GEAppliances 21 Installation instructions


Add to my manuals
128 Pages

advertisement

GEAppliances 21 Installation instructions | Manualzz
Profile Bottom Freezer
Refrigerators
GEAppliances.com
Safety Instructions . . . . . . . . . . . .2, 3
Operating Instructions
Additional Features. . . . . . . . . . . . . . . . . . 9
Automatic Icemaker . . . . . . . . . . . . 12-13
Care and Cleaning . . . . . . . . . . . . . 13–14
Controls . . . . . . . . . . . . . . . . . . . . . . . . . .4–5
Crispers and Pans . . . . . . . . . . . . . . . . . .10
Freezer . . . . . . . . . . . . . . . . . . . . . . . . . . . .11
Replacing the Light Bulbs . . . . . . . . . . .15
Shelves and Bins . . . . . . . . . . . . . . . . . .8, 9
Water Filter . . . . . . . . . . . . . . . . . . . . . . .6, 7
Installation Instructions
Installing the Refrigerator. . . . . . . 17–21
Installing the Water Line . . . . . . . . 30–32
Preparing to Install
the Refrigerator . . . . . . . . . . . . . . . . . . . .16
Removing and Replacing
the Doors (Double Door
Refrigerator Models only) . . . . . . . 27–29
Removing and Replacing the
Freezer Drawer . . . . . . . . . . . . . . . . 22, 23
Reversing the Door Swing
(Single Door Refrigerator
Models only) . . . . . . . . . . . . . . . . . . . 24–26
Troubleshooting Tips . . . . . . 33–37
Owner’s Manual and
Installation Instructions
Models 20, 21, 22 and 23
Congélateur inférieur
Réfrigérateurs
Manuel d’utilisation
et d’installation
La section française commence à la page 40
Congelador inferior
Refrigeradores
Manual del
propietario e
instalación
La sección en español empieza en la página 83
Normal Operating Sounds . . . . . . . . . .33
Consumer Support
Consumer Support . . . . . . . . Back Cover
Performance Data Sheet . . . . . . . 39-40
Warranty . . . . . . . . . . . . . . . . . . . . . . . . . .38
Write the model and serial
numbers here:
Model # ____________________
Serial # _____________________
Find these numbers on a label
on the right side, near the top of the
refrigerator compartment.
200D9366P016 49-60603-6 10-14 GE
IMPORTANT SAFETY INFORMATION.
READ ALL INSTRUCTIONS BEFORE USING.
SAFETY
GE Appliances website
For more information on your refrigerator’s operation, visit www.GEAppliances.com or
call 800.GECARES (800.432.2737). In Canada visit GEAppliances.ca or call 800.561.3344.
REFRIGERATOR SAFETY INFORMATION
This is the safety alert symbol. This symbol alerts you to potential hazards that can kill or hurt you and others. All safety
messages will follow the safety alert symbol and the word “DANGER”, “WARNING”, or “CAUTION”. These words are defined
as:
DANGER
Indicates a hazardous situation which, if not avoided, will result in death or serious injury.
WARNING Indicates a hazardous situation which, if not avoided, could result in death or serious injury.
CAUTION
WARNING
Indicates a hazardous situation which, if not avoided, could result in minor or moderate injury.
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of fire, explosion, electric shock, or injury when using your
refrigerator follow these basic safety precautions:
„ This refrigerator must be properly installed and located in
accordance with the Installation Instructions before it is used.
„ Unplug the refrigerator before making repairs, replacing a light
bulb, or cleaning.
Note: Power to the refrigerator cannot be disconnected by any
setting on the control panel.
Note: Repairs must be performed by a qualified service
professional.
„ Replace all parts and panels before operating.
„ Do not store or use gasoline or other flammable vapors and
liquids in the vicinity of this or any other appliance.
CAUTION
IMPORTANT SAFETY INSTRUCTIONS
To reduce the risk of injury when using your refrigerator, follow these basic
safety precautions.
„ Do not clean glass shelves or covers with warm water
when they are cold. Glass shelves and covers may break if
exposed to sudden temperature changes or impact, such
as bumping or dropping. Tempered glass is designed to
shatter into many small pieces if it breaks.
„ Keep fingers out of the “pinch point” areas; clearances
between the doors and between the doors and cabinet are
necessarily small. Be careful closing doors when children
are in the area.
2
„ Because of potential safety hazards under certain conditions,
we strongly recommend against the use of an extension cord.
However, if you must use an extension cord, it is absolutely
necessary that it be a UL-listed (in the United States) or a CSA
certified (in Canada), 3-wire grounding type appliance extension
cord having a grounding type plug and outlet and that the electrical
rating of the cord be 15 amperes (minimum) and 120 volts.
„ To prevent suffocation and entrapment hazards to children,
remove the fresh food and freezer doors from any refrigerator
before disposing of it or discontinuing its use.
„ Do not allow children to climb, stand or hang on the door
handles or the shelves in the refrigerator. They could seriously
injure themselves.
„ Do not touch the cold surfaces in the freezer compartment
when hands are damp or wet, skin may stick to these
extremely cold surfaces.
„ Do not refreeze frozen foods which have thawed
completely.
„ In refrigerators with automatic icemakers, avoid contact
with the moving parts of the ejector mechanism, or with the
heating element that releases the cubes. Do not place fingers
or hands on the automatic ice making mechanism while the
refrigerator is plugged in.
GEAppliances.com
SAFETY
(CONT.)
INSTALLATION
WARNING
Explosion Hazard.
Keep flammable materials and vapors, such as gasoline, away from refrigerator. Failure to do so can
result in fire, explosion, or death.
CONNECTING ELECTRICITY
WARNING
Electrical Shock Hazard.
Plug into a grounded 3-prong outlet
Do not remove the ground prong
Do not use an adapter
Failure to follow these instructions can result in
death, fire, or electrical shock.
Do not, under any circumstances, cut or remove the third (ground) prong from the power cord.
For personal safety, this appliance must be properly grounded.
The power cord of this appliance is equipped with a 3-prong
(grounding) plug which mates with a standard 3-prong
(grounding) wall outlet to minimize the possibility of electric
shock hazard from this appliance.
Have the wall outlet and circuit checked by a qualified
electrician to make sure the outlet is properly grounded.
Where a standard 2-prong wall outlet is encountered, it
is your personal responsibility and obligation to have it
replaced with a properly grounded 3-prong wall outlet. Do
not use an adapter.
The refrigerator should always be plugged into its own
individual electrical outlet which has a voltage rating that
matches the rating plate.
A 115 Volt AC, 60 Hz, 15- or 20-amp fused, grounded
electrical supply is required. This provides the best
performance and also prevents overloading house wiring
circuits which could cause a fire hazard from overheated
wires.
Never unplug your refrigerator by pulling on the power cord.
Always grip plug firmly and pull straight out from the outlet.
Repair or replace immediately all power cords that have
become frayed or otherwise damaged. Do not use a cord
that shows cracks or abrasion damage along its length or
at either end.
When moving the refrigerator away from the wall, be
careful not to roll over or damage the power cord.
USE OF ADAPTER PLUGS
Adapter plugs are not permitted in Canada.
PROPER DISPOSAL OF YOUR OLD REFRIGERATOR
WARNING Suffocation and child entrapment hazard.
Remove fresh-food and freezer doors from the refrigerator, prior to disposal. Failure to do so can
result in child entrapment which can lead to death or brain damage.
IMPORTANT:
Child entrapment and suffocation are not problems
of the past. Junked or abandoned refrigerators are
still dangerous even if they will sit for “just a few
days.” If you are getting rid of your old refrigerator,
please follow the instructions below to help prevent
accidents.
Before You Throw Away Your Old Refrigerator or
Freezer:
„ Leave the shelves in place so that children may
not easily climb inside.
Refrigerants
All refrigeration products contain refrigerants,
which under federal law must be removed prior
to product disposal. If you are getting rid of an old
refrigeration product, check with the company
handling the disposal about what to do.
„ Take off the fresh food and freezer doors.
READ AND FOLLOW THIS SAFETY INFORMATION CAREFULLY.
SAVE THESE INSTRUCTIONS
3
About the controls with temperature settings.
(on some models)
ACTUAL
TEMP
(FIG A)
(on some models)
(FIG B)
NOTE: The refrigerator is shipped with protective film covering the temperature controls. If this film was not removed
during installation, remove it now.
The temperature controls are preset in the factory at 37°F for the refrigerator compartment and 0°F for
the freezer compartment. Allow 24 hours for the temperature to stabilize to the preset recommended
settings.
The temperature controls can display both the SET temperature as well as the actual temperature in the
refrigerator and freezer. The actual temperature may vary slightly from the SET temperature based on
usage and operating environment.
Setting either or both controls to OFF stops cooling in both the freezer and refrigerator compartments,
but does not shut off electrical power to the refrigerator.
Changing the Temperature
For Controls-on-the-Door Models:
FIG. “A” To change the temperature, press and release the
WARMER or COLDER pad. The ACTUAL TEMP light will come on
and the display will show the actual temperature. To change the
temperature, tap either the WARMER or COLDER pad until the
desired temperature is displayed.
FIG. “B” To visualize the real temperature press and release
the ACTUAL TEMP pad. The display will show the actual
temperature for 10 seconds.
To change the temperature, tap either the WARMER or
COLDER pad until the desired temperature is displayed. The SET
TEMP light will come on during this process.
For Controls Inside the Refrigerator:
Opening the door displays the actual temperature. To change
the temperature, press either the WARMER or COLDER touch
pads until the desired temperature is displayed.
4
Once the desired temperature has been set, the temperature
display will return to the actual refrigerator and freezer
temperatures after 5 seconds. Several adjustments may be
required.
Each time you adjust controls, allow 24 hours for the refrigerator
to reach the temperature you have set.
To turn the cooling system off, tap the WARMER pad for either
the refrigerator or the freezer until the display shows OFF. To
turn the unit back on, press the COLDER pad for either the
refrigerator or freezer. Then press the COLDER pad again and it
will go to the preset points of 0°F for the freezer and 37°F for the
refrigerator. Setting either or both controls to OFF stops cooling
in both the freezer and refrigerator compartments, but does not
shut off electrical power to the refrigerator.
About TurboCool.™ (on some models)
GEAppliances.com
How it Works
(on some models)
(on some models)
TurboCool rapidly cools the refrigerator
compartment in order to more quickly
cool foods. Use TurboCool when adding
a large amount of food to the refrigerator
compartment, putting away foods after they
have been sitting out at room temperature or
when putting away warm leftovers. It can also
be used if the refrigerator has been without
power for an extended period.
Once activated, the compressor will turn
on immediately and the fans will cycle on
and off at high speed as needed for eight
hours. The compressor will continue to run
until the refrigerator compartment cools to
approximately 34°F (1°C), then it will cycle on
and off to maintain this setting. After 8 hours, or
if TurboCool is pressed again, the refrigerator
compartment will return to the original setting.
How to Use
Press TurboCool. The refrigerator temperature
display will show .
After TurboCool is complete, the refrigerator
compartment will return to the original setting.
NOTES: The refrigerator temperature cannot
be changed during TurboCool.
The freezer temperature is not
affected during TurboCool.
When opening the refrigerator door
during TurboCool, the fans will
continue to run if they have cycled on.
About Door Alarm (on some models)
The door alarm will sound if any door is open
for more than 2 minutes. The beeping stops
when you close the door.
(on some models)
(on some models)
About Energy Saver (on some models)
This product is equipped with an Energy Saver
feature. The refrigerator is shipped with the
Energy Saver feature enabled.
(on some models)
Over time, moisture can form on the front
surface of the refrigerator cabinet and cause
rust. If moisture does appear on the front
surface of the refrigerator cabinet, turn off the
Energy Saver feature by pressing and releasing
the ENERGY SAVER pad on the control panel.
(on some models)
5
About the water filter. (on 22 and 23 models only)
Water Filter Cartridge
Filter Bypass Plug
The water filter cartridge is located in the
back upper right corner of the refrigerator
compartment.
You must use the filter bypass plug when a
replacement filter cartridge is not available. The
icemaker will not operate without the filter or
filter bypass plug.
When to Replace the Filter
There is a replacement indicator light for
the water filter cartridge on the temperature
display. This light will turn orange to tell you
that you need to replace the filter soon. The
filter cartridge should be replaced when the
replacement indicator light turns red or if
the flow of water to the dispenser or icemaker
decreases.
Installing the Filter Cartridge
Cartridge
Holder
If you are replacing the cartridge, first
remove the old one by slowly turning it to
the left. DO NOT pull down on the cartridge.
A small amount of water may drip down.
CAUTION
If air has been trapped in the
system, the filter cartridge may be ejected as it is
removed. Use caution when removing.
Remove the protective foil from the end of
the cartridge.
Cartridge
Holder
Fill the replacement cartridge with water
from the tap to allow for better flow from
the dispenser immediately after installation.
Lining up the arrow on the cartridge
and the cartridge holder, slowly rotate the
cartridge clockwise until it stops. When the
cartridge is properly installed, you will feel it
“click” as it locks into place.
Do not overtighten.
(on some models)
Run water from the dispenser for
3 minutes (about 11ø2 gallons) to clear
the system and prevent sputtering.
See To Use the Dispenser section.
Press and hold the RESET WATER FILTER
pad for 3 seconds.
NOTE: A newly-installed water filter
cartridge may cause water to spurt from
the dispenser.
(on some models)
6
Replacement Filters:
To order additional filter cartridges
in the United States, visit our Website,
GEAppliances.com, or call GE Parts and
Accessories, 800.626.2002.
Filter Model MWF
Customers in Canada should consult
the yellow pages for the nearest Mabe Service
Center.
About the water filter. (on 20 models only)
GEAppliances.com
Water Filter Cartridge
Filter Bypass Plug
The water filter cartridge is located in the
back upper right corner of the refrigerator
compartment.
You must use the filter bypass plug when a
replacement filter cartridge is not available. The
icemaker will not operate without the filter or
filter bypass plug.
When to Replace the Filter
The filter cartridge should be replaced when
the flow of water to the icemaker decreases, or
every 6 months.
Installing the Filter Cartridge
If you are replacing the cartridge, first
remove the old one. Open the cartridge
cover by pressing in on the tab at the front
and pulling down.
Replacement Filters:
To order additional filter cartridges in
the United States, visit our Website,
GEAppliances.com, or call GE Parts and
Accessories, 800.626.2002.
Filter Model GSWF
Customers in Canada should consult the yellow
pages for the nearest Mabe Service Center.
Remove the cartridge by slowly rotating it
counterclockwise. A small amount of water
may drip down.
CAUTION
If air has been trapped in the
system, the filter cartridge may be ejected as it is
removed. Use caution when removing.
Remove the protective foil from the end of
the cartridge.
Lining up the arrow on the cartridge and
the cartridge holder, slowly rotate the
cartridge clockwise until it stops. When the
cartridge is properly installed, you will feel it
“click” as it locks into place. The grip on the
end of the cartridge should be positioned
vertically.
Do not overtighten.
Close the cartridge cover.
7
About the shelves and bins.
Not all features are on all models.
Rearranging the Shelves
Shelves in the refrigerator compartment are adjustable.
Refrigerator Compartment
To remove:
Remove all items from the shelf.
Tilt the shelf up at the front.
Some models have wire shelves
that can be adjusted in the same
manner.
Lift the shelf up at the back and bring the
shelf out.
To replace:
While tilting the shelf up, insert the top hook
at the back of the shelf in a slot on the
track.
Lower the front of the shelf until the bottom
of the shelf locks into place.
Spillproof Shelves (on some models)
Spillproof shelves have special edges to help
prevent spills from dripping to lower shelves. To
remove or replace the shelves, see Rearranging
the Shelves.
Slide-Out Spillproof Shelf (on some models)
The slide-out spillproof shelf allows you to
reach items stored behind others. The special
edges are designed to help prevent spills from
dripping to lower shelves.
To remove:
Remove all items from shelf.
Remove the shelf from the compartment by
lifting up and out.
Remove the glass shelf from the frame by
sliding the shelf out until it stops.
Pull the shelf up to release it from the front
of the frame.
Slide the shelf back to release it from the
back of the frame.
To reinstall the glass shelf, reverse these
instructions.
Make sure that the shelf sits flat after
reinstallation and doesn’t move freely from side
to side.
Make sure you push the shelves all the way in
before you close the door.
Tuck-Away Shelf (on some models)
This shelf can retract to half its size for storage
of tall items on the shelf below.
To remove:
Pull the shelf out and up.
Slide the shelf back until it stops.
8
To return the shelf to its original position,
pull up and forward on the shelf. Push
down slightly to lock the shelf into position.
GEAppliances.com
Adjustable Bins on the Door
Adjustable bins can easily be carried from
refrigerator to work area.
To remove: Lift bin straight up, then pull out.
The snugger helps prevent tipping, spilling or
sliding of small items stored on the door shelf.
Grip the finger hold near the rear of the snugger
and move it to fit your needs.
To replace or relocate: Slide in the bin just
above the molded door supports, and push
down. The bin will lock in place.
Non-Adjustable Bins on the Door
To remove: Lift the bin straight up, then pull out.
To replace: Engage the bin in the molded
supports on the door and push down. It will lock
in place.
About the additional features.
Shelf Saver Rack (on some models)
Slide-out beverage rack holds twelve cans of
soda or two wine/water bottles (lengthwise).
It can be removed for cleaning.
To remove, slide the rack out to the stop
position, lift the rack up and past the stop
position and lift it out.
9
About the crispers and pans.
Not all features are on all models.
Fruit and Vegetable Crisper
Excess water that may accumulate in the
bottom of the drawers or under the drawers
should be wiped dry.
Adjustable Humidity Crisper (on some models)
Slide the control all the way to the HIGH setting
to provide high humidity recommended for
most vegetables.
Second slot
from top
Adjustable Temperature Deli Pan (on some models)
When the pan is placed in the 2nd slot from
the top of the track and the lever is set at
COLDEST, air from the freezer is forced around
the pan to keep it very cold.
You can move the pan to any location if you
don’t want the extra cold storage.
10
Slide the control all the way to the LOW setting
to provide lower humidity levels recommended
for most fruits.
The settings can be adjusted anywhere
between cold
and coldest
.
When set at cold, the pan will stay at the
normal refrigerator temperature.
The coldest setting provides the coldest storage
area.
About the freezer.
GEAppliances.com
Not all features are on all models.
Freezer Shelves and Baskets
A shelf above the ice storage bin
A half-width basket
NOTE: Do not fill baskets higher than the rim of
the basket. This may cause baskets to stick or
jam when opening or closing.
A shallow full-width basket
A deep full-width basket
Appearance and features may vary
Basket Removal
To remove the deep full-width basket on
freezer drawer models:
Open the freezer drawer until it stops.
The freezer basket rests on the inside tabs
on the drawer slides.
Appearance may vary
Lift the basket so that it is out of all 6 slide
bracket tabs.
Tilt the basket and lift out of the drawer.
When replacing the deep full-width basket:
Tilt the basket back and lower it down into
the drawer. Rotate the basket to a horizontal
position and press it down into the 6 alignment
tabs.
NOTE: Always be sure that the basket is seated
in all 6 slide bracket tabs before sliding back
into the freezer. The basket can be turned in
either direction front to back and installed into
the freezer.
To remove the half-width basket:
Pull the basket out to the stop location.
Lift the basket up at the front to release it
from the slides.
Lift the back up and out of the slide.
When replacing the basket, make sure that
the wire tabs and wire hooks on the sides of the
basket go into the slots in the top of the upper
basket slides.
NOTE: Always be sure to fully close this basket.
Appearance may vary
To remove the shallow full-width basket:
Pull the basket out to the stop location.
Lift the basket up and out.
Lift the front up and over the stop location.
Appearance may vary
11
About the automatic icemaker.
A newly installed refrigerator may take 12 to 24 hours to begin making ice.
Automatic Icemaker (on some models)
Power
Switch
Green
Power
Light
Icemaker
Feeler Arm
7KHLFHPDNHUZLOOSURGXFHVHYHQFXEHVSHUF\FOH³
approximately 100–130 cubes in a 24-hour period,
depending on freezer compartment temperature,
room temperature, number of door openings and
other use conditions.
See below for how to access ice and reach the
power switch.
If the refrigerator is operated before the water
connection is made to the icemaker, set the power
switch in the O (off) position.
When the refrigerator has been connected to the
water supply, set the power switch to the l (on)
position. The icemaker power light will turn green
when the freezer light switch is pressed in or when
the freezer door is closed.
The icemaker will fill with water when it cools to 15°F
(–10°C). A newly installed refrigerator may take 12 to
24 hours to begin making ice cubes.
You will hear a buzzing sound each time the
icemaker fills with water.
Throw away the first few batches of ice to allow the
water line to clear.
Accessing Ice and Reaching the
Power Switch
Shelf
Ice Bin
To reach the icemaker power switch, pull the shelf
above the ice bin straight out. Always be sure to
replace the shelf.
Be sure nothing interferes with the sweep of the
feeler arm.
When the bin fills to the level of the feeler arm, the
icemaker will stop producing ice. It is normal for
several cubes to be joined together.
If ice is not used frequently, old ice cubes will
become cloudy, taste stale and shrink.
NOTE: In homes with lower-than-average water
pressure, you may hear the icemaker cycle multiple
times when making one batch of ice.
NOTE: Set the power switch to the O (off) position
if the water supply is shut off.
CAUTION
Avoid contact with the
moving parts of the ejector mechanism, or
with the heating element (located on the
bottom of the ice maker) that releases the
cubes. Do not place fingers or hands on the
automatic ice making mechanism while the
refrigerator is plugged in.
Shelf
Ice Bin
To access ice, simply pull the bin forward.
To reach the power switch.
To access ice.
Icemaker Accessory Kit
If your refrigerator did not come already equipped
with an automatic icemaker, an icemaker accessory
kit is available at extra cost.
Check the back of the refrigerator for the specific
icemaker kit needed for your model.
To Use the Dispenser (on some models)
Spill Shelf
Dispenser Cradle
12
Press the glass gently against the top of the
dispenser cradle.
The spill shelf is not self-draining. To reduce water
spotting, the shelf should be cleaned regularly.
If no water is dispensed when the refrigerator is first
installed, there may be air in the water line system.
Press the dispenser arm for at least two minutes to
remove trapped air from the water line and to fill the
water system. To flush out impurities in the water line,
throw away the first six glassfuls of water.
Locking the Dispenser
Press the LOCK pad for 3 seconds to lock
the dispenser and control panel. To unlock,
press and hold the pad again for 3 seconds.
GEAppliances.com
To Use the Internal Water Dispenser (on some models)
The water dispenser is located on the left wall inside
the refrigerator compartment.
To dispense water:
Hold the glass against the recess.
Push the water dispenser button.
Hold the glass underneath the dispenser for 2–3
seconds after releasing the dispenser button.
Water may continue to dispense after the button
is released.
If no water is dispensed when the refrigerator is first
installed, there may be air in the water line system.
Press the dispenser button for at least 2 minutes to
remove trapped air from the water line and to fill the
water system. During this process, the dispenser noise
may be loud as the air is purged from the water line
system. To flush out impurities in the water line, throw
away the first 6 glassfuls of water.
NOTE: To avoid water deposits, the dispenser should
be cleaned periodically by wiping with a clean cloth
or sponge.
Care and cleaning of the refrigerator.
Cleaning the Outside
The door handles and trim. Clean with a cloth
dampened with soapy water. Dry with a soft
cloth. Do not use wax on the door handles and
trim.
Keep the outside clean. Wipe with a clean
cloth lightly dampened with kitchen appliance
wax or mild liquid dish detergent. Dry and
polish with a clean, soft cloth.
Do not wipe the refrigerator with a soiled
dish cloth or wet towel. These may leave a
residue that can erode the paint. Do not use
scouring pads, powdered cleaners, bleach
or cleaners containing bleach because these
products can scratch and weaken the paint
finish.
The stainless steel panels and door handles.
The stainless steel doors and door handles
(on some models) can be cleaned with a
commercially available stainless steel cleaner.
Cleaners with oxalic acid such as Bar Keepers
Friend Soft Cleanser™ will remove rust,
tarnish and small blemishes. Use only a liquid
cleanser free of grit and rub in the direction
of the brush lines with a damp soft sponge.
Do not use appliance wax or polish on the
stainless steel.
Silver-plated plastic parts. Wash parts with
soap or other mild detergents. Wipe clean with
a sponge, damp cloth or paper towel.
Do not scrub with steel-wool pads or other
abrasive cleaners.
Cleaning the Inside
To help prevent odors, leave an open box
of baking soda in the refrigerator and freezer
compartments.
Unplug the refrigerator before cleaning.
If this is not practical, wring excess moisture
out of sponge or cloth when cleaning around
switches, lights or controls.
Use an appliance wax polish on the inside
surface between the doors.
8VHZDUPZDWHUDQGEDNLQJVRGDVROXWLRQ³
about a tablespoon (15 ml) of baking soda to
a quart (1 liter) of water. This both cleans and
neutralizes odors. Rinse and wipe dry.
After cleaning the door gaskets, apply a thin
layer of petroleum jelly to the door gaskets at
the hinge side. This helps keep the gaskets from
sticking and bending out of shape.
CAUTION
Do not clean glass shelves
or covers with warm water when they are
cold. Glass shelves and covers may break
if exposed to sudden temperature changes
or impact such as bumping or dropping.
Tempered glass is designed to shatter into
many small pieces if it breaks.
Do not wash any plastic refrigerator parts in
the dishwasher.
Silver-accented plastic parts. Wash parts with
soapy water. Wipe clean with a sponge, damp
cloth or paper towel.
Do not scrub with steel-wool pads or other
abrasive cleaners.
13
Care and cleaning of the refrigerator. (cont.)
Behind the Refrigerator
Be careful when moving the refrigerator away
from the wall. All types of floor coverings can
be damaged, particularly cushioned coverings
and those with embossed surfaces.
Raise the leveling legs located at the bottom
front of the refrigerator.
Lower the leveling legs until they touch the
floor.
When pushing the refrigerator back, make
sure you don’t roll over the power cord or
icemaker supply line (on some models).
Pull the refrigerator straight out and return it
to position by pushing it straight in. Moving the
refrigerator in a side direction may result in
damage to the floor covering or refrigerator.
Preparing for Vacation
For long vacations or absences, remove food
and unplug the refrigerator. Clean the interior
with a baking soda solution of one tablespoon
(15 ml) of baking soda to one quart (1 liter) of
water. Leave the doors open.
If the temperature can drop below freezing,
have a qualified servicer drain the water supply
system (on some models) to prevent serious
property damage due to flooding.
Set the icemaker power switch to the O (off)
position and shut off the water supply to the
refrigerator.
Preparing to Move
Secure all loose items such as base grille,
shelves and drawers by taping them securely
in place to prevent damage.
When using a hand truck to move the
refrigerator, do not rest the front or back of the
refrigerator against the hand truck. This could
damage the refrigerator. Handle only from the
sides of the refrigerator.
14
Be sure the refrigerator stays in an upright
position during moving.
Replacing the light bulbs.
GEAppliances.com
WARNING Before replacing a burned-out light bulb, the refrigerator should be unplugged in order to avoid contact with a
live wire filament. (A burned-out light bulb may break when being replaced.)
Turning the control to the OFF position does not remove power to the light circuit.
Refrigerator Lights
Unplug the refrigerator.
To remove the light shield, grasp the shield
at the back and pull out to release the tabs
at the back.
Rotate the shield down and then forward to
release the tabs at the front of the shield.
After replacing with an appliance bulb of
the same or lower wattage, replace the
shield.
Plug the refrigerator back in.
NOTE: Appliance bulbs may be ordered from
GE Parts and Accessories, 800.626.2002.
Freezer Light
Unplug the refrigerator.
Remove the freezer basket for access. The
bulb is located at the rear of the freezer
inside a light shield.
After replacing with an appliance bulb of
the same or lower wattage, replace the
shield and freezer basket.
Plug the refrigerator back in.
To remove, grasp the shield at the top and
pull out to release the tabs at the bottom.
Appearance may vary
Middle Lights
Unplug the refrigerator.
The bulbs are located behind the crisper
drawers. To remove the drawers, lift up
slightly while pulling the drawer past the
stop location.
Lights are
behind crisper
drawers
Replace the bulbs with appliance bulbs
of the same or lower wattage.
Replace crisper drawers by sliding them
gently back onto the tracks while lifting up
slightly.
Light Bulbs
Plug the refrigerator back in.
15
Installation
Instructions
Refrigerator
Models 20, 21, 22 and 23
Questions? Call 800.GE.CARES (800.432.2737) or visit our Website at: GEAppliances.com
In Canada, call 1.800.561.3344 or visit our Website at: www.GEAppliances.ca
BEFORE YOU BEGIN
TOOLS YOU MAY NEED
Read these instructions completely and carefully.
•
IMPORTANT ³ Save these instructions
for local inspector’s use.
•
•
•
•
•
•
•
Adjustable Wrench
IMPORTANT ³ Observe all governing
codes and ordinances.
Note to Installer – Be sure to leave these
instructions with the Consumer.
