON!VALANCHEMÉSCIERTOS
Silverados y Sierras
s3EPUEDEUTILIZARENOTROSSISTEMASDECOMBUSTIBLEFLEXIBLES
LDT8 Juego maestro de herramientas de desconexión.
s0ARATRABACONRESORTEYACOPLESDEDESCONEXIØNRÉPIDAUSADOSEN
ELAIREACONDICIONADOYENLASLÓNEASDECOMBUSTIBLESDEVEHÓCULOS
&ORD'-Y#HRYSLER
LDT6 Juego de desconexión.
s$ESCONECTAELAIREACONDICIONADOLASLÓNEASDECOMBUSTIBLEDE
CONEXIØNRÉPIDAYLOSACOPLESDETRABACONRESORTEENLASLÓNEASDE
!#DE&ORDY#HRYSLER
s4RABAJAENLÓNEASDECOMBUSTIBLEYOTROSACOPLESDEDESCONEXIØN
RÉPIDAENVEHÓCULOSDE%%55EIMPORTADOS
s%NÉNGULOPARAACCEDERALUGARESDIFÓCILES
s%LPLÉSTICODURABLEESRESISTENTEALOSCOMBUSTIBLESYLOSSOLVENTES
s)NCLUYETAMA×OSDESDEHASTA
LDT14 Juego maestro de herramientas de
desconexión Plus.
s#ONTIENETODASLASHERRAMIENTASQUECONTIENEELJUEGOMAESTRODE
HERRAMIENTASDEDESCONEXIØN,$4
s,ASHERRAMIENTASDEDESCONEXIØN*IFFY4ITEDEYDELJUEGO,$430
s%LADAPTADORAZULPARALÓNEADECOMBUSTIBLEDEDELJUEGODE
HERRAMIENTASPARADESCONECTARLALÓNEADECOMBUSTIBLE,$4&
s5NJUEGODEHERRAMIENTASNEUMÉTICASDEDESCONEXIØNPARA
EMPUJARTIRARQUEFUNCIONANENCAMIONESDE
SERVICIOPESADOYAPLICACIONESINDUSTRIALES
s,AETIQUETADENTRODELACUBIERTADELACAJA
TRANSPORTADORAMUESTRAIMÉGENESYAPLICACIONES
LW11
YA9457
FIH9056
LDTF2
LDT8
LDT6
LDT14
LW204
DdYn]k\]dYdf]Y\][geZmklaZd]
s“El torque de resorte” ofrece un mayor agarre en el accesorio con
más fuerza en la llave (hasta 2 veces las Normas ANSI)
sRemueve incluso los accesorios de frenos y combustible más desgastados
s&UNCIONADONDEOTRASLLAVESCONTUERCAABOCARDADAFALLAN
sTiene fácil acceso a las áreas estrechas donde se encuentran los accesorios
s3EADAPTAAMÉSDELDELOSVEHÓCULOSDE%%55EIMPORTADOS
s#UENTACONCABEZASDELLAVEPLEGABLESCOMPACTASFABRICADASDE
cromo-molibdeno con acabado de óxido negro
ADVERTENCIA
FIH9055
LW10 Llave de la línea de combustible/freno.MM
LW11 Llave de la línea de combustible/freno.MM
LW1213 Llave de la línea de combustible/freno.MM
LW14 Llave de la línea de combustible/freno.MM
LW204 Llave de la línea de combustible/freno.
s)NCLUYE,7,7,7Y,7MMAMMA
PIEZASENBANDEJADEESPUMADEALMACENAMIENTO
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
427
SISTEMAS DE COMBUSTIBLE Y MOTOR
Sistemas de combustible
Llaves para distribuidor en pulg.
Pieza No.
S8564B
S9707
M3515
S8176
S9609
S9622
S9626
Tamaño llave,
pulgadas
1/2
1/2
9/16
9/16
9/16
9/16
9/16
S8564B
S8564B Llave para distribuidor.
tMotores Ford, Lincoln y Mercury;
despeja los cables y las bobinas
S9707 Llave para distribuidor.
t-OTORES&ORD-ERCURYY#ADILLAC
M3515 Llave para distribuidor.
t#AMIONES'-6Y6
S8176 Llave para distribuidor.
tMotores Pontiac y Oldsmobile
S9609 Llave para distribuidor.
t-OTORES#HEVROLET6
S9622 Llave para distribuidor.
t!UTOS'-GRANDESCONMOTORES6DE
YPOSTERIORES
S9626 Llave para distribuidor.
s-OTORES'-6
S9707
S8176
S9622
S6134
Llaves métricas para distribuidor
S9609
S6134 Llave métrica para distribuidor.
t-OTORES#ADILLACDE,6DEYPOSTERIORESMOTORES'-
DE,6Y67'OLFDE
sMM
S9626
TM63A
Mangos
Pieza No.
A
B
C
TM63A
1/4
21/32
3/16
4
9
TM63A Mango flexible.
t#UADRODE
s0ARAAPLICACIONESDEBAJOTORQUE
s0ARAUSARENDISTRIBUIDORESTIPOVENTANADE$ELCO2EMY
Cepillo para limpiar
ACD12A
ACD12A Cepillo para limpiar el distribuidor.–
Blue-Point®.
t%LCEPILLODEALAMBRELIMPIALASCONEXIONESTERMINALESEN
los distribuidores y bobinas
sDELARGOCONEMPU×ADURADEDELARGO
s!LAMBREDEDEDIÉMETRO
Herramientas de encendido
YA6465
YA6465 Llave moduladora para encendido de Ford.
tSe utiliza para remover los pernos retenedores hexagonales de
7/32" (5.5 mm) en los módulos de encendido de Ford
s#UADROHEXAGONALDE
428
YA2700
ITHE100
IT100
Comprobadores de encendido
YA2700 Comprobador de módulo de encendido.
t0ARAPROBARMØDULOSDE#HRYSLERDEYPASADORESMØDULOS'-
DEYPASADORESMÉSMØDULOStipo “virola” de Ford de 3
pasadores
s%LINDICADOR,%$OFRECEUNALECTURASIMPLEDE“bien” o “mal”
ITHE100 Comprobador de encendido.
t)GUALQUE(4PEROPARAUTILIZARENLOSSISTEMAS(%)
IT100 Comprobador de encendido.
t0ARASISTEMASDEENCENDIDOESTÉNDAR
s6ERIFICALASCHISPASSINREMOVERLABUJÓADELMOTOR
s,OSCOMPROBADORESSEAJUSTANALCABLEDELABUJÓAYLAGRAMPACON
resorte se agarra a una descarga a tierra apropiada
www.snapon.com/shoptools
SISTEMAS DE COMBUSTIBLE Y MOTOR
Herramientas de servicio para distribuidores
S6176
SWR1
S6150
S6154
SWR2
YA1238
SWR4
SWR102
YA9385
YA9375A
YA6675
Sensor de oxigeno
S6176 Dado para sensor de oxígeno.
s0ARAELSERVICIODELAMAYORÓADELOSVEHÓCULOS.ISSAN-AZDA
(ONDA!CURA
s%LLADORANURADOLIBERALASPROYECCIONES
sMM#UADRODEDELARGO
S6150 Llave para sensor de oxígeno.
s%LDISE×OESPECIALDELLAVEDEPIEOFRECELAFUERZANECESARIAPARALA
REMOCIØNINSTALACIØN
s4AMA×ODELLAVEDEPUNTASDECUADRODE
s!CABADODENÓQUELCROMO
S6154 Llave para sensor de oxígeno.
s0ARAUSARENSENSORESDEOXÓGENOEN!CURA2$8MM
s!BERTURADELLAVEDEPUNTASCUADRODE
s!CABADODENÓQUELCROMO
SWR1 Llave para sensor de oxígeno.
s$ISE×ADOPARATODOSLOSSENSORESDEOXÓGENOCONUNHEXÉGONODE
s,ACABEZAFLEXIBLEOFRECEELESPACIONECESARIOPARALAREMOCIØN
INSTALACIØNDESENSORESDEOXÓGENOCUANDOELSENSORSEUBICA
HACIAARRIBAYHACIAADENTROENELSUELOOCUANDOSENECESITA
APALANCAMIENTOALREDEDORDELTUBODEESCAPE
s,OSMOTORES&ORD#ONTOURSY&ORD-ODULARDE,Y,UTILIZADOS
ENCAMIONESY356CUENTANCONESTAAPLICACIØN
s/TRASAPLICACIONESINCLUYENSENSORESDEGOLPETEODEYMM
UTILIZADORENCAMIONESMEDIANOS356YVANS
s3ISTEMADE&LANK$RIVE®PARAMAYORTORQUEAPLICADO
s!CABADOCROMADOPARAUNAFÉCILLIMPIEZAYPROTECCIØNCONTRALACORROSIØN
s#ABEZACOMPACTADEPOCOESPACIO
s,ARGOTOTAL(EXÉGONODEPUNTASDE$IÉMETRODE
CABEZA!NCHODERANURA
SWR2 Dado para sensor de oxígeno.
s0ARASENSORESDEOXÓGENOUBICADOSENLOSMÞLTIPLESDEESCAPEDE
AUTOMØVILESYCAMIONETASINCLUYENDO67DEYPOSTERIORES
s#UADRODECONHEXÉGONODE
s!BERTURADEPARAUNFÉCILACCESOALSENSORDEOXÓGENO
s3ISTEMADELLAVECON&LANK$RIVEPARAUNMAYORTORQUEAPLICADOCON
MENOSESFUERZO
s$ETENCIØNDEBOLAENCUADROCUADRADOPARAUNARETENCIØNSEGURA
s!CABADOINDUSTRIAL
SWR4 Llave para sensor de oxígeno.
s3EUTILIZAENSENSORESDEOXÓGENOCONUNHEXÉGONODEMM
s%LDISE×ODEEMPU×ADURACONCABEZAFLEXIBLEOFRECEELESPACIO
ADICIONALPARALAREMOCIØNINSTALACIØNDESENSORESDEOXÓGENOY
SENSORESDEAIRECOMBUSTIBLE
s!CABADOCROMADOPARAUNAFÉCILLIMPIEZAYPROTECCIØNCONTRALACORROSIØN
s,APROFUNDIDADDELDADOYELDIÉMETRODEPAREDDELDADOSON
CRUCIALESPARAELESPACIOLIMITADODENTRODELAPROTECCIØNTÏRMICA
s,ARGOTOTAL(EXÉGONODEPUNTASDE$IÉMETRODE
CABEZA!NCHODERANURA!PLICACIONES
s4OYOTAYPOSTERIORES
s!CURAYPOSTERIORES
s,EXUS(ONDA(YUNDAIY+IAYPOSTERIORES
ADVERTENCIA
s.ISSAN-AZDAYPOSTERIORES
SWR102 Juego de llaves para sensor de oxígeno
s372Y372PIEZASENBANDEJADEALMACENAMIENTO
YA1239 Llave para sensor de oxígeno con cuadro
doble–Blue-Point®.
s#UADRODEY
s3UJETEELMANGOARTICULADODEALEXTREMODELAHERRAMIENTAPARA
AFLOJARINICIALMENTELOSSENSORESATASCADOSUSEUNTRINQUETEDEEN
LAPARTESUPERIORPARALOGARUNARÉPIDAEXTRACCIØNEINSTALACIØN
s3EADAPTAALASAPLICACIONESDELSENSORDEOXÓGENOCONUNA
PROTECCIØNTÏRMICA
s%LCUERPORANURADOPERMITEESPECIOPARAELARNÏSDELCABLE
s%LDISE×ODEACEROFORJADOTRATADOTÏRMICAMENTECONPUNTAS
SOPORTARÉAPLICACIONESDEEXTRACCIØNDETORQUEALTO
YA9385 Dado para sensor de oxígeno–Blue-Point.
s0ARAINSTALARYREMOVERSENSORESDEOXÓGENOYVACÓOENLAMAYORÓA
DELOSVEHÓCULOSNACIONALESEIMPORTADOS
s0UEDEUTILIZARSECONUNALLAVEDEIMPACTO
s(EXÉGONOEXTERNODE2ANURADEXPARALIBERAR
OBSTRUCCIONESMMCUADRODE
s!CABADOINDUSTRIALNEGRO
YA9375A Llave para sensor de oxígeno–Blue-Point.
s0ARASENSORESDEOXÓGENOENMOTORESDE,4Y,4,6DE's4AMBIÏNPARAAPLICACIONESENMOTOCICLETAS(ARLEY$AVIDSON®
MODELOYPOSTERIORES
s%LIMINALANECESIDADDEDESENGANCHARELSISTEMADEESCAPECUANDO
SEREMUEVEOREINSTALAELSENSORDEOXÓGENO
s#UADRODECONHEXÉGONODE
s!CABADOINDUSTRIAL
YA6675 Dado para sensor de oxígeno
protegido–Blue-Point.
s0ARAUSARENLOSÞLTIMOSMODELOSDE4OYOTAY,EXUS
s,APROFUNDIDADYELDIÉMETROEXTERNOSONCRUCIALESPARAELESPACIO
LIMITADODENTRODELAPROTECCIØNTÏRMICA
s(EXÉGONODEPUNTASPARAELDOBLEDE“ÉNGULOSHORARIOSv
COMPARADOCONLASCONFIGURACIONESDEPUNTAS
s&ORJADOPARAUNAMÉXIMARESISTENCIA
YA6775 Llave para sensor de oxígeno–Blue-Point.
s$ISE×ADOPARAUTILIZARCONLAMAYORÓADELOSSENSORESDEOXÓGENO
INDEPENDIENTEMENTEDELTAMA×ODELOSCONECTORESELÏCTRICOSQUETENGAN
s$ISE×ODELADODOBLECONFIGURACIØNDEPUNTASYPUNTAS
s%LDISE×ODELAEMPU×ADURACONPIVOTEPERMITEREALIZARUNAPALANCA
POSITIVAENÉREASRESTRINGIDAS
YA6775
Fgmk]`]jjYea]flYk\]eYfg[jgeY\Ykg\]Y[YZY\gaf\mkljaYd[gf`]jjYea]flYk\]aehY[lg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
429
SERVICIO DE BATERÍAS
Carga. Prueba. Refuerzo.
Inversión. Diagnóstico.
Cuando utiliza el equipo de servicio de batería de Snap-on®
no importa lo que ocurra en su taller porque usted estará
preparado. Cuando de baterías se trata, la versatilidad
significa poder y eso es exactamente lo que Snap-on le brinda.
;Yj_Y\gj\]ZYl]jYkHdmk™ — La cuestión fundamental: Las
baterías cambiaron. ¿Su cargador cambió? Cargue casi todas
las baterías que se le ocurra a la velocidad que necesite. De
manera segura. Es así de simple.
Hjm]ZY\]d]imahg2KfYh%gfhjghgj[agfYj]kmdlY\gk
confiables en un paquete fácil de usar.
@]jjYea]flYk\]k]jna[ag2<]k\]bm]_gk`YklY`]jjYea]flYk
individuales, Snap-on ofrece una gama completa de equipos
seguros en los que puede confiar.
;YZd]k'[Yj_Y\gj\]j]^m]jrg2;gehd]lYe]fl]YakdY\g$
el equipo de calidad profesional es perfecto para el taller
o el campo.
430
CARGADORES DE BATERÍA
EEBC500 Cargador de batería Plus.
s Adaptabilidad: Baterías estándares de automóviles, de ciclo profundo,
AGM y de gel; cada una requiere un ciclo de carga diferente
s Versatilidad: Carga baterías de 6, 12 y 24 voltios con regímenes de
carga de 4, 15 y 60 amperes
s Conveniencia: Tomas a tierra GFCI para brindar potencia auxiliar a
las luces y a otros accesorios: compartimiento de almacenamiento
al alcance de la mano para herramientas de mano con baterías
opcionales
s Inteligencia: Operación completamente automática: los algoritmos
controlados por microprocesadores optimizan el ciclo de carga sin
sobrecarga. Incluye modo manual para carga temporizada.
s Potencia: potencia de encendido del motor de 300 amperes
s Alta tecnología: la exclusiva alimentación de reprogramación de
destellos mantiene el voltaje consistente especificado por OEM
s Información: Pantalla digital: voltaje, % de carga y % de rendimiento
del alternador
s Profesionalismo: Diseño aerodinámico y resistente. La empuñadura
de altura de trabajo superior ayuda a aliviar la tensión en la parte
inferior de la espalda.
s SS3151 DVD de información del producto
EEBC100 Cargador manual
s Tiempo de carga establecido manualmente, según sea necesario
s Encendido del motor de 200 amperes 12 voltios y 100 amperes
6 voltios disponible para encendido de emergencia
s La carga rápida de 40 amperes se realiza en 0.5 a 1.0 hora
s La carga rápida de 10 amperes se realiza en 3 a 5 hora
s La resistente empuñadura retráctil ofrece un almacenamiento
conveniente
s En lista de UL - Estados Unidos y Canadá
EEBC500
EEBC500CVR
EEBC100
Especificaciones
Corrientes de salida A CC
Voltaje de salidaVCC
EEBC500
EEBC500INT
60/15/4
60/15/4
6/12/24
6/12/24
3 interruptores 3 interruptores Posiciones del interruptor
64 combinaciones
64 combinaciones
14.6
7
Corriente de entrada continua (máxima), amperes
Corriente de entrada de ayuda de
66.5
25
arranque (máximo), amperes
120
230/240
Voltaje de entrada (especificado), VCA
300
300
Índice de ayuda para arranque, ADC
1/36
1/36
Ciclo trabajo ayuda arranque
5
5
Ayuda de arranque a tiempo (segundos)
180
180
Ayuda de arranque fuera de tiempo (segundos)
300
300
Índice de refuerzo, Amp.
Fija
Fija
Tipo de cable de CC
7'6"
7'6"
Longitud cable de CC
4 AWG
4 AWG
Calibrador de conductores de CC
500A
500A
Abrazaderas de CC
9
9
Largo cable de CA, pies
14-3
14-3
Calibrador de cable de CA
Ninguno
Ninguno
Amperímetro
Digital
Digital
Voltímetro
Digital
Digital
Temporizador
Auto-reconfigurable Auto-reconfigurable
Disyuntor de CA
Auto-reconfigurable Auto-reconfigurable
Disyuntor de CC
8 SCR
8 SCR
Rectificador
Enfriado por
Enfriado
por ventilador
Ventilación
ventilador
3
3
Cant. de régimen de carga
10
10
Tamaño de rueda, pulgadas
86
90
Peso, lb.
20.4 x 16.5 x 30.5
20.4 x 16.5 x 30.5
Dimensión L. x An. x Al., pulgadas.
Sí
No
Uso externo
Estadounidense Australia, Europa, Reino Unido
País de Uso
Incluido
EEBC5CABLE-A, E, U
Cable de suministro eléctrico
EEBC500SOJ
60/15/4
6/12/24
3 interruptores 64 combinaciones
14.1
EEBC100
40/10/2
6/12
88
30
5
10
100
120
300
200
1/36
1/48
5
5
180
240
300
200
Fija
Fija
7'6"
6'
4 AWG
8 AWG
500A
300A
9
6
14-3
16-3
Ninguno
0-40
Digital
Ninguno
Digital
135 Minutos
Auto-reconfigurable Auto-reconfigurable
Auto-reconfigurable Auto-reconfigurable
8 SCR
4 diodos
Enfriado por
Enfriado por
ventilador
ventilador
3
3
10
6
90
40
20.4 x 16.5 x 30.5
13.8 x 13.5 x 20
No
No
Japón
Estados Unidos
Incluido
Incluido
SOPORTE TÉCNICO
EEBC5CABLE-A
EEBC5CABLE-E
EEBC5CABLE-U
EEBC500CVR Cubierta del
cargador de baterías PLUS.
sCubierta de protección para el
cargador de baterías EEBC500 de
la serie PLUS
EEBC5CABLE-A
sAlimentación, Australia. Utilizar
solamente con EEBC500INT
EEBC5CABLE-E
sAlimentación, Europa. Utilizar
solamente con EEBC500INT
EEBC5CABLE-U
sAlimentación, Reino Unido. Utilizar
solamente con EEBC500INT
EEBC500-15 Juego de
cables.
sgPARALASERIE%%"#
1-866-713-6007
ADVERTENCIA
=d[Yj_Y\gj\]Z]]klYj9H9?9<G[mYf\g[gf][l]fg\]k[gf][l]fdgk[YZd]k
=nal]kgZj][Yj_YjdYkZYl]jYkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
431
CARGADORES DE BATERÍAS
Cargadores de banco
EEBC2216 Cargador de batería en la parte superior del banco.
s/PERACIØNAUTOMÉTICAMÉSUNASECUENCIADECARGACONTROLADAPORUN
MICROPROCESADORINTELIGENTEPARAUSARCONUNAAMPLIAVARIEDADDETIPOS
DEBATERÓAS
s#ARGARLASBATERÓASCONVENCIONALES!'-SINMANTENIMIENTODEGELDE
CICLOPROFUNDOYDENAVÓOS
s3IMPLEMENTEHAYQUESELECCIONARELTAMA×OCORRECTODELABATERÓAEL
CARGADORINICIARÉELPROCESODECARGAAUTOMÉTICO
Especificaciones
Entrada
Salida
Rango de batería (óptimo)
Largo de cable de carga, pies
Dimensiones
Peso de envío, lb. (kg)
EEBC2216
EEBC2216
120 voltios de CA, 60 Hz, 4.4 amperes
12 voltios de CC, 1 a 16 amperes
25-200 AH
6
10.75" (L.) x 4.5" (An.) x 7.875" (Al.)
4.94 (2.24)
Mantenedores de batería
EEBM500 Mantenedor de baterías de 4 A 6/12 voltios.
s/PERACIØNCOMPLETAMENTEAUTOMÉTICAAVOLTIOSRÏGIMENDECARGA
DE!
s#OMPATIBLECONBATERÓASCONVENCIONALES!'-SINMANTENIMIENTODE
GELDEBOBINADOENESPIRALYDECICLOPROFUNDO
s)NDICADOR,%$DELESTADODECARGA
s)NCLUYEUNCABLEDESALIDADECONEXIØNRÉPIDACONJUEGODEABRAZADERAS
JUEGODETERMINALESDEANILLOYACCESORIOSDESALIDADELADAPTADORDE
VOLTIOS
s$ISE×OERGONØMICOCONBOTONESGRANDESPARAUSARFÉCILMENTEINCLUSO
CONGUANTESPUESTOS
s!DVERTENCIADEPOLARIDADINVERSAYFALLADELABATERÓA
EEBM100 Mantenedor de baterías de 1.5A 12 voltios.
s/PERACIØNCOMPLETAMENTEAUTOMÉTICAAVOLTIOSRÏGIMENDECARGADE!
s#OMPATIBLECONBATERÓASCONVENCIONALES!'-SINMANTENIMIENTODE
GELDEBOBINADOENESPIRALYDECICLOPROFUNDO
s)NDICADOR,%$DELESTADODECARGA
s#APUCHØNENGOMADOPARAEVITARQUESERAYENLOSCOMPONENTESDEL
VEHÓCULOYPARAPROTEGERELMANTENEDOR
s#ABLEDESALIDADECONEXIØNRÉPIDACONJUEGODEABRAZADERASY
accesorios de salida del terminal de anillo
EEBM500
EEBM100
Inversor de corriente
EEPI1500
EEPI175
EEPI1500 Inversor de corriente.
s7
sAlimenta teléfonos celulares, computadoras, Nintendo® DS, reproductores
de DVD, iPods®, etc.
s3EENCHUFAALASALIDADECORRIENTEDEVOLTIOSDELVEHÓCULO
s"RINDAVOLTIOSDE#!DENTRODESUVEHÓCULO
s0ROPORCIONACORRIENTEDE53"ADISPOSITIVOSELECTRØNICOSPEQUE×OS
EEPI175 Inversor de corriente.
s7
s,ASMISMASCARACTERÓSTICASQUE%%0)
sPUERTOS53"
s#ABEENELSOPORTEPARAVASOS
EEPI2250 Inversor de corriente.
s7DEPOTENCIACONTINUAYPOTENCIAPICODE7PARAENCENDERUNA
AMPLIAVARIEDADDEHERRAMIENTASAPLICACIONESELECTRØNICASYARTEFACTOS
s0OTENCIAESTABLELIMPIAYCONFIABLECONGRANCAPACIDADDESOBRETENSIØN
PARAUSARENLASAPLICACIONESMÉSEXIGENTES
s!PLICACIONESELECTRØNICASPRECISASPARAPERMITIRLACARGAADECUADADELAS
APLICACIONESELÏCTRICASLAPTOPTELÏFONOSCELULARESYDISPOSITIVOSDEJUEGO
s4RESSALIDASDE#!DEVOLTIOS
s0ARACAMIONESDEREMOLQUEFLOTASVEHÓCULOSDECONSTRUCCIØNYDEUSOMILITAR
EEPI2250
432
www.snapon.com/shoptools
COMPROBADORES DEL SISTEMA DE BATERÍAS
;gehjgZY\gj\]\aY_fkla[gq[Yj_Y\gj\]kakl]eYk\]ZYl]jYk<%L9;™$
[Yj_Y\gjqYjjYf[Y\gj]k\]eglgj
$4!#0LUSESUNSERVICIOÞNICODESISTEMASDEARRANQUEYCARGATODOENUNO
EECS306BKR D-TAC Plus. #OMPROBADORDEDIAGNØSTICOYCARGADORDESISTEMASDEBATERÓASD-TAC
)NCLUYEIMPRESORAINTEGRADAYCARRO
EECS306BPR D-TAC Plus. D-TAC NOINCLUYECARRO
s0RUEBADESISTEMAAUTOMATIZADABATERÓAARRANQUEALTERNADOR
s$ETERMINACIØNDEBATERÓACORRECTAINCORRECTAMÉSRECAMBIOAUTOMÉTICO
s6OLTAJEDEARRANQUENORMALANORMAL
s$ETERMINACIØNDEALTERNADORAPROBADODESAPROBADOENMODOCARGADO
sAyuda para el arranque de 300 A
s%LMENÞLOCALIZADORDEDESPERFECTOSOFRECEUNAGAMADEOPCIONESDEPRUEBADEPRECISIØNINCLUYENDOUNMULTIMEDIDOR
DIGITALUNMEDIDORDEIMPEDANCIAUNACARGADEBATERÓAPROGRAMABLEYPRUEBASDESONDADEAMPERIOS
EECS306BHD D-TAC Plus para servicios pesado.
s.UEVASAPLICACIONESDEDIESELYGASOLINADESERVICIOPESADO)DEALPARALOSSISTEMASAUTOMOTRICESESTÉNDAR
s%XTIENDELATABLA##!PARAMÞLTIPLESBATERÓAS0RUEBAMÞLTIPLESBATERÓASENPARALELOCONUNASOLAPRUEBARÉPIDA
s3ONDADEIMPEDANCIAESPECIALCONPUESTAACEROPRUEBAARNESESDECABLEADOGENERALPARALOCALIZAR
CONEXIONESMALASODEFECTUOSAS
s,ASPRUEBASDEALTERNADORYARRANCADORMODIFICADOSBAJALAS20-YELTIEMPODEARRANQUEPARAREALIZAR
ESTASPRUEBASENMOTORESDIESELGRANDES
s,ASONDADE'DEAMPERAJEPARACAMIONESDESERVICIOPESADOOFRECEUNAAMPLIALONGITUDDECABLEPARA
LLEGARALASCABINAS
EECS306BHK Juego de actualización de servicio pesado de D-TAC Plus. !CTUALIZA
$4!#0LUSASERVICIOPESADO
EECS306BKR
;gehjgZY\gj\]kakl]eYk\]ZYl]jYk'YjjYfim]'[Yj_YEa[jgN9L¡
s0RUEBACOMPLETADESISTEMASAUTOMOTRICESDEBATERÓAALTERNADORESYARRANCADORESENMENOSDEUNMINUTO
s0RUEBABATERÓASDEYVOLTIOSYSISTEMASDECARGADEYVOLTIOS
s,APRUEBADEIMPEDANCIADEUNABATERÓAREALIZAELDIAGNØSTICODEUNABATERÓAENMENOSDECINCOSEGUNDOS
s#OMPENSAAUTOMÉTICAMENTEELESTADODECARGAYLATEMPERATURA
s!PLICACIONESPARACAMIONESDETRABAJOPESADOnBATERÓASDEHASTA##!SISTEMASDECARGADE
HASTA!
s#ARGADEAMPREFRIGERADACONVENTILADORPARAPRUEBASPRECISASDEALTERNADORBAJOCARGA
=kh][a^a[Y[agf]k\]==;K+(,:):Ea[jgN9L
Especificaciones
Amplitud del voltímetro
Resolución del voltímetro
0.01 voltios
Precisión del voltímetro
1% de la lectura ±L.S.D.
Rango de prueba
Baterías CCA 100 a 1500
Sistemas de medidas
Duración de las baterías
EECS304B1B
EECS304B1B
0 a 50 voltios
CA /CCA / DIN
EECS306BHK
50 horas
Dimensiones
8.5" x 7" x 2.5"
Peso, lb. (kg)
2.6 (1.179)
EECS304B1B Comprobador MicroVAT.0ROGRAMADOPARAIDIOMAINGLÏSFRANCÏSCANADIENSE
YESPA×OLLATINOAMERICANO
9[[]kgjagk<%L9;'Ea[jgN9L
2-6342-1 Sonda de alto amperaje.
tSonda de alto amperaje inductiva prensil para comprobadores de sistemas de batería D-TAC Plus
serie EECS306B y comprobadores AVR MicroVAT serie EECS304B1B
s2ANGODEAAMPPARAPROBARCIRCUITOSDECORRIENTEALTA
s'DELARGO2ESOLUCIØNDEAMP
2-6442-1 Sonda de bajo amperaje.
tSonda de alto amperaje inductiva prensil para comprobadores de sistemas de batería D-Tac Plus
serie EECS306B y EECS304B1B MicroVAT
s2ANGODEA!PARAPROBARCIRCUITOSDECORRIENTEBAJA
s'DELARGO2ESOLUCIØNDEM!
DTACCART Carro rodante.
s#ARRODEALMACENAMIENTORODANTEPARAEL#OMPROBADORDEDIAGNØSTICOYCARGADORDESISTEMASDE
baterías D-Tac Plusserie EECS306B
s#ARRODEACEROTUBULARCONRUEDASDELANTERASCONTRABAYBANDEJASDEALMACENAMIENTO
s%LPESODELCARROESDELIBRAS
2-22566 Impresora. ,AIMPRESORAINALÉMBRICACUENTACONCOMUNICACIØNINFRARROJAYROLLODEPAPEL
DE"0ARACOMPROBADOR-ICRO6!4SERIE%%#3""YCOMPROBADOR9!OPCIONAL
8-00910A Papel para impresora. #OMPROBADORDELSISTEMADEBATERÓAS4!#PLUS
5-08826A Papel para impresora. #OMPROBADORDEDIAGNØSTICODELSISTEMADEBATERÓAS
-ICRO6!4
ADVERTENCIA
2-22566
2-6442-1
2-6342-1
=d[Yj_Y\gj\]Z]]klYj9H9?9<G[mYf\g[gf][l]fg\]k[gf][l]fdgk[YZd]k
=nal]kgZj][Yj_YjdYkZYl]jYkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
433
COMPROBADORES DE BATERÍAS
Los comprobadores de baterías electrónicos usan tecnología de conductancia para proporcionarle
rápidamente al técnico el estado de la batería, el sistema de arranque y el sistema de carga. Selecciones
de los 4 modelos para una buena y mejor alineación. Una unidad tiene una impresora incorporada y otra
usa una impresora infrarroja inalámbrica. Algunas incluyen comandos en pantalla hasta en 7 idiomas.
Comprobadores de baterías electrónicos
YA2636
EECS500
Incluye
YA2612B
YA2624
EECS500
100-1,400
YA2636
100-3,500
YA2624
390-1,700
YA2612B
100-1,400
Conductancia
Conductancia
Conductancia
Conductancia
CCA
% y CCA
%
%
Protección de polaridad inversa
Protege y detecta
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
Indicador de recarga de batería
s
s
s
s
s
s
s
Muestra voltios
Muestra voltios
Muestra voltios
Muestra voltios
Rango CCA
Método de prueba
Muestra % capacidad de batería disponible
Muestra condición de batería
Prueba baterías descargadas
Muestra estado de carga de batería
Prueba baterías de 12V
Prueba baterías de 6 y 12V
Prueba pilas húmedas/AGM/baterías de célula de gel
Detecta y muestra elemento dañado
Advertencia de carga en superficie
Prueba sistemas de carga/arranque de 12V
s
s
Muestra voltios
Prueba sistemas de carga/arranque de 12/24/36V
Diagnóstico de juego de cables interno
Detección de cables sueltos
Conversión de unidades internacionales, EN, JIS, EIC, DIN
s
s
s
s
s
s
s
s
Impresora infrarroja interna
Impresora infrarroja
s
Prueba juegos de baterías en paralelo y en serie (24V)
Capacidad para impresora
Almacena datos de prueba para revisión e impresión
Idiomas: inglés, español, francés
Encabezado personalizado con fecha y hora
Pantalla
Largo de cable, pulgadas. (mm)
s
s
s
s
16 caracteres en 2 líneas
LCD de 16 caracteres
LED de 4 dígitos
LED de 3 dígitos
36 (914.4)
48 (1,219.2)
48 (1,219.2)
24 (609.6)
s
s
s
s
s
7 idiomas
Función de drenaje parásito
Imán de retención
DVD de información del producto
SS3152
YA2636-4 Adaptador USB infrarrojo.
s3EUTILIZAPARAALMACENAREIMPRIMIRLOSRESULTASDELAPRUEBA9!
AUNA0#OLAPTOP
s3OFTWARE#USTOMENEL#$INCLUIDOCONELJUEGO
HHGA-5 Impresora infrarroja.
t)MPRESORAINFRARROJAPARAELCOMPROBADOR9!
HHGA-18 Rollo de papel de repuesto.
tPAQUETESDEROLLOSDEREPUESTOPARALAIMPRESORAINFRARROJA(('!
EECS500-1 Rollo de papel de repuesto.
t2OLLOSDEPAPELPARALAIMPRESORA%%#3
434
Muestra voltios
s
Detecta onda del alternador
Compensación de temperatura
s
s
s
s
SOPORTE TÉCNICO
1-866-592-8052
Sólo para EECS500
YA2636-4
www.snapon.com/shoptools
HHGA-5
HERRAMIENTAS DE SERVICIO DE BATERÍA
;Yj_Y\gj]k\]j]^m]jrgk'[YZd]k\]j]^m]jrg'YZjYrY\]jYk
;Yj_Y\gj\]j]^m]jrghgjl~lad
EECS309B Cargador de refuerzo portátil.
s0OTENCIAPICODEPARAUNARRANQUERÉPIDO–FUNCIONACONBATERÓASMUYDESCARGADAS
s%LINDICADORDENIVELDECARGADE,%$PERMITECONOCERELESTADODELACARGAALINSTANTE
s,OSCONDUCTORESDELASABRAZADERASDECALIBREINCLUIDOSSEDESPRENDENMEDIANTEDADOS
DEBRONCEDESERVICIOPESADOPARAUNFÉCILREEMPLAZODELOSCABLESENELLUGARDETRABAJO
sBORNESAISLADOSGARANTIZANUNASEPARACIØNYALMACENAMIENTOSEGURODELASABRAZADERAS
s,ATOMAPARAENCENDEDORDECIGARRILLOSDE6PERMITERECARGARYTAMBIÏNOFRECEUNAFUENTE
DE6PARACONECTARDISPOSITIVOSEXTERNOSCOMORADIOSLÉMPARAS3EINCLUYEUNCABLEDE
ALIMENTACIØNDE
s2ECARGARÉPIDACONELCARGADORDEMONTAJEENPAREDDE6AMPERESINCLUYELUCES
INDICADORASDELESTADODECARGA
EECS309B Accesorios opcionales:
EECS309B-5. Cable positivo y abrazadera de 60".
EECS309B-6. Cable negativo y abrazadera de 60".
EECS309B-9. Cables de motocicleta (positivos y negativos).
EECS660 Cargador de refuerzo portátil.
s0OTENCIAPICODEPARAARRANCARENCALOROENFRÓO
sCABLESDESERVICIODELARGOALCANCEDE
s,ASABRAZADERASDEGRADOINDUSTRIAL)NDUSTRIALAGARRANYSOSTIENENTERMINALESDEBATERÓAS
s%NCHUFARRÉPIDAMENTEELCABLEDEEXTENSIØNDETALLERESDESERVICIOPESADOALFRENTEDELA
UNIDADPARATENERUNACARGAINCORPORADA
s%NERGÓADEVOLTIOSDE##PARAMAYORCOMODIDAD
BC20500
EECS309B
EECS660
BC25500P
;YZd]k'YZjYrY\]jYk
s#ABLESPARAAYUDARACARGARDECALIDAD
PROFESIONALCONTRENZASPARASERVICIOPESADO
DECOBRE
s,OSCUERPOSDELASABRAZADERASESTÉN
COMPLETAMENTEAISLADOSYTIENENMORDAZAS
DECOBREHUNDIDASPARAMINIMIZARLAS
POSIBILIDADESDEQUESEPRODUZCANCHISPASSI
LOSCABLESSETOCANPORACCIDENTE
s,OSRESORTESDELASABRAZADERASDESERVICIO
PESADOPERMITENOBTENERUNFIRMEAGARREEN
LOSBORNESSUPERIORESOLATERALESDELABATERÓA
BC20500 Juego de cables para
batería.
#ABLETRENZADOCONHILOSDECOBRE
gDELARGOCALIBRE
BC15500 Juego de cables para
batería.
#ABLETRENZADOCONHILOSDECOBRE
gDELARGOCALIBRE
2005BSKA
Bm]_gk\]k]jna[ag
4ODOSLOSCOMPONENTESSEDESCRIBENEILUSTRANEN
LASIGUIENTEPÉGINA
2005BSKA Juego para servicio de
baterías. Incluye 5 piezas:
##00INZAFINAANGULAR
"!0INZASPARAABRAZADERASDECABLES
"4#,IMPIADORPARATERMINALESLATERALES
"4#",IMPIADORPARATERMINALES
#*!BRAZADERADECABLECONTRABA
AUTOMÉTICA
#/"OLSADEJUEGO
ADVERTENCIA
BC25500P Cables para batería estilo enchufe.
s#ABLEPARAARRANCARYARNÏSDECONEXIØN
s,OSCABLESDEgDEGRUESOCALIBRESECONECTAN
ALENCHUFEMONTADOENELPARAGOLPESPARALLEGAR
ACUALQUIERVEHÓCULODESCOMPUESTOSINTENERQUE
LEVANTARELCAPØDELCAMIØN
s%LENCHUFEPOLARIZADOSEMONTAENELPARAGOLPESDEL
CAMIØNDESERVICIOYSECONECTAALABATERÓADELCAMIØN
s,ASABRAZADERASDEAMPERESESTÉN
COMPLETAMENTEAISLADASCONVINILO#ABLEDECALIBRE
TRENZADOSCONHILOSDECOBRE
@]jjYea]flYk\]K]jna[ag\]:Yl]jYk
2004BSKA
MT302A
Afl]jjmhlgj[gfkgd]fga\]hYjY
YjjYfim]j]eglg
2004BSKA Juego para servicio
de baterías. Incluye 4 piezas:
##00INZAFINAANGULAR
"4#,IMPIADORPARATERMINALES
LATERALES
"4#!#EPILLOPARATERMINALES
9!,LAVEPARATERMINALESDE
BATERÓA' #/""OLSADEJUEGODEVINILO
MT302A Interruptor con solenoide
para arranque remoto.
s,OSALAMBRESDEgPERMITENLEVANTARELMOTOR
PORLOSLADOSOPORDEBAJOPARAQUELASMANOS
NOMUEVANCORREASPIEZAS
s%LBASTIDORPROTEGEALINTERRUPTORDEPOLVOYLAHUMEDAD
s%LINTERRUPTORDESERVICIOPESADOREDUCEELRIESGODE
CHISPASEINCLUYEUNACUBIERTADESEGURIDAD
sAMPERESAVOLTIOSAMPERES
AVOLTIOS
=d[Yj_Y\gj\]Z]]klYj9H9?9<G[mYf\g[gf][l]fg\]k[gf][l]fdgk[YZd]k
=nal]kgZj][Yj_YjdYkZYl]jYkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
435
HERRAMIENTAS DE SERVICIO DE BATERÍA
208CCP
B260A
Herramientas para
abrazaderas de cables
208CCP Pinzas finas
angulares.
tLa punta redondeada protege la batería
sLas mordazas están compensadas a
30° para lograr una mejor palanca
sDELARGO
GA486A
B260A Pinzas para
abrazaderas de cable.
sSepara y limpia las abrazaderas de
los cables
s0ALANCAENUNEXTREMO
sDELARGO
BTC3A
GA486A Extractor de
abrazaderas de cables.
sSe utiliza para remover
abrazaderas de cables sin dañar
los bornes
sDELARGO
BTC7B
YA9484
BTC3A Cepillo para terminales.
sCepillo de alambre de cerdas duras que
cepilla cuidadosamente bornes y abrazaderas
sDELARGO
BTC7B Limpiador para terminales.
s,IMPIALOSBORNESYLASABRAZADERASDELOS
cables
sIncluye un cepillo de alambre circular
pequeño con tapa protectora para limpiar las
terminales laterales
s#UERPOPLÉSTICO
BTC8A Limpiador para terminales.
sLimpia los bornes y las abrazaderas de los cables
CJ92 Extractor de
abrazaderas de cables.
sLas mordazas autobloqueantes
sujetan firmemente las terminales
YLASEXTRAENSINDA×ARELBORNE
sDESEPARACIØN
BTC8A
BTC10
YA249
Herramientas para terminales–
Blue-Point®.
BT101
CJ92
s#UERPOPLÉSTICO
sDELARGO
BTC10 Limpiador para terminales
laterales.
s0OSEECORTADORESUBICADOSAUNCOSTADOQUE
limpian los contactos de la batería; un cepillo
que limpia los contactos de los cables
sDELARGO
YA9484 Tenazas para terminales de
batería.
sEs la herramienta ideal para reemplazar o
REPARAREXTREMOSDETERMINALESDECABLE
s%LDISE×OAYUDAAEVITARELPLIEGUEEXCESIVO
s4AMA×OSDETERMINALDECALIBREHASTA
YA249L
YA249 Llave para terminales de
batería GM.
sDiseño de llave de ojo con trinquete para usar
en baterías de terminales laterales GM
s(EXDEYDEDELARGO
YA249L Llave para terminales
laterales de batería (5/16").
s,ARGOEXTRADEPARACONECTARY
desconectar las terminales laterales de la
BATERÓAENVANS&ORD!EROSTARDEEN
ADELANTEYDE'-COMO0ONTIAC'RAND!-
,UMINA!06AUTOSDECUERPOh7vADEMÉSDE
"UICK2EGAL/LDS#UTLASS#HEVROLET,UMINAY
0ONTIAC'RAND0RIXDEYPOSTERIORES
s,LAVEDE
BB4C
Hidrómetros–Blue-Point
BT101 Hidrómetro para baterías.
s-IDELAGRAVEDADESPECÓFICADEA
sNo es necesario de usar tablas de temperatura o
interpretar lecturas flotantes difíciles
sSu diseño permite que tanto al cliente como el técnico
PUEDANVISUALIZARELESTADODELÉCIDODELABATERÓA
BB4C Hidrómetro/termómetro.
s-IDELAGRAVEDADESPECÓFICADEAE
incluye una escala de consulta rápida que indica
MALAREGULAROBUENAMEDIANTEUNCØDIGO
DECOLORESASÓCOMOUNAESCALADECORRECCIONES
de temperatura
sDELARGO
436
GA207A
BB6
BL1B
Instrumentos de llenado–Blue-Point Transportador–Blue-Point
BB6 Pera para llenado de baterías.
s#APACIDADPARAONZASDELÓQUIDO
s0OSEEUNPIVOTEDEGOMADUROCON
antiderrame para rellenar sin pérdidas
sDELARGO
GA207A Instrumento de llenado
automático.
s)NSERTEELSURTIDORENELORIFICIODELLENADO
y presione
s,LENASINREBASARSE
BL1B Transportador de baterías.
t0ARABATERÓASDEBORNESUPERIORY
terminales laterales
s0OSEEALMOHADILLASDEGOMAQUE
aseguran con firmeza las baterías con
ANCHOSDEA
s%LAGARREDEPLÉSTICOPERMITESUJETARLO
con firmeza
www.snapon.com/shoptools
AIRE ACONDICIONADO Y SISTEMA DE ENFRIAMIENTO
Más negocios internos implican más
periodos comerciales.
Snap-on® ofrece la última tecnología en aire
acondicionados (A/C) y en productos para el sistema de
refrigeración junto con una cobertura completa del sistema
de enfriamiento. Desde intercambiadores de líquido
refrigerante y recargadores hasta comprobadores de presión
del sistema de enfriamiento, Snap-on lo ayudará a enfriar
cualquier vehículo en la ruta.
<]k\]]imahgk\]Yaj]Y[gf\a[agfY\gim]j]YdarYfdYeYqgjY
del trabajo automáticamente, hasta equipos manuales que
ofrecen resultados rápidos y precisos; no tomará mucho
tiempo obtener un rendimiento de su inversión.
J][a[dY\gj]kq\]l][lgj]k\]hj\a\YkhYjYYaj]
acondicionado: Diseñados y fabricados para cumplir con
todas las normas EPA y SAE vigentes, los recicladores
Snap-on demuestran a sus clientes lo que valen.
Además, reducen el uso de refrigerante en su taller y
hjgl]_]f]dgrgfgea]fljYkim]dgk\]l][lgj]kK9=B*/1)
[]jlaÇ[Y\gk\]l][lYf`YklYdYkhj\a\Yke~kh]im]Yk&
;gZ]jlmjY\]dkakl]eY2<]k\]ZgeZYk\]nY[gqbm]_gk
edlahd]k`YklYbm]_gk\]\]l][[af\]hj\a\YkMN
y termómetros digitales, las necesidades de su aire
acondicionado están cubiertas.
Reducción de llamadas.
Dgdlaegim]\]k]Y`Y[]j]kj]YdarYj]deakegljYZYbg
dos veces. Cuando utilice equipos de servicio de aire
acondicionado de Snap-on, la precisión será su carta
de presentación. Con la operación controlada por
el microprocesador y los mecanismos de detección
automática, usted trabaja con un equipo más inteligente.
437
AIRE ACONDICIONADO
Sistemas de Reciclaje/Recarga (R134a)
EEAC325B
Centro de servicio de aire acondicionado KOOL KARE™
PLUS (R134a)
Centro de servicio de aire acondicionado EEAC325B.
s#OMPLETAPROGRAMABILIDADAUTOMÉTICADESECUENCIAS
s#ALIBRADORESMÉSGRANDESPANTALLADEXMÉSGRANDEYPRUEBADE
ESCAPEDEVACÓO
EEAC324B/EEAC325B Accesorios estándares:
EEAC325A1 Filtro secador giratorio
EEAC325A2 Manguera de servicio, parte lateral superior
EEAC325A3 Manguera de servicio, parte lateral inferior
EEAC325A4 Drenaje de botella de aceite
EEAC325A5 Acoplador de servicio, parte lateral superior
EEAC325A6 Acoplador de servicio, parte lateral inferior
EEAC324B/EEAC325B Características compartidas:
s0URGADEAIRECOMPLETAMENTEAUTOMÉTICAEINYECCIØNDEACEITEINCORPORADA
s#UMPLECONELESTÉNDAR3!%*DEUNARECUPERACIØNDEREFRIGERANTEDEL
YPRECISIØNDECARGADEONZAS
s!UMENTODELENLARECUPERACIØNDEREFRIGERANTEAHORRAREFRIGERANTE
s,AMAYORPRECISIØNDECARGAREDUCELASLLAMADASALCENTRODEREPARACIONES
del aire acondicionado
s-ANGUERASEXTRALARGASDEgPARAAPLICACIONESDESERVICIOPESADO
s/PERACIØNCONTROLADAPORMICROPROCESADOR
s#UMPLECONTODOSLASNORMAS3!%5,Y#3!SOBREOPERACIØNRENDIMIENTOY
PUREZARECICLAJEENUNASOLASECUENCIA
s/PERACIØNSIMPLEGUIADAPORMENÞ
s#IERREAUTOMÉTICODETANQUEYALTAPRESIØN
s0URGAAUTOMÉTICADEAIREYOTROSGASESNOCONDENSABLES
s-ULTILINGàE
EEAC325B Sólo posee:
s"ASEDEDATOSDEVEHÓCULOSPARAESPECIFICACIONESDEACEITE
YREFRIGERANTE
s)MPORTACAPACIDADDECARGADIRECTAMENTEENELMODODECARGA
s4IEMPODEESPERADEVACÓOPROGRAMABLE
s3OFTWAREQUESEPUEDEACTUALIZAR
EEAC324B
Centro de servicio de aire acondicionado ECO™
PLUS (R134a)
EEAC324B Centro de servicio de aire acondicionado.
s'RANRENDIMIENTOALPRECIODEUNSEMIAUTOMÉTICO
s,AINTERFAZINTUITIVAUTILIZAOPCIONESDEMENÞCON
DESPLAZAMIENTOHACIAARRIBAYABAJO
s,APANTALLADEMENÞGUÓAALTÏCNICOATRAVÏSDELPROCESO
del servicio
Especificaciones
EEAC324B/EEAC325B
Rango de temperatura
Humedad relativa
Presión de operación
Rango de temperatura de
almacenamiento
Compresor
Vacío
Bomba de vacío (EEAC324B)
Bomba de vacío (EEAC325B)
Rangos del manómetro
Cantidad recuperada
Índice de recuperación
Cantidad de carga refrigerante
Capacidad de refrigerante a
bordo
Carga de botella de aceite
Drenaje de botella de aceite
Dimensiones
Inyección de tinta de aceite
ultravioleta
Garantía
Base de datos de vehículos (EEAC324B)
Base de datos de vehículos (EEAC325B)
50° a 120° F (10° a 49° C)
Hasta 80% sin condensación
450 psi
-4° a 140° F (-20° a 60° C)
1/3 HP, 1.1 CFM oscilante
28 pulgadas Hg a nivel del mar
1/4 HP, 1.5 CFM, oscilante, 40 micrones
1/3 HP, 3.0 CFM, oscilante, 40 micrones
Lado superior: 500 psi (34 BAR)
Lado inferior: 350 psi (24 BAR)
23 lb. (10.43 Kg)
1 libra por minuto
0-22 lb. (9.98 Kg)
30 lb. (14 Kg)
12 onz. (360 ml)
12 onz. (360 ml)
34" Prof. x 46" Al. x 24" An.
Sí
2 años
No
Sí
SOPORTE TÉCNICO
1-866-769-2788
EEAC325A1 – Filtro secador giratorio para recicladores de aire
ACONDICIONADO%%!#!%%!#"Y%%!#!%%!#"%VITE
TIEMPODEINACTIVIDADDELRECICLADORDELAIREACONDICIONADO4ENGAFILTROS
%%!#!ADICIONALESAMANOYAQUEELNUEVOESTÉNDAR3!%*
EXIGEQUESEREEMPLACEELFILTROSECADORDESPUÏSDEUTILIZARLIBRASDE
REFRIGERANTE%LINDICADORDEVIDADELFILTROSEDACUANDOSEFILTRARON
LBDEREFRIGERANTE3EPRODUCEELCIERREOBLIGATORIODELFILTRODESPUÏSDE
HABERSEFILTRADOLBDEREFRIGERANTE
EEAC325ACV Cubierta del centro
de servicio de aire acondicionado.
s0ROTEGE%%!#!%%!#"
%%!#!Y%%!#"DELPOLVOLA
HUMEDADYLOSENTORNOSDELTALLER
EEAC325ACV
Ventas de aire acondicionado
SS444E Bandera de comercialización - Aire
acondicionado.
s0LÉSTICORESISTENTEALAINTEMPERIEYDURADERO
s-IDEX
s)NCLUYECUERDASDEENLASESQUINAS
SS444E
438
www.snapon.com/shoptools
AIRE ACONDICIONADO
Accesorios de reciclaje/recarga
Accesorios del centro de servicio
Juego maestro de secadores
ACTFILTERPL Filtro para aire acondicionado.
s&ILTRAYSEPARASELLADORESTINTASDESECHOS
LUBRICANTESYOTROSCONTAMINANTESDE
AIREAACONDICIONADO
s%LDA×OSEPRODUCEAPARTIRDELOSSELLADORES4IPO
)4IPO))QUEINGRESANALEQUIPODESERVICIODEAIRE
ACONDICIONADODEUNVEHÓCULODURANTE
SUREPARACIØN
s.OSEREQUIERENIRECOMIENDA!#&),4%20,PARA
RECICLADORES%%!#!%%!#!Y
%%!#"%%!#"CERTIFICADOSPOR*
ACTFILTER1 Juego de filtros de repuesto. ACTFILTERPL
s&ILTRODEREPUESTOPARA!#4&),4%20,
EAK0030C01AB Juego maestro de
secadores.
s,OSFILTROSSECADORESDEBENCAMBIARSE
REGULARMENTESEGÞNELUSODELAUNIDAD
s%LJUEGOINCLUYEELFILTROYLASINSTRUCCIONES
s5TILIZAREN%%!#"%%!#$
%%!#!LATERALDE2%%!#!
%%!#!%%!#!Y%%!#!
Juegos de cambio de aceite
EAK0029C00AB Juego de
compresor.
s5TILIZAREN%%!##%%!#!
Filtros secadores
Y%%!#!
EEAC325A1 Filtro secador.
s5TILIZAREN%%!#!%%!#"Y%%!#!%%!#"%LBLOQUEO EAK0029C01AB Juego de
compresor.
OBLIGATORIODELFILTROOCURRIRÉDESPUÏSDEFILTRARLIBRASDE
s5TILIZAREN%%!#!%%!#!%%!#!
REFRIGERANTE
%%!#!%%!#!%%!#"Y
EAK0095C01AB Filtro secador.
%%!#!%%!#"
s5TILIZAREN%%!##%%!##Y%%!#!LATERALDE2
s)NCLUYECUARTOSDEACEITEPARTESE
EAK0095C02AB Filtro secador.
INSTRUCCIONES
s5TILIZAREN%%!#!LATERALDE2A
ACT71-0A Juego de bomba de vacío.
EAK0030C02AB Juego maestro de secadores.
s"OTELLADEONZAS
s5TILIZAREN%%!#!LATERALDE2A
s#ALENTADODEMODODOBLE
ACT795UV Detectores de fugas
ACT785A Detector electrónico de pérdida de
de gas refrigerante.
gas refrigerante del sensor calentado.
s3ECARACTERIZAPORTENERLUZULTRAVIOLETAY s!LTASENSIBILIDADALOSREFRIGERANTES(&#TALESCOMO2A
SENSORELECTRØNICODEELECTROLITOSØLIDO
s!LARMADIGITALCONINDICADORNUMÏRICODELTAMA×ODELAPÏRDIDA
s$ETECTATODASLASTINTASDISPONIBLES
s)NDICADORESAUDIOVISUALESDEPÏRDIDAS,%$INTERMITENTE
COMERCIALMENTE
s!LARMADIGITALCONINDICADORNUMÏRICODEL s$ETECTAPÏRDIDASPEQUE×ASREDUCCIØNDEFALSOSDISPAROS
s#ERTIFICADOPOR3!%*
TAMA×ODELAPÏRDIDA
ACT760A Detector de pérdidas
s,APANTALLADELUCESULTRAVIOLETASSE
ENCIENDEDECOLORFLUORESCENTECUANDO de sensor calentado.
HAYPÏRDIDASDETINTA
s4ECNOLOGÓADESENSORCALENTADO
s.OSENECESITANLENTESDEAUMENTOULTRAVIOLETA s3ENSORESTABLEDEVIDAPROLONGADA
s#ALIBRACIØNAUTOMÉTICAYREINICIOA
s#ALIBRACIØNAUTOMÉTICAYREINICIO
NIVELESAMBIENTE
ANIVELESAMBIENTE
sNIVELESDESENSIBILIDADAJUSTABLES
ACT795UV
sNIVELESDESENSIBILIDADAJUSTABLES
s"OMBAMECÉNICAVERDADERA
s"OMBAMECÉNICAVERDADERA
s3ENSORESTABLEDEVIDAPROLONGADA
s&UNCIØNDEOPERACIØNSILENCIOSA
INDICADORDEBATERÓABAJA
s#ERTIFICADOPOR
s&UNCIØNDEOPERACIØNSILENCIOSA
3!%*
s#ERTIFICADOPOR3!%*
ACT760A
s#ERTIFICADOPOR%.
s#ERTIFICADOPOR
s#ERTIFICADOPOR#%
%.
ACT785A
s#ERTIFICADOPOR#%
ACT795UV
ACT785A
0.05 onz./yarda (R134a),
0.05 onz./yarda (R134a),
0.025 onz./yarda (R22)
0.03 onz./yarda (R22)
3 LED ultravioleta
—
Modo ultravioleta
395 a 415 nm
—
Largo de onda ultravioleta
>300 horas
>300 horas
Vida útil del sensor
4 pilas alcalinas AA
4 pilas alcalinas AA
Suministro eléctrico
8 horas continuas
8 horas continuas
Duración de las baterías
—
<20 segundos
Tiempo calentamiento
17 pulg.
17 pulgadas
Largo de sonda
1.5 (.68)
1.5 (.68)
Peso, lb. (kg)
3 años (2 para el sensor)
3 años (2 para el sensor)
Garantía
Pantalla digital con 7 segmentos (1 a 9) Pantalla digital con 7 segmentos (1 a 9)
Pantalla numérica
LED visual de la sonda
Sí
Sensor cercano a la alarma
Incluido
Incluido
Caja de transporte
Rango de sensibilidad
ADVERTENCIA
EAK0029C01AB
ACT71-0A
Equipo de servicio (R134a y R12)
Detectores de fugas de gas refrigerante
Especificaciones
EAK0030C01AB
ACT760A
0.05 onz./yarda (R134a),
0.03 onz./yarda (R22)
—
—
>300 horas
4 pilas alcalinas AA
8 horas continuas
<20 segundos
17 pulgadas
1.5 (.68)
3 años (2 para el sensor)
—
—
—
ACT120A
Balanza de carga electrónica
ACT120A Balanza electrónica
para refrigerante.
s5TILIZARCONREFRIGERANTES2
O2A
s,EELACANTIDADDETRANSFERENCIA
DURANTELASOPERACIONESDE
CARGAYRECUPERO
s,ECTURAENLIBRASOKILOGRAMOS
s&UNCIØNDEAPAGADOAUTOMÉTICO
ALASHORAS
Especificaciones
Capacidad,
libras (kg)
ACT120A
240 (110 kg)
±.16 onz (±0.01 kg) o
0.1% de lectura (el que
sea mayor)
0.01 lb. (0.01 kg)
Resolución
Temperatura de 32° F a 120° F (0° C a
49° C)
operación
9" (228.6 mm) cuadrada
Plataforma
Suministro
Batería de 9 V (incluida)
eléctrico
Duración de las
40 horas aprox.
baterías
Precisión
Mk]hjgl][[af\]k]_mja\Y\ lYflg]dmkmYjag[gegh]jkgfYk[]j[YfYk!
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
439
AIRE ACONDICIONADO
Equipo de servicio (R134a y R12)
ACTUVPROKT Juego de inyección UV medido.
s3OLUCIØNDEINYECCIØNDETINTADENUEVATECNOLOGÓA
s!PRETARELGATILLOUNAVEZDEMANERAPRECISAPORAPLICACIØN
s-ÉSPRECISAQUELASPISTOLASDECALAFATEADO
s)NCLUYECARTUCHODEGRANCAPACIDADDEONZASQUECUBRE
96 aplicaciones
ACTUVPRO12
s#ARTUCHODETINTADEONZAS
para ACTUVPROKT
ACTUVPRO
s0ISTOLADEINYECCIØNSØLOPARA
ACTUVPROKT
ACTUVPROKT
ACTUVQUADKT
ACTUVMINI4
ACTUVLED
Juegos de detector de pérdidas ultravioletas (Luz LED)
ACTUVQUADKT Juego de detector de pérdidas ultravioleta–Blue-Point®.
tIncluye 4 luces ultravioleta de LED, mini inyector de tinta, cartuchos de tinta para
aire acondicionado, manguera con acoplador R134a, adaptador R12, 1 onza de tinta
para líquido refrigerante,1 onza de tinta para aceite/combustible/ATF, 10 etiquetas de
servicio de aire acondicionado y anteojos de protección contra los rayos UV
ACTUVMINI4 Juego de miniluz UV de LED flexible y anteojos contra
rayos UV–Blue-Point.
s La luz de LED brillante con sonda flexible de 12" permite acceder a lugares difíciles
sEmpuñadura con agarre cómodo y botón de encendido y apagado ubicado para
practicidad del usuario
s)NCLUYELUZFLEXIBLEYANTEOJOSDEPROTECCIØNCONTRALOSRAYOS56
ACTUVLED Juego de luz UV con LED–Blue-Point.
s Incluye una luz UV giratoria inalámbrica con LED ultra brillante (ACTUVLED8) más una
batería recargable, cargador de batería y anteojos para rayos UV
ACTUVC10 Cartucho de tinta.
s Cartucho de tinta de 10 aplicaciones con 10 etiquetas de servicio de aire acondicionado
ACTUVINJKT
ACTUVINJKT Juego de detección de pérdidas para aire
acondicionado–Blue-Point.
s Detecta las pérdidas de refrigerante del aire acondicionado de manera rápida y fácil
s,ATINTAUNIVERSALPARAAIREACONDICIONADOESTÉAPROBADAPOR3!%Y
OEMIncluye:
s4INTAUNIVERSALPARAAIREACONDICIONADOPARARELLENARAUNMÉXIMODE
vehículos ACTUVKITRHT
s%XCLUSIVOINYECTORESTILOPISTOLAYCARTUCHODETINTA
s0OTENTELUZDE7,UXEON®
s#OMPATIBLECONTINTASFLUORESCENTES
s!DAPTADOR2A
s!NTEOJOSPARARAYOS56
s!UTOADHESIVOSDESERVICIO
s#ØMODACAJADEALMACENAMIENTO
ACTUVKITHRT–Blue-Point
s#ONSTADECARTUCHOSDEONZA
Juego de detector de pérdida
ultravioleta
(Luz de alta intensidad)
ACTUVDYEKIT UV Juego de
detección de pérdidas–
Blue-Point. Incluye una luz de alta
intensidad (ACTUVDYEKIT1), inyector de t
inta y cartucho con 25 aplicaciones,
ACTUVDYEKIT
manguera con acople R134a
(ACTUVDYEKIT2), adaptador R12
(ACTUVDYEKIT4), 25 etiquetas de servicio
de aire acondicionado (ACTUVDYEKIT5), limpiador de tinta (CLEAN1SM),
anteojos de protección contra rayos UV (GLASS20BKY) y caja de
almacenamiento (ACTUVDYEKIT6).
ACTUVDYEKT1 Luz UV de alta intensidad.
s La luz compacta de alta densidad de 12 V CC/50 W llega a los lugares más difíciles
s%LCABLEENBOBINASEEXTIENDEHASTAgCONGANCHOSDESUJECIØNALA
bateríaACTUVDYEKT2 Manguera de inyección.
s Manguera con acoplador R134a para ACTUVDYEKIT
ACTUVDYEKT3 Empuñadura de reemplazo para inyector.
s Empuñadura de reemplazo para inyector de tinta de ACTUVDYEKIT
ACTUVDYEKT4 Adaptador para R12.
s Adaptador R12 para ACTUVDYEKIT
ACTUVDYEKT5 Etiquetas de servicio de aire acondicionado.
s Paquete de 25 etiquetas de servicio de aire acondicionado para ACTUVDYEKIT
ACTUVC25 Cartucho de tinta.
s Cartucho de tinta de 25 aplicaciones con 25 etiquetas de servicio de
aire acondicionado
GLASS20BKY Anteojos de seguridad.
s Armazón negra con lentes ámbar
440
ACTUVGUNA
ACTUVKITA
ACTUVGUNA8
Juego de detector de pérdida ultravioleta
sInyecte tinta en el puerto lateral bajo en automóviles con sistema
de aire acondicionado, haga circular y verifique si hay pérdidas
con la miniluz UV
s$ETECTEPÏRDIDASDEONZAPORA×O
sUtilice tintas opcionales para verificar pérdidas en motores,
transmisiones, sistemas hidráulicos y sistemas de dirección hidráulica
ACTUVKITA Juego de detector de pérdidas
ultravioleta de R12/R134a–Blue-Point Incluye:
ACTUVGUN3 Pistola en inyección
ACTUVGUN5 Adaptador pistola inyección R134a
ACTUVGUNA7 Adaptador pistola inyección sistema R12
ACTUVGUNA8 Cartucho de tinta universal (8 onzas)
ACTUVLITE4 Lupa UV
ACTUVLITEA8 Luz UV giratoria (12 voltios, 50 W)
ACTUVLITEA9 Caja de almacenamiento
ACTUVGUNA Juego de pistola de inyección–BluePoint Incluye:
ACTUVGUN3 Pistola en inyección
ACTUVGUN5 Adaptador pistola inyección R134a
ACTUVGUNA7 Adaptador pistola inyección sistema R12
ACTUVGUNA8 Cartucho de tinta universal (8 onzas)
www.snapon.com/shoptools
AIRE ACONDICIONADO
=imahg\]k]jna[ag J)+,YqJ)*!
;Yjlm[`gk\]laflYhYjY\]l][lgj\]hj\a\Yk
mdljYnagd]lY'9[[]kgjagk
Pieza No.
ACTUVGUN3
ACTUVGUN5
ACTUVLITEA8
ACTUVGUNP1
ACTUVGUNP2
ACTUVGUNP3
ACTUVGUNP4
ACTUVGUNE1
ACTUVGUN2
ACTUV10PAK
YAUVCOOL
YAUV4N1
ACTUVKITJR1
ACTUVKITJR2
Descripción
Pistola de inyección
Adaptador pistola inyección R134a
Miniluz giratoria UV 12V, 50W
Cartuchos de aceite PAG/Viscosidad 46 (seis, 8 onz.)
Cartuchos de aceite PAG/Viscosidad 100 (seis, 8 onz.)
Cartuchos de aceite PAG/Viscosidad 125 (seis, 8 onz.)
Cartuchos de aceite PAG/Viscosidad 150 (seis, 8 onz.)
Cartuchos de aceite Ester/Viscosidad 100 (seis, 8 onz.)
Cartucho de tinta universal para aire acondicionado (4 onz.)
Cartuchos de tinta universal (diez, 1/4 onz.)
Cartuchos de tinta de líquido refrigerante. (seis, 1 onz.).
Cartuchos de tinta accesorios para motor/transmisión/
sistema hidráulico dirección del motor. (seis, 1 onz.).
Cartuchos de tinta para aire acondicionado (seis, 1/4 onz.)
Cartuchos de tinta para aire acondicionado (seis, 1 onz.)
Dafl]jfYkmdljYnagd]lYk–:dm]%Hgafl®
ECFUVLITE Juego súper compacto de linternas de
detección de pérdida de UV.
s&OCO,%$DEALTAINTENSIDADCONUNA
VIDADESERVICIODEHORAS
sCOMPARABLEALÉMPARASDE7DEALTA
INTENSIDAD
s#OMPATIBLECONTODASLASTINTASDEDETECCIØNDE ECFUVLITE
PÏRDIDAESTÉNDARES
s!LCANCEDEINSPECCIØNDEHASTA'
s3EINCLUYENBATERÓAS!!!YLUPAFLUORESCENTE
ECFUV150 Linterna de detección de pérdidas UV.
s4ECNOLOGÓA,%$DEMUYALTAINTENSIDAD
sVECESMÉSBRILLANTEQUELASLUCES
,%$NORMALES
s0OTENCIACOMPARABLEALÉMPARAS
DE7
s!LCANCEDEINSPECCIØNDEHASTA'
ECFUV150
s#OMPATIBLECONTODASLASTINTASESTÉNDARES
s3EINCLUYELUPAFLUORESCENTEYCARGADOR
ECFUVDUAL Linterna de detección de pérdidas UV.
s$ETERMINAFUGASDEAIREACONDICIONADO
ACEITECOMBUSTIBLE!4&03COMPONENTES
HIDRÉULICOSREFRIGERANTEYDELA
CARROCERÓADELAUTOMØVIL
s5TILIZARCONLÉMPARAAZULCONTINTA
FLUORESCENTELÉMPARABLANCAPARALA
INSPECCIØNGENERALDECOMPONENTES
s,OS,%$DEHORASNUNCA
NECESITANREPUESTOS
s!LCANCEDEINSPECCIØNULTRAVIOLETADEHASTA
ECFUVDUAL
'AM
s4RABAJACONPILASALCALINAS!!!INCLUIDAS
s,INTERNAFUNDAYLUPAFLUORESCENTEINCLUIDAS
Bm]_g\]k]jna[ag\]d[gd][lgj–:dm]%Hgafl
ACT1234PKT Juego de reparación del
colector.
s)NCLUYEVARIOSREPUESTOSDELENTESPERILLAS
ANILLOS/JUNTASYMÉS
s5SARPARADARSERVICIOACALIBRADORESDEL
COLECTOR!#42!#4#!#42Y
!#4
ADVERTENCIA
ACTR5150A Juego de calibrador digital del
colector (R134a).
s-UESTRALASCAPACIDADESDELREFRIGERANTEYELACEITE
s0ANTALLA,#$GRANDEYFÉCILDELEERQUEMUESTRALAS
LECTURASDEPRESIØNYVACÓOPARA2A
s#OLECTORCONBLOQUEDEALUMINIODEALTACALIDAD
s2EALIZALAVERIFICACIØNDEPÏRDIDASDELSISTEMAAL
CONCLUIRELPROCESODEEVACUACIØN
s%LGANCHODESERVICIOPESADOSEPLIEGAYSE
GUARDAENLAPARTETRASERA
ACTR5150A
s#APUCHØNDEGOMAPARAPROTECCIØNADICIONAL
s)NCLUYECOLECTORDIGITALMANGUERASDE"Y
ACOPLADORESMANUALESENUNACAJADEALMACENAMIENTO
;YdaZjY\gj]k\]hjm]ZY\][gd][lgj J)+,Y!
ACTR5134 Juego calibrador de colector.
s%XTRAGRANDE
s#ARADELCALIBRADORDEMMYVIDRIO
SOBREDIMENSIONADOPARAMEJORVISIBILIDAD
s6ÉLVULASDECOLECTORGRANDESTIPOPELOTADE
DEGIROPARAABRIRCERRAR
s!COPLADORESMANUALESALTOSYBAJOSPARA
CONEXIONESRÉPIDAS
s,ASMANGUERASDE"DENILØNROJAYAZUL
ACTR5134
CUMPLENCONLASNORMASDE%0!3!%Y5,
s-ANGUERADECARGADE"AMARILLA
ACTR4151 Calibrador del conector–Blue-Point.
s,OSACOPLESMANUALESESTÉNACTIVADOSCONRESORTE
PARAELIMINARDA×OSALAVÉLVULADESERVICIO
s#UERPODEALUMINIOTROQUELADOCONUNIONESDE
PLANCHASSØLIDAS
s,OSCALIBRADORESANTIONDEODESILICONASDELLADO
SUPERIOREINFERIORMMREDUCENLASVIBRACIONES
s%LVIDRIOPERMITEELMONITOREOVISUALDELFLUJODEL
REFRIGERANTE
s-ANGUERADECARGADE"-ANGUERADECARGA
ACTR4151
AMARILLAMÉSMANGUERASDE"ROJASYAMARILLAS
ACTR4131 Juego del múltiple del aire
acondicionado–Blue-Point.
s,OSCALIBRADORESANTIONDEOREDUCENELMOVIMIENTO
s0ERILLASCONSTRUIDASTOTALMENTEENMETALCOLOCADAS
ENLOSLATERALESDEFÉCILAGARRE
s,AVÉLVULATIPOPISTØNQUEFLOTALIBREMENTEREDUCEEL
DESGASTEDELOSANILLOS/
s!COPLESMANUALES2A
s,ASMANGUERASCONCAPAINTERNADENILØNDE"
CUMPLENCONLASNORMASDE%0!3!%Y5,
s,AMANGUERAAMARILLAINCLUYEUNAVÉLVULADECIERRE ACTR4131
ACTR4772-3 Acoplador rápido superior.
ACTR4772-2 Acoplador rápido inferior.
;YdaZjY\gj\]hjm]ZY\][gd][lgj J)+,Y'J)*!
ACT1234PKT
;YdaZjY\gj\]hjm]ZY\][gd][lgj J)*!
ACT9500C Calibrador del colector.
s#UERPODEALUMINIOEXTRUIDOCONCALIBRADORESDEMM
s%LVIDRIOLEPERMITEVERCØMOFLUYEELREFRIGERANTE
s6ÉLVULASTIPO3CHRADERINCORPORADAS
s-ANGUERADECARGADEAMARILLA
s-AGUERADECARGADE”AMARILLAMÉSMANGUERA
DE”ROJASYAZULES
;YdaZjY\gj]k\a_alYd]k\]d[gd][lgj J)+,Y!–
:dm]%Hgafl
ACT9500C
ACT51234 Calibrador de prueba de colector de R12/R134a.
s,OSTRESJUEGOSDEMANGUERASDE"ROJASAZULESMÉSDE"
AMARILLAPERMITENUNINTERCAMBIOREALENTRELOS
REFRIGERANTES2Y2A
s6ÉLVULASDECOLECTORGRANDESPOSITIVASTIPO
PELOTADEDEGIROPARAABRIRCERRAR
s6IDRIOSOBREDIMENSIONADOPARAMEJORVISIBILIDAD
s#ARADELCALIBRADORDEMMPARAMEJOR
VISIBILIDAD
s,OSACOPLADORESMANUALESALTOSYBAJOSPARA
CONEXIONESRÉPIDAS
ACT51234
s-ANGUERASDENILØNCUMPLENCONALASNORMAS
DE%0!3!%Y5,
Mk]hjgl][[af\]k]_mja\Y\ lYflg]dmkmYjag[gegh]jkgfYk[]j[YfYk!
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
441
AIRE ACONDICIONADO
Equipo de servicio (R134a y R12)
ACTRB72
ACTRY96
ACTB72
ACTB72A
ACTR72A
Mangueras de repuesto (R134a)
Mangueras de reemplazo (R12)
s-ANGUERASDEBAJASATURACIØNPARACONEXIONESDEEQUIPOSINTERNOS
s5NIONES!#-%DE
s,ASMANGUERASCUMPLENCON3!%*
ACTRR72 2OJAgDELARGO
ACTRR96 2OJAgDELARGO
ACTRB72 !ZULgDELARGO
ACTRB96 !ZULgDELARGO
ACTRY72 !MARILLAgDELARGO
ACTRY96 !MARILLAgDELARGO
s,ASMANGUERASDEgINCLUYENVÉLVULASDECIERREMANUALDEDEGIRO
s#UMPLENCONLANORMA3!%*
s,ASMANGUERASDEgYgTAMBIÏNESTÉNDISPONIBLESCONVÉLVULAS
DECIERREAUTOMÉTICO
ACTB72 6ÉLVULADECIERREMANUALDEgAZULDEGIRO
ACTB72A 6ÉLVULADECIERREAUTOMÉTICODEgAZUL
ACTR72A 6ÉLVULADECIERREAUTOMÉTICODEgROJA
ACTY72 6ÉLVULADECIERREMANUALDEgAMARILLODEGIRO
ACTY72A 6ÉLVULADECIERREAUTOMÉTICODEgAMARILLO
ACT9006
ACT9005
ACTR12345C
Bombas de vacío (R134a/R12)–Blue-Point®
ACT2100
ACTMAN2100
Herramientas para plegar mangueras de aire acondicionado
ACT2100 Juego de plegadores hidráulicos de mangueras
de aire acondicionado–Blue-Point.
s0LIEGAOINSTALALAMAYORÓADELASUNIONESCONPÞASOCUENTAS
s0ERMITEALUSUARIOCREARMANGUERASDEAIREACONDICIONADODELARGO
ESTÉNDAROPERSONALIZADO
s%LJUEGOCONTIENELAHERRAMIENTAHIDRÉULICAMANUALPARADOBLAR
MANGUERAS!#4JUEGOSDETERRAJASPARAUNIONESESTÉNDARES
YJUEGOSDETERRAJASPARAUNIONESDEBARRERAREDUCIDA
ACTMAN2100 Juego de plegadores manuales de
mangueras de aire acondicionado–Blue-Point.
s6ERSIØNMANUALDELPLEGADORHIDRÉULICODEMANGUERAS!#4
s3EMONTAFÉCILMENTEALBANCODETRABAJOOSESOSTIENEDEMANERASEGURA
ENUNSOPORTE
s)NCLUYEUNJUEGOCOMPLETODETERRAJASQUECUBRENLOSTAMA×OSDE
MANGUERAESTÉNDAR.ªY
ACT21001 Herramienta para plegar mangueras.
s(ERRAMIENTAHIDRÉULICAMANUALPARAPLEGARMANGUERASDEAIREACONDICIONADO
OINSTALARNUEVASUNIONESENMANGUERASDEAIREACONDICIONADO
Pieza No.
ACT21002
ACT21003
ACT21004
ACT21005
ACT21006
ACT21007
ACT21008
442
Descripción
Tamaño de la unión Tamaño de la manguera
5/16" (estándar),13/32"
Juego de terrajas estándar/ N.° 6 (estándar),N.° 8
de barrera reducida
(barrera reducida)
(barrera reducida)
13/32"
Juego de terrajas estándar
#8
1/2"
Juego de terrajas estándar
#10
5/8"
Juego de terrajas estándar
#12
Juego de terrajas de
5/16"
#6
barrera reducida
Juego de terrajas de
1/2"
#10
barrera reducida
Juego de terrajas de
5/8"
#12
barrera reducida
ACTR12345C Bomba de vacío.
s%LDISE×ODEETAPASDISMINUYELAPRESIØNDEBOMBEOPARA
OBTENERUNVACÓOMÉSPROFUNDO
s,AVÉLVULADERETENCIØNINTERNADETIENELASALIDADEACEITEEN
CASODEUNAINTERRUPCIØNDELAALIMENTACIØNELÏCTRICA
s!CCESOALPUERTODELLENADODEACEITECENTRALDESDELAPARTE
DELANTERAYDESDELOSCOSTADOS
s!LOJAMIENTOLIVIANOYDURADERODEALUMINIOFUNDIDOAPRESIØN
s)NTEGRALALISTADE5,
Especificaciones
Capacidad de aire libre, pcm (l/min)
Capacidad de aceite
Escape
Dimensiones
Requerimientos eléctricos
Motor de bomba, hp
Puerto de entrada
Velocidad de la bomba
Vacío máximo
ACTR12345C
1.5 (42.4)
10 onz. (0.25 kg)
1/2" NPT
5" x 12" x 9"
120 VCA, 60 Hz.
1/6
1/4" SAE y 1/2" ACME
3,450 RPM
50 micrones
ACT9005 Bomba de vacío.
s"OMBADEUNASOLAETAPADEALTAEFICIENCIADE0#s6ACÓOMÉXIMODEMICRONES
sTAMA×OSDEPUERTODEENTRADA3!%Y!#-%
s,AVÉLVULAESTABILIZADORADEGASEVITALACONTAMINACIØNDELACEITE
s0UERTODELLENADODEACEITEDEFÉCILACCESO
s(0
s-OTORDE6#!
s0ESOLIBRASCAPACIDADDEACEITEONZAS
ACT9006 Bomba de vacío.
s"OMBADEETAPASDEALTAEFICIENCIADE0#s6ACÓOMÉXIMODEMICRONES
sTAMA×OSDEPUERTODEENTRADA3!%Y!#-%
s0UERTODELLENADODEACEITEDEFÉCILACCESO
s-OTORDE(0Y6#!
s0ESOLIBRASCAPACIDADDEACEITEONZAS
www.snapon.com/shoptools
AIRE ACONDICIONADO
=imahg\]k]jna[ag J)+,YqJ)*!
:geZYk\]nY[g J)+,Y'J)*!
ACT28B Bomba de vacío neumática–
Blue-Point®.
s%XTRAEIMPUREZASYHUMEDADDELOSSISTEMAS
de aire acondicionado durante evacuaciones
s/PERACONHASTA03)'
s%LCONSUMOESDE0#%-ELFLUJODEVACÓO
1/3 hp a 28"
s%NTRADADEAIRE".04
s%NTRADADEVACÓO"5.#
L]jee]ljgk
ACT28B
@]jjYea]flYk\]f[d]g\]n~dnmdY J)+,Y'J)*!
ACT1297 Juego de herramientas de núcleo de válvula
maestra (R134a/R12).
tSu diseño único ofrece un dispositivo de traba que mantiene el eje
en posición al remover o instalar el núcleo de la válvula
sPermite remover e instalar núcleos de
válvula Schrader en sistemas
completamente cargados
Incluye:
s Adaptador superior GM/Ford R12 (1/4" x 3/16")
s Adaptador superior Ford R12 (1/4" x 1/8")
s Conector superior R134a (16 mm)
s Conector inferior R134a (13 mm)
s Conector giratorio 1/4" FL
s Caja para almacenamiento de los
componentes del grupo
ACT1297
s Conjunto de instalación/remoción de núcleo de
válvula de hueco largo GM
s Conjunto de instalación/remoción de núcleo de válvula JRA R134a
s Conjunto de instalación/extracción de núcleo de válvula inferior Eton R134a
s Conjunto de instalación/extracción de núcleo de válvula superior
Eton R134a
ACT2105 Juego de servicio tubos de orificio.
s)NSTALARYREMOVERCUALQUIERTIPODE
tubo de orificio
s2EMOVERPANTALLASYTUBOSROTOS
sIncluye eje con punta de broca,
extractor GM, extensión de bronce,
extractor, eje de remoción, tuerca de
remoción y caja de almacenamiento
TEMP2A
TEMP2A Termómetro digital–Blue-Point.
s5TILIZARENSISTEMASDEAIREACONDICIONADOSISTEMASDEREFRIGERACIØNY
otras aplicaciones
s,EELATEMPERATURADELOSLÓQUIDOSSØLIDOSYGASES
s0ANTALLADEFÉCILLECTURAENª&Yª#
s)MÉNLACUBIERTAMANTIENEFIJALAUNIDAD
s,ACUBIERTADELAPUNTAPROTEGELASONDADURANTEELALMACENAMIENTO
s#UMPLECONLASNORMAS#%
TEMP3A Termómetro digital–Blue-Point.
sPara ver la temperatura del aire de la ventilación
central por debajo del capó al colocar el sensor
externo en la ventilación central
sCompare la temperatura exterior con
la temperatura de descarga del aire
acondicionado
s3ENSORINTERNOINCORPORADO
sSensor externo con cable de extensión de 10'
s-EMORIA-·.-­8PARAAMBOSSENSORES
s5TILIZABATERÓAS!!!ESTÉNDARINCLUIDAS
s0ANTALLAAMPLIARETROILUMINADACONRELOJ
TEMP3A
s#UMPLECONLASNORMAS#%
Especificaciones
TEMP2A
TEMP3A
Rango de
-58° a 300° F (-50 a 150° C)
-58° a 158° F (-50 a 70° C)
temperatura
± 0.1° F (± 0.1° C)
+/- .1° F (+/- .1° C)
Resolución
± 2.0° F (± 1.0° C)
+/- 1.8° F (+/- 1.0° C)
Precisión
Tiempo de respuesta Se actualiza cada 1.5 segundos Se actualiza cada 1.5 segundos
MTACDC1-1
AAA
Batería
Ahorrador de batería Apagado automático luego de
—
35 minutos
3 1/2" (89 mm)
—
Largo de sonda
7" (178 mm) con caja
—
Largo total
TEMP10 Termómetro digital de bolsillo–
Blue-Point.
s-IDELÓQUIDOAIREYTEMPERATURADELASUPERFICIE
por medio de una sonda fuerte de acero inoxidable
s0ANTALLADIGITALPARAUNAFÉCILVISUALIZACIØN
N~dnmdY\]ljYfkeakgj\]Za\f
ACT2105
s,ACABEZADEVISUALIZACIØNANGULARSEPUEDEROTAR
ACT413A Válvula de transmisor
s#ONVIERTEDEGRADOS&AHRENHEIT&A#ENTÓGRADO#
de bidón.
s2ANGOSDETEMPERATURAª&Aª&ª#Aª#
s0ARABIDONESDECARGA2A"), R12 (2
sEstuche de transporte plástico
1/2") de aceite (2"ESTÉNDARDE%%55
sIncluye puertos de 1/2" ACME-M y de 1/4" FL-M
ACT73A Termómetro tipo cuadrante de
sLa válvula de retención de seguridad interna evita
escala doble–Blue-Point.
TEMP10
el reflujo en el sistema
s'AMAª&HASTAª&ENINCREMENTOSDEª
ACT413A
sFabricada con material compuesto y puertos de bronce
sVerifica temperatura del condensador, aire
s)NCLUYEINSERTOPARABIDONESMÉSPEQUE×OS
externo, y potencia refrigerante
s" de diámetro
Afq][lgj\]Y[]al] J)+,Y!
ACT83A Termómetro tipo
ACTR82375 Inyector de aceite.
cuadrante–Blue-Point.
s5SEPARAAGREGARACEITEREFRIGERANTEO
ACTR82375
ACT73A
grandes cantidades de tintas de detección de pérdida ultravioleta al s'AMAª&HASTAª&ENINCREMENTOS
DEª
sistema de aire acondicionado
sSe adapta rápidamente a grupos de calibrador de múltiple o a equipos de carga sSumergir los pivotes alrededor de 2"
ENLÓQUIDOS" en gases
s2OSCAMACHO!#-%DE" x rosca hembra R134a de 13 mm en el
s" de diámetro
lado inferior
ACT83A
ACT2030 Comprobador de
s#APACIDADDEONZAS
temperatura de aire acondicionado–Blue-Point.
s5SEÞNICAMENTE2A
sDetermina el desempeño de los sistemas de aire acondicionado de
K]jna[ag\]]eZjY_m]qk]ddg J)*!
manera rápida y sencilla
ACT1300A Juego de extracción de
sMicroprocesador compara la temperatura
aire acondicionado y embrague.
de la ventilación de aire acondicionado y la
sSimplifica la extracción/instalación del
temperatura ambiente
aire acondicionado, el embrague del
s!PAGADOAUTOMÉTICO
s)NCLUYETABLADEDIAGNØSTICOY
compresor y las placas de embrague
sugerencias técnicas
s0ROVEEELACCESOALASJUNTASDELEJE
s5SAUNABATERÓADE6INCLUIDA
sPara usar en compresores de aire
s'AMADEªAª&
ACT1300A
acondicionado Ford, Chrysler y GM
ACT2030
ADVERTENCIA
Mk]hjgl][[af\]k]_mja\Y\ lYflg]dmkmYjag[gegh]jkgfYk[]j[YfYk!
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
443
AIRE ACONDICIONADO
Herramientas de servicio del aire acondicionado
ACT106B
ACT1009A
ACT1008A
ACT119
ACT1046C
ACT111B
ACT118B
TR109
ACT1290A
ACT81290
ACT499A
R404
RF818SC
TLE80A
ACT407
CT4G
GOGGLE1
ACT1370
Adaptadores / Válvulas / Conectores
ACT106B Extractor de tubo de expansión.
tPara la mayoría de los modelos GM
sDELARGO
ACT1009A Extractor de tubo de orificio.
tSe usa como extractor de pantalla CCOT y FFOT
s5SARJUNTOCON!#4"
ACT1008A Herramienta para tubo de orificio.
tPara dar servicio a sistemas de aire acondicionado
sDELARGOACT119 Juego de conexión rápida.
tSimplifica la conexión a los acoples de servicio de los núcleos de las válvulas
s)NCLUYEUNACOPLADORRECTOYUNACOPLADORAªQUEACEPTACUALQUIERA
de los 2 adaptadores
Herramientas de servicio
ACT1046C Juego de limpieza.
sProporciona limpieza a presión de los condensadores, evaporadores y
LÓNEASDELREFRIGERANTEDESPUÏSDEQUEELSISTEMADEAIREACONDICIONADO
ESTÉCOMPLETAMENTEDESCARGADO
s$ISE×ADOPARATRABAJARCONCUALQUIERMATERIALDELIMPIEZALIVIANOQUE
pueda mezclarse con aire presurizado
s)NCLUYEPISTOLADEPRESIØNMANGUERACARTUCHOYADAPTADORDECARTUCHO
ACT111B Adaptador inyector de aceite del compresor.
s%LCUERPODEALUMINIOCONTIENEHASTAONZASDEACEITE
s5TILIZALAPRESIØNDIFERENCIALDELLADOSUPERIOREINFERIORDELSISTEMADE
aire acondicionado
ACT118B Juego de acople de traba de resorte.
t5NJUEGODEPIEZASAYUDAALADESCONEXIØNDELOSACOPLESDELA
LÓNEADELREFRIGERANTEENMUCHOSSISTEMASDEAIREACONDICIONADO&ORD
MODELOYPOSTERIOR
s#ODIFICADOPORCOLORROJOAZULNEGROYBEIGE
TR109 Herramientas para núcleo de válvulas.
t5SEPARAREMOVEROREEMPLAZARLOSNÞCLEOSDEVÉLVULASENSISTEMASDE
AIREACONDICIONADOHUECOGRANDE
sDELARGO
ACT1290A Herramienta de servicio de núcleo de válvula
universal.
t2EMUEVEYREEMPLAZALOSNÞCLEOSDEVÉLVULATIPO3CHRADERDETAMA×O
ESTÉNDARADEMÉSDELTAMA×OMÉSGRANDEDELOSSISTEMAS'ACT81290 Herramienta de servicio de núcleo de válvula
universal.
t5SEENNÞCLEOSDEVÉLVULAESTÉNDAR22AYNÞCLEOSDEVÉLVULAS
2ADEGRANCALIBRE*2!%!4/.
ACT499A Llave inglesa.
t,LAVECONPERNOSREGULABLESDISE×ADAPARACOMPRESORES'-2
s3EPUEDEAPLICARAALGUNOSEMBRAGUES'-7ARNER0ITTSY/GURA
444
R404 Llave de ojo de trinquete de refrigeración.
tTAMA×OSCUADRADOSCONOCIDOSY
s2ÉPIDAACCIØNDETRINQUETECONPALANCASDEREVERSOENAMBOS
extremos
RF818SC Llave de ojo de trinquete de refrigeración.
tPUNTASPARADARSERVICIOALASTAPASDEVÉLVULASDE
COMPRESORENEXTREMO
s#UADROHEMBRADEENELOTROEXTREMOPARAVEHÓCULOSSIN
VÉLVULAS3CHRADER
TLE80A Torx Dado de 6 puntas.
t0ARASUJETADORES4ORX%ENMUCHOSCOMPRESORES
s#UADRODE
TLE60A Dado de 6 puntas Torx
t0ARASUJETADORES4ORX%ENCOMPRESORES%ATONY9ORKDE
en adelante
s#UADRODE
ACT407 Enderezadora de aleta y limpiador.
t%STAHERRAMIENTAMULTICABEZAMANEJAY
ALETASPORPULGADA
sDELARGO
CT4G Comprobador de circuitos.
t0ARASISTEMASDEY6
s2EALIZAPRUEBASCONELMOTORAPAGADO
s#ABLEDECONPROTECCIØNCONTRATIRONES
GOGGLE1 Gafas de protección.
t!RMAZØNMOLDEADADURABLECONUNAPIEZAELÉSTICAFLEXIBLEQUE
se sella con comodidad para un calce perfecto alrededor de la
NARIZLASMEJILLASYLAFRENTE
s,ABANDATRASERASEAJUSTARÉPIDAYFÉCILMENTEALREDEDORDELACABEZA
s%LSISTEMADEVENTILACIØNINDIRECTODIRIGEELFLUJODEAIRESOBRE
las lentes
s4IENELENTES5VEX#™RECUBIERTASQUELOPROTEGENCONTRALA
niebla, las rayaduras y los rayos ultravioletas
s#UMPLECON!.3):
ACT1370 Juego de desconexión.
t)NCLUYEHERRAMIENTASPARADESCONECTARLOSACOPLESDERESORTE
en líneas de combustible
s#ONVENIENTEORGANIZADORPLÉSTICO
s%SÞTILPARALOSACOPLESDERESORTEDELOSSISTEMASDEAIRE
ACONDICIONADOCOMOASÓTAMBIÏNPARALOSCONECTORESDEEMPUJE
y traba en el radiador y en líneas de transmisión
s)NCLUYEHERRAMIENTASPARADESCONECTARLOSACOPLESDERESORTE
ENLASLÓNEASDEAIREACONDICIONADODE&ORD'-Y#HRYSLER
s4RABAJAENLÓNEASDECOMBUSTIBLEYPUEDEUTILIZARSECOMOCONECTOR
DEEMPUJEDETRABAENRADIADORESYLÓNEASDETRANSMISIØN
s,OSTAMA×OSINCLUIDOSSONY
®
www.snapon.com/shoptools
AIRE ACONDICIONADO
@]jjYea]flYkhYjYjY\aY\gj
SVTSRAD262A
SVTSRAD262U
RADKITPLUSA
RADKITPLUSJR
YA4505
s#ARGAELSISTEMARÉPIDAMENTEPASANDOLAMEZCLAPORELSIFØN
DIRECTAMENTEDESDEELRECIPIENTEDEMEZCLA
SVTSRAD262A Cargador de vacío del sistema de
s2EQUIEREUNSUMINISTRODEAIREDEPSI#&-
enfriamiento.
s)NCLUYECALIBRADOR6ENTURIYPROTECTORDECALIBRADORCONJUNTO
s%LIMINAELAIREATRAPADOENELSISTEMADEENFRIAMIENTOQUEPUEDE
DEMANGUERASDERECARGAADAPTADORESPARALAMAYORÓADELAS
CAUSARSOBRECALENTAMIENTO
APLICACIONESYADAPTADORCØNICODEAJUSTEUNIVERSALENCAJADE
s)DEALPARATALLERESESPECIALIZADOSENVEHÓCULOSOGARAJESMUNICIPALES
ALMACENAMIENTO
s%XPANDELAVERSATILIDADDELOSCOMPROBADORESDELSISTEMADE
RADKITPLUSJR Cargador de vacío del sistema de
ENFRIAMIENTO3643#
enfriamiento.
s%STÉNDISPONIBLESPORSEPARADOADAPTADORESPARACASITODOSLOS
s2EDUCEELTIEMPODECARGADELSISTEMAELIMINALASBURBUJASDEAIREY
VEHÓCULOSNACIONALESEIMPORTADOS
COMPRUEBASIHAYPÏRDIDASENELSISTEMA
s%LCALIBRADORRELLENOCONLÓQUIDOOFRECEUNALECTURAPRECISA
s%LTAMA×OCOMPACTOPERMITEACCESOENÉREASRESTRINGIDASDEBAJODELCAPØ
s)NCLUYECONJUNTODECUERPOPRINCIPALCONJUNTODEVENTURIYMANGUERA s%LADAPTADORCØNICOPERMITEQUELAUNIDADFUNCIONEENLAMAYORÓADE
CONJUNTODEMANGUERADESUCCIØNMANUALDEINSTRUCCIONESCONUNA
LOSVEHÓCULOSDEPASAJEROSYCAMIONESLIVIANOSDELOS%%55YDE
LISTACOMPLETADEADAPTADORES
OTROSPAÓSES
SVTSRAD262U Cargador universal del sistema de
s,AVÉLVULADECONTROLCONBOTØNPULSADORELIMINALANECESIDADDE
enfriamiento.
INTERCAMBIARLASMANGUERAS
s,AVERSIØNUNIVERSALNOREQUIEREADAPTADORESDELSISTEMADEENFRIAMIENTO s%LAIREDELTALLERPSIPERMITEOBTENERUNPOTENTEVACÓO
s)NCLUYECONOSESTILOUNIVERSALPARACUBRIRLAMAYORÓADELASAPLICACIONES
s%LIMINALANECESIDADDEPURGARELSISTEMA
RADKITPLUSA Cargador/vacío del sistema de
YA4505 Adaptador universal para radiador–Blue-Point.
enfriamiento.
s%LIMINAFÉCILMENTEELAIREATRAPADOENELSISTEMADEENFRIAMIENTOQUE s#OBERTURADEAPLICACIONESDEENAUTOSYCAMIONESLIVIANOS
s2EEMPLAZAADAPTADORESPARARADIADORCOSTOSOS
PUEDECAUSARSOBRECALENTAMIENTO
s0RUEBASDEVACÓOPARAREVISARSIEXISTENPÏRDIDASANTESDEREALIZAR s#OMPATIBLECONCUELLOSDERADIADOROTANQUESDEDEPØSITO
s3EPUEDEUTILIZARCONCARGADORESDELSISTEMADEENFRIAMIENTO
ELLLENADO
®
s,OSPROTECTORESDECALIBREAYUDANAEVITARELDA×OALOSBASTIDORESDE 2!$+)40,53!O2!$0,53!DE3NAPON BOMBADEVACÓOY
PRESIØN9!"YCOMPROBADORESPARAELSISTEMADEENFRIAMIENTO
LOSCALIBRADORES
s6ÉLVULADEVACÓOACTIVADAPORBOTØNPARAFÉCILOPERACIØNDELAVÉLVULA 3643!3643"Y3643#
;Yj_Y\gj\]nY[g\]dkakl]eY\]]f^jaYea]flg&
2009FPI
YA2090
LDTSP4
YA9190
YA7747
CG25
@]jjYea]flYkhYjYjY\aY\gjqlYhf\][gf_]dYea]flg
YA2090 Llave de tapa de radiador–Blue-Point.
t3UJETAYREMUEVETAPASDERADIADORESCONOSINALAS
s
YA9190 Dado universal del tapón de drenaje del
radiador–Blue-Point.
t%LEXTREMOCONDOBLERANURADEESTEDADOCONCUADRODE
SEAJUSTARÉALAMAYORÓADELOSTAPONESDEDRENAJESDELRADIADOR
QUETIENENALAS
s3EAJUSTAA!CURA(ONDA4OYOTA,EXUSYAOTRASMARCASIMPORTADAS
2009FPI Juego instalador de tapón de congelamiento.
s(ERRAMIENTADEINSTALACIØNDEDELARGOCONUNA
EMPU×ADURATIPOBOLILLAPARAUNAFÉCILUBICACIØN
sCABEZASINSTALADORASENTAMA×ODEYMM
YA7747 Adaptador neumático–Blue-Point.
s!CELERALAINSTALACIØNDELTAPØNDECONGELAMIENTO
s3EUTILIZACONELJUEGOINSTALADOR&0)
s%LVÉSTAGOESTILO0ARKERDEPERMITEUTILIZARLOCON
MARTILLOSNEUMÉTICOS
ADVERTENCIA
CG25 Extractor de tapón de congelamiento.
t4APONESDECONGELAMIENTODEHASTADEDIÉMETRO
s%LYUGODEDEESPESORRECIBEUNTORNILLOAUTORROSCANTEDE
DELARGO
s0RIMEROTALADREUNORIFICIODE
LDTSP4 Juego de accesorios de desconexión rápida.
s)NCLUYELOSTAMA×OSY
s!PLICACIONESVEHÓCULOS'-MODELOYPOSTERIORESMUCHOS
VEHÓCULOS$AIMLER#HRYSLERMODELOYPOSTERIORESALGUNOS
VEHÓCULOS-ERCEDESMODELOYPOSTERIORES62OD&REIGHTLINER
0ETERBILT6OLVOY7HITE,AÞTILACCIØNDELRESORTEMANTIENELA
HERRAMIENTAENLALÓNEAPARAQUESEAFÉCILDEUTILIZAR,OSDIENTES
ENCAJANPERFECTAMENTEENLATOLERANCIAAPRETADADELOSCONECTORES
*IFFYTITE#UANDOSEROTAPERMITETIRARDELALÓNEASINDA×AREL
CONECTOROELSUJETADORDERETENCIØN3EADAPTAALOSACCESORIOSMÉS
CONOCIDOSDE*IFFYTITEENLASLÓNEASDELREFRIGERANTEDEACEITEUTILIZADO
ENTRANSMISIONESYRADIADORESYENOTRASAPLICACIONES
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1
445
AIRE ACONDICIONADO
Comprobadores
AF102
Comprobadores de anticongelantes y líquido
de enfriamiento
EETA305B
AF102 Hidrómetro para anticongelantes.
t3EINDICAELGRADODEPROTECCIØNPORMEDIODEUNALECTURADIRECTA
NOREQUIEREESCALASCOMPENSANTESDETEMPERATURA
s2ANGODEª&Aª&
s)NCLUYEUNAESCALAENGRADOS#ELSIUS
s#OMPRUEBASOLUCIONESFRÓASYCALIENTES
EETA305B Refractómetro–Blue-Point®.
s$ETERMINACONRAPIDEZYPRECISIØNELPUNTODECONGELAMIENTODELA
SOLUCIØNANTICONGELANTESOBRELABASEDEPROPILENGLICOLYETILENGLICOL
s)NDICAELNIVELDECARGAENELÉCIDODELABATERÓA
s%LLENTEDEENFOQUEFACILITALALECTURADELAESCALA
s)NCLUYEUNACABEZAYPRISMADEACEROYVIDRIOUNAGARREPARADEDOS
DEGOMAYLENTEDEENFOQUECONRESGUARDODECAUCHO
s%SPECIFICACIØNDEGAMA0ROPILENGLICOLDEª&Aª&CON
DIVISIONESCADAªETILENGLICOLDEª&Aª&CONDIVISIONES
CADAª
GDCT16
YAUVCOOL Fluido detector de pérdidas.
s3EISBOTELLASDEONZADETINTAPARASISTEMASDEENFRIAMIENTOPARA
UTILIZARCON!#456,)4%!