Note to Consumer – Keep these instructions for
future reference.
Skill level – Installation of this appliance requires
basic mechanical skills.
Completion time – Refrigerator Installation
20 minutes
Water Line Installation
30 minutes
Proper installation is the responsibility of the
installer.
Product failure due to improper installation is not
covered under the Warranty.
1/4” Outer Diameter
Compression Nut
and Ferrule (sleeve)
(icemaker models only)
3/8” and 5/16” Socket
Ratchet/Driver
Phillips Head Screwdriver
3/32”, 1/8” and 3/16” Allen
wrenches
1/8” Drill Bit and
Electric or Hand Drill
PREPARATION
Pencil
MOVING THE REFRIGERATOR INDOORS
If the refrigerator will not fit through a doorway,
the refrigerator door and freezer drawer can be
removed.
• To remove the refrigerator door, see Step 1 in
the Reversing the Door Swing section.
• To remove the freezer drawer, see the Removing
the Freezer Drawer section.
Wire Cutters
WATER SUPPLY TO THE ICEMAKER AND
DISPENSER (ON SOME MODELS)
If the refrigerator has an icemaker, it will have to be
connected to a cold water line. A GE water supply
kit (containing tubing, shutoff valve, fittings and
instructions) is available at extra cost from your dealer,
by visiting our Website at GEAppliances.com (in
Canada at www.GEAppliances.ca) or from Parts and
Accessories, 800.626.2002 (In Canada .888.261.3055).
16
Tape measure
1/4” Nut Driver
Level
Installation Instructions
INSTALLING THE REFRIGERATOR
REFRIGERATOR LOCATION
REMOVE TOP CAP (cont.) (on some models)
• Do not install the refrigerator where the temperature
will go below 60°F (16°C) because it will not run often
enough to maintain proper temperatures.
• Do not install the refrigerator where the temperature
will go above 100°F (37°C) because it will not perform
properly.
• Do not install the refrigerator in a location exposed to
water (rain, etc.) or direct sunlight.
• Install it on a floor strong enough to support it fully
loaded.
REINSTALL DOORS, DRAWERS AND TOP CAP
E Carefully lower the door onto the center hinge.
Reinstall top hinge. NOTE: Ensure the door is properly
aligned to the case top to avoid readjustment of the
door during top cap reinstallation.
F Place cap over the top of the refrigerator. Reinstall
the original screws in the top and back of the cap.
G Reinstall the bottom freezer drawer. Refer to
“Replacing the Freezer Drawer” section.
A
CLEARANCES
For clearance for ease of installation, proper air
circulation and plumbing and electrical, please refer to
the rating plate on the top left wall of the refrigerator.
REMOVE TOP CAP (on some models)
• IMPORTANT NOTE: This refrigerator is 34-1/2” deep.
Doors and passageways leading to the installation
location must be at least 36” wide in order to leave
the doors and handles attached to the refrigerator
while transporting it into the installation location.
If passageways are less than 36”, the refrigerator
doors and handles can easily be scratched and
damaged. The top cap and doors can be removed
to allow the refrigerator to be safely moved indoors.
Start with Step A.
• If it is not necessary to remove doors, skip Step A.
Leave tape and all packaging on doors until the
refrigerator is in the final location.
• SKID REMOVAL: Tilt refrigerator to each side to
remove skid.
• NOTE: Use a padded hand truck to move this
refrigerator. Place the refrigerator on the hand truck
with a side against the truck. We strongly recommend
that TWO PEOPLE move and complete this installation.
A Locate and remove the two Phillips head screws on
the top of the refrigerator. Remove the two screws
on each side at the rear of the top cap. Lift off and
remove top cap.
B Remove the fresh-food door. Refer to Steps 1
through 3 of “Reversing the Door Swing” section.
C Remove the bottom freezer drawer. Refer to
“Removing Freezer Drawer” section.
D Move refrigerator to the installation location.
Top Hinge B
1 CONNECTING THE REFRIGERATOR
TO THE HOUSE WATER LINE
(icemaker and dispenser models)
A cold water supply is required for automatic
icemaker operation. If there is not a cold water
supply, you will need to provide one. See Installing
the Water Line section.
NOTES:
• Before making the connection to the refrigerator,
be sure the refrigerator power cord is not plugged
into the wall outlet.
• If your refrigerator does not have a water filter, we
recommend installing one if your water supply has
sand or particles that could clog the screen of the
refrigerator’s water valve. Install it in the water line
near the refrigerator. If using GE SmartConnect™
Refrigerator Tubing Kit, you will need an additional
tube (WX08X10002) to connect the filter. Do not cut
plastic tube to install filter.
17
Installation Instructions
INSTALLING THE REFRIGERATOR (cont.)
2 TURN ON THE WATER SUPPLY
(icemaker and dispenser models)
1 CONNECTING THE REFRIGERATOR TO
THE HOUSE WATER LINE
(cont.)
Turn the water on at the shutoff valve (house
water supply) and check for any leaks.
A If you are using copper tubing, place a
compression nut and ferrule (sleeve) onto the
end of the tubing coming from the house cold
water supply.
If you are using the GE SmartConnect™
tubing, the nuts are already assembled to
the tubing.
B If you are using copper tubing, insert
the end of the tubing into the refrigerator
connection, at the back of the refrigerator,
as far as possible. While holding the tubing,
tighten the fitting.
If you are using GE SmartConnect™ tubing,
insert the molded end of the tubing into the
refrigerator connection, at the back of the
refrigerator, and tighten the compression
nut until it is hand tight. Then tighten one
additional turn with a wrench. Overtightening
may cause leaks.
C Fasten the tubing into the clamp provided to
hold it in position. You may need to pry open
the clamp.
3 PLUG IN THE REFRIGERATOR
On models with an icemaker, before plugging
in the refrigerator, make sure the icemaker
power switch is set to the O (off) position.
See the grounding information attached to the
power cord.
One of the illustrations below will look like
the connection on your refrigerator.
4 PUT THE REFRIGERATOR IN PLACE
Icemaker-Ready models
Move the refrigerator to its final location.
1/4” Copper
Tubing
Tubing
Clamp
1/4”
Compression
Nut
Ferrule
(sleeve)
Refrigerator
Connection
5 LEVEL THE REFRIGERATOR
Adjustable legs at the front corners of the
refrigerator should be set so the refrigerator is
firmly positioned on the floor, and the front is
raised just enough that the door closes easily
when opened about halfway.
SmartConnect™
Tubing
To adjust the leveling legs, turn the
legs clockwise to raise the refrigerator,
counterclockwise to lower it.
Icemaker-Installed Models
Refrigerator
Connection
Ferrule
(sleeve)
1/4”
Compression
Nut
SmartConnect™
Tubing
1/4” Tubing
Tubing Clamp
18
Installation Instructions
7 REMOVE THE FREEZER DOOR HANDLE
6 REMOVE THE FRESH FOOD
DOOR HANDLE
Stainless steel and plastic handles:
Loosen the set screws located on the
underside of the handle with the 1/8” Allen
wrench and remove the handle.
NOTE: If the handle mounting fasteners need
to be tightened or removed, use a 3/16” Allen
wrench.
(For placement in the installation location
or reversal of the handles – on some
models)
Stainless steel (on
some models):
REMOVING
THE DOOR
HANDLE: Loosen
Badge
the set screws
A
with the 3/32”
Allen wrench
and remove
the handle. NOTE:
B
For Double Door
models follow the Mounting
same procedure Fasteners
on the opposite
(appearance may vary)
door.
(appearance may vary)
Plastic handle
(on some models):
REMOVING THE DOOR HANDLE: Depress the tab
on the underside left of the handle and slide the
handle left and off of the mounting fasteners.
Plastic handle
(on some models):
REMOVING THE DOOR HANDLE: Depress the
tab on the underside of the handle and slide
the handle up and off of the mounting
fasteners.
REVERSING THE DOOR HANDLE (on some
models):
• Remove
the handle
B
mounting
fasteners with
Badge
a 3/16” Allen
wrench and
A
transfer
the handle
mounting
Mounting
fasteners to Fasteners
the right side.
(appearance may vary)
• Remove the
logo badge.
• Remove and transfer the plug button to
the left side of the fresh food door. NOTE:
Use a flat plastic edge to prevent damaging
the door. Remove any adhesive on the door
with a mild detergent. Remove the paper
covering on the adhesive backing on
the logo badge prior to carefully attaching
the badge to the door.
Note: if the handle mounting fasteners need to be
tightened or removed use a 3/16” Allen wrench.
(appearance may vary)
19
Installation Instructions
INSTALLING THE REFRIGERATOR (cont.)
9 ATTACH THE FREEZER DOOR HANDLE
8 ATTACH THE FRESH FOOD
DOOR HANDLE
Stainless steel handle:
Attach the
handle to the
handle mounting
fasteners and
tighten the set
screws with a
3/32” Allen
wrench.
NOTE: For
Double Door
models follow
the same
procedure on the
opposite door.
Stainless steel and plastic handles:
Attach the handle firmly to the mounting
fasteners and tighten the set screws on
the bottom of the handle with a 1/8” Allen
wrench.
Plastic handle: (on some models)
A
Mounting
Fasteners
(appearance may vary)
(appearance may vary)
Attach the handle to the handle mounting
fasteners by aligning the slots with the handle
mounting fasteners.
Slide it right until it is firmly locked into position.
Plastic handle:
Attach the handle to the handle mounting
fasteners by aligning the slots with the
handle mounting fasteners.
Slide it down until it is firmly locked into
position.
Slots on back
of handle
Slots on back of
handle
Mounting
fasteners
NOTE: Before attaching the
handle, make sure the tab is
oriented as shown.
(appearance may vary)
(appearance may vary)
20
Installation Instructions
10 LEVEL THE REFRIGERATOR
11 SET THE CONTROLS
The leveling legs have 2 purposes:
1) Leveling legs adjust so the refrigerator is
firmly positioned on the floor and does not
wobble.
2) Leveling legs serve as a stabilizing brake
to hold the refrigerator securely in position
during operation and cleaning. The leveling
legs also prevent the refrigerator from
tipping.
Set the controls to the recommended setting.
A Remove the grille by removing the two Phillips
head screws.
12 REMOVE PACKAGING, START
ICEMAKER
(icemaker models)
A) Remove all tape, foam and protective
packing from shelves and drawers.
B) Remove the tie downs from the freezer
baskets.
C) Place half width basket onto drawer
slides. See About the freezer section for
instructions.
Set the icemaker power switch to the I (on)
position. The icemaker will not begin to operate
until it reaches its operating temperature of
15°F (–9°C) or below. It will then begin operation
automatically. It will take 2–3 days to fill the
ice bin.
B Turn the leveling legs clockwise to raise
the refrigerator, counterclockwise to lower it.
Power
switch
CAUTION
To avoid possible personal
injury or property damage, the leveling legs
must be firmly touching the floor.
NOTE:
In lower water pressure conditions, the water
valve may turn on up to 3 times to deliver
enough water to the icemaker.
C Replace the base grille by inserting the two
Phillips head screws.
21
Installation Instructions
REMOVING THE FREEZER DRAWER
2 REMOVE THE DRAWER FRONT FROM
THE SLIDES (cont.)
The freezer drawer can be removed, if needed,
to fit through tight areas.
Read these instructions completely and carefully.
B Lift up on both sides of the freezer drawer
handle to separate the drawer railings from
the rail assemblies.
C Set the drawer front on a non-scratching
surface.
D Push the rail assemblies back into locking
position.
1 REMOVE THE BASKET
A Open the freezer drawer until it stops.
B The freezer basket rests on a frame inside the
freezer drawer. Lift the basket up at the back.
C Lift the front up and lift the entire basket up
and out of the drawer.
Rail Assembly
Drawer
Assembly
3 REMOVE THE BASE GRILLE
(if needed)
If, after removing the freezer drawer and
refrigerator door, the refrigerator will still not
fit through a doorway, the base grille can be
removed.
A Remove the base grille by removing the screws.
2 REMOVE THE DRAWER FRONT
FROM THE SLIDES
A Remove the screw on each side of the railing.
Screw
22
Installation Instructions
1 ATTACH AND SECURE THE DRAWER
FRONT TO THE SLIDES (cont.)
Two people may be required to complete
this procedure.
E
Replace the screws on both rail assemblies.
1 ATTACH AND SECURE THE DRAWER
FRONT TO THE SLIDES
A Pull out the rail assemblies to the full length
on each side of the cabinet.
Screw
2 REPLACE THE FREEZER BASKET
B Locate the slots on the inside of the rail
assemblies near the back.
Replace the lower freezer basket by lowering it
into the frame.
Slot
Rail assembly
C Insert the hooks at the back of the drawer
railings into the slots on the rail assemblies.
D Lower the front of the drawer, making sure the
tabs on the sides of the railings fit into the front
slots in the rail assemblies.
Hook
Slot
Tab
23
Installation Instructions
REVERSING THE DOOR SWING (Single Door Refrigerator Models only)
1 REMOVE THE REFRIGERATOR DOOR
IMPORTANT NOTES
Tape the door shut with masking tape.
When reversing the door swing:
NOTE: Door swing is not reversible on stainless
steel models.
• Read the instructions all the way through before
starting.
• Parts are included in the door hinge kit.
• Handle parts carefully to avoid scratching paint.
• Set screws down by their related parts to avoid
using them in the wrong places.
• Provide a non-scratching work surface for
the doors.
IMPORTANT: Once you begin, do not move the
cabinet until door-swing reversal is completed.
These instructions are for changing the hinges
IURPWKHULJKWVLGHWRWKHOHIWVLGH³LI\RXHYHUZDQW
to change the hinges back to the right side, follow
these same instructions and reverse all references
to left and right.
• Once door swing is finalized, ensure the logo
badge is properly aligned and permanently
secured to the door by removing the adhesive
cover on the back side. NOTE: A replacement
logo badge is included in the hinge kit.
Unplug the refrigerator from its electrical outlet.
Empty all door shelves, including the dairy
compartment.
A
B
Remove the hinge cover on top of the
refrigerator door by carefully prying it up with a
putty knife, if necessary.
C Using a 5/16” socket ratchet/driver, remove
the bolts securing the top hinge to the cabinet.
Then lift the hinge straight up to free the hinge
pin from the socket in the top of the door.
D Carefully remove the door thimble from inside
the socket. This will be used again when
reinstalling the door on the other side.
Hinge Cover
Top Hinge
Door Thimble
TOOLS YOU WILL NEED
Adjustable Wrench
Masking Tape
Phillips Screwdriver
E
5/16” Socket Ratchet/
Driver
Remove the tape and tilt the door away from
the cabinet. Lift the door off the center hinge
pin. Ensure that the plastic hinge pin thimble
remains on the hinge pin or inside door hinge
pin hole located in the bottom of the door.
Thin-blade Screwdriver
Torx T-20 Driver
F Set the door on a non-scratching surface with
the inside up.
24
Installation Instructions
2 REMOVE CENTER HINGE
4 TRANSFER REFRIGERATOR DOOR STOP
A Remove the hinge pin from the hinge bracket.
The hinge pin will be used again with the new
hinge bracket for the other side.
A
B
C
B Using a 5/16” socket ratchet/driver, remove the
bolts securing the center hinge to the cabinet.
Set the bolts aside.
Remove the door stop on right side of the
bottom of the refrigerator door by removing
the two screws.
Move the plastic hinge hole thimble to the
opposite hole.
Install the door stop on the left side, making
sure to line up the screw holes in the door stop
with the holes in the bottom of the door.
Bottom of
Refrigerator Door
(Right Side)
3 INSTALL CENTER HINGE
A Transfer the plug button and screw hole cover
in the hinge holes on the left side to the right
side.
Bottom of
Refrigerator Door
(Left Side)
5 TRANSFER REFRIGERATOR
DOOR HANDLE TO RIGHT
Refer to Remove the Fresh Food Door Handle
and Attach the Fresh Food Door Handle
sections for instructions.
B A new hinge bracket is required for the left
side (supplied in the door hinge kit). Install the
center hinge from the kit on the left side.
C Install the hinge pin into the new hinge bracket.
25
Installation Instructions
REVERSING THE DOOR SWING (cont.)
6 REHANG REFRIGERATOR DOOR
A
Lower the refrigerator door onto the center
hinge pin. Ensure that the plastic hinge pin
thimble is on the center hinge pin or inside
door hinge pin hole located in the bottom
of the door.
B
Insert the door thimble into the hinge hole on
top of the refrigerator door and then insert the
top hinge pin. Make sure the door is aligned
with the cabinet. Attach the hinge to the top of
the cabinet loosely with the bolts.
Make sure the gasket on the door is flush
against the cabinet and is not folded. Support
the door on the handle side and make sure the
door is straight and the gap between the doors
is even across the front. While holding the door
in place, tighten the top hinge bolts. Replace
the hinge cover.
C
7 INSTALL THE LOGO BADGE
Remove the adhesive backing paper and align
the pins on the back of the badge with the
holes in the door. Apply pressure to the badge
to ensure it sticks to the door.
26
Installation Instructions
REMOVING THE DOORS (Double Door Refrigerator Models only)
IMPORTANT NOTES
1 REMOVE THE REFRIGERATOR DOORS
NOTE: Door swing is not reversible.
• Read the instructions all the way through before
starting.
• Handle parts carefully to avoid scratching paint.
• Set screws down by their related parts to avoid
using them in the wrong places.
• Provide a non-scratching work surface for
the doors.
IMPORTANT: Once you begin, do not move
the cabinet.
These instructions are for removing the doors.
Unplug the refrigerator from its electrical outlet.
Empty all door shelves, including the dairy
compartment.
A
Tape the doors shut with masking tape.
(for water dispenser models)
B
Start with left-hand door first: Remove the
screw securing the center hinge cover, lift the
hinge cover and place to the side on top of the
refrigerator.
Remove hinge cover
(1 Phillips screw)
TOOLS YOU WILL NEED
Adjustable Wrench
(for water dispenser models)
3/8” and 10 mm Socket
Ratchet/Driver
C
Remove water coupling and power coupling.
C1
Masking Tape
Thin-blade Screwdriver
Water Coupling
Remove the metal
spring clip. Use a
screwdriver to push
the red plastic locking
clip down and off.
Phillips Screwdriver
C2
Pull tube.
Water Coupling
Push red collar
and hold.
C3
Pull apart
power coupling
to disconnect
27
Power Coupling
Black mark
flush with
collar assembly
Installation Instructions
REMOVING THE DOORS (cont.)
1 REMOVE THE REFRIGERATOR DOORS
2 REMOVE CENTER HINGE
(cont.)
Using a 5/16” socket ratchet/driver, remove the
bolts securing the center hinge to the cabinet.
Set the hinge and bolts aside.
D Remove the hinge cover on top of the
refrigerator door by removing the Phillips head
screw and pulling it up.
E Using a 5/16” socket ratchet/driver, remove
the bolts securing the top hinge to the cabinet.
Then lift the hinge straight up to free the hinge
pin from the socket in the top of the door.
Hinge Cover
3 REMOVE OPPOSITE DOOR
Follow the same procedure on the opposite
door. There are no wires, water lines or center
hinge covers on the opposite side.
4 REMOVE FREEZER DRAWER
Top Hinge
F
Refer to the Removing the Freezer Drawer
section for instructions.
Remove the tape and tilt the door away from
the cabinet. Lift the door off the center hinge
pin. Ensure that the plastic hinge pin thimble
remains on the hinge pin or inside door hinge
pin hole located in the bottom of the door.
G Set the door on a non-scratching surface with
the inside up.
28
Installation Instructions
REPLACING THE DOORS (Double Door Refrigerator Models only)
2 REHANG REFRIGERATOR DOORS (CONT.)
1 INSTALL CENTER HINGE
E Make sure the gasket on the door is flush
against the cabinet and is not folded. Make
sure the door is straight and the gap between
the doors is even across the front. While
holding the aligned door in place, tighten
the top hinge bolts. Replace the hinge cover
and screw.
Install the center hinge on each side.
2 REHANG REFRIGERATOR DOORS
Hinge Cover
A Lower the refrigerator door onto the center
hinge pin. Ensure that the plastic hinge pin
thimble is on the center hinge pin or inside
door hinge pin hole located in the bottom
of the door.
Top Hinge
Bolts
(appearance may vary)
3 REPLACE OPPOSITE DOOR
Hinge Pin
Follow the same procedure on the opposite
door. There is no water line or hinge cover.
B Securely tape the door shut with masking tape
or have a second person support the door.
C Route wires through bottom left hinge pin slot.
Insert the top hinge pin into the hinge hole
on top of the refrigerator door. Make sure the
door is aligned with the cabinet and opposite
door. Attach the hinge to the top of the cabinet
loosely with the bolts.
4 ALIGN DOUBLE DOORS
If the top of the doors are uneven, first try to
raise the lowest door by turning the leveling leg
on the same side as the door until the doors
are even. If the unit rocks, re-adjust the leveling
legs to the extent that the unit is stable.
Bottom
Left Hinge
Pin Slot
(appearance may vary)
If the doors remain uneven, turn the adjustable
pin to raise, or lower, the left door to match
the right door. Use a 1/4” Allen wrench to turn
the pin.
D On left-hand doors, pass the wires and water
line through the center hinge pin. Then connect
the water line and 4-pin connector.
Adjustable pin
Center Hinge Pin
5 REPLACE FREEZER DRAWER
4-Pin
Connector
Refer to the Replacing the Freezer Drawer
section for instructions.
Water Line
29
Installation Instructions
INSTALLING THE WATER LINE (ICEMAKER MODELS)
WHAT YOU WILL NEED
BEFORE YOU BEGIN
Recommended copper water supply kits are
WX8X2, WX8X3 or WX8X4, depending on the
amount of tubing you need. Approved plastic
water supply lines are GE SmartConnect™
Refrigerator Tubing (WX08X10006, WX08X10015
and WX08X10025).
When connecting your refrigerator to a GE Reverse
Osmosis Water System, the only approved
installation is with a GE RVKit. For other reverse
osmosis water systems, follow the manufacturer’s
recommendations.
If the water supply to the refrigerator is from
a Reverse Osmosis Water Filtration System
AND the refrigerator also has a water filter,
use the refrigerator’s filter bypass plug. Using
the refrigerator’s water filtration cartridge in
conjunction with the RO filter can result in hollow
ice cubes.
This water line installation is not warranted by
the refrigerator or icemaker manufacturer. Follow
these instructions carefully to minimize the risk of
expensive water damage.
Water hammer (water banging in the pipes) in
house plumbing can cause damage to refrigerator
parts and lead to water leakage or flooding. Call a
qualified plumber to correct water hammer before
installing the water supply line to the refrigerator.
To prevent burns and product damage, do not hook
up the water line to the hot water line.
If you use your refrigerator before connecting
the water line, make sure the icemaker power
switch is in the O (off) position.
Do not install the icemaker tubing in areas where
temperatures fall below freezing.
When using any electrical device (such as a power
drill) during installation, be sure the device is double
insulated or grounded in a manner to prevent the
hazard of electric shock, or is battery powered.
All installations must be in accordance with local
plumbing code requirements.
• Copper or GE SmartConnect™ Refrigerator
Tubing kit, 1/4” outer diameter to connect the
refrigerator to the water supply. If using copper,
be sure both ends of the tubing are cut square.
To determine how much tubing you need: measure
the distance from the water valve on the back
of the refrigerator to the water supply pipe.
Be sure there is sufficient extra tubing to allow
the refrigerator to move out from the wall after
installation.
GE SmartConnect™ Refrigerator Tubing Kits
are available in the following lengths:
8’ (2.4 m)
– WX08X10006
15’ (4.6 m) – WX08X10015
25’ (7.6 m) – WX08X10025
30
Installation Instructions
Install the shutoff valve on the nearest frequently
used drinking water line.
WHAT YOU WILL NEED (CONT.)
NOTE: The only GE approved plastic tubing
is that supplied in GE SmartConnect™ Refrigerator
Tubing kits. Do not use any other plastic water
supply line because the line is under pressure
at all times. Certain types of plastic will crack or
rupture with age and cause water damage to
your home.
• A GE water supply kit (containing tubing,
shutoff valve and fittings listed below) is available
at extra cost from your dealer or from Parts
and Accessories, 800.626.2002 (in Canada
1.888.261.3055).
• A cold water supply. The water pressure must
be between 20 and 120 p.s.i. (1.4–8.1 bar).
1 SHUT OFF THE MAIN WATER SUPPLY
Turn on the nearest faucet long enough
to clear the line of water.
2 CHOOSE THE VALVE LOCATION
Choose a location for the valve that is easily
accessible. It is best to connect into the side
of a vertical water pipe. When it is necessary
to connect into a horizontal water pipe, make
the connection to the top or side, rather than at
the bottom, to avoid drawing off any sediment
from the water pipe.
• Power drill.
• 1/2” or adjustable wrench.
• Straight and Phillips blade screwdriver.
• Two 1/4” outer diameter compression nuts
DQGIHUUXOHVVOHHYHV³to connect the copper
tubing to the shutoff valve and the refrigerator
water valve.
OR
• If you are using a GE SmartConnect™
Refrigerator Tubing kit, the necessary fittings
are preassembled to the tubing.
3 DRILL THE HOLE FOR THE VALVE
Drill a 1/4” hole in the water pipe (even if using
a self-piercing valve), using a sharp bit. Remove
any burrs resulting from drilling the hole in
the pipe.
Take care not to allow water to drain into the
drill.
• If your existing copper water line has a flared
fitting at the end, you will need an adapter
(available at plumbing supply stores) to connect
the water line to the refrigerator OR you can cut
off the flared fitting with a tube cutter and then
use a compression fitting. Do not cut formed end
from GE SmartConnect™ Refrigerator tubing.
Failure to drill a 1/4” hole may result in reduced
ice production or smaller cubes.
• Shutoff valve to connect to the cold water line.
The shutoff valve should have a water inlet with
a minimum inside diameter of 5/32” at the
point of connection to the COLD WATER LINE.
Saddle-type shutoff valves are included in many
water supply kits. Before purchasing, make sure
a saddle-type valve complies with your local
plumbing codes.
31
Installation Instructions
INSTALLING THE WATER LINE (cont.)
4 FASTEN THE SHUTOFF VALVE
7 CONNECT THE TUBING TO THE VALVE
Fasten the shutoff valve to the cold water pipe
with the pipe clamp.
Place the compression nut and ferrule (sleeve)
for copper tubing onto the end of the tubing and
connect it to the shutoff valve.
Pipe Clamp
Make sure the tubing is fully inserted into
the valve. Tighten the compression nut securely.
For plastic tubing from a GE SmartConnect™
Refrigerator Tubing kit, insert the molded end
of the tubing into the shutoff valve and tighten
compression nut until it is hand tight, then
tighten one additional turn with a wrench.
Overtightening may cause leaks.
Vertical Cold Water Pipe
Saddle-Type
Shutoff Valve
NOTE: Commonwealth of Massachusetts
Plumbing Codes 248CMR shall be adhered to.
Saddle valves are illegal and use is not permitted
in Massachusetts. Consult with your licensed
plumber.
Saddle-Type
Shutoff Valve
SmartConnect™
Tubing
5 TIGHTEN THE PIPE CLAMP
Packing Nut
Tighten the clamp screws until the sealing
washer begins to swell.
NOTE: Do not overtighten or you may crush
the tubing.
Outlet Valve
Ferrule (sleeve)
NOTE: Commonwealth of Massachusetts
Plumbing Codes 248CMR shall be adhered to.
Saddle valves are illegal and use is not permitted
in Massachusetts. Consult with your licensed
plumber.
Washer
Pipe Clamp
Compression Nut
Inlet End
Clamp
Screw
8 FLUSH OUT THE TUBING
Turn the main water supply on and flush out
the tubing until the water is clear.
Shut the water off at the water valve after
about one quart (1 liter) of water has been
flushed through the tubing.
6 ROUTE THE TUBING
Route the tubing between the cold water line
and the refrigerator.
Route the tubing through a hole drilled in the
wall or floor (behind the refrigerator or adjacent
base cabinet) as close to the wall as possible.
To complete the installation of the refrigerator,
go back to Step 1 in Installing the Refrigerator.
32
Normal operating sounds.
GEAppliances.com
Newer refrigerators sound different from older refrigerators.
Modern refrigerators have more features and use newer technology.
Do you hear what I hear? These sounds are normal.
HUMMM...
WHOOSH...
„ The new high efficiency compressor may run faster
and longer than your old refrigerator and you may
hear a high-pitched hum or pulsating sound while
it is operating.
„ You may hear a whooshing sound when the
doors close. This is due to pressure equalizing within
the refrigerator.
„ You may hear the fans spinning at high speeds.
This happens when the refrigerator is first plugged in,
when the doors are opened frequently or when a large
amount of food is added to the refrigerator or freezer
compartments. The fans are helping to maintain the
correct temperatures.
„ The fans change speeds in order to provide optimal
cooling and energy savings.
CLICKS, POPS,
CRACKS and SNAPS
WATER SOUNDS
„ You may hear cracking or popping sounds when
the refrigerator is first plugged in. This happens as
the refrigerator cools to the correct temperature.