GDCT16 Comprobador de pérdidas de combustión.
s/FRECEUNMODOFÉCILYRÉPIDODEDIAGNOSTICARLOSPROBLEMASDE
SOBRECALENTAMIENTODELMOTOR
s6ERIFIQUELAEXISTENCIADEPÏRDIDASENTRELACÉMARADECOMBUSTIØNY
ELSISTEMADEENFRIAMIENTO
s#OMPRUEBELAEXISTENCIADEPÏRDIDASDECOMBUSTIØNENLACABEZAY
JUNTAANTESDERETIRARELRADIADOR
s0ARAUTILIZARENMOTORESDIESELYAGASOLINAREFRIGERADOSPORAGUA
s%LJUEGOINCLUYECÉMARADEPRUEBACOMPLETABOTELLADEONZASDE
FLUIDODEPRUEBAEINSTRUCCIONES
GDCT161 Fluido detector de pérdidas.
s"OTELLADEONZASDEFLUIDODEPRUEBADEPÏRDIDASPARAEL
COMPROBADORDEPÏRDIDASDECOMBUSTIØN'$#4
SVTS262C
SVTS263
Comprobadores para el sistema de enfriamiento
SVTS262C Comprobador del sistema de enfriamiento.
s#OMPRUEBASILATAPAAPRESIØNYELSISTEMADEENFRIAMIENTOTIENEN
PÏRDIDASENUNAAMPLIAVARIEDADDEVEHÓCULOSDE%%55YDEOTROSPAÓSES
s,ATAPACUENTACONUNAPALANCAGIRATORIAPARAELAJUSTEDEPRESIØNFINO
s"OMBAMANUALCONCARACTERÓSTICASDEAJUSTEYCABEZADEL
COMPROBADORCONMANGUERADE"QUELEETANTOEN03)COMOENK0A
s%LMATERIALMEJORADODELACABEZADELABOMBAESRESISTENTE
ALACORROSIØN
s)NCLUYELOSADAPTADORESPARARADIADOR364!4!'-!Y
4!#MÉSLACAJADEALMACENAMIENTO
s2EMÓTASEALAHOJADEINSTRUCCIONES364#PARAOBTENERUN
LISTADOCOMPLETODELASAPLICACIONES
446
YAUVCOOL
Comprobadores de pérdidas–Blue-Point
SVTS263 Comprobador de presión del sistema de
enfriamiento, neumático.
s!CTUALIZACIØNNEUMÉTICAPARAELCOMPROBADORDELSISTEMADE
ENFRIAMIENTODELABOMBAMANUAL3643#
s)NCLUYEADAPTADORESDELSISTEMADEENFRIAMIENTOCOMUNES
4!"364!Y4!#
s5TILIZAAIREDELTALLERCONPRESIØNREGULADAPARAREALIZARLAPRUEBADEPRESIØN
ENLOSSISTEMASDEENFRIAMIENTOCONELOBJETIVODEDETECTARPÏRDIDAS
s,AREGULACIØNDEPRESIØNDEPRECISIØNPERMITEREALIZARLAPRUEBADE
MANERASEGURAENLOSSISTEMASPEQUE×OS
s,LENASISTEMASGRANDESENSEGUNDOS
s#OMPONENTESDEACEROINOXIDABLEENCHAPADOSENCROMOPARAUN
ACABADODURADERO
s#OMPATIBLECONLOSADAPTADORESDELSISTEMADEENFRIAMIENTOMÉSCOMUNES
s%LCONJUNTODELATAPACONRESORTEDELIBERACIØNDESEGURIDAD
RESTRINGELAPRESIØNAUNMÉXIMODEPSI
s%LCONVENIENTEGANCHOGIRATORIOPERMITECOLGARLAUNIDADPORDEBAJO
DELCAPØDELVEHÓCULO
www.snapon.com/shoptools
AIRE ACONDICIONADO
9[[]kgjagkhYjY[gehjgZY\gj]k
SVT262-28A
SVT262-29
TA34A
TA246A
TA46
TA47
TA58
TA445
TA16B
TA23A
TA18B
TA26A
TA27
TA31A
TA30A
TA32A
TA36GM
TA37
TA38C
TA39A
TA40
TA41
TA44
TA48
TA49
TA50
TA52
TA53
TA54
TA56
TA446
TA4503
TA245A
TA246A
TA345A
TA346A
TA4505
TA4504
TA33A
TA45
TA57
A4503A
9[[]kgjagkhYjY[gehjgZY\gj]k\]dkakl]eY\]]f^jaYea]flg
Los adaptadores para radiadores y adaptadores de tapa que se enumeran a continuación pueden utilizarse con los comprobadores del sistema
de enfriamiento SVTS262 y SVTS263. Para obtener un listado completo de las aplicaciones para modelos de años específicos, consulte el
manual de instrucciones del comprobador del sistema de enfriamiento SVTS262C.
Adaptador
para radiador
Adaptador de
tapa
Aplicación
Acura, Chevrolet, Chrysler/Dodge/Eagle/
Plymouth, Ford/Lincoln/Mercury, Geo, Honda,
Hyundai, Infiniti, Isuzu, Lexus, Mazda, Mitsubishi,
Nissan, Subaru, Suzuki y Toyota
SVT262-28A
SVT262-29
TA16B
TA23A
VW y Audi
TA18B
TA26A
TA27
—
TA31A
TA30A
TA32A
TA33A
Volvo, Saab, Jeep, Sterling y Renault
Camiones grandes Volvo con un cuello de
llenado roscado de 63 mm x 3 mm
VW
Buick, Cadillac, Chevrolet, Ford, International,
Mercedes, Oldsmobile, Pontiac y Saturn
Ford, Jaguar, Pontiac, Porsche, Range Rover
y Saab. Se utiliza con el adaptador de tapa
TA246A
TA34A
TA246A
TA36GM
TA37
TA38C
TA39A
TA41
TA40
TA44
TA45
TA46
TA47
TA48
TA49
TA50
—
ADVERTENCIA
Cadillac, Chevrolet, Geo, GMC, Pontiac, Oldsmobile
y Saturn. Se utiliza con el adaptador de tapa TA37
Acura, Chevrolet, Chrysler, Geo, Honda, Isuzu,
Lexus, Mazda, Mitsubishi, Suzuki y Toyota. Se
utiliza con el adaptador de tapa TA39A
Audi y VW. Se utiliza con el adaptador de tapa
TA40
Mercedes
Ford, Jaguar y Mazda. Se utiliza con el
adaptador de tapa TA47
Toyota
Camiones grandes Volvo con un cuello de
llenado con rosca macho de 48 mm x 3 mm
Adaptador
para radiador
Adaptador de
tapa
TA52
TA53
TA54
—
TA56
TA57
TA58
—
TA445
TA446
TA4503
—
TA245A
TA246A
TA345A
TA346A
TA450A
Juego de
adaptadores
para
camiones
TA4505
TA4504
A450-1A
Tapón de
goma
A450-2A
Junta de
goma
A4503A
Juego de
adaptadores
para GM
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1
Aplicación
Mazda 3 (2004 y posteriores) y Volvo S40/V50
(2004 y posteriores)
Camiones Freightliner con un cuello de llenado
con rosca macho de 60 mm x 3 mm
Cobalt SS (2005 y posteriores) y Saturn Ion
Redline (2004 y posteriores) con sistemas de
enfriamiento del sobrealimentador
Vans Dodge Sprinter 2007 que cuenten con un
cuello de llenado roscado de 42 mm x 2.5 mm
BMW serie 3 (2006 y posteriores), y series 5 y 6
(2005 y posteriores)
Carrocerías de autos X y J GM modelo 1980
BMW y Mercury. Se utiliza con el adaptador de
tapa TA246A
BMW y Range Rover
Para camiones con adaptadores de cuello de
llenado tamaño "B" (D.E. 2 11/16"). Incluye el
tapón de goma A450-1A.
Para camiones con adaptadores de cuello de
llenado tamaño "B" (D.E. 2 11/16")
Se utiliza con el juego de adaptadores para
camión TA450A o como tapón de reemplazo
para el juego de adaptadores A4503A para GM
Se utiliza con el juego de adaptadores para
camión TA450A o como junta de reemplazo para
el juego de adaptadores A4503A para GM
Comprueba la presión del sistema en los
sistemas de enfriamiento cerrados en las
carrocerías de autos GM 2.5L "X" y en
carrocerías de autos 1.8L "J"
447
AIRE ACONDICIONADO
Accesorios para comprobadores
TAB10022
TAB10025
TAB10031
TAB10034
TAB10036
TAB10245
TAB10041
TAB10044
Juegos de adaptadores de sistema de enfriamiento–Blue-Point®
Adaptador para radiador
TAB10022
TAB10025
TAB10031
TAB10034
TAB10036
TAB10041
TAB10044
TAB10046
TAB10048
TAB10052
TAB10056
TAB10245
TAB10345
TAB10445
Aplicaciones
VW, Audi y Porsche
Volvo, Saab y Jeep
VW 1990-1998
Ford, Jaguar, Saab y Saturn
GM, Ford, Jaguar, Mazda y Nissan
VW, Audi y Porsche
Mercedes-Benz y Chrysler
Ford, Jaguar y Mazda
Toyota Celica y MR2
Mazda y Volvo
Chevy Cobalt y Saturn Ion
BMW y Mercury anteriores a 1988
Modelos 1988 a 2006 de BMW y Range Rover
Vehículos BMW modelo 2005 y posteriores
TAB10046
TAB10048
TAB10345
TAB10052
TAB10056
TAB10445
SVTA17000
Juego de adaptadores del sistema de enfriamiento
SVTA17000 Juego de adaptadores del sistema
de enfriamiento.
tJuego de adaptadores complementarios para el juego de comprobadores
del sistema de enfriamiento SVTS262C
sLos 17 adaptadores fabricados en metal de alta calidad cubren vehículos
hasta 2006
sIncluye los adaptadores SVT262-28A, TA16B, TA18B, TA31A, TA34A, TA36GM,
TA38C, TA41, TA44, TA46, TA48, TA52, TA56, TA245A, TA445 y TA4503
sLa caja de almacenamiento (PBSVTA1417) tiene compartimientos de
almacenamiento adicionales para el conjunto de bomba y calibrador del
juego SVTS262C
PBSVTA1417 Caja de almacenamiento.
tCaja de almacenamiento para los juegos SVTAB1400 y SVTA17000
s#UBIERTAREMOVIBLEPARAVERLASHERRAMIENTAS
Juegos de adaptadores de sistema de enfriamiento de camiones
SVTAB1400
SVTAB1400 Juego de adaptadores del sistema de
enfriamiento–Blue-Point.
tLos adaptadores de la serie TAB se caracterizan por estar
formados por una combinación de metal/plástico, lo que los
convierte en una opción de bajo costo
s)NCLUYEADAPTADORESPARARADIADORFORMADOSPORUNA
combinación de metal/plástico
sLa caja de almacenamiento tiene compartimientos de
almacenamiento adicionales para ubicar el conjunto de bomba
y calibrador y 3 adaptadores originales del juego SVTS262C
s)NCLUYETODOSLOSADAPTADORESDELASERIE4!"MÉSELADAPTADOR
TA4503
sConsulte el manual de instrucciones para obtener una lista
completa de todas las aplicaciones
SVTA6100 Juego de adaptadores del sistema de
enfriamiento de camiones grandes.
tDiseñado para utilizar con SVTS262C, pero compatible con casi cualquier
comprobador del sistema de enfriamiento
s)DEALPARASERVICIOENGRANDESCAMIONES6OLVO+ENWORTH&REIGHTLINERETC
sPrueba la presión de los 8 cuellos de llenado diferentes que se encuentran
en camiones grandes y modernos cuando están junto con el adaptador
TAB10036 de los juegos SVTS262B, SVTS262C o SVTS263
sTambién puede combinarse con el comprobador de presión del sistema de
enfriamiento neumático SVTS263 para ofrecer casi el 100% de cobertura en
el motor
sIncluye los adaptadores TA27, TA50, TA54, TA32A, TA4505 y TA58 más el
manual de instrucciones en la caja de almacenamiento PBSVTA600
448
www.snapon.com/shoptools
SVTA6100
AIRE ACONDICIONADO
;gehjgZY\gj]k'@]jjYea]flYk\]k]jna[ag
;gehjgZY\gj]khYjY]dkakl]eY\]]f^jaYea]flg kakl]eY\]k]ddY\g\]
[~eYjY\]Yaj]!–:dm]%Hgafl®
SVT275 Comprobador del sistema de enfriamiento.
s El sistema de sellado de cámara de aire inflable permite su utilización en la mayoría de los
vehículos comerciales livianos y de pasajeros
s Prueba los tanques de alimentación y los sistemas de radiadores, así como las tapas tipo
rosca y estilo bayoneta
s Localiza pérdidas en juntas de la cabeza, núcleos del radiador y el calefactor, bastidores y
tapones de expansión, bombas de agua y mangueras
s Prueba la presión de descarga de las tapas y la condición de sellado
s Adecuado para aplicaciones marinas
s El tubo de drenaje de fluidos permite que el líquido refrigerante vuelva al depósito o sea
recolectado en forma segura para el reciclaje
s Prueba en ciclos a más de 1,500 inflaciones
s El juego incluye SVT2751 hasta SVT27514 (14 piezas) más una manguera de suministro de aire
y un manual de instrucciones en una caja de almacenamiento
Pieza No.
SVT2751
SVT2752
SVT2753
SVT2754
SVT2755
SVT2756
SVT2757
SVT2758
SVT2759
SVT27510
SVT27511
SVT27512
SVT27513
SVT27514
Descripción
Aplicación
—
Bomba de presión
—
Calibrador, 0 a 30 psi (0 a 207 kPa)
—
Cámara de aire de repuesto
—
Juego de juntas de válvula
—
Conjunto de cabeza
Extensión de cuello (azul)
Tanques de alimentación VW
Extensión de cuello (roja)
Microvehículos japoneses
Extensión de cuello (negra)
Tanques de alimentación Audi/VW
Adaptador de tapa (azul)
Bayoneta estándar, tanque de alimentación Ford, carrocería N GM
Adaptador de tapa (amarillo)
Tanques de alimentación de rosca externa Jeep, Saab, Audi/VW
Profundo para modelos japoneses pequeños, tanques de
Adaptador de tapa (verde)
alimentación interna Audi/VW
Poco profundo para modelos japoneses pequeños, tanques
Adaptador de tapa (rojo)
de alimentación de rosca externa Audi/VW último modelo
Adaptador de tapa (anaranjado)
BMW, Land Rover y Range Rover último modelo
Adaptador de tapa (gris)
Mercedes último modelo con adaptador tipo rosca
SVT275
;gjlY\gjYkqj]egn]\gjYk\]eYf_m]jY–:dm]%Hgafl
YA9344 Herramienta para desconectar la manguera de calefacción.
t Remueve las mangueras de calefacción con acoples de desconexión rápida de 3/4" o 5/8" del
núcleo del calefactor trasero en vans Dodge Caravan y Plymouth Voyager modelo
1987 y posteriores
sPuede alcanzar áreas de difícil acceso cerca del muro refractario de las vans de Ford Aerostar
modelo 1986 y posteriores, y de las vans Ford Econoline 1990 y posteriores
YA1000A Cortador multiuso.
tIdeal para cortar mangueras de calefacción, mangueras de combustible, alambres de cobre, tubos
de PVC, mangueras de limpiaparabrisas y mangueras para frenos de aire, además de cualquier
material resistente o semirresistente con un diámetro de 0" a 1 1/8"
tEmpuñadura con contornos cómodos con agarraderas plásticas
tGancho de alambre para un almacenamiento seguro: 9 5/8" de largo
PWC60 Cortador de manguera de palanca combinada.
t8 1/2" La acción combinada multiplica la presión normal de la mano para cortar con facilidad
muchos tipos de mangueras de goma o plástico de hasta 1 1/8" de diámetro
tIncluye hojas de cortadoras y componentes internos de acero inoxidable
HCR1 Herramienta de extracción de acoples de manguera de calefacción.
tExtrae los acoples rotos de la manguera de calefacción en motores GM
tPuede utilizarse con una llave de impacto
YA9344
YA1000A
PWC60
HCR1
DdYn]khYjY]eZjY_m]\]n]fladY\gj'Kghgjl]khYjYhgd]Y–:dm]%Hgafl
YA9325 Juego de llaves para embrague del ventilador Ford.
t Juego de 36 y 58 mm
s Incluye YA9325-1 y YA9325-2. Aplicaciones: Camiones de la serie E 4.9L (1984-1991), camiones
de la serie F 4.9L (1984-1992), Bronco II y Ranger 2.8L (1984-1985), Ranger 2.9L (1986-1992),
Aerostar 3.0L (1986-1988), Aerostar y Ranger 4.0L OHV (1990 y posteriores), Explorer 4.0L OHV
(1991 y posteriores), Mazda Navajo 4.0L OHV (1991-1994), Mazda B4000 4.0L OHV (1995 y
posteriores), Explorer 4.0L V6 SOHC (1997 y posteriores) y Mountaineer 4.0L V6 SOHC
(1998 y posteriores)
YA9325-1 Llave plana métrica. Tamaño de llave de 36 mm, 343 mm de largo.
YA9325-2 Llave de pie. Tamaño de llave de 58 mm, 58.7 mm de largo.
YA9521 Llave plana. Llave de 36 mm/48 mm, 356 mm de largo.
ADVERTENCIA
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
YA9325
YA9521
449
AIRE ACONDICIONADO
Herramientas de servicio
Llaves para embrague de ventilador/Soportes para
polea–Blue-Point®
YA9526
YA9980
YA6120
YA6160
YA6210
YA6180
FCT706
Llave para el embrague del ventilador
FCT706 Llave para embrague del ventilador.
t Llave para embrague de ventilador para motores de camiones de
servicio pesado
t El patrón de orificios de la herramienta se alinea con los
sujetadores en el cubo del ventilador
t Se utiliza con una llave de extremo abierto para quitar el
embrague del ventilador
t La longitud de 24 1/2" ofrece máxima palanca
t Aplicaciones: Modelos internacionales (VT365, T444E, DT466,
DT350 y HT530), Ford Power Stroke (7.6L y 6.0L), Detroit Diesel
(Serie 40) y John Deere
YA6180 Llave para embrague de ventilador–Blue-Point.
t Se utiliza en motores GM y Ford diesel y a gasolina con tuerca de
embrague del ventilador de 48 mm
t Brinda la palanca necesaria para extraer la tuerca del embrague
del ventilador
t El largo total es de 20 1/8" (511.2 mm)
t El ancho de la cabeza es 4 1/8" (104.8 mm)
t El espesor de la cabeza es 3/8" (9.5 mm)
HCP48CP
HCP9
YA9526 Llave para embrague del ventilador Ford.
t Llave de extremo abierto de 40 mm
t Se utiliza con YA9325-2 o YA9522
t Las aplicaciones incluyen las vans Econoline 4.9L (1992-1996) y
camionetas de la serie F 4.9L (1993-1996)
YA9980 Soporte para polea de embrague de ventilador
o bomba de agua.
t Se utiliza en vehículos con poleas embutidas
t Se utiliza en vehículos GM (4.8L V8, 5.3L V8, 6.0L V8 1999 y
modelos posteriores) y Chrysler (3.9L V6, 4.7L V8, 5.2L V8, 5.9L V8,
8.0L V10 1998 y modelos posteriores)
t No se puede usar en un automóvil Chrysler de 4.7L V8 que posea
repuestos de fábrica de las bombas de agua
YA6120 Juego de llaves para embrague del ventilador.
Aplicaciones en Ford/Lincoln/Mercury: Camiones de la serie E 4.9L
(1984-1991), camiones de la serie F 4.9L (1984-1992), Bronco II y
Ranger 2.8L (1984-1985), Ranger 2.9L (1986-1992), Aerostar 3.0L
(1986-1988), Aerostar y Ranger 4.0L OHV (1990 y posteriores),
Explorer 4.0L OHV (1991 y posteriores), Mazda Navajo 4.0L OHV
(1991-1994), Mazda B4000 4.0L OHV (1995 y posteriores), Explorer
4.0L V6 SOHC (1997 y posteriores) y Mountaineer 4.0L V6 SOHC (1998
y posteriores). Aplicaciones en GM: vans Astro y Safari de 4.3L, Blazer,
Jimmy y Bravada SUV de 4.3L, camionetas S10, Sonoma e Isuzu
Hombre de 2.2L de 4 tiempos y 4.3L V6, camionetas Sierra C1500,
C2500, C3500, K1500, C1500/C2500/C3500/K1500, Chevy Express
G1500/G2500, vans Savana G1500/G2500 de 4.3L V6, 5.0L V8 y 5.7L
V8; y Suburban, Tahoe, Yukon, Escalade, Denali y Envoy de 5.7L V8.
YA6160 Soporte para polea de embrague de ventilador universal.
t Extrae y reemplaza el embrague del ventilador en vehículos que
usan poleas de bomba de agua con pernos
t Invierta el soporte para operaciones de montaje
t Se utiliza con la llave YA9521 de 36/48 mm o la llave YA9526 de 40 mm
para muchas aplicaciones en Chrysler, Ford, Lincoln, Mercury y GM
YA6210 Llave para embrague de ventilador de BMW/Audi/VW.
t La llave para embrague de ventilador de 32 mm se utiliza con la
herramienta de soporte de polea de embrague de ventilador YA6160
para el servicio de vehículos Audi (1996 y posteriores), VW Passat
3.0L V6 (1998 y posteriores) y vehículos BMW serie 3, 5, 6, 7, 8, X y Z
t YA6160 es apta para todos los modelos listados excepto los motores
de 4.0L y 4.4L V8
t Hecha con acero tratado térmicamente
t Largo total de 17" (431.8 mm)
HCP10
HCP20
HCP10 Pinzas para grampa de manguera de
Pinzas para grampa de manguera de calefacción
calefacción Mobea–Blue-Point.
HCP48CP Pinzas para grampa de manguera de
t 9"
calefacción Mobea.
t Igual a HCP9, excepto por las grampas de manguera de estilo nuevo
t 8"
instaladas en autos GM, Ford, VW, BMW, Toyota, Volvo y Audi
t Para abrazaderas de 3/4" a 2” de diámetro
HCP10RK
Juego de servicio–Blue-Point.
t Las mordazas se cierran dentro de 1/8"
HCP9 Pinzas para grampa de manguera de calefacción t Incluye 1 par de puntas de reemplazo además de un resorte de
reemplazo para HCP10
Corbin–Blue-Point.
HCP20 Pinzas para grampa de manguera de
t 9"
t Remueve o reemplaza todas las grampas de manguera con alambre calefacción Mobea–Blue-Point.
t Para mangueras de calefacción y radiadores de modelos 1988-1990
para resortes
de GM, Ford, Chrysler y la mayoría de los importados
t Las mordazas de ranura profunda giran 180° y cierran en 3
diferentes posiciones
t Las mordazas giran a casi cualquier ángulo
450
www.snapon.com/shoptools
AIRE ACONDICIONADO
@]jjYea]flYk\]k]jna[ag
PHP3
PHP1
YA497A
®
HafrYkhYjY_jYehY\]eYf_m]jY\][Yd]^Y[[af–:dm]%Hgafl
YA497A Pinzas para remover mangueras.
t Simplifican la remoción de mangueras de combustible y de vacío de
5/32" a 1/2"
t 8" de largo total
PHP1 Pinzas para grampa de manguera.
t Extraen grampas de mangueras de 1 1/4" de diámetro
t Gire las mordazas para colocar grampas en paralelo
t 9 1/4" de largo total
PHP2 Pinzas para grampa de manguera.
t Extraen grampas de mangueras de 1 1/4" a 2 3/4" de diámetro
t Gire las mordazas para colocar grampas en paralelo
t Mordaza de 4 3/8" de largo
t 14" de largo
PHP3 Pinzas para grampa de manguera.
t Extraen grampas de mangueras de 3/4" de diámetro
t Gire las mordazas para colocar grampas en paralelo
t Mordaza de 1 1/4" de largo
t 5 1/2" de largo
t Acabado industrial negro
SHCP1
HafrYkhYjY_jYehY\]eYf_m]jY\][Yd]^Y[[af
SHCP1 Pinzas para grampa de manguera.
sEl diseño único de la mordaza funcionará en los 3 estilos de grampas
de mangueras en el mercado automotriz (estándar, de ahorro de
espacio y preabierto)
sLos agarres bimoldeados ofrecen más comodidad y control al mismo
tiempo que reducen el cansancio de la mano
t La horquilla del cable ofrece una función de fácil almacenamiento
sEl sistema de trinquete con base redonda ofrece una mayor superficie
de agarre en la función de traba
sLa palanca de traba cuenta con 2 engranajes de traba combinados
para prevenir el deslizamiento y el desgaste
s%LCABLEFLEXIBLELLEGAALUGARESDIFÓCILESCONESFUERZOMÓNIMO
Ha[gk\]Y_Yjj]kmYn]hYjYeYf_m]jY
t Ideales para remover y reemplazar mangueras y grampas
t Diseño exclusivo de la hoja para sortear los obstáculos más difíciles
t El material blando y resistente a los solventes de la empuñadura ofrece
un agarre cómodo y seguro
Pieza No.
Acabado
SGA173BR
SGA174BR
SGA175BR
SGA1710BR
SGA1711BR
SGA1712BR
SGA176BR
SGA177BR
SGCP1BR
Cromados
Cromados
Cromados
Cromados
Cromados
Cromados
Acabado industrial
Acabado industrial
Acabado industrial
SGA173BR
SGA1710BR
Largo de hoja,
pulgadas (mm)
5.43 (137.9)
4.94 (125.5)
4.61 (117.1)
11.66 (296.1)
10.89 (276.6)
11 (279.6)
5.62 (142.9)
4.12 (104.7)
3.75 (95.3)
SGA174BR
Largo, pulgadas (mm)
10.33 (262.4)
9.84 (249.9)
9.51 (241.6)
16.56 (420.6)
15.79 (401.1)
15.91 (404.1)
10.50 (266.7)
9.00 (228.6)
8.50 (215.9)
SGA175BR
SGA1711BR
SGA173BR Pico para manguera del radiador.
t Para aplicaciones de fácil acceso
SGA174BR Pico para manguera del radiador.
t Perfecto para aplicaciones de difícil acceso
SGA175BR Pico para manguera del radiador.
t Ideal para colocarlo detrás de la manguera y tirar
SGA1710BR Pico para manguera del radiador.
t Pico más largo para ofrecer un alcance superior
SGA1711BR Pico para manguera del radiador.
t El largo y el ángulo están diseñados para aplicaciones de
difícil acceso y largo alcance
SGA1712BR Pico para manguera del radiador.
t El pico largo permite maniobrar fácilmente para sortear
obstáculos
SGA176BR Pico para manguera del radiador.
t Pico de 45° para aplicaciones de acceso restringido
SGA177BR Pico para manguera del radiador.
t Pico de 90° para aplicaciones de acceso restringido
SGCP1BR Extractor de pasadores de aletas.
t Facilita el trabajo de extracción de pasadores incluso más
grandes
t El vástago con tratamiento térmico brinda máxima resistencia
t Empuñadura con agarre blando: 8 1/2" de largo
SGRHT2BR Juego de picos para manguera del radiador.
t Incluye SGA173BR y SGA1710BR
SGRHT6BR Juego de picos para manguera del radiador.
t Incluye SGA173BR, SGA174BR, SGA175BR, SGA1710BR,
SGA1711BR y SGA1712BR
SGRHTLB3BR Juego de picos para manguera del radiador.
t Incluye SGA176BR, SGA177BR y SGCP1BR
SGA176BR
SGA1712BR
SGA177BR
SGCP1BR
ADVERTENCIA
SGRHT2BR
SGRHT6BR
DYk]ehmY\mjYkhd~kla[YkfgZjaf\Yfhjgl][[af[gfljY\]k[Yj_Yk]d[lja[Yk
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
SGRHTLB3BR
451
SERVICIO DEBAJO DE AUTOMÓVILES
Expansión del alcance de su negocio.
Es el equipo que utiliza todos los días, por lo que necesita
que sea lo más eficiente posible. Snap-on® proporciona la
versatilidad para trabajar en una amplia variedad de vehículos
con el mismo equipo, lo que le ofrece más espacio y asegura
que los trabajos que llegan a su taller se queden en él.
KfYh%gfd]^Y[adalY]dY[[]kgYfm]ngkf]_g[agk&Em[`gk\]
los mismos equipos para debajo del automóvil que usted
utiliza para automóviles y camionetas se pueden usar
también tanto para vehículos comerciales livianos como
para motocicletas.
El equipo para debajo del automóvil de Snap-on es fácil de usar,
ofrece la precisión que usted necesita y proporciona resultados
consistentes, lo que facilita su utilización en el taller.
;YeZaY\gj]k\]f]me~la[gk2<ak]Y\gkhYjYeYf]bYj
los neumáticos de alto rendimiento más complejos de
la industria. Snap-on ofrece modelos equipados con
asist. de reborde neumático y protección adicional para
eafaearYj]d\Yg]fdYk[gklgkYkjm]\Yk&
:YdYf[]Y\gj]k\]jm]\Yk2=dj]ngdm[agfYjag[gfbmflg\]
k]fkgj]kNajlmYdHdYf]E]Ykmj]e]fl® divide el
neumático y la rueda "en el centro" para una precisión y
repetición insuperables.
=imahgk\]]d]nY[af2DYk[YjY[l]jkla[Yke]bgjY\Yk$
el mejor acceso y las capacidades de carga múltiples
significan que usted tendrá que rechazar
menos trabajos.
452
BALANCEO DE RUEDAS
:YdYf[]Y\gj]k[gehmlYjarY\gk
Características compartidas:
s3EUTILIZAENAUTOMØVILESDEPASAJEROSCAMIONESLIVIANOS
MOTOCICLETASYVEHÓCULOSCOMERCIALESLIVIANOS
s0RECISIØNDELAUBICACIØNDEPESASA¢ª
s/CHOMODOSDEBALANCEO
$INÉMICOPARABALANCEARLAMAYORÓADELASRUEDASENDOSPLANOS
%STÉTICOIDEALPARALLANTASANGOSTAS
!,5CADAUNO
!,53POSICIØNPERSONALIZADADELA
UBICACIØNDEPESAS
IDEALPARAMEDICIØNINTERNA
EEWB304C
s-ODODEOPERACIØNDOBLEPERMITEREALIZARINGRESOSDEPARÉMETROS
PORSEPARADO
s-ODODEUBICACIØNDEPESASPERSONALIZADO
s0ANTALLAS,%$INDICALASPOSICIONESDELAUBICACIØNDEPESASALA
IZQUIERDAYALADERECHA
s6ENTANAS,%$INDICALACANTIDADDEPESASALAIZQUIERDASYALA
DERECHA
s!UTOCALIBRACIØNYAUTODIAGNØSTICONECESITAMANTENIMIENTOMÓNIMO
EEWB305C
:YdYf[]Y\gjeglgjarY\ghYjYjm]\Yk
:YdYf[]Y\gj\]_ajgeYfmYdhYjYjm]\Yk
EEWB304C Balanceador motorizado para ruedas.
s%NTRADAAUTOMÉTICADEDOSPARÉMETROSPARAMEDIRLACOMPENSACIØN
DELALLANTAYLADISTANCIATOCANDOELCALIBRADORDEDISTANCIA
s,ABANDEJAPARAPESASMOLDEADATIENEBOLSILLOSDE
ALMACENAMIENTODEPESAS
EEWB305C Balanceador de giro manual para ruedas.
s%NTRADAAUTOMÉTICADEUNPARÉMETROPARAMEDIRLACOMPENSACIØN
YLADISTANCIADELALLANTAYLADISTANCIATOCANDOELCALIBRADOR
DEDISTANCIA
s,ABANDEJAPARAPESASMOLDEADATIENEBOLSILLOSDE
ALMACENAMIENTODEPESAS
9[[]kgjagk]kl~f\Yj]k2]b]\],(ee
Especificaciones
Operaciones
Precisión, onz. (g)
Diám. de llanta, pulg. (mm)
Ancho de llanta, pulg. (mm)
Diámetro máximo del neumático, pulg. (mm)
Ancho máximo del neumático, pulg. (mm)
Peso máximo del neumático/rueda, lb. (kg)
Velocidad del eje en cálculo, RPM
Tiempo del ciclo, segundos
Nivel de ruido, dBa
Requerimientos eléctricos
Peso de envío, lb. (kg)
Espacio de piso requerido
EEWB304C
Motorizado
0.10 (2)
8-30 (203-762)
3-25 (76-635)
44 (1,118)
20 (508)
154 (69)
<200
<7
70
115V, monofásico, 60Hz, 15A
325 (148)
62" de ancho x 64 1/2"
de profundidad
EEWB305C
Giro manual
0.10 (2)
6-30 (152-762)
1-20 (25-508)
44 (1,118)
19 (482)
120 (54)
119
<15
70
115V, monofásico, 60Hz, 15A
230 (105)
60" de ancho x 48"
de profundidad
Pieza No.
EAM0003J05A
EAM0003J06A
EAM0003J07A
EAM0003J08A
EAA0263G66A
EAC0058D08A
EAC0058D15A
EAM0021D90A
WWPR13A
EAA0247G21A
EAA0255J33A
EAA0346J75A
EAA0346J76A
EAK0221J64A
Descripción
Cono pequeño: 1 11/16" a 2 17/32"
Cono mediano: 2 3/16" a 3"
Cono largo: 2 13/16" a 3 19/32"
Cono para camión: 3 3/8" a 5 1/32"
Tuerca rápida de 40 mm
Disco de presión
Protector de goma
Eje corto de 40 mm
Pinzas para pesas de ruedas (opcional)
Calibre de ancho de llanta
Juego de actualización de eje de
40 mm (para EEWB305A y EEWB304A)
Brida de extensión opcional de 1"
Brida de extensión opcional de 2"
Adaptador de CA (sólo EEWB305C)
SOPORTE TÉCNICO
1-800-225-5786
ADVERTENCIA
D]Yqka_Ylg\gkdgke]fkYb]k\]k]_mja\Y\]fdYkafkljm[[agf]k
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
453
BALANCEO DE RUEDAS
Balanceadores computarizados
EEWB308B
WB410
Balanceador para ruedas de camiones / autos
Balanceador para ruedas de motocicleta
WB410 Balanceador computarizado para ruedas de
camiones y autos.
s"ALANCEALAMAYORÓADELASRUEDASDECAMIONESLIVIANOSCONAGUJEROS
CENTRALESDEACONUSODEADAPTADORESESTÉNDARES
s,ABATERÓAINCORPORADAOFRECEPOTENCIAALMØDULOELECTRØNICOLOCUAL
OFRECEUNAPORTABILIDADCOMPLETA
s%LGATOINCORPORADOPERMITEQUEELBALANCEODELASRUEDASMÉS
PESADASSEALLEVADOACABOPORUNASOLAPERSONA
s-ÞLTIPLESMODOSDEBALANCEOESTÉTICODINÉMICOYCUATROMODOS
PERSONALIZADOS
s)NCLUYEBANDEJAPARAPESASPEQUE×AS
s&UNCIONACONCORRIENTEELÏCTRICADE6#!(ZO6##
6605-000101 Adaptador de potencia. 6#!INCLUIDO
EAK0221J00A Juego de conos para camiones de
servicio mediano.
s5TILIZARENRUEDASDECAMIONESDESERVICIOMEDIANODETONELADAS
OSUPERIORES
s!PLICACIONESRUEDASDEACERODE&ORD&Y&
s0ARAUSARCONTODOSLOSBALANCEADORESDERUEDAS3NAPON®CONUNEJE
DEMMDEDIÉMETRO
!CCESORIOSOPCIONALES
WB1497 Juego de montaje de conos traseros p/automotores.
WB1465-01 Placa adaptadora.
t0ARACÓRCULODEPERNOSDEMMYCÓRCULODEPERNOS
DEMM
WB1496-01 Placa adaptadora de rueda Dayton.
t0ARARUEDASDEADEDIÉMETRO
WB1496-02 Placa adaptadora de rueda Dayton.
t0ARARUEDASDEADEDIÉMETRO
EAA0346J76A Adaptador de extensión.
t0ERMITEBALANCEARRUEDASDECAMIONESLIVIANOSEXTRAANCHAS
EEWB308B Balanceador para ruedas de motocicleta.
s"ALANCEODEGIROMANUALRÉPIDOFÉCILYPRECISOPARARUEDASDE
MOTOCICLETA
s,APANTALLADEPESODEPLANOSHACEQUEELSISTEMASEAFÉCILDE
USARYDEENTENDER
s%LFRENOAUTOMÉTICODETIENELARUEDADESPUÏSDEQUESECOMPLETAN
LASMEDICIONESYDATIEMPOPARASELECCIONARLASPESAS
sBOLSILLOSPARAPESASESTÉNDARUNOPARAELALMACENAMIENTODE
PESASDECINTAOPINZAS
s%LINGRESOAUTOMÉTICODEDISTANCIAACELERAELTIEMPODE
CONFIGURACIØNLADISTANCIASEINGRESAENLAMEMORIATOCANDOUNA
SOLAVEZ
s,AMEMORIAPERMITEELALMACENAMIENTOYLARECUPERACIØN
INSTANTÉNEADEDELOSPARÉMETROSDERUEDASMÉSUTILIZADOSOEL
USODEOPERADORESPARAUNBALANCEOMÉSRÉPIDO
s,ATRABADEHUSILLOACTIVADAPORPEDALSOSTIENEELCONJUNTODE
RUEDAYNEUMÉTICOPARALAUBICACIØNPRECISADELASPESAS
s%SPACIODEINSTALACIØNREQUERIDODEANCHOXDE
PROFUNDIDADXMM
s,ATECNOLOGÓA60))MAGENDEPLANOVIRTUALOFRECEPRECISIØN
INSUPERABLEDENTRODEGRADOSYONZA
s,AAUTOCALIBRACIØNASEGURAUNBALANCEOPRECISO
EAK0221J64A Adaptador de potencia.
s6#!(ZINCLUIDO
Especificaciones
WB410
2 (50)
Precisión en modo normal, onz. (g.)
*
Precisión en modo fino, onz. (g.)
13-26 (330-660)
Diám. de llanta, pulg. (mm)
4 1/2-15 (114-381)
Ancho de llanta, pulgadas (mm)
Máx. 500 (227)
Peso del neumático, lb. (kg)
ONZGRAMOSENLLANTASDEMENOSDEDEDIÉMETRO
SOPORTE TÉCNICO
ONZASGRAMOSCUANDOELBALANCEADORESTÉCALIBRADO
HACIAABAJOPARALLANTASDEAUTOMØVILESDESDEONZASDE
1-800-225-5786
PRECISIØNENLLANTASDECAMIONES
454
Especificaciones
Precisión, onz. (g)
Resolución de ubicación de pesas
Tiempo del ciclo (para ruedas de 15")
Velocidad de medición de eje
Capacidad del eje, lb. (kg)
Diám. de llanta, pulg. (mm)
Ancho de llanta, pulgadas (mm)
Diám. del neumático, pulg. (mm)
Ancho del neumático, pulg. (mm)
Requerimientos eléctricos
Peso de envío, lb. (kg)
www.snapon.com/shoptools
EEWB308B
0.10 (2.8)
±0.7°
8 segundos aproximadamente
menor que 100 RPM
60 (27.2) máximo
6-30 (152-762)
1-20 (25-508)
44 (1,117) máximo
16 (406.4) máximo
120 VCA
225 (102) con accesorios estándar
CAMBIADORES DE NEUMÁTICOS
9[[]kgjagkq[Yj_Y\gj]k
9[[]kgjagkhYjYZYdYf[]Yjjm]\Yk
EEWB3-1
EEWB3-04
EEWB3-2
Bm]_gk\]hdY[Y\]hYkY\gj\]d[geh]fkY\gj
El juego de placa de pasador alinea y centra con precisión la llanta
al balanceador de la
rueda. Elimina la desalineación y ahorra tiempo al equilibrarse con
precisión la primera vez.
sLa lista completa de los tipos de vehículos se detalla en la tabla
de aplicaciones incluida
sFunciona con balanceadores de ruedas que tengan un eje de 40 mm
EEWB3-1 Juego de placa de pasador para
automóviles, camiones livianos y SUV–Blue-Point®.
EEWB3-2 Juego de placa de pasador para camiones
livianos y SUV–Blue-Point.
Descripción de los componentes
EEWB3-1 EEWB3-2
EEWB3-11 Placa adaptadora N.º 1
s
EEWB3-12 Placa adaptadora N.º 2
s
EEWB3-13 Placa adaptadora N.º 3
s
EEWB3-14 Placa adaptadora N.º 4
s
EEWB3-21 Placa adaptadora para SUV y camiones livianos N.º 1
s
EEWB3-22 Placa adaptadora para SUV y camiones livianos N.º 2
s
8X
6X
EEWB3-01 Perno A (1 cada uno)
8X
6X
EEWB3-02 Perno B (1 cada uno)
5X
EEWB3-03 Perno C (1 cada uno) 5
Opcional
Opcional
EEWB3-04 Soporte
EEWB3-23 EEWB3-2 Tabla de aplicaciones
s
EEWB3-15 EEWB3-1 Tabla de aplicaciones
s
Parte
Parte
EEWB3-07 Reemplazo del anillo "O" 25 pkg.
.OTA,OSJUEGOSDEPLACADEPASADOR%%7"Y%%7"
SOPORTE
TÉCNICO
funcionan con compensadores que tengan un eje de 40 mm.
1-800-242-6687
%STOINCLUYELOSMODELOSDE3NAPON®%%7"#Y%%7"#
y otras marcas. Los modelos anteriores de compensadores de
3NAPONPUEDENACTUALIZARSEHASTAELMÉXIMOTAMA×ODEEJEAL
PEDIREL*UEGODEACTUALIZACIØNDEEJE%!!*!
YA1714 Ayuda del
levantamiento–Blue-Point.
tElimina la elevación manual del
conjunto de neumático y rueda
sFunciona en automóviles de pasajeros,
camiones livianos y ruedas de camiones:
ajuste automático del tamaño
sMinimiza el esfuerzo y limita las lesiones
de la espalda para que pueda realizar los
trabajos de manera rápida y segura
sAyuda al usuario en la alineación del
conjunto de neumático y rueda a los
YA1714
pernos del cubo para facilitar el remontaje
sEvita que el eje del balanceador de la rueda se dañe o se doble
s0ESOMÉXIMODELNEUMÉTICORUEDALIBRAS
s,AGAMADELDIÉMETRODELNEUMÉTICOESDEA
s!LTURADEELEVACIØNDEMÉSDE
WWPR13A
KRD401A
KRD401A Armario de pesas p/ruedas.
t!LMACENAMIENTOPUNAAMPLIAVARIEDADDEPESASDERUEDASCOLOCAR
en la pared o en el banco
sCOMPARTIMIENTOSCADAUNOMIDEX
s5 separadores deslizantes permiten agrandar compartimientos para
ACOMODARPESASPRUEDASMUYGRANDES
WWPR13A Pinzas de pesas p/ruedas en ángulo recto.
t2EMUEVAYREEMPLACECFACILIDADPESASDERUEDASASÓCOMOTAMBIÏN
para cortarlas y plegarlas
s&ABRICADADEACEROFORTALECIDOTÏRMICAMENTE
sIncluye cómodos agarres de empuñadura de vinilo y un martillo con
punta de plástico reemplazable
WWPR13-3 Reemplazo de punta de martillo.
t0ARA7702!
;YeZaY\gj]k\]f]me~la[gk
;YeZaY\gj]k\]f]me~la[gkZ~ka[g
EEWH301B Cambiador de neumáticos.
t%STAUNIDADSECARACTERIZAPORCILINDROSDEIMPULSODEDOBLEFUERZANEUMÉTICA
DEPARAOFRECERPOTENCIADEAVANCEYRETROCESODELCICLO
s3EPARADORDENEUMÉTICOLLANTAINFERIORAJUSTABLEEINTEGRADOPMAYORVERSATILIDAD
sVÓASDEPOTENCIADEFUENTESNEUMÉTICASEHIDRÉULICAS!CCESORIOSESTÉNDARES
EAA0247C78A Barra de herramienta de reemplazo.
00066006000 Botella de lubricante.
Accesorios opcionales:
EAA0247C79A Juego protector de nilón de barra del neumático.
EAA0247G70A Depresor.
Especificaciones
EEWH301B
ADVERTENCIA
Diám. de llanta, pulg. (mm)
Ancho de llanta, pulgadas (mm)
Suministro de aire requerido
Torque p/poste central
Cilindros
Cámara de compensación
Medidas, pulg. (mm)
Peso de envío, lb. (kg)
EEWH301B
10-17.5 (254-445)
3-19.75 (76-502)
120 - 180 PSI (8-12 Bar)
a torque de 150 PSI = 550 pies. lbs.
Dos golpes de 7" de diámetro x 6 1/2"
10" de diámetro x 18 3/4 de alto (0.75 pies cúbicos)
22 x 54 1/2 x 44 (559 x 1,384 x 1,118)
520 (236)
D]Yqka_Ylg\gkdgke]fkYb]k\]k]_mja\Y\]fdYkafkljm[[agf]k
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
455
CAMBIADORES DE NEUMÁTICOS
Cambiadores de neumáticos
Los cambiadores de neumáticos de Snap-on® vienen en diversos modelos para adaptarse a las necesidades
individuales del taller.
Estas unidades tienen características únicas para prestar servicio a una amplia gama de tipos y tamaños
de neumáticos.
EEWH306A
EEWH317A
EEWH311A
EEWH310A
EEWH315A
sLa cabeza de montaje/desmontaje se adapta a la posición correcta y
está designada para evitar el contacto directo con la llanta
sLas mordazas de grampa para llantas de contacto de 6 puntas
ofrecen una resistencia adicional al deslizamiento y puede ajustarse
para permitir capacidad adicional de engrampado
sEl separador de neumático/llanta montado en el lateral permite
desllantar neumáticos de manera efectiva en casi todas las
configuraciones de llantas
s El asistente de reborde neumático le ofrece al operador potencia
neumática adicional para ayudarlo a montar y desmontar neumáticos de
bajo perfil, de granrendimiento y de pasada plana (en algunos modelos)
sEl asentamiento del neumático está integrado en las mordazas de
contacto y fuerzan aire adicional para que ingrese en la cavidad
del neumático
EEWH306A
Infatigable cambiador
de neumáticos
Tipo
De giro
EAA0329G33B
Asist. de reborde neumático
10-18
Rango de engrampado externo (pulg.)
12-20
Rango de engrampado interno (pulgadas)
12
Ancho de llanta (máx., pulg.)
39
Diámetro de neumático (máx., pulg.)
13
Ancho de neumático (máx., pulg.)
13
Ancho para separar neumático/llanta (máx., pulg.)
Fuerza para separar neumático/llanta
3,300
(libras a 150 psi)
140-170
Requerimientos de aire (psi)
120 V 60 Hz, 20 A
Requerimientos de voltaje
449
Peso Neto (libras)
67.8 x 41.0 x 49.0
Altura x Ancho x Profundidad total (pulg.)
ST4029446
+4 adaptadores
EAA0270J11A
Brazo de freno de seguridad
† 10-18" automóviles, 8-15" scooter, 15-21" motocicleta
* 13" automóviles, 10" motocicleta
§ Usar con EAA0304G80A
456
s%LMOTORDE(0DEGRANTORQUEELIMINACASIPORCOMPLETOLA
velocidad crítica
sEl engrampado con dos cilindros ofrecen más fuerza de engrampado
y ofrece una presión uniforme de engrampado en la llanta
sLas inserciones de nilón en la cabeza de montaje/desmontaje junto
con grampas para llantas ofrecen mayor resistencia a las rayaduras
y protección de las llantas
sLa cámara de compensación ofrece volumen adicional de aire
durante el proceso de asentamiento del neumático
sEl calibrador de inflado y el separador de agua es estándar e incluye
un aceitador integral
s,OSADAPTADORESAUMENTANLACAPACIDADDEENGRAMPAMIENTODE
llantas (opcional)
sEl brazo de freno de seguridad ofrece otro nivel de retención para el
conjunto de rueda y neumático cuando se asienta el neumático (opcional)
EEWH311A
Cambiador de
neumáticos de
inclinación
EEWH317A
Cambiador de
neumáticos de lujo
EEWH315A
Neumático de lujo/
Cambiador de
neumáticos neumático
EEWH310A
Cambiador de
neumáticos de
motocicleta
Inclinación
De giro
De giro
De giro
Incluido
10-24
12-24
14
39
14
13
Incluido
10-24
12-24
13
39
13
14
Incluido
10-24
12-24
13
39
13
14
EAA0329G33B
10-21†
12-20
12/10†
39
10/13*
13
3,300
3,300
3,300
3,300
140-170
120 V 60 Hz, 20 A
719
69.3 x 41.4 x 55.3
EAA0332G91A
EAA0304G72A
140-170
120 V 60 Hz, 20 A
661
74.8 x 39.3 x 45.3
EAA0304G76A
EAA0270J14A
140-170
—
558
74.8 x 39.3 x 45.3
EAA0304G76A
EAA0270J14A
140-170
120 V 60 Hz, 20 A
306
67.3 x 30.3 x 28.0
ST4029446
—
SOPORTE TÉCNICO
1-800-242-6687
www.snapon.com/shoptools
NEUMÁTICOS Y RUEDAS
Egfalgj]g\]hj]kaf\]f]me~la[gk
[email protected]]jjYea]flYk
TPMS1 Herramienta para monitoreo de presión de neumáticos.
s4RABAJACONTODOSSENSORESMAGNÏTICOSYELECTRØNICOSDELEQUIPO
original sin espacios en la cobertura
s3EPUEDEACTUALIZARYPERMITEBAJARLOSPROTOCOLOSMÉSNUEVOS
s%LMØDULODEACTUALIZACIØN0)-VIENEINTEGRADOALAUNIDAD
s#ABLE53"INCLUIDO
SOPORTE TÉCNICO
1-866-498-7671
s2EGÓSTRESEENLÓNEAENWWWTPMSCOM
QDTPMS Herramientas de torque para núcleo de válvulas.
s%SPECÓFICAMENTEDISE×ADAPARAREMOVEREINSTALARCONPRECISIØNLOS
NÞCLEOSDEVÉLVULADENEUMÉTICO40-3YELIMINARELRIESGODECAUSAR
DA×OALOSCAROSSENSORES40-3
s0REFIJADAENPIESLIBRASPARAEVITARUNEXCESOOUNAFALTADETORQUE
s,ACONFIGURACIØNDETORQUEPREFIJADATAMBIÏNAYUDAAEVITARFUGASDEL
NÞCLEODELAVÉLVULALOQUELLEVAAUNAPRESIØNDENEUMÉTICOBAJAY
ALERTAS40-3
TPRG60 TPMS/Manómetro de neumático de carrera–Blue-Point®.
s)DEALPARAAPLICACIONESQUEREQUIERENLECTURASPRECISASTALESCOMO
COMPROBACIØNDECALIBRADOR40-3YTRACCIØNDEDESEMPE×O
s%LMOVIMIENTO0OWER&LEX™ presenta durabilidad y precisión de los repuestos
s±DEPRECISIØN
TPMS1
TPRG60
QDTPMS
EYfe]ljgk\]f]me~la[gk–:dm]%Hgafl
TPGHGDD150
TPGDL150
TPGD150
TPGDL1000
EYfe]ljg\a_alYd\]f]me~la[gk
TPGD150 Calibre digital de presión de neumáticos.
sVaría de 5 a 150 psi en incrementos de 0.5
sManguera trenzada flexible de 11" (279 mm) con mandril de doble
pedal para válvulas de neumáticos de difícil acceso
sEl protector de goma del manómetro con borde negro, ofrece una
superficie de agarre segura y lo protege en caso de que se caiga
s!PAGADOAUTOMÉTICOEXTIENDELAVIDAÞTILDELABATERÓA
sDEPRECISIØN
TPGHDD150 Calibre digital de presión de neumáticos.
sVaría de 5 a 150 psi en incrementos de 0.5 psi y de 101 a 150 psi en
incrementos de 1.0 psi
s0ANTALLAGRANDEDIGITALCONPROYECCIØNPOSTERIOR
sEl acabado de cromo ayuda a prevenir la corrosión y facilita la limpieza
sLargo total de 12.5" (317.5 mm) para válvulas de neumáticos de
difícil acceso
s%LAPAGADOAUTOMÉTICOEXTIENDELAVIDAÞTILDELABATERÓA
s5TILIZAUNABATERÓAREEMPLAZABLEDELITIO#26OEQUIVALENTE
ADVERTENCIA
TPGDL150 Manómetro digital de neumáticos.
s)LUMINACIØNDEFONDOPARAUNAFÉCILLECTURADELASMEDICIONES
s!PAGADOAUTOMÉTICOEXTIENDELAVIDAÞTILDELABATERÓA
s,ECTURAAPSI
s0ROTECCIØNDEGOMAAPRUEBADEGOLPESPARAEVITARDA×OSPORCAÓDAS
s!GARRESDEDEDOSMOLDEADOSPARAMAYORCOMODIDAD
s0LACADEFRENTEDEFUNDICIØNPESADA
s)NCLUYEGANCHODECINTURØNDEACEROYBATERÓAS
TPGDL1000 Manómetro digital/Inflador de neumáticos.
s-IDEDEAPSI
s-UESTRALASLECTURASENPSI"!2K0AOKGM
s!CCESORIO.04DEPARALACONEXIØNDEAIREDEENTRADA
s0ROTECCIØNDEGOMAAPRUEBADEGOLPESPARAEVITARDA×OS
por caídas
s"OTØNDEENCENDIDOAPAGADOPARALALUZDELAPANTALLA
s-ANDRILNEUMÉTICOPARAENGANCHARYMANDRILDEDOBLEPEDALINCLUIDO
s"ATERÓASINCLUIDAS
s±DEPRECISIØN
D]Yqka_Ylg\gkdgke]fkYb]k\]k]_mja\Y\]fdYkafkljm[[agf]k
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
457
NEUMÁTICOS Y RUEDAS
Manómetros de neumáticos–Blue-Point®
YA243A
TPG160
TPGIF120
TPIF160
TPGF60
TPGL30
TPG60
TPDLIF150
TPG15
Calibres de presión tipo cuadrante
YA243A Calibre de presión tipo cuadrante.
tCalibrado en incrementos de 1 psi de 0 a 100 psi
sIncluye cara de cuadrante de 2", protector de goma del calibre y
movimiento del collar completamente de engranajes con tubo de
Bourdon de bronce
sSe puede usar en neumáticos de tractores que contengan solución
anticongelante sin la necesidad de lavar o aceitar después de usarlo
s-ANGUERADECONBOTØNPULSADORQUELIBERAELAIREHASTALA
presión exacta.
TPGIF120 Manómetro automático.
tCalibrado en incrementos de 2 psi de 12 a 120 psi
s-ANDRILDEDOBLEPEDALYMANGUERADE
TPGF60 Manómetro de neumáticos.
t-ANGUERAFLEXIBLEDEMMENTREELMANØMETROYELMANDRIL
PARAVÉLVULASDENEUMÉTICOSDEDIFÓCILACCESOCUADRANTEGRANDEDE
2" con escala de 5 a 60 psi, mandril con ángulo giratorio y botón
pulsador para purgar a la presión deseada
s,AAGUJAMANTIENELALECTURAHASTAQUESELIBERA
sEl manómetro en caja de acero durable tiene un movimiento de
precisión de bronce sólido completamente de engranajes con un tubo
de Bourdon de bronce
s%LTUBODE"OURDONNOSEVEAFECTADOPORLOSCAMBIOSDETEMPERATURA
HUMEDADOALTITUD
s,APROTECCIØNDEGOMANEGRAPROTEGEELCALIBRADOR
TPG60 Manómetro de neumáticos básico.
tCuadrante grande de 2" con una escala de 5 a 60 psi, mandril recto y
válvula con botón pulsador para purgar a la presión deseada
s,AAGUJAMANTIENELALECTURAHASTAQUESELIBERA
sEl manómetro en caja de acero durable tiene un movimiento de
precisión de bronce sólido completamente de engranajes con un tubo
de Bourdon de bronce
s%LTUBODE"OURDONNOSEVEAFECTADOPORLOSCAMBIOSDETEMPERATURA
HUMEDADOALTITUD
s,APROTECCIØNDEGOMANEGRAPROTEGEELCALIBRADOR
TPG160 Manómetro para neumáticos de servicio pesado.
tCuadrante grande de 2" con escala de 5 a 160 psi, mandril recto de doble
pedal y válvula con botón pulsador para purgar a la presión deseada
s,AAGUJAMANTIENELALECTURAHASTAQUESELIBERA
sEl manómetro en caja de acero durable tiene un movimiento de
precisión de bronce sólido completamente de engranajes con un tubo
de Bourdon de bronce
s%LTUBODE"OURDONNOSEVEAFECTADOPORLOSCAMBIOSDETEMPERATURA
HUMEDADOALTITUD
s,APROTECCIØNDEGOMANEGRAPROTEGEELCALIBRADOR
458
TPIF160 Manómetro/Inflador de neumáticos.
t#UADRANTEGRANDEFÉCILDELEERQUESECARACTERIZAPORESCALAS
APSIENINCREMENTOSDEPSIYK0AENINCREMENTOS
DEK0A
s0ALANCADEACTIVACIØNGRANDE
s-ANGUERADEGOMAFLEXIBLEDECONMANDRILNEUMÉTICODE
doble pedal
s,APROTECCIØNDEGOMAPROTEGEELMANØMETRO
s,OSCØMODOSAGARRESDEGOMARANURADOSENLAEMPU×ADURAYENEL
extremo de la manguera aseguran un agarre
TPGL30 Manómetro de neumáticos.
t#UADRANTEGRANDEFÉCILDELEERDEVARÓADEAPSIEN
incrementos de 0.5 psi
s-ANGUERATRENZADAFLEXIBLEDEMMCONMANDRILGIRATORIO
PARAVÉLVULASDENEUMÉTICOSDEDIFÓCILACCESO
s%LPROTECTORDEGOMADELMANØMETRONEGROOFRECEUNASUPERFICIE
de agarre segura y lo protege en caso de que se caiga
s,OSCØMODOSAGARRESDEGOMARANURADOSENLAEMPU×ADURAYENEL
extremo de la manguera aseguran un agarre
TPDLIF150 Inflador de neumáticos doble.
t)NFLANEUMÉTICOSGRANDESDECAMIØNENFORMASIMULTÉNEA
s!JUSTELAPRESIØNDESEADATRABELOSMANDRILESNEUMÉTICOSYRETÓRESE
s%LSISTEMAINCLUYEMANGUERASFLEXIBLESDEgYDOSMANDRILES
NEUMÉTICOSCONTRABAESTÉNDARCONPEDALDOBLE
s-ANØMETROREGULADORDEAIREGRANDEFÉCILDELEERPERMITEAL
usuario establecer la presión deseada
sEl calibre está regulado en incrementos de 5 psi, de 0 a 150 psi y
ENINCREMENTOSDEKGCM§DEAKGCM§
s)NCLUYEABRAZADERADEMONTAJE
TPG15 Manómetro de neumáticos de baja presión.
t-ANØMETRODEBAJAPRESIØNPARA!46CORTADORASDECÏSPEDTUBOS
DEHORQUETASDEMOTOCICLETASETC
s%LDISE×OÞNICOOFRECEMÉXIMARESISTENCIAALOSGOLPESEL
MOVIMIENTODELDADOESTÉAISLADOLOQUEREDUCELOSEFECTOSDELGOLPE
sCalibradores amortiguados de silicona y mejor movimiento
ACOLCHADOCONDISE×ODEAMORTIGUACIØNDELAVIBRACIØNPARASERVICIO
más prolongado del calibrador
s0ANTALLASDELCALIBRADORCLARASYCONCISASFÉCILESDELEERDEA
PSIENINCREMENTOSDEPSI
www.snapon.com/shoptools
NEUMÁTICOS Y RUEDAS
EYfe]ljgk\]f]me~la[gk–:dm]%Hgafl®
TPGP100
TPGP120DF
TPGP150SDF
TPGP120
TPGP50
TPGP45LQ
TPGP20
TPGP150DF
EYfe]ljgk\]f]me~la[gk]f
^gjeY\]d~har
TPGP100 Manómetro.
sCalibrado en incrementos de 1 psi de 10
APSIEINCREMENTOSDEK0ADEA
K0A
s#ABEZARECTA
s%NCHAPADOENCROMO
sDELARGO
TPGP120 Manómetro.
s#ALIBRADOENINCREMENTOSDEPSIDEA
PSIEINCREMENTOSDEK0ADE
AK0A
s%NCHAPADOENCROMO
sDELARGO
TPGP120DF Manómetro.
s#ALIBRADOENINCREMENTOSDEPSIDEA
PSIEINCREMENTOSDEK0ADE
AK0A
s$EPEDALDOBLE
s%NCHAPADOENCROMO
sDELARGO
TPGP50 Manómetro.
tCalibrado en incrementos de 1 psi de 10 a
50 psi en marcas negras y en incrementos
DEK0ADEAK0AENMARCASROJAS
s'ANCHODEBOLSILLO
TPGP20 Manómetro de baja
presión.
t#ALIBRADOENINCREMENTOSDELBDE
APSI
s0ARAEQUIPOSDEJARDÓNYCÏSPED!46S
SOPLADORESDENIEVEETC
sDELARGO
TPGP150SDF Manómetro para
neumáticos.
tMide de 10 a 150 psi
s$ISE×ODEDOBLEPIE%LPEDALRECTOES
adecuado para usar en neumáticos tipo
camión "Budd"
sEl pedal del reverso en ángulo a 30° es útil
ENÉREASDIFÓCILESDEALCANZAR
s)NCLUYEGANCHOPARACOLGAR
s%NCHAPADOENCROMO
sDELARGO
TPGP45LQ Manómetro para aire y
líquido.
tCalibrado en incrementos de 1 psi de 5 a
45 psi
s%LRESORTESERETRAEENELMANØMETRO
causando la acción de bombeo para retirar
ELLÓQUIDODELNEUMÉTICO
s'ANCHODEBOLSILLO
sDELARGO
TPGP150DF Manómetro de alta
presión.
t#ALIBRADOENINCREMENTOSDEPSIDE
a 150 psi
s)NCLUYEANILLOPARACOLGAR
s$EPEDALDOBLE
sDELARGO
EYf\jad]kf]me~la[gk
GA359
GA356A
GA296A
GA460A
GA358
YA173A
EYf\jad]kf]me~la[gk
La capacidad máxima de todos los mandriles
neumáticos de Snap-on es de 150 psi
GA356A Mandril neumático de
doble pedal–Blue-Point.
tRosca NPT hembra de 1/4"-18 con tuerca
hexagonal de 5/8"
sEl pedal recto funciona bien en llantas de
ruedas estilo Budd
sEl pedal del reverso en ángulo a 30° es útil
en situaciones de acceso limitado
sDELARGO
GA460A Mandril neumático de
doble pedal–Blue-Point.
tRosca NPT hembra de 1/4"-18
sDELARGO
®
ADVERTENCIA
GA296A Mandril neumático en
ángulo–Blue-Point.
tRosca NPT hembra de 1/4"-18
s)NCLUYEJUNTADEGOMA
GA358 Mandril neumático.
t%MPU×ADURANEGRAESTILODESTORNILLADOR
s4AMA×ODEROSCA.04
s,ARGOTOTALDE
GA359 Mandril neumático de doble pedal.
tLlega con facilidad a ruedas en tándem
INTERNASDEDIFÓCILACCESO
s3ECARACTERIZANPORUNATRABADE
inclinación que se traba en la válvula
sEl mandril en ángulo invertido de 30° se
puede usar en neumáticos externos
s%MPU×ADURAESTILODESTORNILLADOR
s4AMA×ODEROSCA.04
s,ONGITUDTOTALDE
YA173A Mandril neumático estilo para
enganchar en ángulo–Blue-Point.
tRosca NPT hembra de 1/4"-18
s'ANCHODELPIVOTEDEVÉLVULACARGADOCON
resorte y operado por gatillo
s0RESIØNOPERATIVAMÉXIMADEPSI
Fg]p[]\YdY[YhY[a\Y\\]hj]kaf
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
459
NEUMÁTICOS Y RUEDAS
Herramientas para válvulas
TR107A
TR108
TR109
TR117O
VT1A
GA143B
VT14
QDTPMS
Válvula y pivote
TR107A Herramienta para núcleo
de válvulas.
s Para instalar y remover núcleos de válvulas
estándar
s%MPU×ADURAESTILODESTORNILLADOR
sDELARGO
TR108 Herramienta para núcleo de
válvulas.
s3IMILARA42!DELARGO
TR109 Herramientas para núcleo de
válvulas.
s0ARAREMOVEROREEMPLAZARLOSNÞCLEOSDE
válvulas en sistemas de aire acondicionado
DIÉMETROGRANDE
sDELARGO
TR117O Herramienta para remover/
instalar núcleos de válvulas.
s (ERRAMIENTAPARAREMOVERINSTALARNÞCLEOS
de válvulas
sDELARGO
VT1A Colocador de vástago de
válvula.
s3IMPLIFICALAINSTALACIØNDELPIVOTEDEVÉLVULA
en llantas de neumáticos sin cámaras
s%LVÉSTAGOESTÉREMACHADOPARAACOMODAR
varios estilos de llantas
s#ØMODAEMPU×ADURATIPODESTORNILLADOR
GA143B Herramienta para núcleo
de válvula y pivote–Blue-Point.
s ,AHERRAMIENTADEFUNCIONESINSERTA
YREMUEVENÞCLEOSENROSCAMACHOSDE
VÉSTAGOSINTERNOSYFILETEAROSCASEXTERNAS
sX
VT14 Herramientas para núcleo de
válvulas universal–Blue-Point.
s ,ABROCADEEXTREMODOBLEREMUEVEEINSTALA
NÞCLEOSDEVÉLVULASGRANDESYPEQUE×OS
s2EVIERTALALLAVEDEEXTREMOSDOBLESENEL
CUERPODELAHERRAMIENTAPARAQUESEADAPTE
ANÞCLEOSDEVÉLVULASGRANDESYPEQUE×OS
s5SEELEXTREMOENCOPAPARAREMOVERTAPAS
de válvulas
s'ARANTÓADEPORVIDAQDTPMS
Herramientas de torque para núcleo
de válvulas.
s%SPECÓFICAMENTEDISE×ADOPARALOSNÞCLEOS
DEVÉLVULADENEUMÉTICO40-3PARAELIMINAR
ELRIESGODECAUSARDA×OALOSCAROS
SENSORES40-3
s0REFIJADAENPIESLIBRASPARAEVITARUN
EXCESOOUNAFALTADETORQUEYFUGASDEL
NÞCLEODELAVÉLVULALOQUELLEVAAUNA
PRESIØNDENEUMÉTICOBAJAYALERTAS40-3
Calibre de profundidad de banda de rodadura
GA599A
GA599A Calibre de profundidad de banda de rodadura.
s-IDEHASTAUNAPROFUNDIDADDEENINCREMENTOSDE
s#UERPOPLÉSTICOCONSONDADEALUMINIOYCALIBREDESLIZANTE
s)NCLUYEGANCHODEBOLSILLO
TDG1 Calibre de profundidad de banda de rodadura.
s%LCALIBREDESLIZANTECUENTACONUNACODIFICACIØNDECOLORES
s-IDEHASTAUNAPROFUNDIDADDEENINCREMENTOSDE
s#UERPOPLÉSTICOCONSONDADEALUMINIOYCALIBREDESLIZANTE
s)NCLUYEGANCHODEBOLSILLO
TDG1
460
www.snapon.com/shoptools
NEUMÁTICOS Y RUEDAS
@]jjYea]flYk\]lgjim]\]jm]\Yk–:dm]%Hgafl®
NYjaddYk\]lgjim]'k]jna[ag]kl~f\Yj
s%LESTROBOSCOPIOPATENTADASDETIENENELGIROEXACTAMENTEENELTORQUECORRECTO
s$ISE×ADOPARAENTORNOSPROFESIONALESDUROS
sFABRICADAENACERODERESORTESUECOCONTRATAMIENTOTÏRMICOENUNDISE×ODEUNASOLA
PIEZASØLIDA
s,ASVARILLASVIENENENPAQUETESINDIVIDUALES
s%LJUEGOVIENECONUNATABLADETORQUECONCØDIGODECOLORESQUEMUESTRALAVARILLA
CORRECTAPARACASITODOSLOSVEHÓCULOSEXTRANJEROSYNACIONALES B
BT
BT
QS
TQ
QS
s'ARANTÓADEPORVIDA
10
S5
6
El juego
contiene:
Pieza No.
Tamaño, mm
Color
21
22
21
21
19
21
19
22
19
17
17
22
17
21
17
19
19
24
14
21
22
Marrón
Anaranjado
Marrón claro
Gris marengo
Gris
Negro
Azul
Turquesa
Amarillo
Rojo
Verde
Blanco
Amarillo claro
Rojo-anaranjado
Blanco opaco
Tostado claro
Cuarzo
Verde claro
Tierra
Morado claro
Celeste
BTQS12A
BTQS12AA
BTQS12B
BTQS12BB
BTQS12C
BTQS12D
BTQS12E
BTQS12EE
BTQS12F
BTQS12G
BTQS12H
BTQS12I
BTQS12K
BTQS12KK
BTQS12MM
BTQS12NN
BTQS12OO
BTQS12T
BTQS12UU
BTQS12XX
BTQS12Y
BTQSWC10Tabla de
00
00
00
BTQS500
Límite de torque, pies lb. Cuadro, pulgadas
100
1/2
s
75
1/2
s
80
1/2
s
s
147
1/2
s
s
100
1/2
s
s
60
1/2
80
1/2
s
140
1/2
s
s
65
1/2
s
80
1/2
s
55
1/2
s
120
1/2
s
s
113
1/2
s
110
1/2
90
1/2
s
90
1/2
120
1/2
140
1/2
s
80
1/2
160
1/2
s
100
1/2
s
Los juegos que se muestran incluyen una caja de almacenamiento
pared.4ABLAPARAPAREDDECOLORESPARAFOSASDESERVICIO BT
QS
HD
El juego 400
contiene:
BTQS600
BTQS1000
NYjaddYk\]lgjim]'k]jna[agh]kY\g
Pieza No.
BTQSHD34114
BTQSHD3433M
BTQSHD1114
BTQSHD133M
BTQSHD1112
BTQSHD11316
Tamaño, pulgadas, (mm)
11/4
(33)
11/4
(33)
11/2
13/16 cuadrado
Color
Límite de torque, pies lb. Cuadro, pulgadas
3/4
HD rojo
250
3/4
HD marrón
475
HD rojo
250
1
s
HD marrón
475
1
s
HD negro
475
1
s
HD amarillo
475
1
s
El juego que se muestra incluye una caja de almacenamiento
TS
S
El juego 2KT
contiene:
BTQSHD400
NYjaddYk\]lgjim]'Yhda[Y[af]kh][aYd
Pieza No.
TSS2TT
TSS2QQ
Tamaño, mm
22
22
Color
Rosa
Salmón
Límite de torque, pies lb.
150
95
s
s
=pl]fkagf]khYjYlgjim]
s,OSDADOSPARATORQUEDERUEDASAYUDANAELIMINARTUERCASDERUEDASCONSOBRETORQUE
YESPÉRRAGOSROTOSODA×ADOSYLADISTORSIØNDEROTORESTAMBORESYRUEDAS
s-ANGUITODEBAJAFRICCIØNCODIFICADOPORCOLORPARAUNARÉPIDAREFERENCIA
s!CERODEALEACIØNESPECIALFORMADOENFRÓOPARAUNAMAYORPRECISIØNYRESISTENCIA
s#UADROCUADRADOMACHOYHEMBRADEPARAUSARCONDADOSDEIMPACTOADECUADOS
s%LCUADROCUADRADOHEMBRAESTÉDISE×ADOPARAUNARESISTENCIAMEJORADA
ENLLAVESDEIMPACTO
30
5
s%LCUADROCUADRADOMACHOTIENEUNANILLODEFRICCIØNPARAUNA
El juego TSK
TA
RETENCIØNSEGURA
contiene:
Pieza No.
Color
TSKT65A
TSKT80A
TSKT100A
TSKT120A
TSKT140A
Amarillo
Azul
Gris
Blanco
Verde azulado
ADVERTENCIA
TSS2KT
Límite de torque, pies lb.
65
s
80
s
100
s
120
s
140
s
El juego que se muestra incluye una caja de almacenamiento
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
305TSKTA
461
NEUMÁTICOS Y RUEDAS
Dados de tuerca de rueda/de retención–Blue-Point®
Dados de tuercas de ruedas
LSR1500 Juego de dado rebatible giratorio de
rueda/estándar.
sDADOSPARAUSARENLAMAYORÓADELOSTAMA×OSDETUERCAS
DERUEDASCONOCIDOSMMMM
MMY
s#ONFIGURACIØNDELAS,LAVES&LANK$RIVE®
DEPUNTASENUNEXTREMOYUNDADO
GIRATORIODEESTRÓASPARAREMOVER
TUERCASDERUEDASDA×ADASENEL
OTROEXTREMO
s,EVANTEELDADOCUANDOENCUENTRE
UNACABEZADA×ADA
s%LEXTREMOESTRIADOIDENTIFICAELEXTREMO
DELDADOGIRATORIO
s,OSDADOSYLAEXTENSIØNDETIENEN
TODOSUNCUADRODEPARAUSARCON
MANGOSMANUALESOLLAVESDEIMPACTO
LSR1500
s!CABADODEØXIDONEGRO
s#AJADEALMACENAMIENTO
LSR2000 Juego de dado rebatible
de rueda de pared delgada.
s#UBRELOSTAMA×OSDETUERCASDERUEDAS
MÉSCONOCIDOS
sYMMYMM&LANK
$RIVECONFIGURACIØNDELSISTEMADELLAVES
s%LCUADROCUADRADODESEUBICAEN
ELCENTRODELDADO
LSR2000
s5SARCONMANGOMANUALOLLAVEDEIMPACTO
s)NCLUYEDADOSDETUERCASDERUEDAS,32
Y,32YUNAEXTENSIØNDEENUNACAJAAMEDIDA
s!CABADOINDUSTRIALNEGRO
LSR2000PLUS Juego de dado
rebatible de tuerca de rueda.
sDADOSREBATIBLESDEY
YMÉSYMM
s4ODOSLOSDADOSTIENENDELARGO
s%LCUADROCUADRADODESEUBICAEN
LSR2000PLUS
ELCENTRODELDADO
s5SARCONLLAVESDEIMPACTOOMANGOSMANUALES
s#AJAAMEDIDA
s!CABADONEGROINDUSTRIALENTODOSLOSCOMPONENTES
s2EQUIEREELUSODEUNAEXTENSIØN,32%84
OPCIONALNOINCLUIDA
LSR1150 Dado rebatible de rueda de
LSR1150
pared delgada.
s%LDADOREBATIBLEDERUEDASDEPAREDDELGADAABARCA
LOSTAMA×OSDETUERCASDERUEDASDEY
s5SARCONMANGOMANUALOLLAVEDEIMPACTO
sDELARGO
LSR1250 Dado rebatible de rueda de
pared delgada
s%LDADOREBATIBLEDERUEDADEPAREDDELGADAABARCALOS
TAMA×OSDERUEDASDEMMYMM
s5SARCONMANGOMANUALOLLAVEDEIMPACTO
sDELARGO
LSR2500 Juego de dado rebatible
giratorio de traba/de rueda.
s2EMUEVENRÉPIDAYFÉCILMENTELASRUEDAS
DA×ADASEXTREMODEESTRÓASO
LASTRABASDERUEDASDA×ADASCONLLAVES
DA×ADASOPERDIDASEXTREMODEESTRÓAS
s%LCUADROCUADRADODESEUBICAEN
LSR2500
ELCENTRODELDADO
s5SARCONMANGOMANUALOLLAVEDEIMPACTO
s)NCLUYEDADOSDETRABADERUEDAS,32Y
,32YUNAEXTENSIØNDEENUNACAJAAMEDIDA
s!CABADONEGROINDUSTRIAL
LSR2501 Dado rebatible giratorio de
traba/de rueda.
LSR2501
s%LDADOGIRATORIODEMMREMUEVERÉPIDAY
FÉCILMENTELASRUEDASDA×ADASEXTREMODEESTRÓASOLAS
TRABASDERUEDASDA×ADASCONLLAVESDA×ADASOPERDIDAS
EXTREMODEESTRÓAS
s5SARCONMANGOMANUALOLLAVEDEIMPACTO
s!CABADOINDUSTRIALNEGRODELARGO
462
LSR2502 Dado rebatible giratorio de traba/de rueda.
s)GUALQUE,32EXCEPTOENELTAMA×ODE
LSR2503 Dado rebatible giratorio de traba/de rueda.
s)GUALQUE,32EXCEPTOENELTAMA×ODEMM
LSR2500PLUS Juego de dado rebatible giratorio de
traba/de rueda.
s2EMUEVENRÉPIDAYFÉCILMENTELASRUEDASDA×ADASEXTREMODE
ESTRÓASOLASTRABASDERUEDASDA×ADAS
CONLLAVESDA×ADASOPERDIDAS
EXTREMODEESTRÓAS
s%LCUADROCUADRADODESEUBICA
ENELCENTRODELDADO
s5SARCONMANGOMANUALOLLAVE
LSR2500PLUS
DEIMPACTO
s)NCLUYEDADOSDETRABADERUEDAS,32,32Y,32
ENUNACAJAAMEDIDA
s!CABADOINDUSTRIALNEGRO
s,32%84ESUNAEXTENSIØNOPCIONALDELPARAELJUEGO
LSR1450 Juego de dado rebatible giratorio de rueda
de pared delgada.
s!BARCALOSTAMA×OSDERUEDASDEYMM
s#ONFIGURACIØNDELLAVECON&LANK$RIVE
s%LCUADROCUADRADODESEUBICAENELCENTRODELDADO
REQUIERELAEXTENSIØNOPCIONAL,32%84
s#OMPLEMENTOIDEALPARA,32Y,320,53
s!CABADOINDUSTRIALNEGRO
s$%MAYORMMn$%MENORMM
s,ARGOMM
LSR1580 Dado rebatible de tuerca de rueda de
pared delgada.
s4AMA×ODEDADODEYMMDELARGO
s5SARCONMANGOMANUALOLLAVEDEIMPACTO
s2EQUIEREELUSODEUNAEXTENSIØN,32%84OPCIONAL
s%LCUADROCUADRADODESEUBICAENELCENTRODELDADO
LSRM2000 Juego de dado rebatible métrico.
s)NCLUYEDADOS,32Y,32MÉSEXTENSIØNDE
,32%84
s$ISE×ADOPARAVEHÓCULOSYPOSTERIORES
s)NCLUYETAMA×OSDEYMM
s!PLICACIONES#AMIONETA$ODGE$ODGE324(ONDA
/DYSSEY,AND2OVER,2ANGE2OVERY3PORT,EXUS,8Y
4OYOTA,AND#RUISER
LSR1560 Dado rebatible.
s4AMA×ODELDADODEYDELARGO
s5SARCONMANGOMANUALYLLAVEDEIMPACTO
s!MPLÓALOSJUEGOS,32Y,320,53
s2EQUIEREELUSODEUNAEXTENSIØN,32%84NOINCLUIDA
s%LCUADROCUADRADODESEUBICAENELCENTRODELDADO
s!PLICACIONES6ANSSERIE#HEVY'-#CAMIONETA$ODGE
2AM&ORD%&ORD3UPER$UTY(UMMER(,INCOLN
"LACKWOOD,EXUS,84OYOTA,AND#RUISER*AGUAR8*
YCAMIONETASY356#HEVY'-#VANS0LYMOUTHDE
TONELADA
LSR1570 Dado rebatible.
s4AMA×ODELDADODEYDELARGO
s5SARCONMANGOMANUALOLLAVEDEIMPACTO
s!MPLÓALOSJUEGOS,32Y,320,53
s2EQUIEREELUSODEUNAEXTENSIØN,32%84OPCIONAL
s%LCUADROCUADRADODESEUBICAENELCENTRODELDADO
s!PLICACIONES$ODGE2AM,AND
2OVER2ANGE2OVER$ISCOVERY))&ORD%&ORD&
www.snapon.com/shoptools
NEUMÁTICOS Y RUEDAS
<Y\gk\]lm]j[Yk\]jm]\Yk'\]j]l]f[af
IMX32B
TSR700
TSR800
DW402C
2003LN
YA1005C
<Y\gk\]lm]j[Yk\]jm]\Yk
A98A
TSR1000
DW402C Dado de impacto de tuercas de ruedas Dayton.
s#UADROCUADRADODECONABERTURADELLAVEDEPUNTASDE
s5SARCONRETENEDORESDEDADOS
YA1005C Juego removedor de tuerca de rueda de traba–
Blue-Point®.
s2EMUEVELASTUERCASDERUEDASDETRABAYLOSTAPONESDERUEDASDE
TRABAENLAMAYORÓADELOSVEHÓCULOSINCLUSOLASNUEVASTRABASDE
TAPACUBOSDE#HRYSLER%LJUEGOACTUALIZADOINCLUYEELNUEVODADODE
TUERCADERUEDATURBOPARAREMOVERFÉCILMENTELASTUERCASDERUEDAS
DA×ADASDEYMM
s%LTORBELLINOAHUSADOENELDADOSEAGARRADELATUERCADERUEDADA×ADA
PARAREMOVERLACONRAPIDEZ
s%STÉDISE×ADOSØLOPARAUSOMANUALEXCEPTOPORELDADODETUERCADE
RUEDATURBOQUESEDEBERÉUSARCONUNALLAVEDEIMPACTO
2003LN Juego de dados de tuercas de ruedas con
extremo doble.
s%LJUEGOINCLUYEDADO!!DADO!-YBARRADEEXTENSIØN)-8"
PZAS
A98A Dado de tuercas de ruedas de 6 puntas.
s%LCUADROCUADRADODEESTÉEMBUTIDOENTREDOSABERTURASDELLAVE
DEPUNTASY
s$EDELARGOYDEDIÉMETRO
A98M Dado de 6 puntas.
s%LCUADROCUADRADODEESTÉEMBUTIDOENTREDOSABERTURASDELLAVE
DEPUNTASYMM
s$EDELARGOYDEDIÉMETRO
IMX32B Extensión de impacto.
s#UADROCUADRADODEVÉSTAGODEDEDIÉMETRODELARGO
s-ECANISMODETRABADEANILLODERESORTE
TSR500 Dado para remover tuercas de ruedas–Blue-Point.
s5SAREN/%-ÞLTIMOMODELOYENTUERCASDERUEDASCOMERCIALES
s%LDISE×ODELADODOBLEPERMITEUSARLOENTUERCASDERUEDASDE
YMM
s5SARCONLLAVEDEIMPACTOCCUADRODE
s%LDISE×ODEDADOESTRIADOAYUDAAREMOVERLAMAYORÓADELASTUERCASDE
RUEDASDIFÓCILES
s)NCLUYEPUNZØNEXTRACTOR
<Y\gk\]ljYZY\]
jm]\Yº:dm]%Hgafl
LSR1000A Juego de dados
para remover trabas de
las ruedas.
s2EMUEVEFÉCILMENTE
LAMAYORÓADELASTUERCAS
DERUEDASYTRABASDE
RUEDASENLAMAYORÓADE
LOSVEHÓCULOSDEPASAJEROS
YCAMIONESLIVIANOS
NACIONALESEIMPORTADOS
s5SARCONMANGOMANUAL
OLLAVEDEIMPACTO
LSR1000A
s!LGUNOSDADOSCUBRENAPLICACIONES
ESPECÓFICASPARA'-&ORDY#HRYSLER
s%LJUEGOINCLUYEDADOSEXTENSIØNYPUNZØNEXTRACTORENCAJADE
ALMACENAMIENTOPLÉSTICA
ADVERTENCIA
TSR1250
TSR600 Dado de tuerca de rueda de traba–Blue-Point.
s%LCUADROCUADRADODESEUBICAENELCENTRODELDADO
s5SEELPASADORINCLUIDOPARARETIRARLATUERCADELARUEDASIESTÉ
ACU×ADAENELDADO
s2EMUEVELAMAYORÓADELASTUERCASDERUEDADETRABAYTIENEUN
DISE×ODEDADOREBATIBLEEN
s0ARAUSARCONLLAVEDEIMPACTO
s%STRIADOPARAAGARREEXTRA
TSR700 Dado para remover tuercas de ruedas–BluePoint.
s5SAREN/%-ÞLTIMOMODELOYENTUERCASDERUEDASCOMERCIALES
s%LDISE×ODELADODOBLEPERMITEUSARLOENTUERCASDERUEDASDE
YMM
s5SARCONLLAVEDEIMPACTOCCUADRODE
s%LDISE×ODEDADODEESTRÓASAYUDAAREMOVERLAMAYORÓADELAS
TUERCASDERUEDASDIFÓCILES
TSR800 Dado para remover tuercas de ruedas–BluePoint.
s5SAREN/%-ÞLTIMOMODELOYENTUERCASDERUEDASCOMERCIALES
s%LDISE×ODELADODOBLEPERMITEUSARLOENTUERCASDERUEDASDE
YMM
s3EUTILIZACONUNALLAVEDEIMPACTOCONCUADRODE
s%LDISE×ODEDADODEESTRÓASAYUDAAREMOVERLAMAYORÓADE
LASTUERCASREDONDASDERUEDASDIFÓCILES
TSR1000 Dado de tuerca de rueda–Blue-Point.
s%LJUEGOINCLUYEDADOSDETUERCASPARARUEDAS432Y432
MÉSPUNZØNEXTRACTOR
s5SAR432EN/%-ÞLTIMOMODELOYENTUERCASDERUEDASCOMERCIALES
s%LDISE×ODELADODOBLEPERMITEUSARLOENTUERCASDERUEDASDE
YMM
s432REMUEVELAMAYORÓADELASTUERCASDERUEDADETRABAY
TIENEUNDISE×ODEDADOREBATIBLEEN
s0ARAUSARCONHERRAMIENTASDECUADRODE
s%LDISE×ODEDADOPROPORCIONAUNAGARREEXTRA
TSR1250 Dado de tuercas de ruedas–Blue-Point.
s$ISE×ODEDADODOBLEREBATIBLEDEIMPACTOCONCUADRODE
s2EMUEVELASTUERCASDERUEDASCONTAPASFALTANTESODEFORMADAS
s%LLATERALDEMMSEAJUSTAATAPASDECROMODEFORMADASDE
MMQUESEENCUENTRANENMUCHOSVEHÓCULOS'-Y#HRYSLER
s%LLATERALDEMMSEAJUSTAALASCUBIERTASDECROMO
FALTANTESDELASTUERCASDERUEDASOXIDADAS
LMS24
<Y\gk\]lm]j[Yk\]jm]\Yk [Yj_Y\]
j][~eYjY!º:dm]%Hgafl
s0ERMITELAFÉCILREMOCIØNMÞLTIPLEDETUERCASDERUEDASDE
HASTATUERCASPORVEZ
s%VITAQUELASTUERCASDELASRUEDASGIRENOSEPIERDANYEL
MOVIMIENTOINÞTIL
s)DEALPARAUSARENTALLERESDENEUMÉTICOSYFRENOS
s0UEDENAJUSTARCÉMARASNEUMÉTICASDEYPULGADAS
CÞBICASQUEESTÉNEQUIPADASCONVARILLAROSCADADEY
TUERCADE
Pieza No.
LMS24
Tamaño llave,
pulgadas (mm)
3/4
(19)
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/&
Cuadro
cuadrado,
pulgadas
1/2
Diámetro
externo,
pulgadas
1
Largo
total,
pulgadas
5 5/16
463
NEUMÁTICOS Y RUEDAS
Dados de tuercas de ruedas / de retención
Colgadores de rueda
0ERMITEBALANCEARLASRUEDASDEMANERAMÉSRÉPIDASEGURAYFÉCILCUANDOSEINTENTAINSERTARY
AJUSTARLOSBULONESDELARUEDA
Pieza No.
WHM1
WHM1
Tamaño de rosca
M12 x 1.5
Tamaño hex.
10 mm
Aplicaciones
Mercedes, BMW, Mini, Cadillac Catera, Chrysler Crossfire
WHS1
M14 x 1.5
15 mm
Mercedes actual, camiones Dodge Sprinter actuales, camiones Freightliner
Sprinter desde 2002 hasta 2004
WHV1
M14 x 1.5
10 mm
Volkswagen, Audi, Mercedes ML Class, BMW serie 7 y X5, Porsche
WHS1
WHM2 Juego de colgador de rueda (Mercedes/BMW). *UEGODECOLGADORESDERUEDA7(-
WHS2 Juego de colgador de rueda (Dodge/Freightliner Sprinter). *UEGODECOLGADORESDERUEDA7(3
WHV2 Juego de colgador de rueda (VW/Audi). *UEGODECOLGADORESDERUEDA7(6
WHV1
Dados de tuerca de eje
ANS1933A
ANS1938
ANS1900B
5SARCONUNALLAVEDETORQUEPARASERVICIOENTUERCASDETRABADE
COJINETESDERUEDASDECAMIØN
Dados de tuercas de ejes–Blue-Point®
Pieza No.
Tamaño nominal
2 1/2"
ANS1937
2 3/8"
ANS1939*
2 3/4"
ANS1938
2 1/8"-54 mm
ANS1900B
Cuadro cuadrado
de 3/4"
59 mm
ANS1933A**
2 3/32"
ANS1901A
2 1/4"
ANS1920A
2 3/8"
ANS1902A
2 3/8"
ANS1903A
2 1/2"
ANS1921A*
2 9/16"
ANS1928A*
2 9/16"
ANS1905A
2 9/16"
ANS1904A
2 5/8"
ANS1922A
2 3/4"
ANS1923A
2 3/4"
ANS1924A
2 13/16"
ANS1926A
2 7/8"
ANS1932A
3"
ANS1906A
3"
ANS1907A
3 1/4"
ANS1908A
3 1/4"
ANS1909A
3 1/2"
ANS1910A
3 1/2"
ANS1911A
3 3/4"
ANS1925A
3 13/16"
ANS1927A
3 7/8"
ANS1912A
3 7/8"
ANS1913A
4"
ANS1914A
4 1/8"
ANS1915A
4 3/8"
ANS1916A
4 3/8"
ANS1917A
4 7/8"
ANS1918A
4 7/8"
ANS1919A
3EAJUSTAATUERCASHEXREDONDEADASESPECIALESENEJES$ANADE
ALGUNOSCAMIONES&ORD
0ARAVEHÓCULOSDETONELADACONTUERCASDETRABAAUTOMÉTICA
$ISE×ADOSPARAVEHÓCULOS&ORDDEÞLTIMOMODELO#UADROCUADRADO
DETAMA×ONOMINALDEMM!CABADOINDUSTRIAL
Cuadro cuadrado
de 1/2"
464
Estilo
6 puntas
6 puntas
6 puntas
6 puntas
6 puntas
6 puntas
6 puntas
6 puntas
8 puntas
6 puntas
6 puntas
8 puntas
6 puntas
6 puntas
6 puntas
8 puntas
8 puntas
6 puntas
6 puntas
8 puntas
6 puntas
8 puntas
6 puntas
8 puntas
8 puntas
8 puntas
6 puntas
8 puntas
6 puntas
6 puntas
6 puntas
8 puntas
6 puntas
8 puntas
305SIMMY
Juego de tuercas de ejes de GM
(cuadro 1/2")–Blue-Point
Pieza No.
SIMM290
SIMM300
SIMM340
SIMM350
SIMM360
Tamaño,
mm
29
30
34
35
36
S6109A
30
5S
I
El juego MM
Y
contiene:
A
B
C
D
E
41.3
42.9
49.3
50.8
50.8
41.3
42.9
44.5
45.8
45.8
71.6
71.1
72.8
72.8
72.8
88.9
88.9
88.9
88.9
88.9
21.3
21.6
22.6
22.9
22.9
S8695C
s
s
s
s
s
S6146
S6109A Dado de tuerca de eje de 6 orejetas.
s0ARALATUERCADERETENCIØNDELCOJINETEDELARUEDADELANTERAEN
VEHÓCULOSDETONELADASCONSUSPENSIØNDESERVICIOPESADO
s$ISE×ADOSPARAUSARENCAMIONES'-&ORDY$ODGECONEJEDE
LASERIE$ANA
s#UADROCUADRADODEDELARGO
s!CABADOINDUSTRIAL
S8695C Dado de tuerca de eje de 4 orejetas.
s#UADROCUADRADODEDELARGO
s0ARAVEHÓCULOSDETONELADASCONTUERCASDETRABAMANUALES
s3EUTILIZAENLATUERCADERETENCIØNDELCOJINETEDELARUEDA
DELANTERACONEJEDELASERIE$ANAUTILIZADOENVEHÓCULOS'-
&ORD$ODGEY!-#DEYPOSTERIORES
s!CABADOINDUSTRIAL
s!PLICACIONESFERROVIARIASSEUTILIZAPARAINSTALAROREMOVER
ELBUJEDETECTORDEPUNTASENMÉQUINASINTERRUPTORAS
7!"#/-"
S6146 Dado de tuerca de eje de 4 orejetas.
s0ARATUERCADERETENCIØNDECOJINETEDELARUEDADELANTERAEN
VEHÓCULOSDETONELADASCONEJEDELASERIE$ANAUTILIZADO
ENCAMIONES'-&ORDY$ODGE
s#UADROCUADRADODEDELARGO
s!CABADOINDUSTRIAL
www.snapon.com/shoptools
NEUMÁTICOS Y RUEDAS
<Y\gk\]lm]j[Y\]]b]
<Y\gk\]lm]j[Y\]]b]hYjYYhda[Y[agf]k]kh][aYd]k$hmd_Y\Yk
SIM540A Dado de tuerca de eje de 6 planos.
s2EMOVEROINSTALARTUERCASDEEJESDECAMIONES$ODGE
MODELOYPOSTERIORES
s/BIENPARAUTILIZARENAPLICACIONESDERUEDASDEOTROS
camiones y AUTOBUSES
s$ISE×ODELLAVE&LANK$RIVE®
s#UADROCUADRADODE
SIM540A
QUICK3FR150
BRUTUS3R250D
DdYn]k\]lgjim]
BRUTUS3R250D Llave de torque en pulgadas tipo clic
ajustable para EE.UU.
s-ÉSRESISTENTEPARAUNAVIDAÞTILMÉSPROLONGADA
s,EVARELOJDEARENAUNAMENORFRICCIØNREDUCEELDESGASTEY
RETIENEELLUBRICANTE
s%LCOJINETEDEEMPUJEREDUCEELDESGASTE
s“,APARADAPOSITIVA”'ORILLA0ROOFEVITAELDESMONTAJEACCIDENTAL
0RECAUCIØN.OAJUSTARPORDEBAJODELAMARCAMÉSBAJADELAESCALA
s%LTORNILLODECARGAMÉSGRANDEYRESISTENTEAYUDAAEVITARLOSDA×OS
causados por el impacto
s#ABEZASELLADADEGRANRESISTENCIA
s,AEMPU×ADURALARGAPROPORCIONAMAYORPALANCA
s%SPECIFICACIONES!3-%GARANTIZADASSEGÞN.)34SINCARGO
QUICK3FR150 Llave de torque electrónica.
s)DEALPARAUSARENTALLERESDENEUMÉTICOS
s/FRECEPRECONFIGURACIONESPARALOSTORQUEMÉSCOMUNESDE
TUERCADERUEDASYPIESLB
s0RECISIØNDE
s,AINDICACIØNVISUALDELUZAMARILLAVERDEROJALEINDICAALOPERADOR
CUANDOSEHAALCANZADOLACONFIGURACIØN
s%LELEMENTODETRABAEVITACAMBIOSNODESEADOSDELA
CONFIGURACIØNPREFIJADA
s-ÉSEXACTOSQUELASVARILLASDETORQUE
s#UADROCUADRADODE
Mkg_]f]jYd\]lm]j[Yk\]jm]\Yk
Tamaño de tuerca de rueda
Hex. profundo de 7/8"
Hex. profundo de 15/16"
Hex. profundo de 1"
Hex. profundo de 1 1/16"
Hex. profundo de 1 1/8"
Hex. profundo de 1 3/16"
Hex. profundo de 1 1/4"
Hex. profundo de 1 5/16"
Hex. profundo de 1 1/2"
Hex. profundo de 1 3/4"
Cuadrado de 13/16"
Hex. profundo de 30 mm
Hex. profundo de 32 mm
Hex. profundo de 33 mm
Hex. profundo de 35mm
Hex. profundo de 36 mm
Hex. profundo de 38 mm
Hex. profundo de 41 mm
Hex. de 1 1/2" - cuadrado de 13/16"
Hex. de 41 mm - Cuadrado de 21 mm
* Thin walled extra deep.
Cuadro de 3/4"
SIM282
SIM302
SIM322
SIM342
SIM362
SIM382
DW402C*
SIM422
SIM482
SIM562
BW626A
SIMM302
SIMM322
SIMM332
SIMM352
SIMM362
SIMM382
SIMM412
BWD482
BWDM412
Cuadro de 1"
—
—
—
SIM343
—
SIM383
SIM403
SIM423
SIM483B
SIM563
BW726A
SIMM303
SIMM323
SIMM333
—
—
SIM383
—
BWD483
—
SIMDM300
IMDM320
IMDM390
<Y\g\]lm]j[Yk\]]b]hYjYYhda[Y[agf]k]kh][aYd]k$ee ;mY\jg\])'*!
Pieza No.
SIMDM300
IMDM320
IMDM390
SIM540A
Tamaño
30 mm
32 mm
29 mm
1 11/16"
Estilo
A
B
C
D
E
12 ptas.
—
—
64 mm 88.9 mm 22.2 mm
12 ptas. 45.7 mm 45.7 mm 36.8 mm 50.8 mm 20.6 mm
12 ptas. 53.8 mm 39.6 mm 36.8 mm 50.8 mm 22.3 mm
7/8"
6 ptas. 2 1/2"
1 5/8"
2 7/8"
3 1/2"
SIMDM300 Dado de tuerca de eje 12 planos.
s#UADROCUADRADODE
!PLICACIONESREMOCIØNDETUERCASDEEJE
s4OYOTA!VALON#AMRY(IGHLANDERY-ATRIX
s,EXUS%3
s0ONTIAC6IBE
s67"EETLE*ETTAY'OLFYPOSTERIORES
s$ODGE6ANS$ODGE&REIGHTLINER3PRINTERCONEJETRASERODEMM
YMÉSNUEVOS
!PLICACIONESEJESDESALIDAENTRANSMISIONESAUTOMÉTICAS
s#HRYSLER#Y#ROSSFIRE
s$ODGE-AGNUM
s*EEP'RAND#HEROKEEMODELOS6
s-ERCEDES-UCHOSA×OSDECOBERTURA
s!PLICACIONESTUERCASDEBRIDASENLAJUNTADEDIFERENCIALDELEJEDE
TRANSMISIØNYDELEJEDELPI×ØN
s"-7SERIE%
IMDM390 Dado de impacto poco profundo métrico de
12 puntas
s3EUTILIZAENELCUBODELANTERODEL4OYOTA4UNDRA7$
s#UADRODE
IMDM320 Dado de impacto poco profundo de 12 puntas.
!PLICACIONESDECUADRODE
s4UERCASDELEJEDETRANSMISIØNEN674OUAREGMODELOY
posteriores
s4UERCASDELEJEENELCHASIS-ERCEDES7DEACLASE
3#Y3,
s4UERCASDELEJEEN0ORSCHE"OXSTER#AYENNEY
s4UERCASDELEJEENLASSERIES88Y8DE"-7SERIE
y posteriores
Aplicaciones
Uso general en camiones de servicio mediano y liviano
Uso general en camiones de servicio mediano y liviano
Uso general en camiones de servicio mediano y liviano
Uso general, Ford F700 con ruedas de 8 orificios
Varios
Varios
Ruedas con rayos de rin para remolques estilo Dayton para servicios pesados.
Varios
Aplicaciones de ruedas con guía de pernos estilo Budd
Aplicaciones de equipos para construcción y fuera de ruta
Tuercas internas en aplicaciones de ruedas Budd
Tamaños de ruedas pequeñas de 8 tuercas para camiones de servicio mediano
Aplicaciones de camiones europeos
Aplicaciones de ruedas con guía de cubos generales
Aplicaciones de camiones importados
Aplicaciones de camiones importados
Aplicaciones de camiones importados
Aplicaciones de ruedas con guía de pernos estilo Budd
Aplicaciones de ruedas con guía de pernos estilo Budd
Aplicaciones de ruedas con guía de pernos estilo Budd
<Y\gk\]jm]\Yk\][Yeagf]khYjYk]jna[agkh]kY\gk
HDLUGSET1
HDLUGSET2
HDLUGSET1 Juego de dados de tuercas de
ruedas de servicio pesado.
sIncluye: SIM383, SIM403, SIM483B, SIMM333, SIMM383
más BW726A y BWD483 en una caja de almacenamiento
HDLUGSET2 Juego de dados de tuercas de
ruedas de servicio pesado.
sIncluye: SIM342, SIM482, SIMM332, SIMM382, SIMM412,
DW402C, más BW626A, BWD482 y BWDM412 en una caja
de almacenamiento PAKPB063
ADVERTENCIA
s#ONFIGURACIØNDELLAVE&LANK$RIVE
s%LACERODEALEACIØNCOMBINARESISTENCIAYDURABILIDAD
s4ODOSLOSDADOSSONDECUADROCUADRADODE
s#ONFIGURACIØNDELLAVE&LANK$RIVE
s%LACERODEALEACIØNESPECIALCOMBINARESISTENCIA
YDURABILIDAD
s4ODOSLOSDADOSSONDECUADROCUADRADODE
Fgmk]\Y\gk[jgeY\gkg\]Y[YZY\gaf\mkljaYd[gf`]jjYea]flYk\]aehY[lg&
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/&
465
NEUMÁTICOS Y RUEDAS
Dados y herramientas para desllantar
Dados de impacto de doble abertura
s!BERTURASDEPUNTASYCUADRADASCOMBINADAS
s5SARCONLOSRETENEDORESDEDADOSQUESEMUESTRANACONTINUACIØN
s!CABADOINDUSTRIAL
BWD482 Dado de doble abertura.
s(EXÉGONODECUADRADODECUADRODE
s,APROFUNDIDADDEABERTURAHEXAGONAL
ESDELAPROFUNDIDADDEABERTURA
CUADRADAESDEELHUELGO
HEXAGONALESDE
sDELARGO
BWD483 Dado de doble abertura.
BWD482
s3IMILARA"7$EXCEPTOQUECONTIENE
UNCUADROCUADRADODE
BWDM412 Dado de doble abertura.
s#UADROCUADRADODECONHEXÉGONO
DEMMYCUADRADODEMMDEBAJO
DELHEXÉGONO
s0ARA.ISSANY)SUZUCLASESY
DEYPOSTERIORES
s,ARGOMM
BWDM412
BWS1316A Removedor de pernos–Blue-Point®.
s0ARAUSARENPERNOSDEDERUEDAS"UDD
WSK755 Juego de pernos de ruedas para camiones
livianos–Blue-Point.
s0ARAUSARENLAMAYORÓADELOSCAMIONESLIVIANOSY356NACIONALES
EIMPORTADOS
s,ASUNIDADESCONCENTRADOAUTOMÉTICOPERMITENUNARÉPIDA
INSTALACIØNLAPRIMERAVEZ
s.ODA×ARÉLASROSCASUTILIZARCONLLAVESDEIMPACTO
s#ONTENEDORTIPOCONCHADEALMEJAPARAALMACENAMIENTO
s)NCLUYEINSTALADORESMMYMM
MÉSESPACIADORESYARANDELAS
Dados de impacto
BW626A
5SARCONLOSRETENEDORESDEDADOSQUESEMUESTRANARRIBAALADERECHA
!CABADOINDUSTRIAL
Pieza No.
BW626A
IM562
SIMM332
BW726A
Cuadro cuadrado,
pulgadas
3/4
3/4
3/4
1
Tamaño llave
Largo
Cuadrado de 13/16"
Hex. de 1 3/4"
Hexagonal de 33 mm
Cuadrado de 13/16"
4"
2 3/4"
82.6 mm
2 1/4"
BWS1316A
WSK755
WSK938 Juego de pernos para ruedas de automotores.
s0ARAUSARENLAMAYORÓADELOSAUTOSNACIONALESEIMPORTADOS
s,ASUNIDADESCONCENTRADOAUTOMÉTICOPERMITENUNARÉPIDAINSTALACIØN
LAPRIMERAVEZ
s.ODA×ARÉLASROSCASUTILIZARCONLLAVESDEIMPACTO
s#ONTENEDORTIPOCONCHADEALMEJAPARAALMACENAMIENTO
s)NCLUYEINSTALADORESMMYMMMÉS
ESPACIADORESYARANDELAS
Pasador de grillete
Dados de impacto de pasadores de grillete
s,ALLAVEDEFORMAOVALADASEUSAENELSERVICIODEPASADORESDEGRILLETESENSEMITRACTORES)NTERNATIONALY+ENWORTH
SPS10 Dado de pasador de grillete.#UADROCUADRADODE,AABERTURADELDADOESDEXDELARGO
SPS11 Dado de pasador de grillete.#UADROCUADRADODE,AABERTURADELDADOESDEXDELARGO
SPS10
Dados tipo llave inglesa
0ARAUSARCONLLAVEDETORQUECUANDOSEPRESTANSERVICIOSENEJESDE#HEVROLET'-Y&ORD
Pieza No.
ANS1929A*
ANS1930
ANS7269A
"LUE0OINT
Cuadro cuadrado,
pulgadas
3/4
3/4
1/2
No. de
orejetas
6
6
4
Diámetro externo,
pulgadas
2 5/8
2 7/8
2 3/4
Aplicaciones
Chevy/GMC con ejes de 5,200 y 7,200 lb.
Chevy/GMC con ejes de 11,000 y 13,500 lb.
Para Ford F250/F350 de 1985 y posteriores con eje trasero flotante.
ANS1929A
Herramientas para desllantar
TR200 Herramienta para desllantar.
s0ARALOSNEUMÉTICOSDEØMNIBUSCAMIONESOTRACTORES
s%LMARTILLODESLIZANTEPESALIBRAS
s'OLPEDEDELARGOLARGOTOTALDECERRADOYEXPANDIDO
BH102 Martillo.
s,AEMPU×ADURADELBDEDELARGOLEOTORGALAFUERZAYPALANCANECESARIA
PARADESLLANTARNEUMÉTICOSENAUTOSOENCAMIONESGRANDES
s!GARREDEGOMA
BH102-1 Empuñadura de reemplazo para martillo.
TR200
BH102
Retenedores de dados de impacto
Cuadro de 3/4"
Cuadro de 1"
IM182R Anillo de traba de goma.
s0ARATODASLASUNIDADESCONCUADRODE
IMR2 Retenedor de dado.
IM243P Pasador de traba de acero.
s0ARAUSARCON)-2
s3EAJUSTAA)-
IM243R Anillo de traba de goma sintético.
s0ARA)-)-A)-Y3)-A3)--
466
www.snapon.com/shoptools
IMR3 Retenedor de dado.
s0ARATODOSLOSDADOSDE
s%LSISTEMADERETENCIØNDE
PIEZASOSTIENEELDADOALYUNQUE
DELALLAVEDEIMPACTO
NEUMÁTICOS Y RUEDAS
@]jjYea]flYk\]k]jna[ag_]f]jYd
=pljY[lgj]k\]hYkY\gj]k\]Yd]lYk
TR100
DdYflY
TR102
TR100 Herramienta
para llanta.
s5TILIZARENLLANTASSEPARABLESYANILLOSDE
TSP813
traba para llanta
s5NEXTREMOSEENCUENTRAENÉNGULOELOTROESRECTO
s-IDEDELARGOCONEXTREMOSAMPLIOSDEY
TR102 Herramienta para llanta.
s0ARALLANTASCONCENTROSDESMONTABLES
s-IDEDELARGOCONUNEXTREMOAMPLIODE
TSP813 Separador de neumáticos de motocicleta.
s0ERMITEQUESOLAPERSONAINSTALENEUMÉTICOSCONCÉMARA
ENMOTOCICLETASDECALLEMOTOCICLETASTODOTERRENOEQUIPOS
AGRÓCOLASPEQUE×OSYEQUIPOSINDUSTRIALES
s0ERMITEACCEDERCONFACILIDADALORIFICIODELVÉSTAGODEVÉLVULACUANDO
INSTALAVÉSTAGOSDEVÉLVULASAªENNEUMÉTICOSCONCÉMARA
s%MPU×ADURAESTILODESTORNILLADORPARAMAYORCOMODIDADYCONTROL
s&ABRICADOTOTALMENTEENMETALDESERVICIOPESADOELACABADO
industrial negro ayuda a
EVITARLACORROSIØN
s,ARGOTOTAL
BmflY
S6129
YA105
S6129 Extractor de juntas.
s$ISE×ADOPARAEXTRAERELCOJINETEDELARUEDAUOTRASJUNTASPEQUE×AS
sDELARGOACABADOINDUSTRIAL
YA105 Extractor de juntas.
s0ARAREMOVERJUNTASDEGOMA
SRT1
sPUNTASDISE×ADASPARAALCANZARYFUNCIONAR
ENCASITODASLASAPLICACIONESDEJUNTAS
sDELARGO
SRT1 Herramientas de remoción de juntas.
s!HORRATIEMPOYTRABAJOALELIMINARLAPALANCACONTRALOSCOJINETESO
SACARLASJUNTAS
s3OSTIENESOLAMENTELAJUNTASINDA×ARLOSCOJINETES
s,ASJUNTASPERMANECENINTACTASLOQUEPERMITEUNANÉLISIS
completo de fallas
s,ASCU×ASYLAEMPU×ADURALARGAOFRECENPALANCAEXCEPCIONAL
s#ONSTRUCCIØNPARASERVICIOPESADOPARAUNAMAYORVIDAÞTILYCONFIABILIDAD
s&UNCIONACONJUNTASDEDIRECCIØNTRACCIØNYRUEDASDEREMOLQUEEN
las ruedas más grandes para servicio pesado
388CF Alicates diagonales de gran palanca.
sEl alicate de gran palanca extrae fácilmente los pasadores
de aleta
s-ORDAZADEDELARGO
sDELARGO
s!GARRESDEVINILO
388CF
SGCP1BR Extractor de pasadores
de aletas.
sEl vástago con tratamiento
térmico brinda
máxima resistencia
SGCP1BR
s%MPU×ADURADEAGARREBLANDODELARGO
S9094B Extractor de pasadores de aletas.
sLos pasadores se extraen
GOLPEANDOELYUNQUECONFUERZA
s,AEMPU×ADURALATERALGARANTIZAUNAGARREFIRME
S9094B
sDELARGO
s'ANCHODEACEROREEMPLAZABLE
S9094A2X Juego de remaches y gancho
de reemplazo.
s0ARA3"
CP9 Pinzas de pasadores de aletas.
CP9
s%LEXTREMOENÉNGULOAªAFLOJAELPASADOR
s%LEXTREMOENÉNGULOAªLOEXTRAE
sDELARGO
BF620C
BF623
EYrgk–:dm]%Hgafl
BF620C Mazo con cabeza de goma.
s,ASØLIDACABEZADEGOMAPOSEEUNLARGODEYUNDIÉMETRO
DE
s%MPU×ADURADEMADERAMACIZADE
s)DEALPARAREEMPLAZARTAPACUBOSTRABAJODECARROCERÓAETC
BF623 Mazo para golpe suave.
s$ISE×ADOPARAREDUCIRDA×OSYABOLLADURAS
s 0ARAUTILIZARENAPLICACIONESDEARMADOYENTODOTIPODE
superficies, como metales, vidrio, plástico y madera
sLa cabeza de polímero especial es resistente a la fatiga dinámica y
ALADEFORMACIØNYCOMPRESIØNINCLUSOATEMPERATURASEXTREMAS
LYhY[mZgk
HCH1A Herramienta par
HCH1A
instalar/remover tapacubos.
sExtremo tipo palanca en ángulo amplio para remover los tapacubos
y un mazo incorporado para reemplazarlos
s#ØMODAEMPU×ADURATIPODESTORNILLADOR
sDELARGO
HCH2 Tapacubos para centros
HCH2
Removedor–Blue-Point®.
sLa palanca de extremo doble remueve los tapacubos para centros
ENLAMAYORÓADELASRUEDASDECROMOYALUMINIOSINDA×ARLARUEDA
s,OSEXTREMOSDELAHERRAMIENTATIENENUNACUBIERTADE06#PARA
proteger la superficie de la rueda
s&UNCIONAENTAPACUBOSPARACENTROSDEPLÉSTICOODEMETAL
TWP8 Receptáculo de ruedas
de camión.
TWP8
s!YUDAAEVITARLASUCIEDADYLOSDERRAMES
s3EADAPTAALLANTASCONUNDIÉMETROINTERNODEOMÉSGRANDES
PARASERUTILIZADASENLAMAYORÓADELOSCAMIONESYREMOLQUES
s#ONTIENEHASTAONZASDEACEITE
s%LRECEPTÉCULONOSEARQUEASISECALIENTEELACEITE
s%LCOMPARTIMIENTOSOBRE
LAEMPU×ADURACONTIENELASTUERCAS
del cubo
;YdrYkhYjYjm]\Yk–:dm]%Hgafl
LYhY_mYj\Yhgdng
GCP10 Herramienta para tapa
GCP10
para grasa y polvo.
sLas mordazas ahusadas de la herramienta calzan detrás del borde
plegado de la tapa para grasa
sEMPU×ADURADISE×ADAPARAPALANQUEARLOSTAPACUBOS
ADVERTENCIA
J][]hl~[mdg\]jm]\Yk
\][Yeaf–:dm]%Hgafl
YA9020A
YA9020A Calzas para ruedas
de camiones.
sLas calzas para camiones de servicio pesado se conectan por
MEDIODEUNACUERDADENILØNDEgMIDENDEANCHOYTIENEN
UNAALTURATOTALDE
s$ISE×OANTIDESLIZANTE
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/&
467
ALINEACIÓN DE RUEDAS
Junta de bola
Prensa para la junta de bola
BJP1
BJP1-18
Juego maestro de prensa para junta universal/junta
de bola BJP1. El juego maestro de prensa para junta de bola
cubre el 95% de los autos de pasajeros y camiones livianos y SUV
actuales nacionales. Aplicaciones: vehículos Ford (43 modelos),
GM (53 modelos), Dodge/Daimler-Chrysler (54 modelos) y Jeep
(16 modelos). Instala y remueve juntas de bola con accesorios
para grasa rectos y premontados. El armazón de prensa cuenta
con una garganta grande para aplicaciones de junta de bola y
capacidad de soporte de prensa de tornillo para aplicaciones de
juntas universales. El diseño de traba de copa mantiene las copas
en su lugar. Tornillo de presión con rosca gruesa grande para mayor
resistencia y fuerza máxima. Accesorio de engrase Zerk para un
funcionamiento suave del tornillo. Incluye una tabla de aplicaciones
completa para juntas de bola/juntas universales y una caja de
almacenamiento/transporte. Visite www.snapon.com para obtener
información completa sobre todas las guías de aplicaciones.
BJP1F Armazón de prensa.
sAbertura de garganta de 7 13/16": 3 1/2" de profundidad
s!LTURADEDELARGO
ME7A207 Anillo de retención.
sAnillo de retención incluido en los juegos BJP1 y UJP1
ME7A208 Anillo de resorte grande.
sAnillo de resorte grande incluido en los juegos BJP1 y UJP1
ME7A209 Anillo de resorte pequeño.
sAnillo de resorte pequeño incluido en los juegos BJP1 y UJP1
ME9A34 Bola de acero.
sBola de acero incluida en los juegos BJP1 y UJP1
PAKPB061 Caja de almacenamiento.
Pieza No.
BJP1-1
BJP1-2
BJP1-3
BJP1-4
BJP1-5
BJP1-6
BJP1-7
BJP1-8
BJP1-9
BJP1-10
BJP1-11
BJP1-12
BJP1-13
BJP1-14
BJP1-16
BJP1-17
BJP1 Componentes del juego
D.I.-D.E.,
pulgadas
Largo,
pulgadas
Adaptador de manguito
Tornillo de presión, rosca de 1 1/8
-7 UNRC, hexágono de 7/8
Almohadilla de presión (junta de bola)
Almohadilla de presión (junta universal)
Adaptador
Adaptador / Extensión
Adaptador
Adaptador
Adaptador, cara frontal en ángulo de 4.5º
Adaptador, cara frontal en ángulo de 4.5º
Adaptador
Adaptador
Adaptador
Adaptador
Adaptador
Accesorio para grasa (para
armazón de prensa BJP1F)
1 9/32 - 1 21/32
2 1/8
—
9 3/4
N/A - 1 19/32
N/A - 7/8
29/32 - 1 11/32
1 1/4 - 1 21/32
1 11/16 - 1 29/32
1 25/32 - 2
1 27/32 - 2
2 11/32 - 2 21/32
2 - 2 1/4
2 1/4 - 2 1/2
2 7/16 - 2 3/4
2 11/16 - 2 15/16
2 1/4 - 2 1/2
3 3/16
3 3/16
1 13/16
2 1/16
1 1/8
1
1 1/4
2 1/8
2 1/8
2 3/4
1 11/16
2 3/4
1 1/8
2 1/4 - 2 1/2
1 1/8
Herramientas de servicio general
BJP1-18 Adaptador del receptor.
sUtilizar con BJP1 para una instalación o remoción rápida de juntas de bola
INFERIORESPARAVAN3PRINTER$ODGE-ERCEDESMODELOSDEA
s,ASHERRAMIENTASNECESARIASPARALAREMOCIØNINSTALACIØNDEJUNTAS
de bola inferiores incluyen: pistón de instalación (BJP1-11), receptor
de instalación (BJP1-13), pistón de remoción (BJP1-6) y receptor de
remoción (BJP1-18)
s,ASAPLICACIONESDELAJUNTADEBOLASUPERIORESNOSEAPLICANAESTA
herramienta
BJP1HONDA Juego de adaptadores.
s0ARAINSTALARYREMOVERJUNTASDEBOLASUPERIORESINFERIORESENMUCHO
vehículos Honda y Acura: debe utilizarse con el juego maestro de juntas
de bola BJP1/de prensa para junta universal
s)NCLUYEADAPTADORESPARAJUNTADEBOLA"*0Y"*0MÉSCADA
UNOANILLOS/-%!
BJP1-22 Adaptador.
sPara instalar y remover juntas de bola superiores/inferiores en mucho
vehículos Honda y Acura: debe utilizarse con el juego maestro de juntas
de bola BJP1/de prensa para junta universal
BJP1-24 Adaptador.
s0ARAINSTALARYREMOVERJUNTASDEBOLASUPERIORESINFERIORESENMUCHO
vehículos Honda y Acura: debe utilizarse con el juego maestro de juntas
de bola BJP1/de prensa para junta universal
BJP1-25 Adaptador del receptor.
s5TILIZARCONELJUEGOMAESTRODEJUNTASDEBOLA"*0DEPRENSAPARA
junta universal para instalar y remover rápidamente las juntas de bola
DECAMIONES&ORD&Y&DEA
Junta de bola/separadores de la barra de unión
Pieza No.
1658C
468
A204
A200
A201
A203
A204
S9365B
Abertura de
mordazas, pulgadas
5/8
13/16
1
1 1/4
Largo total,
pulgadas
12
18
12
12
S9613
Dados para junta de bola
S9365B Dado p/ junta de bola. S9613 Dado para junta de bola.
sPara automóviles medianos Chrysler sPara usar en ejes 4-5B tales como
s#UADROCUADRADODE
se encuentran en las camionetas con
s%LTAMA×ODEALLAVEES
tracción en las cuatro ruedas Dodge,
largo de 2"
Ford, Chevrolet, GMC, International
S9479A Dado para junta de bola. sAjusta el manguito en el tope del
sPara camionetas y vans Dodge/Chrysler yugo de la suspensión delantera
s#UADROCUADRADODE
sCuadro cuadrado de 1/2", D.E. 1",
s%LTAMA×ODEALLAVEESLARGO largo 2 1/8"
de 2"
Herramientas de servicio general
SIML160
BJP1HONDA
SIML160 Dado de impacto extra profundo de
6 puntas.
sSe utiliza para extraer o reemplazar tuercas de cinta de
retención de tanques de combustible
sTambién tiene aplicaciones en tuercas de ajuste de
frenos de emergencia y retenedores estabilizantes
s#UADROCUADRADODECONABERTURADELLAVEDE
puntas de 1/2"
sDELARGO
Herramientas de servicio general–
Blue-Point®
1658C Alzaprimas.
s16" de largo
2420A Alzaprimas.
sDELARGO
2430C Alzaprimas.
sPunta ahusada en un extremo y borde tipo
cincel el el otro
s&ILODEDADODELARGOTOTALDE
www.snapon.com/shoptools
ALINEACIÓN DE RUEDAS
@]jjYea]flYk\]k]jna[ag_]f]jYd
TC90A
@]jjYea]flYk\]
k]jna[ag_]f]jYd
BF620C
TC90A Cortador del tubo de escape.
s0ARACORTESDEADEDIÉMETROENAUTOMØVILES
s,ACADENADECORTEDEESLABONESMIDEvDELARGO
s%LEJEROSCADOCCRUCETABRINDAELASTICIDADPARAEVITARQUE
SEROMPANLASRUEDASDELACADENA
s)DEALPARACORTARELCONJUNTODELPUNTALAFINDEPERMITIREL
SERVICIODELCARTUCHO
TC90A1 Conjunto de cadena.
s)NCLUYERUEDAYPASADORDERODILLO
BF620C Mazo con cabeza de goma–Blue-Point®.
s,ASØLIDACABEZADEGOMATIENEDELARGOY
DEDIÉMETRO
s%MPU×ADURADEMADERAMACIZADE
s)DEALPARAREEMPLAZARTAPACUBOSTRABAJODECARROCERÓAETC
GCP10 Herramienta para tapa para grasa y polvo.
s,ASMORDAZASAHUSADASCALZANDETRÉSDELBORDEPLEGADO
DELATAPAPGRASA
GCP10
s5NAEMPU×ADURADISE×ADAPARAPALANQUEARLOS
TAPACUBOS
B240B Gato de pedal de
freno y acelerador–Blue-Point.
s-ANTIENEELREDUCTORAUNA20-CONSTANTE
s3EAJUSTAFÉCILMENTEALLARGODESEADO
s%LTORNILLODEAJUSTEESTABLECEENFORMAPRECISA
LAS20-DESEADAS
s,APUNTADEGOMAMANTIENEALAHERRAMIENTA
FIRMEMENTEUBICADA
s,ARGOTOTALDECM
s4AMBIÏNSEPUEDEUSARCOMOPULSADORDELPEDAL
YA6510 Extractor de bujes–Blue-Point.
s5TILIZADOEN!CURA)NTEGRAADEMÉSDE
DIVERSOSVEHÓCULOS(ONDA
YA6510-2 Adaptador para el extractor de
bujes–Blue-Point.
s0ERMITEUTILIZARELEXTRACTORDEBUJES9!EN
VEHÓCULOS)NTEGRAMODELO
B240B
YA6510
9egjla_mY\gj
<Y\gk\]Yegjla_mY\gj
Pieza No.
A137
A138
A139
Cuadro cuadrado,
pulgadas
3/8
3/8
3/8
Ancho oval
llave
1/4"
15/64"
6 mm
Diám. oval
llave
5/16"
21/64"
8 mm
Largo,
pulgadas
29/32
29/32
23 mm
A137
Jm]\Y_ajYlgjaY
DdYn]k
,LAVESDECOMBINACIØNMÏTRICAS$ISE×ODEMANGOLARGOPARASUACCESO
17
18
19
Pieza No.
A
B
C
D
E
OEXLM17B
OEXLM18B
OEXLM19B
25
27
28
35
37
39
11
12
12
8
8
9
298
314
330
OEXLM18B
CC6630 Herramienta para alineación rueda/giratoria.
CC6630
s&UNCIONAEN#HEVY%XPRESS'-SERIE'YPOSTERIORESYVANS3AVANNADE'-#
s%LIMINALANECESIDADDEUSARELPERNOEXCÏNTRICODELANTERODEMM
ALCUALESDIFÓCILACCEDERPORDETRÉSDEUNAPLACADEACERO
s%NGANCHARLAHERRAMIENTAENELBRAZO!DEARRIBACONLATUERCADETRABADESAJUSTADAPRESIONAROTIRARDELA
HERRAMIENTAPARAFACILITARELAJUSTEDELASRUEDASGIRATORIAS
s!HORRAALREDEDORDEMINUTOSPORLADO
@]jjYea]flY\]Ybmkl]\]dYZYjjY\]mfaf
WA12A Herramienta de ajuste de
la barra de unión.
s0ARAAUTOMØVILESGRANDESYCAMIONESLIVIANOS
s#UADROCUADRADODEDELARGO
WA13A
WA13A Herramienta de ajuste de la barra de unión.
s0ARAAUTOMØVILESCOMPACTOSYMEDIANOS
s#UADROCUADRADODEDELARGO
WA16 Herramienta de ajuste de
la barra de unión.
s0ARACAMIONESGRANDES
WA17
s#UADROCUADRADODEDELARGO
WA17 Herramienta de ajuste de la barra de unión.
s%LDISE×OPERMITEUNAROTACIØNDEªDELMANGUITO
DEAJUSTEHASTAENÉREASESTRECHAS
s5SARENMANGUITOSDEENCAMIONETASGRANDES
DEYTONELADASINCLUSO&ORD3UPER$UTY
s5SARCONTRINQUETEDECUADROCUADRADOOMANGO
ARTICULADODE
s!CABADOCROMADODELARGO
ADVERTENCIA
:YjjY\]Mfaf
YA2218
YA2218 Herramienta de ajuste de la
barra de unión.
s0ARAVEHÓCULOSNACIONALESEIMPORTADOSCON
DIRECCIØNDECREMALLERAYPI×ØNQUEUSAN
BARRASDEUNIØNCONSECCIONESDEAGARRE
MOLETEADASOHEXAGONALESDEAMM
s-ORDAZASCARGADASCONRESORTEYEMPU×ADURA
DECØMODOAGARRE
Fgmk]`]jjYea]flYk\]eYfg[jgeY\Ykg\]Y[YZY\gaf\mkljaYd[gf`]jjYea]flYk\]aehY[lg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
469
ALINEACIÓN DE RUEDAS
Barra de Unión
YA2222
YA3000C
YA3100
YA3500
WA14A
WW500
WA800
ITRS22
YA6870
Herramienta de ajuste de la barra de unión
YA2222 Llave de ajuste de la barra de unión.
s0ARAVEHÓCULOSNACIONALESEIMPORTADOSCONDIRECCIØNDECREMALLERAY
PI×ØNQUEUSANBARRASDEUNIØNCONSECCIONESDEAGARREMOLETEADASO
HEXAGONALESDEMM
s-ORDAZASCARGADASCONRESORTEYEMPU×ADURADECØMODOAGARRE
sDELARGO
YA2223 Llave de ajuste de la barra de unión.
s0ARADIRECCIØNDECREMALLERAYPI×ØNQUEUSANBARRASDEUNIØNDEAMM
s-ORDAZASCARGADASCONRESORTEYEMPU×ADURADECØMODOAGARRE
s!PLICACIONES$ODGE$AKOTAY#ARAVANYPOSTERIORES$ODGE$URANGO
$ODGE6IPERYPOSTERIORESYLAMAYORÓADELOSCAMIONES'-DETON
TONYTONYPOSTERIORES
Herramientas de extracción/instalación de la barra de unión
YA3000C Herramienta para ajuste de la barra de unión
interna–Blue-Point®.
s$ISE×ADAPREMOVERLASBARRASDEUNIØNQUENOPOSEENUNHEXÉGONOCOMPLETOEN
ELEXTREMODELCUADRO
s3ECOLOCANADAPTADORESDEPIEREMOVIBLESENELHEXÉGONODELABARRADEUNIØN
s3EAJUSTAALPIEPARAREMOVEROINSTALARLABARRADEUNIØN
s)NCLUYEADAPTADORESDEPIEENLOSSIGUIENTESTAMA×OS
YMM
WA14A Dado del extremo de la barra de unión.
s0ARAREMOVERLOSEXTREMOSDELABARRADEUNIØN
s3EAJUSTAALAMAYORÓADELOSAUTOMØVILESYAALGUNOSCAMIONES
s,AABERTURAEN5MIDEX
s0ARAUSARCONEMPU×ADURASCONCUADROCUADRADODE$)
DELARGO
WA15 Dado del extremo de la barra de unión.
s3IMILARAL7!!
s0ARABARRASDEUNIØNQUEDANSERVICIOALAMAYORÓADELOSCAMIONESDE#LASEA
s,AABERTURAEN5MIDEX
s0ARAUTILIZARCONEMPU×ADURASCONCUADROCUADRADODE$)
DELARGO
WA800 Dado de la barra de unión para camiones de servicio pesado.
s3EUSAENLAMAYORÓADELOSCAMIONESDESERVICIOPESADODE#LASEYCEJES
DEALIBRAS
s,ARANURAEN5MIDEX
s%LDIÉMETROINTERIORESDE
s,ALONGITUDTOTALESDE
ITRS22 Dado de bujes de la barra de unión–Blue-Point.
s3EUTILIZAPARAACCEDERALOSBUJESDELABARRADEUNIØNINTERNAENVEHÓCULOS
#HRYSLER,(3#ONCORDEY$ODGE-)NTREPIDQUESECARACTERIZANPORELESTILO
DECARROCERÓA,(
s%LDISE×ODEBAJOPERFILOFRECEFÉCILACCESOPARAINSTALAROREMOVERLOSPERNOS
DECABEZAHEXAGONALDEOMM
s.OESPOSIBLEUTILIZARUNDADOCONVENCIONALENESTAAPLICACIØN
YA3100 Herramienta para ajuste de la barra de unión interna.
s3EUTILIZAENLASBARRASDEUNIØNINTERNACONPLANOSINACCESIBLESCONLLAVESQUE
SEENCUENTRANENMUCHOSCAMIONESY356
s,AHERRAMIENTAGRANDEPARAAJUSTEDELABARRADEUNIØNINTERNAINCLUYELLAVES
DEPIEMMMMYMM
s%LDADOLARGOSEDESLIZASOBREELEXTREMODELABARRADEUNIØNYLALLAVEDEPIE
SEAJUSTAALDADOPARAUNAFÉCILREMOCIØNEINSTALACIØN
s,ASAPLICACIONESINCLUYENMUCHOSCAMIONESY356DE4OYOTA.ISSAN&ORD
,INCOLN-ERCURYY#HEVROLET
s4AMBIÏNSEADAPTAAALGUNOSVEHÓCULOS#ADILLAC%SCALADE(UMMER((ONDA
0ASSPORTY*EEP,IBERTY
470
YA2224 Herramienta de ajuste de la barra de
unión.
s$EDISE×OSIMILARA9!PEROPARABARRASDEUNIØN
DEAMMDEDIÉMETROTALESCOMOLASQUESE
ENCUENTRANENLOSVEHÓCULOS&ORD%SCORT'-'EOYLOS
MODELOSMÉSPEQUE×OSDE.ISSANCONDIRECCIØNDE
CREMALLERAYPI×ØN
s-ORDAZASCARGADASCONRESORTEYEMPU×ADURASDE
CØMODOAGARRE
sDELARGO
YA3500 Llave para barra de unión interna
universal–Blue-Point.
s2EMUEVELABARRADEUNIØNINTERNAEQUIPADACONDADOS
DEEXTREMOSCOMPLETAMENTEREDONDEADOSOPLANOS
s$ISE×ADAPARAREMOVEREINSTALARTODOSLOSDADOSDE
BARRASDEUNIØNINTERNAHASTADE
s,ACABEZADELALLAVETIENEJUEGOSDETORNILLOSQUESE
AJUSTANCONTRAELDADO
s)NCLUYEUNALLAVEHEXDECABEZACORTADE
s'ARANTÓADEPORVIDA
WW500 Llave para cremallera–Blue-Point.
s3EUSAENCREMALLERASDEDIRECCIØNPARAREALIZARSERVICIOS
ALOSEXTREMOSDELASBARRASDEUNIØNINTERNA
s3EAMOLDAALEXTREMODELACREMALLERACONCUADRO
HEXAGONALREDONDEADOCONPLANOSDECUADROO
REDONDEADOSINPLANOSDECUADRO
s,AUNIVERSALSEAMOLDAATAMA×OSDESDEMM
HASTAMMYLOSTAMA×OS
HEXAGONALESDESDEMMHASTAMM
CUADROHEXAGONALDEMM
s,AFUERZADESUJECIØNAUMENTAAMEDIDAQUELACARGA
SEAPLICA
YA6870 Juego de alineación de convergencia
trasera de Subaru.
s)NCLUYELLAVESCADAUNADEDELARGOPARATENERMÉS
ALCANCE
s9!UNALLAVEDEMMDEPUNTASCONELÉNGULO
CORRECTODEªPARASOSTENERDEMANERASEGURAELPERNO
DELEVA
s9!UNALLAVEDEEXTREMODOBLEDEMMMM
DEPUNTASDISE×ADAPARACUMPLIRCONLOSNIVELESDE
TORQUEALTOREQUERIDOSCUANDOSEAFLOJAAJUSTALATUERCADE
RETENCIØNDELPERNODELEVA
s5TILIZADAENTODOSLOS3UBARUMODELOYPOSTERIORES
s9!SEADAPTAALOSAUTOMØVILES3UBARUMODELO
YPOSTERIORES9!SEADAPTAA3UBARU
MMYYPOSTERIORESMM
s%LACERODEALTACALIDADRECIBEUNTRATAMIENTOTÏRMICO
ESPECIALPARACUMPLIRCONLOSREQUERIMIENTOSDETORQUE
YA6870-1 Llave de alineación de convergencia.
s,LAVEDEPERNOSDELEVASPARAAUTOMØVILES3UBARU
YA6870-2 Llave de alineación de convergencia.
s,LAVEPARATUERCASDERETENCIØNDEPERNOSDELEVAPARA
AUTOMØVILES3UBARU
www.snapon.com/shoptools
ALINEACIÓN DE RUEDAS
HmflYd
MSC1
MSC2
WA92
WA7500
YA9260
EY[H`]jkgf';gehj]kgj]k\]j]kgjl]k]khajYd]k
@]jjYea]flYkhmflYd]khYjY>gj\q?E
WA92 Compresor de resorte espiral.
s-ANTIENEELRESORTEESPIRALALATENSIØNDESEADAPLAREMOCIØNDE
otras partes
s4ORNILLODE
s,UBRICARLAROSCACONUNCOMPONENTEANTIADHERENTE
MSC1 Herramienta maestra para puntal
MacPherson–Blue-Point®.
s$ISE×ADAPARACOMPRIMIRRÉPIDAYFÉCILMENTELAMAYORÓADELOS
RESORTESDEPUNTALES-AC0HERSON
s#OMPRIMEUNDIÉMETRODEESPIRALDEHASTAMM
s!MPLIOCONTACTODERESORTEPARALOGRARUNACOMPRESIØNESTABLE
s6ARILLAROSCADA!CMEYCERRADURASDEDETENCIØNINCORPORADASPARA
AYUDARATRABARELRESORTEENSULUGAR
s#ONSTRUCCIØNFORJADAPARAMAYORRESISTENCIAYDURABILIDAD
MSC2 Compresor de resorte espiral–Blue-Point.
s2EMUEVEEINSTALARESORTESDEESPIRALENFORMARÉPIDAYSEGURA
s#OMPRIMELOSRESORTESDEESPIRALENTODOSLOSVEHÓCULOSDE
PASAJEROSYENLASCAMIONESDECARGA
s4IENEUNAVARILLAROSCADA!CME
s)NCLUYEUNATARJETADEINSTRUCCIONES
MSCS1000 Juego de compresor
de resorte maestro.
s)NCLUYE-3#Y-3#ENCAJA
de almacenamiento
YA9260 Juego de herramientas de cartucho de puntal
frontal GM.
s2EMUEVEEINSTALAELCARTUCHOPUNTALFRONTALYASEACARGADOCON
ACEITEOGASENAUTOMØVILES'-MODELOYPOSTERIORESCON
plataforma W
s4RABAJATANTOENLOSAMORTIGUADORESCARGADOSDEACEITEQUE
PROVIENENDELINVENTARIODELFABRICANTECOMOENLOSAMORTIGUADORES
COMERCIALESCARGADOSDEGAS
YA9260-1 Llave de tuerca del cartucho puntal.
s,LAVEDETUERCADELCARTUCHOPUNTALDELJUEGO9!
YA9260-2 Llave del paragolpes del sacudidor del puntal.
s,LAVEDELPARAGOLPESDELSACUDIDORDELPUNTALDELJUEGO9!
WA7500 Herramienta del cartucho del puntal de GM.
s2EEMPLAZAELCARTUCHODELPUNTALATRAVÏSDELATORREDEIMPACTO
DELACARROCERÓAENVEHÓCULOS'-SERIE7
s)NCLUYELOSMODELOSYPOSTERIORESDE0ONTIAC'RAND0RIX
/LDSMOBILE#UTLASSY"UICK2EGALYYPOSTERIORESDE
#HEVROLET,UMINA
;m[`addYkYd[YjZmjg
YA333A Juego de cuchillas
al carburo.
sDESBASTADORASDECARBUROPARA
REALIZARAJUSTESDEALINEACIØNEN
PUNTALES-AC0HERSON
s$ISE×ODEDOBLECORTE
s$IÉMETRODELVÉSTAGOLARGODELCORTE
s)NCLUYEBOLSADEJUEGO9!!
<Y\ghYjYlm]j[Y\]hmflYdNO'9m\a
YA8730 Dado para tuerca de puntal
VW/Audi.
s0ARAVEHÓCULOSMODERNOSDETRACCIØN
DELANTERAPARAREMOVERLATUERCADERETENCIØN
del puntal superior
YA8730
YA333A
YA
El juego 333
A
contiene:
Pieza No.
YA333A1
YA333A2
YA333A3
Diámetro
cabeza,
pulgadas
1/4
3/8
5/8
Largo vástago,
pulgadas
1
2
2
s
s
s
LCAT1
@]jjYea]flY\]dZjYrg\][gfljgdaf^]jagj–:dm]%Hgafl
LCAT1 Herramienta del brazo de control inferior.
s#ONLAOPERACIØNDEHOMBREse realiza ELTRABAJOMÉSRÉPIDAY
FÉCILMENTE
sFacilita el reemplazo de puntales y remueve las juntas de bola sin
DA×OS
ADVERTENCIA
YA6810
@]jjYea]flYhYjYZmb]k\]Ymlgenad][email protected]\Y'9[mjY–:dm]%Hgafl
YA6810 Juego de herramientas para bujes de
automóviles Honda/Acura.
sSe utiliza para remover e instalar bujes del brazo de control inferior
de vehículos Honda y Acura sin necesidad de una prensa
Aplicaciones:
Honda:
sCivic 2001-2005
s#26
s%LEMENT
s0ILOTYPOSTERIORES
s/DYSSEYYPOSTERIORES
s2IDGELINEYPOSTERIORES
s!CCORD
Acura:
s-$8
s4,
Fgmk]`]jjYea]flYk\]eYfg[jgeY\Ykg\]Y[YZY\gaf\mkljaYd[gf`]jjYea]flYk\]aehY[lg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
471
EXTRACTORES DE RUEDAS/EJES
Extractores para pernos de punta de eje
Hidráulicos con capacidad de 20 toneladas
CG430HYC Juego de prensas hidráulicas para pasadores
de punta de eje. %LCONJUNTODEBOMBAYPISTØNHIDRÉULICOS#'!
UTILIZATONELADASDEFUERZACONTROLADAPARAREMOVERPASADORESDE
PUNTADEEJEMUYAJUSTADOSENVEHÓCULOSGRANDESCONPASADORESDE
PUNTADEEJEDEHASTADEDIÉMETRO4AMBIÏNREMUEVEPASADORES
DEANCLAJEDEZAPATASDEFRENOENCAMIONES&ABRICADOCONBRAZOLATERAL
ANCHO5SAPILOTOSDEXXYX)NCLUYEBUJES
DEGUÓAXYX
CG430HYC2S Juego de prensas hidráulicas para
pasadores de punta de eje.
s#'(9#*UEGOCONPISTØNHIDRÉULICO#'!3YBOMBADEETAPAS
CG430B Juego de prensas para pasadores de punta de eje.
s*UEGO#'(9#SINLOSCOMPONENTESDEFUERZAHIDRÉULICA
Hidráulicos con capacidad de 35 toneladas
CG730HY Prensa hidráulica para pasadores de punta de eje.
s0ARAUSARENCAMIONESGRANDESYMEDIANOSCONPASADORESDEPUNTADE
EJECONDIÉMETRODEA
s%SSIMILARA#'(9#EXCEPTOQUEUSACOMPONENTESDEFUERZA
HIDRÉULICADETONELADASPISTØN#'BOMBA#'!MANGUERA
#'YACOPLADORRÉPIDO#'
s)NCLUYEBUJESDEGUÓAYPILOTOS
CG730HY2S Juego de prensas para pasadores de punta
de eje.
s#'(9*UEGOCONPISTØNHIDRÉULICO#'!3YBOMBADEETAPAS
CG730 Juego de prensas para pasadores de punta de eje.
s*UEGO#'(9SINLOSCOMPONENTESDEFUERZAHIDRÉULICA
CG430HYC
Juego manual de 3/4 y 1 tonelada
CG230A Juego de prensas para pasadores de punta de eje.
s!PLICACIONESCONCAMIONESPESADOSØMNIBUSYVANSCUYOSPASADORES
DEPUNTADEEJESEANMÉSGRANDESDEINCLUYENDOLOSCAMIONESY
VANS&ORDDETONYTON
s,ASEPARACIØNESDEYALCANZAUNAPROFUNDIDADDE
s)NCLUYEUNAGUÓADEBUJEDEADAPTADORYPILOTOSDEDE
DIÉMETRODEY
CG230A
Componentes del juego
Pieza No.
CG430HYC
—
—
Tornillo de Adaptador Cabeza de Poste del
presión
de yugo
trabajo
yugo (2)
CG430-1
CG430-2
CG430-3
CG430-4
—
—
—
—
—
—
—
—
Tuerca del
poste (2)
CG45-2
—
—
Guía piloto
CG430-6
—
—
Buje de 1
x 7/8"
CG430-7
—
—
3/8"
Buje de 1 3/8"
Tapón de
expansión
x 3 1/4"
CG430-8
CJ91-2A
—
—
—
—
Juego
Hidráulico
CG420A
—
—
Pilotos de
diámetro 7/8"
CG230-9 (6")
CG230-8 (4")
CG230-10 (8")
CG430HYC2S %STEESELJUEGO#'(9#CONPISTØNHIDRÉULICO#'!3YBOMBADEETAPAS
Pieza No.
CG730HY
—
—
—
—
—
—
Tornillo de
presión
CG730-1
—
—
—
—
—
—
Adaptador
de yugo
CG730-2
—
—
—
—
—
—
Cabeza de
trabajo
CG730-3
—
—
—
—
—
—
Poste del
yugo (2)
CG730-4
—
—
—
—
—
—
Guía
piloto
CG730-6
—
—
—
—
—
—
Tuerca del
poste (2)
CG750-7
—
—
—
—
—
—
Buje de 1
15/16"
CG730-7
—
—
—
—
—
—
Buje de 1
9/16"
CG730-8
—
—
—
—
—
—
Buje de 1
13/16"
CG730-9
—
—
—
—
—
—
Juego
Hidráulico
CG420A
—
—
—
—
—
—
Pilotos
CG730-12 (6 3/4")
CG730-10 (2 1/4")
CG730-11 (4 1/2")
CG730-15 (6")
CG730-13 (9")
CG730-16 (9 1/2")
CG730-14 (11 1/4")
CG730HY2S %STEESELJUEGO#'(9CONPISTØNHIDRÉULICO#'!3YBOMBADEETAPAS
Pieza No.
CG212A
—
—
Pieza No.
CG230A
—
—
—
472
Separación,
pulgadas.
3
—
—
Alcance,
pulgadas
6 1/2
—
—
Separación,
pulgadas
5 1/8
—
—
—
Alcance,
pulgadas
12 3/16
—
—
—
Tornillo de Yugo de
presión
tornillo
CG21A
CG21B
—
—
—
—
Tornillo de
presión
CG230-1
—
—
—
Yugo de
tornillo
CG230-2
—
—
—
Poste del yugo Tuerca del
de tornillo (2)
poste (2)
CG21D
CG21J
—
—
—
—
Poste del yugo
de tornillo (2)
CG230-4
—
—
—
Tuerca del
poste (2)
CG230-5
—
—
—
Buje de
Cabeza de
uso general
1 1/4"
CG21P5
CG21P3
—
—
—
—
Cabeza de
uso general
CG230-3
—
—
—
Buje de
1 1/4"
CG230-6
—
—
—
Buje de 1"
CG21P2
—
—
Pilotos de
diámetro 7/8"
CG230-9 (6")
CG230-7 (2")
CG230-8 (4")
CG230-10 (8")
www.snapon.com/shoptools
Pilotos
CG21E largo (3/4" de diámetro)
CG21F corto (3/4" de diámetro)
CG21G largo (5/8" de diámetro)
Adaptador
CG230-11
—
—
—
EXTRACTORES DE RUEDAS/EJES Y ÁRBOL DE TRANSMISIÓN
=pljY[lgj]k\]jm]\Yk']b]k
9\YhlY\gjhYjYj]egn]j[mZg\]jm]\Y
DHP1 Adaptador para remover cubo
DHP1
de rueda en Dodge.
s$ISE×ADOPARAREMOVERCUBOSFRONTALESENCAMIONETASDECARGA
$ODGEDETONELADASSERIEYDETONELADASERIE
s2EDUCEELRÏGIMENPLANONECESARIOPARACAMBIARLASJUNTAS
UNIVERSALESPARAREALIZARELSERVICIOALDIFERENCIALDELANTEROJUNTAS
DEBOLAYCUALQUIERSERVICIODELCUBODELANTERO
s%NPROMEDIOLLEVAHORASHACERLOSDOSLADOSUTILIZANDOUN
MARTILLODEFORJAUNMARTILLOANTORCHAODESLIZANTEDESERVICIO
PESADO#ONEL$(0LLEVAALREDEDORDEHORAHACERLOSDOSLADOS
s3INROTORESROTOSALUSARUNMARTILLODEFORJA
s3INUSARMARTILLOSDESLIZANTESDESERVICIOPESADO
s,ASJUNTASYLOSCOJINETESDERUEDASNOSUFRIRÉNDA×OS
FHP1 Adaptador para remover cubo de rueda en Ford.
s$ISE×ADOPARASACARLOSCUBOSFRONTALESENCAMIONETASDECARGA
&ORDSERIE&Y&
s2EDUCEELRÏGIMENPLANONECESARIOPARACAMBIARLASJUNTAS
UNIVERSALESPARAREALIZARELSERVICIOALDIFERENCIALDELANTEROJUNTAS
DEBOLAYCUALQUIERSERVICIODELCUBODELANTERO
s,ACOLOCACIØNSUAVEDELDADONODA×ARÉLOSPERNOS
EYjladdgkq]b]k\]kdarYfl]k
CJ1250
CJ1250 Martillo deslizante de 12 lb.
s$ISE×ADOPARAEXTRAEREJESTRASEROS
s%STEMARTILLODESLIZANTEMIDEAPROXIMADAMENTEDELARGO
CONUNAROSCADE
s3EPUEDEUSARCONELEXTRACTORDECUBOS9!!
HafrYk\]Yfaddgk\]j]kgjl]
SRP400A Juego de pinzas de anillos de resorte.
s)NCLUYELASSIGUIENTESPINZASDEANILLODERESORTEENUNABANDEJADE
ALMACENAMIENTO
SRP1B Pinzas de anillos de resorte.
s0ARAEJESDESALIDAENTRANSMISIONES's,ASMORDAZASSERRADASESTÉNDOBLADAS
ENUNÉNGULOA°
s0UNTADEMIDEDELARGO
SRP2A Pinzas de anillos de resorte.
s%XTREMOSDEDEESPESORCONMUESCADE SRP400A
s,ASMORDAZASTIENENUNÉNGULODE°DE
DIÉMETROPARAANILLOSDERESORTECONLENGàETA
s3EAPLICA!3-%!.3)"
sDELARGO
SRP3A Pinzas de anillos de resorte.
s0UNTASRECTASDEDEANCHOYEXTREMOSDEDEESPESOR
s3EAPLICA!3-%!.3)"
sDELARGO
SRP5B Pinzas de anillos de resorte.
s!CCIØNDEREMACHESPARALAEXPANSIØNDELAPUNTADEGRANPALANCA
s,OSEXTREMOSDEPUNTARECTADEANCHOTIENENMUESCASPARALAS
LENGàETASDELANILLODERESORTE
sDELARGO
SRP4 Pinzas de anillos de resorte.
s%XTREMOSDE
DEANCHOCONMUESCADE
DEDIÉMETROPARAANILLOS
DERESORTECONLENGàETA
SRP4
s,ASMORDAZASESTÉNDOBLADAS
ENÉNGULOSDE°
sDELARGO
S8673C1
Pieza No.
Tipo
S8673C1
Impulsador
S8673B3
Instalador
de junta
ADVERTENCIA
D.E.,
pulgadas
—
2
3/4
Profundidad,
pulgadas
1
15/16
1 15/16
S8673B3
Aplicación
Ford serie C-4, GM series
200, 350, y 375
Ford serie C-4, GM series
200, 350, y 375
CJ129A
=pljY[lgj]k
YA498A
4567SH
CJ129A Extractor universal de cubos de ruedas. 3E
USAPARAREMOVERELCONJUNTOFRONTALDERUEDAEJEDEVEHÓCULOS
DETRACCIØNDELANTERA&ORD'-#HRYSLERYDELAMAYORÓADELOS
AUTOMØVILESIMPORTADOS4AMBIÏNSEUSAPARAREMOVERLOSTAMBORES
DELFRENOPOSTERIORENEJESAHUSADOSCOMOLOSDE!-#Y#HRYSLER
%LYUNQUEREMOVIBLESEAJUSTASOBREUNHEXÉGONODEENUN
TORNILLODEPRESIØN)NCLUYEPATASAJUSTABLES
YA498A Extractor de cubos de ruedas de tracción
delantera.0ARALAMAYORÓADELOSVEHÓCULOSDE%%55YDEOTROS
PAÓSESCONSUSPENSIØNFRONTALINDEPENDIENTE%LTORNILLOAPRESIØN
MIDEX
4567SH Extractor atornillable de árbol de ejes. !FLOJA
LOSEJESENAUTOMØVILES&ORDY'-YENCAMIONESLIVIANOSCON
EJESTIPOBRIDA)NCLUYEBASTIDORTRESMORDAZASREMOVIBLESMARTILLO
DESLIZABLEDELBYTORNILLODESLIZABLEDEXCON
HEXÉGONODE3EAJUSTAACUALQUIERPATRØNCONUNCÓRCULODE
TORNILLODEA
LjYfkeakaf
PRT600A Juego de servicio de transmisión.
s0ARAPRODUCTOSDE#HRYSLER'-Y&ORD
PRT21 Herramienta selladora de amplia gama.
s(OJADEACERODERESORTEDEX
sDELARGO
PRT22 Herramienta selladora de amplia gama.
s"UCLESDEALAMBREALTOENCARBONO
DEENCADAEXTREMO
sDELARGO
SRPC3800 Juego de
pinzas de anillos de
retención convertibles.
s0UNTASRECTASDE
sDELARGO
SRPC7000 Pinzas de
anillos de retención convertibles.
s0UNTASRECTASDE
sDELARGO
PR15 Pinzas de anillos
de resorte externas.
PRT600A
s0UNTASDEDEANCHOEN
ÉNGULODE°
sDELARGO
PR16 Pinzas de anillos de resorte externas.
s0UNTASREMACHADASANCHASDE
sDELARGO
=pljY[lgj]k]aehmdkY\gj]khYjYbmflYk\]Y[]al]'Zmb]k
s$ISE×ADASPARAREMOVEROCAMBIARLOSBUJESDELBASTIDORDELA
EXTENSIØNTRASERADELATRANSMISIØNYLASJUNTASDEACEITEENLAMAYORÓA
DELASTRANSMISIONESAUTOMÉTICASDE&ORD'-#HRYSLERY!-#
s#ONSULTEELGRÉFICOPARACONOCERLASESPECIFICACIONESYAPLICACIONES
S8673C1 Mango para bujes.
s,AEMPU×ADURASEATORNILLAAUNEXTREMOELBUJESECOLOCAEN
ELOTROEXTREMOYSEAJUSTAENELBASTIDORDELEJECONUNOSPOCOS
GOLPESSUAVESDEMARTILLO
S8673B3 Instaladores de junta de aceite.
s3EDESLIZASOBRELACABEZADELIMPULSADOR
s5SARPARAREEMPLAZARJUNTASDEACEITE
s2EVERSIBLE
=pYeaf]]d]pljY[lgjqdYkYhda[Y[agf]k\]hj]kaf
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
473
ÁRBOL DE TRANSMISIÓN
Transmisión
YA321
YA2340
YA7244A
XLE1012A
S5902
YA322
CPT110A
EEPV308A
Herramientas de servicio de transmisión
YA321 Juego de tapas herméticas–Blue-Point®.
s5 tapas de polietileno para realizar el servicio en todas las
TRANSMISIONESNACIONALESYENLAMAYORÓADELASIMPORTADAS
cuando se remueve el eje de transmisión
s,ASTAPASEVITANELINGRESODESUCIEDADDELATRANSMISIØNYEVITALA
PÏRDIDADELÓQUIDOS
YA2340 Juego de tapas herméticas.
s2ETIENEELLÓQUIDODETRANSMISIØNALSELLARLATRANSMISIØNYLOSEJES
transversales cuando se remueve el eje de propulsión o el eje
IMPULSORENLAMAYORÓADELOSVEHÓCULOSNACIONALESEIMPORTADOS
s#ENTRADODEENGRANAJELATERALPARALOSEJESTRANSVERSALESDE&ORD
sTAPASCUBRENUNRANGODEA
s%LDISE×OSEGMENTADOEVITAQUELASTAPASSEDESLICEN
YA7244A Herramienta de conexión/desconexión rápida.
s0ARAVEHÓCULOS&ORDÞLTIMOMODELOCONCONECTORESDETRABAA
PRESIØNENLÓNEASDEENFRIAMIENTODETRANSMISIØNASÓCOMOENLAS
LÓNEASDECOMBUSTIBLE
s%LDIÉMETROESDE
XLE1012A Llave de ojo Torx®.
s,OSTAMA×OSDELALLAVE4ORXSON%Y%
s%LEJEDETRANSMISIØNSETIENEQUEREMOVERCUANDOSEREMOLCAN
CAMIONES#ORVETTEDEYCAMIONES'-#Y#HEVYDE
y 1 toneladas
s$ISE×ADAPARAACCEDERALOSSUJETADORESDELALÓNEADETRANSMISIØN
s4AMBIÏNSEUSAPARALASLÓNEASDETRANSMISIØN!-#
CPT110A Dado de tapón de drenaje.
s3EUTILIZAENTAPONESDEDRENAJEDETRANSMISIØN67
s!LGUNASAPLICACIONESADICIONALESINCLUYENLAREMOCIØNDELAS
RUEDASDELANTERASENMOTOCICLETAS4RIUMPH$AYTONAY!MERICA
s%LDADODEPUNTASDEMMSEUSAPARATAPONESDEDRENAJEDE
TRANSMISIØN67
s#UADRODEDELARGO
S5902 Llave para tapón de aceite/transmisión.
s%XTREMOSDEOJODEPUNTASDEMMYDEPUNTASDEMM
s$ISE×ADAPARATAPONESDEDRENAJEDETRANSMISIØNDE67
sMMDELARGO
YA322 Juego de impulsador de juntas–Blue-Point.
s15 impulsadores diferentes para instalar juntas de transmisión
delanteras y traseras
s)NCLUYEUNMANGOMAESTRO
s#ADAIMPULSADORSEENCUENTRANUMERADOPARAAPLICACIONESDE
TRANSMISIØNESPECÓFICAS
EEPV308A Juego de manómetro para transmisión
automática.
s0ARAUSARENTODOSLOSVEHÓCULOSDELOSPRINCIPALESFABRICANTES
nacionales e importados
s)NCLUYECONJUNTOSDEMANØMETROSPARARANGOSDEALTAYBAJAPRESIØN
ADAPTADORESPARAPROBARUNAGRANVARIEDADDETRANSMISIONES
automáticas nacionales e importadas, manual de instrucción completo
con cuadro de aplicaciones y se entrega en caja de almacenamiento
sACCESORIOSESPECIALESPARACONECTARLOSPUERTOSDEPRUEBASDE
DIFÓCILACCESOENÉREASQUEREQUIERENDEÉNGULOSDEªØª
s%LCONJUNTODEMANØMETRODEALTAPRESIØNINCLUYEUNMANØMETRO
DEDEDIÉMETROYUNAMANGUERAFLEXIBLEDEgCONACOPLE
PARALÓQUIDOS
s%LCONJUNTODEMANØMETRODEBAJAPRESIØNINCLUYEUNMANØMETRO
DEDEDIÉMETROYUNAMANGUERADEgFLEXIBLECONACOPLADOR
PARALÓQUIDOS
474
Dado Torx Plus SLEPL200 de bajo perfil.
sPara extraer e instalar la placa con cuadro de
bajo perfil y los pernos del volante en motores
Nissan QR25con transmisiones automáticas
sSimilar a la herramienta especial de Nissan J-45816
s%LTAMA×OES%0,
s#UADRODE
SLEPL200
s0ARAPERNOSDEVOLANTEENMOTORES
Nissan QR25 con transmisiones manuales,
®
utilice el dado Torx Plus 4MACHO&4840%CONCUADRODE
LDT3812 Herramienta de desconexión de la línea de
refrigeración del aceite de transmisión.
sTAMA×OSYDISE×ADOSPARADESCONECTARLASLÓNEASDE
refrigeración de la transmisión
s3EUSAELTAMA×OPARA&ORD6%XPLORERMODELOY
POSTERIORESMÉS&ORD&Y#ADILLACMODELOYPOSTERIORES
s%LTAMA×OESPARACAMIONESDETRABAJOSUPERPESADO&ORD&
&Y&
FIH9057B Herramienta de desconexión rápida de la
línea de transmisión.
s0ARALÓNEASDETRANSMISIØNYCOMBUSTIBLEDEDE$%YDE
$%ENCIERTOSMODELOS&ORDY#ADILLAC
s&ABRICADACONUNDENILØNDEVIDRIODURADEROPERMITEQUESE
APLIQUEMÉSPRESIØNYOFRECEUNAVIDAÞTILDELAHERRAMIENTAMÉS
prolongada
s%LDISE×OCOMPACTOPERMITEELACCESOAÉREASESTRECHAS!PLICACIONES
EN&ORD
s%XPLORERYPOSTERIORESCONTRANSMISIØNAUTOMÉTICADECINCO
VELOCIDADES
s#AMIONES&SERIEDEPRODUCCIØNDEFINALESDECON
TRANSMISIØNAUTOMÉTICADECUATROVELOCIDADES
s#AMIONES&YPOSTERIORESTODOSLOSMODELOS
s4HUNDERBIRDY,INCOLN,3YPOSTERIORES
s#AMIONES#ADILLACSERIE&&YPOSTERIORES
s328YPOSTERIORES
s#43YPOSTERIORES
s343YPOSTERIORES
LDT3812
FIH9057B
www.snapon.com/shoptools
ÁRBOL DE TRANSMISIÓN
LjYfkeakaf
CJ193
CJ193-1-1
YA9348
=pljY[lgj\]dYZgeZY\]ljYfkeakaf
CJ193 Extractor de la bomba de transmisión.
s,AREMOCIØNDELABOMBADELANTERAENLASTRANSMISIONESDE'-
&ORDY#HRYSLERREQUIEREEXTRACTORES
s)NCLUYEMARTILLODESLIZANTEDELBYUNTORNILLODESLIZANTEDE
X
s3EAPLICAENLAMAYORÓADELOSVEHÓCULOS'-&ORD##!/$
SOBREMARCHAAUTOMÉTICAY#HRYSLER4&/.
CJ193-1-1 Adaptador opcional.
s%LEXTREMOMACHO-DEESTÉDISE×ADOPARAFUNCIONAREN
BOMBASDETRANSMISIØN&ORDY#HRYSLER
s,OSEXTREMOSHEMBRADEDESEATORNILLANCONELTORNILLO
DESLIZANTEDE#*
sDELARGO
YA9648
ATS2200
AfklYdY\gj]kqj]egn]\gj]k\]bmflYk'Zmb]k
YA9348 Instalador/removedor de juntas de
transmisión de GM.
s2EMUEVEEINSTALAJUNTASDEEJEDESELECTORDECAMBIODE
TRANSMISIØNDE'-SINTENERQUEDRENARELLÓQUIDO
s#UADRODEROSCADE5.#"
s%LPERNODELREMOVEDORTIENEUNACABEZADEYUNAROSCADE
5.#!
YA9648 Herramienta de remoción/instalación.
s3EAPLICAENCAMIONES'-MODELOYPOSTERIORESYENVANS
!STROCONTRANSMISIONES,%Y,%
ATS2200 Instalador/removedor de bujes.
s0ARAUSARENEXTENSIONESDEBUJESDEBASTIDORMIENTRASESTÉENELVEHÓCULO
s#ENTRAYSUJETAELEJEDESALIDAENLAPOSICIØNCORRECTAPARALAS
TAREASDEMONTAJE
Dg[YdarY\gjeY_fla[g\]~f_mdg–:dm]%Hgafl® @]jjYea]flYkhYjYbmflYmfan]jkYd
YA328A Localizador de ángulo.
s(ERRAMIENTADEPRECISIØNEXACTAPARADETERMINAR
MEDICIONESDEÉNGULOS
s)DEALPARAVERIFICARELCUADRODELÉNGULODELÉRBOLDE
TRANSMISIØN
s$ETRÉSDELOSNÞMEROSHAYUNINDICADORROJOENGRADOS
PARAUNALECTURAEXACTA
s%SCALASENPULGADASY
MÏTRICASMOLDEADASEN
LABASEDELAHERRAMIENTA
ENYDECIMALESMÏTRICOS
s'RANIMÉNDEX
INTRODUCIDOENLABASEPARA
UNARETENCIØNFIRME
YA328A
=b]\]ljYfkeakaf
UJP1 Juego de prensa para junta universal. %LARMAZØNDEPRENSABRINDA
CAPACIDADDESOPORTEDEPRENSADETORNILLOYGARGANTAGRANDEPARAAPLICACIONESDE
JUNTASUNIVERSALES%LDISE×ODETRABADECOPAMANTIENELASCOPASENSULUGAR4ORNILLO
DEPRESIØNCONROSCAGRUESAGRANDEPARAMAYORRESISTENCIAYFUERZAMÉXIMA!CCESORIO
DEENGRASE:ERKPARAUNFUNCIONAMIENTOSUAVEDELTORNILLO$UREZADELADAPTADORDE
2C)NCLUYEUNATABLADEAPLICACIONES)NCLUYECAJADEALMACENAMIENTO
BJP1F Armazón de prensa.DEGARGANTADELARGO
BJP1-1 Adaptador de manguito.DELARGO
BJP1-2 Tornillo de presión.5.2#HEXDEg
BJP1-4 Almohadilla de presión.*UNTAUNIVERSALDELONGITUD
BJP1-5 Adaptador.
BJP1-7 Adaptador. BJP1-8 Adaptador. BJP1-17 Accesorio para grasa.
ME7A207 Anillo de retención.
ME7A208 Anillo de resorte grande.
ME7A209 Anillo de resorte pequeño.
ME9A34 Bola de acero.
UJP1
PAKPB061 Caja de almacenamiento.
=eZjY_m]
YA7646
GA454A
SP2031
A144A
@]jjYea]flYk\]k]jna[ag\]]eZjY_m]
GA454A Llave de ajuste de embrague "Spicer".
s0ARAAJUSTEINTERNODEEMBRAGUESDERESORTESCURVOS3PICERY
EMBRAGUESDEMÞLTIPLESPALANCAS
s%LIMINALANECESIDADDEUSARPALANCASQUEPUEDANDA×ARLAS
PARTESDEEMBRAGUE
sDELARGO
SP2031 Extractor para cojinete piloto.
s3ESUJETAAEJESDEMARTILLOSDESLIZANTESCONROSCASDEØ
s%LADAPTADORPARATORNILLODEPRESIØNESTÉFABRICADOENACERO
RESISTENTEALATENSIØN
s!CABADOINDUSTRIAL
YA7646 Herramienta de acoplamiento de embrague
Ford.
s!LCANCEYDESCONECTELALÓNEADEEMBRAGUEHIDRÉULICADELCILINDRO
DELEMBRAGUESINDA×ARLALÓNEADEACOPLAMIENTOOEMBRAGUE
s!PLICACIONESVEHÓCULOS&ORDACTUALESCONEMBRAGUEHIDRÉULICO
INCLUSOCAMIONESDESERVICIOLIVIANO"RONCO))2ANGER%XPLORER
Y4HUNDERBIRDY-ERCURY#OUGARMODELOYPOSTERIORESCON
TRANSMISIØNMANUALYEMBRAGUEHIDRÉULICO
s)GUALQUE&ORD.O44!
ADVERTENCIA
ATS2987
A37M
A145
A144A Herramienta para girar volantes.
s5SARCUANDOREEMPLACELAPLACADEPRESIØNDELEMBRAGUE
s'IRAELVOLANTEAUNPUNTOPREDETERMINADOQUESEPUEDEEVITARCUANDO
SEGOLPEACONELARRANQUE
sDELARGO
ATS2987 Embrague de transmisión automática
Compresor de resorte–Blue-Point.
s3EUTILIZAPARACOMPRIMIRLOSRESORTESDELEMBRAGUEENLAMAYORÓADE
LASUNIDADESDEEMBRAGUEDETRANSMISIØNAUTOMÉTICA
s3EENTREGAENCAJADEALMACENAMIENTO!43
A37M Juego de alineación del embrague.
s0ARAVEHÓCULOSCONTRANSMISIONESESTÉNDARINCLUSOMUCHOSAUTOS
IMPORTADOS
s0ERMITEUNARÉPIDAALINEACIØNCONUNACOMPLETAGAMADEEMBRAGUES
DEUNDISCOTAMA×OSDEPORTABROCASQUEVARÓANDEA
s3EENTREGAENCAJADEALMACENAMIENTO0"
PB21 Caja de almacenamiento.
A145 Juego de alineación del embrague.
s%LCOMPA×EROMÉSPEQUE×ODE!s)NCLUYEPORTABROCASDEEXTREMODOBLEENLAGAMADEA
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
475
ÁRBOL DE TRANSMISIÓN
Herramientas para tracción en las cuatro ruedas
CVBOOTRP
YA3050
YA3085
YA3080
KD3191
FBG1
CVBOOTKIT
Herramientas para capuchón y junta–Blue-Point®
Herramientas para capuchón y junta
YA3050 Pinzas para grampa de capuchón.
sPara grampas sin mariposa, incluso aquellas en las juntas
universales de VC internas del último modelo de GM
YA3080 Pinzas para grampa de capuchón.
sPara grampas tipo mariposa
s,OSUFICIENTEMENTERESISTENTESCOMOPARAGRAMPASTIPOMARIPOSA
incluso las juntas universales de VC externas de último modelo de
GM
s5SARCONLLAVESDETORQUEPARACUMPLIRCONLASESPECIFICACIONES
requeridas
YA3085 Herramienta para bandas de capuchón.
®
®
sReinstala las bandas de capuchón Band-it o Band-it Jr.
KD3191 Grampa para junta–Blue-Point.
sSe utiliza para enroscar el extremo libre de la banda de grampa
s3OSTIENELATENSIØNHASTAQUELABANDASEPUEDAASEGURAR
s0ARAUSARCONGRAMPASDEEXTREMOLIBRETIPO"ANDITBANDADE
ROLLOYGANCHOSOGRAMPASPREFORMADASTIPO"ANDIT*R
s3EUSAUNDADOCONTRINQUETEPARAGIRARELTORNILLOACTUANTEPARA
ajustar
FBG1 Instalador de capuchones VC Flex–Blue-Point.
sReduce la instalación de capuchones VC a menos de 20 minutos
s,AHERRAMIENTADILATAELCAPUCHØNPERMITIENDOQUESEDESLICE
sobre el muñón para una rápida instalación y un menor cansancio
s)NCLUYEUNINSTALADORDECAPUCHONES&LEXUNREGULADORNEUMÉTICO
&"'!2YUNACAJADEALMACENAMIENTO
s0ARAUTILIZARCONLOSCAPUCHONES6#DETALLADOSENESTAPÉGINA
HST100-1
FBGAR Regulador neumático.
s2EGULADORNEUMÉTICOPARAELINSTALADORDECAPUCHONES6#&LEX&"'
CVBOOTKIT Juego de reemplazo completo de
capuchones VC.
sCADA#6"//43sCADA#6"//4,'
sCADA#6"//420
CVBOOTXS Capuchón de reemplazo para ATV.
s3EADAPTAALAMAYORÓADELASAPLICACIONESDECAPUCHONESPARA!46
s)NCLUYECAPUCHØNABRAZADERASYGRASA
CVBOOTXSPK Juego de capuchones de reemplazo
para ATV.
s0AQUETEDE#6"//483
CVBOOTLG Capuchón VC grande.
s3EADAPTAALAMAYORÓADELOSAUTOMØVILESY356CONCAPUCHONES
VC grandes
s)NCLUYECAPUCHØNABRAZADERASYGRASA
CVBOOTLGPK Juego de capuchones VC grandes.
s0AQUETEDE#6"//4,'
CVBOOTSM VC pequeño.
s3EADAPTAALAMAYORÓADELOSAUTOMØVILESY356CONCAPUCHONES
VC pequeños
s)NCLUYECAPUCHØNABRAZADERASYGRASA
CVBOOTKSMPK Juego de capuchones VC pequeños.
s0AQUETEDE#6"//43CVBOOTRP Juego de cremallera y piñón universales.
s3EADAPTAALOSCAPUCHONESDECREMALLERAYPI×ØNENLAMAYORÓADE
los autos
s)NCLUYECAPUCHØNABRAZADERASYGRASA
CVBOOTRPPK Juego de capuchones de cremallera y
piñón universales.
s0AQUETEDE#6"//420
s)NCLUYECAPUCHØNABRAZADERASYGRASA
FABLM8E
YA5500
Herramientas para remoción de semiejes.
Herramientas de servicio de tracción delantera
HST100-1 Herramienta para remoción de semiejes.
s0.900" de diámetro
s2EMUEVEFÉCILMENTEELSEMIEJEDELAMAYORÓADELOSVEHÓCULOSCON
tracción delantera nacionales e importados con un suave golpe de
mazo de bronce
HST100-2 Herramienta para remoción de semiejes.
s0.940" de diámetro
s2EMUEVEFÉCILMENTEELSEMIEJEDELAMAYORÓADELOSVEHÓCULOSCON
tracción delantera nacionales e importados con un suave golpe de
mazo de bronce
FABLM8E Mango métrico hexagonal de bola largo.
sHexagonal de 8 mm, cuadro de 3/8"
s0ARATORNILLOSDEBRIDASDEEJEDETRACCIØNDETRANSMISIØNESTÉNDAR
para vehículos Omni y Horizon de 1978 y posteriores
YA5500 Llave para volante.
sPara vehículos nacionales e importados
sÚtil en lugares con acceso muy limitado para utilizar llaves tipo inglesas
s$ESLICESOBREELBORDEDELVOLANTEYGÓRELO
sDELARGO
s%MPU×ADURADEVINILO
476
www.snapon.com/shoptools
ÁRBOL DE TRANSMISIÓN/ELEVACIÓN
@]jjYea]flYkhYjYljY[[af]fdYk[mYljgjm]\Yk
=pljY[lgj\]`mkgk
YA2220 Extractor de husos.
sRoscado en 3 pasos (1 1/2", 1 5/8" y 2") para la mayoría de los husos
delanteros en los vehículos con tracción en las 4 ruedas
s3EUTILIZACONMARTILLOSDESLIZANTESDEY
YA2220
<a^]j]f[aYd
@]jjYea]flYk\]k]jna[aghYjY]d\a^]j]f[aYd
A176 Llave para ajuste del diferencial.
sPara la mayoría de los diferenciales donde se encuentran
las tuercas de ajuste 9/32" y 17/32"
sÂTILPARATRANSMISIONESENGRANAJESDEDIRECCIØNYALGUNAS
BOMBASDEAGUAENDONDESEREQUIEREUNALLAVEINGLESA
ajustable
sDELARGO
M3548A Dado de impacto para tuerca de piñón
diesel.
sUsar sólo en tuercas de piñón
M3586 Dado de impacto para tuerca de piñón.
s3EUTILIZAPARAREMOVERELDADOPARATUERCAENLOSEJES
DELASERIE$ANAENLOSCAMIONES&ORDY$ODGEÞLTIMO
modelo
s%SLOSUFICIENTEMENTEFUERTEPARAMANIPULARELTORQUE
REQUERIDO
s3ISTEMADELLAVE&LANK$RIVE
s!CABADOINDUSTRIALPARAMAYORPROTECCIØNCONTRACORROSIØN
M3587 Dado de impacto para tuerca de piñón.
s3EUTILIZAPARAREMOVERLATUERCADEPI×ØNEN#ADILLAC#43
DECAMIONES'-DEY$ODGEDECONEJES
!!-DE
s!PLICACIONESADICIONALESREMOCIØNDELÉRBOLDEEJESDEL
ÞLTIMOMODELODE"-7MÉS"-7%%-Y356CON
tuercas de eje de 12 puntas de 36 mm
s%SLOSUFICIENTEMENTEFUERTEPARAMANIPULARELTORQUE
REQUERIDO
s3ISTEMADELLAVES&LANK$RIVE
s4AMA×ODELALLAVEMM4AMA×OCUADRO$%
DELEXTREMODELALLAVE$%DELEXTREMODELCUADRO
(UELGODELPERNO0ROFUNDIDADHEX
,ARGOTOTAL
s!CABADOINDUSTRIALPARAMAYORPROTECCIØNCONTRACORROSIØN
IMDM360 Dado de impacto.
!PLICACIONES
s0ERNOSDELCIGàE×ALDELANTERODELMOTORDIESEL$URAMAXs
­RBOLDEEJESDELÞLTIMOMODELODE"-7
s3EUTILIZAPARAREMOVERTUERCASDEPI×ØNENCAMIONES'-
DEY$ODGEDECONEJES!!-DE
A176
M3548A
M3586
®
IMDM360
M3587
D.E. del
Profundidad
Llave Tamaño, Transmisión
D.E. del extremo
extremo
hex.,
Largo total,
Tamaño,
pulgadas, pulgadas
de la llave,
del cuadro, Huelgo del perno, pulgadas, pulgadas
(mm)
pulgadas (mm) pulgadas (mm) pulgadas (mm)
(mm)
(mm)
3/4
M3548A
2 3/4
1 9/16
2 3/ 8
2 3/ 4
1 9/16
3 3/4
7
3
3
3
1
M3586
1 /8
/4
2 /8
1 /4
2
1 /8
2 3/4
3/4
M3587
(36)
2
1 3/4
1 9/16
1
2 1/4
1/2
IMDM360
(36)
(50.8)
(46)
(41.3)
(22.2)
(57.2)
Pieza No.
?Ylgk
YA1715 Gato para motocicletas–Blue-Point®.
sLBSDECAPACIDAD
s!LTURABAJADEALTURAMÉXIMADE
s,AALMOHADILLARECUBIERTACONGOMADOBLEOFRECEPROTECCIØN
adicional a la motocicleta
s,AEMPU×ADURAPARATIRARAYUDAALUSUARIOAMANIOBRARELGATO
en posición
s/PERACIØNDEPIEPARAFACILITARELUSO
s#INTASDESEGURIDADPARAASEGURARLAMOTOCICLETA
YA1715
ADVERTENCIA
Fgd]nYfl]n]`[mdgkim]]p[]\YfdY[YhY[a\Y\\]d_Ylgg\]kmkghgjl]FgljYZYb]\]ZYbg\]n]`[mdgkkgkl]fa\gkfa[Ye]fl]hgj_Ylgk3mlada[]kghgjl]k
Mk]_Ylgkqkghgjl]kkdg]fkmh]j^a[a]k\mjYkfan]dY\YkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
477
ELEVACIÓN
Gatos
El brazo de elevación está fabricado con
hierro dúctil y es más resistente que los
diseños estampados
Empuñadura de 1 pieza con
mecanismo de liberación
universal
YA1707
La bomba de acción rápida
lleva la silleta a la altura de
servicio rápidamente
YA1642A
Las placas laterales de 5/16" tienen bridas
para lograr mayor resistencia
YA700B
YA642C
YA1716
Gatos de servicio de chasis corto
Pieza No.
Capacidad,
ton.
YA700B
YA1642A*
YA642C*
YA1707*
YA1716*
2 1/2
2
2
3 1/2
2
Altura
máxima
de
elevación,
pulgadas
23
19 1/2
20
22
20
Altura
mínima,
pulgadas
Tamaño
de silleta,
pulgadas
Largo del
armazón,
pulgadas
Largo de la
empuñadura,
pulgadas
Garantía
Peso,
libras
4 3/4
5 1/2
3 3/4
3 3/4
3
5 3/4
5 1/8
5 1/2
4 1/4
—
30 1/2
25 3/8
29 3/4
29 7/8
30 1/4
45 3/4
42 1/8
49 7/8
50
40
2 años
1 año
1 año
1 año
1 año
96
73
95
103
97
*Blue-Point®
Gatos de servicio de aluminio
YA1713
RACEJACKSET
sEl diseño de doble bomba lleva
rápidamente la silleta a la altura de servicio
sLa empuñadura con corte de diamante,
antideslizante con almohadilla de paragolpes de
espuma protege los vehículos
Gatos de servicio de aluminio–Blue-Point®
Pieza No.
Capacidad, ton.
YA1713
3
RACEJACKSET*
1 1/2
* incluye ALUMSTAND en la pág. 480
478
Altura máxima
de elevación,
pulgadas
18 1/4
17 3/8
Altura mínima,
pulgadas
4
3 1/2
Tamaño de la
silleta,
pulgadas
5
5
Largo del
armazón,
pulgadas
30
25 1/8
www.snapon.com/shoptools
Largo de la
empuñadura,
pulgadas
49 1/2
47 1/2
Garantía
Peso, libras
1 año
1 año
72
46
ELEVACIÓN
?Ylgk
YA657C
YA660C
YA662C
YA667C
?Ylgk\]k]jna[ag\][`YkakdYj_g–:dm]%Hgafl®
Pieza No.
YA657C
YA667C
YA660C
YA662C
Tipo
Capacidad,
ton.
Hidráulicos
Neumáticos/hidráulicos
Hidráulicos
Neumáticos/hidráulicos
4
4
10
10
Altura máxima
de elevación,
pulgadas
24
24
27
27
Altura
mínima,
pulgadas
5
5
7
7
Tamaño
de silleta,
pulgadas
5 1 /2
5 1 /2
7 3 /8
7 3 /8
Largo del
armazón,
pulgadas
53 1/8
53 1/8
55 1/2
55 1/2
Largo
empuñadura,
pulgadas
42 1/8
42 1/8
42 1/8
42 1/8
YA1731A
Capacidad,
ton.
Altura mín.,
pulgadas
Altura máxima
de elevación,
pulgadas
YA1731A
YA731B
22
20
9 7/8
9 1/2
20 1/4
17 1/2
Garantía
Peso, libras
1 año
1 año
1 año
1 año
164
168
436
441
YA731B
?Ylgkf]me~la[gkhYjY[Yeagf]k–:dm]%Hgafl
Pieza No.
Presión
mínima de
operación, psi
—
140
—
140
Aumento
de
potencia,
pulgadas
6 3/8
5 1/2
Extensión
del tornillo,
pulgadas
Largo
empuñadura,
pulgadas
Tamaño base,
pulgadas
psi mínima (para
capacidad de
carga nominal)
Peso,
lbs.
4
2 1/2
48 3/4
50
22 7/8 x 12 1/2
8 x 5 1/2
150 psi
140
77.5
69
=d]nY[af\]]plj]egk
?Ylgkf]me~la[gk\]]d]nY[af\]]plj]egk
Especificaciones
Capacidad, ton.
Altura mín., pulgadas
Altura máxima de elevación, pulgadas
Aumento de potencia, pulgadas
Extensión de silleta, pulgadas
PSI mín. (para capacidad de carga nominal)
Espacio (columna de elevación hacia frente de
silleta ), pulgadas
Peso Neto, lb. (kg)
ADVERTENCIA
YA696D
2 1/2
8
35 3/8
24 3/4
23 1/4 a 41 1/4
200
YA692D
10
12 1/2
50 1/2
28
25 a 53
200
20
13
210
586
YA692D
YA696D
Fgd]nYfl]n]`[mdgkim]]p[]\YfdY[YhY[a\Y\\]d_Ylgg\]kmkghgjl]FgljYZYb]\]ZYbg\]n]`[mdgkkgkl]fa\gkfa[Ye]fl]hgj_Ylgk3mlada[]kghgjl]k
Mk]_Ylgkkdg]fkmh]jÇ[a]k\mjYk$^m]jl]kqfan]dY\YkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
479
ELEVACIÓN
Soportes
YA875B
YA874B
YA512
ALUMSTAND
Soportes para gatos (en pares)
Pieza No.
YA874B
YA875B
YA512*
ALUMSTAND*
*Blue-Point®
Capacidad, ton.
Altura mín., pulgadas
Altura máxima, pulgadas
3 (por par)
6 (por par)
12 (por par)
3 (por par)
11 1/2
15 3/8
17 1/2
10 3/8
17
24 1/4
27 1/2
15 3/8
Soportes de uso múltiple–Blue-Point
%LDISE×ODELGADOMAXIMIZALOSESPACIOSDETRABAJOYELALMACENAMIENTO%LTORNILLO!CMEPERMITEUNAJUSTEDEALTURAPRECISO
Pieza No.
YA779B
YA779B
Capacidad,
ton.
3/4
Altura mín.,
pulgadas
53 1/4
Altura máxima,
pulgadas
80
Tamaño base,
pulgadas
12 (diámetro)
Tamaño tapa, pulgadas
5 5/16 x 2 7/16
Gato rodante
Gato rodante hidráulico–Blue-Point
s"RINDAUNAPOTENCIAPOSITIVAYEFICIENTEPARALAEXTRACCIØNEINSTALACIØN
DERUEDASYNEUMÉTICOSSIMPLESENTÉNDEMYDOBLES
s,OSBRAZOSDEELEVACIØNPUEDENAJUSTARSEPARAADAPTARSEADIFERENTES
COMBINACIONESDERUEDAS
Pieza
No.
YA765D
Gama de
Capacidad, elevación,
ton.
pulgadas
3/4
3a9
Brazo de
elevación
(largo),
pulgadas
27 1/2
YA765D
480
www.snapon.com/shoptools
Brazo de
elevación
(alcance),
pulgadas
26
Largo,
Ancho,
Altura,
pulgadas pulgadas pulgadas
42 7/8
38 1/2
34 5/8
ELEVACIÓN
?Ylgk\]ljYfkeakaf'Kghgjl]khYjYlYfim]k\][geZmklaZd]
?Ylgk\]ljYfkeakaf–:dm]%Hgafl®
YA715A Gato de transmisión hidráulica neumático/
manual de 1/2 ton.
s5TILIZAAIREPARALAVELOCIDADDELAOPERACIØNYLABOMBAMANUALPARA
LOGRARUNCONTROLPRECISO
s,ABASEEXTRAANCHABAJAELCENTRODEGRAVEDADYBRINDAMAYOR
ESTABILIDAD
s2UEDASDEACERORESISTENTEYCOJINETESDEBOLADEGIROCOMPLETO
s3ILLETAESTILOTRINQUETEAJUSTABLE
s5NEXCLUSIVOYPRÉCTICOPEDALDELIBERACIØNPERMITEBAJARLACARGADE
FORMACONTROLADA
YA714D Gato de transmisión de elevación alta de 1/2 ton.
s-ANIVELAPARAUNAALINEACIØNFÉCILYPRECISA
s,OSBRAZOSDESOPORTEDECARGAAJUSTABLESSEADAPTANATODASLAS
BRIDASDELCONTENEDORDELATRANSMISIØN
s,ABOMBACONPEDALPERMITEACCIONARLOSINUSARLASMANOS
s"ASEANCHASOBRERUEDASGIRATORIASPARAUNAMAYORESTABILIDAD
YA876C Gato de transmisión hidráulica de 1/2 ton.
s,ACABEZAAJUSTABLEPUEDEINCLINARSEPARAUNØPTIMOALINEAMIENTODE
LOSPATRONESDEPERNOSDETRANSMISIØN
s3EINCLUYECADENACONFRENOSDECARGA
s%LDISE×ODERUEDASGIRATORIASPERMITEELFÉCILMOVIMIENTOY
POSICIONAMIENTO
s2UEDASDEACERORESISTENTEYCOJINETESDEBOLADEGIROCOMPLETO
s$ADODEBOMBEOFÉCILDEUSARCONGIRODEºPARAELMEJORMANEJO
DIRECCIONAL
YA727B Gato de transmisión hidráulica de horquilla de 1 ton.
s3EUSAENØMNIBUSCAMIONESMAQUINARIAAGRÓCOLAAUTOMOTORESY
VEHÓCULOSPARALACONSTRUCCIØN
s3EINCLUYECADENACONFRENOSDECARGA
sPLACASDEMONTAJESAJUSTABLESFUNDIDASYPESADAS
sCU×ASPARASOPORTARLACARGA
YA780 Sostén del gato de transmisión.
s3EADAPTAALAMAYORÓADELASTRANSMISIONESDE!6!.#%Y2%42/#%3/
s3EUTILIZAPARAESTABILIZARLATRANSMISIØNAUTOMÉTICACUANDOSE
EXTRAEOINSTALACONUNGATODETRANSMISIØN
s3EMONTACONPERNOSYTIENEOPCIONESDEORIFICIOSPARAMONTARLO
Kghgjl]hYjYlYfim]\][geZmklaZd]YA712A Soporte
para tanque de combustible.
s&ACILITAELSERVICIOENTANQUESYBOMBASDECOMBUSTIBLEYOTROS
COMPONENTES
s0UEDEUSARSECONTANQUESDECOMBUSTIBLEDEHASTAGALONESVACÓOS
s)NCLUYECORREASDESUJECIØNYCABLEDECONEXIØNATIERRA
s-IDEDEALTOXDELARGOXDEANCHO
YA715A
YA714D
YA727B
YA780
YA712A
YA876C
=kh][a^a[Y[agf]k\]d_Ylg\]ljYfkeakaf
Pieza No.
Cap., Altura
máx.,
ton. pulgadas
Base de
silleta,
pulgadas
Tamaño de
cabeza de
elevación,
pulgadas
Largo Largo del Ancho del
empuñadura, chasis, chasis,
pulgadas pulgadas pulgadas
Inclinación
Altura Área de silleta exp., Tamaño
min.,
del gato,
pulgadas
pulgadas
pulgadas
YA714D
1/2
69 7/8
8 7/8 x 7 1/8
15 1/2 x 15 1/2
11
—
33 1/2
12°
33
21 x 21
YA876C
1/2
24 3/4
12 5/8 x 7 7/8
9x9
22 1/2
33
20
60º (adelante) 18º
(atrás) 12º (izq. y der.)
8 1/2
17 x 9 3/8
YA715A
YA727B
1/2
1
ADVERTENCIA
77 5/8
44
8 7/8 x 7 1/8
9x9
18 5/8 x 12 1/4 15 1/2 x 15 1/2
11
19 1/2
—
48
20
12°
37 7/8
29 7/8
40º (adelante) 15º
(atrás) 10º (izq. y der.)
10
Peso Neto,
lb (kg)
34 1/8 (de largo) x
181 (82.1)
36 1/8 (de ancho)
31 1/8 x 15
106 (48.1)
34 1/8 (de largo) x
21 x 21
196 (88.9)
36 1/8 (de ancho)
20 1/2 (de largo) x 18 47 1/2 (de largo) x
309 (140.2)
1/2 (de ancho)
28 1/4 (de ancho)
Fgd]nYfl]n]`[mdgkim]]p[]\YfdY[YhY[a\Y\\]d_Ylgg\]kmkghgjl]FgljYZYb]\]ZYbg\]n]`[mdgkkgkl]fa\gkfa[Ye]fl]hgj_Ylgk3mlada[]kghgjl]k
481
Mk]_Ylgkqkghgjl]kkdg]fkmh]jÇ[a]k\mjYkfan]dY\YkD]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
ELEVACIÓN
Grúa y eslingas para motor/Gatos de botella–Blue-Point®
YA778 Grúa para motor.
s%LBRAZODEELEVACIØNSEEXTIENDEDEAAUNAALTURADE
s"OMBAREMOTAEXTERNACONAJUSTEFINO
s(UELLADEXCUANDOSEPLIEGAPARAUNFÉCIL
ALMACENAMIENTO
s%LGANCHOGIRATORIOA°BRINDAMOVILIDAD
s#APACIDADDEELEVACIØNMÉXIMADETONELADAS
A238
A238 Eslinga para motores.
s#ABLEFLEXIBLEDECADAEXTREMOTIENEUNAPLACAPERFORADAPARA
PERNOSDEDEDIÉMETRO
YA554A Placa de elevación del motor.
s3EATORNILLAACALIBRESDEENTRADAENMOTORES66DECARBURADORCON
ØCILINDROSYMOTORES66CONCUERPODEMARIPOSADE%%55
s#APACIDADDEELEVACIØNDETONELADAS
YA778
YA2670A
YA554A
GA197A
Grúa y eslinga para motor
YA2670A Grúa para motor.
sUnidad liviana y portátil - Capacidad de 500 libras
sBarra ajustable que se inserta entre los guardabarros de 46" a 61 1/2"
s)DEALPARALASREMOCIONESDETRANSMISIONESDE!6!.#%
s%LCABEZALSEAJUSTAºENAMBASDIRECCIONES
YA2674A Barra compensada para chasis“W”.
s3EUTILIZAENVEHÓCULOS'-CONCHASIS“W”
s5NDISPOSITIVOESPECIALSUJETALAPARTEINFERIORDELABARRADETRÉSDEL
MIEMBROTRANSVERSALFRENTEALRADIADOR
YA2675A Juego de adaptadores giratorios.
s0ERMITEELMONTAJEENTRELAPLACADETUBOSTELESCØPICAPRINCIPALYLA
placa de pie triangular
s0ERMITEQUELASPLACASDEPIEGIRENYSEALINEENENLOSRIELES
COLECTORESDEGOTEODELASABERTURASAHUSADAS
YA1228
GA197A Herramienta de elevación/extracción.
s%LEVACIØNMÉXIMADEg
sgDEDISTANCIAMÓNIMAENTREGANCHOS
s%LGANCHOANCLADOGIRACOMPLETOS
s%LSISTEMAAUTOMÉTICODEDESCENSOPERMITEBAJARLACARGALENTAMENTE
DEAUNDIENTEPORVEZ
s#APACIDADDETON
YA2676A Placas de pie.
s0ARAUSARCONVEHÓCULOS(ONDA!CCORD/DYSSEYYPOSTERIORES
s&UNCIONANMEJORCONELJUEGODEADAPTADORESGIRATORIOS9!
YA2673A Barra compensada.
s5NDISPOSITIVOESPECIALSUJETALAPARTEINFERIORDELABARRADETRÉSDEL
MIEMBROTRANSVERSALFRENTEALRADIADOR
YA1229A
YA1233A
YAS1233A
Gatos de botella hidráulicos
Pieza No.
YA1228
YA1229A
YAS1229A*
YA1233A
YAS1233A*
-ODELODEPERFILBAJO
482
Capacidad,
ton.
Altura mín.,
pulgadas
8
12
12
20
20
8 1/8
9 1/2
6 1/8
9 1/2
6 1/2
Altura
máxima,
pulgadas
17 5/8
18 5/8
10 5/8
18 5/8
11 1/4
Extensión
del tornillo,
pulgadas
2 3/4
3 1/8
1 5/8
3 1/8
1 5/8
Tamaño base,
pulgadas
Largo empuñadura,
pulgadas
Diámetro de tapa,
pulgadas
Fuerza operativa, lb.
4 3/4 x 4 3/4
5 1/4 x 5 1/8
5 1/4 x 5 1/8
6 1/4 x 5 7/8
6 1/4 x 5 7/8
18 1/8 (armado)
18 1/8 (armado)
18 1/8 (armado)
18 1/8 (armado)
18 1/8 (armado)
1 3/8
1 3/4
1 3/4
2
2
101
102
89
109
101
www.snapon.com/shoptools
SOLDADURA
Equipo de soldadura que trabaja tanto
como usted.
La cantidad de soldadoras MIG o TIG de Snap-on, los
cortadores de plasma, los juegos de antorchas de oxígenoacetileno, los equipos de seguridad protectores y las
herramientas para soldar hacen su trabajo, de manera que
usted pueda continuar con el suyo.
N]jkYlada\Y\2DgkYdae]flY\gj]k\]YdYeZj]\]kegflYZd]k]kl~f
diseñados para permitir un mejor acceso a zonas remotas.
J]f\aea]flg2Dgkh]jag\gk\]kgd\Y\mjYe~khjgdgf_Y\gk$
dgk[a[dgk\]k]jna[age~kYdlgkqdgkjYf_gk\]Yehk&e~k
amplios contribuyen a un rendimiento líder en la industria.
;YhY[a\Y\2DYkhaklgdYkYdae]flY\gjYk\]Ydmeafagqdgk
Y[[]kgjagkLA?\]<&;&eYf]bYfedlahd]keYl]jaYd]kq_jgkgj]k&
<mjYZada\Y\2Dgk[gfbmflgk\]Ydae]flY\gj]k\]YdYeZj]$
la construcción de transformadores de cobre sobre cobre
y los ventiladores de enfriamiento integral proporcionan
una mayor durabilidad.
>~[ad\]mkYj2Dgk[gfljgd]kkaehdaÇ[Y\gk\]hgka[af\]
[YdgjeafaearYf]dla]ehg\][gfÇ_mjY[afqYme]flYf
la productividad.
K]_mja\Y\2HjglbYk][gf]imahgk\]k]_mja\Y\im]
proporcionan una sensación natural mientras trabaja.
<]k\]e~k[YjYkZ~ka[Yk$nakgj]k[gfgk[mj][aea]flg
Ymlge~la[g`YklY^mf\Ykhjgl][lgjYkq_mYfl]k&
9kakl]f[aY29[[]\YYdYYkakl]f[aY
l[fa[Y\]KfYh%gfddYeYf\gYd2
)%0((%9:;%O=D<
483
SOLDADURA
Soldadoras de alimentación de alambre MIG/Muscle MIG Snap-on®
Las soldadoras MIG Snap-on tienen ciclos más elevados de trabajo a máximo amperaje lo que proporciona más veces de
soldadura y rendimiento que excede la competencia. Ideal para muchas aplicaciones, incluso reparación de automóviles,
talleres, camiones de servicio pesado, granjas y talleres de fabricación de metales. Las capacidades adicionales incluyen
un conjunto de alimentador separable, punto-costura (algunos modelos), junto con el accesorio TIG opcional y los
paquetes de pistola alimentadora.
El conjunto de alimentación
de alambre, construido
con aluminio troquelado y
maquinado de precisión,
ofrece engranajes
completamente metálicos
y una entrega de 800
pulgadas/mín. para obtener
velocidades de alambre
consistentes
El transformador
ahusado y todo bobinado
en cobre ofrece
aislamiento Nomex y
laminaciones atornilladas
para proporcionar
control preciso de voltaje
y soldaduras que pueden
repetirse
El banco de capacitor y el
juego de diodos brindan
voltaje consistente y
características de arco
suave líderes en la
industria
MM250SL
Especificaciones
Amperaje de salida máximo (amperes)
Índice del ciclo de trabajo
MIG220
MM250SL
MM140SL
MIG220
MM350XL
MM140SL
MM350XL
270
220
140
350
185A-100%
185A-60%
140A-100%
300A-100%
Capacidad de soldadora (pulgadas)
3/8
5/16
1/4
7/16
Configuraciones de voltaje - MIG/TIG
8/4
12/4
8/4
8/4
Punto-costura
Sí
No
Sí
No
Alimentador separable
Sí
No
Sí
Sí
0.023-0.045
0.023-0.045
0.023-0.045
0.023-0.0625
Tamaño de alambre (pulgadas)
Largo de la antorcha (pies)
10
10
10
12
Largo del cable del alimentador (pies)
15
n/d
15
15
Largo del cable de conexión a tierra (pies)
15
10
15
15
Largo del cable de alimentación de entrada (pies)
20
20
20
20
Pistola alimentadora lista para usar
Sí
Sí
Sí
Sí
208/230 VCA, 50/60 Hz
208/230 VCA, 50/60 Hz
115 VCA, 50/60 Hz
208/230 VCA, 50/60 Hz
26/24
31/28
30
46/42
Sí
Sí
Sí
Sí
2 años
2 años
2 años
2 años
Voltaje de entrada
Amperaje de entrada (recomendado)
Regulador/medidor de flujo de gas
Garantía*
*No incluye cable ni antorcha
SOPORTE TÉCNICO
1-800-ABC-WELD
484
www.snapon.com/shoptools
SOLDADURA
Kgd\Y\gjYkEA?hgjl~lad]k
DYkkgd\Y\gjYkEA?KfYh%gf®hm]\]fmladarYjk][geghgdYja\Y\\aj][lY[gf_Yk[gfhjgl][lgjghgdYja\Y\afn]jkYkaf_Yk[gf
hjgl][[afhYjYYdYeZj]\]f[d]g^mf\]fl]&EA?)*-qEA?)+-kgf[gehY[lYkqhgjl~lad]khYjYmkYj]f]ddm_Yj\]ljYZYbg&
Especificaciones
MIG125
MIG135
FM140A
YA212AIND
125
135
140
230
80A-20%
90A-20%
140A-100%
230A-60%
Capacidad de soldadora (pulgadas)
3/16
1/4
1/4
5/16
Configuraciones de voltaje - MIG/TIG
4/-
7/-
12/4
12/4
Amperaje de salida máximo (amperes)
Índice del ciclo de trabajo
No
No
Sí
No
0.023-0.035
0.023-0.035
0.023-0.035
0.023-0.045
Largo de la antorcha (pies)
7
9
10
10
Largo del cable de conexión a tierra (pies)
8
8
15
15
Largo del cable de alimentación de entrada (pies)
6
6
20
20
Pistola alimentadora lista para usar
No
No
Sí
Sí
115 VCA, 50/60 Hz
115 VCA, 50/60 Hz
115 VCA, 50/60 Hz
208/230 VCA, 50/60 Hz
26/24
Purgador de gas de punto o costura
Tamaño de alambre (pulgadas)
Voltaje de entrada
Amperaje de entrada (recomendado)
20
20
20/30
Regulador/medidor de flujo de gas
Regulador
Regulador
Sí
Sí
2 años
2 años
2 años
2 años
Garantía*
.OINCLUYECABLENIANTORCHA
SOPORTE TÉCNICO
1-800-ABC-WELD
Kgd\Y\gjYkLA?
LA?*-(Kgd\Y\gjYk
Aplicaciones:
Soldadura de alta calidad sobre acero, aluminio, cromo molibdeno,
acero inoxidable y cobre.
s3OLDADURA##4)'CONENCENDIDODEARCOSINALTAFRECUENCIA
s3OLDADURA#!Y##4)'CONENCENDIDODEARCOCONALTAFRECUENCIA
s#ONTROLDEBALANCEAJUSTABLE
s3OLDADURA4)'CONTINUA0ULSOYDEETAPAS
s4IEMPODEENCENDIDO#!Y##ENCALIENTEYAJUSTEDECORRIENTE
s%NCENDIDOCONINTERRUPTOROCONTROLCONPEDALOPCIONAL
)NCLUYE
s2EGULADORDEGASESTILOMEDIDORDEFLUJO
s#ONJUNTODEANTORCHA4)'DEg
s#ONJUNTODECABLEDECONEXIØNATIERRAPARATRABAJODEg
s*UEGODERUEDASSOSTÏNDELCILINDRO
s*UEGODEPARTESDEANTORCHA4)'YELECTRODOS
s)NTERRUPTORREMOTODEENCENDIDODEARCO
TIG250FP Control remoto de amperaje. #ONTROLREMOTODE
AMPERAJEOPCIONALQUESEOPERAMEDIANTEUNPEDALPARASOLDADORAS
4)''!3Y4)'(/
ADVERTENCIA
TIG250H20
Especificaciones
Soplete
Voltaje de entrada
Corriente de entrada
Corriente de salida
Ciclo de trabajo
Suministro de gas
Largo del cable de la antorcha (pies)
Largo del cable de conexión a tierra (pies)
Largo del cable de alimentación (pies)
Peso de envío
TIG250FP
TIG250GAS
TIG250H20
Refrigerado por gas
208/230 VCA
82/74 amp.
250 amp.
60% a 200 amp.
Argón
25
25
12
325 lb.
Refrigerado por agua
208/230 VCA
82/74 amp.
250 amp.
60% a 200 amp.
Argón
25
25
12
363 lb.
SOPORTE TÉCNICO
1-800-ABC-WELD
Mk]hjgl][lgj^Y[aYdqjghY\]hjgl][[afea]fljYkkm]d\]q[gjl]
Fgh]jealYim]`YqYh]jkgfYkYkmYdj]\]\gjea]fljYkkm]d\]g[gjl]
485
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
SOLDADURA
Accesorios para soldadoras MIG/Muscle MIG
Piezas y consumibles - Soldadoras MIG
Pieza No.
CKS15TG1030
CKS15TG1035
CKS35XL1235
CKS15TG1025
CKS15TG1230
CKS15TG1235
CKS15TG1530
CKS15TG1535
CKS25SG1035
CKS35XL1245
CKS35XL1535
CKS35XL1545
CKSM103LB
CKSM123LB
CKSM104LN
CKSM124LN
CKSM3T2510
CKSM3T3010
CKSM3T3510
CKSM3T4510
CKSM3TN50
CKSM6C62
CKSM3TB2
CKSM3TBR3
CKSM3TD
CKSM6D
CKSM6B
CKSER706303
CKSER7063011
CKSER7063033
CKSER706353
CKSER7063511
CKSER7063533
CKSGRFM
CKSGR115
MIG023
MIG030
MIG035
MIG1151
MIG1152
MIG1153
MIG1154
MIG1155
MIG1156
MIG1157
Descripción
MM140SL
MM250SL
MM350XL
MIG220
MIG125
MIG135
FM140A
YA212AIND
Cable de 10 pies y antorcha (cable de 0.030)
Cable de 10 pies y antorcha (cable de 0.035)
Cable de 12 pies y antorcha (cable de 0.035)
Cable de 10 pies y antorcha (cable de 0.025)
Cable de 12 pies y antorcha (cable de 0.030)
Cable de 12 pies y antorcha (cable de 0.035)
Cable de 15 pies y antorcha (cable de 0.030)
Cable de 15 pies y antorcha (cable de 0.035)
Cable de 10 pies y antorcha (cable de 0.035)
Cable de 12 pies y antorcha (cable de 0.045)
Cable de 15 pies y antorcha (cable de 0.035)
Cable de 15 pies y antorcha (cable de 0.045)
Forro para antorcha de 10 pies (0.020 - 0.030)
Forro para antorcha de 12 pies (0.020 - 0.030)
Forro para antorcha de 10 pies (0.030 - 0.045)
Forro para antorcha de 12 pies (0.030 - 0.045)
Punta de contacto (0.025), 10 c/u
Punta de contacto (0.030), 10 c/u
Punta de contacto (0.035), 10 c/u
Punta de contacto (0.045), 10 c/u
Tobera ajustable de 1/2"
Tobera con D.I. de 5/8
Aisladores (2 c/u) con anillos O (6 c/u)
Anillos O del aislador
Difusor de gas
Difusor de gas
Buje de tobera aislado
Alambre de acero (tamaño de 0.030) 3 lbs.
Alambre de acero (tamaño de 0.030) 11 lbs.
Alambre de acero (tamaño de 0.030) 33 lbs.
Alambre de acero (tamaño de 0.035) 3 lbs.
Alambre de acero (tamaño de 0.035) 11 lbs.
Alambre de acero (tamaño de 0.035) 33 lbs.
Regulador - Medidor de flujo
Regulador
Punta de contacto (0.023), 10 c/u
Punta de contacto (0.030), 10 c/u
Punta de contacto (0.035), 10 c/u
Tobera ahusada
Tobera de soldadura de punto
Forro de acero
Resorte de tobera
Cable de 9 pies y antorcha
Difusor
Forro de Teflon® (para alambre de
aluminio)
Estándar
Opcional
–
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
–
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
–
Estándar
Estándar
Estándar
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
–
Estándar
–
–
–
–
–
–
–
–
–
–
Opcional
Estándar
–
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
–
–
–
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
–
Estándar
Estándar
Estándar
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
Opcional
Estándar
–
–
–
–
–
–
–
–
–
–
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
–
Opcional
–
Estándar
Opcional
Opcional
Estándar
Opcional
–
Estándar
–
–
–
Estándar
Estándar
Opcional
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
–
–
–
–
–
–
–
–
–
–
Opcional
Estándar
–
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
–
–
–
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
Estándar
Estándar
Estándar
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
Opcional
Estándar
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
Opcional
Opcional
–
Opcional
Opcional
–
–
Estándar
Estándar
Opcional
Opcional
Estándar
Opcional
Estándar
Estándar
–
Estándar
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
Opcional
Opcional
–
Opcional
Opcional
–
–
Estándar
Estándar
Opcional
Opcional
Estándar
Opcional
Estándar
Estándar
Estándar
Estándar
Estándar
Opcional
–
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
–
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
–
Estándar
Estándar
Estándar
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
–
Estándar
–
–
–
–
–
–
–
–
–
–
Opcional
Estándar
–
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
–
–
–
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
–
Estándar
Estándar
Estándar
–
–
Estándar
Opcional
Opcional
Opcional
Opcional
Opcional
Estándar
–
–
–
–
–
–
–
–
–
–
–
–
–
–
Opcional
Opcional
–
–
MIGCARTA Carro para soldadora y cortador de plasma—
Blue Point®.
s"ANDEJASUPERIORDEXPARAALMACENARLASSOLDADORAS-)'Y
LOSCORTADORESDEPLASMA
sBANDEJASADICIONALESPARAALMACENARLOSACCESORIOS
s)NCLUYESOPORTEDECILINDRODEPOSICIØNMÞLTIPLEPARADIVERSOSTAMA×OS
DEBOTELLAS
s)NCLUYEGANCHOSPARAALMACENARCABLE
MIGCARTA
486
www.snapon.com/shoptools
SOLDADURA
9[[]kgjagkhYjYkgd\Y\gjYEA?