„ The freezer control will click when starting or stopping
the compressor.
„ Defrost timer snapping in and out of the defrost cycle.
„ Expansion and contraction of cooling coils during and
after defrost can cause a cracking or popping sound.
„ On models with an icemaker, after an icemaking cycle,
you may hear the ice cubes dropping into the ice
bucket.
„ The flow of refrigerant through the freezer cooling coils
may make a gurgling noise like boiling water.
„ Water dropping on the defrost heater can cause a sizzling,
popping or buzzing sound during the defrost cycle.
„ A water dripping noise may occur during the defrost cycle
as ice melts from the evaporator and flows into the drain
pan.
„ Closing the door may cause a gurgling sound due to
pressure equalization.
„ On models with a dispenser, during water dispense,
For additional information on normal
icemaker operating sounds, see the
About the automatic icemaker section.
you may hear the water lines move at initial dispense
and after dispenser button is released.
Before you call for service…
Troubleshooting Tips
Save time and money! Review the charts on
the following pages first and you may not need to call
for service.
Problem
Possible Causes
What To Do
Refrigerator does not
operate
Refrigerator in defrost cycle.
• Wait about 30 minutes for defrost cycle to end.
Control in 0 (off) position.
• Move the control to a temperature setting.
Refrigerator is unplugged.
• Push the plug completely into the outlet.
The fuse is blown/circuit
breaker is tripped.
• Replace fuse or reset the breaker.
Leveling legs need adjusting.
• See Level the Refrigerator.
Vibration or rattling
(slight vibration
is normal)
33
Before you call for service…
Troubleshooting Tips
Problem
Possible Causes
What To Do
Motor operates for
long periods or cycles
on and off frequently.
(Modern refrigerators
with more storage
space and a larger
freezer require more
operating time. They
start and stop often
to maintain even
temperatures.)
Normal when refrigerator
is first plugged in.
• Wait 24 hours for the refrigerator to completely
cool down.
Often occurs when large
amounts of food are
placed in refrigerator.
• This is normal.
Door left open.
• Check to see if package is holding door open.
Hot weather or frequent
door openings.
• This is normal.
Temperature control
set at the coldest setting.
• See About the controls.
TurboCool function has been
activated.
• This is normal when the TurboCool function is activated.
See About TurboCool for more information.
Temperature controls not set
cold enough.
• See About the controls.
Warm weather or frequent
door openings.
• Set the temperature control one step colder.
See About the controls.
Door left open.
• Check to see if package is holding door open.
Frost or ice crystals
on frozen food
(frost within package
is normal)
Door left open.
• Check to see if package is holding door open.
Door openings too frequent
or too long.
• This is normal.
Frequent “buzzing”
sound
Icemaker power switch is in
the I (on) position, but the
water supply to the refrigerator
has not been connected.
• Set the power switch to the 0 (off) position. Keeping it
in the I (on) position will damage the water valve.
Small or hollow cubes
Water filter clogged.
• Replace filter cartridge with new cartridge or with plug.
Automatic icemaker
(on some models)
does not work
Icemaker power switch is
not on.
• Set the power switch to the I (on) position.
The icemaker power light will turn green when the
freezer light switch is pressed in or when the freezer
door is closed.
Water supply turned off or
not connected.
• See Installing the water line.
Freezer compartment
too warm.
• Wait 24 hours for the refrigerator to completely
cool down.
Piled up cubes in the storage
bin cause the icemaker
to shut off.
• Level cubes by hand.
Ice cubes stuck in icemaker.
(Green power light on
icemaker blinking.)
• Turn off the icemaker, remove cubes and turn
the icemaker back on.
Icemaker light is not lit.
• This is normal when the freezer door is open. The
icemaker power light will turn green when the freezer
light switch is pressed in or when the freezer door is
closed.
Refrigerator or freezer
compartment too warm
34
GEAppliances.com
Problem
Possible Causes
What To Do
Ice cubes have
odor/taste
Food transmitting odor/taste
to ice cubes.
• Wrap foods well.
Interior of refrigerator
needs cleaning.
• See Care and cleaning.
• Keep an open box of baking soda in the refrigerator;
replace every three months.
Door left open.
• Check to see if package is holding door open.
Freezer control not set
cold enough.
• See About the controls.
Foods transmitting
odor to refrigerator.
• Foods with strong odors should be tightly wrapped.
• Keep an open box of baking soda in the refrigerator;
replace every three months.
Interior needs cleaning.
• See Care and cleaning.
Moisture forms on
outside of refrigerator
Not unusual during
periods of high humidity.
• Wipe surface dry and reset the refrigerator control
one setting colder.
Moisture collects inside
(in humid weather, air
carries moisture into
refrigerator when
doors are opened)
Too frequent or too
long door openings.
• This is normal.
Refrigerator or freezer
compartment light
does not work
No power at outlet.
• Replace fuse or reset the breaker.
Light bulb burned out or loose.
• See Replacing the light bulbs.
Door/drawer does not
close by itself
Leveling legs need adjusting.
• See Installing the Refrigerator.
Freezer door/drawer
pops open when
refrigerator door
is closed
This is normal if, after popping
open, the freezer door/drawer
closed on its own.
• This indicates that there is a good seal on the freezer
door/drawer. If the freezer door/drawer does not
automatically close after popping open, then see the
Problem: Door/drawer does not close by itself, above.
Hot air from bottom
of refrigerator
Normal air flow cooling
motor. In the refrigeration
process, it is normal that
heat be expelled in the
area under the refrigerator.
Some floor coverings will
discolor at these normal
and safe temperatures.
Food freezing in
the refrigerator
Food too close to the air vent
at the back of the refrigerator.
• Move the food away from the air vent.
Refrigerator control is set
too cold.
• Move the refrigerator control to a warmer
temperature setting one increment at a time.
Defrost heater is on.
• This is normal.
Slow ice cube freezing
Refrigerator has odor
Orange glow
in the freezer
35
Before you call for service…
Troubleshooting Tips
Problem
Possible Causes
What To Do
Water has poor
taste/odor
Water dispenser has not been
used for a long time.
• Dispense water until all water in system is
replenished.
Water in first glass
is warm
Normal when refrigerator
is first installed.
• Wait 24 hours for the refrigerator to completely
cool down.
Water dispenser has not been
used for a long time.
• Dispense water until all water is system is
replenished.
Water system has been drained. • Allow several hours for replenished supply to chill.
Water dispenser
does not work
Water supply line turned off
or not connected.
• See Installing the water line.
Water filter clogged.
• Replace filter cartridge or remove filter and install plug.
Air may be trapped in
the water system.
• Press the dispenser arm for at least 2 minutes.
Water in reservoir is frozen
because the controls are set
too cold.
• Set the refrigerator control to a warmer setting
and wait 24 hours. If water does not dispense after
24 hours, call for service.
Water spurting from
dispenser
Newly-installed filter cartridge. • Run water from the dispenser for 3 minutes
(about 11ø 2 gallons).
No water or ice cube
production
Supply line or shutoff valve
is clogged.
• Call a plumber.
Water filter clogged.
• Replace filter cartridge or remove filter and install plug.
Filter cartridge not
properly installed.
• Remove and reinstall filter cartridge, being certain that
it locks into place. The blade on the end of the cartridge
should be positioned vertically.
Glass not being held under
the dispenser long enough
after button is released.
• Hold the glass underneath the dispenser for 2–3
seconds after releasing the dispenser button. Water
may continue to dispense after the button is released.
Air may be present in the
water line system, causing
water to drip after being
dispensed.
• Dispense water for at least 2 minutes to remove air
from system.
Water is leaking from
dispenser
36
GEAppliances.com
Problem
Possible Causes
What To Do
My display is
showing
TurboCool function is activated. • See About TurboCool for more information.
Water filter indicator
light changed color
This is normal.
• See About the water filter for more information.
Water filter indicator
light remains red
even after replacing
the water filter
Water filter indicator must
be reset.
• Press and hold the RESET WATER FILTER pad for
3 seconds. See About the water filter for more
information.
Water filter indicator
light is not lit
This is normal. This light will
• See About the water filter for more information.
turn orange to tell you that you
need to replace the filter soon.
The filter cartridge should be
replaced when the replacement
indicator light turns red.
Handle is loose /
handle has a gap
Handle needs adjusting.
• See Attach the Fresh Food handle and Attach the
Freezer handle sections for detailed instructions.
Refrigerator beeping
This is the door alarm.
• Close door.
Control setting is
not lit
On some models, the light bulbs • If the control settings do not light up, check to see if
at the top of the refrigerator
the light bulbs are burned out, and replace if necessary.
compartment light up the
temperature control settings.
Refrigerator doors are
not even (on Double
Door models only)
Doors need realigning.
• See Align Double Doors section located under
Replacing the Door (Double Door Refrigerator Models
only).
Baskets stick or jam
when opening or
closing
Baskets are too full.
• To open: remove some of the products from
the basket when opened as far as possible.
Readjust the products left in the basket and
try to open the basket again.
• To close: readjust products in the basket or remove
any product that is above the rim of the basket and
close the basket.
37
Refrigerator Warranty.
All warranty service provided by our Factory Service Centers,
or an authorized Customer Care® technician. To schedule service
on-line, visit us at GEAppliances.com, or call 800.GE.CARES
(800.432.2737). Please have serial number and model number
available when calling for service.
In Canada, call 800.561.3344.
For The Period Of:
Staple your receipt here.
Proof of the original purchase
date is needed to obtain service
under the warranty.
GE Will Replace:
GE and GE PROFILE MODELS:
One Year
Any part of the refrigerator which fails due to a defect in materials or workmanship.
From the date of the
During this limited one-year warranty, GE will also provide, free of charge, all labor and
original purchase
related service to replace the defective part.
Thirty Days
(Water filter, if included)
From the original
purchase date of
the refrigerator
Any part of the water filter cartridge which fails due to a defect in materials or workmanship.
During this limited thirty-day warranty, GE will also provide, free of charge, a replacement water
filter cartridge.
GE PROFILE MODELS O NLY:
Five Years
Any part of the sealed refrigerating system (the compressor, condenser, evaporator
(GE Profile models only) and all connecting tubing) which fails due to a defect in materials or workmanship.
From the date of the
During this limited five-year sealed refrigerating system warranty, GE will also provide,
free of charge, all labor and related service to replace the defective part in the sealed
original purchase
refrigerating system.
What GE Will Not Cover:
„ Service trips to your home to teach you how to use
the product.
„ Improper installation, delivery or maintenance.
„ Failure of the product if it is abused, misused, or used for
other than the intended purpose or used commercially.
„ Loss of food due to spoilage.
„ Replacement of house fuses or resetting of circuit breakers.
„ Damage to finish, such as surface rust, tarnish, or small
blemishes not reported within 48 hours of delivery.
„ Replacement of the water filter cartridge, if included, due
to water pressure that is outside the specified operating
range or due to excessive sediment in the water supply.
„ Replacement of the light bulbs, if included, or water filter
cartridge, if included, other than as noted above.
„ Damage to the product caused by accident, fire, floods
or acts of God.
„ Incidental or consequential damage caused by possible
defects with this appliance.
„ Product not accessible to provide required service.
(;&/86,212),03/,(':$55$17,(6³<RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHG
in this Limited Warranty. Any implied warranties, including the implied warranties of merchantability or
fitness for a particular purpose, are limited to one year or the shortest period allowed by law.
For US Customers: This warranty is extended to the original purchaser and any succeeding owner for products
purchased for home use within the USA. If the product is located in an area where service by a GE Authorized
Servicer is not available, you may be responsible for a trip charge or you may be required to bring the product
to an Authorized GE Service location for service. In Alaska, the warranty excludes the cost of shipping or service
calls to your home.
Some states do not allow the exclusion or limitation of incidental or consequential damages. This warranty gives
you specific legal rights, and you may also have other rights which vary from state to state. To know what your
legal rights are, consult your local or state consumer affairs office or your state’s Attorney General.
Warrantor US: General Electric Company. Louisville, KY 40225
For Customers in Canada: This warranty is extended to the original purchaser and any succeeding owner for
products purchased in Canada for home use within Canada. In-home warrant service will be provided in areas
where it is available and deemed reasonable by MC Commercial to provide.
Warrantor Canada: MC Commercial, Burlington, Ontario, L7R 5B6
38
Performance Data Sheet
SmartWater™ Filtration System³GE MWF Cartridge
Performance Data Information
Capacity: 300 Gallons (1,135 Liters)
7KHFRQFHQWUDWLRQRIWKHFRQWDPLQDQWVWHVWHGIRUWKLV¿OWHULQZDWHUHQWHULQJWKHV\VWHPZDVUHGXFHGWR
DFRQFHQWUDWLRQOHVVWKDQRUHTXDOWRWKHSHUPLVVLEOHOLPLWIRUZDWHUOHDYLQJWKHV\VWHPDVVSHFL¿HGLQ
16)$16,6WDQGDUGDQG6WDQGDUG6\VWHPWHVWHGDQGFHUWL¿HGE\16),QWHUQDWLRQDODJDLQVW16)
ANSI Standard 42 and Standard 53.
Please see geappliances.com for complete listing of the contaminants tested and the amounts reduced.
The following pharmaceutical reduction claims have not been certi¿ed by NSF International or the state of California.
Claims tested and veri¿ed by independent laboratory:
Contaminant
Reduction
Atenolol
Fluoxetine
Ibuprofen
Progesterone
Trimethoprim
AvHUDJH,Q¾XHQW
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
16)VSHFL½HG
Challenge Concentration
N/A
N/A
N/A
N/A
N/A
Avg %
Reduction
99.5%
99.4%
94.1%
99.5%
99.5%
Average Product
Water
Concentration
5.0 ng/L
5.4 ng/L
52.3 ng/L
5.0 ng/L
2.0 ng/L
Max Permissible
Product Water NSF Reduction
Concentration Requirements
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
NSF
Test Report
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Application Guidelines/Water Supply Parameters
Service Flow
Water Supply
0.5 gpm (21.9 lpm)
Potable Water
Water Pressure
Water Temperature
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
It is essential that the manufacturer’s recommended installation, maintenance and filter replacement requirements be carried out for the product to perform as advertised.
See Installation Manual for Warranty information.
Note: While the testing was performed under standard laboratory conditions,
actual performance may vary.
Replacement Cartridge: MWF. For estimated costs of replacement elements
please call 1-800-626-2002 or visit our website at www.geapplianceparts.com.
WARNING
WARNING
To reduce the risk associated with ingestion of contaminants:
• Do not use with water that is microbiologically unsafe or of unknown quality
without adequate disinfection before and after the system. Systems certL¿ed
for cyst reduction may be used on disinfected water that may contain ¿lterable
cysts. EPA Establishment Number 10350-MN-005.
For conditions of use, health claims certified by the California Department of Public
Health, and replacements, see performance data sheet. California Department
of Public Health Certification #05-1698. The contaminants or other substances
removed or reduced by this water filter are not necessarily in all users’ water.
REPLACEMENT
ELEMENT
NOTICE
To reduce the risk associated with property damage due to water leakage:
• Read and follow use instructions before installation and use of this system.
• Installation and use MUST comply with all state and local plumbing codes.
• Do not install if water pressure exceeds 120 psi (8.2 bar). If your water pressure
exceeds 80 psi, you must install a pressure-limiting valve. Contact a plumbing
professional if you are uncertain how to check your water pressure.
• Do not install where water hammer conditions may occur. If water hammer
conditions exist you must install a water hammer arrester. Contact a plumbing
professional if you are uncertain how to check for this condition.
• Do not install on hot water supply lines. The maximum operating water
temperature of this ¿lter system is 100º F (38º C).
• Protect ¿lter from freezing. Drain ¿lter when temperatures drop
below 33ºF (0.6ºC).
•
must be replaced every 6 months at the
rated capacity, or sooner if a noticeable reduction in ÀRw rate occurs.
Tested and cerWL½ed by NSF International
against NSF/ANSI Standard 42 and
Standard 53 in model GE MWF for the
reduction of the claims speci½Hd on the
performance data sheet.
39
Performance Data Sheet
SmartWater Filtration System
GSWF Cartridge
This system has been tested according to NSF/ANSI 42/53 for reduction of the substances listed below.
The concentration of the indicated substances in water entering the system was reduced to a concentration
less than or equal to the permissible limit for water leaving the system, as specified in NSF/ANSI 42/53.*
(100% safety factors built in for unmetered usage)
Standard No. 42: Aesthetic Effects
Parameter
USEPA
MCL
³
³
³
&KORULQH
72
3DUWLFXODWH
Influent
Average
PJ/
³
P/
Influent Challenge
Concentration
PJ/+10%
³
at least 10,000 particles/mL
Effluent
Average
Maximum
< 0.05 mg/L
0.05 mg/L
³
³
P/
P/
% Reduction
Average
Minimum
> 97.29%
96.43%
³
³
Min. Required
Reduction
> 50%
³
> 85%
% Reduction
Average
Minimum
98.97%
98.61%
> 99.99%
> 99.99%
> 99.33%
> 99.33%
> 99.29%
97.86%
99.07%
98.75%
> 76.12%
> 66.67%
Min. Required
Reduction
0.5 NTU
> 99.95%
0.010 mg/L
0.010 mg/L
0.0002 mg/L
0.003 mg/L
Standard No. 53: Health Effects
Parameter
Turbidity
Cysts
Lead at pH 6.5
Lead at pH 8.5
Lindane
Atrazine
USEPA
MCL
1 NTU***
99.95% Reduction
0.015 mg/L
0.015 mg/L
0.0002 mg/L
0.003 mg/L
Influent
Average
10.3 NTU***
/
0.15 mg/L
0.14 mg/L
0.0216 mg/L
0.008 mg/L
Influent Challenge
Effluent
Concentration
Average
Maximum
1+1 NTU***
0.106 NTU
0.14 NTU
Minimum 50,000 L
0
0
0.15 mg/L+10%
< 0.001 mg/L
< 0.001 mg/L
0.15 mg/L+10%
0.001 mg/L
0.003 mg/L
0.002 mg/L+10% < 0.00002 mg/L < 0.00002 mg/L
0.009 mg/L+10% < 0.002 mg/L
< 0.002 mg/L
* Tested using a flow rate of 0.5 gpm; pressure of 60 psig; pH of 7.5 ± 0.5; temp. of 68° ± 5°F (20° ± 3°C)
** Measurement in Particles/ml. Particles used were 0.5-1 microns
*** NTU=Nephelometric Turbidity units
Operating Specifications
„
„
„
„
Capacity: certified for up to 750 gallons (2,838 l); up to six months
Pressure requirement: 40–120 psi (2.8–8.2 bar)
Temperature: 33–100ºF (0.6–38ºC)
Flow rate: 0.5 gpm (1.9 lpm)
General Installation/Operation/Maintenance Requirements
„
„
Flush new cartridge at full flow for 3 minutes to purge out trapped air.
Replace cartridge when flow becomes too slow.
Special Notices
Installation instructions, parts and service availability, and standard warranty are included with the product when shipped.
This drinking water system must be maintained according to manufacturer’s instructions, including replacement of filter
cartridges.
„ Do not use with water that is microbiologically unsafe or of unknown quality without adequate disinfection before or after
the system. Systems certified for cyst reduction may be used on disinfected water that may contain filterable cysts.
„ The contaminants or other substances removed or reduced by this water treatment system are not necessarily in your water.
„ Check for compliance with the state and local laws and regulations.
„ Note that while the testing was performed under standard laboratory conditions, actual performance may vary. Systems
must be installed and operated in accordance with manufacturer’s recommended procedures and guidelines.
„
„
System tested and certified by NSF International against Standard 42 for the reduction of
chlorine, taste and odor, particulate Class I and Standard 53 for the reduction of cyst, lead,
Lindane, Atrazine and turbidity.
Manufactured for: General Electric Company, Louisville, KY 40225
40
NSF
®
Mesures de sécurité . . . . . . . . . . . . . . . . 42, 43
Fonctionnement
Caractéristiques supplémentaires . . . . . . . . . . 49
Clayettes et bacs. . . . . . . . . . . . . . . . . . . . . . . . 48, 49
Congélateur. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51
Entretien et nettoyage
du réfrigérateur . . . . . . . . . . . . . . . . . . . . . . . . . 53, 54
Le filtre à eau . . . . . . . . . . . . . . . . . . . . . . . . . . . 46, 47
Les bacs à rangement et bacs à légume . . . 50
Les commandes . . . . . . . . . . . . . . . . . . . . . . . . 44, 25
Machine à glaçons automatique. . . . . . . . . . . . 52
Remplacement des ampoules . . . . . . . . . . . . . . 55
Installation
Changement du sens
d’ouverture des portes
(modèles de réfrigérateurs
à une porte uniquement). . . . . . . . . . . . . . . . 64–66
Enlèvement et remise en place
des portes (modèles de réfrigérateurs
à deux portes uniquement) . . . . . . . . . . . . . 67–69
Enlèvement du tiroir
du compartiment congélation . . . . . . . . . . . . . . 62
Installation de la conduite d’eau . . . . . . . . 70–72
Installation du réfrigérateur . . . . . . . . . . . . . 57–61
Préparation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56
Remise en place du tiroir
du compartiment congélation . . . . . . . . . . . . . . 63
Conseils de dépannage . . . . . . . . . . . . 73–77
Bruits normaux de fonctionnement . . . . . . . . . 73
Soutien au consommateur
Feuillet de données relatives à la
performance de la cartouche . . . . . . . . . . . 79, 80
Garantie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78
Soutien au consommateur . . . . . . . . . . . . . . . . . 82
Transcrivez les numéros de modèle et de série ici :
# de modèle _____________________________
# de série _______________________________
Ils figurent sur l’étiquette qui se trouve à l’interieur
du compartiment réfrigérateur en haute à droite.
41
MESURES DE SÉCURITÉ IMPORTANTES.
LISEZ D’ABORD TOUTES LES DIRECTIVES.
SÉCURITÉ
Site Internet d’Électroménagers GE
Pour de plus amples informations sur le fonctionnement de votre réfrigérateur, consultez
le site www.electromenagersge.ca ou composez le 800.561.3344.
CONSIGNES DE SÉCURITÉ POUR LE RÉFRIGÉRATEUR
Ce symbole représente une alerte de sécurité. Ce symbole vous avise de dangers possibles pouvant causer
la mort, des blessures ou autres. Tous les messages de sécurité seront précédés du symbole d’alerte de sécurité
ainsi que des mots « DANGER », « AVERTISSEMENT » ou « MISE EN GARDE ». Ces messages sont les suivants :
Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, entraînera des blessures
graves, voire la mort.
. un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
AVERTISSEMENT Signale une situation qui présente
blessures graves, voire la mort.
MISE EN GARDE Signale une situation qui présente un danger imminent et qui, si elle n’est pas évitée, peut entraîner des
blessures mineures ou graves.
DANGER
AVERTISSEMENT
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque d’incendie, d’explosion, de choc électrique ou de blessures
lorsque vous utilisez votre réfrigérateurde , veuillez suivre ces consignes de sécurité :
„ Ce réfrigérateur doit être correctement installé conformément aux
Consignes d’Installation avant toute utilisation.
„ Débranchez le réfrigérateur avant d’effectuer une réparation, de
remplacer une ampoule ou de le nettoyer.
Remarque : L’alimentation du réfrigérateur ne peut être
déconnectée par aucune des fonctions sur le panneau de
commande.
Remarque : Les réparations doivent être effectuées par un
professionnel qualifié.
„ Remettez toutes les pièces et panneaux en place avant d’utiliser
l’appareil.
„ Ne stockez pas ou n’utilisez pas d’essence ou d’autres vapeurs et
liquides inflammables à proximité de cet appareil ou de tout autre
appareil électroménager.
„ Nous déconseillons fortement l’utilisation d’une rallonge à cause
des risques potentiels dans certaines conditions. Cependant, si
l’utilisation d’un cordon prolongateur est nécessaire, ce dernier doit
obligatoirement être homologué UL (aux USA) ou CSA (au Canada),
à trois brins avec mise à la terre pour appareil électroménager et
doit être équipé d’une fiche et d’une prise femelle avec terre. Les
caractéristiques électriques du cordon prolongateur doivent être de
15 ampères (minimum) et de 120 volts.
„ Pour éviter les risques d’asphyxie et d’enfermement pour les
enfants. Démontez les portes du congélateur et du compartiment
de réfrigération avant de le mettre au rebut ou d’interrompre son
utilisation.
„ Ne laissez pas les enfants grimper, se mettre debout ou se
suspendre aux poignées de portes dans le réfrigérateur ou aux
clayettes du réfrigérateur. Ils pourraient se blesser gravement.
IMPORTANTES CONSIGNES DE SÉCURITÉ
Pour réduire le risque de blessures lorsque vous utilisez votre réfrigérateurde , veuillez
ATTENTION suivre ces consignes de sécurité.
„ Ne nettoyez pas les clayettes ou les couvercles en verre avec de
l’eau tiède quand ceux-ci sont froids. Les clayettes et couvercles
en verre peuvent se casser s’ils sont exposés à des changements
soudains de température ou si vous les cognez ou les faites
tomber. Le verre trempé est conçu pour se briser en petits
morceaux en cas de casse
„ Éloignez les doigts des parties du congélateur où l’on peut
facilement se pincer : les espaces entre les portes, et entre les
portes et les placards sont toujours étroits. Soyez prudent lorsque
vous fermez les portes en présence d’enfants.
42
„ Ne touchez pas les surfaces froides du congélateur lorsque vous
avez les mains humides ou mouillées. La peau risque d’adhérer à
ces surfaces extrêmement froides.
„ Ne recongelez pas les aliments surgelés qui ont complètement
dégelé.
„ Si votre réfrigérateur est doté d’une machine à glaçons
automatique, évitez le contact avec les pièces mobiles du
mécanisme éjecteur, ou avec l’élément chauffant qui libère les
glaçons. Ne posez pas les doigts ou les mains sur le mécanisme de
la machine à glaçons automatique pendant que le réfrigérateur est
branché.
www.electromenagersge.ca
SÉCURITÉ
(CONT.)
INSTALLATION
Risque d’explosion.
Conservez les matériaux et vapeurs inflammables tels que l’essence à l’écart de votre réfrigérateur.
Une explosion, un incendie voire la mort pourrait en résulter.
AVERTISSEMENT
BRANCHEMENTS ÉLECTRIQUES
AVERTISSEMENT
Risque de choc électrique.
Branchez l’appareil dans une prise triple avec terre.
Ne retirez pas la broche de terre.
N’utilisez pas d’adaptateur.
Le non-respect de ces instructions peut entraîner
des risques d’incendies, des chocs électriques ou la
mort.
Ne coupez pas ou n’enlevez pas, sous aucun prétexte, la troisième broche de mise à la terre du cordon
d’alimentation. Pour des raisons de sécurité, cet appareil doit être correctement mis à la terre.
Le cordon d’alimentation de cet appareil est équipé d’une fiche
à trois broches (pour une mise à la terre) qui s’adapte à la prise
de courant standard à 3 broches (pour une mise à la terre) pour
minimiser les risques de chocs électriques par cet appareil.
Faites vérifier la prise murale et le circuit électrique par
un électricien qualifié pour s’assurer que le système est
correctement mis à la terre.
Dans le cas d’une prise biphasée, l’installateur a la
responsabilité et l’obligation de la remplacer par une
prise triphasée correctement mise à la terre. N’utilisez pas
d’adaptateur.
Le réfrigérateur doit toujours être branché à sa propre prise
électrique d’une tension nominale correspondant à celle
indiquée sur sa plaque signalétique.
Une alimentation électrique à 115 volts CA, 60 Hz, avec
un fusible de 15 ou 20 ampères et une mise à la terre est
nécessaire. Ceci permet d’obtenir un meilleur rendement et
évite de surcharger les circuits électriques du domicile qui
risque d’occasionner un incendie en surchauffant.
Ne débranchez jamais le réfrigérateur en tirant sur le cordon
d’alimentation. Prenez toujours fermement la fiche en main et
tirez pour la sortir de la prise.
Réparez ou remplacez immédiatement tout cordon électrique
usé ou endommagé. N’utilisez pas un cordon fissuré ou
présentant des dommages dus aux frottements soit sur sa
longueur ou aux extrémités.
Lorsque vous éloignez votre réfrigérateur du mur, faites
attention à ne pas le faire rouler sur le cordon d’alimentation
afin de ne pas l’endommager.
FICHE D’ADAPTATION
Fiches d’adaptation non permises au Canada.
MISE AU REBUT APPROPRIÉE DE VOTRE ANCIEN RÉFRIGÉRATEUR
Un enfant risque de suffoquer ou d’y être emprisonné.
Démontez les portes du compartiment de réfrigération et du compartiment de congélation du
réfrigérateur, avant mettre celui-ci au rebut. Le non-respect de cette recommandation peut entraîner
l’enfermement d’un enfant qui peut entraîner la mort ou des lésions cérébrales.