9[[]kgjagk%Kgd\Y\gjYkEA?
Imagen
Pieza No.
Descripción
MHG5A
Pistola alimentadora para aluminio
s#ONVIERTELASSOLDADORASDETALLADAS
a soldadura de aluminio
MHG5B
Pistola alimentadora para aluminio
s#ONVIERTELASSOLDADORASDETALLADAS
a soldadura de aluminio
CKSTP2125A
Paquete TIG de CC
s!GREGACAPACIDADDESOLDADURA4)'
de CC para soldar metales ferrosos
FLEXTIG25
Paquete TIG de CC
s!GREGACAPACIDADDESOLDADURA4)'
de CC para soldar metales ferrosos
CKS2TK
MM140SL
s
s
MM250SL
MM350XL
s
FM140A
YA212AIND
s
s
s
s
s
s
s
s
s
s
Sostén de dos cilindros
MIG220
s
s
CKSMPK1
Juego de piezas
s
s
s
s
s
s
CKSMPK10
Juego de piezas maestras
s
s
s
s
s
s
Ha]rYk$Y[[]kgjagkq[gfkmeaZd]k%HYim]l]k\]haklgdYYdae]flY\gjYhYjYYdmeafagqLA?
Pieza No.
Descripción
CKSM5C62
CKSM5NB
CKSM5B
CKSM35NA62
CKSM35D
CKSMGT2510
CKSMGT3010
CKSMGT3510
CKSMGT36410
CKS404330
CKS404335
CKS4043364
CKSTIGSHARP
CKS3T116
CKS3T332
CKS3T418
CKS3C116
CKS3C332
CKS3C418
CKS3CB116
CKS3CB332
CKS3CB418
ADVERTENCIA
5/8"
Tobera de
Cuerpo de tobera
Buje de tobera aislado
Conjunto de tobera
Difusor de gas
Punta de contacto (0.025) 10 c/u
Punta de contacto (0.030) 10 c/u
Punta de contacto (0.035) 10 c/u
Punta de contacto (3/64) 10 c/u
Alambre de aluminio (tamaño de 0.030) 1 lb.
Alambre de aluminio (tamaño de 0.035) 1 lb.
Alambre de aluminio (Tamaño de 3/64") 1 libra
Afilador de tungsteno químico
Tungsteno de 3" - tamaño de 1/16"
Tungsteno de 3" - tamaño de 3/32"
Tungsteno de 3" - tamaño de 1/8"
Boquilla para tungsteno de 1/16"
Boquilla para tungsteno de 3/32"
Boquilla para tungsteno de 1/8"
Cuerpo de boquilla para tungsteno de 1/16"
Cuerpo de boquilla para tungsteno de 3/32"
Cuerpo de boquilla para tungsteno de 1/8"
MHG5A
MHG5B
CKSTP2125A
FLEXTIG25
Estándar
Estándar
Estándar
Estándar
Estándar
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
Opcional
–
–
–
–
–
–
–
–
–
–
Estándar
Estándar
Estándar
Estándar
Estándar
Opcional
Opcional
Estándar
Opcional
Opcional
Estándar
Opcional
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
Opcional
–
Estándar
Estándar
–
Estándar
Estándar
–
Estándar
Estándar
–
–
–
–
–
–
–
–
–
–
–
–
Opcional
Estándar
Estándar
Opcional
Estándar
Estándar
Opcional
Estándar
Estándar
Opcional
Mk]hjgl][lgj^Y[aYdqjghY\]hjgl][[afea]fljYkkm]d\]q[gjl]
Fgh]jealYim]`YqYh]jkgfYkYkmYdj]\]\gjea]fljYkkm]d\]g[gjl]
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
487
SOLDADURA
Cortadoras de plasma
Snap-on® ofrece cortadores de plasmas que son ideales para cortar metales ferrosos (acero, acero inoxidable) así
como también metales no ferrosos (aluminio) y acero nuevo de alta resistencia. Ambos modelos remueven fácilmente
las soldaduras por puntos. Utiliza aire comprimido seco y limpio, sin la necesidad de utilizar gas en cilindros. Incluye
regulador de aire para ajustes precisos de presión de aire para lograr la mejor calidad de corte. Mango compacto de la
antorcha para acceder a áreas estrechas.
PLASMA25
PLASMA50
Servicio pesado
Estándar
PLASMA50
PLASMA25
Especificaciones
30 y 50
1/2
3 /4
208/230 VCA, 50/60 Hz
30
40%
88 psi a 7 CFM
18
18
6
2 años
Amperaje de salida máximo (amperes)
Espesor del corte (pulg.)
Espesor del servidor (pulg.)
Entrada principal (V)
Entrada principal (A)
Ciclo de trabajo a máximo amperaje
Requerimientos de aire comprimido (mínimo)
Largo del cable de la antorcha (pies)
Largo del cable de conexión a tierra (pies)
Largo del cable de alimentación (pies)
Garantía*
* No incluye cable ni antorcha
25
3/8
–
115 V 50/60 Hz
20
20%
88 psi a 5 CFM
12
12
6
2 años
SOPORTE TÉCNICO
1-800-ABC-WELD
Partes consumibles para cortadores de plasma
Partes consumibles para cortadores de plasma
PLASMA115
PLASMA230
Sostén de boquilla
Paquete de 5 resortes espaciadores
Difusor
Paquete de 5 toberas cortas (1 mm)
Paquete de 3 toberas largas (1 mm) (35-50 amp.)
Paquete de 5 electrodos cortos
Paquete de 5 toberas cortas (0.9 mm) (0-35 amp.)
Paquete de 5 electrodos largos
Paquete de 2 electrodos largos
Paquete de 5 toberas largas (0.9mm) (35-50 amp.)
Conjunto de antorcha completo
PLASMA2304
—
PLASMA23031
PLASMA2301
PLASMA2302
PLASMA1151
—
—
PLASMA1152
—
PLASMA1153
PLASMA2304
PLASMA2309
PLASMA23031
PLASMA2301
PLASMA2302
PLASMA2305
PLASMA2306
PLASMA2307
—
PLASMA2308
PLASMA23010
PLASMA2308
PLASMA2305
PLASMA2304
Partes consumibles para cortadores de plasma
PLASMA25
PLASMA50
Sostén de boquilla
Paquete de 2 anillos circulares
Paquete de 5 electrodos
Paquete de 2 difusores
Espaciador de dos puntas
Paquete de 5 boquillas
Cabeza de la antorcha
Conjunto de antorcha completo
PLASMA5001
PLASMA5003
PLASMA5004
PLASMA5005
PLASMA2504
PLASMA2502
PLASMA5006
PLASMA2503
PLASMA5001
PLASMA5003
PLASMA5004
PLASMA5005
PLASMA2504
PLASMA5002
PLASMA5006
PLASMA5007
PLASMA5001
PLASMA2306
PLASMA5005
488
www.snapon.com/shoptools
PLASMA2504
SOLDADURA
Kgd\Y\gjY\]_Yk»:dm]Hgafl®
WE200A
WE250A
Kgd\Y\gjY\]?Yk
s3EUTILIZAPARALAREPARACIØNCONSTRUCCIØNFABRICACIØNMANUFACTURA
YMANTENIMIENTODEAUTOMØVILES
s%LREGULADORFORJADOENLATØNESDURABLEYRESISTENTE
s%LDIÉMETRODELREGULADORDEPERMITECONTROLARELGASDE
MANERAPRECISA
s%LFILTROINTERNOEVITAQUEINGRESENPARTÓCULASALREGULADOR
s3ELLODEPOLITETRAFLUOROETILENO04&%4EFLON®
s,ACODIFICACIØNDECOLORESDELAVÉLVULADEAPAGADODELAEMPU×ADURA
PERMITEIDENTIFICARCONFACILIDADELCONTROLDEGASCORRESPONDIENTE
s,APUNTAPARACORTEDEDOSPIEZASESMÉSFÉCILDELIMPIAR
s,AMANGUERADEALTACALIDADBRINDAMENORRESISTENCIAALASROTURAS
YMAYORFLEXIBILIDAD
;gehgf]fl]k\]dbm]_g
Pieza No.
W
E2
00
El juego
A
contiene:
W
E2
50
A
Descripción
HRC1401340
HRC1300380
HRC9100614
HRC4300557
HRC4304482
HRC9004486
WE200A1
WE200A2
WE250A1
WE250A2
HRC1502172
HRC1600890
HRC1600870
HRC1600850
WE200A Juego de soldadoras de servicio estándar.
s#ORTAHASTAYSUELDAHASTA#ORTAHASTAYSUELDAHASTA
CONPUNTASOPCIONALES
WE250A Juego de soldadoras de servicio mediano.
s#ORTAHASTAYSUELDAHASTA#ORTAHASTAYSUELDAHASTA
CONPUNTASOPCIONALES
9[[]kgjagkgh[agfYd]k
Pieza No.
Empuñadura de soldadora 85 con válvulas
de verificación
72-3 Accesorio de corte
D-85 Mezclador para soldar
Manguera doble de 3/16 x 20
Anteojos de protección
Percutor
Regulador de oxígeno
Regulador de acetileno
Regulador de oxígeno
Regulador de acetileno
6290-1 Punta para corte de CA N.º 1
23-A-90-5 Punta para soldar N.º 5
23-A-90-3 Punta para soldar N.º 3
23-A-90-1 Punta para soldar N.º 1
W
E2
El juego 00A
contiene:
W
E2
50
A
Descripción
Estándar
Estándar
HRC1800710
J-63-1 Conjunto de calefacción
Opcional
Opcional
Estándar
Estándar
Estándar
Estándar
Estándar
Estándar
Estándar
–
–
Estándar
Estándar
Estándar
Estándar
Estándar
Estándar
Estándar
Estándar
Estándar
–
–
Estándar
Estándar
Estándar
Estándar
Estándar
Estándar
HRC1600840
HRC1600860
HRC1600880
HRC1502170
HRC1502171
HRC1502173
HRC1502174
HRC1502175
HRC4301650
HRC9000160
HRC9004484
23-A-90-0 Punta para soldar N.º 0
23-A-90-2 Punta para soldar N.º 2
23-A-90-4 Punta para soldar N.º 4
6290-00AC Punta para corte de CA N.º 00
6290-0AC Punta para corte de CA N.º 00
6290-2AC Punta para corte de CA N.º 2
6290-3AC Punta para corte de CA N.º 3
6290-4AC Punta para corte de CA N.º 4
88-5FBT PR. Interceptor de la llama de la antorcha
E-9 Limpiador de puntas (punta de 2 piezas)
Piedras de repuesto
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
–
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
Opcional
?mYfl]k'eYf_Yk\]kgd\Yj»:dm]Hgafl
YA427B Guantes de soldar.
s!YUDANAPROTEGERLASMANOSDELAS
CHISPASCUANDOSEESTÉSOLDANDO
s&ABRICADOSDECUEROCONAISLAMIENTO
ADICIONALPARAPROTEGERCONTRAELCALOR
s0ALMAREFORZADAPARAMAYORDURABILIDAD
ADVERTENCIA
YA4282 Guantes de soldar TIG.
YA4280 Mangas de soldar.
s)DEALESPARALOSPROCESOSDESOLDADURA4)'
s!YUDANAPROTEGERLOSBRAZOSDELASCHISPAS
s$ECUERODECERDOPARATENERUNCONTROLPRECISO CUANDOSEESTÉSOLDANDOOCORTANDO
s!YUDANAPROTEGERLASMANOSDELCALORYLASCHISPAS s4IENEBANDASELÉSTICASENCADAEXTREMO
s0U×ODECUEROGRUESOPARAPROTEGERLASMU×ECAS DELAMANGA
s&ABRICADASDETELARETARDANTEDEFLAMA
Mk]hjgl][lgj^Y[aYdqjghY\]hjgl][[afea]fljYkkm]d\]q[gjl]
Fgh]jealYim]`YqYh]jkgfYkYkmYdj]\]\gjea]fljYkkm]d\]g[gjl]
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
489
SOLDADURA
Accesorios
Cascos para soldar (con oscurecimiento automático, de color ajustable)
Los cascos para soldar ajustables con oscurecimiento automático se accionan automáticamente con fuentes de luz ultravioleta y ofrecen un
ajuste de color variable para diferentes procesos de soldadura. Algunos modelos tienen sensibilidad ajustable para diversas condiciones de luz y
una configuración de retardo ajustable para mantener el estado de oscurecimiento durante períodos prolongados.
Especificaciones
YA612B
YA613
YA4601
YA4602**
#9-12
#9-13
#9-13
#9-13
Sensibilidad
Ajustable
Ajustable
Ajustable
Ajustable
Retardo
Ajustable
Ajustable
Ajustable
Fija
#4
#4
#3.5
#3.5
3.75 X 2.38
3.75 X 2.38
3.81 X 2.40
3.81 X 1.88
8.93
8.93
9.14
7.16
2
4
4
2
0.25 a 0.80
0.25 a 1.0
0.2-1.0
0.1-1.0
Color
Color transparente
Área de visión (pulgadas)
Área de visión (pulgadas cuadradas)
Cantidad de sensores
Tiempo de retardo (segundos)
0.04
0.04
0.04
0.04
Pila solar AA
Solar de litio
Solar de litio
Solar
Velocidad de conmutación (minutos)
Suministro eléctrico
ANSI
ANSI
ANSI, CE, DIN, EN, CSA
ANSI, CE, DIN, EN, CSA
Opcional Lupa de 1.5 veces
YA555MAG1.5*
YA555MAG1.5
—
—
Opcional Lupa de 2.0 veces
YA555MAG2.0*
YA555MAG2.0
—
2 años
2 años
Normas aplicables
Garantía
—
2 años
* requiere YA612MAGADP
1 año
**Blue-Point®
Cascos para soldar (con oscurecimiento automático, de color fijo) Los cascos de color fijo con oscurecimiento automático
ofrecen un color fijo N.° 10 y accionan automáticamente mediante fuentes de luz ultravioleta. El color transparente le brinda al operador
visibilidad para alinear el trabajo antes de soldar.
Especificaciones
YA590
YA4603*
EFPCODERED
EFPHANNIBAL
EFPNITESTLKR
Estilo de lente
Plano
Plano
Periférico de 180°
Periférico de 180°
Periférico de 180°
Color
#10
#10
#10
#10
#10
Color transparente
#4
#3.5
#3
#3
#3
3.75 X 1.2
3.81 X 1.38
4.25 X 2.0
4.25 X 2.0
4.25 X 2.0
4.5
5.26
8.5
8.5
8.5
1
2
1
1
1
0.25
0.25-0.045
0.5
0.5
0.5
Área de visión (pulgadas)
Área de visión (pulgadas cuadradas)
Cantidad de sensores
Tiempo de retardo (segundos)
0.04
0.04
0.04
0.04
0.04
Pila AA
Solar
Solar de litio
Solar de litio
Solar de litio
Normas aplicables
ANSI
ANSI, CE, DIN, EN, CSA
Lentes (incluidas)
—
—
Opcional Lupa de 1.5 veces
YA555MAG1.5
—
ANSI
EFP10WLDLENS
EFPCLLENSREP
—
ANSI
EFP10WLDLENS
EFPCLLENSREP
—
ANSI
EFP10WLDLENS
EFPCLLENSREP
—
Opcional Lupa de 2.0 veces
YA555MAG2.0
—
—
—
—
2 años
1 año
1 año
1 año
1 año
Velocidad de conmutación (minutos)
Suministro eléctrico
Garantía
*Blue-Point®
490
www.snapon.com/shoptools
SOLDADURA
9[[]kgjagk
;Yk[gkhYjYkgd\Yj \][gdgj^abg!&,OSCASOSPARASOLDARDECOLORFIJOOFRECENUNAPROTECCIØNDECOLOR.,AMÉSCARACONBISAGRAS
PUEDEAJUSTARSEPARADESPLEGARSESINUSARLASMANOS
Especificaciones
YA551B
YA555A
EFPKILLA
EFPBONEHED
EFPSTRIKER
Plano
Plano
Periférico de 180°
Periférico de 180°
Periférico de 180°
#10
#10
#10
#10
#10
5.25 X 4.50
5.25 X 4.50
—
—
—
23.63
23.63
35.6
35.6
35.6
ANSI
ANSI
ANSI
ANSI
ANSI
—
—
EFPCLLENSREP
EFPCLLENSREP
EFPCLLENSREP
Opcional Lupa de 1.5 veces
YA555MAG1.5*
—
—
—
—
Opcional Lupa de 2.0 veces
YA555MAG2.0*
—
—
—
—
2 años
2 años
1 año
1 año
1 año
Estilo de lente
Color
Área de visión (pulgadas)
Área de visión (pulgadas
cuadradas)
Normas aplicables
Lentes (incluidas)
Garantía
REQUIERE9!-!'!$0
9fl]gbgkhYjYkgd\Y\gj–:dm]%Hgafl®
GAC5002B Anteojos para soldar tipo copa.
s#OLOR.PARASOLDARYCORTAROXIACETILENO
s)NCLUYEESCUDOSLATERALESINCORPORADOSPARAMÉXIMAPROTECCIØN
s3OPORTEDENARIZYBANDADECABEAJUSTABLES
GAC1100C Anteojos de seguridad.
s,ENTESTONALIZADASCOLORVERDEPARATRABAJOSCONANTORCHASDEACETILENO
GAE56C Anteojos para soldador.
s­READEVISIØNCOMPLETADEXCONCOLOR.PARASOLDARYCORTAR
GAC5002B
OXIACETILENO
s%LVISORQUESELEVANTACONLENTESADICIONALESTRANSPARENTESESIDEALPARAESMERILAR
s0UEDECOLOCARSESOBRELAMAYORÓADELOSANTEOJOSRECETADOS
s"ANDADECABEZAAJUSTABLE
s0UEDENUTILIZARSECONLASLUPASOPCIONALES
YA555MAG1.5OYA555MAG2.0
Bm]_g\]eYj[Y
GAC1100C
YA247 Juego de marca de la soldadora.
)NCLUYE
s-ARCADORDEESTEATITA9!PARAHACER
MARCASTEMPORARIAS
s0UNZØN9!CONPUNTADECARBURORESISTENTE
YFILOSAPARAHACERMARCASPERMANENTES
s%STEATITAREEMPLAZABLE
s#ADAHERRAMIENTAPOSEEUNBARRILDE
ALUMINIORESISTENTE
s%LMARCADORDEESTEATITAINCLUYEUNAFILADOR
INCORPORADO
sBOLSADEALMACENAMIENTOÞTIL
EYjladdg\]kgd\Yj
WCH3 Martillo soldador cincel.
s0OSEEEXTREMODEPICOYEXTREMODE
CABEZADECINCELDE
s!CERODEALTAALEACIØNTRATADO
TÏRMICAMENTEPARAMAYORDURACIØN
s%LLARGOTOTALESDE
s%LLARGODELACABEZAESDE
YA247
WCH3
?jYehYkhYjYkgd\Yj
?jYehYk;
s%QUIPADASCONEJESCONTRASALPICADURASCORTADOSCONPRECISIØNDEACEROENDURECIDO
s,OSMARCOSFORJADOSTIENENGARGANTASEXTRAPROFUNDASQUEBRINDANMAYOR
FUERZAYCAPACIDADDETRABAJO
s5NYUNQUERANURADOENCOMBINACIØNCONUNAALMOHADILLASERRADA
PROPORCIONANUNAGARREANTIDESLIZANTEENDIVERSASSUPERFICIESMETÉLICAS
s,OSEJESEMPU×ADURASYALMOHADILLASESTÉNBA×ADASENCOBREPARA
EVITARLAACUMULACIØNDESALPICADURAS
CL402A
ADVERTENCIA
GAE56C
Pieza No.
CL402A
CL403A
CL404A
CL406A
CL408A
CL410A
CL412A
Capacidad, pulgadas
Profundidad de la
garganta, pulgadas
0-2
0-3
0-4
0-6
0-8
2-10
2-12
2
2 1/2
2 7/8
3 5/8
4 1/2
5 5/8
5 3/4
Mk]hjgl][lgj^Y[aYdqjghY\]hjgl][[afea]fljYkkm]d\]q[gjl]
Fgh]jealYim]`YqYh]jkgfYkYkmYdj]\]\gjea]fljYkkm]d\]g[gjl]
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
491
SOLDADURA
Grampas/Prensas de banco
CL408VIS Grampas "C"
de alta visibilidad
CL408VIS
s3IMILARESALASGRAMPAS#SERIE#,
s,OSMODELOSDEALTAVISIBILIDADCUMPLENCONELESTÉNDARDECOLOR
DESEGURIDAD/3(!PARALASREGULACIONESDEPELIGRODEDA×OFÓSICO
.ª
s(USODEDEDIÉMETRO
VGP12212
Mordaza grande–Blue-Point®
Pieza No.
A pulgadas (mm)
B pulgadas (mm)
VGP12212
3 15/16 (100)
12 (300)
s(ERRAMIENTAMULTIPROPØSITOCONMAYORCAPACIDADDEMORDAZAPARAEL
MANTENIMIENTOGENERALYLAEXTRACCIØNDEFILTROSDEACEITEROSCADOS
Pieza No.
Capacidad, pulgadas
Profundidad de la
garganta, pulgadas
CL404VIS
CL406VIS
CL408VIS
0-4 1/2
0-6 1/16
0-8 1/4
3 1/4
3 5/8
5
Grampas "C" de traba–Blue-Point
sGrampasRÉPIDASYFÉCILESDEUSARPALALAFABRICACIØNDEMETALESY
CARROCERÓASDEAUTOMØVILES
Pieza No.
Punta estándar
Punta giratoria
Largo alcance
Aleación de aluminio
Grampa "U" de traba
Mordazas autoajustables
Grampa para planchas de metal
Pinzas para soldaduras obturadoras
VGP12406
VGP12412
VGP12418
VGP12424
VGP22406
VGP22412
VGP22418
VGP22424
VGP13420
VGP14412
VGP12509
VGP23312
VGP12808
VGP13709
A pulgadas (mm)
5/16
(60)
2
3 15/16 (100)
10 1/4 (260)
15 11/16 (400)
1 5/16 (50)
3 15/16 (100)
9 7/16 (240)
15 11/16 (400)
10 5/8 (270)
3 1/2 (90)
2 5/16 (60)
3 15/16 (100)
1 3/4 (45)
1 9/16 (40)
B pulgadas (mm)
6 (152.4)
12 (304.7)
18 (457.2)
24 (609.6)
6 (152.4)
12 (304.7)
18 (457.2)
24 (609.6)
20 (508)
12 (304.7)
9 (228.6)
12 (304.7)
8 (203.2)
9 (228.6)
VGP13420
VGP12412
VGP12412 Grampas "C"
de traba
s'RAMPASRÉPIDASYFÉCILES
DEUSARPARALAFABRICACIØN
DEMETALESYCARROCERÓASDE
AUTOMØVILES
VGP14412
VGP22418
VGP12509
VGP12509 Grampas "U"
de traba
s,AMORDAZAENFORMADEh5vPERMITE
UNFÉCILACCESOYUNAVISIBILIDAD
PERFECTAALEFECTUARSOLDADURAS
VGP13709
VGP22418 Grampas "C"
de traba/Punta giratoria
s,ASALMOHADILLASGIRATORIAS
PERMITENLASUJECIØNPARALELA
MIENTRASEVITANABOLLADURAS
ORASPADURASENSUPERFICIES
DELICADAS
VGP12808
VGP12808 Grampas de
traba/Plancha de metal
s,ASMORDAZASANCHASPERMITEN
SUJETARDOBLARMOLDEARY
PLEGARPLANCHASDEMETALSIN
DEMASIADOESFUERZO
VGP14412 Grampa “C” de
traba/Aleación de aluminio
s,AMORDAZADEALUMINIO
LIVIANANODOBLANIDEFORMALOS
PANELESDELACARROCERÓA
s,OSRESTOSMETÉLICOSDELASOLDADURA
NOSEADHIERENALAMORDAZA
VGP23312
VGP13709 Pinzas de traba/ VGP23312 Grampas de traba/
Soldadura obturadora
Mordazas autoajustables
s,AALMOHADILLAESTRIADADE
s,ASALMOHADILLASGIRATORIASYEL
ALEACIØNDECOBREEVITAQUESE
PERFILANGOSTODELAMORDAZA
QUEMEELMETALCUANDOSEREALIZA SUJETANFIRMEMENTELASSUPERFICIES
UNASOLDADURAOBTURADORAENUNA
AHUSADASENÉREASDONDENO
PLANCHADELGADA
ENTRANLASGRAMPASh#v
Juegos de soldadura/carrocería de automóviles
VGP104 Juego de pinzas de traba para carrocería/soldaduras.
s)NCLUYEPINZASCONMORDAZASAUTOAJUSTABLES6'0PINZAS
PARASOLDADURASOBTURADORAS6'0MÉSPINZASPARAGRAMPA
h#v6'0Y6'0PZASENBOLSADEJUEGO6'0
492
VGP13420 Grampa "C" de
traba/Largo alcance
s%LPERFILANCHOCONMORDAZA
PERFORADAPERMITESUJETAR
OBJETOSGRANDESCONUNA
DISTRIBUCIØNUNIFORMEDE
LATENSIØN
MG2000K
Grampa de soldar/Miniatura–Blue-Point
s4AMA×OREDUCIDOPARAUNØPTIMOACCESOAESPACIOSRESTRINGIDOS
s%LCUERPODEALEACIØNDEALUMINIOASEGURAUNAGRANSOLIDEZCONUN
PESOMÓNIMOYGRANRESISTENCIAALASSALPICADURASYLACORROSIØN
s%LEXCELENTEDISE×OPERMITEEJERCERUNAFUERZADETONELADASIN
RIESGODEDEFORMACIØN
s,AMORDAZAPERFORADAPERMITELAFIJACIØNAARTEFACTOSYLACONEXIØN
DECABLESDEPUESTAATIERRA
s3UJECIØNYLIBERACIØNSINPELLIZCOSYCONUNASOLAMANO
MG2000K Juego de grampas de traba con
micro-agarre. )NCLUYEGRAMPASCONMICROAGARRE
www.snapon.com/shoptools
SOLDADURA
Kgd\Y\gjYk\]hmflg
Electrodo del alojamiento de rueda
YA22300A
Electrodo de largo alcance
YA22300A Soldadora de punto para servicio estándar.
s0RODUCESOLDADURASPORPUNTOSPARAHACERCHAPAYPINTURA
s,AACCIØNTIPOAPLICADORAPRODUCESOLDADURASESTILODEFÉBRICA
s,OSACCESORIOSOPCIONALESPUEDENAUMENTARLACAPACIDADDE
SOLDADURA
YA223001 Punta para soldadora.
s0UNTAPARASOLDADORADEPUNTOLARGAPARA9!!
YA223002 Punta para soldadora.
s0UNTAPARASOLDADORADEPUNTOCORTAPARA9!!
YA223003 Punta para soldadora.
s0UNTAPARASOLDADORADERIELESESCURRIDORESDEREEMPLAZOPARAEL
CONJUNTODECABLEPARASOLDADORA9!
YA223004A Conjunto de cables para soldadora.
s#ONJUNTODECABLEPARASOLDADORAACCESORIOPARALA9!!
s0ERMITESOLDARDESDEUNSOLOLADOCOMOENREVESTIMIENTOSDE
PUERTASYOTRASAPLICACIONES
YA223005A Juego de rectificadores de abolladuras.
s2EPARACIØNRÉPIDAYEFECTIVADEABOLLADURASSINPERFORARORIFICIOSNI
UTILIZARPASADORESDETRACCIØN
YA223006 Punta para soldadora.
s0UNTAPARASOLDADORADERIELESESCURRIDORESDEREEMPLAZOPARAEL
CONJUNTODECABLEPARASOLDADORA9!
YA223009 Punta para soldadora.
s0UNTAPARASOLDADORADERIELESESCURRIDORESPARA9!!
YA22356 Empuñadura.
s.UEVOESTILODEEMPU×ADURAPARAGUARDARELINTERRUPTORMEJORADO
9!0UEDERETROINSTALARSEAMODELOSANTERIORES
YA22357 Interruptor.
s)NTERRUPTORMEJORADOENCAJADEMETALPARAMAYORDURABILIDAD
PUEDERETROINSTALARSEAMODELOSANTERIORES
YA22355
YA22355 Soldadora de puntos refrigerada por líquido
de servicio pesado.
s$ISE×ADAPARAPRODUCIRSOLDADURASPORPUNTOSTIPODEFÉBRICAEN
TALLERESDECHAPAYPINTURA
s,AACCIØNTIPOAPLICADORAPRODUCESOLDADURASESTILODEFÉBRICA
s,APISTOLANEUMÉTICASUELDAATRAVÏSDEPREPARADORESSELLADORESYADHESIVOS
s3ECARACTERIZAPORCIRCULACIØNDELÓQUIDOREFRIGERANTEATRAVÏSDELASPUNTAS
DELASOLDADORAPARALOGRARUNAPENETRACIØNCONSTANTEDELASOLDADURA
s!CCESORIOSINCLUIDOSELECTRODODELARGOALCANCEDEYELECTRODO
DELALOJAMIENTODELARUEDA
Especificaciones
Voltaje principal
Fusible de línea
Salida máxima, amperes
Espesor máximo, calibre
Capacidad del metal revestido
Índice de KVA
Peso de envío, lb.
YA22300A
YA22355
208/230 VCA
50 A
2,800
2 de 20 piezas
No
4
120
208/230 VCA
60 A
6,000
3 de 20 piezas
Sí
6
300
J][laÇ[Y\gjYk\]YZgddY\mjYk'9[[]kgjagk
YA22345KT
J][la^a[Y\gj]k\]YZgddY\mjYk[gfhaklgdY\]]kh~jjY_gk
YA22345KT Juego de rectificador de abolladuras con
pistola de espárragos.
s%LJUEGOINCLUYEPISTOLADEESPÉRRAGOSPUNTASPARASOLDARMARTILLO
DESLIZANTEYRECTIFICADOR4
s3EUTILIZAPARARECTIFICARABOLLADURASALSOLDARPASADORESALAPIEZA
DETRABAJO
s,APISTOLADEESPÉRRAGOSUTILIZACALORMÓNIMOPARAREDUCIRLASQUEMADURAS
YA223451 Pasadores de tracción (2 mm).
s"LANDOSPARAFLEXIONARYESMERILARCONFACILIDAD
s/FRECEUNARECTIFICACIØNDELB
s0AQUETEDE
YA223452 Pasadores de tracción (2.5 mm).
s"LANDOSPARAFLEXIONARYESMERILARCONFACILIDAD
s/FRECEUNARECTIFICACIØNDELB
s0AQUETEDE
YA223454 Rectificador "T".
s#OMPACTAPREPARACIØNDEDA×OSPEQUE×OSENMETALESLIVIANOS
s!YUDAADISMINUIRLARECTIFICACIØNEXCESIVA
ADVERTENCIA
YA223453
YA223453 Grampa magna.
s0OSEEUNATUERCADEMARIPOSAYESAUTOAJUSTABLE
s3ECOLOCAENLOSPASADORESDETRACCIØNPARARECTIFICACIØNDEABOLLADURAS
YA233455 Martillo deslizante.
s"ARRADEACEROLUSTRADACEMPU×ADURADEGOMAQUEASEGURAUNA
ACCIØNDERECTIFICACIØNPOSITIVA
YA223456 Electrodo de encogimiento.
s/FRECEUNCALENTAMIENTORÉPIDO
YA223457 Electrodo para pasador.
s3OSTIENETODOSLOSPASADORESDETAMA×OESTÉNDAR
YA223458 Adornos de bordes.
s3EUSANPARAREPARARCINTASDEBORDESMETÉLICOS
s3ESUELDANENELPANELYOFRECENUNAUNIØNPERMANENTECONLACINTA
DELBORDE
s0AQUETEDE
YA223459 Electrodo para adornos.
s0ARAUTILIZARCONADORNOSDEBORDES9!
s3UJETAELADORNODELBORDEPARASOLDARLO
Mk]hjgl][lgj^Y[aYdqjghY\]hjgl][[afea]fljYkkm]d\]q[gjl]
Fgh]jealYim]`YqYh]jkgfYkYkmYdj]\]\gjea]fljYkkm]d\]g[gjl]
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
493
SOLDADURA
Sistemas de rectificación de abolladuras
YA22350C
YA22375
Sistema portátil de
rectificación de abolladuras
s2ECTIFICAABOLLADURASFÉCILMENTEENLOSTECHOSCAPØSYPANELESLATERALES
s%LDISE×ODEPUNTATIPOESTRELLAELIMINALANECESIDADDEPERFORARAGUJEROSO
CORTARCABEZASDEPASADORES
s%LMARTILLODECABEZADESLIZANTEINCORPORADOACELERAELPROCESODE
RECTIFICACIØNSØLO9!#
Especificaciones
Tipo
Voltaje principal
Fusible de línea
Largo del cable de
alimentación de entrada (pies)
Largo del cable de
alimentación (pies)
Largo del cable de conexión a
tierra (pies)
Peso de envío, (libras)
YA22350C
YA22375
YAH22350C
YAH22375
Punta tipo
estrella
120 VCA
50/60 Hz
30 A
Empuñadura
"T"
120 VCA
50/60 Hz
30 A
Punta tipo
estrella
208/230 VCA
50/60 Hz
30 A
Empuñadura
"T"
208/230 VCA,
50/60 Hz
30 A
25
25
25
25
7
10
7
7
7
7
7
7
64
64
64
64
YA2235CART
YA22351
Accesorios del rectificador portátil de abolladuras
Juego tipo garra para rectificación rápida de abolladuras.
YA2235CART Carro de servicio. !GREGAALTURAY
PORTABILIDADADICIONALES
YA2355 Puntas tipo estrella. 0UNTASDEREEMPLAZOCUPARA
9!#9!(#Y9!
YA2351 Punta para soldadora. 0UNTAPARASOLDARESPÉRRAGOS
LARGOSOPCIONAL
YA2352 Punta para soldadora. 0UNTAOPCIONALPARASOLDAR
REMACHESDEMOLDURAS
YA2353 Punta térmica. 0UNTATÏRMICADEENCOGIMIENTOTÏRMICO
DEREEMPLAZO
YA2358 Base magnética. 'RAMPADETIERRACONBASEMAGNÏTICA
YA22357 Interruptor de gatillo. )NTERRUPTORDEREEMPLAZO
YA223008 Barra de palanca. "ARRADEPALANCADEREEMPLAZO
PARA9!Y!(OPCIONALPARA9!#Y9!(#
YA22351 Juego tipo garra para rectificación rápida de abolladuras.
s3EUTILIZACON9!#9!(#9!Y9!(
s3EUTILIZAPARAESTABLECERMÞLTIPLESPUNTOSDERECTIFICACIØNALO
LARGODELASABOLLADURAS
s,AACCIØNINDEPENDIENTEDELAGARRAVARÓALAFUERZADERECTIFICACIØN
ENMÞLTIPLESPUNTOS
s3EPUEDETIRARCONLAMANOCONUNMARTILLODESLIZANTEOUNACADENA
s3EENTREGACONGANCHOPUNTASYALAMBRES
YA22352 Empuñadura de garra. %MPU×ADURADERECTIFICACIØN
TIPOhGARRAvDECUATRODEDOS%LJUEGOINCLUYEUNA
YA22353 Puntas para soldar. 0UNTASPARASOLDADORAPARA
ALAMBRESDESOLDAR9!%LJUEGOINCLUYE
YA22354 Alambres de soldar. !LAMBRESDESOLDADORDELB
%LJUEGOINCLUYE
494
www.snapon.com/shoptools
ILUMINACIÓN
Soluciones innovadoras de iluminación
definen la forma y la función.
No se puede arreglar lo que no se ve. Por esta razón, Snapon® proporciona soluciones de iluminación que alumbran
más, duran más y ofrecen una amplia gama para ver los
trabajos que se encuentran delante de usted.
N]jk~lad2;geZafYdYadmeafY[af[gfdYlYj]Y2DYk
gh[agf]kMN$j][Yj_YZd]k$È]paZd]k$[gf[YZd]]
inalámbricas para debajo del capó y faros delanteros
kYlak^Y[]fdYf][]ka\Y\q]d]khY[ag&DYn]jkYlada\Y\\]
dYdf]Yj]È]bYdgkj]imakalgk\]dljYZYbg&
Hgjl~lad2L]jeaf]]dljYZYbg\]eYf]jYe~kj~ha\Y[gf
las opciones de iluminación que se enganchan con
manos libres. Desde linternas tipo pluma hasta luces
giratorias magnéticas, dirija la luz a donde lo necesite,
cuando lo necesite.
;gfÇYZd]2DYe~paeYafl]fka\Y\$]d]pl]jagjkda\g
y la prueba rigurosa aseguran que su iluminación
será permanente.
495
ILUMINACIÓN
Linternas (no recargables)
Ca
Al
nti
ca
da
n
(d ce
d
d
Pi
de e ef
eb
ez
h e
b
a
a
a
ter asta ctiv
te
No
ría
í
a
.
s ) o
Lu
Tip
o
Linternas con LED de gran salida
s!LUMINIOPARAAERONAVESMAQUINADODE
PRECISIØN
s2ESISTENTEACHOQUESDEMÉSDE
LIBRAS
s%LANILLO/BRINDAUNSELLOULTRAHERMÏTICO
s2ESISTENTEALOSGOLPESEIMPERMEABLE
s)NTERRUPTORTÉCTICODETRESVÓAS
MOMENTÉNEAMENTEENCENDIDO
CONSTANTEMENTEENCENDIDOMODOBLOQUEO
ECFHEAD1
ECFHEAD1 Lámpara de cabeza con
LED–Blue-Point®.
s%L,%$BRILLANTEDEVATIONUNCANECESITA
REPUESTO
s#ABEZAARTICULADAYBANDADECABEZAAJUSTABLE
s)MPERMEABLE
s4IEMPODEOPERACIØNCONTINUADEHORAS
ENPILASALCALINAS!!!
op
P La era T
av ulga rgo ción iemp
iol da to
(h o
t
et
a s al, oras de
)
zu
Lú
ltr
m
en
es
ECF925B
AA
1
100'
25
—
4
2
ECF950A
123
2
120'
25
—
4 3/4
20
ECF965B
AA
2
150'
100
—
5 7/8
3
ECF975A
123
2
250'
135
—
6
2.5
ECFUV950
LED/UV
123
2
—
—
Sí
4 3/4
15
ECFB1
ECFB1 Linterna de aluminio con
LED–Blue-Point.
s,%$DEVATIOCONLUPACONVEXAPARAUNA
MÉXIMAINTENSIDADDELUZ
s#ONSTRUCCIØNDEALUMINIOANODIZADOPARA
MAYORDURABILIDAD
s)NTERRUPTORENLATAPATRASERACONBOTØNDE
ENCENDIDOAPAGADOCONFUNCIØNSILENCIOSA
s)NCLUYEPILAS!!!
ECFB101
ECFB101 Linterna delgada con
LED–Blue-Point.
s,INTERNABRILLANTEYDURABLEDEVATIO
,UXEONCON,%$
s%LDISE×ODELCOLLARESTRIADOEVITAQUERUEDE
ENSUPERFICIESPLANAS
s)NCLUYEPILASALCALINAS!!YUNA
MU×EQUERA
s2ESISTENTEALAGUAYALOSGOLPES
ECFB200BL
ECFB200S
ECFB200BL/ECFB200S Linterna de
bolsillo–Blue-Point.
s,INTERNADEBOLSILLODELÞMENESY
VATIOSDEALTAINTENSIDAD
sDELARGODEDIÉMETRO
s)NCLUYEUNGANCHOPARABOLSILLOYUNAPUNTA
DEPROTECCIØNDEGOMA
s3EENTREGAENCOLORAZUL%#&"",Y
PLATEADO%#&"3
s)NCLUYEPILAS!!!
ECFLED24
496
ECF201A
ECF35
ECF35 Linterna a prueba de
explosión–Blue-Point.
s!LIMENTADAPORPILAS$
s0OSEEPLATAFORMASDEBATERÓASPARAAISLAR
LASBATERÓASDELFOCO
s#UERPODEPLÉSTICODEALTOIMPACTOPARA
MAYORDURABILIDAD
s#ANALDEJUNTAQUEIMPERMEABILIZAELLENTEY
LATAPADELLENTE
s%NLISTADE5,YAPROBADAPOREL"UREAU
ECFLED24 Luz de trabajo magnética
OF-INES
giratoria con LED–Blue-Point.
s,%$DEGRANSALIDABRINDANUNAFUERTEILUMINACIØN sFEDERALESYMILITARESDELOS%%55
s"ASTIDORDEALUMINIOAZULRESISTENTEPARAMAYOR -854IPO))%STILOAEXCEPCIØN
DELCOLOR
DURABILIDAD
s,ACABEZAGIRATORIAPERMITEELPOSICIONAMIENTO
DIRECCIONAL
s"ASEMAGNÏTICASØLIDAPARAUNMONTAJESEGURO
s)NCLUYEPILAS!!!
ECF201A Linterna de aluminio
estilo policía–Blue-Point.
s,ALINTERNADEVATIOSCON,%$+%L
,%$,UXEONPRODUCELÞMENES
s#UERPODEALUMINIOEXTRUDIDODEGRADO
AEROESPACIAL
s4IEMPODEOPERACIØNPROMEDIODE
HORASENPILASALCALINAS$
NOINCLUIDAS
www.snapon.com/shoptools
ILUMINACIÓN
!CCESORIOSDELINTERNAS
ECFH1 Sostén de linternas
AA/AAA.
s,ABASEMAGNÏTICAOFRECEUN
SOSTÏNFIRMEDELASLINTERNAS
!!!!!
s,AJUNTADEBOLAPERMITEUNGIRO
DE°YUNPIVOTEDE°
s0ERMITEUBICARELHAZDELUZDE
LALINTERNASEGÞNSEANECESARIO
ECFH2 Sostén de linternas
con pilas D.
s,ABASEMAGNÏTICAOFRECEUN
SOSTÏNFIRMEDELASLINTERNASCON
PILAS$
s,AJUNTADEBOLAPERMITEUNGIRO
DE°YUNPIVOTEDE°
s0ERMITEUBICARELHAZDELUZDE
LALINTERNASEGÞNSEANECESARIO
ECFH3 Sostén de
linternas con pilas C.
s,ABASEMAGNÏTICAOFRECEUN
SOSTÏNFIRMEDELASLINTERNASCON
PILAS#CONUNANCHODE"A
"
s,AJUNTADEBOLAPERMITEUNGIRO
DE°YUNPIVOTEDE°
ECFH1
s0ERMITEUBICARELHAZDELUZDE
LALINTERNASEGÞNSEANECESARIO No se incluye la linterna.
ECFH3
,INTERNAS,UCESDEPUNTO,¶MPARASPARAUSOSMLTIPLESRECARGABLES
ECFSP30 Lámpara para
usos múltiples inalámbrica
con 30 LED.
ECFBP30 Lámpara
s,ACARGACOMPLETAOFRECEUNA
para usos múltiples
ECFBP30
OPERACIØNCONTINUADEHASTAHORAS
inalámbrica con LED–Blue-Point®.
s0OSICIONAMIENTOVERSÉTILDELALUZ
s,%$BLANDOSPARAOBTENERUNALUZBRILLANTE
GANCHOGIRATORIOAPOYARSEENEL
QUENOREFLEJE
PIEORECOSTARSE
s,%$DELARGAVIDAÞTILCONCAPACIDADDEHORASDEUSO
s"ATERÓADE.I-(DE6YM!H
s"ATERÓARECARGABLEDE.IMHDURANTEUNTIEMPODE
ENTRADADELCARGADORDE6#!
OPERACIØNAPROXIMADODEHORAS
s"ASTIDORRESISTENTEALOSIMPACTOS
s%LDISE×ODELGADOPERMITEACCEDERALUGARESDIFÓCILES
YLENTEDEPOLICARBONATOAPRUEBA
DEROTURAS
ECFSP30
ECFLED18 Luz plegable para
ECFLED215 Luz de taller recargable con 21
bolsillo con LED–Blue-Point.
LED–Blue-Point.
s,%$SÞPERBRILLANTES
s,UZDETALLERCOMPACTARECARGABLEEINALÉMBRICAQUEPUEDE
s0AQUETEDEBATERÓASRECARGABLES
LLEVARSEATODOSLADOS
DE.I-H
s,OS,%$DELANTEROSOFRECENGRANSALIDADELUZ
ALASSUPERFICIESDETRABAJO
s'ANCHOPLEGABLEPARAMAYOR
s,ALUZDE,%$BRINDAHASTAHORASDE
FLEXIBILIDAD
ILUMINACIØNCONTINUA
s4IEMPOAPROXIMADODEOPERACIØNDE ECFLED18
s%LINTERRUPTORMULTIFUNCIØNALTERNAENTRE
HORAS
ILUMINACIØNFRONTALYSUPERIORCON,%$
s%LDISE×ODEPLEGADOA°OFRECELOMÉS
MODERNOENPOSICIONAMIENTOFLEXIBLE
s$ISE×OMAGNÏTICODOBLEPARAUTILIZARENPARALELO
ECFLED215
OENMÞLTIPLESÉNGULOS
s)NCLUYECARGADORDE6#!YCARGADORDEAUTOMØVILDE6
ECFLED650 Luz de talles compacta recargable–Blue-Point.
s'ANCHOINCORPORADOYSOPORTEPARAUTILIZARLAENMUCHASPOSICIONES
ECF490
s'ANCHODECINTURØNINTEGRADO
s)NALÉMBRICAYRECARGABLEHASTAHORASDEUSOENTREUNACARGAY
LAOTRA
s,%$DEGRANSALIDAGENERANUNASALIDADELUZDE,UX
ECF490 Linterna recargable Xenon®
s%LREFLECTORDEPRECISIØNBRINDAUNASALIDADELUZENÉNGULOAMPLIO
–Blue-Point.
s,ENTESDEPOLICARBONATOCASIIRROMPIBLES
s&OCO8ENON6PARASALIDAMÉXIMADE
s%LDISE×OCOMPACTOSEAJUSTAALCAJØNMÉSESTRECHODELARMARIO
POTENCIA
ECFLED650
RODANTEPARAUNALMACENAMIENTOSEGURO
s)NTENSIDADDELUZEQUIVALENTEAUNALINTERNA
s3ERECARGAENELTALLEROELVEHÓCULOCONCARGADORESDE6#!Y
CONPILAS$
6##INCLUIDOS
ECFLED650-1 Adaptador de 110 VCA. !DAPTADORDE
s"OTØNDEENCENDIDOAPAGADOENLATAPA
6#!PARA%#&,%$
TRASERACONFUNCIØNDESE×ALSILENCIOSA
ECFLED650-2 Cargador de automóvil de 12 VCC.
s)NCLUYEBATERÓASRECARGABLESDE6Y
#ARGADORDEAUTOMØVILDE6##PARA%#&,%$
UNADAPTADORDE6#!
ECUB9500
ECUB9500 Luz inalámbrica
recargable con LED debajo del
capó–Blue-Point.
ECFDUX Xenon recargable–Blue-Point. ECFDUXLED Luz de punto
s,%$ULTRABRILLANTESBRINDANUNASALIDA
s,OSFOCOS8ENONCAMBIANFÉCILMENTEDEHAZ recargable con LED–Blue-Point.
DE,UXAM
s,OS,%$#REEDEGRANINTENSIDADPRODUCEN
SIMPLEADOBLEPARABRINDARMÉSINTENSIDAD
s3EEXTIENDEDEA"PARACUBRIRUNA
s#UERPODEPLÉSTICO!"3RESISTENTECONDISE×O HASTALÞMENES
AMPLIAGAMADEVEHÓCULOS
s!GARRESSOBREMOLDEADOSDESERVICIOPESADO
DEAGARRETIPOPISTOLAEQUILIBRADO
s,OSGANCHOSCUBIERTOSDEGOMAPROTEGEN
PARAUNMANEJOSEGURO
s0RÉCTICAMÏNSULADEMETALPARACOLGAR
LAPINTURA
s)NTERRUPTORDEENCENDIDOAPAGADODEGATILLO
ALMACENARs&UNCIONACONUNABATERÓADE
s,ABATERÓADEM!HBRINDAHORASDE
CONMECANISMODETRABALATERAL
PLOMOÉCIDODE6!H
SALIDADELUZCONSTANTE
s)NCLUYECARGADORESDE6#!Y6##
ECFDUX
ADVERTENCIA
ECFDUXLED
r.OQUITENIANULELACONEXI¥NATIERRAENCUALQUIERENCHUFEEL¯CTRICO
r,EALASPRECAUCIONESDESEGURIDADENLASP¶GINASA
497
ILUMINACIÓN
Lámparas para usos múltiples
De tubo único
ECU4250A Lámpara para usos múltiples fluorescente de 15W.
s5TILIZAUNFOCODETUBOFLUORESCENTEÞNICODE7%#5
s3EINCLUYEUNCABLEDEEXTENSIØNDEgDECONDUCTORES
s)NTEGRALALISTADE5,#5,
ECU415BK Lámpara para usos múltiples fluorescente de 15W.
s5TILIZAUNFOCODETUBOFLUORESCENTEÞNICODE7%#5!
s-ATERIALDEALTOIMPACTOENLAEMPU×ADURAYENLATAPASUPERIOR
PARAMAYORDURABILIDAD
s,ARGODELCABLE'
ECU444AKT Luz para usos múltiples debajo del capó.
s3EAJUSTAAANCHOSDECAPØDE"A"
s5TILIZAUNÞNICOTUVOFLUORESCENTEDE7%#5
s,OSGANCHOSACOLCHONADOSPREVIENENDA×OSALCAPØ
s%LCABLEDEgESFLEXIBLEYRESISTENTEALACEITEYALAGUA
ECU4250A
ECU415BK
ECU444AKT
Especificaciones de tubo único
Pieza No.
ECU4250A
ECU415BK
ECU444AKT
Estilo de
lámpara
Voltaje
Tipo de foco
Vatiaje
delfoco
Largo foco,
pulgadas
Tipo cable
Largo cable,
pies
Tubular
Tubular
Tubular
120 VCA
120 VCA
120 VCA
Único
Único
Único
15
15
15
17 3/4
17
41
18/2 SJTOW
18/2 SJTOW
18/2 SJTOW
25
25
25
Foco de
repuesto
ECU42501
ECU250A17
ECU4443A
Largo total,
pulgadas
23
25
44 1/4
ECU4425A (25')
ECU4450A (50')
Tubo doble
ECU350BK (50')
ECU325BK (25')
ECU4325A
ECU325BK Lámpara para usos múltiples fluorescente
compacta de 13W.
s-ATERIALDEALTOIMPACTOENLAEMPU×ADURAYENLATAPASUPERIOR
PARAMAYORDURABILIDAD
s%LDIFUSOREXTIENDEDEMANERAØPTIMALATRANSMISIØNDELUZ
s'ANCHOMETÉLICOPARACOLGARPARAMAYORFLEXIBILIDAD
ECU350BK Lámpara para usos múltiples fluorescente
compacta de 13W.
s-ATERIALDEALTOIMPACTOENLAEMPU×ADURAYENLATAPASUPERIOR
PARAMAYORDURABILIDAD
s%LDIFUSOREXTIENDEDEMANERAØPTIMALATRANSMISIØNDELUZ
s'ANCHOMETÉLICOPARACOLGARPARAMAYORFLEXIBILIDAD
ECU4325A Lámpara para usos múltiples compacta
fluorescente de 13W.
s%LINTERRUPTORDEENCENDIDOAPAGADOINSTANTÉNEOBRINDAhLUZAPEDIDOv
s0ORTÉTILCONGANCHOSPARACOLGAR
s)NTEGRALALISTADE5,#5,
ECU4425A Fluorescente de 13W con cabeza en ángulo.
s%LDISE×OENÉNGULOMEJORALAILUMINACIØNENÉREASESTRECHAS
s&OCODEENCENDIDOINSTANTÉNEOPARACLIMASFRÓOS
s%LCABLEDEgDEPRIMERACALIDADPARATEMPERATURASBAJOCERO
MANTIENESUFLEXIBILIDADA
s4OMACORRIENTEDEAMPENLAEMPU×ADURA
Especificaciones de tubo doble y cuádruple
Pieza No.
ECU325BK
ECU350BK
ECU4325A
ECU4425A
ECU425ABK
ECU4450A
ECU4000
498
ECU425ABK
ECU4450A Fluorescente de 13 W con cabeza en ángulo.
s%LDISE×OENÉNGULOMEJORALAILUMINACIØNENÉREASESTRECHAS
s&OCODEENCENDIDOINSTANTÉNEOPARACLIMASFRÓOS
s%LCABLEDEgDEPRIMERACALIDADPARATEMPERATURASBAJOCERO
MANTIENESUFLEXIBILIDADA
s4OMACORRIENTEDEAMPENLAEMPU×ADURA
ECU425ABK Fluorescente de 13 W con cabeza en ángulo
s%LBASTIDORYLOSLENTESESTÉNFABRICADOSCONMATERIALESRESISTENTES
ALOSIMPACTOS
s'ANCHOMETÉLICOPARACOLGARCONTRINQUETEPARAUNAMEJORPOSICIØN
s%LCABLEDEgPARACLIMASFRÓOSESFLEXIBLEAESRESISTENTEA
LOSPRODUCTOSQUÓMICOSYLASABRASIONES
s5TILIZAUNFOCODESERVICIOPESADO%#5
ECU325-4 Foco de servicio pesado.
s#OMPONENTESINTERNOSDELABASECONPROTECCIØNDESILICIOPARA
PROLONGARLAVIDAÞTILDELARRANCADOR
s$URACIØNSUPERIORENCONDICIONESSEVERAS
s3EAJUSTAALAMAYORÓADELASLÉMPARASFLUORESCENTESDE7CON
TUBODOBLE
Estilo de
lámpara
Voltaje
Tipo de foco
Vatiaje del
foco
Largo foco,
pulgadas
Tipo cable
Largo cable,
pies
Tubular
Tubular
Tubular
Cabeza en ángulo
Cabeza en ángulo
Cabeza en ángulo
Cabeza plana
120 VCA
120 VCA
120 VCA
120 VCA
120 VCA
120 VCA
120 VCA
Doble
Doble
Doble
Doble
Doble
Doble
Cuad
13
13
13
13
13
13
26
7
7
7
7 1/4
7
7
7
18/2 SJTOW
18/2 SJTOW
18/2 SJTOW
16/3 SJEOW
16/3 SJOW
16/3 SJTOW
16/3 SJTOW
25
50
25
25
25
50
25
www.snapon.com/shoptools
Foco de
repuesto
ECU325-4
ECU325-4
ECU43251A
ECU43251A
ECU325-4
ECU43251A
ECU43251A
Largo total,
pulgadas
13
13
12 1/2
16
14
16
16
ILUMINACIÓN
D~ehYjYkhYjYmkgkedlahd]k
;mYljglmZgkECU4000 Luz doble de servicios múltiples.
s&OCOFLUORESCENTEDEAMP7YTUBOSPARAUNAALTA
INTENSIDADDELALUZDECUATROTUBOS
s%MPU×ADURACØMODAYSEGURACONINTERRUPTORMANUAL
s3ALIDACONCONEXIØNATIERRAENLABASEDELAEMPU×ADURA
s#ABLEDE'INTEGRALALISTADE5,#5,
s5TILIZAELFOCODEREEMPLAZO%#5!
ECU43251A Foco de reemplazo.
s&OCOCONTUBODOBLEDE7SINCENTELLEOPARATEMPERATURASBAJAS
ECU4000
ECU43251A
ECUR4500A
ECUR2450A
ECURO2350A
D~ehYjYkhYjYmkgkedlahd]klahg[Yjj]l]d
ECUR4500A Lámpara tipo carretel de 15W de
servicio pesado.
s%LCARRETELCONCABLESEMONTAALAPAREDOALTECHO
s'ANCHOGIRATORIOA°MÉSGANCHOSHORIZONTALESPARAMAYOR
FLEXIBILIDAD
s"DELARGOCONJUNTODELTUBOYBASTIDORRESISTENTESALOSIMPACTOS
s)NTEGRALALISTA5,#5,
ECUR2450A Luz de cabeza en ángulo tipo carretel
para servicio pesado.
s,UZFLUORESCENTEDE7ENCARRETELDE'
s4OMACORRIENTEDEPATASAMPENLAEMPU×ADURA
s'ANCHOGIRATORIODE°ENLALÉMPARA
s)NTEGRALALISTA5,#5,
ECURO2350A Luz tipo carretel para servicio pesado
de 13 W.
s$ISE×OCOMPACTODEDOSTUBOSDE7
s%LCARRETELCONCABLESEMONTAALAPAREDOALTECHO
s%LINTERRUPTORAUTOMÉTICOACTIVALALÉMPARACUANDOSEEXTIENDEEL
CABLELADESACTIVACUANDOSELORETRAE
s)NTEGRALALISTA5,#5,
ECRB4430 Lámpara tipo carretel incandescente.
s,ÉMPARAINCANDESCENTEDE7CONCARRETELDEg
ECRB4430
ECUR4000
s4OPEDECABLEAJUSTABLEPARAMAYORCOMODIDAD
s4OMACORRIENTESDEPATASCONCONEXIØNATIERRAPARAUNAFUENTEDE
ENERGÓAAUXILIAR
ECUR4000 Lámpara tipo carretel fluorescente de 26 W.
s,ÉMPARAFLUORESCENTEDEDOSTUBOSDE7ENCARRETELDECABLE
DE'
s4OMACORRIENTEDEAMPENLAEMPU×ADURA
s'ANCHOGIRATORIODE°PARACOLGARCONACCIØNDETRINQUETEPARA
UTILIZARENMÞLTIPLESLUGARES
s)NTEGRALALISTADE5,#5,
=kh][a^a[Y[agf]k\]dlahg[Yjj]l]d
Pieza No.
ECUR4500A
ECUR2450A
ECURO2350A
ECRB4430
ECUR4000
Estilo de
lámpara
Voltaje
Tipo de foco
Vatiaje
foco
Largo
foco,
pulgadas
Tipo cable
Largo
cable,
pies
Largo de cable
de toma, pies
Tubular
Cabeza en ángulo
Tubular
Protector metálico
incandescente
Doble (2 focos)
120 VCA
120 VCA
120 VCA
Único
Doble
Doble
15
13
13
17 3/4
7
7
16/3 SJTOW
16/3 SJTOW
16/3 SJTOW
50
50
50
2
2
2
ECU42501
ECU43251A
ECU43251A
120 VCA
Incandescente
75 máx.
—
16/3 SVT
30
2
—
12
120 VCA
Doble
26
7
16/3 SJTOW
50
2
ECU43251A
16
ADVERTENCIA
Fgimal]faYfmd]dY[gf]pafYla]jjY]f[mYdima]j]f[`m^]]d[lja[g
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
Foco derepuesto
Largo
total,
pulgadas
23
16
12 1/2
499
ILUMINACIÓN
Lámparas para usos múltiples
ECU4007
Lámpara fluorescente para usos múltiples
ECU300
ECU4007 Lámpara para usos múltiples de tubo doble.
s,ÉMPARAFLUORESCENTEDE7CONTUBODOBLECONCUALQUIERCABLE
DEEXTENSIØNESTÉNDAR
s'ANCHOGIRATORIODE°PARATENERFLEXIBILIDADALCOLGAR
s%LFOCODEREEMPLAZOES%#5!
ECU44255A
Accesorios de las lámparas para usos múltiples
ECU300 Grampa magnética de lámpara para usos múltiples.
s'RAMPAEXPANDIBLESOBREUNABASEMAGNÏTICA
s0UEDEUTILIZARSECONMUCHASLÉMPARASFLUORESCENTESPARAUSOS
MÞLTIPLESOLINTERNASCONPILASh$v
ECU44255A Grampa magnética de lámpara para usos múltiples.
s'RAMPAEXPANDIBLESOBREUNABASEMAGNÏTICA
s0UEDEUTILIZARSECONMUCHASLÉMPARASFLUORESCENTESPARAUSOSMÞLTIPLES
Cables de extensión y carretel
EC268D
ECR4300A
ECRB4300
EC267D
Tiras y carreteles de tomas múltiplesECR4300A
Carretel de cable de tomas múltiples de 50'.
s#ARRETELDEMONTAJEENPAREDOTECHOCONMÏNSULAGIRATORIAA°
s%LCABLEDEALIMENTACIØNDEgTIENETRESTOMACORRIENTESCON
CONEXIØNATIERRA
s)NCLUYEACCESORIOSPARAMONTAJE
ECRB4300 Carretel de cable de tomas múltiples de
30'–Blue-Point.
s#ARRETELDEMONTAJEENPAREDOTECHOCONMÏNSULAGIRATORIAA
s%LCABLEDEALIMENTACIØNDEgTIENETRESTOMACORRIENTESCON
CONEXIØNATIERRA
s)NCLUYEACCESORIOSPARAMONTAJE
Cables de extensión–Blue-Point®
EC267D Cable de extensión.
s%LCABLE3*47CALIBREDEgMANTIENESUFLEXIBILIDADEN
CLIMASFRÓOS
s2ESISTENTEALOSGOLPESYALAGUA
EC268D Cable de extensión.
s%LCABLE3*47CALIBREDEgMANTIENESUFLEXIBILIDADEN
CLIMASFRÓOS
s2ESISTENTEALOSGOLPESYALAGUA
Lámparas flexibles/Lupas
ECF1600
YA5100B
Lámparas flexibles–Blue-Point
ECF1600 Lámpara doblable.
s%JEFLEXIBLEDE"CONLÉMPARADEGRANINTENSIDAD
s%MPU×ADURADEBARRILEINTERRUPTORDESERVICIOPESADO
s)NCLUYEPILAS!!
YA5100B Lámpara doblable.
s%JEFLEXIBLEDE"CONCUBIERTADEEXTENSIØNDE"PARALOGRARUN
MAYORALCANCE
s,ALÉMPARADECRIPTØNBRILLANTEFUNCIONACONPILAS!!
YA5100-2 Foco de linterna.
s&OCODEREPUESTOPARA9!"
YA5100B-1 Interruptor de linterna.
s)NTERRUPTORDEREPUESTOPARA9!"
500
YA537
Lupa
YA537 Lupa de bolsillo.
s,ALUPAPLEGABLEINCLUYEDOSLENTESDEXPARALOGRARUNEFECTO
COMBINADODEX
www.snapon.com/shoptools
EQUIPOS DE TALLER
Simplificación de los trabajos complejos.
EYfl]faea]flg\]Èma\gk -(*
Snap-on es conocido por la innovación. Usted lo encontrará en
todas las selecciones de equipos de taller. Si se trata de reducir el
tiempo que lleva cambiar un buje o cambiar su manera de pensar
acerca de trabajos de carrocería, Snap-on simplifica el trabajo.
DmZja[Y[af -(.
Mantenimiento implica el ingreso
de oportunidades para propietarios
de talleres.
Servicio de motor
510
Válvula
517
;adaf\jg -*(
Daeha]rY\]dkakl]eY\][geZmklaZd]2=d\af]jgafn]jla\g]fdgk
sistemas de servicio de combustible completamente automáticos
sumamente eficiente se recupera en tan solo tres meses.
EYfl]faea]flg\]dima\g\]^j]fg$\]ljYfkeakafq\]\aj][[af Ykakla\Y2EYfl]f_Ydgkn]`[mdgk\]kmk[da]fl]k]f^mf[agfYea]flg
qkme]ghgjlmfa\Y\]k\]af_j]kgkhYjYkmlYdd]j&
=imahg\][`gjjgYZjYkang2=imahg\][`gjjgÇbgqhgjl~lad
\ak]Y\ghYjYeYf]bYjmfYYehdaY_YeY\]ljYZYbgk&<]k\]
mfa\Y\]keYfmYd]k`YklYYjeYjagk\]lYeYgaf\mkljaYd$
KfYh%gfla]f]dgim]kmlYdd]jf][]kalYhYjYÇfYdarYj]dljYZYbg& Dgk]d]e]flgk^mf\Ye]flYd]k2HYjY[gfkljmaj]df]_g[ag$f][]kalY
dYZYk]&DYk;YeaddYk$dgk[gehj]kgj]k\]Yaj]$dgkdima\gk$dgk
bm]_gk\]dmZja[Y[afq[YdaZjY\gj]kkgfmfZm]f[gea]frg&
Haklf -*)
:mb]k'BmflYk -**
;mZa]jlYk\]_mYj\YZYjjgk -*;YeaddYk -*.
E]\a[af -*0
=kh]bgkq`]jjYea]flYk\]]f_Yf[`] -+,
>j]fgk -+.
;Yjjg[]jY -,-
Jg[aY\g\]haflmjY --.
Kakl]eYk\][`gjjgYZjYkang --1
Hj]fkYk\]ZYf[g'?jYehYk; -.*
:Yf[gk\]ljYZYbg -.,
Hj]fkYk -.-
;gehj]kgj]k\]Yaj] -./
501
MANTENIMIENTO DE FLUIDOS
Equipo de servicio de transferencia de fluidos
EETF303B
EETF304B
Intercambiadores de líquidos de transmisión de
servicio pesado
EETF303B/304B Intercambiadores de líquidos de
transmisión de servicio pesado. Reemplaza el líquido de
transmisión automática con rapidez, seguridad y facilidad. EETF303B
cuenta con reemplazo total de líquido y ofrece la más avanzada tecnología
de intercambio de líquidos disponible. La capacidad del tanque es de
40 cuartos de galón, mientras que un pequeño pie conserva un valioso
espacio de taller. EETF304A lleva a cabo el intercambio tanto del líquido
de transmisión como del de dirección asistida.
EETF303B y 304B, características:
sIntercambio de líquido de ATF completo (prácticamente el 100%) en 8
minutos o menos utilizando mangueras específicas adaptadoras de vehículos
s,OSADAPTADORESFÉCILESDEUTILIZARPERMITENUNACONEXIØNRÉPIDAA
prácticamente cualquier marca y modelo de automóvil
sCapacidad de servicio pesado, con el agregado del Juego de
mangueras de transmisión para camiones de servicio mediano Allison
s3ECONECTADIRECTAMENTEALASLÓNEASDEENFRIAMIENTODETRANSMISIØN
sin dejar caer el contenedor de transmisión
s3EGUROLIMPIOFÉCILRÉPIDONOSEREQUIEREPOZOELEVADORNIRAMPA
s%LLÓQUIDODEDESECHOSEDRENATOCANDOUNBOTØN
SOPORTE TÉCNICO
1-800-303-5874
Accesorios del intercambiador de líquido de transmisión
Se incluye con EETF303B, EETF304B, EETF306A:
NOR940328 Adaptador para 1/2".
NOR940329 Adaptador de 3/8".NOR940334 Adaptador de
5/16".NOR940831 Conector de manguera maestro. – 2
por unidadNOR940837 Tubo PSX de 12" con boquilla de
aire. Manguera estándar con adaptador para Toyota, Nissan, Honda, Ford
y Chrysler modelos 1975 y más nuevos. Se incluye sólo con EETF304B.
NOR940874 M14 Accesorio tipo banjo. Manguera estándar
con adaptador para Ford Escort modelo 1984 y más nuevos.
NOR940875 Perno de M14 x 1.5 con 2 arandelas. Manguera
estándar con adaptador para Ford Escort modelo 1984 y más nuevos.
NOR941801 Unión giratoria abocardada, 5/8" - 18 SAE, 45˚.
Manguera estándar con adaptador para Chrysler modelo 1993 y más nuevos.
NOR941802 Abocardada, 5/8" - 18 SAE, 45˚. Manguera
estándar con adaptador para Chrysler.
NOR941803 Unión giratoria abocardada, 5/8" - 18 SAE, 45˚.
Manguera estándar con adaptador para todos los GM con líneas de 3/8"
de diámetro.
NOR941805 Manguera de extremo abierto con
abrazadera, 3/8" de diámetro.Manguera estándar con
adaptador para importaciones modelo 1987 y más nuevas.
NOR941807 Unión giratoria abocardada invertida, 5/8"
- 18 SAE, 45˚. Manguera estándar con adaptador para GM modelo
1997 y más nuevos con líneas de 3/8" de diámetro.
NOR941809 Manguera de extremo abierto con
abrazadera, 1/2" de diámetro.Manguera estándar con
adaptador para importaciones.
NOR941813 Manguera de extremo abierto con
abrazadera, 5/16" de diámetro. Manguera estándar con
adaptador para importaciones.
502
EETF306A
EETF304B Características para la dirección asistida:
sReemplaza hasta el 95% del líquido de dirección asistida viejo en minutos
sLas mangueras de servicio utilizan el depósito del vehículo para drenar y
recargar el líquido de la dirección asistida para un servicio eficiente
s%LCOLGANTEREMOTOFACILITALAOPERACIØNPARAUNAMAYOREFECTIVIDAD
s%LCOMPARTIMIENTOPARALABOTELLADELÓQUIDONUEVOFACILITAEL
intercambio de líquidos y lo hace práctico
s%LLÓQUIDOVIEJOSEESCURREDIRECTAMENTEENELTANQUEDEDESECHOS
para no ensuciar y facilitar la limpieza
EETF306A, características:
s4ECNOLOGÓADEMEDICIØNELECTRØNICA
s#APACIDADPARASELECCIONARCUALQUIERCANTIDADDEINTERCAMBIODE
líquidos de 1 a 35 cuartos
sIntercambio de líquidos de transmisión multifunción en línea o a
través del tubo de medición
sEl panel de control de LCD completamente interactivo elimina las conjeturas
s3UGERENCIASDEPANTALLAFÉCILESDESEGUIR
sBomba grande de 2.5 GPM que puede manipular desde vehículos de
flujo bajo a camiones y autobuses
s#ARACTERÓSTICASDE!'2%'!2Y2%-/6%2LÓQUIDO
sIndicador CAMBIAR MANGUERAS y la capacidad de cambiar la
dirección del flujo con sólo pulsar un botón
s4OTALIZADORDELÓQUIDO
s-EMORIADEPÏRDIDADEALIMENTACIØN
s&UNCIØNDEPAUSAMÉSVOLTÓMETRO
NOR941815 1/4"-18 NPTF. Manguera estándar con adaptador
para Jeep Cherokee modelos 1980-1986.
NOR941816 Invertida, 1/2" - 20 SAE, 45˚. Manguera
estándar con adaptador para Chrysler, Ford Aerostar, Jaguar, Mercedes
y Cadillac modelos 1985 y más nuevos.
NOR941817 Invertida, 1/2" - 20 SAE, 45˚. Manguera
estándar con adaptador para Chrysler y Ford.
NOR941818 Unión giratoria invertida, 5/8" - 18 SAE.
Manguera estándar con adaptador para Ford modelo 1980 y más
nuevo con tuerca grande.
NOR941819 Invertido, 5/8" - 18 SAE. Manguera estándar
con adaptador para Ford.
NOR941820 Unión giratoria invertida, 1/2" - 20 SAE,
90˚. Manguera estándar con adaptador para GM con líneas de 3/8"
de diámetro.
NOR941821 Invertido, 1/2" - 20 SAE. Manguera estándar con
adaptador para GM.
NOR941822 Invertido, 1/2" - 20 SAE. Manguera estándar
con adaptador para Ford.
NOR941823 Unión giratoria invertida, 1/2" - 20 SAE,
90˚. Manguera estándar con adaptador para tuercas pequeñas/
grandes de 5/16" de Ford: 1980 y más nuevos.
NOR941825 Anillo "O" giratorio, M14 x 1.5. Manguera estándar
con adaptador para Jeep Cherokee modelos 1980-1986 Ford Escort.
NOR941828 Accesorio con tope universal de 1/4".
Manguera estándar con adaptador para importaciones.
NOR941829 Manguera de extremo abierto con
abrazadera, 1/4" de diámetro. Manguera estándar con
adaptador para importaciones.
www.snapon.com/shoptools
MANTENIMIENTO DE FLUIDOS
=imahg\]k]jna[ag\]ljYfk^]j]f[aY\]Èma\gk
9[[]kgjagk\]dafl]j[YeZaY\gj\]dima\g\]ljYfkeakaf&
NOR941830 Accesorio con tope universal de 5/16".
Manguera estándar con adaptador para Infiniti, Lexus y BMW modelos
YMÉSNUEVOS
NOR941831 Accesorio con tope universal de 3/8".
-ANGUERAESTÉNDARCONADAPTADORPARA4OYOTA.ISSAN(ONDA&ORDY
#HRYSLERMODELOSYMÉSNUEVOS
NOR941832 Accesorio con tope universal de 1/2".
-ANGUERAESTÉNDARCONADAPTADORPARA4OYOTA.ISSAN(ONDA&ORDY
#HRYSLERMODELOSYMÉSNUEVOS
NOR941835 Abocardada invertida, 9/16" - 18 JIC, 37˚.
Manguera estándar con adaptador para Dodge Durango/Dakota TODOSLOSA×OS
NOR941836 Unión giratoria invertida, 9/16" - 18 JIC,
37˚. Manguera estándar con adaptador para Dodge Durango/Dakota TODOSLOSA×OS
NOR941841 Anillo "O" macho Duramax/Allison.
NOR941842 Anillo "O" hembra Duramax/Allison.
NOR942162 Herramienta de desconexión rápida.
NOR942163S Adaptador para GM.NOR940388 Macho
18 de 3/4".NOR940389 Hembra 18 de 3/4".
NOR941900 Extremo abierto de 5/8".NOR941899
Adaptador de 5/8".NOR941910 Adaptador de 3/8"
para Ford.NOR942169 Adaptador de 3/8" para
GM.NOR941080 – Hembra de manguera N. ° 93 para
Ford Focus/Mercury Mystique.
NOR941081 – Macho de manguera N.° 94 Ford Focus/
Mercury Mystique .
NOR940922 – Se incluye el imán de dársena sólo con
EETF304B.
NOR941178 – Se incluye un adaptador Y PSX sólo con
EETF304B.
NOR941923 Ford F150 de 1/2 ton.
NOR941925 Ford Focus.
Juegos y accesorios de adaptadores opcionales:
NOR941168S Juego de mangueras para camiones de
servicio mediano Allison.
NOR941220 Juego de soportes para montaje de
manguera en pared.NOR940872 Juego de filtro/folleto.
NOR942165 Accesorio tipo escalón.
EEBR311A
BrakeKare™
EETF305A
SOPORTE TÉCNICO
TransKare™
SOPORTE TÉCNICO
1-877-906-1395
Afl]j[YeZaY\gj]k\]dima\gk\]ljYfkeakaf
EETF305A Intercambiador AFT TransKare 1. Lleve el
servicio de transmisión a un nuevo nivel de velocidad, simplicidad,
productividad y rentabilidad. Ahora se puede realizar un cambio completo
de transmisión de vehículo rápidamente a través del tubo medición de
nivel, sin entrar en las líneas de enfriamiento, conectar adaptadores, etc.
Sin experiencia técnica, grúas ni herramientas y no ensucia. El sistema
TransKare también ofrece la mejor manera de drenar el contenedor antes
de los reemplazos de filtro y junta o las reparaciones internas.
sRealiza un cambio de ATF, drena el contenedor de transmisión,
y/o llena por completo los niveles de ATF en los vehículos con una
varilla de medición de nivel de transmisión
sEl índice de flujo alto permite la mayoría de los cambios de líquido
de transmisión automáticos a través del tubo de medición de nivel
en 10 minutos utilizando la varilla de medición
sPanel de control intuitivo, controlado por microprocesador con
operación guiada paso por paso
sEl LED brillante de 7 segmentos muestra la función, el volumen de líquido
de entrada y salida, el avance progresivo del proceso y la cuenta de servicio
s6##SEPUEDEUTILIZARALEJADODELÉREADESERVICIO
s'RANMOVILIDADDISE×OCOMPACTOPERORESISTENTE
s.UEVODEPØSITODE!4&CONMEDIDORALAVISTAFÉCILMENTEVISIBLE
sMANGUERAS(YTRONEXTERNASDEgREFORZADASCONNILØN
ADVERTENCIA
E~imafY\]hmj_Y\g\]^j]fgk
1-800-393-1272
EEBR311A Sistema de purgado de frenos BrakeKare.
Un método seguro, fácil, rápido y completo para mantener los
sistemas de frenos hidráulicos. Automáticamente:
sExtrae el líquido de frenos de desecho
sLimpia, purga y recarga el sistema con líquido nuevo
sPurga el sistema de frenos de automóviles
.OSENECESITANINGUNAEXPERIENCIATÏCNICASEREQUIEREPOCOTIEMPODETÏCNICOYNO
ensucia. El BrakeKare System ofrece un servicio adicional rentable para trabajos de frenos,
cambios de aceite, afinaciones, reparaciones en general o mantenimiento programado.
sServicio integral del sistema de frenos hidráulicos; limpieza y
DIAGNØSTICOENAMINUTOS
sLas tiras de prueba le ofrecen al técnico indicadores visuales de la
condición del sistema de frenos
s%XTRAEELLÓQUIDODEFRENOSVIEJOYLODESECHAENUNRECIPIENTEPARA
desechos interno
sReduce la posibilidad de que el técnico entre en contacto con el
líquido contaminado
s.IVELAELSISTEMACONPRESIØNPULSÉTILENELDEPØSITODECILINDRO
maestro y vacío en los 4 purgadores a la vez
s3ERECARGACONLÓQUIDONUEVOYPURGAELSISTEMA
s4AMBIÏNSEPUEDEUTILIZARPARAELSERVICIO de nivelación de
embrague hidráulico
s0ANELDECONTROLELECTRØNICOPASOAPASOPARAFACILITARLAOPERACIØN
sSe conecta al cilindro maestro del vehículo a través de los
adaptadores de depósito
sRestaura la presión de pedal suave, reduce la corrosión de componentes
internos de freno y mejora la seguridad del sistema de freno
D]Yqka_Ylg\gkdgke]fkYb]k]afkljm[[agf]k\]k]_mja\Y\
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
503
MANTENIMIENTO DE FLUIDOS
%QUIPODESERVICIODETRANSFERENCIADElUIDOS
FuelKare™ Sistema de servicio de combustible
EEFS305A FuelKare Sistema de servicio de
combustible.
El sistema FuelKare de Snap-on limpia por impulsos el riel de
combustible y las líneas de combustible; remueve la acumulación
de carbón blando en la cámara de combustión, los pasajes de
inducción, en las válvulas de entrada y en el múltiple de entrada. Un
proceso de 2 etapas (con el motor apagado, con el motor encendido)
asegura una limpieza completa y efectiva. El resultado es un
desempeño del motor restablecido, una reducción en las emisiones
del vehículo y una reducción del consumo de combustible. El sistema
FuelKare también soluciona automáticamente los problemas de los
componentes del sistema de combustible antes de comenzar el
servicio. Totalmente portátil, funciona a 12 VCC.
®
SOPORTE TÉCNICO
1-877-906-1395
s Opciones de servicio rápido de 1 ó 2 líneas
s Controles intuitivos totalmente electrónicos con secuencia paso a paso
s Funciones de diagnóstico controladas electrónicamente para
controlar el índice de flujo, la presión de contrapunto, la presión de
trabajo y las filtraciones
s El juego de adaptadores estándar sirve para más del 90% de los
automóviles y camiones livianos nacionales e importados
s El juego de adaptadores de lujo ofrece cobertura extendida para
aplicaciones menos comunes/más complejas
sUtiliza el sistema de filtración interna y una mezcla de combustible
y solución limpiadora del sistema de combustible de Snap-on que
circula a través del circuito de combustible para ablandar, disolver
y extraer los depósitos y contaminantes acumulados
EEFS305A
FuelKare
EEFS305ACV Cubierta de nilón. Para EEFS305A FuelKare
Sistema de servicio de combustible.
EEFS308A5. Paquete de filtros de repuesto.
AEC061004011. (4) botellas de 1 litro de solución limpiadora del
sistema de combustible.
AEC060812011. (12) botellas de 8 onzas de fluido limpiador de
sistema de combustible para EEFS305A.
SOPORTE TÉCNICO
1-877-776-8486
EEFS505A
EEFS505012
EEFS304AC4
Mantenimiento del sistema de combustible
EEFS505A Descarbonizador del sistema de
combustible–Blue-Point®. Limpia el riel de combustible, los
inyectores, la cámara de combustión y las válvulas de entrada. El
CD de aplicación de vehículos cubre vehículos desde 1987 a 2006
e identifica adaptadores adecuados, ubicación de conexiones y
procedimientos de apagado de la bomba de combustible. Incluye el
juego de adaptadores para todos los vehículos populares. Ninguna
mezcla de limpiador de sistema de combustible elimina la exposición
del técnico a los químicos. Indicador LED de finalización de servicio
y alarma sonora. Requiere el fluido limpiador de sistema de
combustible EEFS505012 (que se vende por separado).
EEFS505012 Fluido limpiador del sistema de
combustible–Blue-Point (12) latas de 17 onzas de fluido
limpiador de sistema de combustible para EEFS505A.
504
EEFS106AC2
EEFS304AC4 Limpiador para motor. Se utiliza como
limpiador para todas las piezas, como limpiador de motor superior y
en máquinas de limpieza. Remueve carbón, suciedad, goma y barniz
que son dañinos para los componentes importantes del motor. La
solución a base detergente no es perjudicial para los componentes
importantes del motor. Caja de botellas de 32 onzas. Para utilizar con
el equipo descarbonizador de la serie EEFS100.
EEFS106AC2 Detergente para motor diesel. Detergente
profesional para limpiar motores diesel. (4) botellas de 32 onzas.
Se utiliza para remover contaminantes del motor y del sistema
de combustible. Incluye 6 unidades de limpiador de tres etapas.
Cada unidad está compuesta por 1 botella de limpiador de toma
de aire, 1 botella de removedor de carbón del motor y 1 botella de
acondicionador de combustible. Para utilizar con la serie EEFS103 de
equipo descarbonizador de afinación diesel.
www.snapon.com/shoptools
MANTENIMIENTO DE FLUIDOS
%QUIPODESERVICIODETRANSFERENCIADEFLUIDOS
)NTERCAMBIADORDEL«QUIDOREFRIGERANTE
EESE336A Sistema de intercambio de líquido
refrigerante.
Rápido y sencillo reemplazo del líquido refrigerante de motor sin
ensuciar. Extrae y recarga el líquido refrigerante de motor y prueba
la presión del sistema de enfriamiento, sin que el motor del vehículo
esté en marcha. Una sola válvula maestra controla las funciones
de drenaje, prueba, vacío y recarga. Se conecta a la manguera del
radiador superior mediante los adaptadores de manguera.
sProceso de drenaje y llenado eléctrico completo en menos de 8 minutos
s0RUEBASDEPRESIØNDETAPADELRADIADORYPÏRDIDASDELSISTEMA
sDos tanques de almacenamiento de 32 cuartos de galón con calibradores
s#ALIBRADORDEPRESIØNVACÓODELSISTEMA
s&UNCIONACONAIRECOMPRIMIDO
Incluye:
s#ONJUNTODEVARILLADESUCCIØN
s#ONJUNTOSDEADAPTADORESDERADIADOR
s0INZASPARAESTRANGULARMANGUERASPEQUE×ASMEDIANASGRANDES
EESE336A
s-ANGUERASDEGOMAPARALÓQUIDOREFRIGERANTE$)$)
SS2196B
Sistema de intercambio de
$)$)
líquido refrigerante
Especificaciones:
Accesorios opcionales:
s#ALIBRADORDEPRESIØNVACÓOPULG('APSI
EAK0239L01B. Juego de recicladores opcional
s4EMPERATURADEOPERACIØN˚HASTA˚&˚HASTA˚#
s4EMPERATURADEALMACENAMIENTO˚HASTA˚&˚HASTA˚# SS2196B Juego Point-of-Purchase de
intercambiador de líquido refrigerante.
s$IMENSIONES!LTOX!NCHOX0ROFUNDIDAD
%LJUEGO0OINTOF0URCHASEDEINTERCAMBIADORDELÓQUIDO
s0OTENCIAPSIMÉXAIRECOMPRIMIDODELTALLER
REFRIGERANTECONTIENEUNATARJETADEMUESTRADEFOLLETO
s0ESOLBKG
folletos de servicio para colocar en la pared y la bandera de
intercambio de líquido refrigerante.
#ARGADORDEVAC«ODELSISTEMADE
ENFRIAMIENTOm"LUE0OINT®
RADPLUSA Intercambiador de líquido
refrigerante.
s6ACÓACARGASISTEMASDEENFRIAMIENTOYREALIZAPRUEBAS
de pérdidas en minutos
sSe conecta a la mayoría de los sistemas de
VAC201
VAC300
enfriamiento del motor en el cuello de llenado del
radiador o el depósito
%XTRACTORESDEFLUIDOSYBOMBASDETRANSFERENCIA
sEvita la necesidad de cortar la manguera del calentador
Extrae fácilmente el aceite de motor, de engranajes y transmisión, el
líquido refrigerante y el líquido de frenos. La unidad crea vacío, ofreciendo o desconectar la manguera del radiador: evacua la
mayoría de los sistemas en menos de 3 minutos
un modo limpio, rápido y simple de eliminar o administrar una amplia
s2ECARGALAMAYORÓADELOSSISTEMASENSEGUNDOS
gama de fluidos. El cierre automático de 8 litros evita el derrame.
s!LMACENAELREFRIGERANTEUSADOENUNDEPØSITOGRANDE
#APACIDADTOTALDEGALONESLITROS,AESTRUCTURADEPOLIETILENO
DEGALONESLITROSPARAMAYORSEGURIDAD
duradero es impermeable a los químicos del hogar y el automóvil.
s%VACUAELSISTEMADEENFRIAMIENTOCONELVACÓO
VAC201 Extractor/Dispensador manual de fluidos.
generado por el aire del taller
s.OSEREQUIEREELECTRICIDADNIAIRECOMPRIMIDO
RADPLUSA
s,ABASESØLIDACONBOMBAEXTERIORAYUDAAEVITARQUESECAIGA
s%LSISTEMACOMPLETOINCLUYEELEXTRACTORDEFLUIDOSMANUALEL
MONTAJEDEMANGUERAPRINCIPAL$)XLARGOMÉSTUBOS FLUIDPUMP Bomba de
rígidos de medición de nivel para la extracción de aceite del motor transferencia de fluidos.
s4RANSFIEREDESVÓATODOSLOSTIPOSDEFLUIDOS
$)XY$)X
incluyendo líquidos refrigerantes, aceite,
VAC300 Extractor de fluidos neumático.
líquido de transmisión y agua
sLa operación silenciosa es consecuencia del silenciador de aire del Venturi s3EUTILIZAPARAINFLARPELOTASPARADEPORTES
sLa unidad se puede utilizar alejada de la fuente de aire creando un vacío, ruedas de bicicleta y dispositivos de
cerrando ambas válvulas de cierre, y transportando la unidad al trabajo
flotación, entre otras cosas
s#ONECTELATUBERÓAYLIBERELASVÉLVULASPARAEVACUARELFLUIDO
s0OLIETILENODURADERONOCORROSIVO
sEl sistema completo incluye el extractor de fluidos neumático con
s)NCLUYEBOMBALARGOSDEDE
Venturi y válvula de cierre de aire en la base, conector de cuello vertedor manguera de fluido, 2 conectores de
PRINCIPALCONJUNTODEMANGUERAPRINCIPAL$)XDELARGO
MANGUERADEENTRADADESCARGA
conjunto de manguera de purga de frenos con control de fluido de línea
manguera de presión de aire, tubo
RECTAV$)XDELARGOMÉSTUBOSRÓGIDOSDEMEDICIØNDENIVEL
de medición de nivel y adaptador de
FLUIDPUMP
PARALAEXTRACCIØNDEACEITEDELMOTOR$)XY$)X
MANGUERADEMEDICIØNDENIVELFLUIDO
ADVERTENCIA
r,EAYSIGATODOSLOSMENSAJESDESEGURIDADENLASINSTRUCCIONES
r,EALASPRECAUCIONESDESEGURIDADENLASP¶GINASA
505
LUBRICACIÓN
Filtro de aceite
YA4050B
YA4022
YA4275
YA4250
YA4274
A106
S3624
OFWAJ13
A127
OFSKIT
Pinzas para filtro / dados para filtro
YA4050B Pinzas para filtro de aceite–Blue-Point®. Sujeta filtros de
aceite para removerlos con más facilidad. Mordaza con compensación de 20° de la
empuñadura para incrementar la accesibilidad. La gama de abertura de la mordaza
es de 2 1/4" a 4". 12" de largo.
YA4275 Pinzas para filtro de aceite–Blue-Point. Se usa en filtros de
4 1/4" a 7" (108-178 mm) de diámetro. Aplicaciones: incluyen motores diesel de
alto torque para camiones y tractores. El ajuste del tamaño de la acción del resorte
asegura un sólido agarre en el filtro. La empuñadura compensada ofrece mayor
capacidad de acceso. Palancas forjadas de servicio pesado. Agarres acolchonados
para mayor comodidad. Acabado industrial negro. El largo total es de 19" (482.6
mm).
YA4250 Pinzas para filtro de aceite–Blue-Point. El diseño de unión
deslizante brinda un rango de abertura de mordazas entre 3 5/8 y 6". 12" de largo.
YA4274 Pinzas para filtro de aceite–Blue-Point. Se usa en filtros de
diámetro de 2 1/2" a 5 1/4". Se usa en aplicaciones de automotores y camiones.
El ajuste del tamaño de la acción del resorte asegura un sólido agarre. La
empuñadura compensada ofrece mayor capacidad de acceso. Palancas forjadas de
servicio pesado. Agarres acolchonados para mayor comodidad. Acabado industrial
negro. El largo total es de 13 1/2".
A106 Dado para filtro de aceite. Diseño de 6 puntas de perfil bajo (1.68"
D.E. x 1.04" largo), para extraer el filtro de aceite de plástico en motores de 4
cilindros de 2.0L, 2.2L y 2.4L GM Ecotec. Presenta el sistema de llaves con Flank
Drive®. Acabado cromado para una vida útil más prolongada y una limpieza fácil.
Tamaño llave: 1 1/4" (32 mm). Cuadro cuadrado de 3/8". Aplicaciones:
s3ATURN,3ERIES)ONY6UEYPOSTERIOR
s'-#AVALIER3UNFIRE'RAND!M3ONOMA3!LEROYPOSTERIOR
s0ONTIAC'Y3OLSTICE
s#HEVROLET((2#OBALT#OBALT33-ALIBUA
s3AAB!LGUNASAPLICACIONESGENERALES
YA4022 Pinzas de largo alcance para filtro de aceite–Blue-Point.
2EMUEVEFILTROSDEACEITEDECOMBUSTIBLEEHIDRÉULICOSDIFÓCILESOMUYAJUSTADOS
MÉSUNIDADESDEENVÓOYOTROS&ÉCILDEMANIOBRARALREDEDORDEMÞLTIPLESDE
escape calientes. 23" de largo y un gran poder de sujeción. Las mordazas de 32
dientes se ajustan en dos tamaños para un óptimo agarre.
YA995
A91E
YA342C
S3624 Dado rebatible del filtro. Una herramienta remueve e instala las 3
CAPASDEFILTROENVEHÓCULOSDIESEL&ORD0OWER3TROKEDE,COMOCAMIONETAS
serie Super Duty, vans Econoline y Excursions. Para usar en la remoción e
instalación de la tapa de filtro de aceite más las tapas de filtro de combustible
PRIMARIOYSECUNDARIOENESTOSVEHÓCULOS.OUSARPARAIMPACTO2EQUIERELA
extensión de cuadro de 3/8" (FX1 o FXWP1 1-1/2" de largo). Cuadro de 3/8".
Aplicaciones de 24 mm adicionales:
Especificaciones:
"UICK66462ENDEZVOUS5LTRA
4AMA×OCUADROCUADRADO
LaCrosse CSX
Tamaños de llaves: 24 y
#ADILLAC6646#43343328
MM
3ATURN,6
#ONFIGURACIØNDELALLAVE
Aplicaciones de 35/36 mm adicionales:
Flank Drive
!UDI67-OTOR62
$%MAYORMM
BMW: Motores de 6, 8 y 12 cilindros
D.E. menor: 1.38" (34.9 mm)
Mercedes: motores diesel
Largo: 1.73" (43.9 mm)
-INI#OOPER
!CABADO.ÓQUEl-Cromo
6OLVOSERIESY8#CONMOTOR
de 6 cilindros de 3.2 litros
OFWAJ13 Pinzas para filtros de aceite con mordazas giratorias–
Blue-Point. Las mordazas giran 90° en cualquier dirección para acceder a
LAMAYORÓADELOSFILTROSDEACEITEYCOMBUSTIBLE,ASMORDAZASSEAJUSTANEN
posiciones, en incrementos de 30PARAADAPTARSEALAMAYORÓADELASAPLICACIONES
La empuñadura de unión deslizable se ajusta de 2 1/4" a 4 3/4" (57 - 120 mm).
A127 Dado para filtro de aceite. Extrae e instala los filtros de aceite de
27 mm (1 1/16") en motores de 4 cilindros 1.8L de Mercedes modelo 2003 y
posteriores. Aplicaciones adicionales: filtros de aceite comerciales con tuerca de 1"
en la parte superior del cilindro. Tamaño de la llave 1 1/16". Cuadro de 3/8".
OFSKIT Juego de dados de filtros para aceite/combustible.
)NCLUYELOSDADOSPARAFILTROSDEACEITE!Y!DADOREBATIBLEPARAFILTRO
S3624, y dado para filtro de combustible diesel Cummins A129 (4 pzas.) en bandeja
de almacenamiento. Las aplicaciones para S3624, A127 y A106 están enumeradas
en esta página. Las aplicaciones para A129 están enumeradas en la página 221.
OFW12418
GA333C
FWA6296A
FW656714A
Llaves para filtros de aceite–Blue-Point
Pieza No.
YA995
YA996
A91E
YA342C
OFW12418
OFW125532
GA333C
GA340A
YA341A
FWA6296A
FWA62121A
FW656714A
FW7614A
FW9315A
FW757715A
FW7630A
FW8015
506
Tamaño
Pasos
3"
76/80 mm
—
—
—
—
—
—
—
62/96 mm
62/121 mm
65/67 mm
76 mm
93 mm
75/77 mm
76 mm
80 mm
2
2
—
—
—
—
—
—
—
—
—
2
1
1
2
1
1
Planos
Estilo
15
Copa
Copa
Correa
Banda
Banda
Banda
Banda
Banda
Banda
Ajustable
Ajustable
Copa
Copa
Copa
Copa
Copa
Copa
14/15
—
—
—
—
—
—
—
—
—
14
14
15
15
30
15
Cuadro cdo.,
Aplicación
pulgadas
3/8
Filtros Fram, AC, Wicks, NAPA, Sears, Motorcraft, Hastings y Baldwin. Cuenta con hexágono externo de 1"
3/8
Filtros OEM y Purolator en vehículos VW, Nissan y Toyota. Cuenta con hexágono externo de 1"
—
Filtros de aceite de gran diámetro de 1 a 6". Incluye cuadros cuadrados de 3/8" y 1/2"
1/2
Para filtros de 4 5/8 hasta 5 1/4" de diámetro
1/2
Para filtros de aceite de 4 1/8 a 4 21/32" (105 hasta 118 mm)
1/2
Para filtros de aceite de 5 5/32 hasta 5 21/32" (130 hasta 143 mm). Similar a OFW12418
Empuñaduras
Para filtros de aceite de 2 7/8 a 3 1/4" de diámetro
Empuñaduras
Para filtros de aceite de 3 1/2 hasta 3 7/8" de diámetro. Similar a GA333C anterior
Empuñaduras
Para filtros de aceite de 4 1/8 hasta 4 7/16" de diámetro. Similar a GA333C anterior
3/8
Llave de filtro ajustable para filtros de aceites de 62 a 96 mm de diámetro. Cuadro cuadrado de 3/8", hexágono externo de 3/4"
3/8
Llave de filtro ajustable para filtros de aceites de 62 a 121 mm de diámetro. Cuadro cuadrado de 3/8", hexágono externo de 3/4"
3/8
Fram-PH4386, PH4967, PH6017, PH6018 y PH6607
3/8
Champion, Champ, Lee, Purolator, Mopar, VW, Porsche, BMW, Mercedes
3/8
Casite, Champ, Champion, GM, Fram, Hastings, Purolator, Wix, Nissan, VW, Porsche, Renault
3/8
NAPA, AC Delco, Castrol, STP, Penske
3/8
Fram, IAPCO, Motorcraft, Parts Plus, Pennzoil
3/8
Motorcraft, Parts Plus, Penska, Purolator
www.snapon.com/shoptools
LUBRICACIÓN
>adljg\]Y[]al]
FWK7A
FWK7A Juego de llaves para filtro de aceite–Blue-Point®.
Las llaves del juego cubren el 95% de los filtros de aceite de automóviles
y camiones livianos nacionales e importados. La caja almacenamiento/
transporte mantiene las llaves juntas para su fácil acceso y contiene cualquier
residuo de aceite manteniéndolo alejado de su unidad de almacenamiento
de herramientas. Incluye una tabla de aplicaciones laminada. El juego FWK7A
incluye llaves para filtro de aceite FW656714A, FW757715A, FW7614A,
FW7630A, FW8015, FW9315A y FWA62121A.
CRUSH1A
9hdYklY\gj]k\]^adljgk\]Y[]al]º:dm]%Hgafl
S9615A Llave de ojo en pulgadas/métrica de 12 puntas.
El extremo de ojo de 12 puntas de 9/16" y 15 mm se ajusta a la mayoría
de los tapones de drenaje de GM. Una compensación de 10° en cada
extremo para obtener el máximo de espacio. Ambos extremos de ojo se
caracterizan por el sistema de llaves Flank Drive®. 9 23/32" de largo.
CRUSH1A Aplastador de filtros de aceite. Remueve
aproximadamente el 95% del exceso de aceite arrojado por los
filtros. Cuenta con una junta autolubricante. 10,000 lb. de fuerza de
compresión con una simple unión a una línea neumática de 60 a
120 psi. El tiempo del ciclo es de 10 a 15 segundos. La puerta que
cambia de ángulos evita que el aceite gotee en el área de trabajo
cuando se colocan o retiran los filtros. No ponga en funcionamiento
el equipo con la puerta abierta. La cámara de aplastante mide 8 1/2"
de alto x 6" cuadrado. La altura es de 23". El peso es de 70 lb.
CRUSH1EX100 Filtro de aire.
<j]fYb]k
LYhf\]dlYeZgj
S9615A
DdYn]hYjYlYhf\][~jl]j
A172A Dado del tapón del tambor.
Un dado remueve prácticamente todos los
tapones y tapas de tambor giratorias. La llave
interior con resorte funciona con tapones más
pequeños y queda automáticamente embutida
cuando se extraen tapones más grandes. Se
utiliza con un trinquete o llave de impacto con
cuadro de 1/2".
YA743 Drenaje de aceite de
desecho. Acopla un tambor estándar de 16
galones. Incluye: medidor de flotador en la tapa
del tambor, depósito telescópico de drenaje
ajustable de 42 3/4" a 70" y base rodante. (No
se incluye el tambor).
YA749 Drenaje. 24 1/2" de diámetro.
Se ajusta a depósitos de drenajes de 6" o
superiores. Evita las salpicaduras cuando se
retiran los receptáculos de transmisión.
YA749
FUNN1
Pieza No.
FUNN1*
FUNN2*
FUNN15*
*Blue-Point
A172A
9[]al]jYkº:dm]%Hgafl
YA743
FUNN2
?jYkYqY[]al]
FUNN15
Tamaño
Estilo
decuello
Tornillo
Tapas
Color
1 pinta
1.25 cuarto
1.5 cuarto
pequeño
grande
grande
s
s
s
Anaranjado
Azul
Rojo
OC5A Aceitera. Aceitera pequeña a
presión de 5 1/2" con cuello largo y ahusado
con punta a rosca. D.E. 1 7/8". Incluye un
soporte de base. Capacidad de 5 onz.
OCF5 Aceitera. Similar a la aceitera
OC5A pero con cuello flexible.
OC5A
OCF5
OFHON33 Llenado de aceite roscado. Llenado de aceite
roscado para utilizar en:
s(ONDA!CCORD#IVIC%LEMENT&IT3
s!CURATODOSLOSMODELOSEXCEPTO-$8Y2$8
s.ISSANLAMAYORÓADELOSMODELOS
s-OTORESDIESEL$ODGE#UMMINS4URBODEA
s#AMIONESDIESEL&ORD4URBO,,,Y,
s0REVIENESUCIEDADNODESEADAALSELLARENELCUELLODELLENADO
OFGMFORD Llenado de aceite roscado. Aplicaciones:
Chevy: Cobalt, Silverado, Tahoe, Trailblazer y Vans; GMC: Sierra,
Envoy; Pontiac: Grand Prix, G6; Saturn: SL1; Cadillac: CTS; Ford:
Explorer, F150, Mustang; Mercury: Mountaineer. Previene suciedad no
deseada al sellar en el cuello de llenado.
=eZm\gk'[m]ddgk'j][]hl~[mdgk
GA96B Para relleno de transmisión–Blue-Point. Embudo
ovalado de 8 1/2" con malla de filtro. 30" de largo.
OFTOY38 Para relleno de aceite de Toyota/Lexus/
Scion. Se ajusta a todos los modelos Toyota, Lexus y Scion (excepto
Toyota Prius) con tapón de llenado de aceite de roscado. Previene
suciedad no deseada al sellar en el cuello de llenado.
ADVERTENCIA
GA96B
OFTOY38
OFHON33
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
OFGMFORD
507
LUBRICACIÓN
Grasa y aceite
YA734A
YA728A
GA473A
YA4190A
YA775
GA471
YA771B
GA472
YA772B
Pistolas de grasa
Manual
Pieza No.
Especificaciones
PSI
Con carga
Capacidad
Manguera flexible
Extensión rígida
Boquilla
De fuerza
neumática
YA734A*
Agarre de pistola
6,000
YA728A*
Palanca
6,000
YA4190A*
Miniatura
—
A granel o por cartucho
A granel o por cartucho
Por cartucho
A granel de 16 onzas y por
cartucho de 14 1/2 onzas
18"
6"
—
A granel de 16 onzas y por
cartucho de 14 1/2 onzas
18"
6"
—
3 oz.
3 oz.
14 oz.
14 oz.
—
—
—
—
5-1/2"
8 1/4"
—
3 1/2"
13 1/4"
—
5 3/8"
19 1/4"
Pieza No.