AVERTISSEMENT
IMPORTANT:
Les enfants pris au piège ou morts d’asphyxie sont
toujours d’actualité. Les réfrigérateurs jetés ou abandonnés
restent dangereux même si vous ne les laissez au rebut
que pour « quelques jours ». Si vous voulez jeter votre
ancien réfrigérateur, suivez les instructions suivantes pour
empêcher les accidents.
Avant de jeter votre ancien réfrigérateur ou
congélateur:
„ Démontez les portes du compartiment de réfrigération et
du compartiment de congélation.
„ Laissez les clayettes en place, pour éviter que des enfants
puissent facilement grimper dans votre réfrigérateur.
Fluides frigorigènes
Les appareils réfrigérants contiennent des fluides
frigorigènes qui conformément à la législation fédérale
doivent être retirés avant la mise au rebut de l’appareil.
Si vous mettez au rebut un ancien réfrigérateur
contenant des fluides frigorigènes, vérifiez la procédure
à suivre auprès de la compagnie responsable de
l’élimination.
LISEZ ET SUIVEZ SOIGNEUSEMENT CES MESURES DE SÉCURITÉ.
CONSERVEZ CES INSTRUCTIONS
43
Les commandes avec réglages de température.
(Sur certains modèles)
ACTUAL
TEMP
(FIG A)
(FIG B)
(Sur certains modèles)
NOTE : Le réfrigérateur est expédié avec une pellicule de protection couvrant les commandes de température. Si
cette pellicule n’a pas été retirée au cours de l’installation faites-le maintenant.
La temperature est pré-réglée à l’usine au numéro 37° F pour le compartiment réfrigérateur et 0° F pour le compartiment
congélateur. Attendez 24 heures que la température se stabilise aux temperatures recommandées pré-réglées.
Le réglage de température peut indiquer la température SET (réglée) ainsi que la température réelle dans le compartiment
réfrigération et dans le compartiment congélation. La température SET (réglée) peut varier légèrement de la température
réelle, selon l’utilisation et les conditions de fonctionnement.
Le placement d’une ou des deux commandes sur OFF (Arrêt) arrête le refroidissement à la fois dans les compartiments du
réfrigérateur et du congélateur mais ne coupe pas l’alimentation électrique du réfrigérateur.
Changement de la température
Pour les modèles avec contrôles sur la porte :
FIG. “A” Pour changer la température, appuyez et relâchez le bouton
WARMER ou COLDER (Plus chaud et Plus froid) . Le vayant ACTUAL TEMP
(Température actuelle) s’allumera et L’affichage indiquera la température
actuelle. Pour changer la température, appuyez brievement sur la
touche WARMER ou COLDER jusqu’à ce que la température désirée
apparaisse.
FIG. “B” Pour afficher la température, appuyez et relâchez le bouton
ACTUAL TEMP (Température actuelle). L’afficheur restera illuminé
pendant 10 secondes.
Pour changer la température, appuyez et relâchez le bouton WARMER
ou COLDER (Plus chaud et Plus froid). L’indicateur lumineux SET TEMP
s’illuminera. Appuyer le bouton WARMER ou COLDER jusqu’à ce que la
Température désirée soit affichée.
Pour les contrôles à l’intérieur du réfrigérateur :
La température actuelle apparaît sur l’écran quand vous ouvrez la porte.
Pour changer la température, appuyez sur la touche WARMER (plus
chaud) ou COLDER (plus froid) jusqu’à ce que la température désirée
apparaisse sur l’écran.
44
Une fois la température souhaitée affichée, après 5 secondes,
la température affichée retournera à celle du réfrigérateur et du
congélateur. Plusieurs ajustements peuvent être nécessaires. Chaque fois
que vous ajustez les commandes, laissez passer 24 heures pour que le
réfrigérateur atteigne la température que vous avez sélectionnée.
Pour éteindre le système de refroidissement, appuyez brièvement sur
le bouton WARMER (plus chaud) du réfrigérateur ou du congélateur
jusqu’à ce que l’affichage indique OFF (Arrêt). Pour remettre l’appareil
en marche, poussez sur le bouton COLDER (plus froid) du réfrigérateur
ou du congélateur. Appuyez à nouveau et la température de l’appareil
passera sur la valeur pré-réglée de 0° F pour le congélateur et 37° F pour
le réfrigérateur. L’affichage d’un ou des deux boutons sur OFF (Arrêt)
arrête le refroidissement dans les compartiments du réfrigérateur et du
congélateur mais ne coupe pas l’alimentation électrique du réfrigérateur.
Au sujet de TurboCool.™ (sur certains modèles)
www.electromenagersge.ca
Fonctionnement
(Sur certains modèles)
(Sur certains modèles)
La commande TurboCool accélère le
refroidissement du compartiment réfrigération
afin de refroidir plus rapidement les aliments.
Utilisez TurboCool quand vous ajoutez
une grande quantité d’aliments dans le
compartiment réfrigération, quand vous mettez
de côté des aliments après les avoir laissés
reposer à la température de la pièce ou quand
vous mettez de côté des restes d’aliments
chauds. Vous pouvez également l’utiliser
après que le réfrigérateur soit resté débranché
pendant une période prolongée.
Utilisation
Appuyez sur le bouton TurboCool. L’écran de
température du réfrigérateur indique .
Quand la commande TurboCool cesse de
fonctionner, le compartiment réfrigération
revient à son réglage original.
NOTES : Vous ne pouvez pas changer la
température du réfrigérateur pendant
que la commande TurboCool
fonctionne.
Le TurboCool n’a pas d’effet sur la
température du congélateur.
Une fois activé, le compresseur se met
immédiatement en route et les ventilateurs
se mettent en marche et s’arrêtent à haute
vitesse pendant huit heures, en suivant leur
cycle. Le compresseur continue à marcher
jusqu’à ce que le compartiment réfrigération
se refroidisse à environ 1° C (34° F), puis il se
met en marche et s’arrête selon son propre
cycle pour maintenir cette température.
Après 8 heures ou si vous pressez à nouveau
sur le bouton TurboCool, le compartiment
réfrigération revient à son réglage original.
Quand vous ouvrez la porte du
réfrigérateur pendant l’action
de la commande TurboCool, les
ventilateurs continuent à fonctionner
si leur cycle le demande.
Alarme de porte (Sur certains modèles)
L’alarme de porte sonne si l’une des portes est
ouverte pendant plus de 2 minutes.
La sonnerie s’arrête quand vous fermez
la porte.
(Sur certains modèles)
(Sur certains modèles)
L’économiseur d’énergie (sur certains modèles)
Votre appareil est équipé d’un mécanisme
économiseur d’énergie. Le réfrigérateur est
livré avec cet économiseur d’énergie en
marche.
(Sur certains modèles)
(Sur certains modèles)
Avec le temps, il peut se former de l’humidité
sur la surface avant du compartiment
réfrigération, qui peut entraîner de la rouille.
S’il apparaît de l’humidité sur la surface
avant du compartiment réfrigération,
éteignez l’économiseur d’énergie en
appuyant, puis relâchant la touche ENERGY
SAVER (économiseur d’énergie) du panneau
de contrôle.
45
Le filtre à eau. (seulement pour les modèles 22 et 23)
Cartouche du filtre à eau
Bouchon de dérivation du filtre
La cartouche du filtre à eau se trouve dans le
coin droit arrière supérieur du compartiment
réfrigérateur.
Il faut utiliser le bouchon de dérivation du filtre
lorsqu’une cartouche de remplacement n’est
pas disponible. Le distributeur et la machine
à glaçons ne peuvent pas fonctionner sans le
filtre ou sans le bouchon de dérivation du filtre.
Remplacement du filtre
Il y a un voyant lumineux avertissant qu’il
faut remplacer la cartouche du filtre d’eau
sur l’affichage de temperature. Cette lumière
devient orange pour vous avertir que vous
devez remplacer bientôt le filtre. Vous devez
remplacer la cartouche de filtre quand le
voyant lumineux devient rouge ou si le débit
de l’eau du distributeur ou de la machine à
glaçons diminue.
Installation de la cartouche
du filtre à eau
Portecartouche
Si vous remplacez la cartouche, d’abord
enlevez la vieille cartouche en tournant
doucement vers la gauche. NE tirez PAS la
cartouche vers le bas. Une petite quantité
d’eau peut s’écouler.
MISE EN GARDE
S’il y a de l’air piégé dans le
système, la cartouche de filtre peut être
éje----ctée pendant qu’elle est enlevée. Procédez
avec soin pour l’enlever.
Portecartouche
Enlevez la feuille de protection de
l’extrémité de la cartouche.
Remplissez la cartouche de remplacement
avec de l’eau du robinet immédiatement
après l’installation pour permettre un
meilleur débit du distributeur.
(Sur certains modèles)
En alignant les flèches de la cartouche
et du boîtier de cartouche, faites tourner
doucement la cartouche dans le sens des
aiguilles d’une montre jusqu’à son arrêt. Si
la cartouche est correctement installée,
vous devez entendre un déclic quand elle
s’engage en place. Ne serrez pas trop fort.
Faites couler de l’eau du distributeur
pendant 3 minutes (environ 5 litres)
pour purger le système et empêcher
les pulvérisations. Consultez la section
Utilisation du distributeur.
(Sur certains modèles)
Appuyez sur la touche RESET WATER
FILTER (remettre à zéro le filtre d’eau)
et tenez-la appuyée pendant 3 secondes.
NOTE : Une cartouche de filtre à eau
nouvellement installée peut occasionner
un jet d’eau du distributeur.
46
Filtres de remplacement :
Pour commander des cartouches
supplémentaires, visitez notre site Web à
l’adresse www.electromenagersge.ca, ou
appelez le Service des pièces et accessoires
au 888.261.3055.
Modèle de filtre MWF
Les clients au Canada devraient consulter
les pages jaunes pour connaître la succursale
Mabe la plus près.
Le filtre à eau. (seulement pour les modèles 20)
www.electromenagersge.ca
Cartouche du filtre à eau
Bouchon de dérivation du filtre
La cartouche du filtre à eau se trouve dans le
coin droit arrière supérieur du compartiment
réfrigérateur.
Il faut utiliser le bouchon de dérivation du filtre
lorsqu’une cartouche de remplacement n’est
pas disponible. Le distributeur et la machine
à glaçons ne peuvent pas fonctionner sans le
filtre ou sans le bouchon de dérivation du filtre.
Remplacement du filtre
La cartouche du filtre doit être remplacée
lorsque le débit d’eau dans la machine à
glaçons diminue, ou bien tous les six mois.
Installation de la cartouche
du filtre à eau
Si vous remplacez la cartouche, d’abord
enlevez la vieille cartouche. Ouvrez le
couvercle de cartouche en l’appuyant sur le
taquet situé à l’avant et en tirant vers le
bas.
Enlevez la cartouche en la faisant tourner
doucement dans le sens contraire à celui
des aiguilles d’une montre. Un peu d’eau
peut tomber.
Filtres de remplacement :
Pour commander des cartouches
supplémentaires, visitez notre site Web à
l’adresse www.electromenagersge.ca, ou
appelez le Service des pièces et accessoires
au 888.261.3055.
Modèle GSWF
Les clients au Canada devraient consulter
les pages jaunes pour connaître la succursale
Mabe la plus près.
ATTENTION S’il y a de l’air piégé dans le
système, la cartouche de filtre peut être éjectée
pendant qu’elle est enlevée. Procédez avec soin
pour l’enlever.
Enlevez la feuille de protection de
l’extrémité de la cartouche.
En alignant les flèches de la cartouche
et du boîtier de cartouche, faites tourner
doucement la cartouche dans le sens des
aiguilles d’une montre jusqu’à son arrêt. Si
la cartouche est correctement installée,
vous devez entendre un déclic quand elle
s’engage en place. La poignée à l’extrémité
de la cartouche doit être placée
verticalement. Ne serrez pas trop fort.
Fermez le couvercle de cartouche.
47
Les clayettes et les balconnets.
Toutes les caractéristiques ne sont pas disponibles sur tous les modèles.
Mise en place des clayettes
Les clayettes du réfrigérateur sont réglables.
Compartiment réfrigération
Enlèvement :
Enlevez tous les articles de la clayette.
Soulevez la clayette à l’avant.
Certains modèles ont des clayettes
en fil de fer que vous pouvez régler
de la même manière.
Soulevez la clayette à l’arrière et faites-la
sortir.
Remise en place :
En faisant basculer la clayette vers
le haut, insérez le crochet supérieur à
l’arrière de la clayette dans une fente
du rail.
Abaissez le devant de la clayette jusqu’à ce
que le bas de la clayette se fixe en place.
Clayettes anti-déversement (sur certains modèles)
Les clayettes anti-déversement ont des bords
spéciaux pour empêcher tout déversement aux
clayettes inférieures. Pour enlever ou remettre
en place ces clayettes, consultez Mise en place
des clayettes.
Clayette coulissante anti-déversement (sur certains modèles)
Grâce à la clayette glissante anti-déversement,
vous pouvez atteindre des articles placés
derrière d’autres. Ses bords spéciaux sont
conçus pour empêcher tout déversement aux
clayettes inférieures.
Enlèvement :
Enlevez tous les articles de la clayette.
48
Tirez la clayette vers le haut pour
la libérer de l’avant du châssis.
Faites glisser la clayette vers l’arrière
pour la libérer de l’arrière du châssis.
Pour replacer la clayette en verre,
suivez cette procédure à l’envers.
Enlevez la clayette du compartiment
en la soulevant et en la sortant.
Assurez-vous que la clayette repose bien à
l’horizontale après l’avoir remise en place, et
qu’elle ne bouge pas d’un côté ou de l’autre.
Enlevez la clayette en verre du châssis
en la faisant glisser vers l’extérieur jusqu’à ce
qu’elle atteigne son point d’arrêt.
Assurez-vous de bien pousser les clayettes
jusqu’au fond pour refermer la porte.
www.electromenagersge.ca
Clayette escamotable (sur certains modèles)
Cette clayette est escamotable sur la moitié de
sa longueur pour permettre le stockage
de grands articles sur la clayette inférieure.
Enlèvement :
Pour replacer la clayette dans sa position
originale, tirez-la vers le haut et vers l’avant.
Abaissez la clayette doucement pour la
verrouiller en position.
Tirez la clayette vers l’extérieur et vers
le haut.
Faites glisser la clayette vers l’arrière
jusqu’à ce qu’elle atteigne son point d’arrêt.
Bacs réglables de porte
Vous pouvez facilement transporter les bacs
réglables du réfrigérateur à votre surface
de travail.
Enlèvement : Soulevez l’avant du bac droit vers
le haut, puis enlevez en soulevant.
La séparation aide à empêcher les petits
articles qui se trouvent sur la clayette de
la porte de se renverser, de couler ou de
glisser. Tenez l’alvéole se trouvant à l’arrière de
la séparation par le doigt et faites bouger la
séparation selon vos besoins.
Remise en place ou changement de place
: Faites glisser le bac juste au-dessus des
soutiens moulés de la porte et poussez
vers le bas. Le bac se verrouillera en place.
Bacs non-réglables de porte
Enlèvement : Soulevez le bac droit vers
le haut, puis enlevez en soulevant.
Remise en place : Engagez le bac dans
les soutiens moulés de la porte et poussez vers
le bas. Il se fixera en place.
Caractéristiques supplémentaires.
Panier sauve clayette (sur certains modèles)
Le panier amovible à breuvages contient douze
boîtes de boisson gazeuse ou deux bouteilles de
vin (longitudinalement).
On peut l’enlever pour nettoyer.
Pour enlever, faites glisser le panier vers
le haut jusqu’à sa position d’arrêt, soulevez
le panier pour lui faire dépasser sa position
d’arrêt, puis enlevez-le.
49
Bacs à rangement et bacs à légume.
Tous les modèles n’ont pas toutes ces caractéristiques.
Bacs à fruits et légumes
Vous devez bien essuyer toute eau en excès qui
peut s’accumuler au fond des bacs ou
en dessous des bacs.
Bac à légume à humidité réglable (sur certains modèles)
Faites glisser le réglage en position HIGH
(élevée) pour obtenir l’humidité maximum
qui est recommandée pour la plupart des
légumes.
2ème rainure
à partir du haut
Bac à charcuterie à température réglable (sur certains modèles)
Quand ce bac est placé dans la 2ème rainure
à partir du haut et le levier est réglé en position
COLDEST (le plus froid), l’air du compartiment
congélation souffle autour du bac pour le
maintenir très froid.
Vous pouvez mettre ce bac n’importe où si
vous ne voulez pas qu’il se refroidisse trop.
50
Faites glisser le réglage en position LOW
(basse) pour obtenir l’humidité minimum qui est
recommandée pour la plupart des fruits.
Vous pouvez régler sa température n’importe
où entre cold (froid)
et coldest (le plus froid)
.
En position cold (froid), le bac reste
à la température du reste du réfrigérateur.
En position coldest (le plus froid), le bac
est à sa température la plus froide.
Congélateur.
www.electromenagersge.ca
Tous les modèles n’ont pas toutes ces caractéristiques.
Clayettes et paniers du compartiment congélation
Une clayette située au-dessus du bac
à glaçons
Un panier sur la moitié de la largeur
NOTE : Ne remplissez pas les paniers au-delà
du bord du panier. Cela pourrait provoquer
un bourrage ou coincer le panier, lors de
l’ouverture ou de la fermeture.
Un panier bas sur toute la largeur
Un panier profond sur toute la largeur
L’apparence et les caractéristiques
peuvent varier
Enlèvement du panier
Pour enlever le panier profond sur toute
la largeur dans les modèles avec un tiroir
de compartiment congélation :
Ouvrez le tiroir du compartiment
congélation jusqu’à son arrêt complet.
L’apparence peut varier
Le panier du compartiment congélation
repose sur les taquets intérieurs des guides
du tiroir.
Soulevez le panier afin qu’il se libère
des 6 taquets coulissants latéraux.
Faites basculer le panier et soulevez-le pour
le faire sortir du tiroir.
Remplacement du panier profond toute
largeur :
Faites basculer le panier vers l’arrière et
abaissez-le dans le tiroir. Faites tourner le
panier en position horizontale et pressez-le vers
le bas dans les six taquets d’alignement.
NOTE : Assurez-vous toujours que le panier est
engagé dans les 6 taquets coulissants latéraux
avant de le faire glisser à sa place dans le
compartiment congélation. Le panier peut
être tourné dans n’importe quel sens avant ou
arrière, puis être installé dans
le compartiment congélation.
Pour enlever le panier sur la moitié
de la largeur :
Tirez le panier hors de son emplacement
d’arrêt.
Soulevez l’avant du panier pour le libérer
des guides.
Quand vous remettez en place le panier,
assurez-vous que les taquets en fil de fer et
les crochets en fil de fer situés sur les côtés du
panier entrent dans les fentes situées
en haut des rails du panier du haut.
Soulevez l’arrière du panier et sortez-le des
guides.
NOTE : Assurez-vous toujours de bien fermer le
panier.
L’apparence peut varier
Pour enlever le panier bas sur toute
la largeur :
Tirez le panier jusqu’à son emplacement
d’arrêt.
Soulevez le panier et faites-le sortir.
Soulevez l’avant et faites-le passer
au-dessus de son emplacement d’arrêt.
L’apparence peut varier
51
Machine à glaçons automatique.
Il faut prévoir entre 12 et 24 heures avant qu’un réfrigérateur nouvellement installé commence à produire des glaçons.
Commutateur de marche Machine
à glaçons
Lumière
Bras palpeur
verte de
fonctionnement
Machine à glaçons automatique
(sur certains modèles)
La machine à glaçons produit sept glaçons par cycle,
soit environ 100 à 130 glaçons par 24 heures, selon
la température du compartiment congélation,
la température de la pièce, le nombre de fois que
la porte est ouverte et les autres conditions
d’utilisation.
Consultez ci-dessous la manière d’avoir accès aux
glaçons et d’atteindre le commutateur de marche.
Si vous faites fonctionner le réfrigérateur avant
de raccorder l’eau à la machine à glaçons, mettez
le commutateur de marche en position O (arrêt).
Après avoir raccordé le réfrigérateur à l’alimentation
d’eau, mettez le commutateur de marche en position
I (marche). Le voyant lumineux de la machine à
glaçons devient vert quand le commutateur de la
lumière du compartiment congélation est pressé ou
quand la porte du compartiment congélation est
fermée.
La machine à glaçons se remplira d’eau si sa
température baisse à –10°C (15°F). Un réfrigérateur
nouvellement installé prend de 12 à 24 heures pour
commencer à produire des glaçons.
Vous entendrez un bourdonnement chaque fois que
la machine à glaçons se remplit d’eau.
Jetez les premiers lots de glaçons pour permettre
à la conduite d’eau de se purger.
Assurez-vous que rien ne gène la course du bras
palpeur.
Quand le bac se remplit jusqu’au niveau du bras
palpeur, la machine à glaçons s’arrête de produire
des glaçons. Il est normal de trouver des glaçons qui
soient soudés ensemble.
Si vous n’utilisez pas souvent vos glaçons, les vieux
glaçons deviennent opaques, prennent un mauvais
goût et rétrécissent.
NOTE : Dans les maisons qui ont une pression d’eau
plus faible que la moyenne, vous pouvez entendre la
machine à glaçons recommencer plusieurs fois son
cycle pour produire une livraison de glaçons.
NOTE : Mettez le commutateur de marche en position
O (off) (arrêt) si l’alimentation d’eau est coupée.
ATTENTION
Évitez le contact avec les
pièces mobiles du mécanisme d’éjection et
O·pOpPHQWFKDXȺDQWVLWXpGDQVOHEDVGHOD
machine à glaçons) qui libère les cubes. Ne placez
ni les doigts ni les mains sur le mécanisme de
production de glace automatique lorsque le
réfrigérateur est branché.
Accès aux glaçons et au commutateur de marche
Clayette
Bac à glaçons
Pour atteindre le commutateur de marche de la machine à glaçons,
tirez la clayette située au-dessus du bac à glaçons et faites-la sortir.
Assurez-vous toujours de bien la remettre en place.
Pour avoir accès aux glaçons, tirez simplement le bac vers vous.
Pour atteindre le commutateur de marche.
Clayette
Bac à glaçons
Pour avoir accès aux glaçons.
Trousse accessoire de machine à glaçons
Si votre réfrigérateur n’est pas déjà équipé d’une
machine à glaçons automatique, vous pouvez
acheter une trousse accessoire de machine à
glaçons.
Vérifiez derrière votre réfrigérateur le modèle
de trousse à glaçons que vous devez acheter
pour votre réfrigérateur.
Pour utiliser le distributeur (sur certains modèles)
Bras de distribution
Bac de trop-plein
52
Appuyez doucement le verre contre le haut du bras
de distribution.
La clayette de trop-plein n’est pas munie d’un
système d’écoulement. Pour réduire les taches d’eau,
vous devez nettoyer régulièrement la clayette.
S’il n’y a pas d’eau distribuée lorsque le réfrigérateur
est initialement installé, il y a peut-être de l’air dans
la conduite d’eau. Appuyez sur la commande de
distribution pendant deux minutes au minimum
pour expulser l’air de la conduite d’eau et remplir
le réservoir d’eau. Afin d’éliminer les éventuelles
impuretés provenant de la conduite d’eau, jetez les six
premiers verres d’eau.
Verrouillage du distributeur
Appuyez sur la touche LOCK (verrouillage) pendant
3 secondes pour verrouiller le distributeur et le
panneau de réglage. Pour déverrouiller, appuyez sur
la touche et tenez-la enfoncée pendant encore 3
secondes.
www.electromenagersge.ca
Pour utiliser le distributeur d’eau interne (sur certains modèles)
Le distributeur d’eau est situé sur la paroi de gauche
à l’intérieur du compartiment réfrigération.
Pour distribuer de l’eau :
Tenir le verre contre le renfoncement.
Poussez le bouton du distributeur d’eau.
Tenez le verre sous le distributeur pendant 2–3
secondes après avoir cessé d’appuyer sur le bouton
du distributeur. L’eau peut continuer à couler après
que le bouton soit revenu en position.
Si l’eau ne coule pas du distributeur quand vous installez
votre réfrigérateur, c’est qu’il peut y avoir de l’air dans le
système de conduite d’eau. Appuyez sur le bouton du
distributeur pendant au moins 2 minutes pour enlever l’air
pris au piège dans la conduite d’eau et pour remplir d’eau le
système du distributeur. Durant ce processus, le distributeur
peut être bruyant puisque de l’air est expulsé des conduites
d’eau. Pour expulser toutes les impuretés de la conduite
d’eau, jetez toujours les 6 premiers verres d’eau.
NOTE : Pour éviter des dépôts d’eau, le distributeur
doit être nettoyé régulièrement en l’essuyant avec une
éponge ou un chiffon propre.
Entretien et nettoyage de votre réfrigérateur.
Nettoyage de l’extérieur
Les poignées de porte et les garnitures. Nettoyez avec un linge
trempé dans de l’eau savonneuse. Séchez avec un linge doux.
N’appliquez pas de cire sur les poignées
et les garnitures de porte.
Conservez l’extérieur propre. Essuyez avec
un linge propre légèrement humecté de cire
à appareil électroménager ou de détersif liquide à vaisselle
doux. Séchez et polissez avec un linge doux, propre.
N’essuyez jamais votre réfrigérateur avec un torchon sale ou
une serviette mouillée. Cela peut laisser un résidu qui risque
d’endommager la peinture. N’utilisez jamais de tampon à récurer,
de nettoyant en poudre, d’eau de javel ou de produit nettoyant
contenant un agent de blanchiment, car ces produits peuvent
rayer et endommager la peinture.
Panneaux et les poignées de porte en acier inoxydable
Vous pouvez nettoyer les portes et les poignées de porte en
acier inoxydable (sur certains modèles) avec un nettoyant
d’acier inoxydable vendu sur le marché. Les nettoyants qui
contiennent de l’acide oxalique, tels que Bar Keepers Friend
Soft Cleanser™, éliminent la rouille, le ternissement et les
petites taches. Utilisez uniquement un nettoyant liquide
exempt d’abrasif et frottez dans la direction des lignes de
brossage à l’aide d’une éponge souple imbibée.
N’utilisez pas de cire pour appareils ménagers sur l’acier
inoxydable.
Pièces en matière plastique plaquée argent.
Lavez ces pièces avec du savon ou un autre détergent doux.
Essuyez avec une éponge, un linge humide ou une serviette en
papier.
Ne frottez jamais avec des tampons en laine d’acier ou d’autres
nettoyants abrasifs.
Nettoyage de l’intérieur
Pour aider à empêcher les odeurs, laissez
une boîte ouverte de bicarbonate de soude dans les
compartiments réfrigération et congélation.
Débranchez votre réfrigérateur avant de
le nettoyer. Si ce n’est pas pratique, enlevez toute humidité au
moyen d’une éponge
ou d’un chiffon pour nettoyer autour des commutateurs, des
lumières ou des réglages.
Utilisez une cire pour appareils électroménagers sur la surface
intérieure entre les portes.
Utilisez une solution d’eau chaude et de bicarbonate de soude
(15 ml [soit une cuillère à soupe environ] de bicarbonate de
soude dans 1 litre [soit une pinte] d’eau). Cette solution nettoie
tout en neutralisant les odeurs. Rincez et séchez en essuyant.
Après avoir nettoyé les joints de porte, appliquez une fine
couche de vaseline sur les joints du côté des charnières pour
empêcher les joints de coller et de se déformer.
ATTENTION
Ne nettoyez pas les tablettes ou
couvercles en verre avec de l’eau chaude lorsqu’ils sont
froids. Les tablettes et couvercles en verre peuvent se briser
s’ils sont exposés à une variation de température soudaine,
ou soumis à un impact s’ils sont heurtés ou échappés. S’il
se brise, le verre trempé est conçu pour se fracturer en un
grand nombre de petits éclats.
Ne lavez aucune pièce en plastique du réfrigérateur au lavevaisselle.
Pièces en matière plastique plaquée argent.
Lavez ces pièces dans de l’eau savonneuse. Essuyez avec une
éponge, un linge humide ou une serviette en papier.
Ne frottez jamais avec des tampons en laine d’acier ou d’autres
nettoyants abrasifs.
53
Entretien et nettoyage de votre réfrigérateur. (suite)
Derrière le réfrigérateur
Prenez un soin particulier lorsque vous éloignez
le réfrigérateur du mur. Tous les types de
revêtements de sol peuvent être endommagés,
particulièrement ceux qui sont coussinés ou
dont la surface est gaufrée.
Soulevez les pieds d’inclinaison situés en bas à
l’avant de votre réfrigérateur.
Abaissez les pieds d’inclinaison jusqu’à
ce qu’ils touchent le sol.
Lorsque vous remettez le réfrigérateur en
place en le poussant, veillez à ne pas le faire
rouler sur le cordon d’alimentation ou sur la
conduite d’eau de la machine à glaçons (sur
certains modèles).
Tirez le réfrigérateur en ligne droite et, lorsque
vous le remettez en place, poussez-le vers le
mur en ligne droite. Les déplacements latéraux
du réfrigérateur pourraient endommager le
revêtement de sol ou le réfrigérateur.
Départ en vacances
Lorsque vous vous absentez pendant une
période prolongée, videz et débranchez
le réfrigérateur. Nettoyez l’intérieur avec
une solution d’eau et de bicarbonate de soude,
à raison 15 ml (d’une cuillère à soupe) de
bicarbonate par litre (1 pinte) d’eau. Laissez les
portes ouvertes.
Si la température risque de descendre
sous le point de congélation, demandez
à un réparateur de vidanger la conduite d’eau
afin d’éviter les dégâts sérieux causés par les
inondations.
Mettez l’interrupteur d’alimentation de la
machine à glaçons à la position O (arrêt) et
fermez l’alimentation d’eau au réfrigérateur.
Déménagement
Immobilisez tous les éléments amovibles, tels
que les clayettes et les bacs, à l’aide de ruban
gommé pour éviter de les endommager.
Si vous utilisez un charriot pour déménager
le réfrigérateur, ne laissez jamais le devant
ou le derrière du réfrigérateur reposer contre
le charriot. Cela pourrait endommager le
réfrigérateur. Ne transportez le réfrigérateur
que par les côtés.
54
Assurez-vous que le réfrigérateur demeure
debout pendant son déménagement.
Remplacement des ampoules.
www.electromenagersge.ca
AVERTISSEMENT
Avant de remplacer une ampoule grillée, le réfrigérateur doit être débranché afin d’éviter le contact avec un
filament sous tension. (Une ampoule grillée peut se briser lors de son remplacement.)
Le courant du circuit de la lampe n’est pas interrompu même en tournant le bouton de la commande de température vers la
position OFF (arrêt).
Lumières du compartiment réfrigération
Débranchez le réfrigérateur.
Pour enlever le pare-lumière, saisissez
l’arrière de le pare-lumière et tirez-le pour le
libérer de ses taquets à l’arrière.
Faites tourner le pare-lumière vers le bas,
puis tirez pour libérer les taquets à l’avant
de le pare-lumière.
Après avoir remplacé l’ampoule par
une ampoule d’appareil électroménager de
même voltage ou d’un voltage plus bas,
remettez en place le pare-lumière.
Rebranchez le réfrigérateur.
NOTE : Vous pouvez commander des ampoules
pour appareils électroménagers
en téléphonant au service de pièces
et accessoires GE, au 1.888.261.3055.
Lumière du compartiment congélation
Débranchez le réfrigérateur.
Retirez le panier du congélateur. L’ampoule
est située au fond du congélateur dans un
boîtier protecteur.
L’apparence peut varier
Pour le retirer, attrapez le boîtier protecteur
par la partie supérieure et tirez-le vers vous
pour libérer les languettes inférieures.
Après avoir remplacé l’ampoule par une
ampoule d’appareil électroménager de
même voltage ou d’un voltage plus bas,
remettez en place le pare-lumière et le
panier du congélateur.
Rebranchez le réfrigérateur.
Lumières intermédiaires
Débranchez le réfrigérateur.
Les ampoules sont situées derrière
les bacs à fruits et légumes. Pour enlever
les bacs, soulevez-les légèrement tout
en tirant le bac au-delà de la position
d’arrêt.
Les lumières sont situées
derrière les bacs à fruits
et légumes
Remplacez les ampoules avec
des ampoules de même puissance
ou inférieure.
Ampoules
Replacez les bacs à fruits et légumes en les
faisant glisser doucement sur les rails, tout
en les soulevant légèrement.
Rebranchez le réfrigérateur.
55
Instructions
d’installation
Réfrigérateur
Modèles 20, 21, 22 et 23
Questions? Appelez le 1.800.561.3344 ou visitez notre site Web à l’adresse : www.electromenagersge.ca
AVANT DE COMMENCER
PREPARATION (suite)
Veuillez lire toutes les directives attentivement.
ALIMENTATION D’EAU DE LA MACHINE À GLAÇONS
ET DU DISTRIBUTEUR (SUR CERTAINS MODÈLES)
•
IMPORTANT ³ Conservez ces instructions
Si votre réfrigérateur est doté d’une machine à glaçons,
la machine à glaçons doit être raccordée à une
conduite d’eau froide. Vous pouvez acheter une trousse
d’alimentation d’eau GE (contenant la tuyauterie,
le robinet d’arrêt, les joints et les instructions) chez
votre revendeur ou en vous adressant à notre site
Web à l’adresse www.electromenagersge.ca ou à
notre service de Pièces et accessoires au numéro de
téléphone 1.888.261.3055.
pour l’inspecteur local.
•
•
•
•
•
•
•
IMPORTANT ³ Respectez toutes
les ordonnances et les codes locaux.
Note à l’installateur – Assurez-vous de laisser
ces instructions au consommateur.
Note au consommateur – Conservez
ces instructions pour référence future.
Niveau de compétence – L’installation
de cet appareil nécessite des compétences
mécaniques de base.
Temps d’installation – Installation du réfrigérateur
20 minutes
Installation de la conduite
d’eau 30 minutes
L’installateur est responsable de bien installer
ce réfrigérateur.
Toute panne du produit due à une mauvaise
installation n’est pas couverte par la garantie.
OUTILS DONT VOUS POUVEZ AVOIR
BESOIN
Tournevis à cliquet
de 3/8 po et de 5/16 po
Clé réglable
Écrou à compression
d’un diamètre exterieur
de 1/4 po et bague
(modèles avec
machine à glaçons
seulement)
PRÉPARATION
DÉPLACEMENT DU RÉFRIGÉRATEUR À L’INTÉRIEUR
DE LA MAISON
Si le réfrigérateur ne peut pas passer par la porte,
vous pouvez enlever la porte du compartiment
réfrigération et le tiroir du compartiment
congélation.
• Pour enlever la porte du compartiment
réfrigération, consultez l’étape 1 de la section
Changement de sens d’ouverture de la porte.
• Pour enlever le tiroir du compartiment
congélation, consultez la section Enlèvement
du tiroir du compartiment congélation.
Perceuse à main
ou électrique
et mèche de 1/8 po
56
Tournevis cruciforme
Clé à six pans de 3/32 po,
1/8 po et 3/16 po
Mètre
Crayon
Tourne-écrou de 1/4 po
Cisaille
Niveau
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR
EMPLACEMENT DU RÉFRIGÉRATEUR
• N’installez jamais votre réfrigérateur dans un emplacement
où la température ambiante sera inférieure à 16° C (60° F).
Il ne se mettra pas en marche suffisamment souvent pour
maintenir des températures convenables.
• N’installez jamais votre réfrigérateur dans un emplacement
où la température ambiante sera supérieure à 37° C (100° F).
Il ne fonctionnera pas bien.
• N’installez pas le réfrigérateur dans un endroit exposé à l’eau
(pluie, etc.) ou directement aux rayons solaires.
• Installez votre réfrigérateur sur un plancher suffisamment solide
pour le porter lorsqu’il est plein.
ENLEVEZ LE CAPUCHON DU HAUT (suite)
(sur certains modèles)
C Enlevez le tiroir du compartiment congélation du bas.
Consultez la section « Enlèvement du tiroir du compartiment
congélation ».
D Amenez le réfrigérateur jusqu’à l’emplacement où vous désirez
l’installer.
REMETTEZ EN PLACE LES PORTES, LES TIROIRS
ET LE CAPUCHON DU HAUT
E Abaissez soigneusement la porte dans la charnière centrale.
Remettez en place la charnière du haut. NOTE : Veillez à ce que
la porte soit bien alignée au sommet de l’armoire pour éviter de
la réajuster pendant la remise en place du capuchon du haut.
F Placez le capuchon en haut du réfrigérateur. Remettez
en place les vis que vous avez enlevées en haut et à l’arrière
du capuchon.
G Remettez en place le tiroir du compartiment congélation
du bas. Consultez la section « Remise en place du tiroir
du compartiment congélation ».
DÉGAGEMENTS
Veuillez consulter la plaque signalétique au haut et à
gauche de la paroi du réfrigérateur pour connaître les
espaces libres nécessaires pour faciliter l’installation, pour
une bonne circulation d’air, la plomberie et l’électricité.
A
ENLEVEZ LE CAPUCHON DU HAUT
(sur certains modèles)
• NOTE IMPORTANTE : Ce réfrigérateur a une profondeur de
34-1/2 po. Les portes et les passages qui mènent à l’endroit
où vous désirez l’installez doivent avoir une largeur du moins
de 36 po., pour permettre de transporter le réfrigérateur
jusqu’à cet endroit sans être obligé d’enlever les portes et
les poignées. Si le passage a moins que 36 po. de largeur,
vous risquez vraiment de rayer et d’endommager les portes
et les poignées de votre réfrigérateur. Vous pouvez enlever
facilement le capuchon du haut et les portes pour déplacer
plus aisément le réfrigérateur chez vous. Commencez par
l’étape A.
• Si vous n’avez pas à enlever les portes, passez directement
à l’étape B. Laissez le ruban et tous les matériaux d’emballage
sur les portes, jusqu’à ce que vous ayez déménagé
le réfrigérateur dans son emplacement final.
• ENLÈVEMENT DU PATIN DE GLISSEMENT : Faites basculer
le réfrigérateur de chaque côté pour enlever le patin
de glissement.
• NOTE : Utilisez un chariot manuel rembourré pour déplacer
le réfrigérateur. Placez le réfrigérateur sur le chariot manuel
avec un côté contre le chariot. Nous vous recommandons
vivement d’utiliser DEUX PERSONNES pour déplacer
le réfrigérateur et l’installer.
A Trouvez et enlevez les deux vis à tête Phillips situées en haut
du réfrigérateur. Enlevez les deux vis situées de chaque côté à
l’arrière du capuchon du haut. Soulevez et enlevez le capuchon
du haut.
B Enlevez la porte du compartiment aliments frais. Consultez
les étapes 1 à 3 de la section « Changement du sens
d’ouverture des portes ».
Charnière
de haut B
1 BRANCHEMENT DU RÉFRIGÉRATEUR
À LA CONDUITE D’EAU DE LA MAISON
(modèles avec machine à glaçons et distributeur)
Une alimentation d’eau froide est requise pour faire fonctionner
la machine à glaçons. Vous devrez en fournir une si elle n’existe
pas. Voir la section Installation de la conduite d’eau.
NOTES :
• Avant de brancher la conduite au réfrigérateur, assurez-vous
que le cordon d’alimentation électrique n’est pas branché
à la prise murale.
• Si votre réfrigérateur n’est pas équipé de filtre à eau, nous
recommandons d’en monter un si votre alimentation d’eau
contient du sable ou des particules qui peuvent boucher
la grille du robinet d’eau du réfrigérateur. Installez-le sur
la conduite d’eau près du réfrigérateur. Si vous utilisez
une trousse GE SmartConnect™ Refrigerator Tubing, vous
aurez besoin d’un tuyau additionnel (WX08X10002) pour
brancher le filtre. Ne coupez pas le tuyau de plastique pour
installer le filtre.
57
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR (SUITE)
1 BRANCHEMENT DU RÉFRIGÉRATEUR
2 OUVREZ L’ALIMENTATION D’EAU
(modèles avec machine à glaçons ou
distributeur)
À LA CONDUITE D’EAU DE LA MAISON
(suite)
Ouvrez l’alimentation d’eau
au niveau du robinet d’arrêt
(l’alimentation d’eau de
la maison) et vérifiez
la présence de fuites.
A Si vous utilisez un tuyau de cuivre, placez
un écrou de compression et une bague
(manchon) à l’extrémité du tuyau qui vient
de l’alimentation d’eau froide de la maison.
Si vous utilisez un tuyau GE SmartConnect,™
les écrous sont déjà assemblés au tuyau.
B Si vous utilisez un tuyau de cuivre, insérez
aussi loin que possible l’extrémité du tuyau
dans le raccord à l’arrière du réfrigérateur.
Tout en tenant le tuyau, serrez le raccord.
Si vous utilisez un tuyau GE SmartConnect,™
insérez l’extrémité moulée du tuyau dans
le raccord à l’arrière du réfrigérateur, puis
serrez l’écrou à compression à la main.
Serrez ensuite un autre tour à l’aide d’une clé.
Un serrage excessif pourrait occasionner
des fuites.
C Fixez le tuyau dans le collet (fourni) pour
le maintenir en position. Il est possible que vous
deviez écarter le collet.
3 BRANCHEZ LE CORDON
DU RÉFRIGÉRATEUR DANS LA PRISE
Sur modèles avec machine à
glaçons : avant de brancher
le réfrigérateur, assurez-vous
que l’interrupteur de
la machine à glaçons
est à la position O (arrêt).
Lisez l’étiquette concernant
la mise à la terre qui est
attachée au cordon d’alimentation.
4 METTEZ LE RÉFRIGÉRATEUR
EN PLACE
L’une des illustrations ci-dessous représente
le branchement de votre réfrigérateur.
Modèles prêts à recevoir une machine à glaçons
Tuyau
de cuivre
1/4 po
Collet à
tuyau
Ecrou à
compression
1/4 po
Bague
(manchon)
Raccord du
réfrigérateur
Transportez le réfrigérateur jusqu’à son emplacement final.
5 METTEZ DE NIVEAU
LE RÉFRIGÉRATEUR
Les pattes réglables des coins avant
du réfrigérateur doivent être ajustées pour que
le réfrigérateur repose solidement sur le sol
et pour que l’avant soit suffisamment levé afin
que la porte se ferme facilement, lors de son
ouverture à moitié chemin.
Tuyau
SmartConnect™
Pour ajuster les pattes réglables, tournez-les
dans le sens horaire pour lever le réfrigérateur
et dans le sens antihoraire pour le baisser.
Modèles dotés d’une machine à glaçons
Raccord du
réfrigérateur
Bague
Ecrou à
(manchon) compression
1/4 po
Tuyau
SmartConnect™
Collet à tuyau
Tuyau
de 1/4 po
58
Instructions d’installation
7 ENLEVEZ LA POIGNÉE DE LA PORTE
6 ENLEVEZ LA POIGNÉE DE PORTE
DU COMPARTIMENT CONGÉLATION
DU COMPARTIMENT POUR ALIMENTS FRAIS
Poignées en acier inoxydable et en matière
plastique :
Desserrez les vis de l’ensemble situées en bas
de la poignée à l’aide de la clé Allen de 1/8 po
et enlevez la poignée.
NOTE : Si vous devez resserrer ou enlever
les fixations de montage de la poignée,
utilisez la clé Allen de 3/16 po.
(Pour placer dans l’emplacement
de l’installation ou changer le sens
d’ouverture des portes – sur certains
modèles)
Poignée en acier inoxydable
(sur certains modèles) :
ENLÈVEMENT
DE LA POIGNÉE
DE PORTE :
Desserrez les vis
de l’ensemble à
l’aide d’une clé
Allen de 3/32 po.
A
et enlevez
la poignée.
NOTE : Pour
les modèles
B
à deux portes,
suivez la même
procédure pour Fixations
de montage
la porte
(l’aspect peut varier)
opposée.
Logo
Poignée en matière plastique
(sur certains modèles) :
ENLÈVEMENT DE LA POIGNÉE DE PORTE :
Appuyez sur le taquet situé à l’intérieur de
la poignée et faites glisser la poignée vers
le haut pour la faire sortir de la fixation
de montage.
CHANGEMENT
DU SENS
D’OUVERTURE
B
DE LA
POIGNÉE
Logo
DE PORTE :
(sur certains
modèles)
A
• Enlevez les
fixations de Fixations
montage de de
la poignée à montage
l’aide d’une
clé Allen de
(l’aspect peut varier)
3/16 po et
faites passer les fixations de montage de
la poignée du côté gauche au côté droit.
• Enlevez le logo.
• Enlevez et faites passer de l’autre côté
le bouchon du côté droit au côté gauche
de la porte du compartiment aliments
frais. NOTE : Utilisez une lame en matière
plastique pour éviter d’endommager
la porte. Enlevez toute colle de la porte à
l’aide d’un détergent doux. Enlevez le papier
adhésif de l’arrière du logo avant de fixer
le logo soigneusement à la porte.
Poignées en matière plastique : (l’aspect peut varier)
ENLÈVEMENT DE LA POIGNÉE DE PORTE :
Appuyez sur le taquet situé à l’intérieur de
la poignée et faites glisser la poignée vers
le haut pour la faire sortir de la fixation
de montage.
NOTE : Si vous devez resserrer ou enlever
les fixations de montage de la poignée,
utilisez la clé Allen de 3/16 po.
(l’aspect peut varier)
59
Instructions d’installation
INSTALLATION DU RÉFRIGÉRATEUR (SUITE)
9 FIXEZ LA POIGNÉE DE LA PORTE
8 FIXEZ LA POIGNÉE DE LA PORTE
DU COMPARTIMENT CONGÉLATION
DU COMPARTIMENT ALIMENTS FRAIS
Poignées en acier inoxydable et en matière
plastique :
Fixez bien la poignée aux fixations
de montage de la poignée et resserrez les vis
de l’ensemble situées en bas de la poignée
à l’aide d’une clé Allen de 1/8 po.
Poignée en acier inoxydable :
Fixez la poignée
aux fixations
A
de montage
de la poignée et
resserrez les vis
de l’ensemble
à l’aide d’une clé
Allen de 3/32 po.
Fixations
NOTE : Pour les
de montage
modèles à deux
portes, suivez
la même
procédure
pour la porte
(l’aspect peut varier)
opposée.
Poignée en matière plastique :
Fixez la poignée aux fixations de montage
de la poignée en alignant les fentes
aux fixations de montage de poignée.
Faites glisser la poignée vers le bas jusqu’à
ce qu’elle soit bien fixée en position.
(l’aspect peut varier)
Poignée en matière plastique:
(sur certains modèles)
Fixez la poignée aux fixations de montage
de la poignée en alignant les fentes
aux fixations de montage de poignée.
Faites glisser la poignée vers le bas jusqu’à ce
qu’elle soit bien fixée en position.
Trous à l’arrière de la poignée
Trous à l’arrière
de la poignée
Fixations
de montage
REMARQUE: Avant de fixer la
poignée, assurez-vous que la
languette soit orientée de la
façon suivante.
(l’aspect peut varier)
(l’aspect peut varier)
60
Instructions d’installation
10 METTEZ LE RÉFRIGÉRATEUR
11 RÉGLEZ LES COMMANDES
DE NIVEAU
Réglez les commandes selon
les recommandations.
Les pieds de nivellement jouent deux rôles :
1) Elles peuvent être réglées de manière
à permettre à l’appareil de reposer
solidement sur le sol.
2) Les pieds de nivellement servent
de frein de stabilisation, pour tenir
le réfrigérateur bien en place pendant
son fonctionnement et son nettoyage.
Les pieds d’inclinaison empêchent
également le réfrigérateur de basculer.
A Enlevez la grille en dévissant les deux vis à tête
Phillips.
12 ENLEVEZ LES MATÉRIAUX
D’EMBALLAGE ET METTEZ EN MARCHE
LA MACHINE À GLAÇONS
(modèles avec machine à glaçons)
A) Enlevez tous les matériaux d’emballage
(rubans, mousse et autre protection)
des clayettes et des tiroirs.
B) Enlevez les arrimages des bacs
du compartiment congélation.
C) Placez le demi bac dans les rails à tiroir.
Consultez les instructions de la section
« Compartiment congélation ».
Mettez le commutateur de la machine
à glaçons en position l (marche). La machine
à glaçons ne se met en marche que lorsqu’elle
atteint une température de fonctionnement
de –9° C (15° F) ou moins. Elle commence
immédiatement à fonctionner. Il faudra
2 à 3 jours pour remplir le bac à glaçons.
B Tournez les pieds dans le sens des
aiguilles d’une montre pour faire monter
le réfrigérateur, dans le sens opposé à celui des
aiguilles d’une montre pour le faire descendre.
Commutateur
d’alimentation
électrique
ATTENTION Pour éviter tous risques de
blessures corporelles ou de dommages
matériels, les pieds de nivellement doit bien
reposer sur le plancher.
C Remettez la grille en remettant les deux vis à tête
Phillips.
NOTE :
Si votre pression d’eau est trop faible,
le robinet peut se remettre en marche jusqu’à
trois fois pour envoyer suffisamment d’eau
à la machine à glaçons.
61
Instructions d’installation
ENLÈVEMENT DU TIROIR DU COMPARTIMENT CONGÉLATION
2 ENLEVEZ L’AVANT DU TIROIR
DES GUIDES (suite)
Vous pouvez enlever le tiroir du compartiment
congélation, si nécessaire, pour passer par
des endroits étroits.
Lisez ces instructions avec soin et complètement.
B Soulevez les deux côtés de la poignée du tiroir
du compartiment congélation pour séparer
les rails du tiroir du mécanisme de rails.
C Posez l’avant du tiroir sur une surface qui
ne raye pas.
D Repoussez les mécanismes de rail en position
de verrouillage.
1 ENLEVEZ LE PANIER
A Ouvrez le tiroir du compartiment congélation
jusqu’à son arrêt complet.
B Le panier du compartiment congélation
repose sur un cadre à l’intérieur du tiroir du
compartiment congélation. Soulevez l’arrière
du panier.
C Soulevez l’avant du panier et soulevez
l’ensemble du panier pour l’enlever
et enlevez-le complètement.
Mécanisme
de rail
Mécanisme
de tiroir
3 ENLÈVEMENT LA GRILLE
DE BASE (si nécessaire)
Si, après avoir enlevé le tiroir du compartiment
congélation et la porte du compartiment
réfrigération, le réfrigérateur ne peut toujours
pas passer par une porte, vous pouvez enlever
la grille de base.
A Enlevez la grille de base en dévissant
les deux vis.
2 ENLEVEZ L’AVANT DU TIROIR
DES GUIDES
A Enlevez la vis de chaque côté des rails.
Vis
62
Instructions d’installation
REMISE EN PLACE DU TIROIR DU COMPARTIMENT CONGÉLATION
1 PLACEMENT ET FIXATION DE L’AVANT
DU TIROIR AUX GUIDES (suite)
Vous aurez peut-être besoin de deux
personnes pour terminer cette procédure.
E
1 PLACEMENT ET FIXATION DE L’AVANT
Remettez en place les vis sur les deux
mécanismes de rail.
DU TIROIR AUX GUIDES
A Tirez les mécanismes de rail à fond de chaque
côté de l’armoire.
Vis
B Trouvez les fentes à l’intérieur des mécanismes
de rail, vers l’arrière.
2 REMISE EN PLACE DU PANIER
DU COMPARTIMENT CONGÉLATION
Remettez en place le panier du bas
du compartiment congélation en l’abaissant
dans son cadre.
Fente
Mécanisme de rail
C Insérez les
crochets situés à l’arrière
des rails du tiroir dans les fentes des
mécanismes de rail.
D
Abaissez l’avant du tiroir, en vous assurant
que les taquets des deux côtés des rails entrent
dans les fentes à l’avant des mécanismes
de rail.
Crochet
Fente
Taquet
63
Instructions d’installation
CHANGEMENT DU SENS D’OUVERTURE DES PORTES
(modèles de réfrigérateurs à une porte uniquement)
1 ENLÈVEMENT DE LA PORTE
NOTES IMPORTANTES
DU COMPARTIMENT RÉFRIGÉRATION
Pour changer le sens d’ouverture des portes :
NOTE : Vous ne pouvez pas changer le sens d’ouverture
des portes sur les modèles en acier inoxydable.
• Lisez les instructions jusqu’à la fin avant de commencer.
• Les pièces sont comprises dans l’ensemble de charnière
de porte.
• Manipulez les pièces avec soin pour éviter de rayer
la peinture.
• Posez les vis près des pièces qu’elles fixent, pour éviter
de les utiliser au mauvais endroit.
• Prévoyez une surface de travail qui ne raye pas les portes.
IMPORTANT : Une fois que vous aurez commencé,
ne bougez plus l’armoire avant d’avoir fini de changer
le sens d’ouverture des portes.
Ces instructions sont données pour faire passer à gauche
les charnières situées du côté droit. Si vous voulez remettre
les charnières à droite, suivez ces instructions en remplaçant
toutes les références au côté gauche par des références
au côté droit.
• Une fois que vous aurez changé le sens d’ouverture de
la porte, assurez-vous que le logo soit bien aligné et bien
fixé à la porte en enlevant le papier adhésif au verso.
NOTE : Un logo de rechange est compris dans l’ensemble
de charnière.
Débranchez le réfrigérateur de sa prise électrique.
Videz toutes les clayettes de porte, y compris
le compartiment laitier.
A Fermez la porte et attachez-la avec le ruban
masque.
B Enlevez le couvercle de la charnière du haut
de la porte du compartiment réfrigération
en faisant doucement levier vers le haut
avec un couteau de vitrier, si nécessaire.
C À l’aide d’un tournevis à cliquet de 5/16 po,
enlevez les boulons qui fixent à l’armoire
la charnière du haut. Ensuite, soulevez
la charnière tout droit vers le haut pour libérer
l’axe de la charnière du support situé en haut
de la porte.
D Sortez doucement le manchon de porte
de son emplacement. Il sera réutilisé pour
installer la porte de l’autre côté.
Couvercle
de charnière
Charnière
du haut
Manchon de porte
OUTILS NÉCESSAIRES
Clé réglable
Ruban masque
Tournevis cruciforme
E
Enlevez le ruban masque et écartez la porte
de l’armoire en la soulevant. Enlevez la porte
de l’axe de la charnière du centre. Assurez-vous
que la bague de l’axe de charnière de plastique
demeure sur l’axe de charnière ou à l’intérieur
du trou de l’axe de charnière de la porte, situé
en bas de la porte.
F
Posez la porte sur une surface qui ne raye pas,
avec l’intérieur vers le haut.
Tournevis à cliquet
de 5/16 po
Tournevis à lame mince
Tournevis Torx T20
64
Instructions d’installation
2 ENLÈVEMENT DE LA CHARNIÈRE
4 TRANSFERT DE L’ARRÊT DE LA PORTE
DU CENTRE
DU COMPARTIMENT RÉFRIGÉRATION
A Enlevez l’axe de la charnière. L’axe sera réutilisé
avec la nouvelle charnière de l’autre côté.
A
B
C
B À l’aide d’une clé à douille de 5/16 po, enlevez
les boulons qui fixent la charnière centrale
à l’armoire. Mettez de côté les boulons.
Enlevez l’arrêt de la porte situé en bas
à droite de la porte du compartiment
réfrigération en enlevant les deux vis.
Faites passer la bague du trou de charnière
en matière plastique dans le trou opposé.
Installez l’arrêt de la porte à gauche, en vous
assurant de bien aligner les trous de vis de
l’arrêt de la porte aux trous du bas de la porte.
Bas de la porte
du compartiment
réfrigération
(côté droit)
3 INSTALLATION DE LA CHARNIÈRE
DU CENTRE
A Faites passer le bouton et le couvercle
des trous de charnière du côté gauche
au côté droit.
Bas de la porte
du compartiment
réfrigération
(côté gauche)
5 TRANSFERT À DROITE DE LA POIGNÉE
DE LA PORTE DU COMPARTIMENT
RÉFRIGÉRATION
Consultez les sections Enlevez la poignée
du compartiment aliments frais et Fixez
la poignée du compartiment aliments frais
pour des instructions.
B Une nouvelle charnière est nécessaire pour
le côté gauche (fournie dans le kit charnière
de porte). Fixez la charnière centrale
de l’ensemble du côté gauche.
C
Installez l’axe de charnière dans la nouvelle
charnière.
65
Instructions d’installation
CHANGEMENT DU SENS D’OUVERTURE DES PORTES
(modèles de réfrigérateurs à une porte uniquement) (SUITE)
6 RE-SUSPENSION DE LA PORTE
7 FIXEZ LE LOGO
DU COMPARTIMENT RÉFRIGÉRATION
A
Abaissez la porte du compartiment
réfrigération sur l’axe de la charnière du
centre. Assurez-vous que la bague en matière
plastique de l’axe de charnière demeure sur
l’axe de charnière du centre ou à l’intérieur
du trou de l’axe de charnière de la porte,
situé en bas de la porte.
B
Insérez le manchon de porte dans le trou
à manchon en haut de la porte du réfrigérateur,
puis insérez l’axe de charnière supérieur.
Assurez-vous que la porte soit alignée
à l’armoire. Fixez la charnière en haut
de l’armoire, sans trop serrer, avec les boulons.
Assurez-vous que le joint de la porte soit aligné
contre l’armoire et ne soit pas tordu. Soutenez
la porte du côté de la poignée et assurez-vous
que la porte soit droite et l’écartement entre
les portes soit uniforme à l’avant. Tout en
tenant la porte en place, serrez les boulons
de la charnière supérieure. Remettez en place
le couvercle de charnière.
C
Enlevez le papier adhésif protecteur et alignez
les taquets de l’arrière du logo avec les trous
de la porte. Faites pression sur le logo pour
vous assurer qu’il colle bien à la porte.
66
Instructions d’installation
ENLÈVEMENT DES PORTES (modèles de réfrigérateurs à deux portes uniquement)
1 ENLÈVEMENT DES PORTES
NOTES IMPORTANTES
DU COMPARTIMENT RÉFRIGÉRATION
NOTE : Vous ne pouvez pas changer le sens
d’ouverture des portes.