PSI
Presión neumática operativa
Relación de la bomba
Con carga
Capacidad
Manguera flexible
Extensión rígida
Boquilla
YA775
YA771B*
6,000
6,000
100
35 - 80
60:1
40:1
A granes, bomba de relleno
A granes, bomba de
o por cartucho
relleno o por cartucho
Cartucho de 14 onzas Cartucho de 14 onzas
—
18"
6"
7 1/2"
—
—
GA471*
GA472*
GA473A*
Agarre de pistola
Agarre de pistola
Agarre de pistola
4,500
5,000
10,000
A granel, por cartucho A granel, por cartucho A granel, por cartucho
o bomba de relleno o bomba de relleno
o bomba de relleno
YA772B*
4,000
60 - 150
40:1
A granes, bomba de
relleno o por cartucho
Cartucho de 14 onzas
18"
6"
—
*Blue-Point
YA747
YA801
YA7500
Accesorios dosificadores–Blue-Point®
YA7500 Paquete de accesorios dosificadores de grasa. Incluye
desde YA760 hasta YA757 (excepto YA750) (10 pzas.) en una bandeja plástica.
YA760 Unión giratoria universal. Unión giratoria de alta presión.
Roscas macho de 1/2"-27 x 1/4" NPT(m). Presión operativa máxima 5,000 psi.
YA761 Acople de boquilla de aguja. Este es el modelo YA750 con
adaptador de manguito de traba para conexión rápida al acople hidráulico.
YA751 Manguera flexible. Para pistolas para grasa eléctricas y
manuales. 1/8" NPT(m) en ambos extremos. Presión máxima 4,500 psi. 12"
de largo.
YA752 Manguera flexible. Versión de YA751 de 18" de largo.
YA758 Manguera flexible. Sólo para mangueras para grasa manuales.
1/8" NPT(m) en ambos extremos. 18" de largo.
YA753 Acople para servicio pesado. Rosca de 1/8" NPT(h). Funciona
en todos los accesorios para grasa de tipo hidráulico.
YA755 Acople. Rosca de 1/8" NPT(h). Funciona en todos los accesoriospara
grasa de tipo hidráulico.
YA756 Acople de extensión. Lubrica los accesorios embutidos El
adaptador de manguito de traba permite una fijación rápida al acople hidráulico
de cualquier válvula de control o pistola a palanca. 6" de largo.
508
YA747 Válvula de control de grasa. Entrada de 1/4" NPT(h), con una
presión operativa máxima de 7,500 psi. Incluye un tubo de extensión de 6" y
una cupla YA753.
YA801 Adaptador tipo aguja. Para accesorios de juntas universales,
bombas de agua y resortes cubiertos por metal. 4 7/8" de largo.
YA754 Acople giratorio. Rosca de 1/8" NPT(h). El acople giratorio a 360°
se traba en posición cada 45°.
YA757 Adaptador para lubricar en ángulo. 90° La cabeza con 90º
de giro permite una lubricación rápida y completa de los sistemas de dirección
y suspensión en los vehículos último modelo con tracción delantera. 4 1/2"
de largo.
YA799 Adaptador de pistola para grasa en ángulo recto. Se
usa en juntas de bola FWD de Chrysler, Dodge y otras ubicaciones de acceso
restringido. Se adjunta a cualquier pistola para grasa. Construcción de metal
con acabado industrial negro. Mide 1 1/2" x 1" x 3/4".
YA750 Boquilla tipo aguja. Rosca de 1/8" NPT(h). 2 3/4" de largo.
GA472-2 Acople de accesorios para grasa. Diseño a presión con
manguito y bola de neopreno. Cuenta con una válvula de retención a resorte.
GA472-9 Manguera trenzada flexible. Resistente a la grasa, aceite y
solvente para accesorios con extremos de bronce.
www.snapon.com/shoptools
LUBRICACIÓN
?jYkYqY[]al]
UFREE1
DaehaY\gj\]Y[[]kgjagkhYjY_jYkY
YA739
YA738
UFREE1 Herramienta para limpiar los accesorios para grasa.
sRápida y fácilmente libera juntas y uniones para un adecuado engrasado y
lubricación
YA737
sInyecta un aceite de viscosidad liviana en la unión de grasa a través del accesorio
para grasa para disolver y remover la suciedad, el óxido y los desechos
:geZYkhYjY_jYkYqY[]al]\]]f_jYfYb]k'EYfmYd
s"OMBEALAGRASANUEVADESPUÏSDELIBERARLAUNIØN
YA739 Bomba manual para aceite de engranajes.3EADAPTAA
s)NCLUYEHERRAMIENTAPARALIMPIEZAAINYECCIØNMANGUERAFLEXIBLEDE
CUALQUIERRECIPIENTEORIGINALDEREFINERÓADEALB3UMINISTRAONZPOR
(120.7 mm) de largo para acceder a áreas estrechas y caja de almacenamiento GOLPEUTILIZANDOACEITEDEENGRANAJES3!%A&)NCLUYEgDEMANGUERA
DEDEBAJAPRESIØNCONBOQUILLADOSIFICADORA
YA737 Bomba manual para grasa.3EFIJAFIRMEMENTEACUALQUIER
RECIPIENTEDEREFINERÓAORIGINALDEALB3EPUEDEAPLICARACUALQUIER
COJINETEDEBOLAORODILLOCON$)DEAYCON$%MÉXIMO
DE#EBAYBOMBEAAÞNCUANDOUSAGRASAABAJASTEMPERATURAS
,APLANCHADESEGUIMIENTOEVITALACANALIZACIØNDELAGRASA.OINCLUYE
manguera ni pistola para grasa.
YA745A
YA746
YA738 Bomba manual para aceite de engranajes.3IRVEPARA
CUALQUIERRECIPIENTEORIGINALDEREFINERÓADELB0ODEROSABOMBACONUNA
HaklgdYkhYjYjg[aY\gqkm[[af\]Y[]al]
RELACIØNACONDESPLAZAMIENTODEPULGADASCÞBICAS)NCLUYEBASE
YA746 Pistola para rociado de aceite. Tipo sifón. Para rociar
RODANTEUNIØNGIRATORIALISAgDEMANGUERADEDEALTAPRESIØNACOPLE
aceites lubricantes, aceites de corte y refrigerantes. Incluye una manguera
neumático
de conexión rápida, plancha de seguimiento, válvula de control de
de succión de vinilo de 6' con filtro.
GRASA9!YUNIØNGIRATORIAUNIVERSAL9!
YA745A Pistola para rociado de aceite–Blue-Point®. Capacidad
DEONZ-ÏTODORÉPIDOYLIMPIOPARAELIMINAROAGREGARACEITEDE
transmisión o de engranajes. El seguidor especial es inerte al aceite, grasa y
AGUA"OQUILLAFLEXIBLE
A180A
YA759
YA736
YA470B
=ehY[Y\gj]khYjY[gbaf]l]k
YA742
A180A Empacador manual para cojinetes. Empaca
simultáneamente apresión cojinetes de ruedas internos y externos con un D.I.
MÓNIMODEYCONUN$%MÉXIMODE5SARCONEQUIPOPARALUBRICACIØN
PRESURIZADOOCONPISTOLAMANUALPARAGRASA)NCLUYEFUNDACONTRAPOLVO
YA470B Empacador manual para cojinetes–Blue-Point. Empaca
DEACOJINETESCONCARGADEGRASA!PLIQUEPRESIØNMANUALPARA
LIMPIARYLLENARCONGRASAELCOJINETE)NCLUYEFUNDACONTRAPOLVODEALTO
YA742 Empacador manual para cojinetes. La unidad cuenta con
UNACABEZAEMPACADORAGRANDE3IRVEPARACOJINETESCON$%DEY
CON$)MÓNIMODE)NCLUYEADAPTADORPARACOJINETESMÉSPEQUE×OS
CON$%DEA
PBT5X29
PBT2120
E]kYk\]ljYfkeakaf
PBT5X29 Mesa de transmisión. 5' de largo.
PBT2120 Cajón. #AJØNOPCIONALXX
ADVERTENCIA
:geZYkhYjY_jYkY'f]me~la[Yk
YA736 Bomba neumática para grasa.3EADAPTAACUALQUIERRECIPIENTE
ORIGINALDEREFINERÓADEALB0ODEROSABOMBACUNARELACIØNDEAC
DESPLAZAMIENTODEPULGADASCÞBICAS)NCLUYEgDEMANGUERADEDE
alta presión, acople neumático de conexión rápida, plancha de seguimiento,
VÉLVULADECONTROLDEGRASA9!YACOPLEDEGIROUNIVERSAL9!
YA759 Bomba neumática para grasa."OMBACONRELACIØNDE
A5TILIZAUNRECIPIENTEDELBYFUNCIONACONLUBRICANTEDETODOS
los grados. Cuenta con silenciador interno para una operación silenciosa y
MOTORNEUMÉTICOPRELUBRICADOQUENOREQUIEREACEITADORAEXTERNA6ÉLVULA
neumática de acero endurecido microcejada exclusiva para asegurar una
VIDAÞTILPROLONGADAYPRODUCTIVANOHAYEMPAQUESQUESEPUEDANDESGASTAR
La válvula de pie tipo pala agrega cebamiento mecánico a la succión normal.
,ASRUEDASGIRATORIASBRINDANLAMOVILIDADDELAUNIDAD.OINCLUYEBARRIL
Km^ja\]jYk
YA762
YA762 Plataforma de base rodante. "RINDAMOVILIDAD
para recipientes de refinería original de 25 a 50 lb. Incluye ruedas
GIRATORIASDECU×AYGRAMPADETORNILLOPARAUNAJUSTESEGURO
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
509
SERVICIO DE MOTOR
Herramientas de servicio
YA9680
ML6000
ML6000COMBO
Sincronización
CC100
ML5000
CC100PK
AS4660
YA9680 Herramienta de polea del cigüeñal–BluePoint®. Diseñada para sujetar la polea del cigüeñal en su lugar
mientras gira el perno del eje de centralización. Extremadamente útil
en motores de 6 válvulas montados transversalmente tal como el
motor VG30 del Nissan Máxima y el motor 3VXFE y 1MZFE del Toyota
Camry. Las poleas traseras en esos vehículos se encuentran cerca de
la torre del amortiguador lo que dificulta la remoción/el cambio del
perno del eje de centralización sin esta útil herramienta.
YA9730 Compresor del tensor de la correa de
sincronización–Blue-Point. Para T-100, Tacoma y 4Runner modelos
1995 y posteriores. Gire el cuadrado para comprimir el tensor, luego instale
el perno de sujeción (YA9730-5 incluido con YA9730).
ML5000 DOHC Herramienta de traba.–Blue-Point.
Traba los piñones del árbol de levas en su lugar para preservar la
sincronización del motor durante el reemplazo de la correa o la cadena.
Pasadores estriados en la traba de la unidad en la ranura en la parte
interior de la rueda de levas. La base de la unidad está fabricada con
aluminio anodizado. Los pasadores son de acero. Funciona con la
mayoría de los camiones livianos y autos nacionales e importados.
ML6000 Abrazadera del engranaje de sincronización/
herramienta de traba de leva–Blue-Point. Evita el daño
del motor que resulta de la sincronización incorrecta. Mantiene la
sincronización de la válvula durante el reemplazo de la correa en
motores con levas dobles y cuadrangulares. El diseño compacto
permite el acceso a motores transversales. Se ajusta a los diámetro
del engranaje de sincronización desde aproximadamente 4"
(101 mm) a 6" (152 mm). Se ajusta el espacio del engranaje desde
aproximadamente 0.06" (1.6 mm) a 3" (76 mm).
510
YA9730-5
YA9730
AS4653
CC100 Grampa de leva única–Blue-Point. La grampa
de leva única se puede usar en motores en los que la grampa dual
ML6000 no se adapta. Su diseño compacto permite su fácil operación
en áreas confinadas del motor. Evita el daño del motor que resulta de la
sincronización incorrecta. Mantiene la sincronización de la válvula durante
el reemplazo de la correa en motores con levas dobles y cuadrangulares.
Simple y fácil de usar. Fabricado con polímeros industriales de alta
resistencia que no corroerán o dañarán las poleas del motor.
CC100PK Juego de grampas de leva única–BluePoint. Juego de (4) grampas de leva única CC100 en bandeja de
almacenamiento.
ML6000COMBO Juego de grampas de leva–BluePoint. Incluye (4) grampas de leva única CC100 y (1) grampa dual
ML6000 en bandeja de almacenamiento.
AS4660 Juego de configuración de sincronización/
traba de motor maestro. Combina todos los componentes y
aplicaciones del juego AS4653 GM/Daewoo, del juego AS4654 Ford/
Mercury/Mazda y del juego AS4645 Chrysler/Asian y, además, un
juego de pasador de retención del tensor.
AS4653 Juego de configuración de sincronización/
traba de motor. Completa selección de las herramientas de
servicio especial para mantener la posición de sincronización del
motor durante el reemplazo de la correa de sincronización y el
trabajo de servicio del tren de válvulas. Aplicaciones:
Chevrolet: Lumina, Monte Carlo, 3.4 V6Oldsmobile: Cutlas Supreme
3.4 V6Pontiac: Grand AM, Le Mans, Sunbird 2.0, Grand Prix 3.4
V6Daewoo: Lanos, Nubria 1,6
www.snapon.com/shoptools
SERVICIO DE MOTOR
@]jjYea]flYk\]k]jna[ag
AS4654
AS4645
AS4145
AS4394
Kaf[jgfarY[af
AS4654 Juego de configuración de sincronización/
traba de motor. Completa selección de las herramientas de
servicio especial para mantener la posición de sincronización del
motor durante el reemplazo de la correa de sincronización y el trabajo
de servicio del tren de válvulas. Aplicaciones:
Ford: Contour, Escort Z2X, Escape, Focus, Probe 2.0, Ranger 2.5,
Taurus 3.2 V6Mercury: Mystique 2.0, Cougar 2.0Mazda: B2300, B2500
AS4145 Juego de configuración de sincronización/
traba de motor (GM). Evita resincronización innecesaria. Cubre
la traba de las levas cuadradas y del cigüeñal. Incluye el calibrador de
sincronización especial esencial para esta aplicación. Aplicaciones: V6
Cadillac Catera, Saab 900, 9000 y 9.5 más Saturn L300.
AS4394 Herramienta de sostén para el piñón del árbol
de levas. Se utiliza como un soporte contador cuando se aflojan
o aprietan los pernos retenedores de piñón. Se utiliza en todos los
modelos con orificios de piñón mayores que 1/2" (12 mm).
AS4645 Juego de configuración de sincronización/
traba de motor. Completa selección de las herramientas de
servicio especial para mantener la posición de sincronización del
motor durante el reemplazo de la correa de sincronización y el trabajo
de servicio del tren de válvulas. Aplicaciones:
Chrysler: Cirrus, Sebring convertible 2,5 V6, Daytona Shelby, Dynasty
clase E, Laser, LeBaron
Dodge: Avenger 2,5 V6, camioneta Colt 2,4, Stealth 4WD 3,0 V6,
Stratus 2,5 V6, Colt 1,6, Aries, Caravan, Dakota, Daytona/Shelby,
Dynasy Lancer, Mini Ram Van, Omni, Shadow, Spirit 2,2/2,5Plymouth:
Colt Vista 2,4, Colt 1,6/200, Laser 2,0, Reliant, Acclaim, Caravelle,
Duster, Horizon, Scamp, Sundance, TC3, Turismo, VoyagerAcura:
2.2CL, 2.3CL, 3.0CL, 3.2TL
Honda: Accord 2,2, 2,3, 3,0 V6; Prelude 2,2, 2,2VTEC, 2,3; Odysey .2,
2.3, 3.5 V6
Hyundai: Elantra 1.6 - 1.8, Sonata 2.0Isuzu: Oasis 2.2 - 2.3, Amigo
2.2, Rodeo 2.2
Mitsubishi: Diamante 3,0 V6, 3,5 V6; 3000GT 3,0 V6; Eclipse/Spyder
2,0, 2,4, 3,0; Galant 2,0, 2,4, 3,0; Expo 2,4; Montero Sport 2.4, 3.0,
3.5 V6.
S6152
MT37A
A121A
A119B
A120
YA6555
Hj]kaf\]Y[]al]'ZgeZY\]Y[]al]
MT37A Juego de manómetro de aceite. Para usar en
motores diesel y a gasolina. Incluye adaptadores estándar y métricos
para los motores más populares nacionales e importados de autos,
camiones, tractores y vehículos familiares. Cuenta con manómetro
brillante de fácil lectura con bota de protección verde. Incluye:
s#ONJUNTODEMANØMETRODEPSIK0A #ONJUNTODE
manguera
s!DAPTADORA
s!DAPTADORA
s!DAPTADORA"304 s!DAPTADORA-
s!DAPTADORA-
s!DAPTADORA-
s#ODOMACHOHEMBRA
s" Manguito grande
s!COPLAMIENTO
s#AJADEALMACENAMIENTO
A121A Dado para interruptor del transmisor de presión
de aceite. 0ARAPRODUCTOSMARCA&ORD'-Y#HRYSLERMODELOS
y posteriores. Tamaño de llave de 12 puntas de 1 3/16", cuadro de
3/8" 3 11/16" de largo.
ADVERTENCIA
A119B Dado para interruptor del transmisor de presión de
aceite. Para productos marca Ford, GM y Chrysler modelos 1986 y anteriores.
Configuración de llave especial de 1 1/16", cuadro de 3/8". 2 1/16" de largo.
A120 Dado para interruptor del transmisor de presión de
aceite. 0ARAVEHÓCULOSDEMARCA&ORD'-Y#HRYSLERMODELOSY
posteriores. También se puede usar en Mitsubishi Eclipse modelo 1999 con
motor 420A sin turbo DOC 2L. Igual diseño que A119B, pero más largo.
Configuración de llave especial de 1 1/16", cuadro de 3/8". 3 11/16" de largo.
S6152 Llave de pie para interruptor del transmisor de presión
de aceite. Cuenta con las mismas aplicaciones que A119B, pero está
diseñado para interruptores de difícil acceso. Abertura de llave de 1 1/16",
cuadro de 3/8".
YA6555 Herramienta de extracción de bomba de aceite
GM–Blue-Point. Diseñada para trabajar en la mayoría de los motores V6 de
GM. No es necesario extraer el múltiple de entrada. Facilita y acelera la extracción
DELATRANSMISIØNDELABOMBADEACEITE!PLICACIONES'-,6A
3.1L V6 (1990 a 1994), 3100 V6 (1994 a 2005) y 3.4L V6 (1999 y posteriores).
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
511
SERVICIO DE MOTOR
Herramientas de servicio
S6018E
S6132A
S6160
GDCT16
S6194
YA6610
FRT10
®
Culata de cilindro–Blue-Point
GDCT16 Comprobador de pérdidas de combustión. Ofrece un
modo fácil y rápido de diagnosticar los problemas de sobrecalentamiento del
motor. Verifica la existencia de pérdidas entre la cámara de combustión y el
sistema de enfriamiento. Compruebe la existencia de pérdidas de combustión
en la cabeza y junta antes de retirar el radiador. La doble cámara en la
unidad de prueba ofrece un alto nivel de precisión. Para utilizar en motores
diesel y a gasolina refrigerados por agua. El juego incluye cámara de prueba
completa, botella de 16 onz. de fluido de prueba e instrucciones.
GDCT161 Fluido detector de pérdidas. Botella de 16 onz. de fluido
de prueba de pérdidas para el comprobador de pérdidas de combustión
GDCT16.
S6018E Mango de cabeza hexagonal. Punta hexagonal de 10 mm
para pernos de cabeza de cilindro. Cuadro de 1/2". 6" de largo. Largo de la
broca es de 4 1/2".
S6132A Dado métrico para perno de tapa de la válvula. Para GM
y Honda modelo 1976 y posteriores; otros vehículos nacionales e importados. El
tamaño de la llave de 12 puntas es de 10 mm. Permite el acceso a pernos de
cabeza, tapa de válvula y balancín, y pernos del cárter. Profundidad de espacio
para pernos con punta extendida como los utilizados en el arnés del cable de la
bujía. Cuadro de 3/8", D.E. de 11/16". 4 1/8" de largo.
S6160 Dado para perno de cabeza de impacto extra largo.
Se utiliza en motores Nissan 1986 y posteriores con pernos de cabeza de
12 mm. El largo de 8" atraviesa el conjunto de leva y balancín para prestar
servicio a los pernos de cabeza. El dado de perfil delgado y el vástago
atravesarán el orificio de acceso y pasarán el árbol de leva de cabeza.
Aplicaciones de torque elevado adicionales: la remoción e instalación de
pernos de bridas de junta universal en vehículos Ford/Mercury tales como
Mustang, Crown Victoria y Lincoln más Ford Explorer, Ranger y camiones F150/
F250. 8" de largo. 12 puntas, acabado industrial. Cuadro cuadrado de 1/2".
S6194 Dado de perno de cabeza. Se utiliza en autos y pick-ups
Toyota y Nissan y en autos Honda con pernos de cabeza de 12 mm. El
largo de 4" atraviesa el conjunto de leva y balancín para prestar servicio a
los pernos de cabeza. El dado de perfil delgado y el vástago atravesarán el
PMP410A
orificio de acceso y pasarán el árbol de leva de cabeza. Aplicaciones de torque
elevado adicionales: la remoción e instalación de pernos de bridas de junta
universal en Ford Explorer, Ranger y camiones F150/F250. 4" de largo. 12
puntas, acabado industrial. Cuadro cuadrado de 1/2".
S6193 Dado de perno de cabeza. Utilizar en todos los autos y
camionetas Toyota y Nissan modelo 1981 y posteriores y en vehículos Honda
modelo 1976 y posteriores y otros autos nacionales e importados con pernos
de cabeza de 10 mm. Entre los usos adicionales se incluyen los pernos de
sujeción de junta universal del árbol de transmisión de Ford. El largo de
4 1/2" atraviesa el conjunto de leva y balancín para dar servicio a pernos
de culata. El dado de perfil delgado y el vástago atravesarán el orificio de
acceso y pasarán el árbol de leva de cabeza. 12 puntas, acabado industrial.
S6195 Dado de perno de cabeza. Igual que S6193, excepto para
pernos de cabeza de 14 mm.
YA6611 Manipulador de cabeza. El diseño de la empuñadura en "T"
ayuda a mover las culatas de cilindro más rápido y más fácilmente. No es
necesario “mantener aferrada” la culata del cilindro durante el movimiento.
Arandela flotante incorporada para un mayor contacto de superficie.
Superficies de agarre cómodas y seguras para las manos. Roscas de M6 x
1.0. Paquete de 2.
YA6612 Manipulador de cabeza. Igual que YA6611 excepto que tiene
roscas de 1/4" x 20. Paquete de 2.
YA6613 Manipulador de cabeza. Igual que YA6611 excepto que tiene
roscas de M8 x 1.25. Paquete de 2.
YA6610 Manipulador de cabeza. El juego incluye (2) manipuladores
de cabeza YA6611 (M6 x 1.0 de rosca), (2) manipuladores de cabeza YA6612
(1/4" x 20 de rosca) y (2) manipuladores de cabeza YA6613 (M8 x 1.25 de
rosca) en un conveniente paquete tipo concha de almeja.
FRT10 Juego para instalación de insertos de bujías. Se usa
para repararcabezas dañadas de bujías quemadas con un inserto de acero
de aleación en el escaso tiempo de 15 a 45 minutos. Para dar servicio a
culatas de cilindro modular en motores 4.6L, 5.4L y 6.8L de Ford. Un sistema
de reparación de calidad y a prueba de inexpertos rápido, efectivo en
cuanto a costos y fácil de usar. Incluye macho (FRT10-1), taladro de núcleo
(FRT10-2), guía (FRT10-3), caja de almacenamiento (FRT10-CASE), DVD con
instrucciones (FRT10-DVD), e inserto de bujía (FRT10-INS).
PMM410A
S5902
Tapones de drenaje
PMP410A Dado métrico de tapón de
tubo interno. Cuadrado hembra de 10 mm.
Para remover o reemplazar el tapón de drenaje
de transmisión estándar. Cuadro de 3/8". D.E. de
3/4". 1" de largo. Dado de tapón de tubo hembra
(para Renault Le Car).
512
PMM410A Dado de tapón de tubo
externo. Cuadrado macho de 10 mm. Para
remover o cambiar el tapón del cárter. Cuadro de
3/8". D.E. de 11/16". 1" de largo.
S5902 Llave para tapón de aceite/
transmisión. Extremos de ojo de 6 puntas de
17 mm y de 12 puntas de 21 mm. Diseñada para
tapones de drenaje de transmisión de VW. 10 1/4"
de largo.
www.snapon.com/shoptools
SERVICIO DE MOTOR
@]jjYea]flYk\]k]jna[ag
YA866
YA8661
YAL866
YA8662
ECK9
Bm]_g\][YdaZjY[afq[gf^a_mjY[af\]d
eglgjº:dm]%Hgafl®
ECK9 Juego de calibración y configuración del motor. Incluye:
las herramientas Whistle Alert™ YA871/YA870, los indicadores TDC YA866/
YAL866, la extensión del calibrador de compresión YA868, la traba del motor
YA865 y los adaptadores de rosca de alojamientos de bujía YA8661/YA8662.
YA871 Whistle Alert (Flexible). Inserte el Whistle Alert en cualquier
alojamiento de bujía de 14 mm, de vuelta el motor y escuche que el silbato
localice el punto muerto superior para el golpe de compresión.
YA870 Whistle Alert (Rígido). Igual al YA871, excepto que también se
puede utilizar con la extensión del calibrador de compresión YA866.
YA866 Indicador de punto muerto superior. El indicador TDC
con rosca de 14 mm posiciona en forma precisa cualquier pistón en el
punto muerto superior. Quite la bujía, atornille la herramienta y rote el
motor mientras observa las marcas de graduación en el eje deslizante. Las
características incluyen marcas de graduación de 1/8" y resortes de acero
inoxidable. Largo total de 6.25" (158.8 mm).
S6192A
CJ113B
<aj][[af`a\j~mda[Y'9dl]jfY\gj':geZY\]Y_mY
S6192A Dado para bomba de agua. Dado con cuadro cuadrado de
1/2" con diseño cola de milano para otorgar engranaje positivo al aplicar torque
alto. Aplicaciones: Cadillac Northstar 4.6L V8 modelos 1992 a 1998 y Oldsmobile
Aurora 4.0L modelos 1997 a 1998. Acabado industrial negro.
S6192A-1Cinta estabilizadora del dado para la bomba de
agua. Se atornilla a la bomba de agua para asegurar el dado S6192A de la
bomba de agua en el lugar durante su remoción y reemplazo. Incluye (2) pernos
M6 x 12 para asegurar la correa a la bomba de agua. Aplicaciones: Cadillac
Northstar 4.6L V8 modelos 1992 a 1998 y Oldsmobile Aurora 4.0L modelos 1997
a 1998. Acabado industrial negro.
CJ113B Instalador para polea de alternador/dirección de
motor. Diseñado para autos nacionales. Impulsador hexagonal de polea de
1", tornillo de presión hexagonal de 7/16" y rosca de 3/8"-16. 4 5/8" de largo.
CJ113C4 Eje instalador para polea (opcional). Tamaño de rosca
5/8"-18UNF (extremo extractor), 3/8"-16UNC (extremo alternador).
CJ117C Extractor para polea de alternador y dirección
de motor. Incluye el adaptador pequeño para remover poleas tipo brida
pequeñas: use el adapt. largo en vehículos de GM200/Platform. También
puede remover poleas de alternadores Chrysler con ranuras dobles.
Reemplace las poleas con el instalador CJ113B. Se incluye el adaptador largo
para manejar las poleas de las mini vans GM. Acabado níquel-cromo, tornillo
con acabado industrial. Diseñado para la mayoría de los autos nacionales
(reemplace la polea con los juegos CJ122).
ADVERTENCIA
YAL866 Indicador de punto muerto superior (largo). El indicador
TDC con rosca de 14 mm posiciona en forma precisa cualquier pistón en el
punto muerto superior. Coloque el TDC con facilidad en motores tipo Hemi.
Simplemente quite la bujía, atornille la herramienta y rote el motor mientras
observa las marcas de graduación en el eje deslizante. Las características
incluyen marcas de graduación de 1/8" y resortes de acero inoxidable. Largo
total de 10.5" (266.7 mm).
YA8661 Adaptador de alojamiento de bujía. Adapta la rosca de
14 mm en los indicadores TDC YA866/YAL866, la extensión del calibrador de
compresión YA868 y la traba del motor YA865 para albergar las roscas de
bujías de 18 mm.
YA8662 Adaptador de alojamiento de bujía. Adapta la rosca de
14 mm en los indicadores TDC YA866/YAL866 y la extensión del calibrador de
compresión YA868 para albergar las roscas de bujías de 12 mm.
CJ117C
CJ147A
CJ122 Juego instalador para polea de dirección de motor.
Incluye instalador CJ113B y eje instalador de polea CJ113C4. 3/8"-18 UNF-2A.
CJ124A Extractor para polea de alternador/dirección de
motor. Versión más grande de CJ117C. Diseñado para vehículos Chrysler,
Ford y GM anteriores.
CJ147A Extractor de cojinetes del piñón inferior del
engranaje de dirección de motor. Herramienta requerida para
cumplir con el Boletín de retiro de GM N.° 02049 y N.° 03062 con respecto
a la separación de cojinetes del piñón inferior en engranajes de dirección del
motor. Para corregir el problema, inspeccione el cojinete del piñón inferior
y reemplácelo. En unos pocos casos, puede ser necesario el reemplazo del
soporte y el conjunto del engranaje de la dirección del piñón. Se incluyen las
instrucciones.
Aplicaciones:
Buick
s2EGAL
s#HEVROLET#AVALIER
s,UMINA
s,UMINA!06
s-ALIBU
s-ONTE#ARLO
s6ENTURE
Oldsmobile
s#UTLASS
s#UTLASS3UPREME
s3ILHOUETTE
s)NTRIGUE
s0ONTIAC'RAND0RIX
s3UNFIRE
s4RANS3PORT
Fgmk]`]jjYea]flYk\]eYfg[jgeY\Ykg\]Y[YZY\gaf\mkljaYd[gf`]jjYea]flYk\]aehY[lg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
513
SERVICIO DE MOTOR
Herramientas de servicio
YA9025
YA9350B
SRD6
YA9340
SBT26
SBIT1
YA9417
Herramientas para tensar correas
YA9025 Herramienta para tensar correas. Para vehículos
Tempo y Topaz modelo 1988 y posteriores equipados con motores
de 2.3L y Taurus y Sable modelo 1986 al último modelo con motores
2.5L. Gira hacia abajo y en torno al alternador para alcanzar el tensor
de correa tipo serpentina accionada por resorte.
SRD6 Herramienta para aflojar el tensor de correa.
Adaptador de 6" de largo con cuadro macho de 1/2". El cuadro
cuadrado triple hembra le brindan al usuario flexibilidad para trabajar
alrededor de los obstáculos al venir en diferentes ángulos con un
mango articulado de 1/2". Similares a los adaptadores de torque
Snap-on® de 6" pero con un cuadro macho. Si se utiliza con una
llave de torque, consulte la Tabla de torque N.° SS307G de Snap-on
con fórmulas para conocer el torque aplicado correcto.
Aplicaciones de servicio pesado:Tensores de correa tipo serpentina
con una abertura con cuadro cuadrado de 1/2" en los motores diesel
Detroit y Caterpillar serie 60 u ómnibus y vans de reparto en los que la
cabina o suspensión del motor dificultan la accesibilidad.Aplicaciones
automotrices:Tensores de correa tipo serpentina de 1/2" en Dodge/
Chrysler (motores de 2.0L y 3.0L), Ford, Lincoln y Mercury (motores de
2.3L, 3.0L, 4.2L, 4.6L) más GM (motores 2.5L, 4.7L, 5.0L, 5.7L).
Herramientas para tensar correas–Blue-Point®
SBT26 Herramienta para correa tipo serpentina.
Funciona en todas las correas tipo serpentina. La mordaza de
la grampa le permite al usuario ubicar la correa tipo serpentina
sin que la correa se resbale de la herramienta. El agarre seguro
permite mover la correa en áreas de difícil acceso. La empuñadura
ergonómica ofrece practicidad y facilidad de uso. Cuerpo de acero
liviano para mayor durabilidad y fuerza.
YA9417 Herramienta para tensar correas. Herramienta
para correa de uso general para instalación y remoción de correas
tipo V y de sincronización. El diseño de dos pasadores y su gran
longitud permiten al usuario empujar y tirar las correas según sus
necesidades para acceder a áreas restringidas.
YA9350B Juego de llaves para tensar la correa de
trinquete. Permite el acceso directo a tensores de correas sin
remover los accesorios de motores o los componentes del armazón.
Cubre casi el 90% de todos los vehículos equipados con tensores
de correa tipo serpentina accionada por resorte. Incluye la llave
YA9350B1 (15 mm) y los adaptadores YA9350-2 a YA9350-9. Todos
los adaptadores tienen un cuadro hexagonal externo de 15 mm
para usar con la llave YA9350B1. Aplicaciones: Chrysler (Dodge y
Plymouth), Ford (Lincoln y Mercury), GM, Isuzu, Jeep, Lexus, Mazda,
Mitsubishi, Saturn, Toyota y VW. Visite www.snapon.com para obtener
una lista completa de aplicaciones.
514
YA9350B1 Llave para tensar correas. Hexágono simple de 15 mm.
YA9350-2 Adaptador. Hexágono simple de 14 mm. Cuadro
hexagonal externo de 15 mm.
YA9350-3 Adaptador. Hexágono simple de 18 mm. Cuadro
hexagonal externo de 15 mm.
YA9350-4 Adaptador. Cuadro cuadrado de 3/8". Cuadro
hexagonal externo de 15 mm.
YA9350-5 Adaptador. Cuadro cuadrado de 1/2". Cuadro
hexagonal externo de 15 mm.
YA9350-6 Adaptador. Hexágono simple de 13 mm. Cuadro
hexagonal externo de 15 mm.
YA9350-7 Adaptador. Hexágono simple de 16 mm. Cuadro
hexagonal externo de 15 mm.
YA9350-8 Adaptador. Hexágono simple de 15 mm.
YA9350-9 Adaptador. Hexágono simple de 19 mm.
YA9340 Llave de correa serpentina. Se usa para liberar
cualquier tensor de la correa serpentina con una abertura con cuadro
cuadrado de 1/2".
La acción del trinquete permite una mejor colocación de la herramienta,
que ofrece un ángulo de mayor giro que una llave de correa serpentina tipo
maciza. La cabeza del trinquete reversible tiene sólo 1" de espesor y se
ajustará entre la cara del tensor y las hojas del ventilador en los motores
diesel Detroit de la serie 60 y algunos Caterpillar. Es también muy apta para
trabajar en ómnibus y vans de reparto en los que la cabina o suspensión
del motor pueden estrechar en gran medida el área de trabajo. La longitud
compacta evita que la empuñadura entre en contacto con las mangueras del
radiador, los tubos enfriadores neumáticos, las líneas hidráulicas o los rieles
de armazón. Agarre de vinilo para brindar comodidad. 13" de largo total.
SBIT1 Herramienta para correa tejida. Ayuda a instalar correas
tejidas en vehículos que no tienen una polea tensora. Aplicaciones:
s2007 – 2009 Ford/Lincoln (Edge, MKZ/MKX) 3.5L utilizado en
bomba de agua
s2009 Chevrolet/GMC/Cadillac (Express, Silverado, Tahoe, Suburban,
Colorado, Avalanche, Sierra, Savana, Yukon, Canyon, Escalade) 4.8,
5.3, 6.0, 6.2L utilizado en compresores de aire acondicionado
s2008 – 2009 Hummer (H3, H3T, H2) 5.3 y 6.2L utilizado en
compresor de aire acondicionado
GA424A Calibrador de la tensión de
correa–Blue-Point.
s,AGAMAESDEALBSA.sM
s!PRIETELAEMPU×ADURACOLOQUEELCALIBRADORENLA
correa del cuadro, suelte la empuñadura y efectúe
la lectura
www.snapon.com/shoptools
GA424A
SERVICIO DE MOTOR
@]jjYea]flYk\]k]jna[ag
PRT16
YA7200
YA8640
YA9870
YA6760
YA65500
YA4590A
YA6551
@]jjYea]flYk]kh][aYd]k
YA7200 Llave para módulo de encendido de Ford.
Para módulos de encendido de Ford modelo 1982 y posteriores. Los
extremos de trinquetes se compensan a 25 grados. Un extremo tiene
7/32" y 6 puntas; el otro extremo una broca T20 Torx®.
@]jjYea]flYk]kh][aYd]kº:dm]%Hgafl®
PRT16 Extractor de varilla a presión. Se usa en motores
GM V6 2.8L, 3.1L y 3.4L. Extrae rápidamente las varillas de presión
de modo que las juntas de entrada se puedan reemplazar fácilmente.
No es necesario aflojar o reajustar el brazo del balancín. La
herramienta desplaza el brazo del balancín para comprimir el resorte
de la válvula y liberar la varilla de presión.
YA7200 Llave para módulo de encendido de Ford.
Para módulos de encendido de Ford modelo 1982 y posteriores. Los
extremos de trinquetes se compensan a 25 grados. Un extremo tiene
7/32" y 6 puntas; el otro extremo una broca T20 Torx®.
YA8640 Llave de correa de leva. Para VW y Audi. Para
ajustar las correas de engranaje del árbol de levas que tiene poleas
intermedias con orificios para pasadores. Agarre de empuñadura
de vinilo.
YA6760 Sostén de la olea de la correa de
sincronización (VW/Audi). Sostiene el extractor del cigüeñal
fijo para remover los pernos del cigüeñal e instalarlo según el
requisito de torque de fábrica. Diseño de 3 pernos para sujetarlo
de manera segura. Cuadro de 1/2" para utilizarlo con un mango
articulado. Termotratada para mayor resistencia. Acabado negro
de gran calidad. Aplicaciones:Turbo de 1.8L de 4 cilindros: VW y Audi
1998-20062.0L de 4 cilindros: VW 1993-2005Turbo de 2.0L de 4
cilindros: VW y Audi modelo 2006 y posteriores
YA9870 Llave inglesa para tensar poleas. Ajusta
fácilmente las correas de engranaje del árbol de levas que posean
poleas intermedias con orificios para pasadores en vehículos
Mitsubishi, Plymouth y Eagle. Los pasadores que sobresalen de la
llave agarran el centro de la polea intermedia y lo rota alrededor de
su perno de retención descentrado. Esta rotación permite el ajuste
ADVERTENCIA
de tensión de la correa de engranaje del árbol de levas. Diseñado
para usarse en: Mitsubishi Eclipse modelo 1990-93 , Eagle Talon y
Plymouth Laser 2,0L DOHC (no turbo), Plymouth Laser 2,0L DOHC
(turbo) modelo 1990-93, Mitsubishi Eclipse y Eagle Talon 2,0L DOHC
(turbo) modelo 1990 y posteriores, Mitsubishi Montero 3,5L DOHC
modelo 1994-96 , Mitsubishi Montero 3,5L SOHC modelo 1994 y
posteriores, Mitsubishi Galant 2.4L SOHC modelo 1994 y posteriores
y Mitsubishi Mirage 1,8L SOHC modelo 1994 y posteriores.
YA4590A Soporte del capó. El eje telescópica de tres
piezas se traba en cualquier posición. El rango es de 20" a 48
1/2". Funcionará en el frente o en los costados de cualquier auto o
camión. Fabricado de tubos de acero y se caracteriza por palancas
de traba en cada sección. Incluye un soporte de sujeción para evitar
el deslizamiento.
YA65500 Removedor de sello de leva. Esta herramienta
especial acelera la remoción del sello del árbol de levas en la
mayoría de los motores V6 Toyota y Lexus. Diseño exclusivo de la
copa que presiona y tira elimina el dificultoso método mediante
enganche. Se usa en Toyota 3.0L y 3.3L V6 (1996 y posteriores) y
Lexus 3.0L y 3.3L V6 (1990 y posteriores). El juego incluye copa,
varilla de presión, arandela, tuerca y perno largo. Fabricados en acero
de aleación con tratamiento térmico.
YA6551 Removedor/Instalador de sello de leva. El
juego ofrece una remoción e instalación precisa y rápida de la junta
del árbol de levas en motores V6 de 3.0L y 3.3L V6 Toyota (1996 y
posteriores) y Lexus (1990 y posteriores). Elimina la posibilidad de
daño en el árbol de levas. Acero de aleación tratado térmicamente
y accesorios de gran calidad. Incluye remoción de copa, varilla de
presión, arandela, tuerca y perno largo.
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
515
SERVICIO DE MOTOR
Herramientas de servicio
YA6010
CJ146
HIW3
YA188G
YA6490
Compensador armónico
YA188G Instalador de compensador armónico–Blue-Point®.
Incluye 7 adaptadores para usar en una gran variedad de motores. Tamaños
de adaptadores: 7/16"-20, 1/2"-20, 9/16"-18, 3/4"-16, M12 x 1.5, M14 x
1.5 y M16 x 2.0.
YA188-13C Adaptador métrico. Opcional M10 x 1.5 para YA188C.
YA6010 Herramienta de sostén para polea de amortiguador
armónico-Blue-Point. Ahorra tiempo al momento de remover e
instalar el perno del cigüeñal en la mayoría de los motores Honda y Acura.
Al utilizarla con un mango articulado o trinquete con cuadro de 1/2”, evita
que la polea gire mientras se remueve/instala el perno de la polea. Puede
utilizarse en la mayoría de los motores Honda (Accord, Civic, CRV, Del Sol,
Insight, Odyssey, Prelude y S2000) y Acura (CL, Integra, Legend, NSX, RL
y TL). Verifique la cobertura exacta de modelo/tamaño de motor en las
instrucciones de las herramientas.
CJ146 GM Juego de compensador armónico de cigüeñal.
Extrae el compensador armónico de cigüeñal en los motores GM de 1990 y
modelos posteriores de 3.3L y 3.8L. Los adaptadores para perno con reborde
ofrecen la profundidad de instalación correcta y evitan el daño al sensor del
cigüeñal y los anillos interruptores. Incluye (3) adaptadores CJ146-1 y (1)
extensión CJ146-2 más una bolsa de almacenamiento de vinilo. Se requiere un
yugo CJ98-1 Snap-on® y tornillo de presión CJ83-3 para usar (no se incluyen).
YA6470 Herramienta de sostén para polea de amortiguador
armónico. Herramienta de sostén para polea de amortiguador armónico
para camiones y SUV GM. Aplicaciones: Motores GEN III 4.6L, 5.3L y 6.0L V8
modelo 1999 y posteriores. Extrae e instala con facilidad el perno que sostiene
la polea. El acabado industrial negro ayuda a proteger contra la corrosión.
HIW3 Llave de impacto manual-Blue-Point. Extrae/reemplaza las
poleas de los compensadores armónicos sin extraer el radiador. Accede a
áreas restringidas donde no entra una llave de impacto neumática o cuando
no hay un suministro de aire disponible. Se utiliza con cualquier dado de
impacto de 1/2". Protección de empuñadura de goma moldeada. Torque
máx.: 600 pies lb. Largo total: 22.06"
S9842A
Interruptor de vacío térmico
S9842A Dado para interruptor de vacío térmico. Para vehículos
nacionales hasta 1988. Abertura de la llave de 6 puntas de 7/8", cuadro de
1/2". 3 1/8" de largo.
YA6490 Extractor para polea de amortiguador armónicoBlue-Point. Se usa en la mayoría de los motores Chrysler, Mitsubishi y
GM. En la mayoría de las aplicaciones esta herramienta compacta elimina
la necesidad de remover el radiador antes de remover la polea. Incluye 4
varillas a presión para uso en cigüeñales que no están perforados totalmente.
Aplicaciones:
GM
2.8L 4 cilindros rectos: Chevy Colorado, GMC Canyon (modelo 2005 y
posteriores)
3.5L 5 cilindros rectos: Chevy Colorado, GMC Canyon (modelo 2004 y
posteriores), Hummer H3 (modelo 2006 y posteriores)
motor de 4.2L de 6 cilindros en línea: Chevy Trailblazer, GMC Envoy,
Olds Bravada (modelo 2003 y posteriores), Buick Rainier (modelo 2004 y
posteriores)
motor V8 de 5.7L (Gen III): Camaro, Corvette, Firebird y Trans-Am (modelo
1997 y posteriores), camiones
Gen III y SUV con 4.8L V8, 5.3L V8, 6.0L V8 y 8.1L V8 (modelo 2000 y
posteriores)
Chrysler
2.0L 4 cilindros, 2.4L 4 cilindros y 2.5L V6 (automóviles modelo 1985 y
posteriores)
2.7L DOHC V6, 3.2L SOHC V6 y 3.5L SOHC V6 (automóviles modelo 1998 y
posteriores)
3.3L V6: (vans modelo 1990 y posteriores)
3.3L y3.5L V6 (automóviles modelos 1993-1997)
3.8L V6 (vans modelo 1994 y posteriores)
4.7L V8 (modelo 1998 y posteriores)
8.0L V10 (camionetas modelo 1994 y posteriores)
Cadillac
4.5L V8: (1988-1992)
4.6L V8: (modelo 1993 y posteriores)
4.9L V8: (1991-1995)
6.0L V8: Escalade
Mitsubishi
2.0L DOHC sin turbo: Eclipse (1995-1999)
Oldsmobile
4.0L V8: (1995 y posteriores)
YA6491 Juego de actualización de extractores para polea de
amortiguador armónico. Actualiza las poleas YA9740 anteriores para las
mismas aplicaciones que la nueva YA6490. El juego también actualiza otros
extractores para poleas que son similares a los de la serie YA9740.
YA5500
Giro/Movimiento
S6158
S6158 Dado para trabar el motor. Para bloque pequeño V8s
Chevrolet de 4L a 6.6L. Diseñado para dar vuelta el motor cuando se
encuentra sobre su soporte. Cuadro de 1/2".
516
YA5500 Llave para volante. Para vehículos nacionales e
importados. Útil para autos con acceso muy limitado para utilizar llaves
tipo inglesas. Deslice sobre el borde del volante y gírelo en la dirección
deseada. 8 13/16" de largo. Empuñadura recubierta de vinilo.
www.snapon.com/shoptools
VÁLVULA
@]jjYea]flYk\]k]jna[ag
KRA16APV
YA8830
YA8830 Soporte para culata de cilindro. Sujeta la culata del
cilindro arriba y alejada del banco de trabajo y permite que quede espacio
para los medidores. La barra de acero se sujeta a una morsa del banco. Sólo
deslícelo en los brazos móviles, que se ajustan a la mayoría de cualquiera de
las configuraciones de las cabezas de acero o aluminio.
KRA16APV Soporte para válvula. (16) orificios de 11/16" brindan
fácil acceso a las válvulas. Está colgado en el gabinete rodante o en armario
de herramientas con borde de 1/4" o más.
YA8895
S6132A
@]jjYea]flYkelja[Yk\]Ybmkl]lahg[gfljYlm]j[Y%
:dm]%Hgafl®
Incluye un destornillador de ajuste intermedio dentro de un dado y un
mango para sujetar en su lugar un tornillo de ajuste mientras que se aprieta
la contratuerca. La empuñadura va de un lado a otro, de modo tal que la
"ventana" del dado se encuentre siempre visible.
YA8895 Herramienta para el ajuste de válvulas. Para todos los
vehículos con tornillos de válvulas con contratuerca de 10mm.
YA8880 Herramienta para el ajuste de válvulas. Para todos los
vehículos con tornillos de válvulas con contratuerca de 12mm.
<Y\ghYjYh]jfg\]lYhY
S6132A Dado métrico para perno de tapa de la válvula.
Para GM y Honda modelo 1976 y posteriores; otros vehículos nacionales
e importados. El tamaño de la llave de 12 puntas es de 10mm. Permite
el acceso a pernos de cabeza, tapa de válvula y balancín, y pernos del
cárter. Profundidad de espacio para pernos con punta extendida como los
utilizados en el arnés del cable de la bujía. Cuadro de 3/8", D.E. de 11/16".
4 1/8" de largo.
YA8825
@]jjYea]flYkhYjY]dYbmkl]\]n~dnmdYkº:dm]%Hgafl
Herramientas para el ajuste de válvulas (para VW actual). Estas dos herramientas fueron diseñadas para usarse juntas en todos los modelos posteriores que
requieren la herramienta VW N.º 2078, que incluye todos los vehículos VW de 5 cilindros y Audi 5000.
YA8825 Herramienta para el ajuste de válvulas. Para motores Toyota y otros motores con árbol de levas de cabezas que utilizan calzas
espaciadoras. Las pinzas de calzas separan la calza y el árbol de levas lo que permite la colocación de la herramienta de cuña incluida YA8825-1 entre el borde
del levantador de válvula y el árbol de leva para reemplazar fácilmente la calza.
YA8825-1 Herramienta de cuña. La herramienta de cuña se coloca entre el borde del levantador de válvula y el árbol de levas para reemplazar
fácilmente la calza.
ADVERTENCIA
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
517
VÁLVULA
Levantadores / Compresores
CF811B
Levantadores de válvulas–BluePoint®
CF811B Compresor de grampa C.
Capacidad de 1" a 2". Para motores de alta
compresión con cabeza en "L", cabeza en
válvula y vehículos con válvulas de cabezas.
El mecanismo de activación evita que el
resorte de la válvula se levante cuando se
lo comprime.
YA9140A
CF19B
CF19B Compresor de
grampa C. Este modelo compacto
incluye mordazas CF19-3A para resortes
de 1/4" a 1 1/16" de diámetro en
motores pequeños, refrigerados por
aire y mordazas CF19A5 para resortes
de 17 mm y 20.8 mm de diámetro en
motores Honda.
CF700B
CF700B Compresor de resorte de
válvula. Capacidad de 7/8" a 2 1/2". Opera
desde 90 a 150 PSI, pero desarrolla una presión
de salida de hasta 3 veces superior. Tamaño de la
herramienta de 1" x 8".
CF22E Juego de mordaza de
reemplazo. Mordazas de compensación
medianas con capacidad de 1" a 2". Para
CF811B y CF700B.
CF21B Juego de mordaza opcional.
Mordazas rectas y pequeñas con capacidad de
7/8" a 1 7/8". Para CF811B and CF700B.
CF23A Juego de mordaza opcional.
Para CF811B y CF700B. Mordazas rectas y
grandes con una capacidad de 1 1/2" a 2 1/2".
YA3271
VST100
Compresores de resorte de
válvula–Blue-Point
YA9140A Compresor de resorte
de válvula universal. Remueve/
instala el resorte de la válvula sin remover
la culata del cilindro del motor. Servicio
nacional e importado de motores con
levas en culata, entre los que se incluyen
Audi, Chrysler, Infiniti, Honda, Hyundai,
Lexus, Mazda, Mitsubishi, Nissan, Porsche,
Saturn, Toyota, Volvo y VW.
YA3271 Compresor de
resorte de válvula. Para la
mayoría de los vehículos y camiones
con válvulas en culata. Funciona
con la culata del cilindro dentro o
fuera del motor. La rueda manual
removible brinda la opción de
usar un dado o llave de 5/8" en
cuartos confinados.
VST100 Compresor de resorte de
válvula que funciona con leva. Elimina la
necesidad de remover el cilindro y de reajustar la
herramienta a cada resorte. Trabaja en la mayoría
de los motores de válvula en culata.
S6121
CG90
Depresores de resortes de válvula
S6121 Depresor de resortes de válvula. Para el motor actual
de Pontiac L4 2.5L, V6 2.8L y para todos los motores actuales de Chevrolet
Pontiac V8. También para el modelo 1980 de AMC Spirit. Sujeta el perno del
brazo del balancín y presiona el resorte de la válvula. La ranura deja libre el
retén de válvula para una fácil remoción. 10" de largo.
518
CG90 Depresor de resortes de válvula. La acción de
autonivelación compensa cualquier resorte de ángulo de hélice. Se
puede ajustar el largo de la mordaza. Tiene igual fuerza de extracción
en ambas mordazas.
www.snapon.com/shoptools
VÁLVULA
@]jjYea]flYk\]k]jna[ag
GA318A
GA317
GA285
YA6380
@]jjYea]flYk\]j]lfhYjYn~dnmdYkº:dm]%Hgafl®
@]jjYea]flYkhYjY]d~jZgd\]d]nYk'[a_]Ydº:dm]%Hgafl
GA318A Herramienta para válvulas en culata.
sRemueve y cambia retenes de válvulas en todos los motores a
gasolina y diesel con válvulas en culata, incluso los motores de VW
Rabbit, motocicletas, embarcaciones y aeronaves
sRetiene los retenes magnéticamente y no torcerá los vástagos de las
válvulas. Use en lugar de los compresores de grampas C o de otro tipo
s5SESØLOCONMARTILLOSDESUPERFICIESUAVE
GA317 Extractor/instalador métrico de retenes para válvulas.
s%XTRAEEINSTALARÉPIDAMENTELOSRETENESDEVÉLVULASENLAMAYORÓADELOS
motores con levas en culata con juntas de vástagos de 4.5 a 7.5 mm
s0RESIONEOGOLPEELAHERRAMIENTACONUNMARTILLOPARAREMOVERLOS
retenes de válvulas
s5NIMÉNENELCUERPODELAHERRAMIENTACAPTURALOSRETENESPARA
retirarlos y desmontar la válvula rápidamente
s0ARAINSTALARLOSRETENESCARGUELOSRETENESLUEGOPRESIONEO
golpee para su instalación
s3EPUEDEUSARENELVEHÓCULOOSOBREBANCODETRABAJO
GA285 Juego para remover e insertar cojinetes del
árbol de levas.
sRemueve e inserta cojinetes en todos los motores
sCinco tapones de accionamiento manejan un rango de 1.475" a 2.690"
s&UNCIONAENCOJINETESUNTANTOPORENCIMAOPORDEBAJODE
sus dimensiones
s#AJAPLÉSTICARESISTENTE
YA6380 Juego de instalador de junta del árbol de levas.
s)NSTALEFÉCILYRÉPIDAMENTELAJUNTADELCIGàE×ALENLAMAYORÓADE
los motores de 4 y 6 cilindros que tienen pernos de leva de 10 mm
YMMX
VL2
YA8230
GA264A
YA6290
YA6770
K]jna[ag_]f]jYdº:dm]%Hgafl
YA8230 Pinzas para junta de vástagos de válvulas.
sRemueven las juntas de vástagos de válvulas en los motores con árbol
de levas en culata, incluidos los de 4 válvulas por cilindro que tienen
acceso restringido a la junta de vástago de válvula
s,ASMORDAZASSERRADASENLAPUNTADELASPINZASTOMANFÉCILMENTELAS
juntas OEM y las comerciales sin problemas
s%MPU×ADURASDEAGARREFÉCIL
GA264A juego de desviador de aceite.
sPara motores con varillas de presión lubricadas a presión
s,OSDESVIADORESSEAGARRANENLOSBALANCINESYDESVÓANACEITEDELOS
ORIFICIOSDEALIMENTACIØNPARAENVIARACEITEALMOTORYELIMINARSALPICADURAS
s,OSDIECISÏISDESVIADORESESTÉNFIJADOSAUNPANELDEALMACENAMIENTO
metálico
Soportes de válvulas.
s#ADAUNOINCLUYECOPASDESUCCIØNDEGOMAPARAUSARCUANDOSE
esmerila a mano las válvulas sin ranuras de cabeza plana
s%MPU×ADURADEMADERAMACIZA
VL2 Soporte de válvulas. Copas de succión de 5/8" y 13/16" de diámetro.
VL3 Soporte de válvulas. Copas de succión de 1 1/8" y 1 3/8" de diámetro.
YA6290 Pinzas para junta de vástagos de válvulas.
sSe utiliza en áreas restringidas con problema de espacio sobre la
culata del cilindro
s,ACABEZADELAPINZAROTADEªAª
s,APUNTADELAMORDAZAPRESENTAUNBORDEDELGADOPARA
ENGANCHARLADEBAJODELASJUNTASDEVÉSTAGOSDEVÉLVULASDIFÓCILES
s,OSCUATROREBORDESVERTICALESENLASMORDAZASAYUDANASOSTENER
la junta de vástagos de válvulas
s!GARREDEEMPU×ADURADEVINILOPARAMAYORCOMODIDADYCONTROL
YA6770 Extractor de arandela magnético.
s 2EMOCIØNDEARANDELASSINOBSTÉCULOSPARAÉREASDIFÓCILES
de alcanzar
s(ERRAMIENTADEEXTREMODOBLECONIMANESPEQUE×OSPARA
AYUDARAREMOVERARANDELASENLUGARESDIFÓCILESDEALCANZARQUESE
ENCUENTRANENLAMAYORÓADELOSTIPOSDEPERNOS
s4AMBIÏNSEUSAPARAAYUDARALTÏCNICOENLAREMOCIØNDEBALDESY
discos de ajuste de válvulas
s(ERRAMIENTALIVIANAYDURADERADENYLONYPLÉSTICOCONRELLENO
de vidrio
@]jjYea]flYk\]k]jna[ag\]_mY\]n~dnmdY
PHG83A
AC10A
J]egn]\gj]kelja[gk\]_mY\]n~dnmdY
Diseñado para utilizar con martillos neumáticos de Snap-on®.
También se pueden utilizar como punzones para pasadores.
PHG97A Extractor de guías de válvulas. Piloto de 5.2 mm. 189 mm de largo.
PHG96A Extractor de guías de válvulas. Piloto de 6.9 mm. 189 mm de largo.
PHG83A Extractor de guías de válvulas. Piloto de 7.7 mm. 190 mm de largo.
PHG86A Extractor de guías de válvulas. Piloto de 9.3 mm. 190 mm de largo.
ADVERTENCIA
;]haddgk\]_mY\]n~dnmdYº:dm]%Hgafl
El alambre del cepillo está tejido en hebras de alambre retorcido.
Cada uno tiene una empuñadura de madera acanalada.
AC10A Cepillo de guía de válvula. Cepillo de 5/16" de diámetro.
AC11A Cepillo de guía de válvula. Cepillo de 11/32" de diámetro.
AC12A Cepillo de guía de válvula. Cepillo de 3/8" de diámetro.
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
519
CILINDRO/PISTÓN
Rectificadoras
Servicio estándar–Blue-Point®
CF61CS
CF61CS Rectificador de cilindro.
s0ARACILINDROSDEADEDIÉMETRO
s#ONCENTRALIZACIØNYDESCENSOAUTØNOMOCONLIMITADORESDESEPARACIØNPARACONTROLAREL
DIÉMETRODELARECTIFICACIØN
s,AACCIØNDELRESORTELEOTORGALATENSIØNCORRECTACUANDOUTILIZAUNTALADROELÏCTRICO
s)NCLUYEPIEDRASDEGRANOSMEDIOS
s4ODASLASPIEDRASDISPONIBLESSONDEDELARGO
CF61-100 Juego de piedras. PIEDRASDEGRANOSGRUESOS
CF61-12S Juego de piedras. PIEDRASDEGRANOSMEDIOS
CF61-14S Juego de piedras. PIEDRASDEGRANOSFINOS
CF62CS Rectificador de cilindro. 3IMILARAL#&#3PEROPARACILINDROSDEA
DEDIÉMETROCONPIEDRASMÉSGRANDES)NCLUYETRESPIEDRASDEGRANOSMEDIOS
4ODASLASPIEDRASDISPONIBLESSONDEDELARGO
CF62-100 Juego de piedras. PIEDRASDEGRANOSGRUESOS
CF62-12S Juego de piedras. PIEDRASDEGRANOSMEDIOS
CF62-14S Juego de piedras. PIEDRASDEGRANOSFINOS
Herramientas de servicio de cilindros
WR30A
GA3627
Escariador de fila–Blue-Point
Diámetros internos de cilindros
WR30A Escariador de filo.
s%SCARIADORTIPOTORNOPARACILINDROSCONUNDIÉMETRODE
3" a 5"
s3ECENTRAENELCILINDRO
WR30A10 Broca del cortador de reemplazo.
GA3627 Calibrador del diámetro interno de cilindro.
s-IDEELDESGASTEDELOSCILINDROSSINREMOVERLOSPISTONES
s0UEDEVERIFICARELDIÉMETRODELCILINDROCUANDOSEUSACONMICRØMETRO
s%LRANGOESDEAENINCREMENTOSDEYMIDELAPROFUNDIDADDELDIÉMETRO
interno de 8".
s)NCLUYECALIBRADORSEISEXTENSIONESYMÉSCAJADE
ALMACENAMIENTO
Pistón, herramientas de servicio del pistón.
Expansores de aros
PRS8
PRS8 Expansores de aros del pistón.
sInstala los aros del pistón de 3/64" a 1/4" de espesor
s%LIMINALAROTURAODISTORSIØNDELOSAROS
sDELARGO
PRS10 Expansores de aros del pistón.
sCapacidad de aros de 2 3/4" a 4 1/4".
s2EMUEVEOINSTALAAROSCORTADOSENFORMARECTAODIAGONAL
s,ATENSIØNDELRESORTEELIMINALANECESIDADDEAJUSTE
PRS12 Expansores de aros del pistón.
s3IMILARA023PEROCONUNACAPACIDADDEAROSDEA
s%XCELENTEPARALASAPLICACIONESDIESELDESERVICIOPESADO
PRS10
520
www.snapon.com/shoptools
PISTÓN
Haklf$`]jjYea]flYk\]k]jna[ag\]dhaklf&
RC40C
RCL30
RCW60
RC150A
RC500
RC980
RC510A
;gehj]kgj]k\]Yjgk
DaehaY\gj]k\]jYfmjYk\]Yjgk
El control del embrague sujeta la banda de tensión en posición a medida
que el pistón se introduce en el cilindro. Las bandas de resortes de 1/2"
de ancho equilibran la tensión sobre el espesor de la correa de manera tal
que el conjunto de aros se comprima en la ranura hasta que esté al ras con
el pistón. Las cuentas en “V” en el borde inferior de la correa evitan que la
herramienta ingrese al cilindro. El RC40C se puede usar invertido para los
camiones Chevrolet, Mercury y Ford con bloques en ángulo.
RC150A Compresor de aros. 4 banda. Capacidad de 3 1/2" a 7". 7"
de profundidad.
RC50C Compresor de aros. 2 banda. Capacidad de 3 1/2" a 7".
Profundidad 3 1/2".
RC40C Compresor de aros. 2 banda. Capacidad de 2 1/8" a 5".
Profundidad 3 1/2".
RCL30 Compresor de aros. 1 banda. Capacidad de 2 1/2" a 5".
Puede desmontarse y retirarse conectando la varilla cuando se lo utiliza en
motores pequeños de aeronaves, motocicletas u otros motores que requieren
que el cilindro sea empujado por sobre el pistón durante el montaje.
RCW60 Compresor de aros. 1 banda. Capacidad de 3" a 5".
Profundidad 1 1/2". Cuenta con una construcción de banda de pliegue de
baja fricción con tornillo de ajuste manual para un ajuste preciso. También se
puede utilizar en motores pequeños de aeronaves y motocicletas en donde
los cilindros se empujan por sobre el pistón durante el montaje.
RC980 Juego de compresor de aros. Funciona tanto vertical como
horizontalmente con empuñadura de agarre de pinzas. Ofrece un mecanismo
de trinquete de dientes finos. Incluye 6 bandas de acero endurecido: 2 7/8"
a 3 1/8", 3 1/8" a 3 3/8", 3 3/8" a 3 5/8", 3 5/8" a 3 7/8", 3 7/8" a 4 1/8",
y 4 1/8" a 4 3/8".
RC980-7 Banda opcional. Capacidad de 4 1/2" a 4 3/4".
RC980-8 Banda opcional. Capacidad de 4 3/4" a 5".
RC980-9 Banda opcional. Capacidad de 5" a 5 1/4".
RC980-10 Banda opcional. Capacidad de 5 1/2" a 5 3/4".
RC980-11 Pinzas de reemplazo.
RC500 Limpiador de ranuras de aros del pistón. Para
pistones con ranuras de 5/64", 3/32", 1/8", 5/32" y 3/16" con diámetros
de 2 1/2" a 5".
RC500-1 Hoja de reemplazo del cortador. Hoja de reemplazo del
cortador.
RC500-11 Hoja opcional del cortador. Para ranuras de 1/8", 1/4",
5/16", 2.5 mm y 3 mm.
RC510A Limpiador de ranuras de aros del pistón. Para pistones
con ranuras de 5/64", 3/32", 1/8", 5/32" y 3/16" con diámetros de 1" a 5".
RC510-1 Rueda de reemplazo del cortador.
RC510-6 Tuerca estriada de reemplazo.
RC510-3 Adaptador. Adapta el RC510A para usarlo en pistones con
diámetros de 1" a 2 3/4".
RC510-7M Rueda cortadora métrica opcional.
ADVERTENCIA
HLE24
EYjladdg\]_gdh]k][g
HLE24 Martillo de golpe seco del pistón. Fabricado en
materiales que no dañan el pistón. La cabeza rellena a chorro reduce en gran
medida el rebote. La longitud de la cabeza es 7 3/4". El diámetro es de 1
1/4" a 1 1/2" con un alcance de 5 1/2" al reborde de la empuñadura. El largo
total es de 12 3/4".
@~_Ydg^mf[agfYjkdgkadYj][laÇ[Y\gjk]]f[m]fljY\]fljg\]d[adaf\jg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
521
BUJES/JUNTAS
Juego de colocador/removedor
A57CA
A57-37
ME4A2
ESD1428
A57Q
A57-3
A57-36
A57-27
A57-15
A57-16
A57-18
A57-14A
A57-8
A57Q Juego de colocador/
removedor de bujes.
s0ARABUJESESTÉNDARY
ESPECIALIZADOSENBRONCEACERO
GOMAO%NLOX
s%LRANGODETAMA×OSDE
ADAPTADORESABARCACASITODOSLOS
BUJESDEGRILLETESYDIRECCIØN
s,OSNUEVOSBUJESSEINSERTAN
AJUSTANDOELTORNILLOLOQUECOLOCA
ALBUJEENSULUGARSINNECESIDAD
DEMARTILLAR
Pieza No.
A57CA
A57-35
ME4A2
ME4A4
A57-3
A57-37
A57-39
A57-41
A57-38
ESD1428
ME11A1
A57-36
A57-27
Pieza No.
A57-5
A57-11
A57-46
A57-20
A57-45
A57-42
A57-48
A57-44
A57-43
A57-15
A57-16
A57-17
A57-26
A57-18
A57-25
A57-14A
A57-8
A57-19
A57-7
A57-6
A57-5
A57-24
A57-10
A57-11
A57-22
A57-12A
A57A13
A57-46
A57-20
A57-23A
s%LMANGUITOPERMITEFORZARLOSBUJES
VIEJOS
s%SÞTILCUANDOELESPACIOLIMITADO
NOPERMITESACARLOS
s,OSCINCOADAPTADORESMÉS
PEQUE×OSSEUTILIZANSØLOCONEL
IMPULSADORMÉSPEQUE×O
Descripción
Tornillo 1/2"-20)
Tornillo (5/8"-18)
Tuerca (1/2"-20)
Tuerca (5/8"-18)
Arandela (1/2" D.I, 1 1/4" D.E.)
Adaptador de manguito (0.500" D.I. x 0.625" D.E.)
Adaptador de manguito (0.640" D.I. x 2.047" D.E.)
Adaptador de manguito (1.000" D.I. x 2.047" D.E.)
Adaptador de manguito (1.500" D.I. x 2.047" D.E.)
Cojinete (1/2" D.I., 1" D.E.)
Cojinete (5/8" D.I., 1 1/8" D.E.)
Manguito (4 15/16" de largo, 2 1/16" D.I.)
Extractor (1/8"-27 rosca ahusada)
Dimensiones, Dimensiones, Dimensión,
Medidas,
pulgadas
pulgadas
pulg. D.I.
pulgadas D.E.
D.E.
D.E. Pequeño
grande
grande
Impulsador de bujes para adaptadores A57-16 a A57-26
0.339
0.434
—
—
0.430
0.497
—
—
0.492
0.622
—
—
—
0.493
—
0.559
—
0.554
—
0.684
Impulsador de bujes para adaptadores A57-8 a A57-20
0.555
0.622
—
—
0.601
0.668
—
—
0.618
0.747
—
—
0.678
0.809
—
—
0.728
0.856
—
—
0.742
0.997
—
—
0.789
0.918
—
—
—
0.851
—
0.980
—
0.907
—
1.046
—
0.919
—
1.027
—
0.993
—
1.122
—
1.034
—
1.136
—
1.055
—
1.184
—
1.101
—
1.230
!DAPTADORESGRANDES
A57-49
522
A57-51
A57-45
A57-42
A57-48
A57-29
A57-40
A57-44
A57-43
A57-47
A57-49
A57-51
A57-50
—
—
1.206
1.222
1.367
—
—
—
—
—
—
www.snapon.com/shoptools
1.250
1.406
1.500
1.372
1.625
1.812
—
—
—
—
—
1.125
1.187
—
—
—
1.375
1.625
1.859
—
—
—
—
—
—
—
—
—
2.000
2.000
13/16 de abertura
17/32 de abertura
1 3/8 de abertura
BUJES/JUNTAS
Bm]_gk\]aehmdkY\gj]k
9)+)(9;gehgf]fl]k\]dbm]_g
Pieza No.
Descripción
Empuñadura (5 3/4" de largo)
Collarín (1 9/16" de largo)
Collarín (1 3/4" de largo)
Collarín (1 31/32" de largo)
Collarín (2 5/16" de largo)
Collarín (2 15/32" de largo)
Collarín (2 27/32" de largo)
Collarín (2 27/32" de largo)
Collarín (3" de largo)
Collarín (3 3/16" de largo)
A1306-1
A1306-2
A1306-3
A1306-4
A1306-5
A1306-6
A1306-7
A1310-1
A1310-2
A1310-3
A1310A
Bm]_g\]aehmdkY\gj\]bmflYkqYdgbYea]flgk\][gbaf]l]
A1310A Juego de impulsador de juntas y guías de cojinete–
®
Blue-Point . Los anillos caben en la mayoría de las medidas de los cojinetes
de rueda estándar. Las tres medidas más grandes caben en la mayoría de los
vehículos último modelo con tracción en las cuatro ruedas.
9)-/;;gehgf]fl]k\]dbm]_g'Y\YhlY\gj]k
D.I.,
pulgadas.
Empuñadura de
impulsador grande
Empuñadura de
impulsador mediano
Empuñadura de
impulsador pequeño
Tuerca de impulsador,
5/16"-24
Tuerca de impulsador,
1/2"-20
3/8
D.E.,
pulgadas.
Pieza No.
D.I.,
pulgadas.
D.E.,
pulgadas.
—
A157-11
5/8
3/4
—
A157-12
11/16
13/16
—
A157-13
3/4
7/8
—
A157-14
13/16
15/16
—
A157-15
7/8
1
7/16
A157-16
15/16
1 1/16
A157-22
15/32
17/32
A157-17
1
1 1/8
A157-7
7/16
1/2
A157-18
1 1/16
1 3/16
Pieza No.
A157-1
A157-2
A157-3
A157-4
A157-5
A157-6
A157-8
1/2
5/8
A157-19
1 1/8
1 1/4
A157-9
9/16
11/16
A157-20
1 3/16
1 5/16
A157-10
5/8
11/16
A157-21
1 1/4
1 3/8
A157C
Bm]_g]kl~f\Yj\]aehmdkY\gj]khYjYZmb]k
A157C Juego estándar de impulsadores para bujes. Los
adaptadores se fijan a los impulsadores con una tuerca estriada. Los
impulsadores pequeños y medianos (A157-3 y A157-2) ajustan todos los
bujes más pequeños (de A157-6 a A157-12); el impulsador grande
(A157-1) ajusta los bujes restantes (de A157-13 a A157-22). Viene en
caja de almacenamiento PB20.
9)-0:;gehgf]fl]k\]dbm]_g'9\YhlY\gj]k
D.E.,
pulgadas.
Pieza No.
D.I.,
pulgadas.
D.E.,
pulgadas.
—
A257-26
1 1/2
1 5/8
—
A257-27
1 9/16
1 11/16
A257-23
D.I.,
pulgadas.
Empuñadura de
impulsador grande
Tuerca de impulsador,
1/2"-20
1 5/16
1 7/16
A257-28
1 5/8
1 3/4
A257-24
A257-25
1 3/8
1 7/16
1 1/2
1 9/16
A257-29
A257-30
1 11/16
1 3/4
1 13/16
1 7/8
Pieza No.
A257-1
A157-5
9*-/;gehgf]fl]k\]dbm]_g'9\YhlY\gj]k
Pieza No.
A257-1
A157-5
A257-23
A257-24
A257-25
A257-26
A257-27
A257-28
A257-29
A257-30
A257-31
A257-32
A257-33
A257-34
A257-35
D.I.,
pulgadas.
Empuñadura de
impulsador grande
Tuerca de impulsador,
1/2"-20
1 5/16
1 3/8
1 7/16
1 1/2
1 9/16
1 5 /8
1 11/16
1 3/4
1 13/16
1 7/8
1 15/16
2
2 1/16
ADVERTENCIA
D.E.,
pulgadas.
Pieza No.
D.I.,
pulgadas.
D.E.,
pulgadas.
—
A257-36
2 1/8
2 1/4
—
A257-37
2 3/16
2 5/16
A257-38
A257-39
A257-40
A257-41
A257-42
A257-43
A257-44
A257-45
A257-46
A257-47
A257-48
A257-49
1/4
2 3/8
2 7/16
2 1/2
2 9/16
2 5/8
2 11/16
2 3/4
2 13/16
2 7/ 8
2 15/16
3
3 1/16
7/16
1
1 1/2
1 9/16
1 5/8
1 11/16
1 3/4
1 13/16
1 7/8
1 15/16
2
2 1/16
2 1/8
2 3/16
2
2 5/16
2 3/8
2 7/16
2 1/2
2 9/16
2 5/8
2 11/16
2 3/4
2 13/16
2 7/8
2 15/16
A158B
Bm]_g\]aehmdkY\gj]khYjYZmb]k\]k]jna[agh]kY\g&
A158B Juego de impulsadores para bujes de servicio
pesado. Incluye ocho adaptadores básicos para el ajuste de bujes en
camiones, tractores y ómnibus. Los adaptadores se fijan al eje del impulsador
roscado por medio de una tuerca estriada. Acabado industrial. Viene en caja
de almacenamiento PB34.
A257
Bm]_g[gehd]lg\]aehmdkY\gj]khYjYZmb]k\]k]jna[agh]kY\g
A257 Juego completo de impulsadores para bujes de servicio
pesado. Complementa el juego A157C al incorporar 27 adaptadores grandes
para trabajos de transmisión, así como muchas otras aplicaciones automotrices
e industriales. El juego se entrega en caja plástica PB27. Acabado industrial.
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
523
BUJES/JUNTAS
Juegos de mangos
A160M Componentes
Pieza No.
Pieza No.
Descripción
A160M6
Adaptador (18-20mm)
A160M7
Adaptador (20-22mm)
A160M8
Adaptador (22-24mm)
A157-4
Descripción
Empuñadura de impulsador
grande
Empuñadura de impulsador
mediano
Empuñadura de impulsador
pequeño
Tuerca del impulsador, 5/16"-24
A160M9
Adaptador (25-27mm)
A157-5
Tuerca del impulsador, 1/2"-20
A160M10
Adaptador (28-30mm)
A160M1
Adaptador (10-12mm)
A160M11
Adaptador (30-34mm)
A160M2
Adaptador (12-14mm)
A160M12
Adaptador (32-36mm)
A160M3
Adaptador (14-16mm)
A160M13
Adaptador (35-40mm)
A160M4
Adaptador (15-17mm)
A160M14
Adaptador (38-42mm)
A160M5
Adaptador (16-18mm)
A157-1
A157-2
A157-3
A160M
Juego estándar métrico de mangos
para bujes
A160M Juego métrico de impulsador
para bujes. Incluye tres empuñaduras de
impulsador y adaptadores de 10 a 42 mm. Se
entrega en caja de almacenamiento PB118.
A261M Componentes
Pieza No.
A261M
Juego métrico de impulsadores para
bujes de servicio pesado.
A261M Juego métrico de impulsadores
para bujes. Incluye una empuñadura de
impulsador extra larga y adaptadores de 40 a
80 mm. Se entrega en caja de almacenamiento
PB117.
Descripción
Pieza No.
Descripción
A257-1
Empuñadura de impulsador grande
A261M5
Adaptador (50-53mm)
A157-5
Tuerca del impulsador, 1/2"-20
A261M6
Adaptador (55-60mm)
A26M1
Adaptador (40-44mm)
A261M7
Adaptador (60-65mm)
A261M2
Adaptador (42-45mm)
A261M8
Adaptador (65-70mm)
A261M3
Adaptador (45-48mm)
A261M9
Adaptador (70-75mm)
A261M4
Adaptador (48-52mm)
A261M10
Adaptador (75-80mm)
YA2480 Componentes
YA2480
524
Pieza No.
Descripción
Pieza No.
Descripción
A1306-1
Empuñadura estriada
YA2480-8
Adaptador (#8)
A1306-1-1
Perno de montaje del adaptador
YA2480-9
Adaptador (#9)
YA2480-17
Arandela de respaldo de acero
YA2480-10
Adaptador (#10)
YA2480-1
Adaptador (#1)
YA2480-11
Adaptador (#11)
YA2480-2
Adaptador (#2)
YA2480-12
Adaptador (#12)
YA2480-3
Adaptador (#3)
YA2480-13
Adaptador (#13)
YA2480-4
Adaptador (#4)
YA2480-14
Adaptador (#14)
YA2480-5
Adaptador (#5)
YA2480-15
Adaptador (#15)
YA2480-6
Adaptador (#6)
YA2480-16
Adaptador (#16)
YA2480-7
Adaptador (#7)
www.snapon.com/shoptools
CUBIERTAS
?mYj\YZYjjgk';mZa]jlYk\]Yka]flgk
DY_geY]khgfbgkY\]YdlY\]fka\Y\dYeafY\Y]fnafadgZjaf\YeYqgjhjgl][[afqY\`]j]f[aYYd
_mYj\YZYjjgk&E]fgkkmk[]hlaZd]Ydgkhda]_m]k&
JCKS6A
JCKS7A
JCKS6A Cubierta de guardabarros.
s-IDEDEANCHOPORDELARGO
s,AZONACENTRALENRELIEVEOFRECEUN
ESPACIOPARAGUARDARHERRAMIENTAS
JCK8
JCKS7A Cubierta de
guardabarros.
s-IDEDEANCHOPORDELARGO
s0ARAUTILIZARENVEHÓCULOSCON
GUARDABARROSANCHO
s,AZONACENTRALENRELIEVEOFRECEUN
ESPACIOPARAGUARDARHERRAMIENTAS
JCK7DBL Cubierta de guardabarros.
s-IDEDEANCHOPORDELARGO
s0ARAUTILIZARENLOSGUARDABARROSMÉSCORTOS
DELAMAYORÓADELOSAUTOMØVILESNUEVOS
s:ONAENRELIEVE
JCK7D Cubierta de guardabarros.
)GUALQUE*#+$",ENROJO
JCK15D
JCK8 Cubierta de guardabarros.
s-IDEDEANCHOPORDELARGO
s,ASUPERFICIEANTIDESLIZANTEYNO
ABSORBENTESEADAPTAALGUARDABARROSDE
CUALQUIERVEHÓCULO
s-ATERIALROJOCONLASPALABRASEN
LETRASBLANCAS
s3ELIMPIAFÉCILMENTECONAGUAYJABØN
JCK15D Cubierta de guardabarros.
s%LMATERIALDEVINILODESERVICIOPESADO
PROTEGETODASLASSUPERFICIES
s-IDEX
SEATCOVER1
KAC1224TCA
KAC1224TCA Cubierta del tanque
de gas de motocicleta.
s3EAJUSTAALOSMODELOSDE(ARLEY
$AVIDSON®$YNA®3OFTAILY4OURING
s3EAJUSTAAVARIOSMODELOSDE9AMAHA
6ICTORY4RIUMPHY+AWASAKIYMUCHOSOTROS
s0ROTEGEELACABADOCUANDOREALIZAEL
MANTENIMIENTODERUTINA
s-ANTIENEALPOLVOYLASUCIEDADALEJADOSDEL
TANQUEDEGAS
s,ACUBIERTAQUENODEJAMARCASUTILIZAUN
FORROINTERNONOABRASIVOQUENOSEDESLIZA
CKM3020
;mZa]jlYk\]Yka]flgk
SEATCOVER1 Cubierta de asiento.
s&ABRICADADENYLONCONUNPROTECTORESPECIALCONTRAMANCHAS
IMPREGNADOENLATELA
s2ESISTENTEALAGRASAYALAGUA
s.OSEROMPECUANDOSELOUTILIZASOBREAPOYACABEZASALTOS
s.EGROCONREBORDESROJOSYLOGOROJO
ADVERTENCIA
JCK7DBL
CKM3020 Tapete de uso múltiple.
s%LTAPETEDENYLONDEUSOMÞLTIPLEOFRECEPROTECCIØNDEPINTURA
YSUPERFICIE
s3EUTILIZACOMOCUBIERTADEGUARDABARROSCUBIERTADEASIENTO
TAPETEPARAPISOOTAPETEPARAARRODILLARSE
s%LRESPALDODEESPUMATEJIDOEVITAQUEELTAPETESEDESLICEENEL
GUARDABARROSOENELRESPALDODELASIENTO
s4AMA×OGRANDEDEX
s!PTOPARALAVARENLAVARROPAS
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
525
CAMILLAS
Camillas estándar
El apoya cabeza tiene
2 3/4" de espesor y la
almohadilla tiene 1 3/4"
de espesor para mayor
comodidad
Espuma de alta
densidad
JCW60R
Respaldo de madera
para máxima
resistencia
JCW65ABL
Espacio a tierra de 3/4"
Camillas de servicio pesado
Cantidad
Largo de Ancho de de ruedas
almohadilla almohadilla giratorias
Diámetro
de ruedas
giratorias
Pieza No.
Color de
almohadilla
Tamaño total,
pulgadas.
JCW60R
Rojo
40L x 17An x 4Al
39"
11"
6
2 1/2"
JCW60BL
Negro
40L x 17An x 4Al
39"
11"
6
2 1/2"
Rojo/Negro 40L x 17An x 4Al
39"
11"
6
2 1/2"
JCW60SP
JCW8A
Rieles laterales del
armazón de acero de
3/4", calibre 16.
Ajustable
JCW65AR
Rojo
40L x 17An x 4Al
39"
11"
6
2 1/2"
s
JCW65ABL
Negro
40L x 17An x 4Al
39"
11"
6
2 1/2"
s
JCW8A*
Negro
40L x 17An x 4Al
39"
11"
4
2 1/2"
Negro
40L x 17An x 4Al
39"
11"
4
2 1/2"
JCW10*
*Blue-Point
s
®
Espuma de alta
densidad
El apoya cabeza tiene
2 3/4" de espesor y la
almohadilla tiene 1 3/4"
de espesor para mayor
comodidad
Almohadilla de 13"
de ancho
JCW70AR
Rieles laterales del
marco de
acero de 1", calibre 16
Respaldo de madera
para máxima
resistencia
JCW75ABL
Espacio a tierra de 1 -3/8".
Tamaño total,
pulgadas.
JCW70AR
Rojo
40L x 22An x 5 3/4Al
39"
13"
4
4"
40L x 22An x 5
3/4Al
39"
13"
4
4"
40L x 22An x 5
3/4Al
Negro
Ajustable
JCW75AR
Rojo
39"
13"
4
4"
s
JCW75ABL
Negro
40L x 22An x 5 3/4Al
39"
13"
4
4"
s
JCW11A*
Negro
39 ½L x 19An x 4 ½Al
39"
13"
4
3"
*Blue-Point
526
Diámetro
de ruedas
giratorias
Color de
almohadilla
JCW70ABL
JCW11A
Largo de Ancho de Cantidad
ruedas
almohadilla almohadilla de
giratorias
Pieza No.
www.snapon.com/shoptools
CAMILLAS
:Yf[gk[gfjm]\Yk
Respaldo de madera
para resistencia
adicional
Espuma de alta
densidad
El cajón
ofrece área de
almacenamiento
adicional
Armazón de acero
de 1", calibre 16
Ruedas giratorias
de cojinete de
bola de 2 -1/2"
JCW95R
JCW80R
Pieza No.
Color de
almohadilla
Tamaño total,
pulgadas.
Tamaño de
asiento,
pulgadas.
Tamaño de cajón,
pulgadas.
JCW80R
Rojo
14 1/4L x 19An x 15Al
10L x 14 1/4An
9 7/8L x 11 1/2An x 1 3/4Prof
14
1/4L
x 19An x 15Al
10L x 14
1/4An
9
7/8L
x 11
1/2An
x1
Ajustable
Rango de
ajuste
—
3/4Prof
—
JCW80BL
Negro
JCW85R*
Rojo
17 3/4L x 15An x 23Al
17 3/4L x 10An x 8Al 9 7/8L x 11 1/2An x 1 3/4Prof
—
JCW85BL*
Negro
17 3/4L x 15An x 23Al
17 3/4L x 10An x 8Al 9 7/8L x 11 1/2An x 1 3/4Prof
—
JCW90BL
Negro
15L x 15An x 21 1/2Al
13 3/4L x 13 3/4An
—
s
14" a 19 1/4"
JCW95R*
Rojo
17 3/4L x 15An x 28 1/4Al
17 3/4L x 10 An x 8 Al
—
s
14" a 19 1/4"
JCW95BL
Negro
17 3/4L x 15An x 28 1/4Al
17 3/4L x 10An x 8Al
—
s
14" a 19 1/4"
JCW9**
Negro
17L x 20 1/2An x 15Al
7L x 14An
—
* Butacas
** Blue-Point®
JCW90BL
JCW9
—
;YeaddYk]kh][aYd]k'9[[]kgjagk
JCP38 Camilla
de plástico.
s$ISE×ODEACCESORIOS
de carrocería
s,X!NX!L
JCP38
JCPW40B
JCPW40B Camilla acolchonada.
sCamilla acolchonada de 13" de ancho con ruedas de
goma de 6"
sProporciona un andar suave sobre superficies irregulares.
s&ABRICADODETUBODEACERODECALIBRE
s$IMENSIONESTOTALES" DELARGOX"de ancho x
"DEALTURA
JCW43A
JCW43A Camilla ajustable de múltiples
posiciones.
s#AMILLACONARMAZØNDEACEROEXTRALARGODE" con
SIETECONFIGURACIONES
s%LARMAZØNSUPERIORSEAJUSTAENPOSICIONESPARA
usar como camilla de respaldo con elevación
s%LARMAZØNINFERIORSEAJUSTAENPOSICIONESPARA
MAYORESTABILIDADCOMOCAMILLAAJUSTABLE
s$IMENSIONESTOTALES"DELARGOX"de ancho x
"DEALTURA
ADVERTENCIA
KRJC23APV
KRJC23APV Colgador para camilla.
s!SEGURALASCAMILLASAARMARIOSRODANTES
s!JUSTABLEACUATROANCHOSDECAMILLADIFERENTES
s3EENGANCHASOBREELBORDEDELARMARIORODANTEY
SEATORNILLA
s)NCLUYEDOSPERNOSPARAGANCHOSYUNABARRADETRABA
Fgk]hYj]kgZj]dY[YeaddYfadYmk][geg[YjjgFg]p[]\YdY[YhY[a\Y\\]h]kg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
527
MEDICIÓN
Micrómetros y juegos
MIC1A
Micrómetros digitales, pulgadas
s,ECTURAESTÉNDARENINCREMENTOSDE
MIC103A
ENLAEMPU×ADURAYENLAPANTALLADEDÓGITOS
s,ECTURATIPO6ERNIERENINCREMENTOSDE
s!RMAZØNAISLADOGRANDEFÉCILDEMANEJARYUNQUESCONPUNTASDECARBURO
GRAMPADETRABAPOSITIVAYDEDALDETOPEDETRINQUETE
Pieza No.
Gama, pulgadas
Incrementos, pulgadas
MIC1A
0-1
.0001
MIC2A
1-2
.0001
MIC3A
2-3
.0001
MIC4A
3-4
.0001
MIC5A
4-5
.0001
MIC103A Juego SAE-Blue-Point®. -)#!-)#!Y-)#!ENCAJA
AMEDIDACONACCESORIOSESTÉNDAR
MICINSIDE12
MICINSIDE12 Juego de micrómetro interior.
s%LRANGOESDEAENINCREMENTOSDE
s)NCLUYECABEZADEMICRØMETROINTERIORYUNASERIEDEVARILLASDECONTACTO
CONBOBINADERESORTESAPRESIØN
MICED1A
MICED1A Micrómetro electrónico digital-Blue-Point.
s,APANTALLALEEHASTAMM
s#ONFIGURACIØNENCEROPARAMODOSDEMEDICIØNABSOLUTOSYEN
INCREMENTOS
s!PAGADOAUTOMÉTICODESPUÏSDEMINUTOS
s!RMAZØNAISLADOCUERPOENDURECIDOYUNQUECONPUNTADECARBURO
GRAMPADETRABAPOSITIVAYDEDALDETOPEDETRINQUETE
MIC1MA
Micrómetros digitales, mm
s,ECTURAESTÉNDARENINCREMENTOSDEMM
ENLAEMPU×ADURAYENLAPANTALLADEDÓGITOS
MIC103MA
s,ECTURATIPO6ERNIERENINCREMENTOSDEMM
s!RMAZØNAISLADOGRANDEFÉCILDEMANEJARYUNQUESCONPUNTASDECARBURO
GRAMPADETRABAPOSITIVAYDEDALDETOPEDETRINQUETE
Pieza No.
Gama, mm
Incrementos, mm
MIC1MA
0-25
0.001
MIC2MA
25-50
0.001
MIC3MA
50-75
0.001
MIC4MA
75-100
0.001
MIC5MA
100-125
0.001
DM6
DM6 Juego de micrómetros de profundidad.
s-IDELAPROFUNDIDADDERANURASCONTRABARRENOSORIFICIOSYENDENTADOSDE
HASTADEPROFUNDIDAD
s"ASECROMADASATINADADEPARAOFRECERMAYORESTABILIDAD
s'RADUADAENINCREMENTOSDE
MIC103MA Juego de micrómetros digitales métricos-BluePoint. -)#-!-)#-!Y-)#-!ENCAJAAMEDIDACONACCESORIOS
ESTÉNDAR
Pieza No.
Descripción
DM61
Barra de 4"
DM62
Barra de 5"
DM63
Barra de 6"
DM64
Barra de 7"
DM65
Barra de 8"
DM66
Barra de 9"
DM67
Cabeza de micrómetro
MICB1A
Micrómetros exteriores–Blue-Point, pulgadas
MICB103A
s,ECTURAESTÉNDARENINCREMENTOSDEENLAEMPU×ADURA
s,ECTURATIPO6ERNIERENINCREMENTOSDE
s!RMAZØNAISLADOGRANDEFÉCILDEMANEJARYUNQUESCONPUNTASDECARBURO
GRAMPADETRABAPOSITIVAYDEDALDETOPEDETRINQUETE
Pieza No.
Rango, pulgadas
Incrementos, pulgadas
MICB1A
0-1
.0001
MICB2A
1-2
.0001
MICB3A
2-3
.0001
MICB4A
3-4
.0001
MICB5A
4-5
.0001
MICB103A Juego SAE-Blue-Point. )NCLUYE-)#"!-)#"!
-)#"!PIEZASENCAJAAMEDIDACONACCESORIOSESTÉNDAR
528
MIC22
Calibradores de prueba tipo micrómetro
s,OSCALIBRADORESDEPRUEBASEUTILIZANCOMOPARÉMETROSDELOSMICRØMETROS
s,AEXACTITUDCUMPLELASESPECIFICACIONESFEDERALES
MIC22
MIC32
MIC42
MIC52
MIC2M2
MM
MIC3M2
MM
www.snapon.com/shoptools
MEDICIÓN
Bm]_gk\][YdaZjY\gjl]d]k[ha[g'\]Y_mb]jgh]im]g
MROUND4
Bm]_g\][YdaZjY\gj\]Y_mb]jgh]im]g
MTEE6
MROUND4 Juego de calibrador de agujero pequeño.
s0ERILLAESTRIADAENLAEMPU×ADURAPARAAJUSTARELTAMA×O
s3UPERFICIEDECALIBRACIØNTOTALMENTEREDONDACONPARTEINFERIORPLANA
Pieza No.
CM4311
CM4312
CM4313
CM4314
Bm]_g\][YdaZjY\gjl]d]k[ha[g
MTEE6 Calibradores telescópicos.
s,APROFUNDIDADMEDIBLEESDEA
s%LJUEGODESEISSEENTREGAENBOLSAPLÉSTICA
Gama, pulgadas
0.125 - 0.200
0.200 - 0.300
0.300 - 0.400
0.400 - 0.500
Pieza No.
CM4349
CM4350
CM4351
CM4352
CM4353
CM4354
Gama, pulgadas
5/16 - 1/2
1/2 - 3/4
3/4 - 1 1/4
1 1/4 - 2 1/8
2 1/8 - 3 1/2
3 1/2 - 6
;YdaZj]k'ZYk]keY_fla[Yk'k]hYjY\gj
PMF147A
MCAL6A
;Ydah]jkº:dm]%Hgafl®
MCAL6A Calibre digital electrónico.
s%LRANGOESDEAAMMEN
RESOLUCIONESDEMM
s3EUTILIZAPARAMEDICIONESINTERIORES
EXTERIORESDEPROFUNDIDADYDEPASO
s#ONVERSIØNDEPULGADASASISTEMAMÏTRICOCON
UNBOTØN
s0ANTALLA,#$GRANDE
s!RMAZØNDEACEROINOXIDABLEENDURECIDO
MCAL12
MCAL12 Calibre digital electrónico.
s(ERRAMIENTAESENCIALPARATRABAJAREN
VEHÓCULOSMÉSGRANDESCAMIONESTRACTORESY
EQUIPOPARAMOVERLATIERRA
s%LRANGOESDEAAMMEN
RESOLUCIONESDEMM
s3EUTILIZAPARAMEDICIONESINTERIORES
EXTERIORESDEPROFUNDIDADYDEPASO
s#ONVERSIØNDEPULGADASASISTEMAMÏTRICOCON
UNBOTØN
s0ANTALLA,#$GRANDECONCONFIGURACIØNEN
CEROFLOTANTE
s4UERCADETRABAYPERILLAMANUALPARAUNAFÉCIL
OPERACIØN
PMF147A Calibre tipo cuadrante en
pulgadas/métrico.
s%LRANGOESDEAAMMEN
INCREMENTOSDEMM
s)NCLUYECAJADEALMACENAMIENTO
:Yk]eY_fla[Y
K]hYjY\gj
PMF129
PMF129 Separador.
s3EPARADORTIPORESORTEQUEVIRTUALMENTENOTIENETORSIØNNIJUEGOLATERAL
s
CM6416
CM6416 Soporte.
s%LIMÉNTIENEUNINTERRUPTORDEh%NCENDIDOPAGADOv
s,ABASEMIDEXX
s%LPOSTEMIDEX,ABARRAMIDEX
s3EAGARRAASUPERFICIESMETÉLICASPLANASOCURVAS
Fan]d]k
TL100A Nivel tipo torpedo.
s(ERRAMIENTADEMEDICIØNPRECISADEDISE×ADAPARATRABAJOSENZONASESTRECHAS
s,ASTIRASMAGNÏTICASYRANURAS6LOHACENIDEALPARATRABAJOSENCA×ERÓAS
YCONDUCTOS
YA328A Localizador de ángulo-Blue-Point.
s(ERRAMIENTADEPRECISIØNEXACTAPARADETERMINARMEDICIONESDEÉNGULOS
s)DEALPARAVERIFICARELCUADRODELÉNGULODELÉRBOLDETRANSMISIØN
s$ETRÉSDELOSNÞMEROSHAYUNINDICADORROJOENGRADOSPARAUNALECTURA
EXACTADELASGRADUACIONES
s%SCALASENPULGADASYMÏTRICASMOLDEADASENLABASEDELAHERRAMIENTAEN
YDECIMALESMÏTRICOS
s'RANIMÉNDEXINTRODUCIDOENLABASEPARAUNARETENCIØNFIRME
ADVERTENCIA
TL100A
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
YA328A
529
MEDICIÓN
Calibradores de sincronización/comprobación con cuadrante indicador
Calibradores de sincronización
GA3625A Calibrador de sincronización.
s-EDIDORDESINCRONIZACIØNDEDOSCICLOSYMOTORPEQUE×O
s)NDICADORDECONGRADUACIONESDE
s#ARADECUADRANTEFÉCILDELEERBLANCOSOBRENEGRO
s3EINCLUYENADAPTADORESDEMMYMM
s0ARABUSCARCENTRODEPUNTOMUERTOSUPERIOR
Juegos de comprobación con cuadrante indicador
GA3625A
GA3400
GA3640
GA3645
GA3634
GA3400 Juego de comprobación con cuadrante
indicador universal.
s*UEGODEINDICADORESDECUADRANTEPEQUE×OS
s2ANGODECONGRADUACIONESDE
s#ARADECUADRANTEFÉCILDELEERBLANCOSOBRENEGRO
s$ISPOSITIVOTRADICIONALTIPOGRAMPAFIJA
s%XCELENTEELECCIØNPARAAPLICACIONESDEMAQUINADO
GA3640 Juego de comprobación con cuadrante
indicador de largo alcance.
GA3645 Juego de comprobación con cuadrante
indicador de largo alcance.
GA3634 Juego indicador de prueba de junta de bola/
freno de disco.
s*UEGOSDEINDICADORESDEUSOMÞLTIPLE
s0ERFECTOPARAUSOENGENERAL
s)NDICADORCONRANGODEYGRADUACIONESDE
s#ARADECUADRANTEFÉCILDELEERBLANCOSOBRENEGRO
s'!UTILIZAUNABASEMAGNÏTICAFIJA
s'!UTILIZAUNABASEMAGNÏTICAPARAMÉSOPCIONESDEMONTAJE
s'!UTILIZAPINZASDETRABAYUNCUELLODEGANSOFLEXIBLEPARA
APLICACIONESNOMAGNÏTICASYÉREASDEDIFÓCILACCESO)DEALPARA
TRABAJOSENLOSFRENOSYENLAPARTEINFERIORDELAUTOMØVIL
GA3450 Calibrador de profundidad de piñón universal.
s-EDIDORDEPROFUNDIDADDEPI×ØNTRASERO
s#ONFIGURACIØNPRECISADEPROFUNDIDADDEPI×ØNPARAVEHÓCULOSDE
HASTATONELADA
s-IDAPREVIAMENTELAPROFUNDIDADDELPI×ØNPARAUSARCONLOS
CONJUNTOSDEENGRANAJES/%
-GA3460 Juego maestro para eje trasero.
s#ONJUNTOMAESTRODECONFIGURACIØNDEPARTETRASERA
s)NCLUYETODOLONECESARIOPARAINSTALARUNAPARTETRASERADE
REEMPLAZOYVERIFICAREJES
s-ÏTODOSDEMONTAJEMÞLTIPLE
s#ARADECUADRANTEFÉCILDELEERBLANCOSOBRENEGRO
s0ARAPARTESTRASERASDEVEHÓCULOSDE%%55YDEOTROSPAÓSESDE
HASTATONELADA
Especificaciones del juego de comprobación con
cuadrante indicador
Pieza No.
GA3400
GA3640
GA3645
GA3634
GA3450
GA3450
GA3460
GA3460
Rango
0.200"
1.00"
1.00"
1.00"
0.00" a 4.00"
0.00" a 1.00"
(0.00" a 4.00" con extensión)
Graduaciones Lectura
0.001"
0.0005"
0.0005"
0.0005"
0.0005"
0-100
0-50
0-50
0-50
0-50
0.0005"
0-50
Platinos y extensiones
GA3601
GA3609
530
GA3601 Extensión del indicador de cuadrante.
t3EUTILIZACONLOSJUEGOSDECOMPROBACIØNCONCUADRANTEINDICADOR'!'!'!Y'!
s,AROSCAHEMBRADEPERMITELAEXTENSIØNDECUALQUIERPLATINOPARAAPLICACIONESESPECIALES
sDELARGO
GA3609 Juego de platinos.
t3EUTILIZACONLOSJUEGOSDECOMPROBACIØNCONCUADRANTEINDICADOR'!'!'!Y'!
s,AROSCAHEMBRADEPERMITELAEXTENSIØNDECUALQUIERPLATINOPARAAPLICACIONESESPECIALES
s,ASEXTENSIONESSEPUEDENUNIRPARALOGRARUNMAYORALCANCE
s,OSPLATINOSPOSEENUNAPUNTAPULIDACONEXTREMORADIALYESTÉNFABRICADOSCONACEROENDURECIDO
s)NCLUYECUATROEXTENSIONESDEYCUATROPLATINOSYUNSOPORTEPARALOS
COMPONENTESDELJUEGO
www.snapon.com/shoptools
MEDICIÓN
;YdaZjY\gj]k\]]kh]kgj]kº:dm]%Hgafl®
FB310B
FB325A
FB335
FBL325A
FBM320
Mkg_]f]jYd
Cant. de
hojas
Pieza No.
Dimensiones hoja, pulgadas
Tamaño hoja
Incrementos
Descripción
FB310B
13
1/2
x3
0.001", 0.0015", 0.002" hasta
0.008", 0.010", 0.012",
0.013", 0.015"
—
Marca doble con tamaños en pulg.
y métricos.
FB325A
25
1/2
x3
0.0015", 0.002" hasta 0.025"
0.001"
Calibrador de espesores para uso general
(25 hojas)
FB335
35
1/2
x3
0.0015", 0.002" hasta 0.035"
0.001"
Espesor de hoja de acero sueca.
FBL325A
25
x 12
0.0015", 0.002" hasta 0.021",
0.025", 0.027", 0.030", 0.040"
0.001"
Hoja larga con marca doble con tamaños en
pulg. y métricos.
FBM320
20
x3
0.05 hasta 1 mm
0.05 mm
Juego de calibradores de
espesores métricos.
1/2
1/2
FB316B
=f[]f\a\g
Pieza No.
Cant. de
hojas
FB316B
18
FB326B
26
Dimensiones hoja, pulgadas
1/4
x 1 3/4
1/2
FB300A
x3
FB308D
FB326B
Tamaño hoja
Incrementos
Descripción
0.010", 0.012", 0.013", 0.015"
hasta 0.022", 0.024" hasta 0.026",
0.028", 0.030", 0.032", 0.035"
0.001"
Hoja corta, juego de calibrador de encendido/
bujía, marcad doble con tamaños en pulg.
y métricos
0.008", 0.010", 0.012", 0.013",
0.015", 0.017", 0.018", 0.020,
0.022, 0.024" hasta 0.026",
0.028", 0.030", 0.032", 0.035"
0.001"
Marca doble con tamaños en pulg. y métricos.
FB322
FB328A
FBM322
@gbYk\gZdY\Ykq\]hYkg
Pieza No.
FB300A
Cant. de
hojas
25
Dimensiones hoja, pulgadas
Tamaño hoja
Incrementos
Descripción
x3
0.006" hasta 0.030"
0.001"
Juego de calibrador de espesor, los extremos de
las hojas están doblados a 45°.
x3
.008"-.010", .011"-.013",
.013"-.015", .014"-.016",
.015"-.017", .017"-.019",
.018"-.020", .020"-.022",
.023"-.025", .025"-.027",
.026"-.028", .028"-.030"
0.001"
Juego de calibrador de espesor de paso
x 3 3/8
0.004"-0.006" hasta 0.025"0.027"
0.001"
"va o no va" con 2 tamaños cada una.
1/2
1/2
FB308D
12
FB322
22
FB328A
2
1/2
x3
.011"-.013", .013"-.015"
—
Para regulación de válvula en motores GM 8.2 L,
marca doble con tamaños en pulg. y métricos.
FBM322
2
1/2
x3
0.20-0.30 mm, 0.40-0.50 mm
—
Empuñadura doblada de 10 3/4" de largo.
1/2
<a]k]d
Pieza No.
FB307D
FB307D
Cant. de
hojas
14
ADVERTENCIA
Dimensiones hoja, pulgadas
1/2
x 4 1/2
Tamaño hoja
0.008", 0.011" hasta
0.014", 0.016" hasta
0.018", 0.020", 0.023" hasta
0.025", 0.027", 0.029"
Incrementos
Descripción
0.001"
Hoja doblada para diesel Cummins, los
extremos de las hojas están doblados en un
ángulo de 90°: las hojas están sujetas
al anillo FB307C1 .
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
531
MEDICIÓN
Calibradores de espesor/bujía
FB305A
FB333O
FBP1O
Calibradores de espesores especiales
Pieza No.
Cant.
de
hojas
Dimensiones hoja,
pulgadas
6
FB305A
1/2
Tamaño
hoja
.006", .008",
.010", .012",
.014", .016"
x3
Incrementos
Descripción
.002"
No magnéticos con marca
doble con tamaños en
pulg. y métricos
Juego de calibrador de espesor/separación
FB333O Juego de calibradores de espesores de fácil agarre. No
magnéticos con marca doble con tamaños en pulg. y métricos. Incluye diez calibradores de
espesores con empuñaduras tipo destornillador anaranjadas. Las hojas miden 4" de largo
y están compensadas a 45° para utilizarlas en los balancines de válvulas y en aplicaciones
de intervalos de aire. El juego se distribuye en la caja de madera FB33301. Incluye las
hojas: 0.010", 0.012", 0.014", 0.016", 0.018", 0.020", 0.022", 0.024", 0.027" y 0.030".
En total hay 25 hojas disponibles (0.006" hasta 0.030") en incrementos de 0.001".
FBP1O Hoja para calibradores de bolsillo. El calibrador de espesor plano estilo
rampa maneja la gama completa de los requisitos para medir el espacio entre electrodos
de las bujías desde 0.020 a 0.080". El dorso posee una escala métrica de hasta 2mm.
Empuñadura anaranjada tipo destornillador con gancho de bolsillo. El largo es de 5 1/2".
FB301A
FBS5
FBS5 Juego de calibrador de espesor/
separación. El juego de cinco piezas incluye:
calibrador de espesor de hoja doblada FB300A,
calibrador de espesor no magnético FB305A y
calibrador de espesor de uso general FB325A más
calibradores de separación de bujías GA461C y
FB360C en bolsa de juego FBS5-1.
Hojas y soporte de espesor–Blue-Point
FB6B0015 hasta FB6B040 (12") Hojas
del calibrador de espesor. Se utilizan con el
soporte FB312. Para hacer el pedido, el tamaño de
la hoja es el sufijo del número de pieza; el prefijo es
FB6B. Incluye las siguientes 34 hojas:
Pieza No.
Tamaño hoja,
pulgadas
Pieza No.
Tamaño hoja,
pulgadas
FB6B0015
0.0015
FB6B017
0.017
FB6B002
0.002
FB6B018
0.018
FB6B0025
0.0025
FB6B019
0.019
FB6B003
0.003
FB6B020
0.020
FB6B004
0.004
FB6B021
0.021
FB6B005
0.005
FB6B022
0.022
FB6B006
0.006
FB6B023
0.023
FB6B007
0.007
FB6B024
0.024
FB6B008
0.008
FB6B025
0.025
FB6B009
0.009
FB6B026
0.026
FB6B010
0.010
FB6B027
0.027
FB6B011
0.011
FB6B028
0.028
FB6B012
0.012
FB6B029
0.029
FB6B013
0.013
FB6B030
0.030
FB6B014
0.014
FB6B032
0.032
FB6B015
0.015
FB6B035
0.035
FB6B016
0.016
FB6B040
0.040
FB302A
GA461C
FB303B
FB361A
FB360C
FB6B040
Calibradores de bujía/separadores–Blue-Point®
FB301A Calibrador de separación de alambre para sistemas de
encendido por platinos. Incluye ocho alambres de 0.020", 0.022", 0.025",
0.028", 0.030", 0.032", 0.035" y 0.040". También incluye un doblador de electrodos.
FB302A Calibrador de separación de alambre para motores de
aviones, motocicletas y motores pequeños. Similar a FB301A. Incluye
ocho alambres de 0.015", 0.016", 0.018", 0.020", 0.025", 0.028", 0.030" y 0.035".
También incluye un doblador de electrodos.
FB303B Calibrador de separación de alambre para sistemas de
encendido electrónico. Similar a FB301A. Incluye seis alambres de 0.044",
0.045", 0.050", 0.054", 0.060" y 0.080". También incluye un doblador de electrodos.
GA461C Calibrador de separación para sistemas de encendido por
platinos. Incluye seis alambres que sobresalen 1/4" del borde del disco metálico.
Los tamaños de alambre incluidos son: 0.025”, 0.030”, 0.034”, 0.035”, 0.040”
y 0.045”. Tiene un doblador de electrodo incorporado. Marca doble con tamaños
decimales y métricos.
FB360C Calibrador de separación para sistemas de encendido
electrónico. Incluye seis tamaños de alambre: 0.040, 0.044", 0.045", 0.050",
0.060" y 0.080". Marca doble con tamaños decimales y métricos.
FB361A Calibrador de separación. El separador de bolsillo posee una rampa
inclinada para configurar la separación. 1 1/2" de diámetro. El rango es de 0.020" a
0.100". Marca doble con tamaños decimales y métricos.
Tabla de conversión decimal/métrica
Decimal,
pulgadas
0.0010
0.0015
Métrica,
mm
0.025
0.038
Decimal,
pulgadas
0.007
0.008
Métrica,
mm
0.178
0.203
Decimal,
pulgadas
0.015
0.016
Métrica,
mm
0.381
0.406
Decimal,
pulgadas
0.023
0.024
Métrica,
mm
0.584
0.610
Decimal,
pulgadas
0.031
0.032
Métrica,
mm
0.787
0.813
Decimal,
pulgadas
0.042
0.044
Métrico,
mm
1.067
1.118
0.0020
0.051
0.009
0.229
0.017
0.432
0.025
0.635
0.033
0.838
0.046
1.168
0.0025
0.064
0.010
0.254
0.018
0.457
0.026
0.660
0.034
0.864
0.052
1.321
0.0030
0.076
0.011
0.279
0.019
0.483
0.027
0.686
0.035
0.889
0.054
1.372
0.0040
0.102
0.012
0.305
0.020
0.508
0.028
0.712
0.036
0.914
0.056
1.422
0.0050
0.127
0.013
0.330
0.021
0.533
0.029
0.737
0.038
0.965
0.060
1.524
0.0060
0.150
0.014
0.356
0.022
0.559
0.030
0.762
0.040
1.016
0.080
2.032
532
www.snapon.com/shoptools
MEDICIÓN
Bm]_gk\]e]\a[af'Zgj\]kj][lgk'j]_dYk\]Y[]jg
GA438A
:gj\]kj][lgk\]hj][akaf
s3EUTILIZAN con calibradores de espesores para verificar la
distorsión en bloques de motores, culatas de cilindros, volantes,
apoyos de cojinetes principales, apoyos de cojinetes de leva,
cubiertas de leva y alojamientos de campanas
s"ORDEDETRABAJOPRECISOBASADODENTRODELPORDELARGO
s'RANESTABILIDADCONUNESPESORDEYUNANCHODE
s#ØMODOORIFICIOPARACOLGARYPROTECTORDELBORDE
GA435 DELARGOGA438A DELARGOGA535 DELARGO
SQUARECOMB12
RULER120
RULER602
SQUAREB12
®
Bm]_gk\]e]\a[afº:dm]%Hgafl
SQUARECOMB12 Juego de medición combinado.
tIncluye el transportador SQUAREB180, la regla de acero
RULER12BSQ y las cabezas deslizantes SQUAREB45 y SQUAREB90
en caja de almacenamiento a medida
SQUAREB12 Juego de medición de mecánico.
tIncluye la cabeza deslizable SQUAREB90 y la regla de acero
RULER12BSQ en caja de almacenamiento a medida
SQUAREB90 Cabeza deslizante (90°).
tCabeza cuadrada de 90° con nivel de burbuja y puntas de trazar
SQUAREB180 Cabeza de transportador (180°).
tEl transportador está graduado hasta 180° en ambas direcciones
s)NCLUYEREGLADEACERO
RULER12BSQ a nivel de burbuja.
tHoja pulida de acero endurecido para mayor precisión
s'RADUADAENINCREMENTOSDEYDEUNLADOYY
DELOTRO
SQUAREB45 Cabeza deslizante (45°).
tCabeza central sólo para ángulos de 45°
TPMA10
TPMA12
RULER600
J]_dYk\]Y[]jg
RULER601
RULER120 Regla de acero en pulg./métrica.
t2EGLADEACEROINOXIDABLEDE
s%LBORDEENPULGESTÉGRADUADOENINCREMENTOSDEPARALAS
PRIMERASYENPARALASÞLTIMAS
s%LBORDEMÏTRICOESTÉGRABADOCONINCREMENTOSENMMYCM
RULER600 Regla de acero.
t2EGLADEACEROINOXIDABLEDE
s'RADUADAENINCREMENTOSDEY
RULER601 Regla de acero (6").
t2EGLADEACEROINOXIDABLEDE
s'RADUADAENINCREMENTOSDEYDEUNLADOY
y mm del otro
RULER602 Regla de bolsillo en pulg./métrica (6").
t2EGLADEACEROINOXIDABLEDECONGANCHOPARABOLSILLO
s"ORDEENPULGCONINCREMENTOSDEYDEUNLADOYCON
INCREMENTOSENMMYCMDELOTRO
;aflYk
TPMA25EM
TPM100
TPMA25
;aflYk\]e]\a[afYmlg%j]lj~[lad]k
TPMAM5
TPMA10 Cinta de medición (10 pies).#INTADEXPIES)NCLUYEESCALAENPULG
MÏTRICACONFRACCIONES
TPMA12 Cinta de medición (12 pies). #INTADEXPIES)NCLUYEESCALAENPULG
MÏTRICACONMARCASMETÉLICASCADA
TPMA25 Cinta de medición (25 pies).#INTADEXPIES)NCLUYEESCALAENPULG
MÏTRICACONMARCASMETÉLICASCADA
TPMAM5 Cinta de medición (5 m).#INTADEMMXM)NCLUYEUNAESCALAMÏTRICA
TPMA25EM Cinta de medición (25 pies).#INTADEXPIESMM)NCLUYEESCALA
ENPULGMÏTRICACONFRACCIONES
ADVERTENCIA
;aflY\]e]\a[af[gfZYkla\gj\]Y[]jg
TPM100 Cinta de medición–Blue-Point.
s)NCLUYEUNAESCALAENPULGMÏTRICA
s$ISE×ODERÉPIDOREBOBINADOFÉCILDEUSAR
s0ALANCADEREBOBINADOALMACENADA
adecuadamente en bastidor
s%LAGARREANTIDESLIZANTEOFRECESEGURIDADY
comodidad
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
533
ESPEJOS
GA51B
UIM2FL
GA52B
GA294
GA53A
GA295
Espejos con bisagra-Blue-Point®
UIM2FL Espejo de inspección flexible.
s%LEJEDEALUMINIODESEPUEDEDOBLARCONFACILIDADA
CUALQUIERÉNGULO
s%LESPEJODEESTÉEMBUTIDOENUNASØLIDACABEZA
DEACEROINOXIDABLE
s4ODASLASJUNTASDEBOLADELOSÉNGULOSSOSTIENEN
FIRMEMENTELACABEZADELESPEJOENCUALQUIERÉNGULO
s%LAGARREACOLCHONADOTEXTURADONOSERESBALAAL
AGARRARLOCONLASMANOSHÞMEDASNIACEITOSAS
GA294 Espejo rectangular.
t,ASJUNTASDEBOLADOBLESPERMITENGIRARELESPEJOAª
s2ESPALDODECOBRECONPLACAELECTROLÓTICA
s6ARILLASTELESCØPICASQUENOGIRAN
s!GARREDEVINILO
s%LTAMA×ODELESPEJOESDEX
s#UANDOESTÉCERRADOELLARGOES
DEEXTENDIDOMIDE
GA295 Espejo redondo. 3IMILARAL'!PEROCON
ESPEJODEDEDIÉMETRO#UANDOESTÉCERRADOELLARGO
ESDEEXTENDIDOMIDE
Pieza No.
GA51B
GA52B
GA53A
Largo total,
pulgadas (mm)
Tamaño del espejo,
pulgadas (mm)
16 1/2 (419.1)
11 (279.4)
16 1/2 (419.1)
1 11/16 x 2 9/16 (42.9 x 65.1)
1 3/16 x 1 1/2 (30.1 x 38.1)
2 5/16 x 3 3/8 (58.7 x 85.7)
PTM157
Espejos de bolsillo–Blue-Point
YA5160A
YA5160A Espejo ajustable iluminado.
t%LTAMA×ODELESPEJOESXCONAUMENTODE
DIÉMETRO
s!JUSTEDERUEDAMANUALENLAEMPU×ADURA
s,ALUZENLABASEDELAEMPU×ADURAFLEXIBLEDEDELARGOES
PROPORCIONADAPORDOSPILAS!!INCLUIDAS
YA51601 Espejo de reemplazo. 1X.
YA51602 Espejo de reemplazo. 2X.
YA5160A3 Foco de reemplazo.
PTM143 Espejo de bolsillo redondo.
t,AEMPU×ADURASEEXTIENDEDEA
sDEDIÉMETRO
s%LMECANISMODEBISAGRAPERMITEUNAJUSTEDEªs)NCLUYEGANCHOPARABOLSILLO
CF143MA Espejo de bolsillo redondo con lupa.
t,AEMPU×ADURASEEXTIENDEDEAsDEDIÉMETRO
s%LMECANISMODEBISAGRAPERMITE
s)NCLUYEGANCHOPARABOLSILLOUNAJUSTEDEª
PTM147 Espejo de bolsillo redondo.
t,AEMPU×ADURASEEXTIENDEDEA
sDEDIÉMETRO
s%LMECANISMODEBISAGRAPERMITEUNAJUSTEDEªs)NCLUYEGANCHOPARABOLSILLO
PTM157 Oval Pocket Mirror.
t,AEMPU×ADURASEEXTIENDEDEA
s&ORMAOVALDEX
s%LMECANISMODEBISAGRAPERMITEUNAJUSTEDEª s)NCLUYEGANCHOPARABOLSILLO
UIM2LTUV
TKSS01MIR
UIM2LM
Espejo de
reemplazo de
plástico
GA51B1P
—
GA53A1P
PTM143
Espejos iluminados–Blue-Point
UIM225
Espejo de
reemplazo
de vidrio
GA51B1
GA52B1
GA53A1
UIM1LT
UIM3LT
UIM2LT
UIM2RSLT
Espejos telescópicos LED–Blue-Point
UIM2LTUV Espejo de inspección flexible.
t,UZ56IDEALPARATRABAJARCONAIREACONDICIONADOREFRIGERANTEYMÞLTIPLESTINTAS
UIM125 Espejo de inspección telescópico.%LESPEJOTIENE s,ACAJA,%$ILUMINALASÉREASOCULTASOSCURAS!LCANCEDESDE
UNDIÉMETRODEDELARGO3EEXTIENDEHASTA
HASTAPARAREALIZARUNAINSPECCIØNPRECISA
UIM225 Espejo de inspección telescópico. %SPEJODE
s4ODASLASJUNTASDEBOLADELOSÉNGULOSSOSTIENENFIRMEMENTELACABEZA
DEDIÉMETRODELARGO3EEXTIENDEHASTA
DELESPEJOENCUALQUIERÉNGULO
UIM325 Espejo de inspección telescópico. %SPEJODE
s 5TILICECONLUPA56!#456,)4%PARADETECTARDERRAMESDETINTA FLUORESCENTE
DEDIÉMETRODELARGOYSEEXTIENDEHASTA
s4AMBIÏNESTÉNDISPONIBLES*UEGODELUZ56!#456'5.!CONPISTOLA
TKSS01MIR Espejo telescópico de acero con bisagras.
DEINYECCIØNYTINTAY!#456'5.!CARTUCHODETINTADEAIRE
t%LESPEJODEACERONOSEROMPESISECAE
ACONDICIONADODEONZAS
s#ONBISAGRASPARAUNPRECISOPOSICIONAMIENTOALCANCEDESDE
UIM1LT Espejo de inspección flexible.
MMHASTAMM
!LCANCEDESDEHASTA%LESPEJOTIENEDEDIÉMETRO
s,ASUPERFICIEDELESPEJOESDEXXMM
UIM2LT Espejo de inspección iluminado.
s%NPOSICIØNRETRAÓDASEAJUSTAFÉCILMENTEENELBOLSILLODELACAMISA !LCANCEDESDEHASTA%LESPEJOTIENEDEDIÉMETRO
UIM2LM Espejo de inspección con lupa.
s,AEMPU×ADURADEACEROINOXIDABLETIENEUNALCANCEDEA UIM3LT Espejo de inspección iluminado.
!LCANCEDESDEHASTA%LESPEJOTIENEDEDIÉMETRO
s%LESPEJOCONLUPADEAUMENTAELÉREADEVISUALIZACIØN
UIM2RSLT Espejo de inspección iluminado con LED.
s4ODASLASJUNTASDEBOLADELOSÉNGULOSSOSTIENENFIRMEMENTELA
s!LCANCEDESDEHASTAPARAINSPECCIONESRÉPIDASYPRECISAS
CABEZADELESPEJOENCUALQUIERÉNGULO
s%LTAMA×ODELESPEJOESDEX
Espejos telescópicos–Blue-Point
534
www.snapon.com/shoptools
HERRAMIENTAS DE ENGANCHE
PTS5
PTIM5
ECFM20
PT5C
PT40A
UPT65
US225
PT5CBL
PHT5
PT7B
PT28E
PT30C
UPT35
PT10C
DPTM24
UPT2FL
EY_f]la[º:dm]%Hgafl®
%NELINTERIORDELASMANGASDEBRONCEDEESTASUNIDADESSECOLOCAN
POTENTESIMANES#ABEZASAJUSTABLESCONBISAGRA
PTS5 Herramienta de enganche magnética/Marcador.
t#ONIMÉNENUNEXTREMOYUNAPUNTAMARCADORA
sIncluye gancho para bolsillo. de acero de carburo de reemplazo en el otro.
sDELARGO
s.OLAUSECOMOPALANCAOPUNZØN
PTIM5 Herramienta de enganche e inspección.
t%LEXTREMOCONIMÉNLEVANTALB s#ONGANCHODEBOLSILLO
s%LLARGOEXTENDIDOESDECERRADOESDE
s%LEXTREMOCONESPEJOMIDEDEDIÉMETRO
PT5C Herramienta de enganche magnética telescópica.
tSEEXTIENDEA
s#ROMADOS
s%LIMÉNLEVANTALB
s'ARANTÓADEPORVIDA
s)NCLUYEGANCHOPARABOLSILLO
PT5CBL Herramienta de enganche magnética telescópica.
t)GUALQUELA04#EXCEPTOQUEESDEAZUL
PHT5 Herramienta de enganche magnética.
t,EVANTALBs%LEJECROMADOSEEXTIENDEDEA
s%LAGARREACOLCHONADONEGRONORESBALAENMANOSHÞMEDASOACEITOSAS
s)NCLUYEGANCHOPARABOLSILLO
PT7B Herramienta de enganche magnética.
t,EVANTALB
sDELARGO
ECFM20 Herramienta de enganche magnética flexible.
t%LEJEFLEXIBLEDEMMLLEGAALUGARESDIFÓCILES
s&UENTEDELUZ,%$BRILLANTEYDURADERA
sBastidor de aluminio anodizado para un peso liviano y resistencia
a la corrosión
s%LPODEROSOIMÉNDENEODIMIOLEVANTALBKG
s&UNCIONACONTRESPILASALCALINAS.DE6INCLUIDAS
PT40A Herramienta de enganche magnética flexible.
t%LIMÉNLEVANTALB
svDELARGOEINCLUYEUNASECCIØNFLEXIBLEDEv
PT10C Herramienta de enganche.
s,EVANTALBDELARGO
PT28E Herramienta de enganche.
tLevanta 2 lb., mide 16 3/4" de largo y se extiende hasta 26 3/4"
s#ABEZADEALUMINIOs%L$%DELASONDAESDE
PT30C Herramienta de enganche.
t,EVANTALB sDELARGO3EEXTIENDEHASTA
UPT15 Herramienta de enganche magnética telescópica.
t,EVANTALB
sDELARGO3EEXTIENDEHASTA
UPT35 Herramienta de enganche magnética telescópica.
t,EVANTALB sDELARGO3EEXTIENDEHASTA
UPT50A Herramienta de enganche magnética telescópica.
t,EVANTALB
sDELARGO3EEXTIENDEHASTA
UPT65 Herramienta de enganche magnética telescópica.
tLa cabeza magnética con forma de copa empuja el flujo hacia el
frente del imán, lo que le permite levantar 16 lb
s,ACABEZAPROTEGELOSLATERALESDELIMÉNDEADHERIRSEASUPERFICIES
ferrosas no deseadas
s!LCANCEDESDEHASTADESDEHASTAMM
UPTM65K Juego de inspección magnético.
t)NCLUYELAHERRAMIENTADEENGANCHE504YELESPEJODE
INSPECCIØN53ENESTUCHEDEVINILO
US225 Espejo de inspección.
t3EADAPTAALAHERRAMIENTADEENGANCHE504
s%LAJUSTEDEBOLADOBLEBRINDA
sMMDEDIÉMETROINFINITASPOSICIONES
DPTM24 Herramienta de enganche magnética flexible.
t#UANDOESTÉENPOSICIØNRETRAÓDAELIMÉNNO
sPresione el vástago para dejar expuesto el imán que se encuentra en la
cubierta y metales ferrosos a los que no apunta toma el objeto deseado
s%LEJEFLEXIBLEDEPERMITE
s,AEMPU×ADURADEAGARREFLEXIBLEOFRECEMANIOBRARFÉCILMENTEEN
LUGARESDIFÓCILESCOMODIDADYCONTROL
UPT2FL Herramienta de enganche magnética flexible.
t%LEJEDEALUMINIODESEPUEDEDOBLARCONFACILIDADACUALQUIERÉNGULO
sLa tapa de potencia se desliza sobre el imán y protege sus laterales
para que no se adhieran a superficies metálicas no deseadas.
s%NGANCHALBCONLATAPADEPOTENCIA
GA265A
UPT1LT
UPT2LT
@]jjYea]flYk\]]f_Yf[`]eY_fla[YkadmeafY\Yk%:dm]%Hgafl
UPT1LT Herramienta de enganche magnética con LED.
La cabeza magnética de acero levanta 8 lb y no se adhiere a superficies
metálicas no deseadas. Alcance desde 6 3/4" hasta 27 3/4".
UPT2LT Herramienta de enganche magnética con LED. La
cabeza magnética giratoria levanta hasta 8 lb. Alcance desde 8" hasta 32 3/4".
UPTLP2 Herramienta de enganche de luz tipo lapicera.
sLa cabeza magnética de acero con nuevo diseño levanta 8 libras y
protege los lados para que no se adhieran a superficies metálicas
no deseadas
s,ALUZ,%$ILUMINAÉREASOSCURAS
sLa empuñadura de acero inoxidable alcanza desde 8" hasta 32-3/4"
ADVERTENCIA
DPTC24
UPTLP2
GA353B
?YjjYk >d]paZd]k!
Abertura de
Número
mordaza,
Pieza No. de garras pulgadas (mm)
2
1 (25.4)
GA265A
3/4 (19.1)
4
YA837A
4
1 (25.4)
GA353B
4
11/4 (31.7)
DPTC24
4
1 (25.4)
UPTC16LT
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
YA837A
Largo de la
sección flexible,
pulgadas (mm)
8 (203.2)
16 (406.4)
8 (203.2)
24 (609)
16 3/4 (425)
Largo total,
pulgadas (mm)
17 3/4 (450.9)
23 1/2 (596.9)
17 1/2 (444.5)
—
26 (660)
535
FRENO
Tornos de frenos y accesorios
Tornos de freno de banco
EEBR312A Tornos de freno de banco.
s$ISE×ADOPARATALLERESCONGRANVOLUMENDETRABAJOQUEMANEJAN
UNAGAMACOMPLETADETAMBORESYROTORESPARAVEHÓCULOS
s0IEZASFUNDIDASCONCOJINETESDEBRONCEPARASERVICIOPESADO
s-OTORDEHP
s3OPORTATAMBORESOROTORESDEHASTALBUTILIZANDOELEJE
ESTÉNDARDEMM
s/FRECEUNRANGODEHUSOADICIONALAMMPARAEL
MAQUINADODEUNAGRANVARIEDADDECONJUNTOSDEFRENOSCONMAYOR
PROFUNDIDADDELTAMBORYANCHODELROTOR
s'AMADEALIMENTACIØNMÞLTIPLEYVELOCIDADDEHUSOCONCAPACIDAD
DEUNCORTEPARACOMODIDADDEUSODELTÏCNICO
s3OSTENESPARAHERRAMIENTASFÉCILESDECAMBIARQUEAHORRAN
TIEMPOMOTORDEALIMENTACIØNVARIABLEYBARRAPERFORANTEDEFÉCIL
POSICIONAMIENTOPARAUNARÉPIDACONFIGURACIØN
s,ASBROCASDEINCLINACIØNPOSITIVABRINDANACABADOSDESUPERFICIE
DEALTACALIDADYCAPACIDADDEUNCORTE
s%LHUSODETRESVELOCIDADESSEADAPTAAUNAAMPLIAGAMADE
DIÉMETROSDEROTORESYTAMBORES
s,AVELOCIDADDEALIMENTACIØNCRUZADAAJUSTABLEPERMITEFÉCILES
CONFIGURACIONESDECORTEÉSPEROCORTEACABADO
Especificaciones
EEBR312A
EEBR312A
Capacidades del rotor
Diámetro máximo
Espesor máximo
Ancho de la cara máximo
Gama de alimentación del
rotor
Capacidades del tambor
14 1/2" (la extensión de alimentación cruzada aumenta
el diámetro máximo del rotor a 20.0 (508 mm)
1 7/8"
3 3/4"
0.002/0.010" por revolución
Diámetro mínimo
6" (152 mm)
Diámetro máximo
28" (711 mm)
Profundidad del tambor
hasta 9 7/8" (251 mm)
AMMCO902500S
Velocidades de alimentación 0.002/0.020"/por revolución (0.05/0.50 mm por revolución)
Huso
Rango de huso
Velocidad del huso (ranura
interna)
Velocidad del huso (ranura
media)
Velocidad del huso (ranura
externa)
Velocidad de alimentación
del huso (mínima)
Velocidad de alimentación
del huso (máxima)
Velocidad de alimentación
cruzada (fina)
Velocidad de alimentación
cruzada (gruesa)
Graduaciones del manubrio
9 7/8" (251 mm)
60 RPM
80 RPM
115 RPM
0.002" (0.05 mm) por revolución
(infinitamente variable)
0.020" (0.50 mm) por revolución
(infinitamente variable)
EEBR312ABP Torno de freno de banco.)NCLUYE4ORNO
DEFRENO%%"2!JUEGODEBANCO!--#/3YJUEGODE
ADAPTADORESBÉSICOS!--#/
EEBR312ADP Torno de freno de banco. )NCLUYETORNO
DEFRENO%%"2!JUEGODEBANCO!--#/3YJUEGODE
ADAPTADORESDELUJO!--#/
AMMC0902500S Torno de freno de banco. *UEGODE
BANCOPARATORNOSDEFRENO3NAPON®)NCLUYEBANCOSE×ALIZACIØN
TABLEROPARAHERRAMIENTASEMBUDODEREBABASYBALDE
0.002" (0.05 mm) por revolución
0.020" (0.50 mm) por revolución
0.002" (0.05 mm)
Eje
Eje estándar de 1"
100 lb (45.36 kg) máximo tambor/rotor/volante
Potencia/Peso/Dimensiones
Motor
AMMCO908500
1 HP
Micrómetros
Requerimientos eléctricos
60 Hz, 120VCA a 20 amps.
Espacio de piso requerido
48" An x 34 1/2" Prof. (1,219.2 x 901.7 mm)
Huso hasta piso con banco
39.75" (1.000 mm)
Altura total
17.25" (438 mm)
Peso de envío
410 lbs (186 kg)
536
AMMCO908500 Micrómetro de tambor de frenos.
5TILICEENTAMBORESDEFRENOS-ECÉNICO
AMMCO908545 Micrómetro de tambor de frenos.
5TILICEENTAMBORESDEFRENOSMM$IGITAL
AMMCO902780 Micrómetro de rotor.
5TILICEENROTORESDEFRENOSMM$IGITAL
www.snapon.com/shoptools
FRENO
9[[]kgjagk\]lgjfgk\]^j]fgk
Kad]f[aY\gj]k
AMMCO901175 Silenciador de rotor.
Silenciador de rotor con ganchos para tornos OTV.
AMMCO901180 Silenciador de rotor.
Silenciador de rotor con ganchos para tornos de banco.
AMMCO905280
AMMCO905280 Banda de silenciador.
Para tambores de automóviles para pasajeros/camiones livianos. 1 3/4".
AMMCO905290 Banda de silenciador. Para tambores de
camiones. 2 3/4".
AMMCO906920 Banda de silenciador. Para rotores ventilados.
AMMCO906921 Banda de silenciador. Para rotores no
ventilados (6 1/2") de diámetro. Paquetes de 2.
AMMCO906922 Banda de silenciador. Para rotores no
ventilados (9 1/4") de diámetro. Paquetes de 2.
AMMCO909800 Conjunto de silenciador de resorte.
Para rotores ventilados.
BTK10A
AMMCO900002
AMMCO900006
9\YhlY\gj]k
Bm]_gk\]Zjg[Yk\]afk]j[af\][YjZmjg
AMMCO900002 Juego de adaptadores básicos.
tJuego de adaptadores ahusados dobles (Se ajusta a alojamientos
de cojinetes con diámetros de 1 3/8" a 2 29/32")
s%SPACIADORESDELARGO
s%SPACIADORCONAUTOALINEACIØNDELARGO
s*UEGODEADAPTADORESSINCUBOPARAAUTOMØVILESYCAMIONES
livianos de 1 27/32" a 3 27/32"
AMMCO900006 Juego de adaptadores de lujo.
t0ARALAMAYORÓADELOSVEHÓCULOSDEPASAJEROSYCAMIONESDEHASTA
TONROTORESYTAMBORESESTÉNDARESYCOMPUESTOSCONCUBOYSINCUBO
s3EAJUSTAAEJESDETORNODE
s)NCLUYEJUEGODEADAPTADORAHUSADOSDOBLESESTÉNDARESDEA
JUEGODEADAPTADORESDEMANDRILDOBLEDEA
juego de adaptadores ahusados dobles de camiones de 2 13/16" a
MANDRILPRINCIPALESPACIADORYESPACIADORCONAUTOALINEACIØN
AMMCO909313 Juego de adaptadores Adaptek.
t3EAJUSTAAEJESDE/RIFICIOSCON$)DEADEDIÉMETRO
s%XTIENDEELJUEGOBÉSICO!--#/AAPLICACIONESPARA
camiones livianos de 1 ton.
AMMCO908994 Juego de adaptadores de servicio mediano.
t*UEGODEADAPTADORESDESERVICIOMEDIANOCON$)DEY
AMMCO904775 Juego de adaptadores de servicio
pesado/mediano.
tHasta cubos de 8"
s3EAJUSTAAEJESDE$)DEA
AMMCO908995 Juego de adaptadores de servicio pesado.
t*UEGODEADAPTADORESDESERVICIOPESADOCON$)DEY
s3EUSAPARAEXTENDERELJUEGODEADAPTADORESDESERVICIOMEDIANO
!--#/
AMMCO941412 Juego de mandril doble.
t$)DEENTREY
s2OTORESYTAMBORESSINCUBOHASTAVEHÓCULOSDETON
s4RESPLACASDERESPALDO
AMMCO940928 Juego de adaptadores 4x4.
t$)DE
s!DAPTADORPARAROTORPRENSADOX
AMMCO903481 Juegos de ejes.
tD.I. de 1 7/8".
s#AMIONESYROTORESDEHASTALB
s)NCLUYEEJETUERCADEEJEYLLAVE
AMMCO9069141 Brocas de carburo.
t%LJUEGODEBROCASDEINSERCIØNDECARBUROINCLINACIØNNEGATIVA
CONTIENEUNPAQUETECONBROCASYTORNILLOSDETRABA
s5SARPARATORNOSDEFRENO%%"2!Y%%"2!3NAPON®
AMMCO9076816 Brocas de carburo.
t%LJUEGODEBROCASDEINSERCIØNDECARBUROINCLINACIØNPOSITIVA
CONTIENEUNPAQUETECONBROCASYTORNILLOSDETRABA
s%STÉNDARENLOSTORNOSDEFRENO%%"2!Y%%"2!
AMMCO940410 Brocas de carburo.
t%LJUEGODEBROCASDEINSERCIØNDECARBUROINCLINACIØNPOSITIVA
CONTIENEUNPAQUETECONBROCASYTORNILLOSDETRABA
s3EUSAPARATORNOSDEFRENOS*"#
AMMCO940415 Brocas de carburo.
s0ARATODOSLOSTORNOS+WIK7AY® con inserciones de reemplazo
YPARALOSMODELOSANTERIORESDETORNOS3NAPONSERIES9!
9!!Y9!
s%LJUEGODEBROCASDEINSERCIØNDECARBUROINCLINACIØNPOSITIVA
CONTIENEBROCAS
AMMCO940435 Brocas de carburo.
s0ARATORNOS!CCU4URN®
s%LJUEGODEBROCASDEINSERCIØNDECARBUROINCLINACIØNPOSITIVA
CONTIENEUNPAQUETEDEBROCAS
AMMCO940610 Brocas redondas.
s"ROCASDEREEMPLAZOREDONDASINCLINACIØNPOSITIVAPARA
ORGANIZADORDEBROCAS!--#/
s0AQUETEDE
AMMCO940630 Organizador de brocas redondas.
s,OSORGANIZADORESDEBROCASREDONDASPUEDENUTILIZARSECON
%%"2!%%"2!Y%%"2!
BTA10 Brocas de carburo.
s0ARATORNOSDEROTORESDEDISCODE!MMCOMODELOS
Y
BTF10 Brocas de carburo.
s0ARATODOSLOSTORNOS&-#CONINSERCIONESDEREEMPLAZO
BTK10A Brocas de carburo.
s0ARATODOSLOSTORNOS+WIK7AYCONINSERCIONESDEREEMPLAZO
YPARALOSMODELOSANTERIORESDETORNOS3NAPONSERIES9!
9!!Y9!
ADVERTENCIA
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
537
FRENO
Tornos de frenos y accesorios
YA180A
YA189
Torno de frenos de disco de vehículos c/ tracción delantera
YA180A Torno de frenos de disco de vehículos c/
tracción delantera.
tPara el maquinado en el automóvil de los rotores de tracción delantera
tSe monta en lugar del calibre
tEl motor del vehículo gira el disco durante el proceso de maquinado
tEl accesorio de montaje especial reduce el tiempo de configuración
y ofrece una referencia rápida p/ los requerimientos del espaciador
y el correcto espaciado de eslabones así como también una línea
de centro p/ la herramienta de corte
tEl juego de extensiones incluye eslabones ranurados y de soporte
de 3 1/4" junto c/ soportes de herramienta a izquierda y derecha
de 6 3/8" p/ maquinar rotores en vehículos c/ tracción en las
cuatro ruedas, camiones de 1 ton. y otros rotores grandes
tCapacidad de disco de 4" a 16"
tEl espesor máximo del rotor es de 1 1/2": el diámetro máximo del rotor
es 12 1/2"
tLa gama de alimentación es de 0.002" a 0.006"
tEl torno incluye una caja de almacenamiento metálica y un video
de capacitación
YA189 Alimentador de potencia.
s$ISE×ADOPADAPTARSEALTORNODEFRENOSDEDISCO9!!
YA280 Mango de potencia p/ frenos de disco.
s5SARC9!!COMOUNAFUENTEDEPOTENCIAPARAGIRARELROTOR
sin depender del motor del vehículo.
s%LCUBOCCUADROCOMPLETAMENTEAJUSTABLESEAJUSTAALAMAYORÓA
de los cubos de 4, 5 y 6 pernos.
s#OMPLETAMENTEAJUSTABLEDEA
s-OTORDE(020-20-CUADROFINAL
s6#!(ZMONOFÉSICO
YAH280-50 Mango de potencia p/ frenos de disco.
t 6(ZVERSIØNDE9!
Juegos de purga de frenos
Purgadores de frenos al vacío-Blue-Point®
BB700
BB500
Purgadores de frenos al vacío
BB500 Juego de purga de frenos.
s)NCLUYEPURGADORDEFRENOSALVACÓO""Y
BOTELLAPARARECARGAAUTOMÉTICA""
BB700REF
BB5001 Purgador de frenos al vacío.
sPurga al vacío rápida y eficiente que puede realizar una sola persona.
s%NVASEGRANDEDEPINTASLITROS'ENERAUNVACÓODEPULG(G
con una presión de aire de 100 psi.
s,OSSELLOSESPECIALMENTEFORMULADOSHACENPOSIBLEUTILIZARLAUNIDAD
con una variedad de fluidos.
s6ÉLVULADEENCENDIDOAPAGADOYREGULADORDEFLUJOSESELLACUANDONO
se la utiliza para evitar derrames.
s'ATILLOCONTRABADELIBERACIØNRÉPIDAVÉLVULADECIERREDESEGURIDAD
válvula de retención que evita el llenado excesivo.
s%LDISE×OCOMPACTOSEAJUSTABIENDEBAJODELARUEDA
s-ANGUERADESUCCIØNDE
s!CCESORIOPARATORNILLODEFRENOUNIVERSAL
BB5002 Botella para recarga automática.
s-ANTIENEELDEPØSITOLLENOHASTAELNIVELCORRECTOENFORMAAUTOMÉTICA
s%NVASEDEONZASFLUIDASML
s3UJETADORDERETENCIØNPARAUNACORRECTAFIJACIØN
s%LDISE×OCOMPACTOSEAJUSTABIENDEBAJODELACAPØ
s3ISTEMADEVENTILACIØNPOSITIVAQUEPROVEEUNFLUJOCONTINUO
s3EAJUSTAAPRÉCTICAMENTETODOSLOSDEPØSITOSDECILINDROSMAESTROS
puede sellarse cuando no se utiliza para evitar derrames
s6ÉLVULADEENCENDIDOAPAGADO
538
BB700 Purgador de frenos al vacío/Limpiador.
sEl control del reductor doble único le permite al control de fluido doble:
girar en una dirección para el modo de purga/limpieza al vacío, girar en
dirección opuesta para permitir que la presión baje y el líquido regrese
al sistema del vehículo/camión o se vacíe el depósito
sEl juego de válvula de purga se puede usar cuando se desconecta del
aire para una operación móvil.
s$OBLEUSOCOMOPURGADORLIMPIADOROEXTRACTORDELÓQUIDOS
sEl sistema único para desconectar la manguera incluye un anillo de
empuje para desconexiones rápidas.
sLa manguera se enrolla alrededor de la cabeza y las trabas en la perilla
y la paja se sujeta en el sostén para obtener un fácil almacenamiento
en cajas de herramientas o estantes.
s$RENALOSLÓQUIDOSRESTANTESENLAMANGUERADESPUÏSDEUSARPARA
evitar trabajos de limpiar el desorden.
s$EPØSITOCONCAPACIDADDECUARTOS
s/PERACIØNSILENCIOSA
s*UNTASDEANILLO/PARAMÞLTIPLESFLUIDOS
s%LANILLOSELLADORSEABREYPERMANECEENLAPARTESUPERIORPARAUNFÉCIL
servicio.
BB700REF Botella de recarga.
s%LIMINALANECESIDADDEREVISARLOSNIVELESDELÓQUIDOS
s%VITAQUEELAIREENTREENELSISTEMADEFRENOS
s&ACILITAELPROCESOEFECTIVODEPURGAREALIZADOPORUNASOLAPERSONA
Adaptadores de purga de frenos tipo diafragma-Blue-Point
Pieza No.
BB300B19
BB300B20
BB300B21
BB300B22A
BB300B26G
BB300B29G
BB300B35G
BB300B36G
BB300B39GC
BB300B41-G9
BB300B42G
BB300B45-G9
BB300B47G
Descripción
Adaptador enfriado por agua p/VW
Dispositivo de purga doble
Válvula de disparo
Juego de adaptadores, 7 pzas.
Adaptador universal
Adaptador redondo universal de 3 1/4"
Adaptador universal
Adaptador de depósito doble p/GM
Adaptador de depósito plástico p/GM/Chrysler
Adaptador rectangular universal
Adaptador universal
Adaptador redondo universal
Adaptador p/Chrysler
www.snapon.com/shoptools
BRAKE
FRENO
Hmj_Y\gj\]^j]fgk%:dm]%Hgafl®
Hmj_Y\gj\]^j]fgkkaf\aY^jY_eYBB100C
Purgador de frenos sin diafragma.
tCapacidad de 1 galón
s"OMBAAUTØNOMADEPRESURIZACIØNMANUAL
s-ÉSDEgDEMANGUERACONCIERREMANØMETROYACOPLADOR
rápido para usar con otros adaptadores de purga de frenos
POREJCUALQUIERADELOSADAPTADORES"""
s5TILICESØLOELLÓQUIDOPARAFRENOSDEAUTOMOTORES$/4
O$/4
LYhY\]hj]kaf\]d[adaf\jgeY]kljg
YA8925 Tapa de presión del cilindro maestro.
s4IENEUNAROSCADE-XQUESEADAPTA
ALDEPØSITODELÓQUIDOYUNAROSCADE
YMMPARAELPURGADORDEPRESIØN
s0ARAVEHÓCULOS-ERCEDES"-7!UDIY0ORSCHE
YA8925
BB100C
@]jjYea]flYkhYjYk]jna[ag\]^j]fgk
Bm]_gk\]k]jna[ag_]f]jYd
BCS70A Juego de puntas para calibre de freno de disco.
Para vehículos de los EE.UU. (excepto Chrysler). 7 piezas.
Pieza No.
FA8E
FA10E
FA12E
FAM8E
FTX40E
FTXB45E
FTXB50E
Descripción
Destornillador hexagonal de 1/4"
Destornillador hexagonal de 5/16"
Destornillador hexagonal de 3/8"
Punta hexagonal de 8mm
Punta Torx® T40
Punta Torx T40
Punta Torx T40
BTK5
PIEZASENBANDEJADEALMACENAMIENTO
BCS70A
BTK7A Juego de servicio de
frenos general.
PIEZASENBANDEJADEALMACENAMIENTO
Pieza No.
B1356E
B1458C
B1461
B3404B
BT11
S6112
B1467A
Descripción
Herramienta p/ resortes
Llave de purga de 9"
Herramienta de ajuste de 8 1/4"
Herramienta de ajuste (para frenos
autoajustables Bendix con tuerca de
ajuste estrella).
Herramienta p/ resortes
Llave de purga
Llave de purga (para GM, Ford y Chrysler)
Pieza No.
131A
B1461
S6110A
S6118A
SGT4BR
Descripción
Pinza p/ resortes de frenos
Herramienta de ajuste de 8 5/16"
Llave de purga (para GM, Datsun y Honda)
Dado c/ tapa de resorte c/ cuadro de 1/4"
Cuadro de 1/4"; mango de vástago largo de 5 3/4"
S6118A
BT19A
BTK7A
BT15
BT9
BT27
BT11
@]jjYea]flYkhYjYj]kgjl]k\]^j]fgk
131A
BT27 Herramienta para resortes de frenos simples
(GM)-Blue-Point.
s,AHERRAMIENTALIBERALATENSIØNDELOSRESORTESDEFRENOSSIMPLES
GRANDESYPEQUE×OSDE'-DURANTEELSERVICIO
!PLICACIONESDERESORTESGRANDES
#HEVROLET3ILVERADOYPOSTERIOR#HEVROLET#OLORADOY
POSTERIOR!PLICACIONESDERESORTESPEQUE×OS'-CONCARROCERÓA(
YPOSTERIOR"ONNEVILLE,E3ABREY$ELTA'-CONCARROCERÓA
#Y5YPOSTERIOR"UICK%LECTRA/LDS#ADILLAC&LEETWOODY
$E6ILLE#HEVY,UMINA!060ONTIAC4RAN3PORTY/LDS3ILHOUETTEY
#HEVY,UMINAY#HEVY-ONTE#ARLOYPOSTERIOR
BT11 Herramienta para resortes de frenos.
s0ARAELSERVICIODERESORTESDEFRENOS"ENDIX®YCUALQUIERRESORTE
unido al poste
s%LEXTREMODELDADOSERETIRAELEXTREMOENGANCHOLOREEMPLAZA
sDELARGO
131A Pinza para resortes de frenos.
s2ETIRAOREEMPLAZARESORTESDEFRENOS"ENDIX,OCKHEED® y otros
DERESORTESDEFRENOSHIDRÉULICOSYMECÉNICOS
s%LGANCHODEACEROENLAMORDAZAESREEMPLAZABLE
s,AEMPU×ADURAOFRECEUNREMOVEDORDERESORTETIPODADOY
colocador de gancho
sDELARGO
ADVERTENCIA
B1356E
BT17A
31-3B Gancho de reemplazo.
s'ANCHODEREEMPLAZOPARAPINZASPARARESORTESDEFRENOS!
S6118A Dado de tapa con resorte.
s%LDADODEEXTREMODOBLECCUADRODEESTÉDISE×ADOP
RESORTESDEFRENOSSUBCOMPACTOSENUNEXTREMOYPAUTOSGRANDES
DELOS%%55YCAMIONESLIVIANOSENELOTRO
s!CABADOINDUSTRIAL
s3EUTILIZACONPUNTA4-"
BT19A Herramienta para resortes de frenos para
servicio pesado.
s$ISE×OPARASERVICIOPESADO
s2EMUEVEOINSTALARESORTESDEFRENOSDELOS%%55YDEOTROS
países con o sin pasadores de sujeción
s%L$)MÉXIMODELALAMBREESDEELLARGOTOTALESDE
BT9 Herramienta para resortes de frenos–Blue-Point.
s2EMUEVEOREEMPLAZALOSRESORTESDEMANERARÉPIDAYFÉCIL
s,EPERMITEALMECÉNICOPRESIONARELRESORTEENSULUGARCONUNSOLO
MOVIMIENTOYREEMPLAZARELMECANISMODEDESLIZAMIENTO
s)NCLUYEDOSMECANISMOSPARAPERMITIRLAREMOCIØNYELREEMPLAZO
sencillo de resortes en los frenos
sDELARGO
B1356E Herramienta para resortes de retención de frenos.
s0ARAUSARENTAPASDERESORTESDERETENCIØNDEENLAMAYORÓA
DELOSVEHÓCULOSMÉSNUEVOS
BT15 Extractor.
s0ARAEXTRAERRESORTESDEFRENOSDEAUTOSGRANDESYCAMIONETASC
FRENOSESTILOTAMBOR
s!CABADOINDUSTRIAL
sDELARGO
BT17A Herramienta para resortes de retención.
s0ARAUSARENRESORTESDERETENCIØNDEDEDIÉMETROQUESE
ENCUENTRANENLAMAYORÓADELOSVEHÓCULOSNUEVOS
s!CABADOINDUSTRIAL
sDELARGO
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
539
FRENO
Herramientas para servicio de frenos
Calibradores de frenos de disco y micrómetros ®
RM130 Micrómetro de rotor–Blue-Point .
sGama de 0.30" a 1.3" en graduaciones
de 0.0001"
s#UADRODEDEPROFUNDIDAD
s9UNQUEENPUNTAPARAREVISARRANURAS
s)NCLUYECAJADEALMACENAMIENTOYESTÉNDARDE
RM130
CONTROLDE
GA3634
DG530
GA3634 Juego indicador de
prueba de junta de bola/freno
de disco.
s6ERIFIQUEELDESGASTEDELAJUNTADE
BOLAELDESCENTRAMIENTODELROTORDEL
FRENOELDESAJUSTEDELENGRANAJEYEL
DESGASTEDELAGUÓADEVÉLVULAODEL
ÉRBOLDELEVAS
s,ASPINZASDETRABASESUJETANCON
FIRMEZAACUALQUIEROBJETOADECUADO
s%LIMINALOSPROBLEMASDEVIBRACIØNY
LASLECTURASFALSAS
s)NCLUYECAJADEALMACENAMIENTO
#-
RG430
Calibradores de rotores/tambores de frenos–Blue-Point
DG530 Calibrador digital de rotores.
t-IDETAMBORESDEFRENOSDEAUTOMØVILESYPARASERVICIOPESADO
s,OSYUNQUESENPUNTAYBRAZOSDEDELARGOPERMITENMAYOR
PRECISIØNYCOBERTURADEMEDICIØN
s0ANTALLADIGITALFÉCILDELEERCONCONVERSIØNDEPULGADASASISTEMAMÏTRICO
s4OPESDEPROFUNDIDADSELECCIONABLEPARAUNUSOMÉSFÉCIL
s'AMADEADEAMMENGRADUACIONESDE
MM
RG430 Calibrador digital de rotores.
t-IDELOSROTORESDEFRENOSYLASJUNTASDEBOLA
s%LYUNQUEENPUNTAYLOSBRAZOSDEDELARGOPERMITENMAYOR
PRECISIØNYCOBERTURADEMEDICIØN
s0ANTALLADIGITALFÉCILDELEERCONCONVERSIØNDEPULGADASASISTEMAMÏTRICO
s4OPESDEPROFUNDIDADSELECCIONABLEPARAUNUSOFÉCIL
s'AMADEADEAMMENGRADUACIONESDEMM
S9523
HSA716
B1468
BSA916
BT4651
Herramientas de ajuste para frenos de camiones
S9523 Ajustador de frenos.
s(ERRAMPARAGIRARTUERCASESTRELLADECAMIONES#HEVROLETCON
RESORTESPARASOBRECARGA
s$IFERENTESÉNGULOSENCADAEXTREMODELAHERRAMIENTAPARAMAYORESPACIO
s%LANCHODELAHOJAESDELAHERRAMMIDEDELARGO
B1468 Ajustador de frenos.
t0ARAUSARENCAMIONES'-#Y#HEVROLETDEYTON
s,ASPUNTASENCADAEXTREMOESTÉNDOBLADASENªYGIRADASª
PARAPERMITIRELACCESOALMECANISMODEAJUSTEDEFRENOS
sDELARGO
BT4651 Juego de ajustador de flojedad para
camiones pesados.
s%LJUEGODEHERRAMIENTASAJUSTADORASDEFLOJEDADAUTOMÉTICAS
ESTILO2OCKWELLINCLUYEUNAHERRAMIENTAAUTOMÉTICAREVERSIBLEY
COMPENSADAPARALIBERAR
s,AHERRAMIENTADELIBERACIØNSEDESLIZAPORDEBAJODELBOTØNDEL
TRINQUETEDETRACCIØNDELAJUSTADORDEFLOJEDADAUTOMÉTICOHASTA
QUEDARTOTALMENTEAPOYADAMIENTRASQUELALLAVESEUTILIZAPARA
AJUSTARELESPACIOENTREELFRENOYELTAMBOR
s%MPU×ADURADEDESTORNILLADORPARAMEJORDESEMPE×OYCOMODIDAD
HSA716 Llave ajustadora de flojedad
t0ARASERVICIODEFRENOSEINSTALACIØNDELAAJUSTADORADEFLOJEDAD
ENCAMIONESDESERVICIOPESADOEQUIPADOSCONAJUSTADORESDE
FLOJEDADAUTOMÉTICOS(ALDEX®
s5SEPARAGIRARELAJUSTADORHEXAGONALMANUAL
s%LAJUSTADORDEHEXAGONALDEEXTRAPROFUNDOPERMITELLEGARA
AJUSTADORESEMBUTIDOS
s,ALONGITUDTOTALDEPERMITEREALIZARELMECANISMOANTIRETROCESO
s,ABOTADEVINILOPROTECTORAEVITAQUELOSCONTAMINANTESINGRESEN
ENELMECANISMODELTRINQUETEPARAOBTENERUNAMAYORVIDAÞTILDE
LAHERRAMIENTA
540
S9153B
B1462A
B3404B
B1461
S5912
S6004
Herramientas de ajuste para frenos de automóviles
S9153B Ajustador de frenos.
t$ISE×ADOPARARODEAROBSTRUCCIONESENVEHÓCULOS'-
s,ASHOJASMIDENDEANCHOLAHERRAMIENTAMIDEDELARGO
B1462A Adaptador de frenos
t0ARAFRENOSTRASEROSDEESOSAUTOSYCAMIONESCPERNOSDEBRAZOS
DEARRASTRE
s,AESPIGAENCADAEXTREMOESTÉAJUSTADAAªPEROEN
DIRECCIONESOPUESTASPARAUSARENLATERALESIZQUIERDOSYDERECHOS
sDELARGO
B3404B Ajustador de freno.
t0ARAFRENOSAUTOAJUSTABLES"ENDIX®YOTROSFRENOSCONTUERCADE
AJUSTEESTRELLAEXCEPTO#HEVROLET
s,ASHOJASTIENENDEANCHOCONUNESPESORDEPUNTADE
sDELARGO
B1461 Adaptador de freno.
t5NEXTREMOPOSEEUNAESPIGAANCHAENÉNGULODEªPARAFRENOS
TRASEROSELOTROEXTREMOESTÉENÉNGULODEªPARAFRENOSDELANTEROS
sDELARGO
S5912 Ajustador de freno.
t0ARAUSAREN67-AZDA/MNIY(ORIZON
s#ADAESPIGAESTÉAHUSADAENUNANCHODEPUNTADE
s5NAESPIGAESRECTAYLAOTRAESTÉCOMPENSADAAª
sDELARGO
S6004 Ajustador de freno.
t0ARAUSARENVEHÓCULOS4OYOTADEYPOSTERIORESALDESARMAR
LOSFRENOSAUTOAJUSTABLES
s5NEXTREMOESTÉCOMPENSADOAªELOTROAª
s%STÉAHUSADAENPUNTASDE
sDELARGO
S6005 Ajustador de freno.
t3IMILARA3
s0ARAUSARENVEHÓCULOS4OYOTAYPOSTERIORESCUANDOSEDEBE
DESARMARPORCOMPLETOLOSFRENOSAUTOAJUSTABLES
s5NEXTREMOTIENEUNÉNGULODEªELOTROPOSEEUNÉNGULOESPECIAL
s#ADAESPIGAESTÉAHUSADAENUNAPUNTADE
sDELARGO
BSA916 Llave ajustadora de flojedad.
s0ARASERVICIODEFRENOSEINSTALACIØNDEAJUSTADORDEFLOJEDAD
ENCAMIONESDESERVICIOPESADOEQUIPADOSCONAJUSTADORESDE
FLOJEDADAUTOMÉTICOS"ENDIX
s5SEPARAGIRARELAJUSTADORHEXAGONALMANUAL
s%LAJUSTADORDEHEXAGONALDEEXTRAPROFUNDOPERMITELLEGARA
AJUSTADORESEMBUTIDOS
s,ALONGITUDTOTALDEPERMITEREALIZARELMECANISMOANTIRETROCESO
s,ABOTADEVINILOPROTECTORAEVITAQUELOSCONTAMINANTESINGRESEN
ENELMECANISMODELTRINQUETEPARAOBTENERUNAMAYORVIDAÞTILDE
LAHERRAMIENTA
www.snapon.com/shoptools
FRENO
@]jjYea]flYkhYjYk]jna[ag\]^j]fgk
MPBS11400
YA2440
YA8610B
SVT710
FTSM4E
BL55A
YA9329A
YA6425
FTSM6E
Pieza
No.
BT350A
GA395
BTG8
BTCP1
Tamaño, Acabado Descripción
mm
Tipo
A
B
C
D
FTSM4E
4
Cromados
Largo
estándar
Triple
cuadrado 17.2 21.6 48.5
FTSM4E2
FTSM5E
5
Cromados
Largo
estándar
Triple
cuadrado 17.2 21.6 48.5
FTSM5E2
FTSM6E
6
Cromados
Largo
estándar
Triple
cuadrado 17.2 21.6 48.5
FTSM6E2
@]jjYea]flYkhYjY^j]fgk\]\ak[g
MPBS1140O Palanca/Herramienta para freno. Perfectas para
talleres de servicio de frenos/neumáticos de gran volumen y aplicaciones
automotrices en general. Diseñadas específicamente para aplicaciones para
levantar y alinear frenos, como pistones, calibres o rotores del freno. Mango
con cuadrado de 3/8" hecho con acero de aleación especial con punta recta.
La longitud total de 11" con un ángulo de 40 garantiza el acceso a aberturas
de ruedas estrechas. Una empuñadura anaranjada grande, cómoda, altamente
visible con tapa de golpeteo permite un agarre bueno aunque pequeño y fuerte
para sostener las herramientas de ajuste de freno. Largo de la empuñadura:
5-1/2". Longitud de la barra expuesta: 5-1/2"; barra: 3/8"; ancho de punta:
3/8"; tipo de punta: punta recta.
YA8610B Juego de herram. p/calibre de freno universalBlue-Point®. Para el reemplazo de las pastillas de freno en la mayoría de
los autos c/frenos de disco en las 4 ruedas. La herramienta y los adaptadores
colocan el pistón del freno dentro del calibre p/dejar espacio p/pastillas de
frenos nuevas y más gruesas. Diseñada para la mayoría de los vehículos Audi,
Chrysler Corporation, Ford, GM, Honda, Jaguar, Mazda, Mini Cooper, Mitsubishi,
Nissan, Saturn, Subaru, Toyota, VW y Volvo. El juego incluye 1 herramienta y 6
adaptadores en una caja de almacenamiento.
YA6730 Juego de herram. para calibre de freno. Combina el
conjunto principal del juego YA8610B y el adaptador YA8610B-7.
YA8610B-7 Adaptador de herram. p/calibre de freno. Para usar
en vehículos Mazada 3 (2004 y posteriores), Mazda 5 (2006 y posteriores),
Mini Cooper (todos los modelos 2002 y posteriores), Volvo S40 (2004 1/2 y
posteriores), Volvo V50 (2006 y posteriores), Volvo C30 (2007 y posteriores),
Pontiac Solstice (2006 y posteriores), Saturn Sky (2007 y posteriores) y Jaguar
tipo X (2006 y posteriores).
YA2440 Separador de pastillas–Blue-Point. Para usar en la mayoría
de los autos y camiones de servicio liviano de EE.UU. y de otros países c/frenos
de disco c/pistón único sin freno de mano. Comprime el pistón del freno de
disco para una fácil instalación de la pastilla.
GA395 Separador–Blue-Point. Para frenos de disco con calibres de cuatro
pistones. Libera las manos p/armar el calibre sobre el rotor. 6 3/4" de largo.
BL55A Removedor del retenedor del cilindro del freno. Se usa
en los autos GM último modelo incluyendo los autos con carrocería X. Expande y
sostiene el retenedor para armar o desarmar el cilindro.
FTSM4E Mango con cuadrado triple métrico. Para usar en tornillos
de manijas de puertas de VW/Audi 1998 y posteriores, sujetadores de tambores de
freno en VW Toureg y en muchas otras aplicaciones de cuadrado triple de 4 y 5 mm.
FTSM5E Mango con cuadrado triple métrico. Para usar en tornillos
de manijas de puertas de VW/Audi 1998 y posteriores y también en aplicaciones de
cuadrado triple de 4 y 5 mm. Para usar también en Porsche Cayenne modelo 2003
a 2008 para aflojar la cubierta en el cable de ajuste para el freno de emergencia.
ADVERTENCIA
FTSM6E Punta métrica c/cuadrado triple. Para calibre de freno
de disco de VW.
SVT710 Analizador de frenos de disco. Utilice el analizador para
detectar deslizamientos y pistones de calibre de freno pegajosos, aire en el
sistema hidráulico, manguera de freno flexible restringida y otros problemas
en los frenos. El juego incluye dos medidores de capacidad de 0-5,000 psi en
una caja de madera. La aguja indicadora de memoria de color rojo registra la
lectura más alta.
YA9329A Herramienta de rotación del pistón–Blue-Point.
Se utiliza p/rotar el pistón e introducirlo en el cilindro del calibre durante el
reemplazo de las pastillas. También introduce el cilindro del freno de mano
en el cilindro del calibre en los vehículos con frenos de disco en las cuatro
ruedas. Para Ford y Mercury 1975 y posteriores más algunos vehículos
fabricados fuera de EE.UU.
BT350A Prensa para pistones de frenos–Blue-Point.
Aplicaciones: la mayoría de los automóviles y camiones de servicio liviano y
pesado. Prensa pistones simples o dobles. Simple y fácil de usar: sin tuercas
ni pernos involucrados en las operaciones de prensa.
YA6425 Herramienta p/calibre de frenos universal (Rosca
izquierda)-Blue-Point. La rosca izquierda es esencial para realizar el
servicio de los calibres de frenos de los modelos Ford más recientes como,
por ejemplo, el Freestyle, Ford 500 y Mercury Montego. Incluye adaptador #2.
BTG8 Juego de calibrador para zapatas/pastillas de frenoBlue-Point. Los calibradores codificados por color informan al instante
sobre la condición de la zapatas/pastillas de freno. Construidos en hoja
metálica de calibre 20 con acabado de recubrimiento de polvo duradero.
El color rojo indica que es necesario realizar el servicio, el amarillo indica
precaución y el verde indica que se encuentran en buen estado. Incluye 8
hojas de prueba que varían en color y espesor:
Rojo 2mm (0.0787")
Amarillo 4mm (0.1575")
Verde 8mm (0.3150")
Rojo 3mm (0.1181")
Amarillo 5mm (0.1969")
Verde 10mm (0.3937")
—
Amarillo 6mm (0.2362")
Verde 12mm (0.4724")
BTCP1 Prensa para calibres de frenos–Blue-Point. Funciona
en calibres fijos y flotantes. Genera una fuerza superior a 1,600 pies lb. para
retraer los pistones de calibre más duros. Mecanismo de palanca simple
usado para aplicar y liberar fuerza para facilitar la operación y agilizar el
servicio. Evita el daño en pistones, cubos o calibres. Garantiza una retracción
paralela de los pistones en los calibres de pistones dobles y cuádruples. Fácil
uso de lado izquierdo y derecho.
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
541
FRENO
Herramientas para servicio de frenos
B1359B
S6110A
BT518
BT1360
BT12
BT400
YA9070A
TAP1
B1467A
B1463A
Herramientas para frenos de camiones
B1359B Herramienta para resortes de retención de
frenos. Para camiones Chrysler y Ford de 3/4 ton. equipados con frenos
Bendix®. El extremo en U está compensado de 30° a 45° para una fácil
remoción de la zapata del freno del resorte de la placa de respaldo.
BT518 Herram. p/zapata de frenos. Para camiones grandes
y remolques c/frenos neumáticos c/diseño de leva en "S". Ofrece
palanca p/retraer la zapata del freno y remover la leva rodante.
Acabado industrial.
BT12 Herram. p/resortes de frenos. Para el servicio de
resortes de retracción de las zapatas de frenos de los camiones que
usan el sistema Bendix, Wagner® y Kelsey-Hayes®. La forma especial
permite tener acceso y hacer palanca.
YA9070A Herramienta de ajuste de frenos traseros.
Para frenos Lucas-Girling de eje único que se encuentran en
camiones Ford F-600 1984 y posteriores y en grandes camiones y
ómnibus Ford. Tiene todos los ángulos rectos p/llegar a través de la
placa de respaldo. Acabado industrial.
BT1360 Herramienta p/resortes de frenos. Extrae los
resortes que sujetan las zapatas de freno de camiones Ford, GM, Dodge
e internacionales de servicio pesado. Empuñadura grande y cómoda.
Fabricada para ofrecer resistencia y durabilidad. Aplicaciones:
Ford: F250, F350, P250, P350, P400GM: 1 ton, algunos 1/2 ton.Dodge:
B300, D200, D300, P200, P300International: Serie 1200 y 1300
BT400 Herramienta p/ resortes de frenos (Servicio
pesado)–Blue-Point®. Para resortes de frenos de camiones
de 3/4 ton y más pesados. Empuñadura en T que genera el torque
máximo cuando detecta resortes duros. La cabeza puede girarse
360° para sortear obstáculos. El largo total es de 7 3/4".
TAP1 Prensa para bujes y pasadores de sujeción de
camiones. Diseñada para remover pasadores y bujes de frenos
de sistemas de freno de tractores y remolques de leva S de “tipo Q”
de 16 1/2" Dana-Spicer, Arvin-Meritor (Rockwell), Eaton, Timkin y
Fruehauf. Remueve los pasadores y bujes de freno sin necesidad de
quitar el cubo de rueda. Los anillos de retención de almohadilla de
presión sostienen firmemente las almohadillas en su lugar. Sólo se
necesitan las dos manos para operarla. Las almohadillas de presión
intercambiables permiten remover el bujo sólo o el pasador y el buje
a la vez. El accesorio de engrase Zerk lubrica y limpia la suciedad del
tornillo de presión para una mayor vida útil. Diseñada para usar con
pistolas de impacto de 3/4". Caja de almacenamiento.
542
B1458C
S6112
Llaves de purgaS
6110A Llave de purga. Para GM, Nissan y Honda. Un extremo
de ojo de 6 puntas de 8 mm; el otro extremo de 10 mm. Los
extremos están compensados p/mayor espacio. 192 mm de largo.
B1460B Llave de purga. Similar a S6110A. Tiene un extremo
de ojo de 3/8" p/trabajos de purga de frenos y un extremo de ojo
de 7/16" p/ajustar pernos excéntricos de la zapata del freno. La
compensación evita el choque c/el brazo de enlace y la placa de
respaldo embutida en la rueda delantera. 9 1/2" de largo.
B1467A Llave de purga. Para GM, Ford y Chrysler. Similar a
S6110A. Los extremos de ojo hexagonales simples de 5/16" y 3/8"
están compensados para acceder a los accesorios de purga. 8 1/2"
de largo.
S6143 Llave de purga. Para la mayoría de los autos fabricados
fuera de EE. UU. Similar a S6110A. Los extremos de ojo de 6 puntas de
7 y 9 mm están compensados para mayor espacio. 252mm de largo.
B1458C Llave de purga. Incluye extremos de ojo hex. simples
de 1/4" y 3/8". 9" de largo.
B1463A Llave de purga. Los extremos de ojo de 6 puntas de
1/4" a 3/8" están ahusados para mayor espacio. Brazos de 3 3/4" de
largo (para accesorios de purga más pequeños en la mayoría de los
autos compactos).
S8184 Llave de purga. Para accesorios de la mayoría de los
autos GM. Similar a B1463A. Aberturas de ojo de 6 puntas de 3/8" y
5/16". Brazos de 4" de largo.
B1470 Llave de purga. Similar a B1463A. Para los últimos
modelos de GM y la mayoría de los autos no fabricados en EE. UU.
Un extremo de ojo de 6 puntas de 8 mm; el otro extremo de 10 mm.
La llave está doblada a 90° p/un mejor acceso. Los brazos miden
aprox.100 mm de largo.
S6112 Llave de purga. Para algunos GM y Toyota, más otros
autos no fabricados en EE. UU. Similar a B1463A. Un extremo de
ojo de 6 puntas de 8 mm; el otro extremo de 10 mm. La llave está
doblada a 90° p/un mejor acceso. Los brazos miden aprox. 130 mm
de largo.
S6111 Llave de purga. Abarca el 90% de las aplicaciones
estadounidenses en los modelos más recientes incluso Chrysler,
Dodge, Ford, GM, Audi, Mercedes y VW. Configuración de llaves
Flank Drive® de 6 puntas de 10 mm y 11 mm. Los extremos están
compensados p/mayor espacio. 235mm de largo.
www.snapon.com/shoptools
FRENO
@]jjYea]flYkhYjYk]jna[ag\]^j]fgk
DdYn]kq\Y\gk
PMP406A Dado métrico de tapón de tubo interno. Para
ajuste de frenos traseros de Subaru de 1973 a 1986. Dado cuadrado
interno de 6 mm con cuadro de 3/8".
6
Pieza No.
A
B
PMP406A
17.2
25.8
PMP406A
J]_mdY\gj\]dj]\m[lgj';YdaZjY\gj\]j]Ybmkl]\]d^j]fg
B240B Regulador del reductor-Blue-Point®.
s-ANTIENEELREDUCTORAUNA20-CONSTANTESEAJUSTAFÉCILMENTEAL
LARGODESEADO
s%LTORNILLODEAJUSTEESTABLECEENFORMAPRECISALAS20-DESEADAS
s,APUNTADEGOMAMANTIENELAHERRAMIENTAUBICADACONFIRMEZAEN
ELPEDALDELACELERADOR
s,ARGOTOTALDE"
YA2780 Calibrador de reajuste del freno.
s#ONFIGURAAUTOMÉTICAMENTEELTAMDELAZAPATADELFRENOCUANDO
SEMIDECONTRALASPAREDESDELTAMBOR
s,ASECCIØNDETRABAPOSITIVAASEGURAUNALECTURAPRECISA
s'AMAMEJORADADEA
B240B
YA2780
>j]fg\]]e]j_]f[aY
SIML160 Dado de impacto extra profundo de 6 puntas.
s3EUTILIZAPEXTRAEROREEMPLAZARTUERCASDECINTADERETENCIØNDE
TANQUESDECOMBUSTIBLE
s4AMBIÏNTIENEAPLICACIONESENTUERCASDEAJUSTEDEFRENOSDE
EMERGENCIAYRETENEDORESESTABILIZANTES
s#UADROCUADRADODECONABERTURADELLAVEDEPUNTASDE
sDELARGO
SIML180 Dado.%LMISMODISE×OQUE3)-,PEROCONHEX
de 9/16"
SIML160
>j]fg\]]e]j_]f[aY%:dm]%Hgafl
BT22A Herramienta para cable de freno de mano.
s$ISE×ADAPARAREMOVERLOSCABLESDELFRENODEMANODELAPLACADE
RESPALDODELFRENOYDELSOSTÏNDEMONTAJEDELCHASIS
s%STAHERRAMIENTADEEXTREMODOBLESEUTILIZAENAPLICACIONES&ORD
%SCORT4OPAZY4EMPOCONUNEXTREMOMIENTRASQUEELEXTREMO
MÉSGRANDESEUTILIZAPARAELSERVICIODELRESTODELOSVEHÓCULOS
BR1 Pinzas p/ anillos C.
s!BREELANILLO#ENLAPALANCADEACCIONAMIENTODELFRENODE
EMERGENCIAPARACAMBIARLASZAPATASDELOSFRENOSTRASEROSEN
MUCHOSVEHÓCULOSYCAMIONESNACIONALESEIMPORTADOS
BR2 Pinzas p/ anillos C.
s3OSTIENEELANILLO#PARAEVITARQUESEDESLICEDURANTELAINSTALACIØN
BT22A
BR1
ADVERTENCIA
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
543
FRENO
Herramientas para servicio de frenos
Juego de bomba de presión de vacío-Blue-Point®
YA4000B Juego de comprobación para automóviles.
s0RODUCEVACÓOOPRESIØNALGIRARUNINTERRUPTOR
s$ISE×OERGONØMICOCØMODO
s,IBERACIØNDEVACÓOPRESIØNACTIVADACONUNDEDO
s#ALIBRADORDEPRESIØNVACÓOTIPODIAFRAGMADURABLEYPRECISO
s"OMBADEVACÓOPRESIØNPORTÉTILCONUNCALIBRADORCOMPUESTODE
y una capuchón de goma
s"OTELLADELÓQUIDOSDEONZASCONTAPASDETRANSFERENCIAY
ALMACENAMIENTODELÓQUIDOSMÉSUNTUBODEASPIRACIØNDELÓQUIDOS
s3EISADAPTADORESAHUSADOSPARACONECTARTUBOSDE$)DE
a 0.50"
s$OSTAPONESDEMÞLTIPLEAHUSADOS
s$OSADAPTADORESDETORNILLOSDEPURGAUNIVERSALES
sENCHUFESDETAPØNDEVACÓOADAPTADOR4DELÓNEADEVACÓO
s$OSTUBOSDECONEXIØNDE$)XDELARGOCONCONECTORDE
cambio rápido
s!DAPTADORDETUBODE$)X$)
s4UBODECOMPROBACIØNDEVACÓODE$)XDELARGO
s!DAPTADORDECOPADEGOMA
s*UEGODERECARGADECILINDROMAESTRO
!PLICACIONES
s!FINACIONESYDIAGNØSTICOSDEDESEMPE×ODELMOTORRELACIONADO
CONELVACÓOYLAPRESIØN
s0URGADEFRENOS
s4RANSFERENCIAEVACUACIØNYMUESTRARIODELÓQUIDOS
YA4000B
Rectificadoras-Blue-Point
CF63
Juegos de rectificadoras de tres brazos y piedras
JT64
Juegos de rectificadoras de dos brazos y piedras
JT64 Rectificadora de dos brazos. Para cilindros de 1/2" a
2 1/4" de diám. Incluye 2 piedras de grano mediano de 1 1/8"
de largo.
JT64-1 Juego de piedras. Juego de 2 piedras medianas
(220 granos) para JT64. 1 1/8" de largo.
JT64-14 Juego de piedras. Juego de dos piedras finas
(400 granos) para JT64. 1 1/8" de largo.
544
CF63 Rectificadora de tres brazos. Para cilindros de 3/4" a
2 1/2" de diám. Tuerca manual ajustable para controlar la tensión.
CF68 Rectificadora de tres brazos. Para cilindros con
diámetro de 1 1/4" a 3 1/2". Tuerca manual ajustable para controlar
la tensión.
Juego de piedras
Pieza No.
Grano
Largo, pulgadas
CF63-100
100 (3)
1 1/8
CF63-1
240 (3)
1 1/8
JT63-21
220 (3)
2
CF63-34
240 (3)
3/4
CF63-14
400 (3)
1 1/8
JT63-24
400 (3)
2
www.snapon.com/shoptools
CARROCERÍA
J]hYjY[af\][Yjjg[]jYk
CJ107
CJ1200
CJ114
BM175
YA2002
=pljY[lgj]k
:YjjY\]Ydaf]Y[af
CJ107 Extractor de abolladuras en carrocerías.
tLa acción del martillo deslizante empuja la abolladura hacia afuera
para poder alisarla
s3EINCLUYEGANCHO“L”PARATRABAJOSMÉSGRANDES
s-ARTILLODESLIZANTEDELB
CJ114 Extractor de abolladuras en carrocerías.
t0RINCIPALMENTEPARAPANELESLATERALESTRASEROSDEBALANCINESYDEPUERTAS
s)NCLUYETORNILLOPARAPUNZARLAPLANCHADEMETALMÉSUNGANCHO
EXTENSIBLEYDESELLOPARATRABAJOSMÉSGRANDES
s-ARTILLODESLIZANTEDELB
YA2002 Rectificador de paneles laterales.
t%LIMINAABOLLADURASDELATERALESPOSTERIORESYABERTURASDELASRUEDAS
s$OSTUBOSDECADAUNOCONDIFERENTESDIMENSIONESSEAJUSTAN
ALAMAYORÓADELASABERTURASDELASRUEDAS
s3EUSACONCADENAFIJADAALARMAZØNDELAMÉQUINAOUNIDADDE
potencia portátil
CJ1200 Juego de rectificador con martillo deslizante.
t)NCLUYEUNMARTILLODESLIZANTECONCONTORNOFORMADODELBYUNA
VARIEDADDEACCESORIOSPLAREPARACIØNDECARROCERÓASDEAUTOMØVILES
BM175 Barra de alineación. 3EUTILIZAPARAALINEARPARAGOLPES
postes de ventanillas, aberturas de ruedas, paneles, capós, bases
DECARROCERÓASYMUESCAS,ACADENADEDEgDELARGOTIENE
GANCHOSSOLDADOSENCADAEXTREMOPARAENGANCHARLAFÉCILMENTEALOS
COMPONENTESDELACARROCERÓA4UBERÓADEDELARGOY
DEDIÉMETRO
Bm]_gkhYjYj]hYjY[af\][Yjjg[]jYk%:dm]%Hgafl®
YA1544A Juego para reparación de carrocerías.
t%LJUEGODETONELADASDECAPACIDADINCLUYEUNIDADHIDRÉULICA
cinco extensiones de “*UEGO3NAP”, separador, más un amplio
surtido de accesorios necesarios para aplicaciones de tracción: el
JUEGODEPIEZASINCLUYEUNACAJADEALMACENAMIENTODURABLE
s%LSISTEMAAUTOMÉTICODESOBRECARGADEBOMBAEVITAELDA×OALOS
PISTONESYALEQUIPO
s%LSEPARADORHIDRÉULICODETONELADADECAPACIDADTIENEUNA
MORDAZADEvYSEEXTIENDEDEA
s,ACABEZAFLEXIBLEINCLUYEUNAALMOHADILLADEGOMAMOLDEADAEN
forma permanente
s,OSTUBOSDEEXTENSIONESDEPAREDESGRUESASRESISTENLASCARGAS
más pesadas
s%LLARGODELAEMPU×ADURAREDUCEELESFUERZODEBOMBEO
YA1545 Juego para reparación de carrocerías.
s%LJUEGODETONDECAPACIDADINCLUYEUNIDADHIDRÉULICACUATRO
EXTENSIONESYSEPARADORYUNAMPLIOSURTIDODE
accesorios en una resistente caja de almacenamiento a medida con ruedas
s!PLICACIONESTRACCIØNSEPARACIØNYPRESIØNDELOSPANELESDELA
CARROCERÓADELOSVEHÓCULOSCOMOTAMBIÏNDECONJUNTOSYPIEZASDE
diversos componentes
s"OMBASCONCAPACIDADDEAPSI
s0ORTÉTILPARAUSARENELTALLEROENLARUTA
ADVERTENCIA
BM101
?Ylg\]ljY[[af'[gehj]kaf
BM101 Gato de tracción/compresión. Capaz de producir
LBDEFUERZADETRACCIØNCOMPRESIØN0UEDEALINEARENDEREZAR
YELIMINARABOLLADURAS'ANCHODEUSOMÞLTIPLEENLACABEZADELGATO
MÉSUNGANCHOENLAVARILLADEFRICCIØNDEDELARGO%MPU×DE
TRESPOSICIONES,AVARILLADEFRICCIØNSEFLEXIONASINDOBLARSEPARA
MANTENERLAPRESIØNCONSTANTEMIENTRASQUEELEXTREMORANURADO
EVITADESLIZAMIENTOS
YA1544A
@~_Ydg^mf[agfYjkdgka]dj][laÇ[Y\gj]kl~\]fljg\]d[adaf\jg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
YA1545
545
CARROCERÍA
Martillos
BF618B
BF630B
BF610B
BF632B
BF604B
BF608B
BF611B
BF617B
BF631B
BF603B
BF614B
BF635
Martillos
BF618B Martillo con un extremo plano redondo y otro acuñado.
tPara enderezar contornos irregulares del guardabarros
BF632B Martillo para panel de puerta.
tPara enderezar el panel de la puerta y de la carrocería
s,ACABEZADEDIÉMMÉSPEQUE×OESTÉCOMPENSADAAº
s%MPU×ADURADEFIBRADEVIDRIO
BF611B Martillo con un extremo plano redondo y otro
cónico corto.
t0ARAABOLLADURASPEQUE×ASYREPARACIONESGENERALESDECHAPA
BF603B Martillo con un extremo plano redondo y otro
cónico largo.
t0ARAENDEREZARABOLLADURASENCHAPACONMATERIALDERELLENOO
CUANDOELMETALESTÉCUBIERTOCONMATERIALAISLANTE
BF630B Martillo con un extremo plano redondo y otro
cónico trunco.
t%LMISMODISE×OQUE"&"PEROCONUNEXTREMOTRUNCO
BF604B Martillo con un extremo plano redondo y otro
tipo cincel.
t0ARATRABAJOSDEACABADOYCALAFATEADO
BF617B Martillo con un extremo plano redondo y otro
rugoso redondo.
t#ONCARASEXTRAGRANDESPARATRABAJARENZONASEXTENSAS
s#ARASERRADAPENCOGERYPLANAPTRABAJOSDEACABADO
BF614B Martillo c/extremo plano y punta cónica extra larga.
tPara trabajar en torretas y guardabarros
BF610B Martillo con un extremo plano redondo y otro
rugoso cuadrado.
t%LMISMODISE×OQUE"&"EXCEPTOQUELACARAENCOGIDAY
rugosa es cuadrada
s%NELOTROEXTREMOTIENEUNACABEZAPARAACABADO
BF608B Martillo con un extremo redondo plano y otro
tipo cincel curvo.
tPara usar debajo de los guardabarros con bordes doblados: la cara
PLANASEUSAPARATRABAJOSENCHAPA
BF631B Martillo con un extremo rugoso redondo y
otro tipo cincel.
t#OMBINAELEXTREMODEL"&"CLACARADENTADADEL"&"
546
BF635 Martillo para revestimiento de puertas.
s0ARAREEMPLAZODEREVESTIMIENTOSDEPUERTA
s,ASCARASANGOSTASYRECTANGULARESTRABAJANENÉREASDEBRIDAESTRECHA
s#ABEZARECTADECORONAALTACONRADIODEPARA
TERMINACIONESDESECCIONESDELGADASSINORIFICIOSPUNZANTES
s#ABEZADECORONAMEDIACONCOMPENSACIØNDEºYRADIODE
para trabajar en bridas angostas contra la estructura de la puerta
s,AEMPU×ADURADEFIBRADEVIDRIOOFRECEEXCELENTEEQUILIBRIOYALTARESISTENCIA
Especificaciones para los martillos
Pieza No.
Largo
Tamaño
Largo
Diám. cara extremo
cabeza,
de empuñadura,
pulgadas redonda, pulg. peña, pulg.
pulgadas
3/16
x 7/8
Peso de
cabeza,
onz.
BF618B
5
1 9/16
12
12 1/2
BF632B
6 5/8
1 1/4 - 1 5/8
—
13
16
BF611B
4
1 15/32
—
12
8
BF603B
6 1/8
1 19/32
1/16
x 7/16
13
12 1/2
BF630B
6
1 19/32
1/4
BF604B
5
1/2
BF617B
4
1/2
BF614B
x 7/16
13
12 1/2
1
5/8
5/8
13
11 1/2
1
7/8
—
13
16
8 5/8
1 5/8
—
17
16
BF610B
4 1/4
1 7/8
—
13
16
BF608B
5 5/16
1 5/8
x 1/16
13
11 1/2
BF631B
5 1/2
1 7/8
5/8
13
11 1/2
1 7/16 - 1 5/8
5/8 x 1 1/2
5/8 x 2
12
16
BF635
7
5/8
Empuñaduras de nogal
Pieza No.
Largo,
pulgadas
Martillos utilizados en
BF603-2R
13
BF603B, BF604B, BF608B, BF617B, BF610B,
BF630B, BF631B, BF633, BF634
BF611-2R
12
BF611B, BF615 y BF618B
BF614-2R
17
BF614B
www.snapon.com/shoptools
CARROCERÍA
Bm]_gk\]`]jjYea]flYkhYjY[Yjjg[]jY
Bm]_gk\]`]jjYea]flYkhYjY[Yjjg[]jY
2005BFA Juego de herramientas para carrocería.
s#ONTIENEELRECTIFICADORPARAABOLLADURASDECARROCERÓA#*
ADEMÉSDELOSMARTILLOSPARACARROCERÓA"&"Y"&"CUCHARA
PARANIVELAR"&"YSUFRIDERADETALØN"&"PZAS
2007BFB Juego de herramientas para carrocería.
t3IETEDELASHERRAMIENTASMÉSNECESARIASPARATRABAJOSDE
CARROCERÓAPROFESIONALESCUCHARA"&"MARTILLOSPARACARROCERÓA
"&""&"Y"&"YSUFRIDERAS"&""&"Y"&"
2005BFA
2007BFB
Lab]jYk\]`gbYdYl]jgº:dm]%Hgafl®
CD10A
CD12A
CD16A
Lab]jYk\]`gbYdYl]jghYjYdYlYk
#ORTAMOLDESDERECHOSCIRCULARESOIRREGULARESCORTESHACIALA
DERECHAOIZQUIERDA
CD7A Tijera de hojalatero de punta ancha. (OJASDE
DELARGO
CD10A Tijera de hojalatero de punta ancha. (OJASDE
DELARGO
CD12A Tijera de hojalatero de combinación. (OJASDE
DELARGO
CD16A Tijera de hojalatero tipo Bulldog. (OJASDE
DELARGO
Lab]jYk\]`gbYdYl]jg\]YnaY[af
DAR9A
s,ASHOJASCOMPENSADASPERMITENQUEELMATERIALCORTADOPASE
DEBAJODESUMANOSINENROLLARSE
s-ANIOBRABLEPARACORTEENÉNGULOOCONFIGURACIONESDELMOLDE
s#ORTAACEROMEDIODECALIBRE
s&ILODECORTEDE
sDELARGO
DAR9A Tijeras de hojalatero. #ONEMPU×ADURAVERDE0ARA
CORTESHACIALADERECHA
DAL9A Tijeras de hojalatero. #ONEMPU×ADURAROJA0ARA
CORTESHACIALAIZQUIERDA
SNP2A
Lab]jYk\]`gbYdYl]jg\]k]jna[agdanaYfgqmkgedlahd]&
SNP2A Cizallas de uso múltiple en ángulo para
servicio pesado.
t0ARACUEROTELAPLÉSTICOGOMACHAPACARTØNMATERIALDEJUNTAS
SOGAYMUCHOSOTROSMATERIALES
s,ASEMPU×ADURASERGONØMICASSEPUEDENUSARCONLAMANO
DERECHAOLAIZQUIERDAEMPU×ADURABLANDAMOLDEADAPARAMAYOR
COMODIDADYCONTROL
s,AHOJAESTÉREMACHADAPARAALAMBREDUROYENTRETEJIDO
s%LINTERRUPTORDETRABAGARANTIZALASEGURIDADDURANTEEL
ALMACENAMIENTO
s%LINTERRUPTORDECONTROLPERMITEQUELASHOJASSEMANTENGANEN
UNAPOSICIØNMÉSESTRECHAPARAFACILITARELMANEJO
s,ASCIZALLASENÉNGULOFACILITANELCORTEATRAVÏSDEMATERIALESPLANOS
;arYddYk'9da[Yl]kº:dm]%Hgafl
;arYddYkhYjYlYdd]j
DAL10B
DAS10B
DAR10B
;arYddYkhYjY[gjlYje]lYd]k
DAS30 Juego de cizallas para cortar metales.
t(OJASDECORTESERRADAS
s#UERPOANGOSTOQUEPERMITEQUEELMETALPASEPORENCIMADE
LACIZALLA
s!GARRESRESISTENTESALACEITEYLAGRASA
s#ADACIZALLATIENEDELARGO)NCLUYE
DAS10B Cizallas. #ONEMPU×ADURAAMARILLA0ARACORTESRECTOS
DAR10B Cizallas. #ONEMPU×ADURAVERDE0ARACORTESHACIALADERECHA
DAL10B Cizallas. #ONEMPU×ADURAROJA0ARACORTESHACIALAIZQUIERDA
ADVERTENCIA
HDSCISSORS Taller de
servicio pesado Tijeras.
t0ARACUEROTELAPLÉSTICOGOMA
CHAPACARTØNMATERIALDEJUNTAS
SOGAYMUCHOSOTROSMATERIALES
s,ASEMPU×ADURASERGONØMICASSE
PUEDENUSARCONLAMANODERECHAO
LAIZQUIERDA
HDSCISSORS
9da[Yl]hYjYnafadg
YA444B Alicate para vinilo.
t#ORTAPERFECTAMENTEPLÉSTICOGOMAVINILO
TAPIZADOSCUEROMANGUERASYSOGA
s%MPU×ADURADEAGARRE%RGO®CON
TRABADESEGURIDAD
s!LMACENAMIENTODEHOJAEN
EMPU×ADURA
s)NCLUYETRESHOJASDEREEMPLAZODE
ACEROINOXIDABLE9!"
YA444B-1 Hojas de reemplazo.
t)NCLUYETRESHOJASDEREEMPLAZOYUN
YUNQUEPARA9!"
YA444B
Fgmk]eYjladdgkim]]klfYkladdY\gk$]phYf\a\gkgjYbY\gk?gdh]][gf]d[]fljg\]dY[YZ]rYq]nal]_gdh]kim]j]Zgl]f
Fg_gdh]]kmh]jÇ[a]k\mjYk3k]dgkkdghYjY_gdh]YjhdYf[`Yk\]e]lYd
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
547
CARROCERÍA
Cucharas y sufrideras
Sufrideras de acero 3EAPLICANLASESPECIFICACIONES"
ATODASLASSUFRIDERAS
BF710B Sufridera de pie.
s0ARAREPARACIØNDESUPERFICIESPLANAS
s-IDEXX
sLB
BF707 Sufridera de talón.
s0ARAUSARENESQUINASAGUDASYDERADIOAMPLIO
s%LREVESTIMIENTODEGOMAPRODUCEUNEFECTODEAMORTIGUAMIENTO
s-IDEXX
BF740 Sufridera con perdigones.
s5NABOLSADECUEROPARASERVICIOPESADOSELLENACONLBDE
PERDIGONES
s%STASUFRIDERAESESENCIALPARASUSTENTARFORMASYCONTORNOS
IRREGULARESENPUERTASGUARDABARROSYOTROSPANELESDECARROCERÓA
s'RACIASASUPERFILDELGADOPUEDEUSARSEENÉREASESTRECHAS
s.ORAYALASSUPERFICIES
sDEANCHOXDELARGO
BF711B Sufridera de talón.
s0ARAUSARENESQUINASAGUDASYDERADIOAMPLIO
s-IDEXX
sLB
BF712B Sufridera de uso múltiple.
s0ARAGUARDABARROSPROFUNDOSYPARAENCOGERCHAPASMEDIANTECALOR
s-IDEXX
sLB
Cucharas
BF715B Sufridera tipo cuchara.
s0ARACALAFATEADOYHENDIDURASPROFUNDAS
ENPUERTASYPANELES
s4AMA×ODELACABEZAXX
LONGITUDTOTALDE
BF716B Cuchara para trabajos de
nivelación livianos.
s%MPAREJAYNIVELADESPERFECTOS
s.ODEBEUSARSECOMOPALANCA
s4AMA×ODELACABEZAX
DELONGITUD
BF710B
BF707
BF711B
BF712B
BF715B
BF716B
BF740
Remaches
Herramientas remachadoras–Blue-Point®
HP2 Herramienta remachadora.
sCuatro punteros para remaches de 3/32" hasta 3/16" de diámetro
s0ARAESPESORESDEA
s&ABRICADACONALEACIØNDEALUMINIO
HP30N Puntero opcional para remachadora.
s3EUSACHERRAMREMACHADORA(0PREEMPLAZARPERNOSSOLDADOS
/%-ENMOLDURAS
s0ARAREMACHESCCUERPODEDEDIÉM
s#ABEZADEDEDIÉM
HP301C Herramienta remachadora neumática/hidráulica.
s&IJAREMACHESESTRUCTURALESREMACHES+LIK&AST®DEADE
DIÉMETROENTODASLASALEACIONESYREMACHES+LIK&AST-ONOBOLTDE
A
s2EQUIERESØLOAPSI2OSCA.04DE
s"RINDALBDEFUERZADETRABAJOCONGOLPESDE
s)NCLUYEPUNTEROSDEYYBOTELLADERECOLECCIØN
DEMANDRIL
s0ESOTOTALDELB
HP302C Herramienta remachadora neumática/hidráulica.
s5NAVERSIØNMÉSPEQUE×AYLIVIANADE(0#
s&IJAREMACHESCIEGOSDEADEDIÉMETROENTODASLAS
ALEACIONESYREMACHES+LIK&ASTY-ONOBOLTDE
s)NCLUYEPUNTEROSDEYYBOTELLADERECOLECCIØN
DEMANDRIL
HP2
PL30
HP301C
HP310
HP320
HP302C
Especificaciones
HP301C
HP302C
HP310
HP320
Presión de aire
recomendada
85-95 psi
85-95 psi
85-95 psi
85-95 psi
—
—
5 (36)
[141.58]
5 (29)
[113.27]
1/2" NPT
3,300 lb.
5/8"
(15.8 mm)
1/4" NPT
1,985 lb.
5/8"
(15.8 mm)
1/4" NPT
3,055 lb.
9/16"
(14.3 mm)
12"
(304.8 mm)
4.2 lb.
(1.91 kg)
1/4" NPT
1,983 lb.
9/16"
(14.0 mm)
11"
(279.4 mm)
3.3 lb.
(1.50 kg)
Consumo de aire promedio,
CFM (SCFM) [l/min]
Tamaño de rosca de entrada de aire
Fuerza de tracción
Golpe
Largo total
Peso
548
—
—
6.6 lb.
(3.0 kg)
4.2 lb.
(1.91 kg)
PL30 Herramienta remachadora.
s0ARAUSARCONUNAGRANVARIEDADDEREMACHESDEEXTREMOABIERTO
YYCERRADOY
s%LDISE×ODEESLABØNCOMPUESTOBRINDAUNAVENTAJAMECÉNICADE
A
s%LCIERREINNOVADORMANTIENECERRADASLASEMPU×ADURASSINCADENAS
NIALAMBRES
s$ISE×ODEEMPU×ADURACORTAPARAFACILITARLAOPERACIØNCONUNAMANO
s$ISE×ODEEXTREMOFRONTALLIBREDEATASCOS
s#UATROPUNTEROSINTERCAMBIABLESSEALMACENANDENTRODELA
EMPU×ADURA
HP310 Herramienta remachadora neumática/hidráulica.
s&IJAREMACHESDEADEDIÉMETROENTODOSLOSMATERIALES
s4AMBIÏNPUEDEFIJARREMACHESEN42IVET+LIK3PLIT®+LIK,OCK©Y
TODOSLOSREMACHESESTRUCTURALES
s)NCLUYEPUNTEROSDEYYBOTELLADE
RECOLECCIØNDEMANDRIL
HP320 Herramienta remachadora neumática/hidráulica.
s&IJAREMACHESDEADEDIÉMETROENTODOSLOSMATERIALES
s)NCLUYEPUNTEROSDEYYBOTELLADERECOLECCIØN
DEMANDRIL
www.snapon.com/shoptools
CARROCERÍA
2EMACHES
*UEGOSDEREMACHADORA–"LUE0OINT®
HP200A Juego de remachadora.
sIncluye: herramienta remachadora HP2, broca para taladro de 1/8" y
200 remaches surtidos de 1/8" y 3/16" de diámetro, además de un
avellanador de 120°
HPKL2 Juego de remachadora para remaches plásticos.
s0ARAREMACHESPLÉSTICOSQUESOSTIENENMOLDURASGUARDABARROS
INTERIORESYOTRASPARTESPLÉSTICASEN'-&ORD#HRYSLERY67
s)NCLUYEREGULADORDEREMACHESYESTILOSDIFERENTESDEREMACHES
plásticos [dos tipos de 5 mm, 2 tipos de 6.3 mm]
HP300 Juego de remaches ciegos grandes.
s,AREMACHADORACONEMPU×ADURAEXTRALARGAINCLUYE
3 punteros
s)NCLUYEUNABOLSADEREMACHES+LIK3PLIT®
s,OSREPUESTOSDELOSREMACHES+LIK3PLITY+LIK&AST®SEENTREGANEN
bolsas de 50 unidades
PL300 Juego de herramienta remachadora.
s)NCLUYEHERRAMREMACHADORA0,UNAGRANVARIEDADDEREMACHES
abiertos y cerrados de 3/32", 1/8", 5/32" y 3/16", más una caja de
almacenamiento plástica con compartimientos individuales
HP200A
HPKL2
HP300
PL300
#OLOCACI¥NDERUEDAS
*UEGOSPARACOLOCACI¥NDETUERCASCOLOCACI¥NDE
ROSCAS–"LUE0OINT
HP650 Juego para colocación de roscas.
sIncluye: una herram. fuerte p/fijar roscas y una variedad de tuercas
Klik Poly-Nuts: 12 cada 8-32, 10-24, 10-32; (8) 1/4"-20 y (6) 5/16"18 roscas
s)NCLUYELOSPUNTEROSYMANDRILESNECESARIOSPARAFIJARLOSTAMA×OS
especificados.
s3EENTREGAENCAJADEALMACENAMIENTO
HP650M Juego métrico para colocación de roscas.
sVersión métrica de HP650, con tuercas Poly-Nuts métricas, incluidas
25 roscas de 4 y 5 mm, (15) de 6 mm y (10) de 8 mm
s)NCLUYEUNAHERRAMIENTAPARACOLOCARROSCASYLOSPUNTEROSY
mandriles necesarios en una caja de almacenamiento
HP650M
,IMAS
,IMADEPUNTA
GA616
BF193
BF193 Lima de punta.
sRemueve la pintura que se ha escurrido por accidente y ayuda a
ELIMINARESCURRIDASYGOTASDEPINTURA
s%LIMINASUAVEMENTELAPINTURASINCAVARLASUPERFICIE
14V
,IMASFLEXIBLESDEDIENTESCURVOS
14V Lima de dientes curvos. DIENTESPORPULGADA
#ORTEÉSPERO5SARCONEMPU×ADURA"&#
14V12 Lima de dientes curvos. DIENTESPORPULGADA
#ORTEFINO5SARCONEMPU×ADURA"&#
ADVERTENCIA
BF775C
%MPU§ADURASDELIMAS–"LUE0OINT
s%MPU×ADURASDEMADERAGIRATORIASCONINSERCIONESDEACERO
roscado de caja endurecida
GA616 Empuñadura de lima. Para lima de dientes curvos 8CT.
GA617 Empuñadura de lima. Para lima de dientes curvos 10CT.
GA618 Empuñadura de lima. Para lima de dientes curvos 12CT.
BF775C Sostén de lima flexible.
s,IVIANOYRÓGIDOCONEMPU×ADURAGRANDEDEALUMINIOTENSOR
ajustable y correa unida en forma permanente
r,EALASPRECAUCIONESDESEGURIDADENLASP¶GINASA
549
CARROCERÍA
Ventanas y parabrisas
GA243
WK200
YA109C
YA208A
WK100
Herramienta para remover ventanas y
parabrisas–Blue-Point®
GA243 Herramienta para extraer molduras.
tPara remover molduras de ventanas y parabrisas en vidrios
cementados
YA109C Herramientas para extraer parabrisas.
tEmpuñadura para tirar de cable de acero
s,ASHOJASDEACEROSONREEMPLAZABLESYPUEDENAFILARSE
s0ARA'-#HRYSLERYOTROSAUTOMØVILESCPARABRISASCOLOCADOSCON
sellador.
WK100 Cuchilla para parabrisas.
t#ORTAELURETANOENDURECIDODEBAJODELTABLERO
s%LTORNILLODERETENCIØNDEHOJAANIVELAYUDAAPREVENIRELDA×OEN
el tablero y en las molduras
s%LVÉSTAGODEALUMINIORÓGIDONOSEDOBLA
s%LLARGOBRINDAPALANCAYALCANCEDECORTE
s%MPU×ADURAACOLCHONADAPARAUNAMÉXIMACOMODIDAD
s)NCLUYEUNAHOJA
s5SAHOJASDEREEMPLAZO9!
sDELARGO
WK200 Cuchilla para parabrisas.
t#ORTAELURETANOENDURECIDODEBAJODELTABLERO
s%LTORNILLODERETENCIØNDEHOJAANIVELAYUDAAPREVENIRELDA×OEN
el tablero y en las molduras
s%LVÉSTAGODEALUMINIORÓGIDONOSEDOBLA
s%LLARGOBRINDAPALANCAYALCANCEDECORTE
s%MPU×ADURAACOLCHONADAPARAUNAMÉXIMACOMODIDAD
s)NCLUYEUNAHOJA
sDELARGO
s5SAHOJASDEREEMPLAZO9!
YA208A Herramienta para instalar la franja de
seguridad del parabrisas.
tLas aberturas en cuña de dos anchos distintos facilitan la
instalación de casi todas las franjas de seguridad
s)NCLUYEUNAPUNTAESPECIALPAPLICACIONESENLOSCAMIONES$ODGE
s%MPU×ADURACONTORNEADADEYVÉSTAGOMETÉLICODE
A192
S9610
Herramienta para remover ventanas y parabrisas
A192 Herramienta para extraer el brazo del
limpiaparabrisas.
t0ARAREMOVERFÉCILMENTELOSBRAZOSDELLIMPIAPARABRISASDELA
MAYORÓADELOSVEHÓCULOS
s%XTREMOSPARAPALANCATANTOANCHOSCOMOANGOSTOS
s.ODEBEUSARENBRAZOSDELLIMPIAPARABRISASATORNILLADOSALEJE
S9610 Dado tipo llave inglesa p/extraer tuercas de
levantavidrios.
t#UADRODEDELARGO
s0ARAAUTOSYCAMIONESLIVIANOS'-Y#HRYSLER
YA5200A
WSC2
YA6390
Rasquetas de ventana—Blue-Point
YA5200A Rasqueta con hoja de afeitar. Su forma singular
entra en áreas estrechas como la que se encuentra entre el tablero de
instrumentos y el parabrisas. Se puede usar cualquier hoja de afeitar
estándar de un solo filo. Las hojas adicionales pueden guardarse en la
empuñadura estilo destornillador. 11" de largo.
WSC2 Rasqueta de ventana con hoja plástica. Para
rasquetear ventanas, parabrisas y más. Incluye una hoja plástica,
aunque también puede usarse cualquier hoja de afeitar estándar de
un solo filo. La herramienta de 8" de largo se dobla sólo hasta 4 5/8".
550
Sujetador de ventana—Blue-Point
YA6390 Sujetador de ventana.
s3EUTILIZAPARAMANTENERLEVANTADOELVIDRIODELAVENTANALATERAL
cuando se trabaja en el regulador
s,ASCOPASDESUCCIØNSEUNENAAMBOSLADOSDELVIDRIOCONUN
cable que pasa sobre el cuadro de la puerta, lo cual evita que el
vidrio se caiga
www.snapon.com/shoptools
CARROCERÍA
Herramientas para puertas–Blue-Point®
YA6220
DHW1
DHS108
@]jjYea]flYkh'ZakY_jYk\]hm]jlYk
DHW1 Llave de broca de trinquete. Palanca de marcha
atrás cómodamente ubicada para accionar con una mano. Largo
total de 10 3/4" para mejor palanca. Rueda estriada para un óptimo
control con los dedos. El bajo espacio de la cabeza llega a lugares
difíciles. El anillo interno en el cuadro cuadrado ofrece una retención
de broca más segura que el tipo magnético. EU - GB.