• Lisez les instructions jusqu’à la fin avant
de commencer.
• Manipulez les pièces avec soin pour éviter de rayer
la peinture.
• Posez les vis près des pièces qu’elles fixent,
pour éviter de les utiliser au mauvais endroit.
• Prévoyez une surface de travail qui ne raye pas
les portes.
IMPORTANT : Une fois que vous aurez commencé,
ne bougez plus l’armoire.
Ces instructions servent à l’enlèvement des portes.
Débranchez le réfrigérateur de sa prise électrique.
Videz toutes les clayettes de porte, y compris
le compartiment laitier.
A
Fermez les portes et attachez-les avec le ruban
masque.
(Pour les modèles à distributeur d’eau)
B
Commencez avec la porte de gauche. Enlevez
la vis qui tient le couvercle de la charnière
du centre, soulevez le couvercle de la charnière
du centre et mettez-le en haut de côté
du réfrigérateur.
OUTILS NÉCESSAIRES
Enlevez le couvercle
de la charnière
(1 vis phillips)
Tournevis à cliquet
de 3/8 po et de 10 mm
Clé réglable
(Pour les modèles à distributeur d’eau)
Ruban masque
C
Tournevis à lame mince
Enlevez les raccords d’eau et d’électricité.
Raccord d’eau
Enlevez l’agrafe
du ressort en métal.
Utilisez le tournevis
pour pousser
l’agrafe en matière
plastique rouge vers
le bas et enlevez-la.
C1
Tournevis cruciforme
Raccord d’eau
Poussez le
manchon rouge
et tenez-le.
C2
Tirez la
conduite.
C3
Séparez le raccord
d’électricité pour
débrancher.
67
Raccord
d’électricité
Marque noire
alignée à
l’ensemble
de manchon.
Instructions d’installation
ENLÈVEMENT DES PORTES (SUITE)
1 ENLÈVEMENT DES PORTES
2 ENLEVEZ LA CHARNIÈRE DU CENTRE
DU COMPARTIMENT RÉFRIGÉRATION
(suite)
À l’aide d’une clé à douille de 5/16 po,
enlevez les boulons qui tiennent la charnière
du centre à l’armoire. Mettez de côté
les boulons et la charnière.
D Enlevez le couvercle de la charnière du haut
de la porte du compartiment réfrigération en
enlevant le vis à tête Phillips et en le tirant vers
le haut.
E À l’aide d’une clé à douille de 5/16 po, enlevez
les boulons qui tiennent la charnière du haut
à l’armoire. Soulevez ensuite la charnière droit
vers le haut pour libérer l’axe de la charnière
de support du haut de la porte.
3 ENLÈVEMENT DE LA PORTE OPPOSÉE
Suivez la même procédure pour la porte
opposée. Il n’y a pas de fils, de conduite d’eau
ou de couvercle de charnière de l’autre côté.
Couvercle de
la charnière
4 ENLÈVEMENT DU TIROIR DU
COMPARTIMENT CONGÉLATION
Consultez la section Enlèvement du tiroir
du compartiment congélation pour des
instructions.
Charnière
du haut
F
Enlevez le ruban et faites basculer la porte
pour l’éloigner de l’armoire. Soulevez la porte
pour l’enlever de l’axe de la charnière centrale.
Assurez-vous que la bague de l’axe de charnière
en matière plastique demeure sur l’axe de
la charnière ou à l’intérieur du trou d’axe de
charnière de la porte situé en bas de la porte.
G Posez la porte sur une surface qui ne raye pas,
l’intérieur vers le haut.
68
Instructions d’installation
REMISE EN PLACE DES PORTES (modèles de réfrigérateurs à deux portes uniquement)
2 RE-SUSPENSION DES PORTES DU
1 INSTALLATION DE LA CHARNIÈRE
COMPARTIMENT RÉFRIGÉRATION (suite)
DU CENTRE
E Assurez-vous que le joint de la porte soit aligné contre
l’armoire et ne soit pas tordu. Assurez-vous que la porte
soit droite et l’écartement entre les portes soit uniforme
à l’avant. Tout en tenant la porte alignée en place,
serrez les boulons de la charnière supérieure. Remettez
en place le couvercle de charnière et la vis.
Installez la charnière du centre de chaque côté.
Couvercle
de charnière
2 RE-SUSPENSION DES PORTES
DU COMPARTIMENT RÉFRIGÉRATION
Boulons
de charnière
du haut
A Abaissez la porte du compartiment réfrigération
sur l’axe de la charnière du centre. Assurez-vous que
la bague en matière plastique de l’axe de charnière
se trouve sur l’axe de charnière du centre ou à l’intérieur
du trou de l’axe de charnière de porte situé en bas
de la porte.
(l’aspect peut varier)
3 REMETTEZ EN PLACE LA PORTE
OPPOSÉE
Suivez la même procédure pour la porte opposée. Il n’y
a pas de conduite d’eau ou de couvercle de charnière.
Axe de
charnière
B Fermez la porte et tenez-la fermée à l’aide de
ruban-masque ou utilisez une deuxième personne
pour soutenir la porte.
C Faites passer les câbles à travers la fente de l’axe de
charnière du bas à gauche. Insérez l’axe de la charnière
du haut dans le trou de la charnière en haut de la porte
du compartiment réfrigération. Assurez-vous que
la porte soit alignée à l’armoire et la porte opposée.
Fixez la charnière en haut de l’armoire, sans trop serrer,
avec les boulons.
4 ALIGNEMENT DES DEUX PORTES
Si le haut des portes n’est pas bien aligné, d’abord
essayez d’élever la porte la plus basse en tournant
le pied d’inclination sur le même côté que la porte
jusqu’à ce que les portes soient bien alignées. Si
l’appareil reste instable, rajustez les pieds d’inclination
dans la mesure où l’apparail devient stable.
Fente de l’axe de
charnière du bas
à gauche
Si les portes ne sont toujours pas à niveau, tournez
l’axe réglable pour soulever ou abaisser la porte de
gauche afin qu’elle soit à niveau avec la porte de droite.
Utilisez une clé Allen de 1/4 po pour tourner l’axe.
(l’aspect peut varier)
D Sur les portes qui ouvrent avec la main gauche, passez
les fils et la conduite d’eau par l’axe de charnière du
centre. Branchez ensuite la conduite d’eau et le contact
à quatre broches.
Axe réglable
Axe de charnière
du centre
5 REMETTEZ EN PLACE LE TIROIR
DU COMPARTIMENT CONGÉLATION
Contact à
4 broches
Consultez la section Remise en place du tiroir
du compartiment congélation pour des instructions.
Conduite d’eau
69
Instructions d’installation
INSTALLATION DE LA CONDUITE D’EAU
(MODÈLES AVEC MACHINE À GLAÇONS)
CE DONT VOUS AUREZ BESOIN
AVANT DE COMMENCER
Nous recommandons les trousses d’alimentation d’eau en
cuivre WX8X2, WX8X3, WX8X4, selon le montant de conduite
dont vous avez besoin. Nous approuvons les conduites d’eau
en matière plastique GE SmartConnect™ Refrigerator Tubing
(WX08X10006, WX08X10015 et WX08X10025).
Si vous installez un système d’eau GE Reverse Osmosis dans
votre réfrigérateur, la seule installation approuvée est celle
de la trousse GE RVKIT. Pour les autres systèmes d’osmose
de l’eau, suivez les recommandations du fabricant.
Si l’alimentation d’eau à votre réfrigérateur vient d’un
système de filtration d’osmose inversée ET si votre
réfrigérateur a également un filtre d’eau, utilisez le bouchon
de dérivation du filtre de votre réfrigérateur. Si vous utilisez
la cartouche de filtration de votre réfrigérateur en
conjonction avec le filtre d’osmose inversée, vous pouvez
produire des glaçons creux.
Cette installation de conduite d’eau n’est pas garantie par le
fabricant de réfrigérateur ou de machine à glaçons. Suivez
soigneusement ces instructions pour minimiser le risque de
dommages onéreux d’inondation.
Les coups de bélier (eau qui donne des coups dans les
tuyaux) dans la tuyauterie de la maison peut occasionner
des dommages aux pièces de votre réfrigérateur, ainsi que
des fuites ou des inondations. Appelez un plombier certifié
pour corriger les coups de bélier avant d’installer la conduite
d’eau de votre réfrigérateur.
Pour prévenir toute brûlure et tout dommage à votre
réfrigérateur, ne branchez jamais la conduite d’eau à une
canalisation d’eau chaude.
Si vous utilisez votre réfrigérateur avant de brancher la
conduite d’eau, assurez-vous de laisser le commutateur
de la machine à glaçon en position O (arrêt).
N’installez jamais les tuyaux de la machine à glaçon
dans des endroits où la température risque de descendre
en dessous du point de congélation.
Si vous utilisez un outil électrique (comme une perceuse
électrique) pendant l’installation, assurez-vous que l’isolement
ou le câblage de cet outil empêche tout danger de secousse
électrique.
Vous devez procéder à toutes vos installations
conformément aux exigences de votre code local
de plomberie.
• Tuyaux en cuivre ou trousse GE SmartConnect™
Refrigerator Tubing, diamètre extérieur de 1/4 po pour
brancher le réfrigérateur à l’alimentation d’eau. Si vous
utilisez un tuyau en cuivre, assurez-vous que les deux
extrémités du tuyau soient coupées bien droit.
Pour trouver la longueur de tuyau dont vous aurez
besoin : mesurez la distance qui va du robinet d’eau situé
derrière le réfrigérateur jusqu’au tuyau d’alimentation
d’eau. Assurez-vous qu’il y ait assez de tuyau en trop pour
vous permettre de décoller le réfrigérateur du mur après
l’installation.
Les trousses GE SmartConnect™ Refrigerator Tubing sont
disponibles dans les dimensions suivantes :
2,4 m (8 pi) – WX08X10006
4,6 m (15 pi) – WX08X10015
7,6 m (25 pi) – WX08X10025
NOTE : Les seuls tuyaux en matière plastique approuvés
par GE sont ceux qui font fournis dans les trousses GE
SmartConnect™ Refrigerator Tubing. N’utilisez jamais
un autre tuyau en matière plastique, car le tuyau
d’alimentation d’eau est tout le temps sous pression.
Certaines catégories de tuyaux en matière plastique
peuvent devenir cassants avec l’âge et peuvent se
fendre, en occasionnant des dommages d’inondation
dans votre maison.
• Vous pouvez acheter une trousse d’alimentation d’eau
GE (contenant un tuyau, un robinet d’arrêt et les joints
énumérés ci-dessous) chez votre distributeur local
ou en le commandant au service de pièces et
accessoires, au 1.888.261.3055.
70
Instructions d’installation
Installez le robinet d’arrêt sur la canalisation d’eau
potable la plus fréquemment utilisée.
CE DONT VOUS AUREZ BESOIN (SUITE)
• Une alimentation d’eau froide potable. La pression
de l’eau doit être entre 20 et 120 p.s.i. (1,4 et 8,1 bar).
1 FERMEZ L’ALIMENTATION
PRINCIPALE D’EAU
Ouvrez le robinet le plus proche suffisamment
longtemps pour purger le tuyau.
• Une perceuse électrique.
• Une clé de 1/2 po ou une clé réglable.
• Un tournevis à lame plate et un tournevis Phillips.
2 CHOISISSEZ L’EMPLACEMENT
DU ROBINET
Choisissez pour le robinet un emplacement
facilement accessible. Il vaut mieux le brancher
de côté à un tuyau vertical. Si vous devez
le brancher à un tuyau horizontal, faites
le branchement en haut ou de côté, plutôt
qu’en bas du tuyau, pour éviter de recevoir
des sédiments du tuyau d’alimentation d’eau.
• Deux écrous à compression d’un diamètre extérieur
GHSRHWGHX[EDJXHVPDQFKRQV³pour brancher
le tuyau en cuivre au robinet d’arrêt et au robinet d’eau
du réfrigérateur.
OU
• Si vous utilisez une trousse d’alimentation d’eau GE avec
tuyau en matière plastique, les garnitures nécessaires
sont déjà montées au tuyau.
• Si votre canalisation d’eau actuelle a un raccord évasé
à une extrémité, vous aurez besoin d’un adaptateur
(que vous trouverez dans votre magasin de matériel
de plomberie) pour brancher le tuyau d’eau au
réfrigérateur, OU BIEN vous pouvez couper le raccord
évasé à l’aide d’un coupe-tube, puis utiliser un raccord
à compression. Ne coupez jamais l’extrémité finie
d’un tuyau de la trousse GE SmartConnect™ Refrigerator
Tubing.
3 PERCEZ UN TROU POUR LE ROBINET
Percez un trou de 1/4 po dans le tuyau d’eau,
à l’aide d’un foret dur. Enlevez toute barbure
due au perçage du trou dans le tuyau.
Faites attention de ne pas laisser de l’eau
couler dans votre perceuse électrique.
Si vous ne percez pas un trou de 1/4 po, vous
obtiendrez une alimentation d’eau réduite et
des glaçons plus petits.
• Un robinet d’arrêt pour brancher le tuyau d’eau froide.
Le robinet d’arrêt doit avoir une entrée d’eau avec
un diamètre intérieur minimal de 5/32 po au point
de jonction avec le TUYAU D’EAU FROIDE. Des robinets
d’arrêt à étrier sont souvent inclus dans les trousses
d’alimentation d’eau. Avant d’acheter, assurez-vous
que le robinet à étrier se conforme à vos codes de
plomberie locaux.
71
Instructions d’installation
INSTALLATION DE LA CONDUITE D’EAU (SUITE)
4 FIXEZ LE ROBINET D’ARRÊT
7 BRANCHEZ LE TUYAU AU ROBINET
Fixez le robinet d’arrêt au tuyau d’eau froide
à l’aide du collier de serrage.
Placez un écrou de compression et une bague
(manchon) à l’extrémité du tuyau et branchez-les
au robinet d’arrêt.
Collier de serrage
Assurez-vous que le tuyau soit bien inséré dans
le robinet. Serrez fort l’écrou de compression.
Pour le tuyau en matière plastique d’une trousse
GE SmartConnect™ Refrigerator Tubing, insérez
l’extrémité moulée du tuyau dans le robinet
d’arrêt et serrez l’écrou de compression
à la main, puis serrez un autre demi tour avec
une clé. Si vous serrez trop fort, vous pouvez
occasionner des fuites.
Tuyau vertical
d’eau froide
Robinet d’arrêt à
étrier
NOTE : Vous devez vous conformer aux Codes
de plomberie 248CMR du Commonwealth of
Massachusetts. Les robinets d’arrêt à étrier sont
illégaux et leur utilisation n’est pas autorisée au
Massachusetts. Consultez votre plombier local.
Tuyau
SmartConnect™
5 SERREZ LE COLLIER DE SERRAGE
Presse-joint
Robinet de sortie
Serrez les vis du collier jusqu’à ce que la rondelle
d’étanchéité commence à enfler.
Bague (manchon)
NOTE : Vous devez vous conformer aux Codes
de plomberie 248CMR du Commonwealth of
Massachusetts. Les robinets d’arrêt à étrier sont
illégaux et leur utilisation n’est pas autorisée au
Massachusetts. Consultez votre plombier local.
NOTE : Ne serrez pas trop. Vous risquez
d’écraser le tuyau.
Rondelle
Collier de serrage
Écrou de compression
Robinet d’arrêt
à étrier
Entrée
Vis du
collier
8 PURGEZ LE TUYAU
Ouvrez le robinet d’alimentation principale
d’eau et purgez le tuyau jusqu’à ce que l’eau
soit claire.
Fermez l’eau au niveau du robinet d’eau après
écoulement d’environ 1 litre (1 quart) d’eau par
le tuyau.
6 ACHEMINEZ LE TUYAU
Acheminez le tuyau du tuyau d’eau froide
au réfrigérateur.
Faites passer le tuyau par un trou percé dans
le mur ou le plancher (derrière le réfrigérateur
ou au niveau de l’armoire de cuisine adjacente),
aussi près du mur que possible.
Pour compléter l’installation du réfrigérateur, retournez
à l’étape 1 de la section Installation du réfrigérateur.
72
Bruits de fonctionnement normaux.
Les réfrigérateurs plus récents font des bruits différents de ceux des anciens. Les réfrigérateurs
modernes présentent plus de fonctions et sont plus avancés sur le plan technologique.
Entendez-vous ce que j’entends ? Ces bruits sont normaux.
OUIR !
HUMMM...
OUUCH....
„ Le nouveau compresseur à rendement élevé peut fonctionner
plus longtemps et plus vite que votre ancien réfrigérateur et vous
pouvez entendre un son modulé ou un ronflement aigu pendant son
fonctionnement.
„ Vous pouvez entendre un sifflement lorsque les portes se ferment.
Cela vient de l’équilibrage de pression dans le réfrigérateur.
„ Vous pouvez entendre les ventilateurs tourner à hautes vitesses. Cela
se produit lorsque le réfrigérateur vient d’être branché, lorsque les portes sont
ouvertes fréquemment ou lors de l’ajout d’une grande quantité d’aliments dans
les compartiments congélateur ou réfrigérateur.
Les ventilateurs permettent de maintenir les bonnes températures.
„ Les ventilateurs changent de vitesses pour assurer des économies d’énergie et
un refroidissement optimaux.
CLICS et CLAQUEMENTS
BRUITS D’EAU
„ Vous pouvez entendre des craquements ou des claquements lorsque
„
„
„
„
„
le réfrigérateur est branché pour la première fois. Cela se produit lorsque
le réfrigérateur se refroidit à la bonne température.
Le règlage du congélateur clique quand le compresseur se met
en marche ou s’ârrete.
La minuterie de dégivrage se mettant en marche ou s’ârretant pendant
le cycle de dégivrage.
L’expansion et la contraction des serpentins de refroidissement pendant
et après le dégivrage peuvent causer un craquement ou un claquement.
Sur les modèles équipés d’une machine à glaçons, après un cycle
de fabrication de glaçons, vous pouvez entendre les glaçons tomber
dans le bac.
Sur les modèles munis d’un distributeur, le mouvement des conduites
peut être audible lors de la première distribution d’eau et après
le relâchement du bouton du distributeur.
„ Le passage de l’agent frigorifique dans les serpentins de refroidissement du
congélateur peut être accompagné d’un gargouillement semblable à celui de
l’eau en ébullition.
„ L’eau tombant sur l’élément chauffant de dégivrage peut faire un bruit de
grésillement, de claquement ou de bourdonnement pendant le cycle de
dégivrage.
„ Un bruit de suintement d’eau peut être entendu pendant le cycle de dégivrage
lorsque la glace de l’évaporateur fond et tombe dans le bac de récupération.
„ Fermer la porte peut causer un gargouillement en raison de l’équilibrage de
pression.
Pour obtenir plus d’information sur les bruits
normaux de fonctionnement de la machine
à glaçons, veuillez consultez la section Machine
à glaçons automatique.
Avant d’appeler un réparateur…
&RQVHLOVGHGpSDQQDJH³eFRQRPLVH]GXWHPSVHWGHO·DUJHQW
Consultez d’abord les tableaux qui suivent et vous pourrez
peut-être éviter de faire appel à un réparateur.
Problème
Causes possibles
Correctifs
Le réfrigérateur
ne fonctionne pas
Le cycle de dégivrage est en cours.
• Attendez environ 30 minutes permettre au cycle de dégivrage
de se terminer.
La commande est réglée
sur 0 (arrêt).
• Réglez la commande de température sur un réglage
de température.
Le réfrigérateur est débranché.
• Enfoncez la fiche de l’appareil dans la prise murale.
Le disjoncteur ou le fusible
peut avoir sauté.
• Remplacez le fusible ou réenclenchez le disjoncteur.
Les pieds de nivellement
ont besoin d’être réglés.
• Consultez Mettez le réfrigérateur de niveau.
Vibration ou bruit
métallique (une légère
vibration est normale)
73
Avant d’appeler un réparateur…
Problème
Causes possibles
Le moteur fonctionne
pendant de longues
périodes
périodes ou
ou démarre
démarre et
et
s’arrête
fréquemment.
s’arrête
fréquemment.
(Les
(Les réfrigérateurs
réfrigérateurs
congélateurs étant plus
modernes
etmoteur
leurs doit
grands, leur
congélateurs étant plus
grands, leurplus
moteur
fonctionner
doit
fonctionner
plus
longtemps. Ils démarrent
longtemps.
Ils
démarrent
et
et s’arrêtent afin de
s’arrêtent afin de maintenir
des températures
uniformes.)
Ceci est normal lorsque le
• Attendez 24 heures pour que le réfrigérateur refroidisse
réfrigérateur vient d’être branché. complètement.
Correctifs
Ceci arrive souvent lorsque
une grande quantité d’aliments
a été mise au réfrigérateur.
• C’est normal.
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche la porte de fermer.
Temps chaud ou ouverture
fréquente des portes.
• C’est normal.
Les commandes de température • Consultez Les commandes.
ont été réglées aux températures
les plus basses.
La fonction TurboCool est active. • C’est normal quand la fonction TurboCool est active. Consultez
la section TurboCool pour de plus amples informations.
Température trop élevée
dans le congélateur ou
le réfrigérateur
La commande de température
du réfrigérateur ou du
congélateur n’est pas réglée
à une température assez basse.
• Consultez Les commandes.
Temps chaud ou ouverture
fréquente des portes.
• Abaissez la commande de température d’une position.
Consultez Les commandes.
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche la porte de fermer.
Givre sur les aliments
surgelés (il est normal
que du givre se forme
à l’intérieur du paquet)
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche la porte de fermer.
Vibration fréquente
Le commutateur de marche
de la machine à glaçons est
en position I (marche), mais
l’approvisionnement en eau du
réfrigérateur n’est pas branché.
• Mettez le commutateur de marche en position 0 (arrêt).
Le robinet d’eau sera endommagé si gardez le commutateur
de marche en position I (marche).
Petits glaçons ou glaçons
creux à l’intérieur
Le filtre à eau est bouché.
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
La machine à glaçons
automatique ne
fonctionne pas
(sur certains modèles)
Le commutateur de marche
n’est pas branché.
• Mettez le commutateur de marche en position I (marche).
Le voyant lumineux de la machine à glaçons devient vert quand
le commutateur de voyant lumineux de compartiment congélation
est pressé ou quand la porte du compartiment congélation est fermée.
L’alimentation d’eau est arrêtée
ou n’est pas branchée.
• Consultez Installation de la conduite d’eau.
Le compartiment
congélateur est trop chaud.
• Attendez 24 heures que le réfrigérateur soit
complètement froid.
Une accumulation de glaçons
dans le tiroir à glaçons peut
causer un arrêt de la machine
à glaçons.
• Égalisez les glaçons à la main.
Des glaçons se sont collés dans
la machine à glaçons (le voyant
lumineux vert de la machine
à glaçons clignote).
• Débranchez la machine à glaçons, enlevez les glaçons,
puis remettez en marche la machine à glaçons.
Le voyant lumineux de machine
à glaçons ne s’allume pas.
• C’est normal quand la porte du compartiment congélation est ouverte.
Le voyant lumineux de la machine à glaçons devient vert quand
le commutateur de voyant lumineux de compartiment congélation
est pressé ou quand la porte du compartiment congélation est fermée.
74
Les ouvertures de porte sont
• C’est normal.
trop fréquentes ou trop longues.
www.electromenagersge.ca
Problème
Causes possibles
Odeur/saveur
anormale des glaçons
Des aliments ont transmis leur
odeur/goût aux glaçons.
• Emballez bien les aliments.
Il faut nettoyer l’intérieur
du réfrigérateur.
• Consultez Entretien et nettoyage.
• Gardez une boite de bicarbonate de soude ouverte dans
votre réfrigérateur. Remplacez-la tous les trois mois.
Porte laissée ouverte.
• Vérifiez qu’il n’y a pas un paquet qui empêche la porte de fermer.
La commande de température
du congélateur n’est pas réglée
à une température assez basse.
• Consultez Les commandes.
Des aliments ont transmis
leur odeur au réfrigérateur.
• Les aliments à odeur forte doivent être emballés
hermétiquement.
• Gardez une boîte ouverte de bicarbonate de soude
dans le réfrigérateur.
Il faut nettoyer l’intérieur.
• Consultez Entretien et nettoyage.
Formation lente
des glaçons
Odeur dans
le réfrigérateur
Correctifs
De la condensation
s’accumule à l’extérieur
Cela n’est pas inhabituel pendant • Essuyez bien la surface extérieure et abaissez
les périodes de forte humidité.
la commande du réfrigérateur d’une position.
De l’humidité se forme
à l’intérieur (quand
il fait humide, l’air
transporte de l’humidité
à l’intérieur du
réfrigérateur quand
vous ouvrez les portes)
Vous ouvrez les portes trop
souvent ou trop longtemps.
• C’est normal.
La lumière de compartiment
réfrigération ou congélation
ne s’allume pas
Pas d’électricité à la prise.
• Remplacez le fusible ou remettez en marche
le disjoncteur.
L’ampoule a brûlé ou elle
n’est pas vissée à fond.
• Consultez Remplacement des ampoules électriques.
La porte/le tiroir
ne ferme pas seul
Vous devez ajuster les pieds
de nivellement.
• Consultez Installation du réfrigérateur.
La porte/le tiroir du
compartiment congélation
s’ouvre quand la porte du
réfrigérateur est fermée
C’est normal si, après s’être
ouvert, la porte/le tiroir du
compartiment congélation
se referme tout seul.
• Cela indique que la porte/le tiroir du compartiment congélation
a un bon joint. Si la porte/le tiroir du compartiment congélation
ne se referme pas automatiquement après s’être ouvert, consultez
la section Problème : La porte/le tiroir ne ferme pas seul, ci-dessus.
De l’air chaud souffle
du bas du réfrigérateur
C’est normal. Le moteur
se refroidit à l’air. Dans le processus
de réfrigération il est normal que
de la chaleur soit émise en bas
du réfrigérateur. Certains
revêtements de sol sont sensibles
et changent de couleur à ces
températures normales
et pas dangereuses.
Les aliments gèlent
dans le compartiment
réfrigération
Les aliments sont trop près de
l’ouverture de circulation d’air
à l’arrière du compartiment
réfrigération.
• Éloignez les aliments de l’ouverture de circulation d’air.
Le réglage de votre
réfrigérateur est trop froid.
• Réglez votre réfrigérateur à une température plus chaude en
sélectionnant une graduation à la fois.
Le chauffage du dégivrage
fonctionne.
• C’est normal.
Il y a une lueur orangée
dans le compartiment
congélation
75
Avant d’appeler un réparateur…
Problème
Causes possibles
Correctifs
Mauvais goût/odeur
de l’eau
Le distributeur d’eau n’a pas
été utilisé depuis longtemps.
• Faites couler l’eau jusqu’à ce que l’eau du système soit
remplacée par de l’eau fraîche.
L’eau versée dans
le premier verre est
chaude
Normal lorsque le réfrigérateur
est initialement installé.
• Attendez 24 heures pour que la température
du réfrigérateur se stabilise.
Le distributeur d’eau n’a pas été
utilisé depuis longtemps.
• Faites couler l’eau jusqu’à ce que l’eau du système soit
remplacée par de l’eau fraîche.
Le réservoir d’eau vient
d’être vidangé.
• Attendez plusieurs heures pour que l’eau refroidisse.
L’alimentation en eau est
coupée ou n’est pas raccordée.
• Consultez Installation de la conduite d’eau.
Le filtre à eau est bouché.
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Il y a de l’air dans la conduite
d’eau.
• Appuyez sur le bras de distribution pendant
au moins deux minutes.
L’eau dans le réservoir est gelée
parce que la température de
réglage est trop froide.
• Augmentez la température de réglage de compartiment
réfrigération et attendez 24 heures. Si l’eau ne coule pas
du distributeur près 24 heures, appelez le service.
Le distributeur d’eau
ne fonctionne pas
L’eau jaillit du distributeur La cartouche du filtre vient
d’être installée.
• Faites couler l’eau du distributeur pendant 3 minutes
(environ 6 litres).
La machine à glaçons
ne distribue ni eau
ni glaçons
La conduite d’eau ou
le robinet d’arrêt est bouché.
• Appelez un plombier.
Le filtre à eau est bouché.
• Remplacez la cartouche du filtre avec une nouvelle
cartouche ou installez le bouchon du filtre.
Cartouche de filtre
mal installée.
• Retirez et réinstallez la cartouche de filtre en vous
assurant qu’elle se bloque en place. La lame à l’extrémité
de la cartouche doit être positionnée verticalement.
Vous ne tenez pas le verre sous
le distributeur suffisamment
longtemps après avoir relâché
le bouton.
• Tenez le verre sous le distributeur pendant 2–3 secondes
après avoir relâché le bouton du distributeur. L’eau peut
continuer à couler après que vous ayez relâché le bouton.
De l’air peut se trouver dans
les conduites d’eau, causant
l’égouttement après
une distribution d’eau.
• Faites écouler l’eau pendant au moins 2 minutes
pour expulser l’air du système.
L’eau coule
du distributeur
76
www.electromenagersge.ca
Problème
Causes possibles
Mon écran indique
La fonction TurboCool est active. • Consultez la section TurboCool pour de plus amples
informations.
Le voyant lumineux du
filtre d’eau a changé de
couleur
C’est normal.
Le voyant lumineux de
Il faut remettre à zéro
filtre d’eau demeure rouge l’indicateur de filtre d’eau.
après un remplacement
du filtre d’eau
Correctifs
• Consultez la section Filtre d’eau pour de plus amples
informations.
• Appuyez sur la touche RESET WATER FILTER (remise
à zéro du filtre d’eau) et tenez-la appuyée pendant
3 secondes. Consultez la section Filtre d’eau pour
de plus amples informations.
Le voyant lumineux
de filtre d’eau ne
s’allume pas
C’est normal. Ce voyant devient • Consultez la section Filtre d’eau pour de plus amples
orange pour vous dire que vous
informations.
avez besoin de remplacer le filtre
bientôt. Vous devez remplacer
le filtre quand le voyant indicateur
de remplacement du filtre devient
rouge.
La poignée est lâche/
Il y a un espace vide pour
la poignée
Vous devez ajuster la poignée
de porte.
• Consultez les sections Fixez la poignée du compartiment
aliments frais et Fixez la poignée du compartiment
congélation pour des instructions détaillées.
Son du réfrigérateur
C’est l’alarme de porte.
• Fermez la porte.
Le réglage de contrôles
n’est pas allumé
Sur certains modèles,
• Si les réglages de contrôle ne s’allument pas, vérifiez
les ampoules électriques situées
que les ampoules électriques ne soient pas brûlées,
en haut du compartiment
et remplacez-les le cas échéant.
réfrigération allument les réglages
de contrôle de la température.
Les portes ne sont pas
Il faut réaligner les portes.
bien alignées (Uniquement
sur les modèles à deux
portes)
• Consultez la section Alignement des deux portes située
dans la section Remise en place des portes (modèles
de réfrigérateurs à deux portes uniquement).
Les paniers se coincent
lors de l’ouverture
ou de la fermeture
• Pour ouvrir : Enlevez certains produits du panier, lorsque
celui-ci est ouvert aussi loin que possible. Repositionnez
les produits laissés dans le panier et essayez de l’ouvrir
à nouveau.
• Pour fermer : Repositionnez les produits dans le panier
et enlevez tout produit placé au-dessus du bord du panier,
puis fermez-le.
Les paniers sont trop remplis.
77
Garantie du réfrigérateur.
Toutes les réparations en vertu de la garantie sont fournis par un technicien autorisé.
Pour céduler une réparation, appelez le 1.800.561.3344. Veuillez avoir votre numéro
de série et votre numéro de modèle à portée de main lorsque vous appelez pour
obtenir un service.
Agrafez votre facture ici.
Pour bénéficier du service de
réparation sous garantie, une
preuve de la date d’achat initial
est nécessaire.
Pendant la période de GE remplacera :
garantie de :
MODÈLES GE, et GE PROFILE™
Un An
A compter de la date
d’achat initial
Toute pièce du réfrigérateur qui s’avère défectueuse en raison d’un défaut de matériau ou de
fabrication. Pendant la validité de la présente garantie limitée d’un an, GE fournira également
gratuitement la main d’œuvre et le service pour réparer la pièce défectueuse.
Trente jours
(filtre à eau, si inclus) A compter
de la date d’achat initial
Toute pièce de la cartouche filtrante qui ne fonctionne pas à cause d’un vice de matériau ou de main
d’œuvre. Pendant la validité de la présente garantie limitée de 30 jours, GE fournira gratuitement une
cartouche filtrante de remplacement.
MODÈLES GE PROFILE SEULEMENT :
Cinq Ans
A compter de
la date d’achat initial
Toute pièce du système fermé du réfrigérateur (compresseur, condenseur, évaporateur et tous les
tuyaux de raccordement) qui s’avère défectueuse en raison d’un défaut de matériau ou de fabrication.
Pendant la validité de la présente garantie limitée de cinq ans, GE fournira également gratuitement la
main d’œuvre et le service pour réparer la pièce défectueuse dans le système fermé du réfrigérateur.
Ce qui n’est pas couvert par GE :
■ Les déplacements à votre domicile pour vous expliquer
l’utilisation de ce produit
■ Une installation, livraison ou maintenance défectueuse.
■ Une panne du produit par abus d’utilisation, par mauvaise
utilisation, par modification ou s’il a été utilisé dans un but
autre que celui pour lequel il a été fabriqué.
■ Détérioration des aliments.
■ Le remplacement des fusibles ou le réenclenchement du
disjoncteur du domicile.
■ Les dommages à la finition, tels que rouille de surface,
ternissement ou petites taches, non signalés dans un délai de
48 heures suivant la livraison.
■ Le remplacement de la cartouche filtrante, si incluse, à cause
d’une pression d’eau en dehors de la gamme de fonctionnement
recommandée ou à cause d’une concentration excessive de
sédiments dans l’eau d’alimentation.
■ Le remplacement des ampoules, si incluses, ou la cartouche
filtrante, si incluse, et dans des conditions autres que celles
susmentionnées.
■ Tout dommage causé par accident, incendie, inondation ou une
catastrophe naturelle.
■ Tout dommage fortuit ou indirect causé par des défauts
éventuels de cet appareil.
■ Le service s’il est impossible d’avoir accès au produit.
EXCLUSION DES GARANTIES TACITES - Votre recours exclusif est l’échange du produit suivant les modalités de
la Garantie Limitée. Toutes garanties tacites, y compris les garanties de valeurs marchandes ou d’adéquation
à des fins particulières, sont limitées à une durée d’un an ou à la durée la plus courte autorisée par la loi.
Pour les clients des États-Unis : Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants pour tout
produit acheté pour une utilisation domestique aux États-Unis. Si le produit est installé dans une région où ne se trouve
aucun réparateur autorisé GE, vous devrez peut-être assumer les frais de transport ou apporter l’appareil à un centre de
service autorisé GE. En Alaska, cette garantie exclut le coût d’expédition ou de dépannage à votre domicile.
Certains états n’acceptent pas d’exclusion ou de limites aux dommages indirects consécutifs. Certains droits particuliers
vous sont dévolus en vertu de la présente garantie et peuvent s’accompagner d’autres droits qui varient selon votre lieu
de résidence. Pour connaître vos droits juridiques, veuillez consulter le bureau local ou le bureau d’état des affaires aux
consommateurs ou le Procureur Général de votre état.
Garant : États-Unis : General Electric Company. Louisville, KY 40225
Pour les clients au Canada : Cette garantie est étendue à l’acheteur d’origine et aux propriétaires suivants pour tout
produit acheté aux Canada pour une utilisation domestique aux Canada.Le service à domicile en vertu de la garantie
sera fourni dans les régions où il est disponible et où MC Commercial estime raisonnable de le fournir.
78
Garant Canada: MC Commercial, Burlington, Ontario, L7R 5B6
Fiche technique de performance
Système de filtration SmartWaterMC - Cartouche MWF de GE
Données relatives au rendement
Capacité : 300 gallons (1135 litres)
/DFRQFHQWUDWLRQGHVFRQWDPLQDQWVWHVWpVSRXUFH¿OWUHGDQVO·HDXHQWUDQWGDQVOHV\VWqPHD
été réduite à une valeur inférieure ou égale à la limite admissible dans l’eau sortant du système,
FRQIRUPpPHQWDX[QRUPHVHWGHOD16)$16,/HV\VWqPHDpWpWHVWpHWFHUWL¿pSDU16)
International conformément aux normes 42 et 53 de la NSF/ANSI.
Veuillez visiter geappliances.com pour connaître la liste complète des contaminants testés et des
concentrations réduites.
Les énoncés de réduction pharmaceutiques n’ont pas été certifiés par la NSF International ou l’état de la Californie.
Énoncés éprouvés et vérifiés par un laboratoire indépendant :
Réduction
de contaminant
Aténolol
Fluoxétine
Ibuprofène
Progestérone
Triméthoprime
Moyenne pour l’eau
d’alimentation
978 ng/L
907 ng/l
885 ng/L
1097 ng/L
415 ng/L
Concentration d’amorce
spécifiée par NSF
N/A
N/A
N/A
N/A
N/A
Concentration
Concentration
% réduction
moyenne de
max permissible
moyenne
substance en sortie
en sortie
99.5%
5.0 ng/L
N/A
99.4%
5.4 ng/L
N/A
94.1%
52.3 ng/L
N/A
99.5%
5.0 ng/L
N/A
99.5%
2.0 ng/L
N/A
Exigences de
réduction NSF
N/A
N/A
N/A
N/A
N/A
Rapport
d’essai NSF
J-00121587
J-00121587
J-00121588
J-00121589
J-00121587
Directives et paramètres de l’alimentation en eau
Débit fourni
Alimentation en eau
0.5 gpm (21.9 lpm)
Eau potable
Pression d’eau
Température de l’eau
40-120 psi (2.8-8.2 bar)
33°F-100°F (0.6°C-38°C)
Il est impératif que les méthodes d’installation, d’entretien et de remplacement du filtre recommandées par le fabricant de ce produit soient respectées.
Consultez le manuel d’installation pour connaître les renseignements de la garantie.
Remarque : Bien que les essais aient été effectués dans des conditions normales
de laboratoire, la performance actuelle peut varier.
Cartouche de rechange : MWF. Pour connaître les coûts évalués des articles de
rechange, veuillez appeler au 1-800-626-2002 ou visitez notre site internet au
www.geapplianceparts.com.
AVIS
Pour réduire le risque associé aux dommages matériels causés par des fuites d’eau :
• Lisez et suivez les instructions avant de procéder à l’installation et d’utiliser votre système.
• L’installation et l’utilisation DOIVENT être conformes à tous les codes locaux
et nationaux de plomberie.
• Ne procédez pas à l’installation si la pression de l’eau dépasse 120 lb/po² (8,2 bars).
AVERTISSEMENT
Si votre pression d’eau dépasse 80 lb/po² (552 kPa), il est nécessaire d’installer un système
Pour réduire le risqué associé à l’ingestion de contaminants :
de limitation de pression. Communiquez avec un plombier professionnel si vous n’êtes
• N’utilisez pas l’eau dont la salubrité microbiologique est inconnue ou
pas sûr de la méthode de vérification de la pression d’eau.
dangereuse sans avoir effectué une désinfection des composants d’arrivée
• N’installez pas le système s’il y a des possibilités de coups de bélier. En cas de coup
et de sortie du système. Les systèmes certifiés pour la réduction de kystes
de bélier, vous devez installer un dispositif anticoup de bélier. Communiquez avec un
peuvent être utilisés pour de l’eau désinfectée contenant des kystes filtrables.
plombier professionnel si n’êtes pas sûr de la méthode permettant de vérifier cette condition.
Établissement EPA no 10350-MN-005.
• Ne raccordez pas le système à des conduites d’alimentation d’eau chaude.
Consultez la fiche technique de performance pour connaître les conditions d’utilisation, La température de service maximale de ce système de filtre est de 38 °C (100 °F).
les énoncés de santé certifiés par le service de santé publique de la Californie et les
• Protégez le filtre contre le gel. Vidangez l’eau du filtre lorsque la température se situe
remplacements. Certification du service de santé publique de la Californie
sous 0,6 °C (33 °F).
no 05-1698. Les contaminants qui peuvent être réduits ou éliminés par ce filtre à eau • La cartouche du filtre jetable doit être remplacée tous les six (6) mois ou moins si
ne sont pas obligatoirement présents dans votre eau.
le débit d’eau du distributeur d’eau ou du distributeur de glace diminue.
ARTICLE
DE RECHANGE
Mis à l’essai et certifié par NSF International
conformément aux normes 42 et 53 de la
ANSI/NSF du modèle MWF de GE pour les
énoncés de réductions mentionnés à la
fiche technique de performance.
79
Feuillet de données relatives à la performance
Cartouche GSWF du système de
Filtration d’eau GE SmartWater
Ce système a été essayé selon les normes NSF/ANSI 42/53 pour une réduction des substances énumérées ci-dessous.
La concentration des substances indiquées dans l’eau qui entre dans le système a été réduite à une concentration
inférieure ou égale à la limite permise pour l’eau quittant le système, telle que précisée par la norme NSF/ANSI 42/53.*
(facteurs intégrés de sécurité à 100% pour une utilisation sans compteur)
Norme NO 42 : Effets esthétiques
Paramètre
&KORUH
72
3DUWLFXOHV
USEPA
MCL
³
³
³
Influent
moyen
PJ/
³
P/
Qualité
influent concentration
PJ/+ 10%
³
10.000 particles/mL minimum
Effluent
Moyenne
Maximum
< 0,05 mg/L
0,05 mg/L
³
³
P/
P/
% Réduction
Moyenne
Minimum
97,29%
96,43%
³
³
Réduction
exigeante min.
> 50%
³
> 85%
% Réduction
Moyenne
Minimum
98,97%
98,61%
> 99,99%
> 99,99%
> 99,33%
> 99,33%
> 99,29%
97,86%
99,07%
98,75%
> 76,12%
> 66,67%
Réduction
exigeante min.
0,5 NTU
> 99,95%
0,010 mg/L
0,010 mg/L
0,0002 mg/L
0,003 mg/L
Norme NO 53 : Effets de santé
Paramètre
Turbidité
Spores
Plomb au pH 6,5
Plomb au pH 8,5
Lindane
Atrazine
USEPA
MCL
1 NTU***
99,95% UpGXFWLRQ
0,015 mg/L
0,015 mg/L
0,0002 mg/L
0,003 mg/L
Influent
moyen
10,3 NTU***
/
0,15 mg/L
0,14 mg/L
0,0216 mg/L
0,008 mg/L
Qualité influent
concentration
1 + 1 NTU***
50.000 L minimum
0,15 mg/L + 10%
0,15 mg/L + 10%
0,002 mg/L + 10%
0,009 mg/L + 10%
Effluent
Moyenne
Maximum
0,106 NTU
0,14 NTU
0
0
< 0,001 mg/L
< 0,001 mg/L
0,001 mg/L
0,003 mg/L
< 0,00002 mg/L
< 0,00002 mg/L
< 0,002 mg/L
< 0,002 mg/L
* Testé utilisant un débit de 0,5 gpm; une pression de 60 psig; un pH de 7,5 ± 0,5; et une temp. de 20 °C ± 3 °C.
** Mesures en particules/ml. Les particules utilisés étaient de 0,5–1 micron.
*** NTU = unités de turbidité néphélométrique
Spécifications d’opération
„
„
„
„
Capacité: certifiée jusqu’à maximum de 750 gallons (2838 l); jusqu’à maximum de six mois
Exigence en matière de pression : 2,8 à 8,2 bar (40 à 120 psi), sans choc
Température : 0,6°–38 °C (33°–100 °F)
Débit : 1,9 lpm (0,5 gpm)
Exigences générales d’installation/opération/entretien
„ Rincez la nouvelle cartouche à plein débit pendant 3 minutes afin de libérer de l’air.
„ Remplacez la cartouche lorsque le débit devient trop lent.
Avis spéciaux
„ Les directives d’installation, la disponibilité de pièces et de service ainsi que la garantie standard sont expédiées avec le produit.
„ Ce système d’eau potable doit être entretenu conformément aux directives du fabricant, y compris le remplacement des cartouches
du filtre.
„ N’utilisez pas lorsque l’eau présente un danger microbiologique ou lorsque l’eau est d’une qualité inconnue sans désinfecter adéquatement
le système avant ou après; le système peut servir pour de l’eau désinfectée qui pourrait contenir des spores filtrables.
„ Les contaminants ou autres substances retirées ou réduites par ce système de traitement de l’eau ne sont pas nécessairement dans
votre eau.
„ Vérifiez pour vous assurer de vous conformer aux lois et règlements locaux et de l’état.
„ Notez que bien que l’essai a eu lieu dans des conditions normales de laboratoire, mais que le rendement réel peut varier. Les systèmes
doivent être installés et fonctionner conformément aux procédures et directives recommandées par le fabricant.
Système testé et homologué par NSF International, selon la norme No 42 pour la réduction de
la concentration de chlore, la suppression des goûts et odeurs, particules Catégorie I, et selon
la norme No 53 pour la réduction de spores, plomb, Lindane, Atrazine et turbidité.
Fabriquée pour : General Electric Company, Louisville, KY 40225
80
NSF
®
Notes.
81
Soutien au consommateur.
Site Web appareils électroménagers GE
www.electromenagersge.ca
Vous avez une question ou vous avez besoin d’aide pour votre appareil électroménager? Contactez-nous par
Internet au site www.electromenagersge.ca 24 heures par jour, tous les jours de l’année.
Service de réparations
1.800.561.3344
Service de réparations GE est tout près de vous.
Pour faire réparer votre électroménager GE, il suffit de nous téléphoner.
Studio de conception réaliste
Sur demande, GE peut fournir une brochure sur l’aménagement d’une cuisine pour les personnes à mobilité réduite.
Écrivez: Directeur, Relations avec les consommateurs, Mabe Canada Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Prolongation de garantie
www.electromenagersge.ca
Achetez un contrat d’entretien GE avant que votre garantie n’expire et bénéficiez d’un rabais substantiel.
Ainsi le service après-vente GE sera toujours là après expiration de la garantie.
Visitez notre site Web ou appelez-nous au 1.888.261.2133.
Pièces et accessoires
Ceux qui désirent réparer eux-mêmes leurs électroménagers peuvent recevoir pièces et accessoires
directement à la maison (cartes VISA, MasterCard et Discover acceptées).
Les directives stipulées dans le présent manuel peuvent être effectuées par n’importe quel utilisateur.
Les autres réparations doivent généralement être effectuées par un technicien qualifié. Soyez prudent,
car une réparation inadéquate peut affecter le fonctionnement sécuritaire de l’appareil.
Vous trouverez dans les pages jaunes de votre annuaire le numéro du Centre de service Mabe le plus proche.
Autrement, appelez-nous au 1.800.661.1616.
Contactez-nous
Si vous n’êtes pas satisfait du service après-vente dont vous avez bénéficié :
Premièrement, communiquez avec les gens qui ont réparé votre appareil.
Ensuite, si vous n’êtes toujours pas satisfait envoyez tous les détails–numéro de téléphone compris–au
Directeur, Relations avec les consommateurs, Mabe Canada Inc.
Bureau 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Inscrivez votre appareil électroménager
www.electromenagersge.ca
Inscrivez votre appareil électroménager en direct, aussitôt que possible. Cela améliorera nos
communications et notre service après-vente. Vous pouvez également nous envoyer par la poste
le formulaire d’inscription joint à votre documentation.
82
Información de seguridad . . . . . . 84, 85
Instrucciones de operación
Características adicionales . . . . . . . . . . . . . . .91
Cómo reemplazar
las bombillas de luz. . . . . . . . . . . . . . . . . . . . . . .96
Congelador . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92
Cuidado y limpieza
del refrigerador. . . . . . . . . . . . . . . . . . . . . . . 94, 95
El filtro de agua. . . . . . . . . . . . . . . . . . . . . . . 88, 89
Gavetas preservadoras
y contenedores. . . . . . . . . . . . . . . . . . . . . . . . . . .91
Los controles del refrigerador . . . . . . . . 86, 87
Los estantes y compartimientos
del refrigerador. . . . . . . . . . . . . . . . . . . . . . . 90, 91
Máquina de hielo automática . . . . . . . . 93, 94
Instrucciones de instalación
Cómo invertir
el vaivén de la puerta
(Modelos de refrigerador
de una sola puerta únicamente). . . 105–107
Cómo reemplazar la gaveta
del congelador . . . . . . . . . . . . . . . . . . . . . . . . . 104
Cómo retirar la gaveta
del congelador . . . . . . . . . . . . . . . . . . . . . . . . . 103
Cómo retirar y volver a colocar
las puertas (Modelos de refrigerador
de doble puerta únicamente) . . . . . 108–111
Instalación de la tubería
del agua . . . . . . . . . . . . . . . . . . . . . . . . . . . 112–114
Instalación del refrigerador. . . . . . . . . .98–102
Preparación para
instalar el refrigerador. . . . . . . . . . . . . . . . . . . .97
Solucionar problemas . . . . . . . . 115–119
Sonidos normales de la operación . . . . . 115
Servicio al consumidor
Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120
Hoja de datos
de funcionamiento . . . . . . . . . . . . . . . . 121, 122
Servicio al consumidor . . . . . . . . . . . . . . . . . 127
Anote aquí los números de modelo
y de serie:
No. de modelo ____________________
No. de serie ______________________
Usted los verá en una etiqueta en el interior
del compartimiento de refrigerador en
la parte superior en el lado derecho.
83
INFORMACIONES IMPORTANTES DE SEGURIDAD.
LEA PRIMERO TODAS LAS INSTRUCCIONES.
SEGURIDAD
Sitio Web de Electrodomésticos de GE
Para más información sobre el funcionamiento de su refrigerador, visite
www.GEAppliances.com
INFORMACIÓN DE SEGURIDAD DEL REFRIGERADOR
Éste es el símbolo de alerta de seguridad. El mismo alerta sobre potenciales riesgos de muerte o lesiones tanto para
usted con para otras personas. Todos los mensajes de seguridad estarán a continuación del símbolo de alerta de seguridad y con la palabra “PELIGRO”, “ADVERTENCIA” o “PRECAUCIÓN”. Estas palabras se definen como:
Indica una situación de riesgo que, si no se evita, podría resultar en la muerte o en lesiones graves.
PELIGRO
ADVERTENCIA
Indica una situación de riesgo que, si no se evita, podría resultar en la muerte o en lesiones graves.
PRECAUCIÓN
Indica una situación de riesgo que, si no se evita, podría resultar en lesiones menores o moderadas.
ADVERTENCIA
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
A fin de reducir el riesgo de incendio, explosión, descargas eléctricas o lesiones
al usar su refrigerador, siga estas precauciones básicas de seguridad:
„ Este refrigerador se deberá instalar y ubicar adecuadamente
de acuerdo con las Instrucciones de Instalación antes de ser
usado.
„ Desenchufe el refrigerador antes de hacer reparaciones,
reemplazar una lámpara de luz o hacer una limpieza.
Nota: La corriente que va al refrigerador no puede ser
desconectada por ninguna configuración del panel de control.
Nota: Las reparaciones deberán ser realizadas por un Profesional
del Servicio Técnico calificado.
„ Reemplace todas las piezas y paneles antes del uso.
„ No guarde ni use gasolina u otros vapores inflamables y líquidos
cerca de este u otros electrodomésticos.
„ Debido a los posibles riesgos sobre la seguridad bajo
ciertas condiciones, recomendamos enfáticamente no usar
prolongadores. Sin embargo, si se debe usar un prolongador,
PRECAUCIÓN
„ A fin de evitar riesgos de que los niños sufran asfixia o queden
atrapados, retire las puertas de comidas frescas y del freezer de
cualquier refrigerador antes de deshacerse o dejar de usar el
mismo.
„ No permita que los niños se trepen, paren o cuelguen de
las manijas de la puerta o de los estantes del refrigerador.
Podrían sufrir lesiones graves.
INSTRUCCIONES IMPORTANTES DE SEGURIDAD
$¿QGHUHGXFLUHOULHVJRGHOHVLRQHVDOXVDUHOUHIULJHUDGRUVLJDHVWDVSUHFDXFLRQHV
básicas.
„ No limpie estantes de vidrio ni tapas con agua caliente
cuando estén fríos. Los estantes de vidrio y las tapas se
pueden romper si son expuestos a cambios de temperatura
repentinos o impactos, tales como sacudones o caídas. El
vidrio templado está diseñado para destruirse en pequeñas
piezas en caso de rotura.
„ Mantenga los dedos fuera de los espacios de “riesgo de
lastimaduras”; los despejes entre las puertas y entre las
puertas y el gabinete son necesariamente pequeños.
Tenga el cuidado de cerrar las puertas cuando los niños se
encuentren en el área.
84
es absolutamente necesario que sea un prolongador para
electrodoméstico de la lista UL (en Estados Unidos) o uno
certificado por CSA (en Canadá), de 3 cables con conexión a
tierra, que cuente con un enchufe con conexión a tierra y un
tomacorriente con una graduación eléctrica del cable de 15
amperes (mínimo) y 120 volts.
„ No toque las superficies frías del compartimiento del freezer
cuando las manos estén húmedas o mojadas, ya que la piel
se podrá adherir a estas superficies extremadamente frías.
„ No vuelva a congelar comidas que hayan estado
totalmente congeladas en forma previa.
„ En refrigeradores con máquinas de hacer hielo automáticas,
evite el contacto con las partes móviles del mecanismo
eyector o con el elemento de calefacción que libera los
cubos. No coloque los dedos ni las manos en el mecanismo
de la máquina de hielo automática mientras el refrigerador
esté enchufado.
GEAppliances.com
SEGURIDAD (CONT)
INSTALACIÓN
ADVERTENCIA
Riesgo de Explosión.
Mantenga cualquier material y vapores inflamables, tales como gasolina, alejados del refrigerador. Si
no se cumple con esto se podrá producir una explosión, incendio o la muerte.
CONEXIÓN DE LA ELECTRICIDAD
ADVERTENCIA
Riesgo de Descarga Eléctrica.
Enchufe en un tomacorriente con conexión a
tierra de 3 cables.
No elimine el cable de conexión a tierra.
No use un adaptador.
Si no se siguen estas instrucciones se podrá
producir a muerte, incendios o descargas
eléctricas.
Nunca, bajo ninguna circunstancia, corte o elimine el tercer cable (tierra) del cable de corriente.
Para su seguridad personal, este electrodoméstico debe estar adecuadamente conectado a tierra.
El cable de corriente de este electrodoméstico contiene un
enchufe de 3 cables (conexión a tierra) que se conecta a un
tomacorriente de pared estándar de 3 cables (conexión a tierra)
para minimizar la posibilidad de riesgos de descargas eléctricas
por parte del mismo.
Se requiere un suministro eléctrico con fusible y conexión
a tierra de 115 voltios de CA, 60 Hz, 15 o 20 amperes. Esto
garantiza el mejor funcionamiento y además previene la
sobrecarga de los circuitos del hogar, lo cual podría ocasionar
riesgos de incendio debido al recalentamiento de cables.
Contrate a un electricista calificado para que controle el
tomacorriente y el circuito eléctrico, a fin de asegurar que el
enchufe esté correctamente conectado a tierra.
Nunca desenchufe el refrigerador tirando del cable de
corriente. Siempre tome su enchufe firmemente y empuje el
mismo hacia afuera para retirarlo.
En caso de contar con un tomacorriente de pared de 2 cables,
es su responsabilidad y obligación reemplazarlo por un
tomacorriente de pared de 3 cables correctamente conectado
a tierra. No use un adaptador.
Repare o reemplace de inmediato todos los cables de corriente
pelados o con cualquier tipo de daño. No use un cable con
cortaduras o abrasión sobre su extensión o extremos.
El refrigerador debería estar siempre conectado a un enchufe
específico con un índice de voltaje equivalente al que figura en
su etiqueta de características técnicas.
Al alejar el refrigerador de la pared, se deberá tener cuidado de
que no ruede sobre ni dañe el cable de corriente.
FORMA ADECUADA DE DESCARTAR SU ANTIGUO REFRIGERADOR
ADVERTENCIA
: Riesgo de que los niños sufran asfixia o y queden atrapados.
Retire del refrigerador las puertas de comidas frescas y del freezer, antes de descartar el refrigerador.
Si esto no se realiza, los niños podrán quedar atrapados y ocasionar la muerte o daño cerebral.
IMPORTANTE: Que un niño quede atrapado o que sufra una asfixia no
son problemas del pasado. Los refrigeradores antiguos
o abandonados aún son peligrosos, incluso aunque se
conserven por “sólo unos pocos días”. Si se deshará de su
antiguo refrigerador, siga las siguientes instrucciones a fin
de evitar accidentes.
Antes de Descartar su Antiguo Refrigerador o
Freezer:
„ Retire las puertas de comidas frescas y del freezer.
„ Deje los estantes en su lugar de modo que los niños no
puedan trepar dentro con facilidad.
Refrigerantes
Todos los productos de refrigeración cuentan
con refrigerantes, que de acuerdo con la ley
federal deberán ser eliminados antes de descartar
el producto. Si se deshará de un producto de
refrigeración antiguo, consulte a la compañía a cargo
sobre cómo deshacerse del mismo.
LEA Y SIGA ESTA INFORMACIÓN DE SEGURIDAD CUIDADOSAMENTE.
GUARDE ESTAS INSTRUCCIONES
85
Los controles con niveles de temperaturas.
(en algunos modelos)
ACTUAL
TEMP
(FIG B)
(FIG A)
(en algunos modelos)
NOTA: El refrigerador se envía con una película de protección que cubre los controles de la temperatura. Si esta
película no se retiró durante la instalación, hágalo ahora.