Pieza No.
Descripción
Tamaño
BMAS60
BMAS80
BMAS100
BMAS120
SDMTAS30
SDMTAS40
SDMTAS45
Broca cuadrada triple
Broca cuadrada triple
Broca cuadrada triple
Broca cuadrada triple
Broca Torx®
Broca Torx
Broca Torx
6 mm
8 mm
10 mm
12 mm
T30
T40
T45
Tamaño
hex.,
pulgadas
Largo,
pulgadas.
5/16
13/16
5
13/16
/16
5/16
5/16
5/16
5/16
5/16
13/16
13/16
13/16
13/16
13/16
DHS108 Juego p/extracción de bisagras de puertas
Las aplicaciones en bisagras de puertas incluyen VW, Audi, Jeep
Cherokee (1997 y 1998) y los primeros modelos de Ford Escort.
Diversas aplicaciones en Audi, VW, y Mercedes además de alineación
de convergencia trasera en Mercedes y pernos de culata en algunos
de los primeros modelos. El juego incluye llave de broca de trinquete
DHW1, dados cuadrados triples BMAS60 a BMAS120 (6 a 12 mm)
y dados Torx SDMTAS30 a SDMTAS45 (T30 a T45). También incluye
bolsa plástica de almacenamiento y sostén de brocas. EU - GB
YA6620 Instalador de bujes para puertas de bisagras
de GM. Se usa en vehículos de GM con bujes reemplazables de
bisagras de puertas de bronce y silicona. La herramienta facilita el
acceso a las áreas estrechas de la bisagra. Guía de manera precisa
y sostiene el buje en su lugar mientras se golpea suavemente con
un martillo o se aprieta con una pinza. Las aplicaciones incluyen S10
y Sonoma (1982-2004), camiones de 1/2 y 3/4 ton (1980-1999),
camiones de 1 ton (1980-2001), Blazer (1980-2005), Suburban
(1980 y posterior), Tahoe (1980 y posterior), Astro y Express (1980 y
posterior) y Avalanche (2002 y posterior).
YA610A
YA520
LPK620
YA511
YA501E
@]jjYea]flYkhYjYYZ]jlmjYk\][a]jj]k
LPK620 Juego maestro p/abrir cerraduras. El juego de 37 piezas
incluye un juego de 6 piezas para la abertura del balancín de vehículos no
fabricados en los EE. UU., un juego de 12 piezas para la abertura de vehículos
GM, un juego de 5 piezas para la abertura del balancín de autos Ford, un juego
de 6 piezas para la abertura de vehículos Chrysler, un juego de 6 piezas para
las chapas tipo hostia de los vehículos importados, un abridor tipo arpón para
extraer llaves rotas, una llave giratoria para cerradura universal tipo pinza y
una herramienta para abrir la tapa del tanque de combustible.
YA511 Juego de herramientas para cerraduras. Contiene 17
herramientas especializadas para abrir la cerradura de autos, vans o camiones.
Incluye muchos de los componentes del juego YA501E y componentes de
servicio adicionales. También incluye una linterna tipo pluma y un manual de
instrucciones en una bolsa de juego de múltiples compartimientos.
YA501E Juego de herramientas para cierre. Contiene 15
herramientas especializadas para abrir la cerradura de autos, vans o
camiones. Incluye una herram. "J" p/vehículos japoneses, además de una
herram. GM p/vehículos Caprice, Buick y Oldsmobile. La herram. Chrysler
también se puede usar p/los vehículos Camry. Linterna de gran intensidad y
manual de instrucciones incluidos.
YA521 Juego de herramientas para cierre. Guía completa e
ilustrada que informa sobre cuál es la mejor herram. y el método más
indicado p/abrir las cerraduras de la mayoría de los vehículos actuales.
ADVERTENCIA
BF272
LOS145
YA610A Herram. p/reformar cerraduras. Permite que vuelvan a su
forma original las aberturas de cerraduras dañadas en automóviles GM, Ford,
Chrysler y la mayoría de los autos no fabricados en EE. UU.
BF272 Cuña inflable. Cuando no puede usarse la cerradura, permite
ingresar al vehículo en forma segura, sin dañar el acabado de la carrocería.
Coloque la unidad desinflada entre el marco de la puerta y la carrocería, infle
la cuña bombeando lentamente para separar la puerta de la carrocería del
vehículo. También permite ingresar a un vehículo separando la cinta de la
ventana del vehículo o puede usarse para ajustar los paneles de la carrocería.
YA520 Juego de cerraduras de puertas. Incluye: dos cuñas
plásticas para crear un espacio entre la puerta y el chasis, un empujador
Day-Glo amarillo de fácil acceso para alcanzar las manijas internas de la
puerta y una traba deslizante plástica para usar en perillas de puertas.
LOS145 Juego de cerraduras de puertas. No hay peligro de que
se activen las bolsas de aire ni que se desconecten las uniones de las puertas.
Accione la palanca de la puerta y el botón de traba manual o eléctrico de la
mayoría de los automóviles y camiones. Incluye: herramienta para abrir puertas
de cuatro piezas que se atornillan juntos sin acopladores para facilitar el
armado y almacenamiento, un delgado empujador de plástico, dos puntas que
brillan en la oscuridad, dos cuñas de plástico para crear un espacio entre la
puerta y el chasis sin dañar la puerta ni los burletes y una cuña inflable BF272.
Use la BF272 para separar con facilidad la puerta de la carrocería sin dañar el
vehículo. La herramienta para abrir incluye una pieza de extensión media para
lograr más alcance en el automóvil en aplicaciones de uso prolongado. Venta
exclusiva a cerrajeros matriculados, policía y reparadores profesionales serios.
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
551
CARROCERÍA
Herramientas para puertas
UTV614
UTV615
Pieza
No.
UTV617
UTV618
UTV614
Herramientas para tapizados y molduras
Extrae los paneles de la puerta y el tapizado rápidamente sin
dañarlos. Las hojas anchas en las herramientas para las puertas
reducen el riesgo de daño durante la remoción del panel. Las hojas
de acero inoxidable están termotratadas para mayor rigidez. Las
cómodas empuñaduras compuestas se caracterizan por un tope para
pulgar de contorno para un máximo control.
YA331
UT
S1
El juego
contiene:
UTV616
UTV615
UTV616
UTV617
UTV618
Descripción
YA331 Herram. p/extracción de sujetadores. Las
horquillas ahusadas se deslizan debajo de la mayoría de los tipos de
sujetadores de carrocería. Al apretar la empuñ., los sujetadores saltan
hacia afuera.
YA1201 Extractor del panel de puertas. Para vehículos
de GM y Ford. Diseñado para evitar que los sujetadores plásticos de
púas pasen a través del panel.
Ancho hoja,
pulg.(mm)
Largototal,
pulg.(mm)
1 1/4 (31.8)
9 1/8 (231.8)
s
1 1/4 (31.8)
9 1/8 (231.8)
s
Herramienta para panel de puertas
de hoja de paso doble en“V”
Herramienta para panel de puertas
con hoja en“U”
Herramienta para panel de mini
puntas con hoja en“U”
Herramienta para panel de mini
puntas con hoja en“V”
Herramienta para panel de puertas
con hoja en“U” invertida
YA1201
Herramientas especiales para puertas–Blue-Point®
05
1/2
(12.7)
9 (228.6)
s
1/2
(12.7)
9 (228.6)
s
10 (254)
s
1 1/4 (31.8)
YA214
YA214 Ajustador de bisagras. Ajusta la posición de las
bisagras de las puertas en la mayoría de los vehículos. Funciona
c/bisagras atornilladas o soldadas. Un adaptador c/pasador de
dos cabezas permite ajustar las puertas c/cerraduras grandes y
pequeñas. 24" de largo total.
Herramientas de agarre blando para remover
tapizado
ASG185BR
ASG186BR
Extrae los sujetadores que aseguran los paneles de la puerta y las
molduras sin dañarlos. Empuñ. blanda con diseño ergonómico y
tope p/el pulgar. El punto de pivote está diseñado para brindar una
palanca apropiada y evitar torceduras que podrían dañar el panel o la
guarnición.
AS
El juego
contiene:
ASG187BR
Pieza No.
ASG189BR
ASG185BR
ASG186BR
ASG187BR
ASG188BR
ASG189BR
ASG190BR
Tamaño de la
abertura,pulg.
7/32
3/8
3/8
7/16
7/16
3/8
Ancho
hoja,pulg.
9/16
13/16
13/16
13/16
13/16
13/16
ASGD1BR
BR
Largo
Total,pulg.
10
10
20
10
20
20
s
s
s
Perfil ahuecado uniforme y amplia separación que se adaptan a los
vehículos mediante retenedores cónicos para una extracción rápida
sin ocasionar daños. Hoja ahuecada para brindar mejor sujeción del
panel de puerta y contacto de los retenedores. Empuñadura de agarre
blando para mayor comodidad y control. El acabado de cromo ayuda
a prevenir la corrosión y facilita la limpieza. Aplicaciones: Ford, GM,
Toyota y otros.
AS
GD
El juego
contiene:
Pieza No.
552
03
Herramientas ahuecadas de agarre blando para
tapizado
ASG103BR
ASGDL1BR
G1
ASGD1BR
ASGDL1BR
Tamaño de la
abertura,pulg.
7/16
7/16
www.snapon.com/shoptools
Ancho
hoja,pulg.
13/16
13/16
Largo
Total,pulg.
10
20
10
2B
R
s
s
CARROCERÍA
@]jjYea]flYkhYjYhm]jlYk'@]jjYea]flYk]kh][aYd]k
EYfabYk'LYharY\gk'Lm]j[Yk\]dhYf]d
DPT7A Juego de herram. p/puertas. Incluye las siete herram.
más necesarias p/remover o sustituir el panel de la puerta, el tapizado
y las manijas. Bandeja de almacenamiento.
A159 Herram. p/manijas de puertas. Para la mayoría de los
automóviles y camiones GM, (excepto Cadillac), y algunos Ford. Empuñ.
acodada c/cubierta plástica. 10 7/8" de largo.
A161B Herram. p/extraer el tapizado. Para GM, Ford y
Chrysler. Tiene una empuñ. tipo destornillador. 7 3/4" de largo.
A177A Herram. p/extraer el tapizado. Para automóviles GM
y la mayoría de los autos no fabricados en EE. UU. Similar a A161B
excepto que posee diferentes aplicaciones. 7 1/2" de largo.
A179A Herram. p/extraer el tapizado. Para todos los
paneles de las puertas de GM. La hoja acodada ayuda a remover
los sujetadores plásticos y los sujetadores tipo cuña sin dañar los
sujetadores ni el panel.
S9614A Destornillador para tuercas del panel. Para GM.
Similar a S6103A, pero se utiliza c/tuercas hexagonales internas p/
paneles de 5/16". 1/4" de cuadro, longitud total de 1 7/8".
S9538A Herram. p/manijas de puertas. Para la mayoría de
los automóviles Chrysler último modelo. Posee un gancho para usar en
manijas de modelos anteriores
S6103A Llave de contratuerca p/panel de puertas. Para
vehículos de Ford y GM. Para las tuercas de panel hexagonales internas
de 3/8" que se usan en los paneles y molduras de las puertas. 1/4" de
cuadro, longitud total de 1 7/8".
A181 Herram. p/extraer el tapizado. Para los sujetadores de
paneles plásticos en camiones Honda, Toyota, Acura, Hyundai y algunos Ford.
Diseño similar a A161B. 7 1/2" de largo. No se incluye en el juego DPT7A.
A159
DPT7A
A161B
A177A
A179A
A181
S9614A
S9538A
S6103A
;ghYk\]km[[af
BF801 Herram. de succión p/servicio pesado. Para
estirar abolladuras o transportar vidrio. La empuñadura aumenta la
fuerza de estiramiento. Copa de succión de 5".
BF802 Herram. de succión de dos copas p/servicio
pesado. Para rectificar abolladuras grandes o levantar materiales
más pesados. La empuñadura. tiene lugar p/ambas manos. El gatillo
libera las dos copas de 4" simultáneamente.
BF803 Copa de succión. Se puede tomar c/dos dedos y tiene
dos lengüetas p/una liberación rápida. 3 1/4" de diámetro.
BFT800 Juego de soportes p/copas de succión. Se
utiliza para sujetar molduras de parabrisas, molduras de protección,
molduras de puertas y emblemas al encolar, instalar guarniciones y
otros componentes livianos. El juego incluye 5 grampas de copas de
succión.
BF802
BF801
BF803
BFT800
Haim]lYk'NYjaddYk
BF200 Juego de varillas p/rectificación. Permite perforar
un agujero de 9/64" y darle forma a la chapa. Incluye cuatro varillas
y dos piquetas p/levantar el metal, un borde recto y una broca p/
taladro. Las varillas levantan el metal sin distorsionarlo. No es
necesario quitar el tapizado.
BF200
ADVERTENCIA
DYk]ehmY\mjYkhd~kla[YkfgZjaf\Yfhjgl][[af[gfljY\]k[Yj_Yk]d[lja[Yk
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
553
CARROCERÍA
Herramientas especiales
Lijado—Blue-Point®
BF185A
BF195
BF185A Bloque de lijado. Para superficies planas o curvas c/
papel de lija seco o al agua. 5" x 2 3/4".
BF189A Bloque de lijado. Para superficies planas o curvas c/
papel de lija seco o al agua. 9" x 2 3/4".
BF190 Bloque de lijado. Lijador multipropósito plano, de filo
y de radio múltiple. El cuerpo flexible se adapta a la mayoría de las
superficies de lijado. 5 1/2" de largo.
BF192A Bloque de lijado. Bloque de dos caras p/lijado en seco
o al agua. El lado suave lija superficies irregulares. El lado rígido lija
superficies planas y curvas.
BF195 Bloque de lijado. Lijador multipropósito de esquina,
ángulo ranurado y radio. El cuerpo flexible se adapta a la mayoría de
las superficies. 5 1/2” de largo.
Soportes p/pintar la cubierta del paragolpes
BF190
BF192A
BFS1000B Soporte para pintar la cubierta del
paragolpes. Este soporte sujeta la cubierta del paragolpes
mientras se lo pinta. Posee cinco posiciones de traba diferentes en el
soporte y una rotación completa de 90° que brinda una versatilidad
máxima. Es liviano (23 lb.) y compacto para guardarlo. Las ruedas
giratorias brindan una completa movilidad.
Tintura para carrocerías al agua
Tintura para carrocerías al agua YAUVWATER. Ideal para
usar en talleres de reparación de carrocerías y vidrios de automóviles.
La tintura fluorescente detecta fácilmente las separaciones que
causan soplidos más derrames alrededor de la ventana del techo,
molduras de puertas, tapas de camiones, juntas de ventanas y
parabrisas. Simplemente mezcle la tintura en la botella con agua y
rocíe sobre el área externa. Verifique los derrames con lámpara UV. Se
limpia fácilmente con agua después de la reparación. Se recomienda
para usar con juego de luz UV ACTUVLITEA.
BFS1000B
Herramienta para remoción de masilla
NYZ7007HD
NYZ7007HD Juego manual para remoción de masilla.
El juego manual incluye un surtido de 15 hojas Nyroc™ y una
empuñadura ergonómica de goma. Ideal para uso industrial,
automotriz y en la aviación, en especial para trabajos delicados y
aplicaciones de rasqueteo en áreas de acceso restringido. Las hojas
Nyroc se afilan rápidamente con lija, piedra pequeña u afilador
neumático opcional. Incluye: (6) hojas Nyroc de 1", (6) hojas Nyroc de
1/2", (3) hojas Nyroc de 1/4" y (1) empuñadura de goma ergonómica.
Antena/espejos/radio
Dados para guarniciones de espejos y radio
YA7575
RRT105
S8703
S9605B
554
YA7575 Herram. p/extracción de radio de Ford–BluePoint. Introduzca los componentes de la herramienta en los orificios
del frente de la radio para liberar los sujetadores de retención de
la radio. Aplicaciones: Mustang 1987 y posteriores, Tempo/Topaz
1988 y posteriores, Continental 1989 y posteriores, Taurus/Sable
1990 y posteriores, Ranger Bronco II, Probe, Lincoln Town Car, Mark
VII, Crown Victoria/Grand Marquis, Thunderbird/Cougar, camionetas
serie F, vans serie E, Explorer 1991 y posteriores, y Windstar 1995 y
posteriores. Igual que Ford No. T87P-19061-A.
RRT105 Juego de herramientas p/extracción de
estéreos de automóviles. Incluye: seis herramientas para la
extracción de estéreos de automóviles. Aplicaciones: Audi, BMW, Ford,
Land Rover, Lincoln, Mazda, Mercedes, Mercury, Merkur, Porsche,
Saab y VW. Una hoja de instrucciones adjunta detalla la aplicación
para el modelo exacto de cada fabricante. EU - GB.
S8703 Dado de espejos c/control remoto. El dado hueco
deja libre la palanca de ajuste. El dado de dos lengüetas tiene un
cuadro cuadrado de 3/8". 19/32" de diámetro en el extremo del
mango; 21/32" de diámetro en el extremo del dado. 2 1/16" de largo.
Acabado niquelado/cromado. Para muchos vehículos Ford y VW.
S9605B Dado de tuercas de ajuste de radio. Similar
en aspecto y función a S8703. Cuadro cuadrado de 1/4". 7/16" de
diámetro en el extremo del cuadro; 9/16" de diámetro en el extremo
del dado. 2 5/16" de largo. Para algunos automóviles de GM y Ford.
www.snapon.com/shoptools
CARROCERÍA/FAROS DELANTEROS
9fl]fY
2160ANT
S6166
<Y\g\]lm]j[YhYjYYfl]fYk
S6166 Dado de tuerca p/antena.
tEl dado de tres lengüetas tiene un hex. externo de 11/16"
sDEDIÉMETRODELARGO
s3EUTILIZAENVEHÓCULOS#HRYSLERDEYPOSTERIORES
2160ANT Llave para antena—Blue-Point®.
t,ASCUATROCONFIGURACIONESSEADAPTANALAMAYORÓADELASTUERCAS
BISELADASDELAANTENAENLOSVEHÓCULOSDE%%55YDEOTROSPAÓSES
s4IENEUNAABERTURADEMMPARAREMOVERANTENASTIPOMÉSTIL
s-IDEXX
s!CABADOANODIZADO
@]jjYea]flYk\]k]jna[ag_]f]jYd
HaklgdYk\][Ydgj
ETB1310
ET1400
ETB1310 Pistola de calor.
s3ELECCIONESDOBLESDETEMPERATURAs%NLISTADE5,!PROBADA
POR#3!DEº&Yº F
ET1400 Pistola de calor.
s3ELECCIØNVARIABLEDETEMPERATURAs%NLISTADE5,!PROBADA
POR#3!HASTA&CONINTERRUPTORDETRESVÓAS
SWDK4
Kgd\Y\mjY\]hmflgk—:dm]%Hgafl
SWDK4 Juego de alicates
p/soldadura de puntos.
t%STEJUEGODEPIEZASESTÉDISE×ADOPCORTARAALTA
VELOCIDADAHASTARPM
s,OSPUNTOSAUTOCENTRADOSMINIMIZANELPASO
SWDK412 Alicate p/soldadura de puntos. SWDK414 Alicate p/soldadura de puntos. SWDK438 Alicate p/soldadura de puntos. SWDK4516 Alicate para soldadura de puntos.
5/16".
Dmr\]nmd[YfarY\gaf^jYjjgbY
BFLIGHT1500A
BFLIGHT1500A Luz de vulcanizado infrarroja (120VCA).
t3EUSAPARASECARPINTURAIMPRIMACIØNRELLENADORDECARROCERÓA
ADHESIVODEUNIØNYPRODUCTOSDEREPARACIØNDEPLÉSTICO
s!LTURAYPIVOTEDELÉMPARAAJUSTABLE
s#UATRORUEDASGIRATORIASPFACILITARMANIOBRALIDAD
s%NLISTADE5,
4IEMPOSDESECADOENSUPERFICIESDE
MINUTOSIMPRIMACIØN+RECUBRIMIENTOABASEDEAGUARELLENADORTAPØN
MINUTOSREPARACIØNDEPLÉSTICO+RELLENADORDECARROCERÓADEPLÉSTICO
ESMALTEACRÓLICO
MINUTOSRECUBRIMIENTOSUPERIOR+IMPRIMACIØNDEALTARESISTENCIA
ADHESIVOSESTRUCTURALES
MINUTOSPOLIURETANOESMALTESSINTÏTICOSSINSØLIDOSALTOS
9ÇfY[af\]^Yjgk\]dYfl]jgk
B4A5
B4A13
RBYF445
B4A14
YA2155
B4A10
9\YhlY\gj]kh'Y^afY[af\]^Yjgk\]dYfl]jgk
J]_mdY\gj]khYjY^Yjgk\]dYfl]jgk
B4A13 Adaptadores grandes aerodinámicos.
0ARALÉMPARASGRANDESUNPAR
B4A14 Adaptadores pequeños aerodinámicos.
0ARALÉMPARASPEQUE×ASUNPAR
B4A5 Adaptador rectangular.0ARALÉMPARASDEXC
ALMOHADILLASPAFINACIØNENSISTEMASDECUATROLÉMPARAS
B4A10 Adaptador rectangular. 0ARALÉMPARASDEX
ENSISTEMASDEDOSLÉMPARAS
RBYF445 Llave de trinquete p/faros delanteros.
s%LLARGOTOTALDEPERMITEACCEDERALOSTORNILLOSDEAJUSTEDEFAROS
s!PLICACIONESÞLTIMOSMODELOSDE&ORDCREGULADORESDEMMYMM
ENDISE×OSAERODINÉMICOSYFAROSCREGULADORESDEMONTAJETRASERO
YA2155 Herram. p/sujetadores de faros delanteros.
s0ERMITEINSTALARRETIRARSUJETADORESDEFAROSDELANTEROSDEVEHÓCULOS
&ORDDEHASTALAACTUALIDADSINDA×ARELSUJETADOR
s3EINTRODUCEFÉCILMENTEENÉREASDEESPACIOREDUCIDOYMIDE
de largo
s!CABADOCROMADO
@]jjYea]flYkhYjYj]kgjl]k\]^Yjgk\]dYfl]jgk
HE52B Herram. p/resortes de faros.
s0ARALOSRESORTESDEALINEACIØN
s6ÉSTAGODEDEDIÉMFIJADOENUNAEMPU×ESTILODESTORNILLADOR
sDELARGO
ADVERTENCIA
YA2155
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
555
SISTEMAS DE ROCIADO DE PINTURA
Pistolas para rociado—Blue-Point®
Una nueva generación de pistolas de rociado de Blue-Point® para imprimación, recubrimiento base y
transparente. Diseñada para los pintores de reacabado de automóviles. Es liviana y bien equilibrada
y entrega un acabado de calidad y de primera clase para automóviles. Posee el disparo de gatillo más
bajo entre las pistolas de su clase. Juegos de reparaciones de calidad y de tamaño de patrón de rociado
inigualable. Hay disponible copas de aluminio intercambiables opcionales de 125 cc, 250 cc y 600 cc.
Está disponible el adaptador PPS 3M® opcional. Un año de garantía completa.
Grande/miniatura - HVLP
Pieza No.
BLP13HVLP
BLP14HVLP
BLP15HVLP
BLP18HVLP
BLP10MHVLP
BLP13HVLP
BLP14HVLP
BLP15HVLP
BLP18HVLP
BLP10MHVLP
Boquilla para fluido (mm)
1.3
1.4
1.5
1.8
1.0
Consumo de aire, scfm
9.5
9.5
9.5
9.5
7.0
29 (2.0, 200)
29 (2.0, 200)
29 (2.0, 200)
29 (2.0, 200)
29 (20, 200)
Peso seco sin copa, oz. (gramos)
12.6 (359)
12.6 (359)
12.6 (359)
12.6 (359)
11.4 (322)
Tamaño de rosca de entrada de aire
1/4" NPSM
1/4" NPSM
1/4" NPSM
1/4" NPSM
1/4" NPSM
600
600
600
600
125
Sólidos altos, colores y
transparencias
Sólidos altos, colores y
transparencias
Sólidos medios, colores
y transparencias
Imprimación, materiales
de alta viscosidad
Imprimación, base y
transparente
PSI máx. de HVLP de entrada
(bar, kPa)
Tamaño de copa, cc
Aplicación
Económico - HVLP
Pieza No.
BLPK14HVLP
Boquilla
para
fluido
Consumo de
aire, scfm
Tamaño de
rosca de
entrada de
aire
Gama de
presión de
aire, psi
Entrega de líquido
(agua)
Tamaño de
copa, cc
1.4mm
14.5
1/4" NPSM
30 a 43
190 a 250 ml/min..
600 ml
Peso
seco sin
copa, oz.
(gramos)
Tamaño de Tamaño
rosca de
copa,
entrada de de cc
aire
Grande - Convencional
Pieza No.
BLPK14HVLP
BLP14CONV
máx.
Boquilla Consumo PSI
HVLP
para
de aire, dedeentrada
fluido
scfm
(bar, kPa)
1.4mm
9.5
—
12.6 (359)
1/4"
NPSM
600
Aplicación
Todos los colores
y transparencias
automotrices
BLP14CONV
Accesorios para pistolas de rociado
Mangueras de aire / fluido
Serie de tapas neumáticas y juegos de servicio
BF7130
BF7220 Manguera de fluido. Manguera de fluido con D.I. de
25 pies x 3/8" y conectores de 3/8" F.P.T.
BF7130 Juego de manguera de aire/fluido. Juego de
manguera de 6´para la copa de presión BF652. El juego incluye una
manguera de aire D.I. de 5/16" con conectores 1/4" F.P.T y manguera
de fluido D.I. 1/4" con conectores 3/8" F.P.T.
556
BF16111 Tapa neumática. Tapa de servicio general (anillo rojo).
BF16113 Tapa neumática. Tapa p/ recubrimiento transparente
(anillo dorado).
BF16114 Tapa neumática. Tapa p/ organizador de materiales
(anillo azul).
BF501RK Juego de repuesto. Para pistolas para rociar BF501.
BF590RK Juego de servicio. Para pistolas para rociar BF590.
www.snapon.com/shoptools
SISTEMAS DE ROCIADO DE PINTURA
9[[]kgjagkhYjYhaklgdYk\]jg[aY\g
;ghYk\]hj]kafqlYfim]k
BF602 Conjunto de copa de baja presión.
sCapacidad de 32 oz.
s6ÉLVULADECONTROLEMBUTIDAPARAMANTENERLA
PRESIØNDELACOPAYLAVÉLVULADEALIVIOPARA
LIBERARLAPRESIØNDELACOPA
s5SECON"&393Y"&393
BF511 Copa para detalles.
sCapacidad de 6 oz.
s&ABRICADADEPOLIETILENORESISTENTETRANSLÞCIDOY
DEALTADENSIDAD
s5SECONPISTOLASPARADETALLES"&"&(6,0
BF503 Copa de sifón universal.
sCapacidad de 32 oz.
s&UNCIONAENTODASLASPISTOLASPARAROCIARLÓDERES
s.OGOTEAENNINGUNAPOSICIØN
s#ONEXIØNDETUERCAGIRATORIADE.04H
;ghYk\]Ydae]flY[afhgj_jYn]\Y\
BF520A
BF540A
BF525
BF555
BF511
BF550
BF503
BF755 Copa de alimentación por
gravedad de aluminio.
s#APACIDADDEOZLITRO
s#OPADEALIMENTACIØNPORGRAVEDADDEALUMINIO5SE
CONTODASLASPISTOLASPARAROCIARDEALIMENTACIØNPOR
GRAVEDAD(6,0DE3NAPON®YCONLAPISTOLAPARAROCIAR
DEALIMENTACIØNPORGRAVEDAD"&!NODELASERIE(6,0
BF7505 Copa miniatura de alimentación
por gravedad de aluminio.
s#APACIDADDEOZCC
s#OPAMINIATURADEALIMENTACIØNPORGRAVEDADDEALUMINIO
s)NCLUYEADAPTADORPARAPODERUTILIZARSEENLASPISTOLASPARAROCIAR
ALIMENTADASPORGRAVEDAD(6,0DE3NAPONYENLAPISTOLAPARA
ROCIARALIMENTADAPORGRAVEDAD"&!NODELASERIE(6,0
BF521A
BF602
BF1210
BF7000
N~dnmdYk'j]_mdY\gj]k\]Yaj]
BF755
BF525 Regulador de presión de aire.
sSALIDASREGULADAS
s)NCLUYEMANØMETRODEAIREDE03)YCONEXIØNNEUMÉTICADE.04
s#APACIDAD#&BF555 Válvula de ajuste de aire (con manómetro).
s$ISE×ADAPARAUTILIZARCONPISTOLASPARAROCIAR(6,0
s)NCLUYEUNMANØMETRODEPSI
s%NTRADADEAIRE.04M3ALIDADEAIRE&04VÉLVULAAHUSADA
BF550 Válvula de ajuste de aire.
s6ÉLVULAAHUSADADEPRECISIØN
s3EABREYCIERRATOTALMENTECONAPROXIMADAMENTEVUELTAS
AJUSTABLEINFINITAMENTE
s0ERILLAGRANDEYDEFÉCILMANEJO
s%NTRADADEAIRE.04M3ALIDADEAIRE.04VÉLVULAAHUSADA
BF1210 Válvula de ajuste de aire “Zona Verde”.
s,EELAPRESIØNDEENTRADAYLAPRESIØNDELATAPANEUMÉTICA
BF7000 Filtro alineado descartable.
s%LFILTRODESCARTABLEELIMINACONTAMINANTESQUESECONDENSANENLA
MANGUERADEAIREENTREELFILTROMONTADOENLAPAREDYLAPISTOLAPARAROCIAR
s2EDUCEDEFECTOSDEPINTURA
s&ÉCILDEINSTALAR
s*UEGODEFILTROS
BF530A
Mfa\Y\]k\][gfljgd'^adljgk\]Yaj]
BF521A Unidad de control de aire.
s)NCLUYEREGULADORQUECUENTACONMANØMETROINVERTIDODE
03)YLLAVEDEADMISIØNDEAIRE
s$OSSALIDASREGULADAS
s5NASALIDAPRINCIPALFILTRADA
s%NTRADADEAIREDE.04H#APACIDADDELFILTRO#&-
s#APACIDADDELREGULADOR#&BF520A Filtro de aire.
s%LEMENTODEFILTRODELTIPOBORDEREUTILIZABLEDEMICRONES
s-UYEFECTIVOPARAELIMINARAGUAACEITEYOTROTIPODECONTAMINACIØN
s%NTRADADEAIRE.043ALIDASDEAIRE.04Y
.04TAPADAS#APACIDADDELFILTRO#&BF530A Filtro de aire.
s%LEMENTODEFILTRODELTIPOBORDEREUTILIZABLEDEMICRONES
s-UYEFECTIVOPARAELIMINARAGUAACEITEYOTROTIPODECONTAMINACIØN
s%NTRADADEAIRE.043ALIDADEAIRE$OSSALIDASDE
.04#APACIDADDEFILTRO#&BF540A Filtro de aire mecánico.
s0ORTÉTILMONTAJEFÉCILENCUALQUIERLUGAR
s$ISE×ADOPARAUNMONTAJEFÉCILUTILIZANDOACOPLESRÉPIDOS
s%NTRADADEAIRE3ALIDASDEAIRE.04.04Y
.04TAPADAS#APACIDADDELFILTRO#&ADVERTENCIA
BF1400
YA999
J]_mdY\gj]k\]hj]kaf\]Yaj]
BF1400 Regulador de presión de aire.
s$IAFRAGMADEAUTOLIBERACIØN
s-ÉXIMAPRESIØNDEENTRADA03)
s,APRESIØNDELACOPAESTÉCONTROLADADEA03)
s-ANØMETRODEPRESIØNDEAIREDEA03)
BF1410 Regulador de presión de aire.
s-INIREGULADORPEQUE×OLIVIANOCONDIAFRAGMAQUESEADJUNTAA
CUALQUIERPISTOLAPARAROCIARINCLUYENDOLOSMODELOS(6,0PARA
UNAPRECISAREGULACIØNDELAPRESIØNDELAIRE
s#ONFIGURACIØNPARAEMPUJAREXTRAERLAPRESIØNDETRABA
s4IENEMANØMETROFÉCILDELEERDE03)
s#APACIDADDE#&-3#&-;,-).=
YA999 Separador de aire/agua.
s3EPARAELAGUADELAIRECOMPRIMIDO
s)NCLUYEVÉLVULADEDRENAJEPDRENAJESPERIØDICOS
sDELARGODEDIÉMETRO
Fg\ajabYdY[gjja]fl]\]Yaj]gdima\g`Y[aY]d[m]jhg&Mk]]f~j]YkZa]fn]fladY\Yk
Fg]phgf_Y]dkgdn]fl]YddYeYk$[`akhYkgYgljYk^m]fl]k\]a_fa[af&
557
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/&
SISTEMAS DE ROCIADO DE PINTURA
Accesorios para pistolas de rociado
AHCC90B
AHCCP90B
Conectores de manguera de alto volumen
AHCC90B Acoplador rápido. Acoplador rápido hembra de
1/4" de alto volumen. Diseñado para proporcionar altos volúmenes
de aire a pistolas para rociar y herramientas neumáticas.
AHCC91B Acoplador rápido. Acoplador rápido macho de
1/4" de alto volumen. Diseñado para proporcionar altos volúmenes
de aire a pistolas para rociar y herramientas neumáticas.
AHCCP90B Boquilla (1/4" hembra). Boquilla hembra
de 1/4" de conexión rápida. Diseñado para proporcionar altos
volúmenes de aire a pistolas para rociar y herramientas neumáticas.
AHCCP97B Adaptador para llave de impacto. Utilizar
con el Acoplador de Flujo Alto AHCC98 para mejorar el rendimiento
a baja presión de las llaves de impacto con cuadro de 1/2" y otras
herramientas neumáticas con alto consumo de aire.
MRB20
Ganchos / soportes de pistolas
para rociar
MRB20 Gancho magnético para
pistola de pintura. No necesitará hacer
orificios en la cabina de pintura para colgar su
pistola de pintura. 160 lb. de fuerza magnética.
BF9893 Soporte de pistola para
rociar. El soporte puede sostener hasta tres
pistolas para rociar de alimentación por gravedad
al mismo tiempo para la recarga. Sostén de
colador ajustable. Construcción de acero.
BF9893
Atomizador
Compresor de aire
BF170A
BF180A
BF180A Compresor. Compresor portátil tipo diafragma sin aceite
de 1/10 HP con purga interna. Compacto, liviano y silencioso. Presión
de trabajo máxima de 33 psi. 115V, 60 Hz, 2.5 amp.
Juegos de atomizadores
BF170A Juego de atomizadores. Atomizador de doble acción de
mezcla interna, alimentado desde el fondo. El diseño de aguja / boquilla
única es capaz de rociar una variedad de acrílicos reducidos, esmaltes,
lacas, barniz y pinturas preparadas para atomizadores. Excelente elección
para aplicaciones múltiples. Incluye: atomizador, frascos de mezcla,
manguera de aire, copa de color, gancho para colgar, aguja adicional y
manual de instrucciones.
BF171
BF360
BF360 Juego de atomizadores. Depósito de pintura rotatorio que
permite la alimentación por gravedad o desde el fondo. Diseñado para usar
punta de un solo tamaño, regulador y aguja para aplicación de cualquier
medio adecuadamente reducido que incluye acrílicos, aguada, tintas,
tinturas, esmaltes, lacas y colorantes. Incluye: atomizador, dos frascos de 2
oz., un frasco de 3/4 oz., manguera trenzada de 6', aguja y boquilla adicional
más caja de almacenamiento plástica con revestimiento de espuma.
BF171 Juego de atomizadores. Atomizador de acción única,
mezcla externa, alimentado desde el fondo. Mezcla de aire y pintura fuera
del atomizador, lo que crea un patrón de puntos más amplio y grueso al
mismo tiempo que provee un mayor volumen de rociado. Para capas de
base, proyectos de retoque y pintura de automóviles. Rocía materiales de
más alta viscosidad, como barnices, tinturas, esmaltes y lacas. Incluye:
atomizador, frascos de mezcla, manguera de aire e instrucciones.
BF105
BF175TA
BF175TA Juego de atomizadores. Atomizador de doble acción
de mezcla interna, alimentado desde el fondo. Elección de agujas/cabezas
finas, medias o pesadas. Rocía una variedad de acrílicos reducidos,
esmaltes, lacas, barniz y pinturas preparadas para atomizadores. Incluye:
atomizador, frascos de mezcla, manguera de aire, copa de color, gancho
para colgar, boquilla adicional, regulador de atomización, aguja y manual
de instrucciones en una caja de almacenamiento.
558
BF105 Juego de atomizadores de alimentación por
gravedad. Ideal para arte gráfica e ilustraciones de automóviles.
Atomizador de doble acción de mezcla interna, alimentado por gravedad
para obtener resultados profesionales. Desempeño perfecto para detalles
pequeños. Configuración de aguja y punta únicas Copa de color montada
permanentemente de 1/3 oz. Rocía cualquier pintura reducida de manera
correcta. Funciona con baja presión. 10-15 psi. Cuenta con las opciones
de una aguja, un regulador y una boquilla para crear un rocío más liviano.
Equilibrada ergonómicamente durante horas para realizar un rociado cómodo.
www.snapon.com/shoptools
SISTEMAS DE ROCIADO DE PINTURA/CHORRO ABRASIVO
DaehaY\gj]khYjYhaklgdYk\]haflmjY
BFCB101
YA7327
;]haddgk\]_mY\]n~dnmdY–:dm]%Hgafl®
PGC500A
DaehaY\gjhYjYhaklgdYk\]haflmjY]kladg_YZaf]l]
PGC500A Limpiador p/ pistolas de pintura. Limpia las
pistolas de pintura en menos de dos minutos. Cumple con la norma
1171 de calidad de SCAQMD. Interruptor de seguridad de aire en la tapa.
Tiene un motor neumático con aspas giratorias de gran torque que sólo
requiere 7 CFM a 60 psi. Incluye regulador y manómetro. Una bomba de
accionamiento magnético sin sellos suministra una poderosa acción de
limpieza, no tiene sellos que se desgasten o que se deban cambiar. Rocía
solvente a 85 psi. Reduce el consumo de solvente a 90%. Mide 30" de
alto, 26" de largo y 24" de ancho en la parte superior.
YA7327 Cepillo para limpiar pistolas de pintura (juego
de 5). Para pistolas de pintura para "exteriores". Se puede utilizar con
todos los solventes de limpieza más comunes (no lo utilice con solventes
marcados como ’corrosivos“). Cerdas de nylon. 7 1/2" de largo.
YA7329 Cepillo para limpiar pistolas de pintura (juego
de 5). Similar a YA7327 pero está diseñado para pistolas de pintura
de “boquilla para fluidos”. 7 3/4" de largo.
BFCB101 Juego de cepillos para limpiar pistolas de pintura.
Juego de pistola para rociar de propósito general. Incluye un juego de agujas de
acero inoxidable de siete piezas c/ empuñ., juego de cepillos mini torcidos de
precisión de 5 piezas, cepillo de tubo de camioneta de 3/8" (12" de largo), cepillo
de cerdas de nilón de 3/16", cepillo de interior de carrocería de nilón de 1/2",
cepillo de carrocería externa c/ cerdas de nilón y cepillo HVLP de nilón de 1/4".
?YZaf]l]hYjYYdeY[]fYjaf^dYeYZd]k
EQFSC45M Gabinete para almacenar inflamables.
Almacene los líquidos volátiles como las pinturas, solventes, alcoholes,
acetona, gasolina y otros productos químicos. Paredes de calibre 16
con paredes de aire de 2". Capacidad de 45 galones con contenedor
para derrames de 5 galones. Canales c/ horquetas de elevación
removible p/ mover y ubicar convenientemente el gabinete. Cumple
con OSHA #29 CFR 1910, el código NFPA #30 y el código UFC #79. El
contenedor de derrame excede los 5 galones requeridos por EPA.
Especificaciones
EQFSC45M
Alto exterior
65"
Ancho exterior
Profundidad
externa
43"
Alto interior
60"
Ancho interior
Profundidad
interna
40"
18"
15"
EQFSC45M
Kakl]eYk\][`gjjgYhj]kafhgjl~lad]k
Kakl]eYk\][`gjjgYhj]kafhgjl~lad]kf]me~la[gk
YA441 Sistema de chorro a presión (250 lb). Para grandes trabajos
de limpieza en el emplazamiento, en aplicaciones de hormigón armado, piedra
y acero, además de muchas otras. El control remoto le permite al operador
apagar el sistema sin tener que regresar al tanque. Capacidad de 250 lb de
arena. Incluye boquilla de 1/4" más manguera p/ arenado reforzada de 25' p/
llegar a todos los puntos de los trabajos grandes. Requiere 80 CFM a 100 psi.
YA449A Sistema de chorro de presión (100 lb). Se reemplazó el
control remoto por una válvula de bola de carbono sólido en el extremo de
la manguera para arenado. Capacidad de 100 lb de arena. Incluye boquilla
de 1/8". La manguera para arenado es de 10' de largo. Requiere de 21 CFM
a 100 psi.
YA448 Sistema de chorro de presión (40 lb). El disparo se controla por
una válvula de bola de acero carbonado en el extremo de la manguera de arenado
del operador para arranques y paradas rápidas. Equipado c/ manguera de arenado
de 8' y receptáculo de presión con capacidad de 40 lb. de arena montado sobre las
patas de un trípode p/ mayor estabilidad. Incluye boquilla de 1/8". Requiere 21 CFM
a 100 psi.
YA432
Kakl]eYk\][`gjjgYhj]kafhgjl~lad]kYdae]flY\gk
hgj_jYn]\Y\&
YA441
ADVERTENCIA
YA448
YA432 Sistema de arenado alimentado por gravedad.
Su portabilidad lo hace práctico para cuadrillas de mantenimiento y
limpiezas en puntos específicos. También es apto para trabajos en
motores y carrocería de automóviles. Requiere 10 ó 18 CFM a 100 psi.
Mk]]f~j]YkZa]fn]fladY\Yk
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
559
SISTEMAS DE CHORRO ABRASIVO
Sistemas de chorro abrasivo tipo gabinete
Los sistemas de chorro abrasivo Snap-on® limpian de manera efectiva las partes metálicas hasta llegar al propio
sustrato. Las aplicaciones varían desde automotrices, de fabricación y restauración hasta talleres de herramientas
y teñido, reparaciones de barcos y restauraciones de motores eléctricos. Los tamaños de los gabinetes varían de
sistemas alimentados por presión de tamaño mediano a grande.
YA3825
YA3423 Gabinete de chorro con
concha de almeja.
tLa tapa estilo concha de almeja facilita la
carga de piezas pesadas
sRuedas giratorias de 3" de goma dura para
portabilidad
sEl eficiente sistema de recolección de polvo
de 135 CFM es silencioso y usa un filtro tipo
cartucho incluido para separar el polvo de
los medios utilizables
sEl sistema de recolección de polvo también
proporciona al usuario una excelente
visibilidad durante el chorro
sLa luz exterior montada en la parte superior
mantiene el foco aislado del área del chorro,
lo cual da más espacio
YA4826P Gabinete de chorro de recarga automática
alimentado a presión.
sEl sistema de medio presurizado limpia hasta cuatro veces más
rápido que los sistemas por sifón.
sEl gabinete de chorro de servicio pesado con una boquilla a chorro
industrial y control con pedal está diseñado para soportar un uso
continuo y disminuir el cansancio del operario
sEl eficiente sistema de recolección de polvo de 135 CFM usa
un filtro tipo cartucho incluido para separar el polvo de medios
utilizables y le proporciona al operario una excelente visibilidad
durante el uso y minimiza los desperdicios
sPosee una puerta a la derecha para piezas pequeñas y una tapa
única estilo concha de almeja que facilita la carga de piezas pesadas
sEl área de trabajo está iluminada con dos luces fluorescentes para
una mayor visibilidad
Dimensiones de
puerta lateral,
pulgadas.
12 Al x 17 1/2 An
16 a 24 Al x 37 1/2 An x 26 Prof
YA3825
11 a 21 Al x 32 An x 21-1/4 Prof
—
YA3423
12 Al x 18 An
23 Al x 35 1/2 An x 23 1/2 Prof
YA3626
14 a 23 Al. x 48 An. x 24 Prof.
13 Al. x 19 An.
YA4826P
8 a 16 Al. x 30 An. x 20 Prof.
—
YA3220
NOTA: El modelo europeo es de 230VCA, 50/60 Hz, monofásico.
560
Dimensiones internas, pulgadas
YA3626 Gabinete de chorro
abrasivo–Blue-Point®.
tIncluye una pistola a chorro de salida
variable estilo gatillo.
sEl eficiente sistema de recolección de polvo
de 100 CFM usa un filtro tipo cartucho
incluido para separar el polvo de medios
utilizables y le proporciona al operario una
buena visibilidad durante el uso y minimiza
desperdicios
sIncluye una puerta a la derecha para piezas
pequeñas y una tapa de abertura en la parte
superior para las piezas de mayor tamaño.
sDos luces fluorescentes para mayor visibilidad
YA3220
YA4826P
Pieza No.
YA3626
YA3423
YA3825 Gabinete de chorro con
concha de almeja.
tPistola a chorro de salida variable estilo gatillo
sEl eficiente sistema de recolección de polvo
de 135 CFM usa un filtro tipo cartucho
incluido para separar el polvo de medios
utilizables y le proporciona al operario una
buena visibilidad durante el uso y minimiza
los desperdicios
sPosee una puerta a la derecha para piezas
pequeñas y una tapa única estilo concha de
almeja que facilita la carga de piezas pesadas.
sDos luces fluorescentes para mayor visibilidad
Dimensiones
abertura superior,
pulgadas
20 Al x 37 1/2 An
16 Al x 34 An
14 Al x 37 An
24 Al. x 48 An.
11 Al. x 28 An.
YA3220 Gabinete de chorro
abrasivo en la parte superior
del banco–Blue-Point.
sGabinete de chorro con huellas
pequeñas y de gran capacidad
sIncluye una pistola a chorro de salida
variable
s4APAENLAPARTESUPERIORPARACARGAR
piezas.
s,UZINTERIORPARAMAYORVISIBILIDAD
YA3220-1 Soporte opcional.
No se muestra.
YAD3976 Recolector de polvo
opcional. 100 CFM, 120 VCA, 60 Hz.
No se muestra.
Dimensiones
totales, pulgadas
Suministro de aire
requerido
70 Al. x 38 An. x 26 Pr.
65 Al x 38 An x 24 Prof
58 Al. x 36 An. x 24 Prof.
60 Al. x 52 An. x 25 Pr.
28 Al. x 32 An. x 20 Prof.
18 CFM a 100 PSI
18 CFM a 100 psi
18 CFM a 100 PSI
45 CFM a 100 PSI
18 CFM a 100 PSI
Herramientas
eléctricas
Requisitos
120 VCA, 60 Hz.
120 VCA, 50/60 Hz.
120 VCA, 60 Hz.
120 VCA, 60 Hz.
120 VCA, 60 Hz.
Modelos
europeos
YAH3825EUR
YAH3423EUR
—
—
—
SOPORTE TÉCNICO
www.snapon.com/shoptools
1-800-253-3661
SISTEMAS DE CHORRO ABRASIVO
Kakl]eYk\][`gjjgYZjYkanglahg_YZaf]l]
YA435
YA4224
YA4224 Gabinete de chorro abrasivo
grande con control con pedal.
tEl gabinete de chorro de servicio pesado con una
pistola a chorro industrial y control con pedal
ESTÉDISE×ADAPARASOPORTARUNUSOCONTINUOY
disminuir el cansancio del operario
sEl eficiente sistema de recolección de polvo de
#&-USADOSBOLSASGRANDESPOLISATINADAS
PARASEPARARELPOLVODEMEDIOSUTILIZABLESY
le proporciona al operario una mejor visibilidad
durante el uso y la eliminación de desperdicios
s)NCLUYEUNAPUERTAALADERECHAPARAPIEZAS
PEQUE×ASYUNATAPADEABERTURAENLAPARTE
SUPERIORPARALASPIEZASDEMAYORTAMA×O
sEl área de trabajo está iluminada con dos luces
fluorescentes para una mayor visibilidad
YA437
9Z]jlmjY\]dYfl]jY
9Z]jlmjYdYl]jYd
YA435 Gabinete de chorro abrasivo.
tEl gabinete de chorro de servicio pesado
incluye una pistola a chorro de salida variable
estilo gatillo.
sEl eficiente sistema de recolección de
POLVODE#&-USADOSBOLSASGRANDES
polisatinadas para separar el polvo de medios
UTILIZABLESYLEPROPORCIONAALOPERARIOUNA
excelente visibilidad durante el uso y la
eliminación de desperdicios.
s)NCLUYEUNAPUERTAALADERECHAPARAPIEZAS
PEQUE×ASYUNAPUERTAFRONTALGRANDEPARALAS
PIEZASDEMAYORTAMA×O
sDos luces fluorescentes para mayor visibilidad.
YA437 Gabinete de chorro abrasivo grande
con control con pedal.
t$ISE×ADOSPARALIMPIARGRANDESARTÓCULOSYVOLÞMENESDE
producción
s,APLATAFORMAGIRATORIAFACILITALALIMPIEZADEMÞLTIPLES
PARTESYOFRECELACAPACIDADDEROTARYLIMPIARPIEZAS
grandes
sGabinete de chorro de servicio pesado con pistola a chorro
DEGRADOINDUSTRIALYCONTROLDEPEDALCONPIEDISE×ADO
para uso continuo y disminución del cansancio del operario
s%LEFICIENTESISTEMADERECOLECCIØNDEPOLVODE#&-
usa tres bolsas grandes polisatinadas para separar el
POLVODEMEDIOSUTILIZABLESYLEPROPORCIONAALOPERARIO
una excelente visibilidad durante el uso y la eliminación
de desperdicios
s$OSLUCESFLUORESCENTESPARAMAYORVISIBILIDAD
SOPORTE TÉCNICO
1-800-253-3661
Dimensiones de Dimensiones
Dimensiones
Suministro de aire
puerta lateral, abertura superior, totales,
pulgadas
requerido
pulgadas
pulgadas.
29 Al. x 41 An. x 23 Pr.
17 Al. x 18 An. 12 Al x 39 1/2 An 73 Al. x 43 An. x 24 Pr. 25 CFM a 100 psi
YA4224
15 a 23 Al. x 40 An. x 26 Pr.
13 Al. x 17 An.
39 x 24
66 Al. x 40 An. x 27 Pr. 18 CFM a 100 psi
YA435
33 Al. x 42 1/2 An. x 44 Prof.
35 Al. x 42 An.
—
78 Al. x 44 An. x 44 Pr. 25 CFM a 100 psi
YA437
./4!%LMODELOEUROPEOESDE6#!(ZMONOFÉSICO
Pieza No.
Dimensiones internas, pulgadas
Herramientas
eléctricas
Requisitos
120 VCA, 60 Hz.
120 VCA, 60 Hz.
120 VCA, 60 Hz.
Modelos
europeos
YAH4224EUR
YAH435-EUR
YAH437-EUR
HaklgdYk\][`gjjg\]Yj]fY
9j]fY\gh]im]g
9j]fY\ghgjYkhajY[af
YA428A
YA428A Arenado por aspiración.
tElimine óxido, suciedad y pintura antigua en interiores con tanta eficiencia
como con un gabinete de chorro
s4ODOELPROCEDIMIENTOSEREALIZADENTRODELACABEZADELCHORROPARAAYUDARA
eliminar el polvo.
sEl arenado “elimina” escombros y los aspira de inmediato en la tolva de polvo.
s0ARAMOVILIDADEL9!!INCLUYEUNCARRODEACEROTUBULARESTRIADOCON
RUEDASSEMINEUMÉTICASDEYRUEDASDUALESDELANTERAS
s4IENEUNAPOTENCIADE#&-
s-IDEXX
s2EQUIERE#&-APSI2EQUIERE6#!
ADVERTENCIA
PSB500AR Pistola para arenado portátil.
s#APACIDADPORTÉTILPARATRABAJOSDELIJADOABRASIVOS
PEQUE×OS
s#ONSTRUCCIØNLIVIANADEALUMINIODISE×ADACONUNABASE
PLANAPARAQUEQUEDEPARADACUANDONOSELAUTILIZA
s%LCONTENEDORDEARENASUSPENDIDODELBDECAPACIDAD
MEJORAELEQUILIBRIOYLACOMODIDADDELUSUARIO
PSB500AR
s2EQUIEREØ#&-ENPSI
PSB100R Pistolas de chorro de arena de velocidad.
s!GARRETIPOPISTOLAACOLCHONADO
s%LTANQUECOMPACTOEIRROMPIBLEDELPERMITEUNSUMINISTRO
autónomo de arena.
s,AALIMENTACIØNPORACCIØNDELAGRAVEDADLEDAFLUJO
consistente y sin interrupciones
s0OSEEUNAVÉLVULADEFLUJODEMATERIALAJUSTABLE
s,APRESIØNDEOPERACIØNESDEAPSI,APRESIØN
DETRABAJOESDEAPSI%LCONSUMOMÉXDEAIRE PSB100R
ESDE#&-APSI
s!COPLEDE.04
s4AMA×ODELCONTENEDOROZ
PSB2020 Sistema de recuperación de
pistola de un solo punto.
tEn pocos segundos, convierte las pistolas de chorro de
ARENADEVELOCIDADDELASERIE03"ENPISTOLASDE
UNSOLOPUNTOCSISTEMASDERECUPERACIØN
s#APTURAELMATERIALDELCHORRODEMANERARÉPIDAY
PSB2020
EFICIENTEYAHORRATIEMPODELIMPIEZA
Mk]]f~j]YkZa]fn]fladY\Yk
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
561
SISTEMAS DE CHORRO ABRASIVO/PRENSAS DE BANCO
Accesorios para arenado
YAD100A
YAD007A
YAD10102A
Accesorios de sistema de chorro
Pieza No.
Boquilla
Chorros de aire
Pistola a chorro
Guantes de chorro
Reemplazo de película
para ventanas
Filtro de reemplazo
YA3626
YAD105
YAD104
YAD100A
YAD007A
YAD20061
YAD714
YADV723
YA4826P
YAD2304
—
—
YAD007A
YAD20061
YA3825
YAD105
YAD104
YAD100A
YAD007A
YAD20061
YAD714
YA4224
YAD10104A
YAD10105A
YAD10102A
YAD007A
YAD20061
YAD674
YA3423
YAD105
YAD104
YAD100A
YAD007A
YAD20061
YAD714
YA435
YAD115
YAD104
YAD100A
YAD007A
YAD20061
YAD019
YA437
YAD10104A
YAD10105A
YAD10102A
YAD007A
YAD20061
YAD018
Abrasivos
YAD4000 Abrasivo de grano de acero. Limpieza a fondo y remoción de óxido e
incrustaciones Balde de 50 lb.
YAD4003 Abrasivo de perdigón de acero. Picado y limpieza de piezas fundidas y
forjadas. Balde de 50 lb.
YA428-1 Abrasivo granate C. No se rompe con la facilidad de la arena de sílice. Produce
menos polvo. Balde de 50 lb.
YA461A Abrasivo de perla de vidrio (grueso). Para acabados satinados gruesos con
una mínima remoción de superficie. Grano grueso de 40-60, balde de 50 lb.
YA462A Abrasivo de perla de vidrio (mediano). Para acabados satinados medianos con
una mínima remoción de superficie. Grano mediano de 60 a 100, balde de 50 lb.
YA463A Abrasivo de perla de vidrio (fino). Usar p/ acabado satinado fino con una
mínima remoción de superficie. Grano fino de 100-200, balde de 50 lb.
YA466A Abrasivo de óxido de aluminio. Un abrasivo resistente que se usa p/ remover
rápidamente la oxidación y las rebabas excesivas. Bajo nivel de polvo y buen nivel de reciclaje.
Balde de 50 lb.
YAD4003
Cascos/Cubiertas
YA414
YA414 Cubierta de tejido de algodón. La tapa de tope protege la cabeza, el rostro y el
cuello del polvo. Protector de servicio liviano para áreas bien ventiladas.
Prensas de banco
Prensas de banco—Blue-Point®
BLPMV5
562
s"LOQUESDEACERODEUNASOLAPIEZAPARAMAYORCAPACIDADDECARGA
s9UNQUEEXTENDIDO
s0UNTOSDELUBRICACIØNPARAMANTENIMIENTO
s"ASEGIRATORIAOPCIONAL
sRango de capacidad de 3.5 ton. a 9 ton. en la abertura máxima
sSoporte de ménsula reforzado
s-ORDAZASINTERCAMBIABLES
s0OLVODEDIAMANTEPARAUNMEJORAGARRE
s&ABRICADACONHIERROFUNDIDODESERVICIOPESADO
s!LINEACIØNDEMORDAZASPRECISA
sHusillo de rosca enrollado para para ubicar y ajustar piezas con facilidad
s(USILLOPROTEGIDO
BLPMV4 Prensa de banco. Mordazas de 4".
BLPMV5 Prensa de banco. Mordazas de 5".
BLPMV6 Prensa de banco. Mordazas de 6".
www.snapon.com/shoptools
PRENSAS DE BANCO
Hj]fkYk\]ZYf[g
WV1560VIS
WV676
Hj]fkYk\]ZYf[g\]k]_mja\Y\YdlYe]fl]nakaZd]k
Hj]fkYk\]ZYf[ghYjYmkgkedlahd]k
Están recubiertas de un color amarillo altamente visibles, que
cumple con la norma de color de seguridad de OSHA p/la legislación
n.º 1910.144 que rige los peligros físicos. El acabado de cubierta
de polvo resiste los rayones y le otorga un acabado duradero y
resistente. Las empuñaduras y trabas están recubiertas con óxido
negro para una mayor resistencia a la corrosión. Las unidades tienen
un diseño en línea recta e incluyen huso y tuerca, tubo de reemplazo
y mordazas de prensas de banco serradas. Base giratoria de 360º.
Las prensas para usos múltiples de servicio regular se pueden usar
en una serie de aplicaciones de taller. Se caracterizan por mordazas
serradas reemplazables, mordazas para tubos incorporadas, base
giratoria y yunque grande para realizar una serie de tareas.
Pieza No.
WV1550VIS
WV1560VIS
Ancho mordaza,
pulg.
5
6
Abertura Máxima,
pulg.
5 1/4
5 3/4
Capacidad de
Tubo, pulg.
1/4-2 1/2
1/4-3 1/2
Pieza No.
WV674*
WV675
WV676
WV656
WV648*
Ancho
mordaza,
pulgadas
4 1/2
5 1/2
6 1/2
6
8
Abertura
Máxima,
pulgadas
3 3/4
4 3/4
5 3/4
6
7 1/ 2
Capacidad
de Tubo,
pulgadas
1/8 - 2
1/8-2
1/8-2 1/2
1/8-3
1/8 - 3
Profundidad
de garganta,
pulgadas.
2 5/8
3 7/16
3 11/16
4 1/4
4 1/2
*Se caracterizan por mordazas para tubos incorporadas, accesorios de
mordaza de prensa de acero reemplazables, base giratoria de traba y
fundición de carrocería resistente de 30,000 psi.
WV4044
WV1745
Hj]fkY\]ZYf[ge][~fa[Y
Para servicio de propósito general y talleres de mantenimiento.
Mordazas superiores reversibles, reemplazables (una serrada, otra lisa),
mordazas para tubos incorporadas, base giratoria y yunque grande.
Pieza No.
WV1745
WV1755
WV1765
WV1780A
Ancho
mordaza,
pulgadas
4 1/2
5 1/2
6 1/2
8
Abertura
Máxima,
pulgadas
4
5
6 1/2
7
Capacidad
de Tubo,
pulgadas
3 1/4
3/8 - 3
3/8 - 3 1/2
1/8 - 3 1/2
Profundidad
de garganta,
pulgadas.
3
3 3/4
4
4 3/4
Cobre
Tapa de
mordaza
WV4044
WV4045
WV4046
WV4046
Hj]fkYkhYjYlmZgkq\]ZYf[gkYunque grande, con husillo
y tuerca incluidos. Piezas de hierro altamente dúctil con resistencia
principal de 60,000 psi. Accesorios p/mordazas de prensa de acero
reemplazable y mordazas p/tubos de acero maquinados. Barra
deslizante de aleación de acero.
Pieza No.
WVC0
WVC2
WVC3
Ancho
mordaza,
pulgadas
3 1/2
5
6
Abertura
Máxima,
pulgadas
4
7
9
WV400N
WV400S
Opción de base giratoria o fija. Yunque grande, c/huso y tuerca
incluidos. Piezas de hierro altamente dúctil con resistencia principal
de 60,000 psi. Los modelos giratorios cuentan c/base antideslizante
de 360°, dientes serrados y doble traba.
Pieza No.
WV300N
WV400N
WV450N
WV500N
WV600N
WV800N
WV300S
WV350S
WV400S
WV450S
WV500S
WV600S
WV800S
ADVERTENCIA
Profundidad
de garganta,
pulgadas.
4 1/2
5 5/16
6 5/8
WVE105RT
Hj]fkYk\]ZYf[g\]e][~fa[g
Ancho
mordaza,
pulgadas
3
4
4 1/2
5
6
8
3
3 1/2
4
4 1/2
5
6
8
Capacidad
de tubo,
pulgadas
1/8 a 2 1/2
1/8 a 4 1/2
3/8 a 6
Abertura
Máxima,
pulgadas
4 3/4
6 1/2
7 1/2
8
10
12
4 3/4
5 1/4
6 1/2
7 1/2
8
10
12
Profundidad
de garganta,
pulgadas.
2 5/8
3 1/2
4
4 1/4
5 1/2
5 13/16
2 5/8
2 3/4
3 1/2
4
4 1/4
5 1/2
5 13/16
Base
Fija
Fija
Fija
Fija
Fija
Fija
Giratorios
Giratorios
Giratorios
Giratorios
Giratorios
Giratorios
Giratorios
Hj]fkYk\]ZYf[g^gjbY\Yk
Las mordazas reversibles endurecidas pueden invertirse para
aplicaciones que no dejan marcas o reemplazarse cuando están
desgastadas. Las unidades forjadas de la competencia no ofrecen
mordazas reemplazables. 360La base giratoria de 360° incrementa
la versatilidad ya que la prensa puede trabarse en prácticamente
cualquier posición. Los tornillos de ajuste de la mordaza aseguran la
alineación y precisión correctas.
Pieza No.
WVE104RT
WVE105RT
WVE106RT
WVE107RT
Ancho mordaza,
pulg.
4
5
6
7
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
Abertura Máxima,
pulg.
3 15/16
5 7/8
7 7/8
8 7/8
Capacidad de
Tubo, pulg.
1/4 - 3/4
1/2 - 2 1/2
1 /2 - 3
3 /4 - 4
563
PRENSAS DE BANCO/BANCOS DE TRABAJO
Tapas de mordazas
Tapas de mordazas
Pieza No.
Descripción
Tamaño, pulgadas
Serie WVA. Las tapas ranuradas de aluminio sostienen piezas desparejas y circulares.
Cara con aleación de aluminio
4
WVA4
Cara con aleación de aluminio
5
WVA5
Cara con aleación de aluminio
6
WVA6
Serie WVF. Tapas con fibras laminadas termorresistentes que evitan la absorción de materiales externos.
Cara de fibra
4
WVF4
Cara de fibra
5
WVF5
Cara de fibra
6
WVF6
Serie WVP. Las tapas prismáticas tienen ranuras verticales y horizontales para marcar, realizar un punzado central, golpear suavemente y realizar cortes de rosca.
Cara prismática
4
WVP4
Cara prismática
5
WVP5
Cara prismática
6
WVP6
Serie WVR. Las tapas tienen cubiertas de goma.
Cara de goma
4
WVR4
Cara de goma
5
WVR5
Cara de goma
6
WVR6
WVA4
WVF4
WVP4
WVR4
Grampas "C"
Grampas C de servicio mediano
s!RMAZØNDEHIERRORANURADODEMÉXIMARESISTENCIA
s4ORNILLODEACEROCONROSCASESTÉNDARESCOMPLETASYEMPU×ADURAS
4DESLIZABLE
s9UNQUEGRANDEYALMOHADILLAGIRATORIADEACEROPGARANTIZARUNA
SUJECIØNSEGURA
s%STILOGARGANTAPROFUNDA
Pieza No.
CL537A
CL537A
CL546A
Profundidad
de la garganta,
pulgadas
3 1/2
6 1/4
Capacidad,
pulgadas
Diámetro del huso,
pulgadas.
2
2 1/2
5/16
3/8
Bancos de trabajo
EQG2223K5
EQG245U5
BPWORKBENCH
Mesas y bancos de trabajo
EQG2223K5 Banco de trabajo de
patas abiertas.
t!CEROPESADODECALIBRECONPATAS
TROQUELADASSOLDADASENUNASOLAPIEZAPARA
BRINDARUNARESISTENCIASUPERIOR
s)NCLUYECAJØNDEALMACENAMIENTOPARAMONTAR
ENUNEXTREMOOENELCENTRODELBANCO
sg!NX0ROFX!L
564
BPWORKBENCH Banco de trabajo
de servicio pesado–Blue-Point®.
t2ECUBRIMIENTODEPOLVODURADERO
COMPLETOENESTANTEINFERIORYSUPERIOR
s0ESONETOLB
s#APACIDADDEPESOLB
s0ANELSUPERIORACEROCALIBRE
s%STANTEINFERIORACEROCALIBRE
s3OPORTEDEACEROACEROCALIBRE
s!NX0ROFX!L
EQG245U5 Banco de trabajo con
pedestal.
t&ABRICADOCONUNASUPERFICIESUPERIOR
PESADADECALIBREYUNABRIDADE
RESPALDOINTEGRAL
s%LPEDESTALDECUATROCAJONESESTÉ
DISE×ADOCONDESLIZADORESDERIELESPARA
UNDESLIZAMIENTOSUAVEYSINOBSTÉCULOS
sg!NX0ROFX!L
www.snapon.com/shoptools
PRENSAS
Hj]fkYk`a\j~mda[Yk\]hakgq\]ZYf[g
DYkhj]fkYk`a\j~mda[Yk \]-($+-$*($)(q,lgf&!j]YdarYfmfY_jYfnYja]\Y\\]ljYZYbgk\]hj]fkY\g$]f\]j]rY\g
qYjeY\g&Dgkhaklgf]khm]\]f\]kdarYjk]]f[mYdima]j\aj][[afdYl]jYd&Dgk\gkZdgim]k\]ljYZYbgaf[dma\gk['[Y\Y
mfa\Y\]kl~fkgkl]fa\gkhgj\gkhmfrgf]k]pl]f\a\gk]fdYhYjl]af^]jagj&Dgkja]d]k\]ljYZYbghm]\]fkmZajk]g
ZYbYjk]\]Y/]fdYkmfa\Y\]k\]-(lgf]dY\Yk$\]Y-]fdYkmfa\Y\]k\]+-lgf]dY\Yk$\]Y+]fdYkmfa\Y\]k\]
*(lgf]dY\Ykq\]Y,]fdYkhj]fkYk\]ZYf[g\])(lgf]dY\Yk&
CG570BHY
CG770HY
CG473HY
Hj]fkYk\]hakg\]*(lgf&
Hj]fkYk\]hakg\]-(lgf&
Hj]fkYk\]hakg\]+-lgf&
CG570BHY Prensas de piso de 50 ton.
Incluye: mecanismo de elevación de mesa, bastidor,
pistón, bomba, bloques de trabajo y accesorios.
CG570BHY2S. CG570BHY con la bomba de
dos etapas.
CG770HY Prensas de piso de 35 ton.
Incluye: mecanismo de elevación de mesa, bastidor,
pistón, bomba, bloques de trabajo y accesorios.
CG770HY2S. CG770HY con la bomba de
dos etapas.
CG473HY Prensas de piso de 20 ton.
Incluye: mecanismo de elevación de mesa, bastidor,
pistón, bomba, bloques de trabajo y accesorios
CG473HY2S. CG473HY con la bomba de dos etapas.
CG470BHY. CG473HY sin el mecanismo de
elevación de mesa.
CG470BHY2S. CG470HY con la bomba de
dos etapas.
CG105HY
CG170HY
Hj]fkYk\]ZYf[g\])(lgf&
Hj]fkYk\]ZYf[g\],lgf&
CG170HY Prensas de banco de 10 ton.
Incluye: bastidor, pistón, bomba, bloques de
trabajo y accesorios.
CG105HY Prensas de banco de 4 ton.
Incluye: bastidor, pistón, bomba y accesorios. Se
puede usar con juego de accesorios CG101.
ADVERTENCIA
9hda[Y[agf]k\]hj]fkY\]hYflYddYghjgl][lgj
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
565
PRENSAS
Prensas hidráulicas de piso y de banco
Ancho del Ancho de canal, pulgadas
Distancia de
área de Viga Riel de Riel de trabajo, pulgadas.
trabajo, lateral Cabezal Trabajo (mín.) (máx.)
pulgadas.
Tornillo
Mesa
Adaptador tipo nariz de toro
Paso
Adaptador Componentes
Mecanismo
Tamaño,
en "V" de
del juego de elevación Pieza No. pulgadas
tornillo
de mesa
Largo
Altura,
pulgadas
Base
Área
CG570BHY
72
3' x 3 1/2'
36
8
10
10
3 3/4
39 1/4
CG471-2 (2)
—
CG471A
Incluido
CG550-13
1
CG570BHY2S.
—
—
—
—
—
—
—
—
—
—
—
—
CG550-14
1 1/2
CG770HY
69
2 1/2' x 3'
28
5
10
10
2 1/4
40 7/8
CG471-2 (2)
—
CG471A
Incluido
CG770-1
7/8
CG770HY2S
—
—
—
—
—
—
—
—
—
—
—
—
CG770-2
1 1/8
CG473HY
60
2' x 3'
20 1/2
5
5
5
4
39 3/4
CG471-2 (2)
CG471-1 (2)
CG471A
Incluido
CG471-3
1/2
CG473HY2S
—
—
—
—
—
—
—
—
—
—
—
—
CG471-4
3/4
CG471-2 (2)
CG471-1 (2)
CG471A
CG472
CG471-3
1/2
Pieza No.
Bloque "V"
50 ton.
35 ton.
20 ton.
1/2
5
5
5
4
—
—
—
—
—
—
—
—
—
—
CG471-4
3/4
1' x 2'
18"
3
4
4
3 1/4
19 1/4
CG170-14 (2)
CG170-15
CG173
—
CG170-16
3/8
—
—
—
—
—
—
—
—
—
—
—
—
CG170-17
3/4
18
11" x 6"
9"
2
2
2
4"
12"
—
CG105-7
—
—
—
CG470BHY
60
2' x 3'
CG470BHY2S
—
—
32 1/2
20
39
3/4
10 ton.
CG170HY
—
4 ton.
CG105HY
—
Placas escalonadas
Use las placas escalonadas para presionar cojinetes, bujes y
aplicaciones de prensa en general.
CG173 Juego de placas escalonadas.
5 piezas. Incluye (componentes descriptos en la
tabla de la derecha):
CG173-1 CG173-4
CG173-2 CG173-5
CG173-3
CG471A Juego de placas escalonadas.
CG471-9
12 piezas. Incluye (componentes descriptos en la
tabla de la derecha):
CG471-6 CG471-9 CG471-12 CG471-15
CG471-7 CG471-10 CG471-13 CG471-16
CG471-8 CG471-11 CG471-14 CG471-17
Placas escalonadas
Pieza No.
CG173-1
CG173-2
CG173-3
CG173-4
CG173-5
CG471-5
CG471-6
CG471-7
CG471-8
Diámetro, pulgadas
5/ 8
y1
3/4 y 1 1/8
7/8 y 1 1/4
1 y 1 3/8
1 1/8 y 1 1/2
1 1/4 y 1 5/8
1 3/8 y 1 3/4
1 1/2 y 1 7/8
1 5/8 y 2 1/16
Pieza No.
Diámetro, pulgadas
CG471-9
CG471-10
CG471-11
CG471-12
CG471-13
CG471-14
CG471-15
CG471-16
CG471-17
1 3/4 y 2 3/16
1 7/8 y 2 5/16
2 y 2 7/16
2 1/8 y 2 5/8
2 1/4 y 2 3/4
2 3/8 y 2 7/8
2 1/2 y 3
2 3/4 y 3 1/4
3 y 3 1 /2
Prensas de ejes
Prensa de eje de 3 toneladas
CG100. Armazón de perfil de acero de 2". Se atornilla a la mesa de
trabajo. El engranaje multiplica la presión de la empuñadura hasta una
fuerza máxima de 3 ton. El juego incluye armazón de prensa de eje,
punzón p/uso general CG100-14, bloque de trabajo CG100-15 y adaptador
CG100-16 p/transformar el cuadro de 1/2" en cuadro redondo de 5/16".
Especificaciones
Dimensiones
Presión, ton.
Tamaño de base
Capacidad vertical
Ancho libre
Ancho entre abrazaderas de
trabajo
Golpe del eje de presión
CG100
566
Diámetro, pulgadas
18" de alto, 11 1/8" de ancho
3
11 1/8" x 6 1/8"
12 3/4"
9"
9"
9" (cuando se agrega el punzón)
Accesorios opcionales para CG100: Los adaptadores del juego de
colocación de bujes A57Q se pueden usar con el adaptador con
cuadro redondo CG100-16 de 5/16". El separador de cojinetes CJ951
cabe perfectamente entre las abrazaderas de la superficie de trabajo.
También es posible usar componentes del juego de accesorios CG101.
www.snapon.com/shoptools
COMPRESORES DE AIRE
BRA5DV30VP
BRAC560V
BRA8180V
BRA5140H
BRARS8180H
BRA9G3B
BRA517V
BRA7180V
BRA10312H
BRA15312H
;gehj]kgj]k\]Yaj]$k]ja]]kh][aYd\]KfYh%gf®
HP
Etapas de la
bomba
Galones
del
tanque
Estilo del
tanque
Requerimientos eléctricos
BRA5DV30VP
5
Único
30
Portátil
120 ó 220 V, monofásico
Requisito del
servicio de
amperaje
30 a 120V
15 a 220V
BRAC560V
5
Único
60
Vertical
Monofásico, 208/230V
20 a 208/230 V
BRA5140H
5
Doble
40
Horizontal
Monofásico, 208/230V
BRA517V
5
Doble
70
Vertical
BRA7180V
7
Doble
80
BRA7180VEM
7
Doble
BRA8180V
8
BRARS8180H
Pieza No.
Arrancador Contador Drenaje
mag
horario automático
Suministro
de aire en
SCFM a psi
PSI
máx.
No
requiere.
No
No
7 @ 125
125
No
No
13.5 @ 140
140
30 a 208/230 V
No
requiere.
No
requiere.
No
No
14.0 @ 175
175
Monofásico, 208/230V
40 a 208/230 V
Sí
No
No
17.5 @ 175
175
Vertical (2)
Monofásico, 208/230V (1)
40 a 208/230 V
Sí
Sí
Sí
23.5 @ 175
175
80
Vertical
Monofásico, 208/230V
40 a 208/230 V
Sí
No
No
23.5 @ 175
175
Doble
80
Vertical (2)
Monofásico, 208/230V (1)
40 a 208/230 V
Sí
Sí
Sí
27.0 @ 175
175
8
Tornillo giratorio
80
Horizontal
Monofásico, 208/230V (1)
40 a 208/230 V
Sí
Sí
Sí
35.0 @ 125
125
BRA9G3B
9
Doble
30
Horizontal
Motor de gas, arranque eléctrico
—
—
No
No
23.0 @ 175
175
BRA10312H
10
Doble
120
Horizontal
Trifásico, 208/230V (3)
40 a 208/230 V
Sí
No
Sí
36.0 @ 175
175
BRA15312H
15
Doble
120
Horizontal
Trifásico, 208/230V (3)
75 a 208/230 V
Sí
No
Sí
48.0 @ 175
175
BRA20312H
20
Doble
120
Horizontal
Trifásico, 208/230V (3)
100 a 208/230 V
Sí
No
Sí
75.0 @ 175
175
(1) Motor de tres fases disponible
(2) Tanque horizontal disponible
(3) Cableado de 440/460 voltios disponibles
ADVERTENCIA
Mk]mfj]_mdY\gj\]hj]kafqmfÇdljg\]`me]\Y\qdmZja[Yfl]]fdYdf]Yf]me~la[Y&
Ka_Ydgkj]imakalgk\]eYfl]faea]flg&D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
567
COMPRESORES DE AIRE
Equipo para procesamiento de aire
Reguladores, filtros y válvulas Quickclamp®
s%LSISTEMAUTILIZADISE×OMODULARDEFILTROSREGULADORESLUBRICANTES
YACCESORIOS
s0ERMITELAINSTALACIØNYREMOCIØNDELASUNIDADESYACCESORIOSDE
LOS3ERVICIOS!(2SINROMPERLACONEXIØNDELTUBO
s%LDISPOSITIVODEENGRAMPADOSOSTIENELOSCOMPONENTESDELPRODUCTO
!(2ENCOMBINACIONESRÓGIDAS
AHR438
Sostén para
montaje en
pared
AHR428 Lubricante del filtro de aceite.
s0OSEEUNBOLDEBAYONETADERÉPIDALIBERACIØNLENTESPRISMÉTICOSDE
ALTAVISIBILIDADYUNINDICADORDENIVELDELÓQUIDO
s,UBRICAUNASOLAHERRAMIENTACILINDROUOTROSDISPOSITIVOS
NEUMÉTICOS
s%LPUERTODEENTRADASALIDAESDE.04H
AHR424
AHR424 Filtro de uso general.
s%XCELENTESCARACTERÓSTICASPARALAREMOCIØNDEAGUA
s%LELEMENTODEFILTROESDEPROFUNDIDADESTÉNDARTIPOMM
s2EMOCIØNDEPARTÓCULASSEGÞN)3/CLASEY
s%LPUERTODEENTRADASALIDAESDE.04H
AHR428
AHR430 Filtro/regulador de uso general.
s,APERILLADEAJUSTEDEBAJOTORQUEQUEEVITAELAUMENTODELA
PRESIØNTIENEUNDISPOSITIVODETRABAINTEGRAL
s%LELEMENTODEFILTROESDEPROFUNDIDADESTÉNDARTIPO«M
s2EMOCIØNDEPARTÓCULASSEGÞN)3/CLASEY
s%LPUERTODEENTRADASALIDAESDE.04H
s%LPUERTODELCALIBREESDE.04H
AHR430
AHR423 Válvula de drenaje automática.
s#UANDOELLÓQUIDOALCANZAELMÉXIMONIVELSEACTIVAELFLOTANTEYEL
ACEITEYELAGUAINNECESARIOSDRENANAUTOMÉTICAMENTE
s0UEDEUTILIZARSEENLASSIGUIENTESUNIDADESENLUGARDEUNDRENAJE
MANUAL!(2Y!(2
AHR423
AHR426
AHR426 Regulador de presión de uso general.
s0OSEEPUERTOSDECALIBRACIØNDEFLUJOCOMPLETOSYREGULADORESDE
DESCARGAESTÉNDARES
s,APERILLADEAJUSTEDEBAJOTORQUEQUEEVITAELAUMENTODELA
PRESIØNTIENEUNDISPOSITIVODETRABAINTEGRAL
s,AVÉLVULABALANCEADAMINIMIZAELEFECTODELAVARIACIØNENLA
PRESIØNDEENTRADACONRESPECTOALAPRESIØNDESALIDA
s%LPUERTODEENTRADASALIDAESDE.04H
s%LPUERTODELCALIBREESDE.04H
AHRB200
Filtros/Reguladores
Gama de
temperatura, °F
(°C)
Flujo, scfm
250 (17.2)
175 (79)
150
300 (20.7)
0-175 (-18-79)
—
250 (17.2)
175 (79)
3.5-100
7/16"-24
UNS
250 (17.2)
0-175 (-18-79)
—
7/16"-24
UNS
Gama de presión
ajustable
Presión de servicio
máxima
Capacidad de aceite
Rango de temperatura de
operación
5-120 PSIG(0.5-8.5
kgf/cm2)
140 PSIG(9.9 kgf/
cm2)
80 ml
41-140° F (5-60° C)
Pieza No.
Presión de entrada
máxima, psi (bar)
AHR424
AHR426*
AHR428
AHR430
Conexión de drenaje
manual
7/16"-24
Conexión de drenaje
automática
1/8"
UNS (m)
—
NPT(f)
—
—
1/8"
NPT(f)
*"LUE0OINT®
Reguladores, filtros y válvulas
Pieza No.
AHRB200
568
Tamaño de puerto
de entrada / salida
1/2"
NPT (h.)
www.snapon.com/shoptools
LIMPIEZA Y SEGURIDAD
Protección de todos sus bienes.
Aumento de las ganancias del taller.
Snap-on® tiene lo que su taller necesita para mantenerlo
limpio y seguro.
­HgjimhY_YjmfYlYja^Y\]k]jna[aghYjYim]d]dd]n]f
kgdn]fl]mkY\g7MfdYnY\gj\]ha]rYk\]KfYh%gf]kmfY
afn]jkaf]fkmlYdd]jq]f]d]flgjfg&9dmkYjmfkakl]eY
\]ÇdljY[afYnYfrY\g$hm]\]]daeafYjdYf][]ka\Y\\]
\]k][`Yjkgdn]fl]mkY\g&=klgd]
Y`gjjYj~\af]jgq$Y\]e~k$
hjgl]_]]de]\agYeZa]fl]&
=imahg\]daeha]rY2MflYdd]jdaehag]kmflYdd]jk]_mjgq
]Ç[a]fl]&KfYh%gfla]f]dYkgdm[afhYjYdYkm[a]\Y\$dY
_jYkYq]dlarf]&EYfl]faea]flg\]mkl]\q\]dlYdd]j]f
hlaeYk[gf\a[agf]k&
=imahg\]k]_mja\Y\2;gfdgkYfl]gbgk\]k]_mja\Y\
Z~ka[gkqdYhjgl][[afhYjYg\gk$qdgkhjgl][lgj]k
^Y[aYd]k\]\ak]ge~kj][a]fl]$KfYh%gfdgYqm\YY
j]YdarYjkmljYZYbg\]eYf]jYk]_mjYq[eg\Y&
DYnY\gj]k\]ha]rYk2KakmlYdd]jf][]kalY
mfa\Y\]k[gfZYk]\]kgdn]fl]kg\]
ZYk]Y[mgkY$KfYh%gfla]f]mfYdf]Y
completa para cumplir con sus
f][]ka\Y\]k\]daeha]rY&
569
LAVADORAS DE PIEZAS
Base de solventes
Las lavadoras de piezas de doble filtro de Snap-on® ofrecen un excelente
suministro de solvente para lavar las piezas. El sistema de filtrado elimina
virtualmente las modificaciones del solvente.
Lavador de filtro doble
s%LFILTRADOCOMPUESTODEDOSETAPASREALIZAUNCONSTANTEFILTRADO
DELSOLVENTE
s,ASTUBERÓASESTÉNFABRICADASCONACERODECALIBREYTIENENUN
BORDEAGREGADOPARAMAYORRESISTENCIA
s3ECOMPLETACONLÉMPARADETRABAJOYPICOFLEXIBLESALVOLA0"$!
El filtrado de
dos etapas
proporciona una
mayorpurificación al
eliminar el aceite y
la grasa
El filtrado de dos
etapas elimina los
sólidos pesados
Filtro de dos etapas
PBD3222A
PBC4828
PBD34A
PBD2622A
PBC3222A
PBC16
Especificaciones
PBD3222A
PBC4828
PBD34A*
PBD2622A
PBC3222A
PBC16
Doble
Doble
—
Doble
Doble
—
Filtrado
Tambor
Cuadradas
Tambor
Tambor
Cuadradas
—
Base
10 Alt. x 32 An. x 22 Prof. 14 Al. x 48 An. x 28 Prof. 7 Alt. x 28 An. x 22 Prof. 7 Al. x 26 An. x 17 Prof. 10 Alt. x 32 An. x 22 Prof. 6 Alt. x 15 An. x 16 Prof.
Dimensiones internas, pulgadas
20
20
10
10
20
5
Requerimientos de fluidos, gal.
120 VCA, 60Hz.
120 VCA, 60Hz.
120 VCA, 60Hz.
120 VCA, 60Hz.
120 VCA, 60Hz.
120 VCA, 60Hz.
Requisitos de potencia de entrada
325
325
210
210
325
210
Volumen de bomba, galones/hora
50
50
50
50
50
50
Presión de salida, psi
39 Al. x 36 An. x 26 Prof. 45 Al. x 52 An. x 32 Prof. 35 Alt. X 31 An. X 23 Prof. 34 Al. x 30 An. x 21 Prof. 39 Al. x 36 An. x 26 Prof. 10 Alt. x 17 An. x 23 Prof.
Dimensiones totales, pulgadas
63
75
60
53
63
23
Altura abierto, pulgadas
PBD3209
PBD3209
—
PBD3202
PBD3209
—
Filtro de reemplazo
PBDH3222AEUR
PBCH4828EUR
—
PBDH2622AEUR
PBCH3222AEUR
—
Modelos europeos, 230 VCA, 50 Hz
Incluida
Incluida
Opcional
—
Incluida
—
PBD1751 Bandeja de piezas
Opcional
Opcional
Opcional
—
Opcional
—
PBA720A Mesa de drenaje
"LUE0OINT®
SOPORTE TÉCNICO
1-800-253-3661
570
www.snapon.com/shoptools
LAVADORAS DE PIEZAS
:Yk]Y[mgkY
PBC42A
PBC33
LjYZYbge]\ag']d[lja[g
PBC42A Lavadora de piezas de alta presión.
s,AVADORAACUOSADEPARTESCOMPLETAMENTECERRADA
s%LCHORROLIMPIACONUNAVARILLADEALTAPRESIØN
s,ASOLUCIØNJABONOSASECALIENTAPARAMAYOREFECTIVIDAD
s%LCICLODEREMOJOAUTOMÉTICOAFLOJALASUCIEDAD
s2EJILLAYTRAMPASDECONTAMINANTESPARASEPARARELACEITEYLA
GRASADELASOLUCIØNJABONOSA
s3EINCLUYENLBDEJABØNENPOLVO9!$7!
PBC33 Lavadora acuosa estándar de partes
calentadas.
s,AVALASPIEZASCONUNPICODELIMPIEZAPRESURIZADO
s3ECALIENTAPARAMAYOREFECTIVIDAD
s4UBERÓADEPOLIETILENODEPAREDGRUESAYBASESØLIDA
s%LNIVELADORINTEGRALDEACEITEREMUEVEELACEITEYLAGRASADELA
SOLUCIØNLIMPIADORA
s)NCLUYEGALONESDELCONCENTRADODESOLUCIØNLIMPIADORA0"!!
Especificaciones
PBC42A
Eléctrica
Fuente de alimentación
24
Profundidad, pulgadas
12
Capacidad del depósito, gal.
230VAC, 60 Hz
Requerimientos eléctricos
3/4
Motor de bomba, hp
500
Presión de salida, psi
180
Volumen, gal./al.
1,500
Calentador, watts
67
Altura abierto, pulgadas
Dimensiones internas, pulgadas 16 a 26 Al. x 40 An. x 24 Prof.
62 Al. x 46 An. x 27 Prof.
Dimensiones totales, pulgadas
-ODELOEUROPEO0"#(!%526#!(Z
Especificaciones
PBC33
Eléctrica
Fuente de alimentación
28 (711)
Profundidad, pulgadas (mm)
20
Capacidad del depósito, gal.
120 VCA, 60Hz.
Requerimientos eléctricos
50
Presión de salida, psi
325
Volumen, gal./al.
1,500
Calentador, watts
65
Altura abierto, pulgadas
Dimensiones internas, pulgadas 10 Alt. x 21 An. x 31 1/2 Prof.
Dimensiones totales, pulgadas 42 Al. x 37 An. x 28 Prof.
-ODELOEUROPEO0"#(%526#!(Z
LjYZYbgh]kY\g']d[lja[g
PBC57A Lavadora automática de piezas de
alta presión.
s,IMPIAAUTOMÉTICAMENTEBLOQUEDEMOTORESCULATAS
DECILINDROSCAJASDETRANSMISIØNYPIEZASPEQUE×AS
s3OLUCIØNJABONOSACALIENTEYPRESURIZADA
s$IECIOCHOBOQUILLASDEALTAPRESIØN
s,APLATAFORMASEROTAYSEEXTRAEPARAFACILITARLA
CARGADELASPIEZAS
s%LNIVELADORINTEGRALDEACEITEREMUEVEELACEITEYLA
GRASADELASOLUCIØNJABONOSA
s3EINCLUYENLBDEJABØNENPOLVO9!$7!
PBC57A
Herramientas eléctricas
60
230 VCA, 60 Hz
Requerimientos eléctricos
(mín. 60 A de servicio)
9,000
Calentador, watts
2
Motor de bomba, hp
500
Capacidad de plataforma giratoria, lb.
30
Diámetro de plataforma giratoria, pulgadas
3
Velocidad de plataforma giratoria, rpm
41Alt. x 35An. x 35Prof.
Dimensiones internas, pulgadas
69Alt. x 53An. x 43Prof.
Dimensiones totales, pulgadas
-ODELOEUROPEO0"#(%526#!(Z
PBC55-1
Especificaciones
Fuente de alimentación
Capacidad del depósito, gal.
ADVERTENCIA
PBC55-3
PBC57A
PBC55-1 Canasta de piezas.
t#ANASTADEACEROPERFORADAPARA
SOSTENERPARTESPEQUE×AS
Árbol de tres piezas PBC55.
s3OPORTEDETUBOSDEACERO
SOLDADOSPARASOSTENERPIEZAS
MÉSPEQUE×ASPARALALIMPIEZA
Fg\ajabYdY[gjja]fl]\]Yaj]gdima\g`Y[aY]d[m]jhgFg]phgf_Y]dkgdn]fl]YddYeYk$[`akhYkmgljYk^m]fl]k\]a_fa[af
Mk]]f~j]YkZa]fn]fladY\YkFgmk]]ddYnY\gjkafim]dY[gf]pafY^mkaZd]gdYn~dnmdY\]k]_mja\Y\]klfaflY[lYk
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
571
LAVADORAS DE PIEZAS
Accesorios para lavadoras de piezas
YA452
YA505
PBA728A
GA501A
Cepillos para limpiar piezas/de base acuosa y
solvente–Blue-Point®
YA452 Cepillo de limpieza de piezas.
s#ERDASDURASCEMPU×PLÉSTICAANTIDESLIZANTECONTORNEADA
s3EADAPTAALAMAYORÓADELASLAVADORASDEPIEZAS
s%LEXTREMOABOCARDADODELAMANGUERACALZAENCUELLOSDE,A
MANGUERADEDELARGOTIENEUNAANILLOINTERNOPARAEVITARQUELA
MANGUERASERETUERZA
sDELARGOTOTAL
GA501A Cepillo para limpiar piezas.
s3IMILARA9!SINMANGUERADELARGO
YA505 Cepillos p/ limpiar piezas.
sPAQUETESPARALIMPIARPIEZASDELMOTORMAQUINARIACOJINETESDE
RUEDASYOTROSCOMPONENTESMETÉLICOS
s,ASCERDASDEPOLIPROPILENORESISTENELUSOREPETIDOENLIMPIARSOLVENTES
s$IÉMETROLARGOTOTAL
PBA728A Concentrado de solución limpiadora de base acuosa.
s3OLUCIØNCONBAJONIVELDEESPUMAEINODORAPARA0"#
s#UANDOSECALIENTASEOBTIENENMEJORESRESULTADOS
s"ALDEPLÉSTICODEGALONES
PBA729 Solución limpiador biodegradable de base acuosa.
s$ETERGENTELÓQUIDOVERDECRISTALINOCONBAJONIVELDEESPUMA
s#UANDOSECALIENTASEOBTIENENMEJORESRESULTADOS
s5SEENLAVADORAS0"#YSIMILARES
s"ALDEPLÉSTICODEGALONES
YADW896A Jabón en polvo alcalino.
s,IMPIADORENPOLVOALCALINOPARALASLAVADORAS0"#!Y0"#!
s"AJONIVELDEESPUMASEGUROPARAUSARENPIEZASDEALUMINIOBRONCEYACERO
s)NCLUYEUNADITIVOINHIBIDORDEØXIDO
s"ALDEPLÉSTICODELB
Accesorios para lavadoras de piezas en
base a solvente
Solución de limpieza p/lavadores
de piezas en base a solventes
PBA760
PBA760 Solvente.
s3OLVENTEDEPETRØLEOCPUNTODEINFLAMACIØN
Aª
s%XCELENTEPARAREMOVERACEITEYGRASA
s3EUSASOLAMENTEENLAVADORASDEPIEZASEN
BASEASOLVENTE
s"ALDEPLÉSTICODEGALONESCONPICOVERTEDOR
PBA725
PBD1751
Limpieza de piezas
YA730D
YA729B
Rieles de manguera
YA571
YA1729
YA730D Rieles de mangueras de aire/agua para
servicio pesado.
s-ANGUERADEBAJAPRESIØNDEgDEDE$)
s4OPEDEBOLAAJUSTABLE
s-ANGUERADECONEXIØNDE
s2ESORTERETRÉCTILDEACERODEALTOCARBONO
s%LBRAZOGUÓASEAJUSTAENPOSICIONES
YA729B Rieles de mangueras.
s-ANGUERADEBAJAPRESIØNDEgDEDE$)
s4OPEDEBOLAAJUSTABLE
s-ANGUERADECONEXIØNDE
s#ONSTRUCCIØNDEMETAL
s0RESIØNMÉXIMAPSI
s4EMPERATURAMÉXDELAGUA&
YA1729 Rieles de mangueras de aire.
s%LFRENODETENSIØNDERESORTECONTROLALAROTACIØNDELRIEL
s,APALANCAGIRATORIADEBRONCEDE.04PERMITEELLIBREFLUJO
DEAIRE
s3EADHIEREFÉCILMENTEALAPAREDOSUPERFICIEDETRABAJO
s.OSEINCLUYELAMANGUERA
Especificaciones
YA1729
28 CFM a 90 psi
Suministro de aire requerido
17 3/4
Diámetro, pulgadas
19
Altura, pulgadas
100
Capacidad del riel, pies (manguera con D.E. de 3/4")
150
Capacidad del riel, pies (manguera con D.E. de 5/8")
11
Ancho, pulgadas
572
PBA729
Soluciones limpiadoras para lavadores de piezas de base acuosa
PBA725 Canasta de piezas.
s3ECUELGADENTRODELASLAVADORASDEPIEZASENBASEA
SOLVENTE
PBD1751 Bandeja de piezas.
s!YUDAAELIMINARELEXCESODESOLVENTE
s3EENGANCHAENLAPARTEEXTERNADELALAVADORADEPIEZAS
s-IDEDEANCHOXDEPROFUNDIDAD
PBA720A Mesa de drenaje.
PBA720A s!YUDAAELIMINARELEXCESODESOLVENTE
s3EENGANCHAENLAPARTEEXTERNADELALAVADORADEPIEZAS
s-IDEDEANCHOXDEPROFUNDIDAD
YA297
NOZZLE360A
GA299
Boquillas y mangueras de agua
YA571 Boquilla para rociar agua.
s2OCÓAAGUACALIENTEOFRÓA
s%LSUJETADORTRABAELCHORROENLACONFIGURACIØNDESEADA
s%LPROTECTORDELPARAGOLPESEVITARAYONESENLAPINTURADELAUTO
s%NCAJAENLASROSCASDELASMANGUERASNORMALESDEJARDÓN
YA297 Boquilla de manguera para ahorrar agua.
s"RINDAUNAPRESIØNCONCENTRADADECORRIENTE
s4IENEUNAVÉLVULADECONTROLACCIONADAPORINTERRUPTORESPECIAL
s#ALZAENLASROSCASDELASMANGUERASCOMUNESDEJARDÓN
sDELARGO
NOZZLE360A Boquilla para rociar agua.
s#ONVIERTECUALQUIERMANGUERAESTÉNDARDEENUNAHERRAMIENTA
DELIMPIEZAMULTIFUNCIØN
s#INCOPATRONESDEROCÓODIFERENTES
s,ABOQUILLAENFORMADECHORROAºESTÉDISE×ADAENALUMINIO
TROQUELADORESISTENTEACEROINOXIDABLEFORJADOFIBRADEVIDRIODEALTO
GRADOYGOMASANTOPRENODEAGARRECØMODO
s!PAGADOENDOSDIRECCIONES
GA299 Pistola neumática de solvente.
s5TILIZADAPARAREMOVERGRASAOAPLICARACEITES
s3ECONVIERTERÉPIDAMENTEENPISTOLANEUMÉTICADEVARALARGA
s)NCLUYEUNAMANGUERADEgPARAPASARQUÓMICOSDELSIFØNALAPISTOLA
s&UNCIONACA03)
www.snapon.com/shoptools
LAVADORAS A PRESIÓN
Con agua fría
Af[dmq]ZgeZY\]n~klY_g\][]j~ea[Y[gfn~dnmdYk\]Y[]jgafgpa\YZd]$
haklgdYY_Yladdg$afq][[af\]hjg\m[lgkimea[gkqhj]kafYbmklYZd]&
SEPW1500P
SEPW1500SM
SEPW1000
SEPW2700G
SEPW1600G
9dae]flY\Yk]d[lja[Ye]fl]
Eglgj\]_YkgdafY
Boquilla para rociar ajustable de 0 a 60° y protección contra GFCI con
cable de alimentación de 35".
Boquilla para rociar intercambiable o ajustable de 0 a 40º y carro con
armazón tubular, recubrimiento de polvo y ruedas neumáticas.
Especificaciones
PSI (bar)
GPM (lpm)
HP
Voltaje
Tapa del tanque de
productos químicos.
Temp. máx. de la bomba.
Térmica
Largo manguera (pies)
Dimensiones (Largo x
Ancho x Altura)
Peso de envío, lb.
SEPW1500P
SEPW1000
SEPW1500SM
Transporte manual Montado en carro Montado en la pared
1,450 (100)
1,000 (69)
1,450 (100)
2 (7.6)
2 (7.6)
2 (7.6)
2
1.5
2
120V/20A/monof. 120V/15A/monof. 120V/20A/monof.
—
1 gal.
—
140° F
Mecánico
26
140° F
Mecánico
50
180° F
Mecánico
40
18" x 12" x 11"
21" x 16" x 36"
20" x 12" x 20"
68
65
98
Especificaciones
PSI (bar)
GPM (lpm)
HP
Motor
Tapa del tanque de combustible.
Tapa del tanque de
productos químicos.
Térmica
Largo manguera (pies)
Dimensiones (Largo x
Ancho x Altura)
Peso de envío, lb.
SEPW1600G
Montado en carro
1,600 (110.4)
3 (11.4)
5
Honda GC
1.9 cuartos de galón
SEPW2700G
Montado en carro
2,700 (183.3)
3 (11.4)
6.5
Honda GC
3.9 cuartos de galón
3 gal
3 gal
165º F
50
165º F
50
30" x 21.5" x 36"
30" x 21.5" x 36"
87
108
;gfY_mY[Yda]fl]]f[]f\a\YhgjY[]al]
;Yda]flY]dY_mYY*((°>&Af[dmq]ZgeZY\]n~klY_g\][]j~ea[Y[gfn~dnmdYk\]Y[]jgafgpa\YZd]$
haklgdYY_Yladdg$ZgimaddYkafl]j[YeZaYZd]k$afq][[af\]hjg\m[lgkimea[gk$hj]kafYbmklYZd]$ZgZafY
]fngdn]fl]]f^jg\]Y[]jgafgpa\YZd]$lYfim]k\][geZmklaZd]\]hgda]lad]fgqhjgl][[af[gfljY?>;A&
;Yjjg[gfYjeYrflmZmdYjqj][mZjaea]flg\]hgdng[gfjm]\Ykf]me~la[YkhYjYeYqgj\mjYZada\Y\&
SEPW14SHDE
SEPW30SHDE
9dae]flY[af]d[lja[Y
Especificaciones
SEPW14SHDE
SEPW15SHDE
SEPW3000QH
SEPW20SHDE
SEPW30SHDE
1,450 (100)
1,500 (103.5)
2,000 (138)
3,000 (207)
PSI (bar)
2 (7.6)
3 (11.4)
4 (15.2)
4 (15.2)
GPM (lpm)
2
3
5
7.5
HP
120V/20A/monof. 230V/20A/monof. 230V/25A/monof. 230V/34A/monof.
Voltaje
Capacidad de
5 gal
5 gal
5 gal
5 gal
combustible
del quemador
Dimensiones (Largo 34" x 27" x 47" 34" x 27" x 47" 34" x 27" x 47" 34" x 27" x 47"
x Ancho x Altura)
350
350
570
600
Peso de envío, lb.
ADVERTENCIA
Eglgj\]_YkgdafY
Especificaciones
PSI (bar)
GPM (lpm)
HP
Motor
Capacidad del tanque de combustible
Capacidad de combustible del quemador
Dimensiones (Largo x Ancho x Altura)
Peso de envío, lb.
Fg\ajabYdY[gjja]fl]\]Yaj]gdima\g`Y[aY]d[m]jhg
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
SEPW3000QH
3,000 (207)
4 (15.2)
13
Honda
6.9 cuartos de galón
5 gal
54" x 32" x 49"
600
573
ASPIRADORAS/VENTILADORES DE TALLER
Aspiradoras para productos líquidos y secos
Máquinas limpiadoras/secadoras de resistencia industrial de operación completa que combinan el
mayor grado de succión/flujo de aire con motores resistentes y duraderos. Los materiales de la más alta
calidad garantizan una larga vida útil. Diseños de motores con cojinetes de bola que ofrece un excelente
desempeño del motor con menor esfuerzo. Diseñados para facilitar el traslado y prolongar la vida útil.