Los controles de temperatura vienen preconfigurados de fábrica a 37° F tanto para el compartimento del refrigerador y
a 0° F para el compartimento del congelador. Deje pasar 24 horas para que la temperatura se estabilice en los niveles
preconfigurados.
Los controles de la temperatura pueden exhibir tanto la temperatura establecida (SET) como la temperatura real en el
refrigerador y en el congelador. La temperatura real puede variar ligeramente de la temperatura fijada según su uso y el
ambiente de operación.
Ajustar uno o ambos controles a la posición OFF (APAGADO) detiene la refrigeración tanto en el compartimiento del
congelador como en el refrigerador, pero no interrumpe el suministro eléctrico hacia el refrigerador.
Cómo cambiar la temperatura
Para modelos con controles en la puerta:
FIG. “A” Para cambiar la temperatura, presione y suelte el
botón WARMER (MÁS CALIENTE) o COLDER (MÁS FRÍO). La luz de
ACTUAL TEMP (temp real) se encenderá y la pantalla mostrará
la temperatura real. Para cambiar la temperatura Pulse el botón
WARMER (MÁS CALIENTE) o COLDER (MÁS FRÍO) hasta que
aparezca la temperatura deseada.
FIG. “B” Para visualizar la temperatura real, presione y libere
el botón ACTUAL TEMP. La pantalla permanecerá encendida
por 10 segundos.
Para cambiar la temperatura, presione y suelte el botón
WARMER (MÁS CALIENTE) o COLDER (MÁS FRÍO). La luz de SET
TEMP se encenderá. Pulse el botón WARMER (MÁS CALIENTE)
o COLDER (MÁS FRÍO) hasta que aparezca la temperatura
deseada.
Para controles dentro del refrigerador:
Al abrir la puerta puede verse la temperatura real. Para cambiar
la temperatura, presione las almohadillas WARMER (más
caliente) o COLDER más frío) hasta visualizar la temperatura
deseada.
86
Una vez la temperatura deseada haya sido ajustada, la pantalla
de la temperatura regresará a las temperaturas reales del
refrigerador y del congelador después de 5 segundos. Puede
que sean necesarios varios ajustes. Cada vez que usted ajuste
los controles, permita que transcurran 24 horas para que el
refrigerador alcance la temperatura que usted ha ajustado.
Para apagar el sistema de enfriamiento, pulse el botón
WARMER (MÁS CALIENTE) para el refrigerador o el congelador
hasta que la pantalla muestre OFF (Apagado). Para accionar
la unidad una vez más, presione el botón COLDER (MÁS FRÍO),
para el refrigerador o el congelador. Entonces presione otra
vez e irá a los puntos preajustados de 0° F para el congelador
y 37° F para el refrigerador. Ajustar uno o ambos controles a
la posición OFF (APAGADO) detiene la refrigeración tanto en el
compartimiento del congelador como en el refrigerador, pero
no interrumpe el suministro eléctrico hacia el refrigerador.
Acerca de TurboCool.™ (en algunos modelos)
GEAppliances.com
Cómo funciona
(en algunos modelos)
(en algunos modelos)
TurboCool enfría rápidamente el
compartimiento del refrigerador para
enfriar los alimentos más rápidamente.
Use TurboCool cuando agregue grandes
cantidades de alimentos al compartimiento
del refrigerador, guardando alimentos después
de que han estado expuestos a temperatura
ambiental o cuando se disponga a guardar
comida sobrante. También puede ser usado
si el refrigerador ha estado sin suministro
eléctrico por un período extenso.
Cómo usar
Presione TurboCool. La temperatura del
refrigerador mostrará
.
Después de que TurboCool sea completado, el
compartimiento del refrigerador regresará al
ajuste original.
NOTAS: La temperatura del refrigerador no
puede cambiarse durante TurboCool.
Una vez activado, el compresor se encenderá
inmediatamente y los ventiladores harán
el ciclo de encendido y apagado a altas
velocidades, según sea necesario por ocho
horas. El compresor continuará funcionando
hasta que el compartimiento del refrigerador
se refrigere a aproximadamente 34º F (1º C),
luego hará el ciclo de encendido y apagado
para mantener este ajuste. Después de 8
horas, o si el TurboCool es presionado otra vez,
el compartimiento del refrigerador regresará al
ajuste original.
La temperatura del congelador no es
afectada durante TurboCool.
Cuando abra la puerta del
refrigerador durante TurboCool, los
ventiladores continuarán funcionando
si han hecho el ciclo de encendido.
Sobre la alarma de la puerta (en algunos modelos)
La alarma de la puerta comenzará a sonar
si cualquier de las puertas queda abierta
por más de 2 minutos. Una vez que se cierra la
puerta, el sonido para.
(en algunos modelos)
(en algunos modelos)
Sobre Energy Saver (Ahorro de Energía) (en algunos modelos)
Este producto está equipado con una
característica de ahorro de energía. El
refrigerador se empaca con la característica de
ahorro de energía activada.
(en algunos modelos)
Con el tiempo, puede formarse humedad en la
superficie frontal del gabinete del refrigerador y
provocar herrumbre. Si aparece humedad en la
superficie frontal del gabinete del refrigerador,
apague la característica de ahorro de energía
presionando y liberando la almohadilla
ENERGY SAVER en el panel de control.
(en algunos modelos)
87
El filtro de agua. (en modelos 22 y 23 únicamente)
Cartucho del filtro
Tapón de derivación del filtro
El cartucho del filtro de agua está ubicado
en la esquina superior derecha trasera
del compartimento del refrigerador.
Se debe usar el tapón de derivación
del filtro cuando un cartucho de filtro de
reemplazamiento no se puede encontrar.
El dispensador y el dispositivo para hacer hielo
no pueden funcionar sin el filtro
o sin el tapón de derivación del filtro.
Reemplazar el filtro
Hay una luz indicadora de reemplazo
del cartucho del filtro de agua en la pantalla
de temperatura. Si se enciende una luz
de color naranja, se debe cambiar el filtro
en poco tiempo. El cartucho del filtro debe
cambiarse si se enciende una luz de color rojo
o si disminuye el flujo de agua hacia
el dispensador o hacia el dispositivo para hacer
hielo.
Instalar el cartucho del filtro
Portacartuchos
Si está reemplazando el cartucho, primero
retire el anterio girándolo hacia la izquierda
lentamente. NO tire del cartucho hacia
abajo. Puede perder
un poco de agua.
PRECAUCIÓN Si se ha quedado aire
atrapado en el sistema, el cartucho del filtro
podría ser expulsado conforme es removido.
Use precaución cuando lo remueva.
Portacartuchos
(En algunos modelos)
Retire el papel de aluminio protector
del extremo del cartucho.
Llene el cartucho de reemplazo con agua
del grifo para permitir que fluya mejor del
dispensador inmediatamente después de
la instalación.
Alinee la flecha del cartucho y el soporte
del cartucho, lentamente rote el cartucho
en sentido de las agujas del reloj hasta que
pare. Cuando el cartucho está instalado
apropiadamente, usted siente un “clic”
cuando encaja en su lugar. No lo apriete
demasiado.
Pase agua por el dispensador
por 3 minutos (aproximadamente
11ø2 galones) para despejar el sistema
y para evitar chisporroteos. Ver
la sección Cómo usar el dispensador.
Presione la tecla de RESET WATER FILTER
(resetear el filtro de agua) y sostenga
durante 3 segundos.
(En algunos modelos)
88
NOTA: Un cartucho del filtro recién instalado
podría causar que el agua chisporrotee desde
el dispensador.
Filtros de recambio:
Para pedir cartuchos adicionales
en los Estados Unidos, visite nuestro sitio
Web, GEAppliances.com, o llame a GE para
partes y accesorios al 800.626.2002.
Modelo de filtro MWF
El filtro de agua. (en modelos 20 únicamente)
GEAppliances.com
Cartucho del filtro
Tapón de derivación del filtro
El cartucho del filtro de agua está ubicado
en la esquina superior derecha trasera del
compartimento del refrigerador.
Se debe usar el tapón de derivación del
filtro cuando un cartucho de filtro de
reemplazamiento no se puede encontrar. El
dispensador y el dispositivo para hacer hielo no
pueden funcionar sin el filtro o sin el tapón de
derivación del filtro.
Reemplazar el filtro
El cartucho del filtro debe cambiarse cuando
disminuye el flujo de agua hacia la máquina de
hielo, o cada seis meses.
Instalar el cartucho del filtro
Si está reemplazando el cartucho, primero
retire el anterior. Abra la tapa del cartucho
presionando la pestaña al frente y halando
hacia abajo.
Filtros de recambio:
Para pedir cartuchos adicionales en los
Estados Unidos, visite nuestro sitio Web,
GEAppliances.com, o llame a GE para partes
y accesorios al 800.626.2002.
Modelo GSWF
Retire el cartucho rotándolo lentamente en
contra del sentido de las agujas del reloj. Es
posible que caiga una pequeña cantidad
de agua.
PRECAUCIÓN Si se ha quedado aire
atrapado en el sistema, el cartucho del filtro
podría ser expulsado conforme es removido.
Use precaución cuando lo remueva.
Retire el papel de aluminio protector
del extremo del cartucho.
Alinee la flecha del cartucho
y el soporte del cartucho, lentamente
rote el cartucho en sentido de
las agujas del reloj hasta que pare.
Cuando el cartucho está instalado
apropiadamente, usted siente un “clic”
cuando encaja en su lugar. La manija
en el extremo del cartucho debería estar
colocada verticalmente. No lo apriete
demasiado.
Cierre la tapa del cartucho.
89
Sobre los estantes y compartimientos.
No todas las características están presentes en todos los modelos.
Reorganización de los estantes
Los estantes en el compartimiento del refrigerador son ajustables.
Compartimiento del refrigerador
Para quitar:
Quite todos los elementos del estante.
Incline el estante en la parte del frente.
Algunos modelos tienen estantes
con cable que pueden ajustarse de
la misma manera.
Levante el estante hacia arriba en la parte
de atrás y saque el estante.
Para reemplazarlo:
Mientras inclina el estante hacia arriba,
inserte el gancho superior en la parte
posterior del estante en la ranura de la
corredera.
Baje el frente del estante hasta que la parte
inferior del estante se ajuste en su lugar.
Estantes a prueba de escurrimientos (en algunos modelos)
Los estantes a prueba de escurrimientos
tienen bordes especiales para evitar que
los escurrimientos se rieguen a los estantes
inferiores. Para retirar o reemplazar los
estantes, vea Reorganización de los estantes.
Estante deslizante a prueba de escurrimientos (en algunos modelos)
El estante deslizante a prueba de
escurrimientos le permite alcanzar alimentos
almacenados detrás de otros. Los bordes
especiales están diseñados para ayudar a
evitar que los escurrimientos se rieguen a los
estantes inferiores.
Para retirarlo:
Quite todos los elementos del estante.
Quite el estante del compartimento
levantándolo hacia arriba y afuera.
Quite el estante de vidrio del armazón
deslizando el estante hacia fuera hasta que
se detenga.
Jale el estante hacia arriba para liberarlo
del frente del armazón.
Deslice el estante hacia atrás para liberarlo
de la parte trasera del armazón.
Para volver a instalar el estante de vidrio,
invierta las instrucciones.
Asegúrese de que el estante esté plano después
de la reinstalación y no se mueva libremente de
lado a lado.
Asegúrese de que empuje los estantes
completamente antes de cerrar la puerta.
Estante retráctil (en algunos modelos)
Este estante puede retraerse a la mitad de
su tamaño para poder almacenar elementos
altos en el estante inferior.
Para quitar:
Levante el estante hacia afuera y arriba.
Para volver el estante a su posición original,
jálelo hacia arriba y adelante. Empuje
suavemente hacia abajo para trabar el
estante en su posición.
Deslice el estante hasta que se detenga.
Compartimientos no ajustables en la puerta
Para retirarlos: Levante el compartimiento
recto y luego hálelo.
90
Para reemplazarlos: Inserte el compartimiento
en los soportes moldeados en la puerta y
empuje hacia abajo. Éste se ajustará en su
lugar.
GEAppliances.com
Compartimientos ajustables en la puerta
Los compartimientos ajustables pueden
llevarse fácilmente del refrigerador al área
de trabajo.
Para retirarlos: Levante el estante recto
y luego hálelo.
El reborde ayuda a evitar la caída,
derramamiento o deslizamiento de elementos
pequeños que se almacenen en el estante de la
puerta. Agarre el retenedor del dedo cerca de
la parte posterior del reborde y muévalo para
ajustarlo a sus necesidades.
Para reemplazar o cambiar de lugar:
Deslice el compartimiento justo encima de los
soportes de la puerta, y presione hacia abajo. El
compartimiento se trabará en su lugar.
Sobre las características adicionales.
Bandeja minimizadora (en algunos modelos)
La bandeja deslizante para bebidas sostiene 12
latas de soda o dos botellas de vino / agua (a lo
largo). Puede retirarse para su limpieza.
Para retirarla: Deslice la bandeja hacia
la posición de freno, levante la bandeja
y pase la posición de freno y levántela.
Sobre las gavetas preservadoras y contenedores.
No todas las características están presentes en todos los modelos.
Gaveta preservadora de frutas y vegetales
El exceso de agua que pueda acumularse al
fondo de las gavetas debe retirarse y se deben
limpiar las gavetas.
Gaveta preservadora de humedad ajustable (en algunos modelos)
Deslice el control completamente hasta
la posición HIGH (alto) para ofrecer la alta
humedad recomendada para la mayoría
de los vegetales.
Lleve el control por completo hasta la posición
LOW (bajo) para ofrecer los niveles bajos de
humedad recomendados para la mayoría de
las frutas.
Contenedor para Deli de temperatura ajustable (en algunos modelos)
Segunda ranura
desde la parte
superior
Cuando el contenedor se coloca en la segunda
ranura desde la parte superior de la bandeja
y el nivelador está en COLDEST (más frío), el
aire del congelador se ve obligado a circular el
contenedor para mantenerlo bien frío.
Puede mover el contenedor a cualquier
ubicación si no desea el almacenamiento más
frío.
Los niveles se pueden ajustar en cualquier nivel
entre frío
y más frío
.
Cuando se fije en frío, el contenedor
permanecerá en la temperatura normal
del refrigerador.
Los niveles más fríos proporcionan el área
de almacenamiento más fría.
91
Sobre el congelador.
No todas las características están presentes en todos los modelos.
Estantes y canastas del congelador
Un estante por encima del recipente
para hielo
Una canasta de ancho medio
NOTA: No llene las canastas más allá del borde
de la canasta. Esto puede provocar que las
canastas se traben o bloqueen cuando se
abren o cierran.
Una canasta delgada de ancho completo
Una canasta delgada de ancho completo
El aspecto y las características
pueden variar
Retiro de la canasta
Para retirar la canasta profunda de ancho
completo en los modelos con gaveta del
congelador:
Abra la gaveta del congelador hasta que
pare.
El aspecto puede variar
La canasta del congelador se apoya
sobre las lengüetas internas de los
deslizadores del cajón.
Levante la canasta para liberarla de las 6
lengüetas del soporte deslizador.
Incline la canasta y sáquelo del cajón.
Cuando vuelva a colocar la canasta profunda
de ancho completo:
Incline la canasta hacia atrás y desciéndala en
el cajón. Gire la canasta a la posición horizontal
y presiónela hacia abajo dentro de las 6
lengüetas de alineación.
NOTA: Siempre verifique que la canasta esté
bien colocada en las 6 lengüetas del soporte
deslizador antes de deslizarlo dentro del
congelador. La canasta puede girarse en
cualquier dirección del frente hacia atrás e
instalarse en el congelador.
Para retirar la canasta de ancho medio:
Hale la canasta hacia fuera hasta el punto
del freno.
Levante la canasta hacia arriba en el frente
para liberarla de las correderas.
Levante la parte posterior hacia arriba y
hacia fuera de la corredera.
Al reemplazar la canasta, cerciórese de que
las pestañas y los ganchos metálicos en los
costados de la canasta encajen arriba de la
parte superior de las correderas de la canasta.
NOTA: Siempre cerciórese de cerrar
completamente la canasta.
El aspecto puede variar
Para retirar la canasta delgada de ancho
completo:
Hale la canasta hacia fuera en el punto del
freno.
Levante el frente hacia arriba y por encima
el punto de freno.
El aspecto puede variar
92
Levante la canasta hacia arriba y hacia
fuera.
Sobre la máquina de hielo automática.
GEAppliances.com
Un refrigerador recientemente instalado puede tomar entre 12 y 24 horas para empezar a hacer hielo.
Interruptor de corriente Máquina
de hielos
Luz verde de
la corriente
Brazo indicador
Máquina de hielo automática (en algunos modelos)
La máquina de hielos producirá siete cubos por ciclo,
aproximadamente entre 100 y 130 cubos en un
periodo de 24 horas, dependiendo de la temperatura
del compartimiento del congelador, la temperatura
del cuarto, el número de veces que se abre la puerta
y otras condiciones de uso.
Vea más abajo para la forma de alcanzar el hielo y el
interruptor eléctrico.
Si el refrigerador se opera antes de hacer la conexión
del agua hacia la máquina de hielo, fije el interruptor
de corriente en la posición O (apagado).
Cuando se haya conectado el refrigerador al
suministro de agua, fije el interruptor de corriente
en la posición I (encendido). La luz de encendido del
dispositivo de hacer hielo será de color verde cuando
el interruptor de la luz del congelador esté pulsado
o cuando la puerta del congelador se encuentre
cerrada.
La máquina de hielos se llenará de agua cuando se
enfríe a –10°C (15°F). Un refrigerador recién instalado
se puede tomar entre 12 y 24 horas para empezar
a hacer cubos de hielo. Escuchará un zumbido cada
vez que la máquina de hielos se llene de agua.
Deseche los primeros cubos de hielo para permitir
que la línea del agua se limpie.
Asegúrese de que nada interfiera con el movimiento
del brazo indicador.
Cuando el contenedor se llene al nivel del brazo
indicador, la máquina de hielos dejará de producir
hielos. Es normal que varios cubos de hielo se junten.
Si el hielo no se usa con frecuencia, los cubos de
hielo viejo se volverán turbios, con sabor rancio y se
encogerán.
NOTA: En hogares con presión de agua inferior
al promedio, es posible que escuche el ciclo de la
máquina de hielos varias veces al hacer un lote de
hielo.
NOTA: Configure el interruptor de energía en la
posición O (apagado) si el suministro de agua está
apagado.
PRECAUCIÓN
Evite el contacto con las partes
en movimiento del mecanismo expulsor o con el
elemento de calefacción (ubicado en la parte inferior
de la máquina de hielos) que expulsa los cubos. No
coloque los dedos ni las manos en el mecanismo
de la máquina de hielos automática mientras el
refrigerador esté enchufado.
Cómo alcanzar el hielo y el
interruptor eléctrico
Estante
Recipiente
para hielo
Para alcanzar el interruptor eléctrico.
Estante
Para alcanzar el interruptor eléctrico de la
máquina de hielos, hale el estante por encima del
recipiente para hielo directamente hacia fuera.
Siempre cerciórese de reemplazar el estante.
Para alcanzar el hielo, simplemente hale el
recipiente hacia delante.
Recipiente para hielo
Para alcanzar el hielo
Kit de accesorios de la máquina de hielos
Si su refrigerador no viene ya equipado con
una máquina de hielos automática, existe un kit
accesorio para la máquina de hielos que está
disponible por un costo adicional.
Revise en la parte posterior del refrigerador en
busca del kit para la máquina de hielos específica
que necesita para su modelo.
Para usar el dispensador (en algunos modelos)
Brazo de
dispensador
Recogedor
Presione el vaso suavemente contra el brazo del
dispensador.
El recogedor no se vacía solo. Para evitar las
manchas de agua, el recogedor y la parrilla se
deberán limpiar regularmente.
Si no hay distribución de agua cuando el refrigerador
está primeramente instalado, hay posibilidad de aire
en el sistema de la línea de agua. Oprima el brazo
del dispensador durante al menos dos minutos para
eliminar el aire atrapado de la línea de agua y llenar
el sistema. Para eliminar las impurezas de la línea de
agua, deseche los primeros seis vasos de agua.
Para bloquear el dispensador
Presione la tecla LOCK (Bloqueo) durante 3 segundos
para cerrar el dispensador y el panel de control. Para
desbloquearlo,
presione la misma
tecla durante
3 segundos
nuevamente.
93
Sobre la máquina de hielo automática.
GEAppliances.com
Para usar el dispensador de agua interno (en algunos modelos)
El dispensador de agua está localizado en la
pared izquierda en el interior del compartimiento
del refrigerador.
Para dispensar agua:
Sostenga el vaso contra el receso.
Empuje el botón del dispensador de agua.
Sostenga el vaso debajo del dispensador por
2 ó 3 segundos después de liberar el botón
del dispensador. El agua podría continuar
dispensándose después de que el botón es
liberado.
Si el dispensador no dispensa agua cuando el
refrigerador es instalado al principio, podría haber
aire en el sistema de línea de agua. Presione el
botón del dispensador por al menos 2 minutos
para remover el aire atrapado de la línea y para
llenar el sistema de agua. Durante este proceso, el
ruido del dispensador puede ser fuerte a medida
que el aire se purga del sistema de la tubería del
agua. Para drenar impurezas en la línea de agua,
deseche los 6 primeros vasos de agua que reciba
del dispensador.
NOTA: Para evitar depósitos de agua, el
dispensador debería ser limpiado periódicamente
pasándole un paño o una esponja limpia.
Cuidado y limpieza del refrigerador.
Limpiar el exterior
Las manijas de la puerta y los ornamentos. Se limpian con un
paño humedecido con
una solución de detergente suave y agua. Seque con un
paño suave. No use cera en las manijas de la puerta ni en los
ornamentos.
Mantenga limpio el terminado.
Limpie con un paño limpio ligeramente humedecido con cera
para aparatos de cocina o un detergente suave y agua. Seque y
pula con un paño limpio y suave.
No limpie el refrigerador con un paño sucio para trastes ni con
un paño húmedo. Estos podrían dejar residuos que afecten a la
pintura. No use estropajos, limpiadores en polvo, blanqueadores
ni limpiadores que contengan blanqueador, ya que estos
productos podrían rayar y desprender
el acabado de pintura.
Los paneles y las manijas de las puertas de acero inoxidable.
Los puertas y las manijas de las puertas de acero inoxidable
(en algunos modelos) pueden ser limpiados con un
limpiador para acero inoxidable para usos comerciales. Los
limpiadores con ácido oxálico tales como Bar Keepers Friend
Soft Cleanser™ eliminarán el óxido, deslustres y pequeñas
manchas. Use sólo un limpiador líquido libre de material
abrasivo y frote en la dirección de las líneas del cepillo con
una esponja suave y húmeda.
No utilice cera para electrodomésticos sobre el acero
inoxidable.
Piezas plásticas plateadas. Lave las piezas con jabón u otro
detergente suave. Limpie con una esponja, paño húmedo o
toalla de papel.
No raspe con esponjillas de metal u otros limpiadores abrasivos.
Limpiar el interior
Para evitar olores, deje una caja abierta de bicarbonato de
sodio en los compartimientos del refrigerador y del congelador.
Desconecte el refrigerador antes de limpiarlo. Si no fuera
posible, exprima el exceso de humedad de la esponja o del paño
cuando se limpie alrededor de botones, bombillas o controles.
Use cera para electrodomésticos en el interior entre las puertas.
8VHDJXDFDOLHQWH\XQDVROXFLyQGHELFDUERQDWRGHVRGLR³
aproximadamente una cucharada (15 ml) de bicarbonato de
sodio por cada cuarto (1 litro) de agua. Esta solución limpia y
neutraliza olores. Enjuague y seque.
Después de limpiar los sellos magnéticos
de las puertas, aplique una capa delgada
de vaselina del lado de la bisagra. Esto ayuda a evitar que los
sellos magnéticos se doblen o se peguen.
94
PRECAUCIÓN No limpie estantes de vidrio ni tapas con
agua caliente cuando estén fríos. Los estantes de vidrio y
las tapas se pueden romper si son expuestos a cambios de
temperatura repentinos o impactos tales como sacudones o
caídas. El vidrio templado está diseñado para destruirse en
pequeñas piezas en caso de rotura.
No lave ninguna parte plástica del refrigerador en la lavadora
de platos.
Piezas plásticas plateadas. Limpie las piezas con agua
jabonosa. Limpie con una esponja, paño húmedo o toalla de
papel.
No raspe con esponjillas de metal u otros limpiadores abrasivos.
GEAppliances.com
Atrás del refrigerador
Se deberá tener cuidado al retirar el refrigerador de la pared.
Todos los tipos de recubrimiento de pisos se pueden dañar,
sobre todo los recubrimientos acojinados y los que tienen
superficies repujadas.
Eleve las patas niveladoras ubicadas en la parte inferior frontal
del refrigerador.
Baje las patas niveladoras hasta que toquen el piso.
Al empujar el refrigerador a su lugar, asegúrese de no pasar
sobre el cable eléctrico ni sobre la línea de alimentación de la
máquina de hielos (en algunos modelos).
Hale el refrigerador en forma recta y empuje nuevamente para
devolverlo a su posición. Mover el refrigerador en dirección
lateral puede causar daños al recubrimiento del piso o al
refrigerador.
Preparación para vacaciones
En el caso de vacaciones o ausencias prolongadas, quite
los alimentos y desenchufe el refrigerador. Limpie el interior
con solución de bicarbonato de una cucharada (15 ml) de
bicarbonato por un cuarto (1 litro) de agua. Deje abiertas las
puertas.
Si la temperatura pueda llegar al punto de congelación, haya
una persona calificada para desaguar el sistema del suministro
de agua para evitar daños a la propiedad causados por
inundación.
Coloque el interruptor de alimentación eléctrica de la máquina
de hielo en la posición O (apagado) y cierre el suministro de
agua al refrigerador.
En caso de mudanza
Asegure todos los elementos sueltos como parrilla de la base,
entrepaños y recipientes pegándolos con cinta adhesiva en su
lugar para evitar daños.
Asegúrese de que el refrigerador se coloque en posición vertical
durante la mudanza.
Al usar una carretilla para mover el refrigerador, no haga
descansar la parte frontal o trasera del refrigerador contra la
carretilla. Esto podría dañar el refrigerador. Manéjelo sólo desde
los laterales del refrigerador.
95
Cómo reemplazar las bombillas.
ADVERTENCIA
Antes de reemplazar una lámpara quemada, el refrigerador deberá ser desenchufado a fin de evitar el
contacto con el filamento de un cable con corriente. (Existe riesgo de que una lámpara quemada se rompa durante su
reemplazo).
Girar el control a la posición OFF no desconecta la corriente del circuito de la luz.
Luces del refrigerador
Desconecte el refrigerador.
Para retirar el protector de la luz, tome
el protector por la parte posterior y hale
hacia fuera para liberar las pestañas
en la parte posterior.
Rote el protector hacia abajo y luego hacia
delante para liberar las pestañas
al frente del protector.
Después de reemplazarlo con una bombilla
de electrodomésticos del mismo o de
inferior voltaje, reemplace el protector.
Conecte de nuevo el refrigerador.
NOTA: Las bombillas del artefacto pueden
solicitarse en Piezas y Accesorios de GE,
800.626.2002.
Luz del congelador
Desconecte el refrigerador.
Quite la cesta del congelador para tener
acceso. La bombilla se encuentra en la
parte de atrás del congelador cubierta por
un protector.
El aspecto puede variar
Después de reemplazarlo con una bombilla
de electrodomésticos del mismo o de
inferior voltaje, reemplace el protector y la
cesta del congelador.
Conecte de nuevo el refrigerador.
Para quitarla, coja el protector por arriba y
estire para soltar las lengüetas inferiores.
Luces medias
Desenchufe el refrigerador.
Las bombillas se encuentran detrás
de las gavetas preservadoras. Para quitar
las gavetas, levántelas un poco mientras
jala de la gaveta más allá de la posición
stop (detención).
Las luces
se encuentran detrás
de las gavetas
preservadoras
Vuelva a colocar bombillas del artefacto del
mismo vataje o menor.
Vuelva a colocar las gavetas preservadoras
deslizándolas con suavidad en las guías
mientras las levanta ligeramente.
Vuelva a enchufar el refrigerador.
96
Bombillas de luz
Instrucciones para
la Instalación
Refrigerador
Modelos 20, 21, 22 y 23
¿Preguntas? Llame al 800.GE.CARES (800.432.2737) o bien visite nuestra página Web: GEAppliances.com
ANTES DE INICIAR
HERRAMIENTAS QUE
USTED PUEDE NECESITAR
Lea estas instrucciones completa y cuidadosamente.
•
IMPORTANTE ³ Guarde estas instrucciones
para uso del inspector local.
•
•
•
•
•
•
•
IMPORTANTE ³ Observe todos los códigos
y órdenes de ley.
Nota al instalador – Asegúrese de dejar estas
instrucciones con el consumidor.
Nota al consumidor – Conserve estas instrucciones
para referencia futura.
Nivel de destreza – La instalación de este aparato
requiere de destrezas mecánicas básicas.
Tiempo