Especificaciones
Tanque
Ruedas giratorias
Succión de agua
Motor
CFM
Aprobación
Operaciones
Conjunto de filtros
Incluye
"LUE0OINT®
YA1023
YA1105
De polietileno de 23 gal
Resistente a la corrosión
Trasera grande/frontal giratoria
Cuatro giratorias
91"
84"
2 etapas
2 etapas
142
78
UL y c-UL
UL y c-UL
Operación completa
Operación completa
YAT90448
YAT24519
Juego de herramientas para productos Juego de herramientas para productos
líquidos y secos de 1.5" (manguera
líquidos y secos de 1.5" (manguera
con extremo giratorio, herramienta
con extremo giratorio, herramienta
para grieta, herramienta para
para grieta, herramienta para
tapizados, dos extensiones rectas,
tapizados, dos extensiones rectas,
bastidor de herramienta para piso con bastidor de herramienta para piso con
accesorios de caras alfombrada,
accesorios de caras alfombrada,
con cepillo y con escobilla)
con cepillo y con escobilla)
Aspiradoras portátiles
YA1009SS
Resistente a la corrosión
Trasera grande/frontal giratoria
84"
2 etapas
78
UL y c-UL
Operación completa
YAT90445
Juego de herramientas para productos
líquidos y secos de 1.5" (manguera con
extremo giratorio, herramienta para
grieta, herramienta para tapizados,
dos extensiones rectas, bastidor de
herramienta para piso con accesorios
de caras alfombrada,
con cepillo y con escobilla)
BLPVAC5*
De polipropileno de 5 gal
4 ruedas giratorias de metal
65"
1 etapa
117
UL y c-UL
Operación completa
- (Filtro de cartucho lavable)
Manguera de 7' (1-1/4" de diám.), 3 varitas de
extensión, filtro de cartucho lavable, mango
de espuma reusable, boquilla para piso/con
escobilla de 10", boquilla de usos múltiples con
cepillo y herramienta para grieta
AV1000A
AV1000A Juego de aspiradora neumática Deluxe.
sIdeal para talleres de medios de vehículos y de carrocería o para
aplicaciones que recolectan polvo, virutas de metal y vidrios rotos
sIncluye un tubo de extensión de 8.7" de aluminio, boquilla en
punta, tubo flexible y herramienta para grietas con cepillo
sLa bolsa recolectora grande tiene una rejilla desviadora de desechos
y grampas deslizantes para bolsa para poder retirar los desechos
s%MPU×ADURADEDISE×OERGONØMICOLIVIANO
Especificaciones
Consumo de aire promedio, DFM (SCFM) [l/min]
Nivel de ruido, velocidad libre, dBa
Nivel de ruido, en operación, dBa
Tamaño de manguera recomendado, pulgadas
Longitud (sin bolsa), pulgadas (mm)
Tamaño de cabeza de cepillo, pulgadas (mm)
Tamaño de la bolsa, pulgadas (mm)
Peso, lb. (kg)
"LUE0OINT
AV1000A*
3 (21) [84.95]
81.2
81.2
3/8
13 (330)
1 1/8 x 2 5/8 (28.5 x 66.7)
6 1/2 x 11 1/4 (165 x 285)
0.88 (0.4)
Explorador portátil
YA1102
YA1102 Explorador portátil.
s5SEENALFOMBRASYTAPIZADOSDEASIENTOSYOTRAS
aplicaciones de limpieza
s4ANQUEMOLDEADODURADERO
s#APACIDADDEGALONES
s0OTENTEMOTORDEBOMBADESOLUCIØNDEPSI
s&UERTERECUPERACIØNCONUNVACÓODE#&s2ÉPIDADESCONEXIØNDELAMANGUERADESOLUCIØNALA
carrocería
s)NCLUYEMANGUERAYHERRAMIENTADEMANO
s5SECONSOLUCIØNLIMPIADORA#,%!.!ONZSEVENDE
por separado
s#ERTIFICACIØN5,Y#3!
s%NLISTADE%4,Y%4,C
s3UCCIØNDEAGUADE
s-OTORDE(0CONDERIVACIØN
Ventiladores de taller
WIND100 Circulador de aire p/servicio pesado.
s0ARAAPLICACIONESDECIRCULACIØNDEAIREDESERVICIO
pesado
s0ARASECARALFOMBRASTAPIZADOSOSUELOSDUROS
además de remover los vapores de espacios cerrados
s#ONUNMÉXIMODE#&s!JUSTEDEDESCARGADETRESPOSICIONES
s)NTERRUPTORDETRESVELOCIDADES
574
WIND100
Especificaciones
WIND100
120VCA / 60 Hz
Potencia
3
Velocidades
1,600 - 2,000 - 2,500 CFM
Suministro de aire
0°/30°/90°
Dirección del flujo del aire
10 3/4 de diám. x 10 1/2 de ancho
Tamaño del ventilador de alta potencia
0.5 Hp
Motor
Servicio continuo
Potencia del motor
15' (18/3)
Cable de CA
Tamaño, (LxAxP), pulgadas 18 de alto x 14 de ancho x 20 1/2 de prof.
www.snapon.com/shoptools
SUMINISTROS DE TALLER
Respaldos/protectores de brazos/rodilleras
Pieza
No.Soportes
para espalda
BACK1M
BACK1L
BACK1XL
BACK1XXL
BACK1SBK
BACK1MBK
BACK1LBK
BACK1XLBK
Tamaño
Color
Mediano:
31" a 36" de cintura
Grande:
35" a 40" de cintura
Extra grande:
39" a 44" de cintura
Extra, extra grande:
43" a 48" de cintura
Pequeño:
27" a 32" de cintura
Mediano
31" a 36" de cintura
Grande:
35" a 40" de cintura
Extra grande:
39" a 44" de cintura
Rojo
Rojo
Rojo
BACK1LBK
BACK1XL
Soportes para espalda
Rojo
s,ASALMOHADILLASDESOPORTECURVASYFIRMESAYUDANADISMINUIREL
CANSANCIODELAESPALDA
s%XCLUSIVODISE×OPATENTADODEALMOHADILLALUMBARPARASOSTENER
CONFIRMEZALAPARTEINFERIORDELAESPALDA
s.OREEMPLAZANELDISE×OCORRECTOPARAELLUGARNIELCORRECTO
ENTRENAMIENTOPARAREALIZARMOVIMIENTOSDELEVANTARTORCERYDOBLAR
Negro
Negro
Negro
Negro
Protectores de brazo/rodilleras
HS700A
HS700A Protector de brazos.
s0ROTEGEELBRAZODEQUEMADURASCUANDOSE
TRABAJACERCADEMOTORES
s0ARAUSARENBRAZOIZQUIERDOODERECHO
PROTEGELAMANOYELANTEBRAZO
s$OBLECAPADE+EVLAR®PARABRINDARMAYOR
PROTECCIØN
s,AVABLE
sMMDELARGOTOTAL
KNEEPAD2
KNEEPAD3
KNEEPAD2 Rodilleras.
s,ACAPADEPOLIPROPILENOLOPROTEGEDELOS
ESCOMBROSQUESEENCUENTRANENELSUELO
s,APROTECCIØNEXTERIORESTÉFIRMEMENTE
AGARRADAALAALMOHADILLAINTERIORDENILØN
PARAMAYORCOMODIDAD
s4IRASDE6ELCRO®EXTRAANCHASPARA
PONÏRSELASYQUITÉRSELASCONMAYOR
FACILIDAD
s,IVIANAS
KNEEPAD3 Rodilleras con
acolchado de gel.
s,AANCHASOLAPAINFERIORTRASERADE
NEOPRENOEVITARASPONES
s!COLCHONADODEGELPARAMAYORCOMODIDAD
s4IRASDEVELCROPARAPONÏRSELASY
QUITÉRSELASCONMAYORFACILIDADAJUSTE
SEGUROYCØMODO
s%XTENSIONESDEALMOHADILLASARTICULADAS
PARAUNAJUSTEMÉSCØMODO
Hjg_jYeYk\]k]jna[agEal[`]dd)®
EYfmYd]k\]k]jna[agEal[`]dd)
SKECAG10 Manual guía Mitchell1 de la aplicación de
control de emisiones.
!BARCAVEHÓCULOSDELOS%%55DEAYVEHÓCULOSIMPORTADOS
DEA
s)NFORMACIØNGENERAL
s#ØMOUSARLA'UÓA-ITCHELLDELAAPLICACIØNDECONTROLDE
EMISIONES
s0ROCEDIMIENTOSDEINSPECCIØNVISUALDE
CONTROLDEEMISIONES
s5BICACIONESDELCONECTORDEDIAGNØSTICO
s.ORMASDEEMISIONESESTATALES
s0ROCEDIMIENTOSDERECONFIGURACIØNDELINDICADOR
DEMANTENIMIENTO
s4ABLADECONVERSIØNDELACILINDRADADELMOTOR
s!BREVIACIONESDELCONTROLDEEMISIONES
s!PLICACIONESDECONTROLDEEMISIONES
SKECAG10
s0RUEBADEFUNCIØN%'2
s%SPECIFICACIONESBÉSICASDESINCRONIZACIØNDEENCENDIDO
s2EVOCACIØNDENORMAS%0!SOBREEMISIONES
s0ROCEDIMIENTOSPARADESACTIVARELCONTROLDETRACCIØN
s3ECCIØNDELCICLODECONDUCCIØN
ADVERTENCIA
SKTPMS09 Presión de
neumáticos Sistemas de
monitoreo Manual MITCHELL1.
s2EQUISITOSDEMANTENIMIENTODEL40s,ISTADEHERRAMIENTASESPECIALES
s!RTÓCULOSESPECÓFICOSDELMODELO
s.OCIØNGENERALDELSISTEMA40s0ROCEDIMIENTOSDERECONFIGURACIØNDEL
INDICADORDEADVERTENCIA
s0ROCEDIMIENTODERECAPACITACIØN
SKTPMS09
REAPRENDIZAJEDELSISTEMA
s.OTASYPRECAUCIONESSOBREELMONTAJEDESMONTAJE
s0ROCEDIMIENTOSDEREEMPLAZODELSENSORDEPRESIØNDE
NEUMÉTICOS
s4ORQUEDELASTUERCASDERUEDA
s4ORQUEDELASTUERCASDELSENSORDEPRESIØNDELNEUMÉTICO
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
575
SUMINISTROS DE TALLER
Lubricación
Lubricante sintéticoU
LUBE1 Lubricante sintético.
s%LAEROSOLFÉCILDEAPLICARPROLONGALAVIDAÞTIL
s&ORMULADOESPECIALMENTEPUTILIZARSEENCOJINETESYENOTROSDISPOSITIVOS
RODANTES
s#AJADELATASDEONZ
Lubricante antiadherente
ULUBE1
AS16
AS4
AS8
s#OMPUESTOANTIADHERENTEDECOBREYGRAFITODEPRIMERACALIDADDEUSO
GENERAL
s&ORMULADOPARAEVITARLAADHESIØNYELDESGARRAMIENTOAALTAS
TEMPERATURASRESISTENTEAº&
s,UBRICAYPROTEGECONTRALACORROSIØN
s&ACILITAELMONTAJEYDESMONTAJEDELASPARTESMETÉLICASYREDUCELA
FRICCIØNYELDESGASTE
AS4 Lubricante antiadherente."OTELLADEONZCONCEPILLO
APLICADORINCORPORADOALATAPA
AS8 Lubricante antiadherente."OTELLADEONZCONCEPILLO
APLICADORINCORPORADOALATAPA
AS16 Lubricante antiadherente. "OTELLADEONZCONCEPILLO
APLICADORINCORPORADOALATAPA
Productos para el cuidado del auto y de detalles
Limpiadores, lustradores y selladores
POLISH1CSA
POLISH1CSA Lustrador/sellador.
s,IMPIALUSTRAYSELLAENUNASOLAAPLICACIØN
RÉPIDAYSENCILLA
s%FICACIASUPERIORENACRÓLICOESMALTE
LACAURETANOTODOSLOSRECUBRIMIENTOS
TRANSPARENTESFIBRADEVIDRIOYPLÉSTICO
s1UITALATIERRALACONTAMINACIØNCON
CARBØNCONTAMINANTESYOXIDACIØNY
DEVUELVEALMATERIALLAPROFUNDIDADYEL
LUSTREORIGINALES
s.OCONTIENECERANISILICONASLIBRES
s#AJADEBOTELLASDEONZ
s5TILÓCELOCONLAALMOHADILLAPARADETALLES
0/,)3($#PARAOBTENERMEJORESRESULTADOS
POLISH2
POLISH2 Lustrador de metales.
s0UEDEAPLICARSEENALUMINIOCROMOACERO
INOXIDABLEBRONCECOBREPLATAYORO
s)NCLUYEUNAPLICADORSÓMILPA×O
s#AJADEUNIDADESDEONZ
CLEAN1A
CLEAN1A Solución limpiadora.
s!ROMAFRESCO
s3OLUCIØNPARALIMPIARNEUMÉTICOSRUEDAS
DEALUMINIOYALEACIØNALFOMBRASASIENTOS
YOTRASTELASINTERIORES
s2ECOMENDADAPARAQUITARMANCHAS
PRODUCIDASPORLOSRAYOS56ENUNIDADES
DE#!
s$ISE×ADAPARAAPLICARLASOLAOCONEL
EXTRACTORDESUCIEDADYMANCHAS9!
DE3NAPON®
s#AJADEBOTELLASCONROCIADORDEONZ
Pulido y cuidado de detalles
s3EUTILIZANENRECUBRIMIENTOSBÉSICOSYPINTURASCONACABADOTRANSPARENTEACRÓLICOESMALTELACAURETANOFIBRADEVIDRIOYPLÉSTICO
s%SPUMADEALTADENSIDADDEDEESPESORRESISTENTEYDURADERA
s,ASUPERFICIECØNCAVAMINIMIZALASSALPICADURASPARAGARANTIZARELUSOEFICIENTEDELMATERIAL
s,ASALMOHADILLASBALANCEADASPOSEENUNAPLACADERESPALDOPARAAPLICARELLUSTRADORENFORMAPAREJAYREDUCIRLAFATIGA
POLISHD8C
POLISHD8C Almohadilla
para detalles.
t!LMOHADILLADEPARAUSARCON
HERRAMIENTASNEUMÉTICASYELÏCTRICAS
s2OSCADE
s3EUTILIZACONELLUSTRADORSELLADOR
0/,)3(#3!
576
POLISHB8C
POLISHB8C Almohadilla p/
lustrado.
t!LMOHADILLADEPARAUSARCON
HERRAMIENTASNEUMÉTICASYELÏCTRICAS
s2OSCADE
www.snapon.com/shoptools
POLISHW8A
POLISHW8A Almohadilla de pulido
de lana (8").
s)DEALPARACORTARPULIRYELIMINARRAYONESE
IMPERFECCIONESDEPINTURA
s,APILADELANADEDURAMÉSQUELAS
ALMOHADILLASDELANAESTÉNDARES
s3EPUEDEUSARCONLASPULIDORAS!4"0
!4"0Y%4"!
SUMINISTROS DE TALLER
Productos para el cuidado del auto y de detalles
Bm]_gk\]dmkljY\gº:dm]%Hgafl®
BUFF3KIT1 Almohadilla de espuma.
tAlmohadillas de espuma onduladas azules de 3" de diámetro para aplicaciones de pulido fino
sALMOHADILLASENTUBODEALMACENAMIENTO%5'"
BUFF3KIT2 Almohadilla de lana de cordero.
tAlmohadillas de lana de cordero negras de 3" de diámetro para aplicaciones de pulido
ultrafino
sALMOHADILLASENTUBODEALMACENAMIENTO%5'"
BUFF3KIT3 Almohadilla de lana enrollada.
s!LMOHADILLASDELANADEENROLLADADEDEDIÉMETROPARAAPLICACIONESDELUSTRADOAGRESIVO
sALMOHADILLASENTUBODEALMACENAMIENTO%5'"
BUFF3KIT4 Almohadilla de fibra ondulada.
s!LMOHADILLASDEFIBRAONDULADASDEDEDIÉMETROPARAAPLICACIONESDELUSTRADOULTRAGRUESO
sALMOHADILLASENTUBODEALMACENAMIENTO%5'"
BUFF3KIT5 Sostén para almohadilla Shur-Grip (3" de diámetro).
s5SECONLASALMOHADILLASDELUSTRADOPULIDODELASERIE"5&&+)4
s%JEDE
sDEDIÉMETRO%5'"
WOD303CSA
BUFF3KIT Juego de lustrado en miniatura.
BUFF3KIT
s)DEALPARALUSTRADOYPULIDODEAUTOMØVILESBOTES
MOTOCICLETASYAVIONESENTREOTROS
sÂSELOSOBRETODASLASSUPERFICIESPINTADASMETALCROMOYMADERA
s!MPLIAVARIEDADDEALMOHADILLASDESDEULTRAFINASAMUYAGRESIVAS
s%LBORDEONDULADOLEPERMITEALUSUARIOLLEGARALUGARESREDUCIDOS
s3ISTEMADERETENSIØNDEGANCHOYOJALPARAUNACONEXIØNDELAALMOHADILLAMANGORÉPIDA
FÉCILYSEGURA
s%LJUEGOINCLUYEEJEDESOSTÏNDEALMOHADILLA3HUR'RIPDEDEDIÉMETROYUNA
DECADAUNADELASSIGUIENTESALMOHADILLASALMOHADILLADEESPUMAONDULADAAZULPULIDO
FINOALMOHADILLADELANADECORDERONEGRAPULIDOULTRAFINOALMOHADILLADELANAENROLLADA
LUSTRADOAGRESIVOYALMOHADILLADEFIBRAONDULADALUSTRADOULTRAGRUESO%5'"
DaehaY\gj]k\]eYfgk
WOD503CSA
WOD423CSA WOD623CSA
Limpiadores Yflakhla[gk\]eYfgk
Limpiadores de eYfgk\]ha]\jYhe]r
s$ISUELVEYELIMINACRAPIDEZLASUCIEDADYMANCHASPERSISTENTESMIENTRASQUE
SUSPROPIEDADESANTISÏPTICASPROTEGENLAPIEL
WOD303CSA Limpiador antiséptico de manos.
t&RESCOAROMAANARANJAS t#AJADELATASDELB
WOD503CSA Limpiador antiséptico de manos.
t#AJADELATASDELB
s,IMPIADORDEMANOSDEPIEDRAPØMEZEXTRAFUERTECON
INGREDIENTEANTISÏPTICO
WOD423CSA Limpiador de manos de piedra pómez.
s&RESCOAROMAANARANJAS
s#AJADELATASDELB
WOD623CSA Limpiador de manos de piedra pómez.
s#AJADELATASDELB
WOD1050CSA Limpiador de manos de piedra pómez.
s&RESCOAROMAANARANJAS
s#AJADEBOTELLASDEGAL
WOD2025ACSA
WOD2325CSA
WOD1050CSA
WOD2018ACSA
DaehaY\gj]k\]eYfgk`a\jgY[lanY\gk
s&ØRMULAABASEDESOJAHIDROACTIVADAYCONCENTRADACONFIBRILLASLIMPIADORAS
s#ONTIENEINGREDIENTEANTISÏPTICOYACONDICIONADORESPARAUNAMÉXIMAPROTECCIØN
de la piel
s%LLIMPIADORDEMANOSOFRECEELMEJORDESEMPE×OENLIMPIEZADELAPIELCON
FIBRILLASPIEDRAPØMEZQUEBRINDANUNADOBLEACCIØNDELIMPIEZA
WOD2025ACSA Limpiador de manos hidroactivado.
s#AJADEBOTELLASDEONZ s2EQUIEREELDOSIFICADORTIPOBOMBA7/$
WOD2325ACSA Limpiador de manos Redline.
s#AJADEBOTELLASDEONZ s2EQUIEREELDOSIFICADORTIPOBOMBA7/$(4
WOD2018ACSA Limpiador de manos hidroactivado.
s$ETAMA×OPORTÉTILESIDEALPARALACAJADEHERRAMIENTASELCARROOELHOGAR
s"OTELLACOMPRIMIBLECONBOQUILLAANTIGOTEO s#AJADEBOTELLASDEONZ
LgYddYk\]eYfghYjYlYdd]j
WOD5020 Toallas para limpiar manos y herramientas.
t%SCONVENIENTEUSARLASTOALLASPLIMPIARLASHERRAMIENTAS
OPARALIMPIARLAGRASAYELACEITEDELASMANOS
s,ASTOALLASCONTIENENLANOLINAYPROTECTORESCONTRALA
OXIDACIØN
sPORCAJA
WOD5020
ADVERTENCIA
WOD507
WOD1027
WOD1027HT
<gka^a[Y\gj]khYjYdaehaY\gj]k\]eYfgk
WOD507 Dosificador p/limpiadores de manos de servicio pesado.
s#ONVENIENTEPARAMONTARENLAPARED s,ATASDELBDELLIMPIADORDEMANOS
WOD1027 Dosificador p/limpiadores de manos estilo bomba.
s$OSIFICADORESTILOBOMBADEMONTAJEENPAREDPARALOSLIMPIADORESDEMANOS
7/$!#3!O7/$!#3!ENBOTELLASDEONZ
WOD1027HT Dosificador p/limpiadores de manos estilo bomba.
s$OSIFICADORESTILOBOMBADEMONTAJEENPAREDPARALOSLIMPIADORESDEMANOS
7/$!#3!O7/$!#3!ENBOTELLASDEONZ
;]haddghYjYmYk'eYfgk
WOD1000 Cepillo para uñas.
t3EUTILIZACONCUALQUIERLIMPIADORDE
MANOSDELASERIE7/$
Fgaf_]jajfamkYj]fdY[YjY
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
WOD1000
577
SUMINISTROS DE TALLER
Cepillos de alambre
WBBS2
WBSS2
WBSS3
WBSS5
WBSS8
Cepillos de alambre
s%MPU×ADURACONAGARREERGONØMICOACOLCHADODISE×ADOPARAMÉXIMA
COMODIDADYCONTROL
s5SELASDOSMANOSPARAMAXIMIZARLAPRESIØN
s%LCALIBREINOXIDABLEPESADOLEOTORGAALAUNIDADMÉXIMARESISTENCIAY
DURABILIDAD
s%LEGIRELANCHOYELLARGODELCEPILLOLEPERMITECUBRIRUNAAMPLIAGAMADEAPLICACIONES
!PLICACIONES
s)DEALPARALIMPIARROSCASTERMINALESDEBATERÓAYJUNTASOXIDADOS
s2EMUEVEELØXIDODELACARROCERÓAANTESDESOLDARDIFERENTESPARTESMETÉLICAS
s%LIMINALAMASILLAYELESMERILADODESOLDADURASQUEESTÉENTRELOSPANELES
WBSS9
WBSS14
WBSS5CAL
Pieza No.
WBBS2
WBSS2
WBSS3
WBSS5
WBSS8
WBSS14
WBSET
WBSS5CAL
WBMSSET
WBSS2BKT
WBBS2BKT
Descripción
Cepillo miniatura de alambre de latón de 2 pulgadas
Cepillo de alambre de acero inoxidable de 3 pulgadas
Cepillo de alambre de acero inoxidable de 5 pulgadas
Cepillo de alambre de acero inoxidable de 7 3/4 pulgadas
Cepillo de alambre de acero inoxidable de 8 3/4 pulgadas
Cepillo de alambre de acero inoxidable de 6 3/4 pulgadas
Incluye (2) cepillos miniaturas de alambre de latón WBBS2 y (1) cepillo miniatura de alambre
de acero inoxidable WBSS2
Cepillo de alambre de acero inoxidable de 11 pulgadas.
Incluye (1) cepillo de alambre de acero inoxidable WBSS8, (1) cepillo de alambre de acero inoxidable WBSS9,
(1) cepillo de alambre de acero inoxidable WBSS14 y (1) juego de cepillo de alambre WBSSET
Incluye (25) cepillos de alambres de acero inoxidable WBSS2
Incluye (25) cepillos de alambre de latón WBBS2
WBSS2BKT
AC58D
WBBS2BKT
AC5B
Cepillos especiales–Blue-Point®
AC64A
AC5B Cepillo p/rayas manual.#ERDASDEACEROINOXIDABLEPUSARENMATERIALESCORROSIVOSDELARGO
AC58D Cepillo de alambre.6ERSIØNMÉSGRANDEDE!#"DELARGO
AC64A Cepillo p/ rayas c/ empuñadura de herradura.#ERDASDEACERODECARBONOXDELARGO
Pistolas de pegamento
Juegos inalámbricos de pistolas de pegamento–Blue-Point
GLUEGUN3
GLUEGUN4KT
Características del producto
GLUEGUN3
175 Watts
Rango de potencia
3 horas
Tiempo de operación
3.5 lb./hr.
Velocidad de derretimiento
Presión sobre el gatillo (pulgadas) Mira de 1/8 - 16 de largo
STD 1/2 - 12 mm
Diámetro de la varilla (pulgadas)
383 ºF/195 ºC
Gama de temperatura
4 minutos
Tiempo calentamiento
Piezo-autoencendido
Fuente de ignición
Sí
Fusible térmico
Sí
Visor de gas
Se pueden usar
Sí
boquillas opcionales
578
GLUEGUN4KT
125 Watts
2 horas
1.6 lb./hr.
Mira de 1/8 - 8 de largo
STD 1/2 - 12 mm
383 ºF/195 ºC
3 minutos
Piezo-autoencendido
Sí
Sí
No
GLUEGUN3 Pistola de pegamento inalámbrica compacta.
s6ELOCIDADESDEDERRETIMIENTODEHASTALBHRCONUNTIEMPODE
CALENTAMIENTODEMINUTOS
s%LTANQUEDECOMBUSTIBLEESDEACEROINOXIDABLEYCONTIENECOMBUSTIBLEPARA
HORASDEUSO
s3ERECARGAENSEGUNDOS
s0UERTODEESCAPEDECOMBUSTIBLEREFRIGERADOYCÉMARADECALORVENTILADA
s!GARREYGATILLODEØPTIMODESEMPE×OPARAUNCONTROLPRECISODELFLUJO
s%LTANQUEDECOMBUSTIBLEESTÉPROBADOABARIASCONVÉLVULADELIBERACIØN
DEBARIAS
s3EINCLUYESOPORTEPARAPISTOLA
GLUEGUN4KT Juego de pistola de pegamento inalámbrica compacta.
)NCLUYEPISTOLADEPEGAMENTOINALÉMBRICACONAUTOENCENDIDORECARGABLECON
BUTANOBARRASDEPEGAMENTODEUSOGENERALYSOPORTEDEALAMBREABISAGRADO
Pieza No.
GLUEGUN2KT1
GLUEGUN2KT2
GLUEGUN2KT3
GLUEGUN2GS8
GLUEGUN2KT9
www.snapon.com/shoptools
Descripción
Boquilla con orificio diagonal, 11/4" (30 mm) para GLUEGUN3
Boquilla con orificio tipo aguja, 11/4" (30 mm) para GLUEGUN3
Boquilla con orificio plano, 11/4" (30 mm) para GLUEGUN3
Barras de pegamento para usos generales. paquete/8.
Soporte para pistola para GLUEGUN3.
SUMINISTROS DE TALLER
Accesorios y discos para esmerilar
9[[]kgjaghYjYj][la^a[Y\gjYkº:dm]%Hgafl®
WD12 Rectificador de ruedas para esmerilar.
s%SMERILAYRECTIFICALASUPERFICIEDELARUEDA
s3EPUEDENINSERTARCORTADORESNUEVOSFÉCILMENTE
s,ACUBIERTAPROTEGEELCORTADOR
Rectificador de ruedas para esmerilar WD13.
s!YUDAAALINEARLASRUEDASESMERILADORAS
s$ISCOSDEACEROENDURECIDOSYSERRADOS
s2UEDASDEDELARGOYDEDEDIÉMETRO
WD13
WD12
Jm]\Yk\]YdYeZj]
Jm]\Yk\]YdYeZj]hd]_Y\g
s,ASCERDASPLEGADASAYUDANAEVITARQUESEDOBLENOROMPANYSEENCUENTRANANCLADASSINSOLDADURASOPLIEGUESENLASBRIDAS
s4AMA×OALAMBRE
AC48ADAPT3/4
s!DAPTAEL!#!ALEJEDE
AC48ADAPT1
s!DAPTAEL!#!ALEJEDE
AC48ADAPT3/4
AC48A
AC48ADAPT1
AC26E
Hd]_Y\g\]k]jna[agh]kY\g YdYeZj]fgl]ehdY\g!
Pieza No.
AC26E
AC28E
Diámetro
cepillo,
pulgadas
6
8
Ancho,
pulgadas
29/32
1 1/8
Eje
Orificio,
pulgadas
5/8, 3/4, 1
5/8, 3/4, 1
Velocidad libre segura
máxima, RPM
6,000
4,500
Los alambres miden 1 1/4" de largo, torneados alrededor de 2/3 de
su longitud.
Pieza No.
AC614B
ADVERTENCIA
AC48A
Diámetro
cepillo,
pulgadas
8
Ancho,
pulgadas
1
Eje
Orificio,
pulgadas
5/8
Velocidad libre
segura máxima, RPM
4,500
=f[YhkmdY\g
9dYeZj]lgjf]Y\g
Ancho de Tamaño de
rueda,
alambre,
pulgadas pulgadas
1/2
.016
Pieza No.
AC207A
AC614B
Diám. de
la rueda,
pulgadas
6
Af\mkljaYdhd]_Y\g YdYeZj]l]ehdY\g\]YdlY\]fka\Y\!
Eje
Orificio,
pulgadas
1/2, 5/8
Velocidad libre
segura máxima,
RPM
9,000
s,ASPUNTASDELOSALAMBRESINDIVIDUALESESTÉNENCAPSULADASENUN
MATERIALDEELASTØMEROSINTÏTICOQUEGRADUALMENTESEDESGASTA
CUANDOSEEXPONENÞNICAMENTELASPUNTASDELOSALAMBRESP
UNAACCIØNDECEPILLADOUNIFORMEMENTERESISTENTE
s)DEALPCARROCERÓASDEAUTOSYAPLICACIONESDESUPERFICIE
Pieza No.
AC207A
AC217A
Ruedas
Diám.,
pulgadas
2
3
Ruedas
Ancho,
pulgadas
1/4
1/4
Fgmk]jm]\Yk\]YdYeZj]khgj]f[aeY\]dYkJHEe~paeYk
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
Alambre
Eje
Máxima
Tamaño,
Orifico, Velocidad libre
pulgadas pulgadas segura, RPM
3/8, 1/2
.014
18,000
3/8, 1/2
.014
18,000
579
EQUIPO DE SEGURIDAD
Guantes
Guantes
SuperCuff®
para
técnicos
GLOVE500BXL
Color
Negro
Negro
Negro
GLOVE500BXL
Negro
GLOVE500BXXL
GLOVE500RL
Guantes
de impacto
SuperCuff
GLOVE501BXL
Pieza No.
GLOVE500BS
GLOVE500BM
GLOVE500BL
Negro
GLOVE500RS
GLOVE500RM
GLOVE500RL
Rojo
Rojo
Rojo
GLOVE500RXL
Rojo
GLOVE500RXXL
Rojo
GLOVE501BS
GLOVE501BM
GLOVE501BL
Negro
Negro
Negro
GLOVE501BXL
Negro
GLOVE501BXXL
Negro
GLOVE501RS
GLOVE501RM
GLOVE501RL
Rojo
Rojo
Rojo
GLOVE501RXL
Rojo
GLOVE501RXXL
Rojo
Tamaño
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
GLOVE501RL
s%LDISE×O3UPER#UFFPERMITEQUELAMU×ECASEMUEVALIBREMENTE
s$OBLECAPAPARAMANOSPARAMAYORPROTECCIØNYCONTROL
s,APALMADEUNAPIEZAPROTEGELASMANOSDECORTESYQUEMADURAS
Guantes de impacto SuperCuff (Guantes de la serie 501)
s%LDISE×O3UPER#UFFPERMITEQUELAMU×ECASEMUEVALIBREMENTE
s$OBLECAPAPARAMANOSPARAMAYORPROTECCIØNYCONTROL
s,OSPANELESDEGOMATÏRMICAEVITANLOSCORTESYRASPADURAS
s%LAPOYODEHERRAMIENTASINCORPORADOPROPORCIONAAPOYOADICIONAL
CONLASHERRAMIENTASNEUMÉTICAS
s%LACOLCHONADODEGELENLAPALMAREDUCEELIMPACTO
Guantes de impacto M-Pact (Guantes de la serie 301)
s,OSGUANTESDEIMPACTODELASERIE-0ACTESTÉNDISE×ADOSPARA
BRINDARMAYORPROTECCIØN
s0ROTECCIØNPARAPALMASANTIVIBRACIØNYDEDOSREFORZADOS
s,APARTESUPERIORMOLDEADACON402GOMAPLÉSTICATÏRMICA
PROTEGEDECORTESRASPADURASYQUEMADURAS
580
GLOVE301RM
Pieza No.
GLOVE301RS
GLOVE301RM
GLOVE301RL
Color
Rojo
Rojo
Rojo
GLOVE301RXL
Rojo
GLOVE301RXX
Rojo
Guantes
GLOVE502BS
para servicio GLOVE502BM
pesado
GLOVE502BL
SuperCuff
GLOVE502BXL
Negro
Negro
Negro
Negro
GLOVE502BXXL
Negro
GLOVE502RS
GLOVE502RM
GLOVE502RL
GLOVE502RXL
Rojo
Rojo
Rojo
Rojo
GLOVE502RXXL
Rojo
GLOVE302RS
GLOVE302RM
GLOVE302RL
GLOVE302RXL
Rojo
Rojo
Rojo
GLOVE502BXL
GLOVE502RL
Guantes
de impacto
(Serie
M-PactII)
Rojo
GLOVE302RXXL
Rojo
Tamaño
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
Pequeño
Mediano
Grande
Extra
grande
Extra,
extra
grande
GLOVE302RM
Guantes para técnicos SuperCuff (Guantes de la serie 500)
GLOVE100L
Guantes
de impacto
(Serie
M-Pact®)
Guantes de servicio pesado SuperCuff (Guantes de
la serie 502)
s%LDISE×O3UPER#UFFPERMITEQUELAMU×ECASEMUEVALIBREMENTE
s$OBLECAPAPARAMANOSPARAMAYORPROTECCIØNYCONTROL
s,OSPANELESDEGOMATÏRMICAEVITANLOSCORTESYRASPADURAS
s%LAPOYODEHERRAMIENTASINCORPORADOPROPORCIONAAPOYOADICIONAL
CONLASHERRAMIENTASNEUMÉTICAS
s%LACOLCHONADODEGELENLAPALMAREDUCEELIMPACTO
s'OMAEVADEMM
s0ROTECCIØNPARALOSNUDILLOSESTILOACORDEØN
Guantes de impacto M-Pact II (Guantes de la serie 302)
s,OSGUANTESDEIMPACTODELASERIE-0ACT))OFRECENMAYOR
PROTECCIØNYDURABILIDAD
s,APARTESUPERIORMOLDEADACON402GOMAPLÉSTICATÏRMICA
PROTEGEDECORTESRASPADURASYQUEMADURAS
s0ALMAMÉSACOLCHADAPARAMAYORCOMODIDAD
Guantes de trabajo de cuero
sin forro
Guantes de trabajo de cuero
forrados
s5SEPARAREALIZARTRABAJOSDESERVICIO
PESADOYUSOPROLONGADO
s#ONPULGARDECALCECØMODOPARA
MAYORAGILIDADYFLEXIBILIDAD
s,OGO3NAPON®ENRELIEVEENELDORSO
GLOVE100M 4AMA×OMEDIANO
GLOVE100L 4AMA×OGRANDE
GLOVE100XL 4AMA×OEXTRAGRANDE
s0ARATRABAJOSDESERVICIOPESADOYUSO
PROLONGADO
s&ORRADOSPARABRINDARPROTECCIØN
YCALOR
s,OGO3NAPONGRABADOENRELIEVEEN
ELDORSO
GLOVE101L 4AMA×OGRANDE
GLOVE101XL 4AMA×OEXTRAGRANDE
GLOVE101L
www.snapon.com/shoptools
EQUIPO DE SEGURIDAD
Guantespara técnicos
GLOVE6L
GLOVE400L
Guantes de nitrilo resistentes a los abrasivos–
Blue-Point®
s#ONCUBIERTADENITRILOPARABRINDARPROTECCIØNENTRABAJOSSUCIOS
s$ISE×OERGONØMICOPREREDONDEADOPARAMAYORCOMODIDAD
s,AALTARESISTENCIAALAABRASIØNPROTEGELASMANOSDELOSBORDESFILOSOS
s%XCELENTEAGARREYAGILIDADENSUPERFICIESHÞMEDASYSECAS
s#LASIFICADOSEGÞNLASNORMAS#%DERESISTENCIAALAABRASIØNA
HOJASAFILADASYALDESGASTEYALAPERFORACIØN
GLOVE400S 0AQUETEDE0EQUE×O
GLOVE400M 0AQUETEDE-EDIANO
GLOVE400L 0AQUETEDE'RANDE
GLOVE400XL 0AQUETEDE%XTRAGRANDE
GLOVE400XXL 0AQUETEDE%XTRAEXTRAGRANDE
Pieza No.
Guantes de
GLOVE8M
nitrilo negro para GLOVE8L
técnicos
GLOVE8XL
Guantes de nitrilo GLOVE5M
para técnicos
GLOVE5L
GLOVE5XL
Guantes de nitrilo GLOVE7M
para servicio
GLOVE7L
pesado para
GLOVE7XL
técnicos
Guantes de látex
GLOVE1M
para técnicos (Con GLOVE1L
poco polvo)
GLOVE1XL
Guantes de látex
GLOVE3MB
para técnicos (sin GLOVE3LB
polvo)
GLOVE3XLB
Guantes de látex
GLOVE6M
para servicio
GLOVE6L
pesado para
GLOVE6XL
técnicos
GLOVE1M
Color
Caja de 100
Caja de 100
Caja de 100
Caja de 100
Caja de 100
Caja de 100
Caja de 50
Caja de 50
Caja de 50
Caja de 100
Caja de 100
Caja de 100
Caja de 100
Caja de 100
Caja de 100
Caja de 50
Caja de 50
Caja de 50
Tamaño
Mediano
Grande
Extra grande
Mediano
Grande
Extra grande
Mediano
Grande
Extra grande
Mediano
Grande
Extra grande
Mediano
Grande
Extra grande
Mediano
Grande
Extra grande
Nitrilo negro (Guantes de las serie 8)
GLOVE103MA
GLOVE103MAB
Guantes de trabajo lavables–Blue-Point
s4EJIDOELÉSTICOYDORSOACOLCHONADOPARABRINDARMAYOR
SENSIBILIDADYFLEXIBILIDAD
s-AYORPROTECCIØNDENUDILLOS
s0ALMADECUEROSINTÏTICODEDOBLECAPARESISTENTEALCALOR
GLOVE103MA .EGRO4AMA×OMEDIANOPAR
GLOVE103LA .EGRO4AMA×OGRANDEPAR
GLOVE103XLA .EGRO4AMA×OEXTRAGRANDEPAR
GLOVE103MAB !ZUL4AMA×OMEDIANOPAR
GLOVE103LAB !ZUL4AMA×OGRANDEPAR
GLOVE103XLAB !ZUL4AMA×OEXTRAGRANDEPAR
GLOVE3LB
GLOVE8M
GLOVE5M
GLOVE7L
s3INPOLVOYEXCELENTERESISTENCIAALDESGASTE
s5SEPARAREALIZARREPARACIONESMECÉNICASROCIADODEPINTURAYRENOVACIONES
s2ESISTEPRODUCTOSQUÓMICOSPARADETALLESDELAUTOMØVIL
Nitrilo (Guantes de la serie 5)
s'UANTESRESISTENTESALOSCORTESYLAABRASIØNPROTEGENDE
SALPICADURASCONPRODUCTOSQUÓMICOS
s2ESISTENCIATRESVECESSUPERIORALADELOSGUANTESDELÉTEXNATURAL
ODEVINILO
s'RACIASALPOCOPOLVOQUETIENESEPUEDENQUITARCONUNMÓNIMORESIDUO
s-ICROTEXTURADOPARAUNMEJORAGARRE
Nitrilo de servicio pesado (Guantes de la serie 7)
s5SARPARAMEZCLADEPINTURASLIMPIEZADEPIEZASYRECONSTITUCIØNDE
TRANSMISIONESENTREOTRAS
s2ESISTENCIAALAPERFORACIØNSUPERIORALADELOSGUANTESDELÉTEX
NATURALOVINILO
s2ESISTENTEACORTESYABRASIØNYPROTEGECONTRASALPICADURASCON
PRODUCTOSQUÓMICOS
s&ABRICADOSENNITRILOCONUNESPESORDEMIL
s-ANGAEXTRALARGAPARAMAYORPROTECCIØN
s3INPOLVO4EXTURADOSPARAUNMEJORAGARRE
Látex (con poco polvo) (Guante de la serie 1)
Dispensador de guantes
GLOVEHOLDERA Guante de látex GLOVEHOLDERA
Torre dispensadora.
s4IENEGUANTESDELASERIE',/6%',/6%',/6%',/6%
',/6%Y',/6%
s&ABRICADACONMETALPARAEVITARDA×OS
s,ABASEMAGNÏTICAPERMITEADHERIRLATORREAUNAUNIDADDE
ALMACENAMIENTODEHERRAMIENTASUOTRASUPERFICIEFERROSA
s4REShRESORTESASEGURANLACAJAENELSOPORTE
s/RIFICIOSPARAMONTAJEENSUPERFICIESNOFERROSAS
sXX
s.EGRO
s,OSGUANTESHIPOALERGÏNICOSDISMINUYENLASREACCIONESALÏRGICAS
s0ROTEGENLASMANOSCONTRAPINTURAGRASAYQUÓMICOSFUERTES
s0OCOPOLVO$ESCARTABLESMILDEESPESOR
Látex (Sin polvo) (Guantes de la serie 3)
s'UANTESHIPOALERGÏNICOSQUEDISMINUYENLASREACCIONESALÏRGICAS
s0ROTEGENLASMANOSCONTRAPINTURAGRASAYQUÓMICOSFUERTES
sMILDEESPESOR
Látex para servicio pesado (Guantes de la serie 6)
s'UANTESMMDEESPESORPARASERVICIOPESADO
s$EDOSYPALMATEXTURADOSPARAMEJORAGARRE
s#ONPOCOPOLVOPARAPONÏRSELOSYQUITÉRSELOSFÉCILMENTE
s2ESISTENTESALAMAYORÓADELOSPRODUCTOSQUÓMICOSCOMERCIALES
s0U×OLARGO
ADVERTENCIA Lea las precauciones de seguridad en las páginas 594 a 597
581
EQUIPO DE SEGURIDAD
Protección auditiva y facial
Protección
para oídos
Especificaciones
Nivel de reducción de
ruido, dB
Banda de cabeza
Auricular
Auriculares ajustables
Auricular
Reemplazos
Peso, lb.
*Blue-Point®
GA3000A*
GA3200*
YA160A
YA1160
25
28
25
27
BLPEP1
21
Acolchonada
Acolchonado
Acolchonada
Acolchonado
Plástica
Espuma
Plástica
Espuma
Plástica
Espuma
s
s
YA160A1
YA11601
BLPEP1-1
.49
.77
.06
.06
.05
Protección facial
Especificaciones
GA224B
GA225*
Estilo de la visera
Plana
Plana
protectora
Tamaño de la
8" x 12" x 0.04" 7 3/4" x 15 1/4"
visera protectora
Banda de cabeza
s
s
Ajustable
s
s
Banda de cabeza
Impacto
s
s
Resistencia
Visera protectora
incluida
Viseras
protectoras de
reemplazo
Transparente
GA224B1
(transparente)
GA224B1G
(verde oscuro)
EFPKILLA
EFPBONEHED
EFPSTRIKER
EFPCODERED
EFPNITESTLKR
180º Periférica
180º Periférica
180º Periférica
180º Periférica
180º Periférica
180º Periférica
35 1/2 pulg. cuad,
en área de visión
35 1/2 pulg. cuad,
en área de visión
35 1/2 pulg. cuad,
en área de visión
35 1/2 pulg. cuad,
en área de visión
35 1/2 pulg. cuad,
en área de visión
35 1/2 pulg. cuad,
en área de visión
s
s
s
s
s
s
s
s
s
s
s
s
s
s
s
Transparente
Transparente y
soldadura No. 10
Transparente y
soldadura No. 10
Transparente y
soldadura No. 10
GA225-1
(con PETG)
GA225-2
(con PC)
EFPCLLENSREP
(transparente)
EFP10WLDLENS
(soldadura No. 10)
EFP3WLDLENS
(soldadura No. 3)
EFP5WLDLENS
(soldadura No. 5)
EFP8WLDLENS
(soldadura No. 8)
EFP12WLDLENS
(soldadura No. 12)
EFPCLLENSREP
(transparente)
EFP10WLDLENS
(soldadura No. 10)
EFP3WLDLENS
(soldadura No.3)
EFP5WLDLENS
(soldadura No. 5)
EFP8WLDLENS
(soldadura No. 8)
EFP12WLDLENS
(soldadura No. 12)
EFPCLLENSREP
(transparente)
EFP10WLDLENS
(soldadura No. 10)
EFP3WLDLENS
(soldadura No.3)
EFP5WLDLENS
(soldadura No. 5)
EFP8WLDLENS
(soldadura No. 8)
EFP12WLDLENS
(soldadura No. 12)
EFPHANNIBAL
s
s
s
Transparente,
soldadura No. 10
y soldadura con
oscurecimiento
automático
EFPCLLENSREP
(transparente)
EFP10WLDLENS
(soldadura No. 10)
EFP3WLDLENS
(soldadura No.3)
EFP5WLDLENS
(soldadura No.5)
EFP8WLDLENS
(soldadura No. 8)
EFP12WLDLENS
(soldadura No. 12)
Transparente,
soldadura No. 10
y soldadura con
oscurecimiento
automático
EFPCLLENSREP
(transparente)
EFP10WLDLENS
(soldadura No. 10)
EFP3WLDLENS
(soldadura No. 3)
EFP5WLDLENS
(soldadura No. 5)
EFP8WLDLENS
(soldadura No. 8)
EFP12WLDLENS
(soldadura No. 12)
Transparente,
soldadura No. 10
y soldadura con
oscurecimiento
automático
EFPCLLENSREP
(transparente)
FP10WLDLENS
(soldadura No. 10)
EFP3WLDLENS
(soldadura No.3)
EFP5WLDLENS
(soldadura No.5)
EFP8WLDLENS
(soldadura No. 8)
EFP12WLDLENS
(soldadura No. 12)
*Blue-Point
Protección de ojos
Anteojos de seguridad / Anteojos de la serie 1, 4, 5, 6
Especificaciones
Lentes
Armazón
Recubrimiento de
lente anti niebla
Lentes que no se rayan
Ajuste del largo de
patilla
Ajuste de inclinación
Diseño
Lentes de reemplazo
disponibles
Cumple con los
requisitos
Información adicional
582
GLASS1R
Transparente
Rojo
GLASS1BK
Transparente
Negro
GLASS4A
Transparente XTR
Negro (nilón)
GLASS5A
Expresso XTR
Negro (nilón)
GLASS6A
Espejadas XTR
Negro (nilón)
GLASS6AAM
Ámbar XTR
Negro (nilón)
s
s
s
s
s
s
s
s
s
s
3 posiciones
3 posiciones
3 posiciones
3 posiciones
Contemporáneo y
liviano
Contemporáneo y
liviano
Lentes con seis bases
curvas e inclinadas
hacia atrás
Lentes con seis bases
curvas e inclinadas
hacia atrás
Lentes con seis bases
curvas e inclinadas
hacia atrás
Lentes con seis bases
curvas e inclinadas
hacia atrás
s
s
s
ANSI Z87.1, CSA
Z94.3-1992, EN166
ANSI Z87.1, CSA
Z94.3-1992, EN166
ANSI Z87.1
ANSI Z87.1
ANSI Z87.1
ANSI Z87.1
—
Mayor visión
periférica y protección
Mayor visión periférica
y protección
Mayor visión periférica
y protección
Mayor visión periférica
y protección
—
www.snapon.com/shoptools
EQUIPO DE SEGURIDAD
Protección de ojos
Anteojos de seguridad/Vidrio serie 9, 10, 11, 12, 13
Especificaciones
Lentes
Armazón
Recubrimiento de lente
anti niebla
Lentes que no se rayan
Ajuste de las pastillas
Diseño
GLASS9BK
Transparente
Negro
GLASS10BK
Marrón
Negro
GLASS11BK
Espejado
Negro
GLASS12BKA
Transparente
Patillas negras
GLASS13CPA
Marrón
Patillas negras
s
s
s
s
s
s
s
Contemporáneo,
deportivo envolvente
Contemporáneo,
deportivo envolvente
Contemporáneo,
deportivo envolvente
5 posiciones
Sin armazón, elegante,
contemporáneo
5 posiciones
Sin armazón, elegante,
contemporáneo
s
s
s
ANSI Z87.1
ANSI Z87.1
ANSI Z87.1
ANSI Z87.1
ANSI Z87.1
Lentes de reemplazo
disponibles
Cumple con los
requisitos
Anteojos de seguridad/Vidrio de la serie 20
Especificaciones
GLASS20BK
GLASS20R
GLASS20BKY
GLASS20RM
GLASS20BLM
Lentes
Transparente
Transparente
Ámbar
Espejada
Espejada
Negro
Rojo
Negro
Rojo
Azul
GLASS20BKW
Verde oscuro
(color No. 5)
Negro
—
—
—
—
—
GLASS20LENSW
—
Con el logo
Snap-on en blanco
en las patillas
Con el logo
Snap-on en blanco
en las patillas
Con el logo
Snap-on en blanco
en las patillas
Con el logo
Snap-on en blanco
en las patillas
Con el logo
Snap-on en blanco
en las patillas
Con el logo
Snap-on en blanco
en las patillas
Con el logo
Snap-on en blanco
en las patillas
Armazón
Lentes de reemplazo
disponibles
Información adicional
GLASS20BL
Transparente
Azul
#UMPLECONLASNORMAS!.3):#3!:Y-),34$
Anteojos de seguridad/Vidrio de la serie 30 y 31
Especificaciones
Lentes
Armazón
Recubrimiento anti niebla
Recubrimiento anti rayaduras
Canal de ventilación
GLASS30R
GLASS30BK
GLASS31R
GLASS31BK
Transparente
Transparente
Transparente
Transparente
Rojo
Negro
Rojo
Negro
s
s
s
s
s
s
s
s
s
s
#UMPLECON!.3):
GLASSVIS
Anteojos de protección
GLASSVIS Protectores oculares.
tSe pueden usar solos o sobre anteojos recetados
s,ATERALESENVOLVENTESRESISTENTEALOSIMPACTOSGUARDAANTIRREFLEJO
s,ENTETRANSPARENTESINCOBERTURACONARMAZØNNEGRA
s#UMPLECONLASNORMAS!.3):#3!:Y-),34$
GLASSIBOTG
GLASSIBOTG Protectores oculares.
t,ALENTEPANORÉMICAÞNICABRINDAMAYORVISIBILIDAD
s2ECUBRIMIENTOPROTECTORDELASLENTESANTINIEBLARESISTENTEALAS
RAYADURASESTÉTICAYLOSRAYOS56
s,ASARMAZONESSEAJUSTANTANTOHORIZONTALCOMOVERTICALMENTEP
MAYORCOMODIDAD
s0ROTECCIØNLATERALCONTRAIMPACTOS
s0UENTENASALUNIVERSAL
s,OGODE3NAPON®ENLAPATILLA
s3UPERALASESPECIFICACIONES!.3)
ADVERTENCIA Lea las precauciones de seguridad en las páginas 594 a 597
583
EQUIPO DE SEGURIDAD
Protección de ojos
GOGGLE1
GAC1575B
GAC1125
GAC1150A
GOGGLE2ATOR
9fl]gbgk\]k]_mja\Y\
GAC1575B Anteojos resistentes a los impactos/polvo.
s,ENTESPLÉSTICASDEACUERDOCONLOSREQUERIMIENTOSDERESISTENCIAY
AGUDEZADELA!MERICAN.ATIONAL3AFETY3TANDARDSY/3(!
s!RMAZØNPLÉSTICASUAVEYVENTILADAQUESEAJUSTAALAFORMA
s#UMPLEOSUPERALASNORMAS!.3):
GOGGLE1 Anteojos de protección.
s!RMAZØNMOLDEADODURABLECONUNAPIEZAELÉSTICAFLEXIBLEQUESE
SELLAPARAUNCALCEPERFECTO
s,ABANDATRASERASEAJUSTARÉPIDAYFÉCILMENTEALREDEDORDELACABEZA
s%LSISTEMADEVENTILACIØNINDIRECTODIRIGEELFLUJODEAIRESOBRE
LASLENTESPARAMINIMIZARLANIEBLAYMEJORARLAVISIØNPOTENCIAL
ALMISMOTIEMPOQUEOFRECEUNAPROTECCIØNSUPERIORCONTRA
SALPICADURASEIMPACTOS
s,ENTES5VEX#©RECUBIERTASQUEBRINDANPROTECCIØNCONTRALA
NIEBLARAYADURASYRAYOSULTRAVIOLETAS
s#UMPLECONLASESPECIFICACIONES!.3)
GOGGLE2ATOR Anteojos de seguridad.
s!RMAZØNMOLDEADODURABLECONUNAPIEZAELÉSTICAFLEXIBLEQUESE
SELLAPARAUNCALCEPERFECTO
s,ABANDATRASERASEAJUSTARÉPIDAYFÉCILMENTEALREDEDORDELACABEZA
s%LSISTEMADEVENTILACIØNINDIRECTODIRIGEELFLUJODEAIRESOBRE
LASLENTESPARAMINIMIZARLANIEBLAYMEJORARLAVISIØNPOTENCIAL
ALMISMOTIEMPOQUEOFRECEUNAPROTECCIØNSUPERIORCONTRA
SALPICADURASEIMPACTOS
s,ENTES5VEX#©RECUBIERTASQUEBRINDANPROTECCIØNCONTRALA
NIEBLARAYADURASYRAYOSULTRAVIOLETAS
s#UMPLECONLASESPECIFICACIONES!.3)
GAC1175A
9fl]gbgk\]k]_mja\Y\]kladg[a[daklY
s6ENTILACIØNLATERALAJUSTABLEPARAMAYORFLUJODEAIRE
s,IVIANOSYPRÉCTICOSCONCABEZAARTICULADAANCHAQUEPERMITEUNA
COLOCACIØNØPTIMA
s#OPASOCULARESACOLCHONADASPARAMAYORCOMODIDADLENTE
ANTINIEBLAESTÉNDAR
s3EPLIEGAFÉCILMENTEPARAUNALMACENAMIENTOCOMPACTO
s#UMPLECONLASNORMAS!.3):
GAC1125 Anteojos de seguridad. ,ENTEANTINIEBLAÉMBAR
GAC1150A Anteojos de seguridad. ,ENTESANTINIEBLAAHUMADA
GAC1175A Anteojos de seguridad. ,ENTESANTINIEBLATRANSPARENTES
GAC1100C Anteojos de seguridad.,ENTESTONALIZADASCOLOR
VERDEPARATRABAJOSCONANTORCHASDEACETILENO
YA127C9
YA127C9 Juego de prefiltro/filtro.
s)NCLUYECUBIERTADEPLÉSTICOPREFILTRO9!
.YCARTUCHODEVAPORORGÉNICO9!
YA127C
J]khajY\gj]kq^adljgk
YA127C Respirador de media máscara.
s)NCLUYECARTUCHOSDEVAPORORGÉNICOY
PREFILTRO.
s!PROBADOPOREL.)/3(YCUMPLECON
LASNORMASDELA/3(!QUERIGEN
LOSRESPIRADORESPARAPARTÓCULASSEGÞNLA
NORMA#&2
s!MPLIASUPERFICIEDESELLADOYUN
AVANZADODISE×ODEABRAZADERAPARAUN
EXCELENTECALCEANTIDESLIZANTE
s!YUDAAPROTEGERDEVAPORESORGÉNICOS
POLVOSYHUMOSCUANDOSEUSACONELPRE
FILTRO9!.YELCARTUCHODEVAPOR
ORGÉNICO9!
s.OEXCEDALASCONCENTRACIONESMÉXIMASDE
USOESTABLECIDASPORLASNORMASESTÉNDAR
584
GAC1100C
YA199
YA199 Respirador de máscara
completa.
s)NCLUYECARTUCHOSDEVAPORORGÉNICOY
PREFILTROS.
s"RINDAUNCALCECØMODOCONCOPADENARIZ
ESTÉNDARCONTRAEMPA×AMIENTOYEXCELENTES
LENTESPANORÉMICASQUENOSERAYAN
s!YUDAAPROTEGERDEVAPORESORGÉNICOSPOLVOS
YHUMOSCUANDOSEUSACONELPREFILTRO9!
.YELCARTUCHODEVAPORORGÉNICO9!
s.OEXCEDALASCONCENTRACIONESMÉXIMASDE
USOESTABLECIDASPORLASNORMASESTÉNDAR
YA1991
YA1992
YA1991 N95 Prefiltro.
s.IVELDEEFICACIADELFILTRODEL
s0ROTECCIØNEFICAZCONTRAAEROSOLESDE
PARTÓCULASLIBRESDEACEITE
s3EINCLUYENPARES
s.OEXCEDALASCONCENTRACIONESMÉXIMASDE
USOESTABLECIDASPORLASNORMASESTÉNDAR
ADVERTENCIA
YA1992 Cartucho para vapores
orgánicos.
s0ROTEGECONTRAVAPORESORGÉNICOS
s3EINCLUYEPAR
s.OEXCEDALASCONCENTRACIONESMÉXIMASDE
USOESTABLECIDASPORLASNORMASESTÉNDAR
s.OUTILICECONISOCIANATOS
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
ARMADO DE JUEGOS
Juegos que crecen con usted.
Cómo funciona el programa
Sus necesidades cambian con el tiempo. Así que,
independientemente de que se esté preparando para su
primer día de trabajo, su nuevo ascenso o si finalmente decidió
deshacerse de su viejo y querido juego y obtener uno nuevo,
Snap-on® cuenta con soluciones de armado de juego para
adaptarse a cada una de sus necesidades. Desde nuestro juego
de aprendiz, cada juego de herramientas amplía los demás, lo
que le permite aumentar de manera gradual su colección de
herramientas junto con sus habilidades y responsabilidades.
O bien, puede hacerlo todo de una vez. Los veteranos del taller
comprobarán que nuestros juegos son los más completos de la
industria, ya que le ofrecen una solución integral llave en mano
para lograr mayor productividad.
Si está comenzando a armar un juego, comience con nuestro
juego de aprendiz 9100GSBO. Incluye una selección equilibrada
de herramientas con cuadro cuadrado de 1/4", 3/8" y 1/2", llaves,
destornilladores, pinzas, punzones y cinceles, un juego básico para
una rutina de mantenimiento. Además, hemos hecho hincapié
en brindarle todas las herramientas métricas que necesita, ya
que se están convirtiendo en las herramientas estándar en el
área de servicio. Conforme aumentan sus necesidades, agregue
el segundo grupo de herramientas: 9000GS2: brinda más de
100 herramientas adicionales estándar y especiales para realizar
trabajos más avanzados. A medida que aumenta cada grupo
nuevo de herramientas, puede ampliar su almacenamiento para
mantener la organización y la productividad. A través de este
método de expansión constante y planificada puede continuar
armando su inventario de herramientas hasta que haya logrado
la máxima selección de combinación de herramientas de mano y
unidades de almacenamiento.
Para obtener mayor información, comuníquese con su
franquicia de Snap-on.
9600GSBO Juego 6 completo en pulg.
Más de 1,000 piezas, incluidas una caja de herramientas
KRL791A y un armario rodante KRL722.
585
ARMADO DEL JUEGO
Juegos en pulgadas
9100GSO Juego de aprendiz
Pieza No.
114ATMP
206EAU
211FSY
211SFSY
317MSPC
91ACP
AW1015DK
BP16B
CSA8C
ECF201A
F80
GA295
GAC1580.
HBPT16
HS18A
OEX709B
PL300CF
PPC710BK
PRH57A
PT5C
PWC6
SHDX80O
TPMA12
9100GSO
Juego de aprendiz en pulgadas
9100GSBO Juego completo de aprendiz.
s)NCLUYECAJASUPERIOR'3/Y+2!!
9100GSO Juego de aprendiz.
s-ÉSDEPIEZASPARAUNASELECCIØNBIEN
EQUILIBRADA
s3ØLOHERRAMIENTAS
9100GSM Juego de aprendiz más métrico.
s*UEGO'3MÉSJUEGODELLAVESHEXAGONALES
MÏTRICAS!7-$+PZASJUEGODEDADOS
MÏTRICODEPTAS&-9PZASYJUEGO
DELLAVESDECOMBINACIØNMÏTRICASDEPUNTAS
/%8-"PZAS
s.OSEINCLUYELACAJASUPERIOR
Descripción
Juego de servicio general con cuadro de 1/4", 6 ptas. (14 pzas.)
Juego de adaptador/extensión con cuadro de 3⁄8" (6 pzas.)
Juego de dados con cuadro de 3/8", 6 ptas. (11 pzas.)
Juego de dados profundos con cuadro de 3/8", 6 ptas. (11 pzas.)
Juego de servicio general con cuadro de 1/2", 6 ptas. (17 pzas.)
Pinzas de unión ajustable de 9 1/4"
Juego de llaves hexagonales (10 pzas.) (7/250" a 3⁄8")
Martillo de bola, 16 onz.
Rasqueta de carbón
Linterna con LED de 3 Watt, (2) pilas D
Trinquete de cabeza sellado con cuadro de 3/8"
Espejo redondo (diámetro de 2 1/4")
Anteojos
Martillo con cabeza de plástico
Segueta deluxe (para hojas de 12")
Juego de llaves de combinación, 12 ptas., (9 pzas.)
Juego de pinzas de punta fina/de alicates diagonales, 3 pzas.
Juego de punzón y cincel, 11 pzas.
Pinzas de anillos de retención
Herramienta de enganche magnética
Pelador/alicate de alambre de 6"
Juego de destornilladores de combinación (8 pzas.)
Cinta de medición, en pulgadas (12')
Página
82
75
25
26
88
153
118
175
181
496
8
534
584
174
176
98
153
170
156
535
155
129
533
KRA2055A
9000GS2 Grupo para agregar
Pieza No.
110STMY
112TMMY
2004BSKA
212EFTXY
212FSMY
212SFSMY
97CCP
1650
AC5B
AWM110DHK
CT4G
FADH12A
FB303B
FB316B
FB325A
FB361A
FLF80
FXK11
GSAF1E
LP10WR
OEX30B
OEX32B
OEXM710B
PK53
RXFS605B
9000GS2
Juego 2 en pulgadas
9200GSB Juego 2 completo en pulgadas.
s)NCLUYE'3/'3MÉSCAJASUPERIOR
+2!!
9200AGSO Juego 2 completo en pulgadas.
s-ÉSDEPIEZAS)NCLUYETODASLASHERRAMIENTAS
DE'3/Y'3
s.OSEINCLUYELAUNIDADDEALMACENAMIENTODE
HERRAMIENTAS
9000GS2 Grupo 2 para agregar.
s-ÉSDEPIEZASPIEZASENELJUEGOPARAAGREGARAL
JUEGODEAPRENDIZ'3/
s3ØLOHERRAMIENTAS
586
KRA4059A
S9704KR
S9706KRA
SGA173BR
SGASA204A0
SGDMRC44B
SGT4BR
TMXK60
Descripción
Juego de dados profundos con cuadro de 1/4", 6 ptas. (10 pzas.)
Juego de dados poco profundos métricos con cuadro de 1/4", 6 ptas.
(12 pzas.)
Juego de servicio de batería, (4 pzas.)
Juego de cuadro de 1⁄4" y 3⁄8” Torx® (12 pzas.)
Juego de dados poco profundos métricos con cuadro de 3⁄8", 6 puntas
(12 pzas)
Juego de dados profundos métricos con cuadro de 3/8", 6 ptas. (12 pzas.)
Pinzas de punta fina de 8"
Barra de palanca de 16"
Cepillo para rayas manual
Juego de llave hexagonal métrica en forma de "L"
Comprobador de circuito
Llave ajustable, empuñadura acolchonada de 12"
Calibrador de separación de alambre
Calibrador de encendido/bujía (18 hojas)
Calibrador métrico/en pulg. (25 hojas)
Calibrador de separación
Trinquete sellado con cabeza larga flexible con cuadro de 3/8"
Extensión con cuadro de 3/8”, 11”
Adaptador de cuadro cuadrado
Pinzas de traba de 10"
Mordaza Llave de combinación de largo estándar de 15⁄16"
Llave de combinación, 12 puntas de 1"
Juego de llaves de combinación métricas (10 pzas.)
Espátulas / rasquetas
Juego de llaves para tuercas abocardadas de extremo doble con cuadro
de 3⁄8", (5 pzas.)
Dado de retención para bujía con cuadro de 3/8", de 6 puntas de 13/16"
Dado de retención de bujías de 6 puntas de 5/8"
Pico de manguera del radiador
Juego de puntas en miniatura, 4 pzas.
Destornilladores de trinquete de agarre blando
Mango de vástago estándar con cuadro de 1⁄4"
Extensión con cuadro de 1/4”, 6”
www.snapon.com/handtools
Página
19
18
435
52
25
126
152
149
578
118
409
120
532
531
531
532
8
67
77
161
98
98
97
182
110
187
187
451
145
136
74
65
ARMADO DEL JUEGO
Juegos en pulgadas
9000GS3O Grupo para agregar
Pieza No.
112STMMY
207EFAMY
208EFAY
309SIMYA
310IMMYA
310SIMMYA
311IMYA
313TWMYA
AC58D
GA3000A
IP80D
JCK7D
JT13A
MG725
OEXM6B
OEXM7B
OEXM8B
OEXM9B
QD3R250
RXFMS606B
S8
SL80
SPBS240
SXK3
TF72
TMXK140
Descripción
Juego de dados profundos métricos con cuadro de 1/4", 6 ptas. (12 pzas.)
Juego de mangos hexagonales métricos con cuadro de 3/8" (7 pzas.)
Juego de mangos hexagonales con cuadro de 3/8" (8 pzas.)
Juego de dado de impacto profundos con cuadro de 1⁄2" de 6 puntas
Juego de dados de impacto poco profundos métricos con cuadro de 1⁄2", 6 puntas
Juego de dado de impacto profundo métrico con cuadro de 1⁄2" de 6 puntas
Juego de dados de impacto poco profundo con cuadro de 1⁄2", 6 puntas
Juego de dados métrico con cuadro de 1/2", 6 ptas. (13 pzas.)
Cepillo de alambre
Protectores auditivos
Junta universal de impacto con cuadro 1/2"
Cubierta de guardabarros
Pistola de chorro
Llave de impacto con cuadro de 1/2"
Llave de combinación corta métrica, 12 ptas. de 6 mm
Llave de combinación corta métrica, 12 ptas. de 7 mm
Llave de combinación corta métrica, 12 ptas. de 8 mm
Llave de combinación corta métrica, 12 ptas. de 9 mm
Llave de torque de 50-250 pies lb. con cuadro de 1⁄2"
Juego de llaves métricas para tuercas abocardadas de extremo doble (6 pzas.)
Junta universal con cuadro de 1/2"
Trinquete sellado con empuñadura larga con cuadro de 1/2"
Palanca con empuñadura de 24", anaranjada
Extensión con cuadro de 1/2", 3 1/2"
Trinquete de cabeza sellado con cuadro de 1/4"
Extensión con cuadro de 1⁄4”, 14”
Página
19
55
57
41
40
41
40
36
578
582
78
525
298
265
99
99
99
99
231
110
77
10
147
69
7
65
9000GS4O Grupo para agregar
Pieza No.
1250
206AFSA
206FSUMA
207SFRH
210FRHMA
313TSYA
388CF
61ACP
AWP160
BP24B
CJ2001P
CSA12CO
E1020
FADH8A
FL80
FX24A
FXK4
FXK8
HBBD32
HBFE32
JCW60R
LP7WR
OEX080B
OEX10B
OEX34B
OEX36B
OEX40B
OEXM200B
OEXM210B
OEXM220B
OEXS709B
OEXSM710B
PPB1012A
PPC104A
PPC108A
PPC204A
PPC208A
PPC3A
PPC5A
SGCP1BR
SGHBF500A
SHDX40O
SN24C
SPBS18O
SRPC105
SSM5A
SX2
TA3
TD2425
TDM117B
TF528D
TM61A
TMX1
TMXK110
UTK100
Descripción
Barra de palanca de 12"
Dado universal poco profundo con cuadro de 3/8", 12 ptas. (6 pzas.)
Juego de dado poco profundo métrico universal con cuadro de 3/8", 6 ptas. (6 pzas.)
Juego de llaves de pie métrico con cuadro de 3/8" (7 pzas.)
Juego de llaves de pie métrico con cuadro de 3/8" (10 pzas.)
Juego de dados profundos c/ cuadro de 1⁄2", 6 puntas (13 pzas.)
Alicates de gran palanca
Pinzas de pico de pato
Pinzas de lengua y ranura de unión ajustable
Martillo de bola, 24 onz.
Juego para agarre de pernos
Rasqueta para carbón, anaranjada
Juego de extractor, 20 pzas.
Llave ajustable, empuñadura acolchonada de 8"
Trinquete sellado con empuñadura larga con cuadro de 3/8"
Extensión con cuadro de 3/8”, 24”
Extensión con cuadro de 3/8”, 4”
Extensión con cuadro de 3/8”, 8”
Martillo de bola de golpe seco, 32 onz.
Martillo de golpe seco, 32 onz.
Camilla, roja
Pinzas de traba de 7"
Llave de combinación corta, 12 ptas. de 1/4"
Llave de combinación, 12 ptas. de 5/16"
Llave de combinación, 12 ptas. de 1 1/16"
Llave de combinación, 12 ptas. de 1 1/8"
Llave de combinación, 12 ptas. de 1 1/4"
Llave de combinación métrica, 12 ptas. de 20 mm
Llave de combinación métrica, 12 ptas. de 21 mm
Llave de combinación métrica, 12 ptas. de 22 mm
Juego de llaves de combinación cortas, 12 ptas., ( 9 pzas.)
Juego de llaves de combinación cortas métricas, 12 ptas., (10 pzas.)
Punzón ahusado de bronce, 3/8"
Punzón de pasador, 1/8"
Punzón de pasador, 1/4"
Punzón para colocación, 1/8"
Punzón para colocación, 1/4"
Punzón para centros, 1/8"
Organizador de punzones y cinceles
Extractor de pasadores de aletas
Juego de limas con empuñaduras (4 pzas.)
Juego de mini destornilladores de combinación, anaranjados
Mango articulado con cuadro de 1/2", 24"
Barra de palanca con empuñadura de 18", anaranjada
Juego de pinzas de anillos de retención (5 pzas.)
Localizador de tornillos de punta plana
Extensión con cuadro de 1/2”, 2”
Adaptador de 1/4" a 3/8"
Juego de machos y terrajas (41 pzas.)
Juego de machos y terrajas métricas (41 pzas.)
Juego para cortado y abocardado doble de tubería
Extensión flexible con cuadro de 1/4”, 6”
Extensión con cuadro de 1/4", 1 1/4"
Extensión estriada con cuadro de 1/4”, 11”
Navaja de uso múltiple
ADVERTENCIA
149
34
34
111
111
37
151
152
160
175
205
181
195
120
8
67
67
67
173
314
526
161
99
98
98
98
98
97
97
98
99
99
171
170
170
170
170
170
170
451
183
129
16
147
155
139
69
73
192
192
184
66
65
65
180
9000GS3O
Juego 3 en pulgadas
9300GSBO Juego 3 completo en
pulgadas.
s)NCLUYE!'3/'3/MÉSCAJASUPERIOR
+2!!Y+2!%ARMARIORODANTE
9300GSO Juego 3 completo en
pulgadas.
s-ÉSDEPIEZAS)NCLUYETODASLAS
HERRAMIENTASDE!'3/Y'3/
s.OSEINCLUYELAUNIDADDEALMACENAMIENTO
DEHERRAMIENTAS
9000GS3O Grupo 3 para agregar.
s-ÉSDEPIEZASPIEZASENELJUEGOPARA
AGREGARALJUEGOENPULGADAS!'3/
s3ØLOHERRAMIENTAS
KRA4059A
KRA4008E
9000GS4O
Juego 4 en pulgadas
9400GSBO Juego 4 completo en
pulgadas.
s3EINCLUYE'3/'3/MÉSCAJA
SUPERIOR+2,0"/YARMARIORODANTE
+2,"0"/
9400GSO Juego 4 completo en
pulgadas.
s-ÉSDEPIEZASINCLUYETODASLAS
HERRAMIENTASDE'3/Y'3
s.OSEINCLUYELAUNIDADDEALMACENAMIENTO
DEHERRAMIENTAS
9000GS4O Grupo 4 para agregar.
s-ÉSDEPIEZASPIEZASENELJUEGOPARA
AGREGARALJUEGOENPULGADAS'3/
s3ØLOHERRAMIENTAS
Lea las precauciones de seguridad en las páginas 594 a 597
KRL751PBO
KRL756BPBO
587
ARMADO DEL JUEGO
Juegos en pulgadas
KRL751PBO
KRL756BPBO
Juego 5 en pulgadas
9000GS50
9500GSBO Juego 5 completo en pulgadas.
s)NCLUYE'3/'3/MÉSCAJASUPERIOR+2,0"/
YARMARIORODANTE+2,"0"/
9500GSO Juego 5 completo en pulgadas.
s-ÉSDEPIEZASINCLUYETODASLASHERRAMIENTASDE
'3/Y'3
s.OSEINCLUYELAUNIDADDEALMACENAMIENTODEHERRAMIENTAS
9000GS5O Grupo 5 para agregar.
s-ÉSDEPIEZASDELJUEGOPARAAGREGARALJUEGOEN
PULGADAS3'/
s(ERRAMIENTASSOLAMENTE
9000GS5O Grupo para agregar
Pieza No.
196CF
212IMFYA
212SIMFYA
214IMFMYA
214SIMFMYA
313TSMYA
497CCP
650
AWP160
BP8B
C2201A
CJ2002
F12LA
FADH10A
FAR7200
FBF80
FK80
HBBT24
IMM200
IMM210
IMM220
IMM230
IMM240
IPF800B
MG325
OEX11B
OEX260B
OEX280B
OEX300B
OEX320B
OEX38B
OEX42B
OEX8B
OEXM230B
OEXM240B
OEXM90B
OXI10B
OXI12B
588
Descripción
Página Pieza No.
Pinzas de punta fina con alicate lateral, 7 1/8"
152
OXI706B
Juego de dados de impacto poco profundos con cuadro de 3/8", 6 ptas. (12 pzas.) 31
OXI8B
Juego de dados profundos de impacto con cuadro de 3/8", 6 ptas. (12 pzas.)
32
OXIM710B
Juego de dados de impacto poco profundos con cuadro de 3/8", 6 ptas. (14 pzas.) 31
OXIM7B
Juego de dados profundos de impacto con cuadro de 3/8", 6 ptas. (14 pzas.)
32
OXIM8B
Juego de dados profundos métricos con cuadro de 1/2", 6 ptas. (13 pzas.)
37
OXIM9B
Pinzas de punta fina (mordaza en ángulo de 90°) de 6 5⁄8"
152
PPC110A
Barra de palanca de 6"
149
PPC112
Pinzas de lengua y ranura de unión ajustable
154
PPC210A
Martillo de bola, 8 onz.
175
PPC824B
Bolsa de juego
—
PPC828B
Juego de extractor para engranajes tipo barra
204
PT28E
Mango articulado con cuadro de 3/8"
16
PWC14
Llave ajustable, empuñadura acolchonada de 10"
120
QD2R100
Trinquete neumático para servicio superpesado con cuadro de 3/8"
269
RTD48
Trinquete sellado con cabeza flexible curva con cuadro de 3/8"
8
S9704KFUA
Trinquete sellado con cabeza flexible corta con cuadro de 3/8"
8
S9706KRFUA
Martillo c/cabeza de bronce, 24 onz.
174
SDM400A
Dado de impacto poco profundo métrico con cuadro de 1⁄2", 6 puntas, 20 mm
40
SF80
Dado de impacto poco profundo métrico con cuadro de 1⁄2", 6 puntas, 21 mm
40
SHDP162O
Dado de impacto poco profundo métrico con cuadro de 1⁄2", 6 puntas, 22 mm
40
SHDP62IR0
Dado de impacto poco profundo métrico con cuadro de 1⁄2", 6 puntas, 23 mm
40
SHDP63IR0
Dado de impacto poco profundo métrico con cuadro de 1⁄2", 6 puntas, 24 mm
40
SIMM200
Junta universal de impacto con cuadro 3/8"
77
SIMM210
Llave de impacto neumática con cuadro de 3/8"
267
SIMM220
Llave de combinación, 12 ptas. de 11/32"
98
SIMM230
Llave de combinación corta, 12 ptas. de 13/16"
99
SIMM240
Llave de combinación corta, 12 ptas. de 7/8"
99
SPBS120
Llave de combinación corta, 12 ptas. de 15/16"
99
SSDE42C
Llave de combinación corta, 12 ptas. de 1"
99
SSDE43C
Llave de combinación, 12 ptas. de 1 3/16"
98
SSDE44C
Llave de combinación, 12 ptas. de 1 5/16"
98
SSDE46C
Llave de combinación, 12 ptas. de 1/4"
98
SSDE48C
Llave de combinación estándar métrica, 12 ptas. de 23 mm
97
SSDMR1AO
Llave de combinación estándar métrica, 12 ptas. de 24 mm
97
TC123C
Llave de combinación estándar métrica, 12 ptas. de 9 mm
97
VS807B
Llave de combinación en miniatura, 12 ptas. de 5/16"
100
XB605A
Llave de combinación en miniatura, 12 ptas. de 3/8"
100
XBM605A
Descripción
Juego de llaves de combinación en miniatura métricas, 12 ptas. (6 pzas.)
Llave de combinación en miniatura, 12 ptas. de 1/4"
Juego de llaves de combinación en miniatura, métrica, 12 ptas. (10 pzas.)
Llave de combinación métrica en miniatura, 12 ptas. de 7 mm
Llave de combinación métrica en miniatura, 12 ptas. de 8 mm
Llave de combinación métrica en miniatura, 12 ptas. de 9 mm
Punzón de pasador, 5/16"
Punzón de pasador, 3/8"
Punzón para colocación, 5/16"
Cincel plano, 3/4"
Cincel plano, 7/8"
Herramienta de enganche
Pelador/Alicate/Plegador para alambre/Alicate para pernos de 8 3⁄4"
Llave de torque tipo clic ajustable de 20-100 pies lb. con cuadro de 3⁄8"
Juego de rectificación (48 pzas.)
Dado universal para bujías con cuadro de 3/8", 13/16"
Dado universal para bujía con cuadro de 3/8", de 6 puntas de 5/8"
Juego de brocas para destornilladores (37 pzas.)
Trinquete de cabeza sellado con cuadro de 1/2"
Destornillador de punta Phillips®, No.2, anaranjado, de 16"
Destornillador de punta Phillips®, No.2, anaranjado, de 6"
Destornillador de punta Phillips®, No.3, anaranjado, de 6"
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 20 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 21 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 22 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 23 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 24 mm
Palanca con empuñadura de 12", anaranjada
Destornillador electrónico de hoja fina y plana
Destornillador electrónico de hoja fina y plana
Destornillador electrónico de hoja fina y plana
Destornillador electrónico de hoja fina y plana
Destornillador electrónico de hoja fina y plana
Destornillador magnético de trinquete, anaranjado
Cortador de tubos
Juego de llaves de extremo abierto (7 pzas.)
Juego de llaves de ojo compensadas en pulgadas, 12 ptas. (5 pzas.)
Juego de llaves con extremo de ojo métrico, 12 ptas. (5 pzas.)
www.snapon.com/handtools
Página
100
100
100
100
100
100
170
170
170
170
170
535
155
231
189
187
187
141
10
131
131
131
41
41
41
41
41
147
132
132
132
132
132
137
184
108
102
102
ARMADO DEL JUEGO
Juegos en pulgadas
KRL722BPBO
KRL791APBO
Juego 6 en pulgadas
9600GSBO Juego 6 completo en pulgadas.
s)NCLUYE'3/'3/MÉSCAJASUPERIOR+2,!0"/
ARMARIORODANTE+2,"0"/YARMARIODEPARED+2!$
9600GSO Juego 6 completo en pulgadas.
s-ÉSDEPIEZAS)NCLUYETODASLASHERRAMIENTASDE'3/
Y'3/
s.OSEINCLUYELAUNIDADDEALMACENAMIENTODEHERRAMIENTAS
9000GS6O Grupo 6 para agregar.
s-ÉSDEPIEZASDELJUEGOPARAAGREGARALJUEGOENPULGADAS'3/
s(ERRAMIENTASSOLAMENTE
9000GS6O
9000GS6O Grupo para agregar
Pieza No.
106ATMXWP
106TMUSA
10SSD
110ETMAY
120SSDP
2050
205IPF
206AFXWP
20SSD
307IPLY
AWP45
AWP65
BP12B
CHN480
CJ2003A
CJ2004
CJ2005
CM6551
DBTR129
E703BCG
E704BCG
E710BCG
FADH6A
FAR25A
FS12B
FSUM11A
FSUM16A
FSUM18A
FSUM19A
FX18
FX36
HBF100
HBFE48
IMTM10A
IMTM12A
IMTM14A
IMTM16A
IMTM18A
IMTM8A
IMTMM10
IMTMM11
IMTMM12
IMTMM13
IMTMM14
Descripción
Juego de extensiones movibles con cuadro de 1/4" (6 pzas.)
Juego de dados universales con cuadro de 1/4", 6 ptas. (6 pzas.)
Destornillador compensado de punta plana
Juego de mangos hexagonales con cuadro de 1/4" (10 pzas.)
Destornillador compensado Phillips®, No. 1 y 2
Barra de palanca de 20"
Juego de dados de impacto giratorios con cuadro de 3⁄8", 6 ptas. (5 pzas.)
Juego de extensiones movibles con cuadro de 3/8" (6 pzas.)
Destornillador compensado de punta plana
Juego de dados giratorios de impacto en pulgada con cuadro de 1⁄2", 6
puntas (5 pzas.)
Pinzas de lengua y ranura de unión ajustable de 4 3⁄4"
Pinzas de lengua y ranura de unión ajustable, 7"
Martillo de bola, 12 onz.
Pinzas de unión ajustable de 20"
Juego de extractor de eje trasero
Juego de extractores intercambiables
Juego de accesorios para extractores
Juego de destornilladores en miniatura (5 pzas.)
Juego de brocas para taladro de 29 brocas
Pinzas electrónicas de punta fina
Pinzas Pinzas de punta fina, punta torcida a 60º, no serradas
Alicates electrónicos con cabeza ahusada, corte True Flush
Llave ajustable, empuñadura acolchonada de 6"
Trinquete neumático con cuadro de 1/4"
Dado universal poco profundo, de 6 puntas, con cuadro de 3⁄8", 3⁄8"
Dado universal poco profundo con cuadro de 3/8", 6 ptas. 11 mm
Dado universal poco profundo con cuadro de 3/8", 6 ptas. 16 mm
Dado universal poco profundo con cuadro de 3/8", 6 ptas. 18 mm
Dado universal poco profundo con cuadro de 3/8", 6 ptas. 19 mm
Extensión con cuadro de 3/8”, 18”
Extensión con cuadro de 3/8”, 36”
Juego de limas mixto (6 pzas.)
Martillo de golpe seco, 48 onz.
Dado de impacto poco profundo con cuadro de 1/4", 6 ptas., de 5/16"
Dado de impacto poco profundo con cuadro de 1/4", 6 ptas., de 3/8"
Dado de impacto poco profundo con cuadro de 1/4", 6 ptas., de 7/16"
Dado de impacto poco profundo con cuadro de 1/4", 6 ptas., de 1/2"
Dado de impacto poco profundo con cuadro de 1/4", 6 ptas., de 9/16"
Dado de impacto poco profundo con cuadro de 1/4", 6 ptas., de 1/4"
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 10 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 11 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 12 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 13 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 14 mm
ADVERTENCIA
66
23
135
57
135
149
35
68
135
Pieza No.
IMTMM15
IMTMM5
IMTMM5.5
IMTMM6
IMTMM7
IMTMM8
IMTMM9
LP5WR
LP6LN
Descripción
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 15 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 5 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 5.5 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 6 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 7 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 8 mm
Dado de impacto métrico con cuadro de 1/4", 6 ptas. de 9 mm
Pinzas de traba, mordaza curva con alicate de 5"
Pinzas de punta larga de traba de 6"
Página
21
21
21
21
21
21
21
161
161
44
NDD1070A
Juego de mangos para tuercas en pulgadas, 6 ptas. (7 pzas.)
140
160
160
175
160
204
204
204
135
286
158
158
157
120
269
34
34
34
34
34
67
67
183
173
22
22
22
22
22
22
21
21
21
21
21
OEX44B
OEX46B
OEX48B
PDR3000A
PPR708BK
R810C
RB604C
RXS605B
SHDTX315O
SHDTX320O
SPBS80
SSDMR8AO
SX15
TD9902B
TS381
TS401
TS421
TW381
TW401
TW421
TW441
TW461
TW481
TWM25
TWM26
TWM27
TWM30
TWM32
VE200A
VS26B
VS28B
VS30B
VS32B
XO605A
Llave de combinación, 12 ptas. de 1 3/8"
Llave de combinación, 12 ptas. de 1 7/16"
Llave de combinación, 12 ptas. de 1 1/2"
Taladro neumático de 3/8"
Juego de punzón de pasador (8 pzas.)
Llave de ojo de trinquete en pulgadas, 12 ptas., 1⁄4"-5⁄16"
Juego de llaves de ojo de trinquete en pulgadas, 12 ptas. (4 pzas.)
Juego de llaves de extremo abierto/para tuercas abocardada, 6 ptas. (5 pzas.)
Destornillador T15 Torx®, anaranjado
Destornillador T20 Torx, anaranjado
Palanca con empuñadura de 8", anaranjada
Destornillador magnético de trinquete, anaranjado
Extensión con cuadro de 1/2”, 15”
Juego de machos y terrajas (25 pzas.)
Dado profundo con cuadro de 1/2", 6 ptas., 1 3/16"
Dado profundo con cuadro de 1/2", 6 ptas., 1 1/4"
Dado profundo con cuadro de 1/2", 6 ptas., 1 5/16"
Dado con cuadro de 1/2", 6 ptas., 1 3/16"
Dado con cuadro de 1/2", 6 ptas., 1 1/4"
Dado con cuadro de 1/2", 6 ptas., 1 5/16"
Dado con cuadro de 1/2", 6 ptas., 1 3/8"
Dado con cuadro de 1/2", 6 ptas., 1 7/16"
Dado con cuadro de 1/2", 6 ptas., 1 1/2"
Dado métrico con cuadro de 1/2", 6 ptas. de 25 mm
Dado métrico con cuadro de 1/2", 6 ptas. de 26 mm
Dado métrico con cuadro de 1/2", 6 ptas. de 27 mm
Dado métrico con cuadro de 1/2", 6 ptas. de 30 mm
Dado métrico con cuadro de 1/2", 6 ptas. de 32 mm
Tablero de control de herramientas
Llave de extremo abierto, 13/16”
Llave de extremo abierto, 7/8”
Llave de extremo abierto, 15/16”
Llave de extremo abierto, 1”
Juego de llaves de ojo compensadas en pulgadas, 12 ptas. (5 pzas.)
98
98
98
271
171
104
104
109
135
135
147
137
69
37
37
37
37
36
36
36
36
36
36
36
36
36
36
36
204
108
108
108
108
103
Lea las precauciones de seguridad en las páginas 594 a 597
589
ARMADO DEL JUEGO
Juegos métricos
Juegos métricos A
9100GMBO Juego A métrico completo.
s-ÉSDEPIEZASINCLUYE!'-/MÉSCAJASUPERIOR
+2!!
9100AGMO Juego A básico métrico.
s3ØLOHERRAMIENTAS
9100AGMO
KRA4059A
9100AGMO Juego A básico métrico
Pieza No.
112STMMY
117TMM
2004BSKA
206EAU
212EFTXY
212FSMY
212SFSMY
317AMMPC
91ACP
97CCP
1650
AC5B
AWM110DHK
BP16B
CSA8C
CT4G
ECF201A
F80
FADH12A
FB316B
FB360C
FB361A
FBM320
FLF80
FXK11
GA295
GSAF1E
HBPT16
HS18A
LP10WR
OEXM710B
PK53A
PL300CF
PPC710ABK
PRH57A
PT5C
PWC6
RXFMS606B
S9704KR
S9706KRA
SGA173BR
SGASA204AO
SGT4BR
SHDX80O
SSDMR4BO
TMXK60
TPMAM5
590
Descripción
Juego de dados profundos métrico con cuadro de 1/4", 6 puntas (12 piezas.)
Juego de inicio métrico con cuadro de 1/4" (17 piezas.)
Juego de servicio de batería, (4 piezas.)
Juego de adaptador con cuadro de 3⁄8" (6 piezas.)
Juego de mangos con cuadro de 3⁄8" y 1⁄4" TORX®, (12 piezas)
Juego de dados métrico con cuadro de 3/8", 6 puntas (12 piezas.)
Juego de dados profundos métricos con cuadro de 3/8", 6 puntas (12 piezas.)
Juego de servicio general métrico con cuadro de 1/2", 6 puntas (17 piezas.)
Pinzas de unión ajustable
Pinzas de punta fina
Barra de palanca de 16" de largo
Cepillo de alambre
Juego de llaves hexagonales métricas (11 piezas)
Martillo de bola, 16 onz.
Rasqueta de carbón
Comprobador de circuito
Linterna con LED de 3 watt
Trinquete sellado con cuadro de 3/8"
Llave ajustable, empuñadura acolchonada de 12"
Juego de calibrador de encendido y bujías (18 hojas)
Juego de calibradores de espesores (6 hojas)
Calibrador de separación
Juego de calibradores de espesores métrico (20 hojas)
Trinquete sellado con cabeza larga flexible con cuadro de 3/8"
Extensión con cuadro de 3/8” y 8", 11” de largo
Espejada
Adaptador de cuadro cuadrado
Martillo c/cabeza de plástico, 16 onz.
Segueta
Pinzas de traba de 10" de largo
Juego de llaves de combinación métricas, 12 puntas, ( 10 piezas)
Rasqueta
Juego de pinzas de punta fina/de alicates diagonales (3 piezas)
Juego de punzón y cincel (11 piezas)
Pinzas de anillos de retención, convertibles
Herramienta de enganche telescópica
Pinzas peladoras/alicates p/alambre
Juego de llaves abocardadas métricas, 6 puntas (6 piezas)
Dado de retención para bujía con cuadro de 3/8", de 6 puntas de 13/16"
Dado de retención para bujía con cuadro de 3/8", de 6 puntas de 5/8"
Herramienta para mangueras de radiador
Juego de puntas/leznas en miniatura, anaranjadas
Punta de vástago estándar
Juego de destornilladores de combinación, anaranjados
Destornillador magnético de trinquete, anaranjado
Extensión con cuadro de 1/4”, 6” de largo
Cinta de medición métrica de 5M
www.snapon.com/handtools
Página
19
81
435
75
52
25
26
88
153
153
149
578
118
175
181
409
496
8
120
531
532
532
531
8
67
534
75
174
176
161
97
182
153
170
156
535
155
110
187
187
451
145
74
129
137
65
533
ARMADO DEL JUEGO
Bm]_gkelja[gk
Bm]_gk:elja[gk
9200GMBOJuego B completo métrico.
s3EINCLUYE!'-/'-/MÉSCAJA
SUPERIOR+2!!YARMARIORODANTE+2!%
9200GMOJuego B métrico.
s-ÉSDEPIEZAS
s.OINCLUYEUNIDADDEALMACENAMIENTO
DEHERRAMIENTAS
9000GM2O Grupo B para agregar.
s-ÉSDEPIEZAS
s(ERRAMIENTASSOLAMENTE
9000GM2O
KRA4008E
KRA4059A
1(((?E*G?jmhghYjYY_j]_Yj
Pieza No.
206FSUMA
207EFAMY
210FRHMA
310IMMYA
310SIMMYA
313TSMYA
388CF
61ACP
1250
AC58D
AWP160
BP24B
CJ2001P
CSA12CO
E1020
FADH8A
FL80
FX24A
FXK4
FXK8
GA3000A
HBFE32
IP80D
JCK7D
JT13A
LP7WR
MG725
OEXM200B
MTK100
Descripción
Juego de dado poco profundo métrico universal con cuadro de 3/8", 6 puntas (6 piezas)
Juego de mangos hexagonales métricos con cuadro de 3/8" (7 piezas)
Juego de llaves abocardadas métricas con cuadro de 3⁄8", 6 puntas (10 piezas)
Juego de dados de impacto poco profundos con cuadro de 1/2", 6 puntas (10 piezas)
Juego de dados profundos de impacto con cuadro de 1/2", 6 puntas (10 piezas)
Juego de dados profundos métricos con cuadro de 1/2", 12 puntas (13 piezas)
Cortadores de gran palanca, 7 3/4" de largo
Pinzas de pico de pato, 7 3/4" de largo
Barra de palanca de 12" de largo
Cepillo de alambre
Pinzas de lengua y ranura de unión ajustable
Martillo de bola, 24 onz.
Juego para agarre de pernos
Rasqueta de carbón
Juego de extractor (20 piezas)
Llave ajustable, empuñadura acolchonada de 8"
Trinquete sellado con empuñadura larga con cuadro de 3/8"
Extensión con cuadro de 3⁄8", 24” de largo
Extensión con cuadro de 3⁄8", 4” de largo
Extensión con cuadro de 3/8”, 8” de largo
Protectores auditivos
Martillo de golpe seco, 32 onz.
Dado giratorio de impacto con cuadro de 1/2"
Cubierta de guardabarros
Pistola de chorro
Pinzas de traba de 7" de largo
Llave de impacto neumática para servicio pesado con cuadro de 1/2"
Llave de combinación métrica, 12 puntas, 20 mm
Navaja de uso múltiple
ADVERTENCIA
34
55
111
40
41
37
151
152
149
578
160
175
205
181
195
120
8
67
67
67
582
173
78
525
298
161
265
97
97
Pieza No.
OEXM210B
OEXM220B
OEXM6B
OEXM7B
OEXM8B
OEXM9B
OEXSM710B
PPC104A
PPC108A
PPC204A
PPC208A
PPC3A
QD3RM30
S8
SGCP1BR
SGHBF500A
SL80
SN24C
SPBS24O
SRPC105
SXK3
TA3
TC28C
TDM117B
TF72
TFM428
TMX1
TMXK140
UTK100
Descripción
Llave de combinación métrica, 12 puntas, 21 mm
Llave de combinación métrica, 12 puntas, 22 mm
Llave de combinación corta métrica, 12 puntas, 6 mm
Llave de combinación corta métrica, 12 puntas, 7 mm
Llave de combinación corta métrica, 12 puntas, 8 mm
Llave de combinación corta métrica, 12 puntas, 9 mm
Juego de llaves de combinación cortas métricas, 12 puntas, (10 piezas)
Punzón de pasador, 1/8"
Punzón de pasador, 1/4"
Punzón para colocación, 1/8"
Punzón para colocación, 1/4"
Punzón para centro, 5/16"
Llave de torque tipo clic con cuadro de 1/2KGsM
Junta universal con cuadro de 1/2"
Extractor de pasadores de aletas
Juego de limas con empuñaduras (4 piezas)
Trinquete sellado con empuñadura larga con cuadro de 1/2"
Mango articulado con cuadro de 1/2", 24" de largo
Palanca con empuñadura de 24" de largo, anaranjada
Pinzas de anillos de retención
Extensión con cuadro de 1/2”, 3” de largo
Adaptador con cuadro de 1/4" a 3/8"
Cortador de tubos
Juego de machos y terrajas métricas (41 piezas)
Trinquete de cabeza flexible sellado con cuadro de 1/4"
Herramienta para abocardado
Extensión con cuadro de 1/4”, 1” de largo
Extensión con cuadro de 1⁄4", 14” de largo
Navaja de uso múltiple
D]YdYkhj][Ym[agf]k\]k]_mja\Y\]fdYkh~_afYk-1,Y-1/
Página
97
97
99
99
99
99
99
170
170
170
170
170
231
77
451
183
10
16
147
157
69
73
184
193
7
184
65
65
180
591
ARMADO DEL JUEGO
Lista de juegos métricos
Juegos C métricos
9300GM3O Juego C completo métrico.
s)NCLUYE'-/'-/MÉSCAJASUPERIOR
+2,0"/YARMARIORODANTE+2,"0"/
9300GMO Juego B métrico.
s-ÉSDEPIEZASINCLUYETODASLASHERRAMIENTASDE
'-/Y'-/
s.OINCLUYEUNIDADDEALMACENAMIENTODEHERRAMIENTAS
9000GM3O Grupo C para agregar.
s-ÉSDEPIEZASENELJUEGOPARAAGREGARAL*UEGO
"'-/
s(ERRAMIENTASSOLAMENTE
9000GM3O
KRL751PBO
KRL756BPBO
9000GM3O Grupo para agregar
Pieza No.
106ATMXWP
196CF
206AFXWP
214IMFMYA
214SIMFMYA
497CCP
650
AWP120
BP8B
CJ2002
F12LA
FADH10A
FAR7200
FBF80
FK80
HBBD32
HBBT24
IMM200
IMM210
IMM220
IMM230
IMM240
IPF800B
IPFM10C
IPFM12C
IPFM13C
IPFM14C
IPFM15C
IPFM16C
IPFM17C
IPFM18C
IPFM19C
IPFM9C
JCW60R
KB2178
MG325
OEXM230B
OEXM240B
OEXM270B
OEXM300B
OEXM90B
OXIM710B
OXIM7B
592
Descripción
Juego de extensiones movibles con cuadro de 1/4" (6 pzas.)
Pinzas de punta fina con alicate, 7 1/8"
Juego de extensiones movibles con cuadro de 3/8" (6 pzas.)
Juego de dados de impacto poco profundos con cuadro de 3/8", 6 ptas. (14 pzas.)
Juego de dados profundos de impacto con cuadro de 3/8", 6 puntas (14 piezas)
Pinzas de punta fina en ángulo de 90° de 6 5⁄8"
Barra de palanca de 6"
Pinzas de lengua y ranura de unión ajustable de 12 3⁄4"
Martillo de bola, 8 onz.
Juego de extractores
Mango articulado con cuadro de 3/8"
Llave ajustable, empuñadura acolchonada de 10"
Trinquete neumático para servicio superpesado con cuadro de 3/8"
Trinquete sellado con cabeza flexible curva con cuadro de 3/8"
Trinquete con empuñadura corta con cuadro de 3/8"
Martillo de bola de golpe seco, 32 onz.
Martillo c/cabeza de bronce, 24 onz.
Dado de impacto poco profundo con cuadro de 1⁄2", 6 puntas, 20 mm
Dado de impacto poco profundo con cuadro de 1⁄2", 6 puntas, 21 mm
Dado de impacto poco profundo con cuadro de 1⁄2", 6 puntas, 22 mm
Dado de impacto poco profundo con cuadro de 1⁄2", 6 puntas, 23 mm
Dado de impacto poco profundo con cuadro de 1⁄2", 6 puntas, 24 mm
Junta universal de impacto con cuadro 3/8"
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 10 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 12 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 13 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 14 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 15 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 16 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 17 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 18 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 19 mm
Dado de impacto giratorio poco profundo métrico con cuadro de 3⁄8", 9 mm
Camilla
Bolsa de juego
Llave de impacto neumática con cuadro de 3/8"
Llave de combinación métrica, 12 puntas, 23 mm
Llave de combinación métrica, 12 puntas, 24 mm
Llave de combinación métrica, 12 puntas, 27 mm
Llave de combinación métrica, 12 puntas, 30 mm
Llave de combinación métrica, 12 puntas, 9 mm
Juego de llaves de combinación en miniatura, métrica, 12 ptas. (10 pzas.)
Llave de combinación métrica en miniatura, 12 ptas. de 7 mm
Página
66
152
68
31
32
152
149
154
175
204
16
110
269
8
8
173
174
40
40
40
40
40
78
35
35
35
35
35
35
35
35
35
35
526
170
267
97
97
97
97
97
100
100
Pieza No.
OXIM8B
OXIM9B
PPB1012A
PPC110A
PPC112
PPC210A
PPC5A
PPC824B
PPC828B
PT28E
PWC14
QD2RM1000
RTD48
S9704KFUA
S9706KRFUA
SDM400A
SF80
SGD304BR
SHDP162O
SHDP62IRO
SHDP63IRO
SIMM200
SIMM210
SIMM220
SIMM230
SIMM240
SPBS120
SSDE42C
SSDE44C
SSDE46C
SSDE48C
SSDMR1AO
SX2
TC123C
TM61A
TMXK110
TWM25
TWM26
TWM27
TWM30
VSM807B
XBM605A
XOM605
Descripción
Llave de combinación métrica en miniatura, 12 ptas. de 8mm
Llave de combinación métrica en miniatura, 12 ptas. de 9 mm
Punzón ahusado de bronce, 3/8"
Punzón de pasador, 5/16"
Punzón de pasador, 3/8"
Punzón para colocación, 5/16"
Sostén para punzón y cincel
Cincel plano, 3/4"
Cincel plano, 7/8"
Herramienta de enganche
Pelador/alicate de alambre/corta pernos
Llave de torque Llave de torque tipo clic de 3/8"
Juego de rectificación
Dado universal para bujías con cuadro de 3/8", 11/16"
Dado universal para bujía con cuadro de 3/8", de 6 puntas de 5/8"
Juego de brocas para destornilladores (37 pzas.)
Trinquete sellado con cabeza flexible con cuadro de 1⁄2"
Destornillador electrónico con punta plana, con cuadro, 0.018" x 1⁄8" x 3"
Destornillador de punta Phillips®, N.° 2 anaranjado
Destornillador Phillips®, N.° 2, anaranjado
Destornillador de punta Phillips®, N.° 3 anaranjado
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 20 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 21 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 22 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 23 mm
Dado de impacto profundo con cuadro de 1/2", 6 ptas. de 24 mm
Palanca con empuñadura de 12", anaranjada
Destornillador electrónico con punta plana, con cuadro, 0.018" x 1⁄8" x 2"
Destornillador electrónico con punta plana, con cuadro, 0.018" x 1⁄8" x 4"
Destornillador electrónico con punta plana, con cuadro, 0.018" x 1⁄8" x 6"
Destornillador electrónico con punta plana, con cuadro, 0.018" x 1⁄8" x 8"
Destornillador magnético de trinquete, anaranjado
Extensión con cuadro de 1/2”, 2”
Cortador de tubos
Extensión flexible con cuadro de 1/4”, 6”
Extensión con cuadro de 1/4”, 11”
Dado métrico con cuadro de 1/2", 6 ptas. de 25 mm
Dado métrico con cuadro de 1/2", 6 ptas. de 26 mm
Dado métrico con cuadro de 1/2", 6 ptas. de 27 mm
Dado métrico con cuadro de 1/2", 6 ptas. de 30 mm
Juego de llaves métricas de extremo abierto (7 pzas.)
Juego de llaves de ojo compensadas largas métricas (5 pzas.)
Juego de llaves de ojo compensadas profundas métricas (5 pzas.)
www.snapon.com/handtools
Página
100
100
171
170
170
170
170
170
170
535
155
231
189
187
187
141
10
130
131
131
131
41
41
41
41
41
147
132
132
132
132
137
69
184
66
65
36
36
36
36
108
102
103
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement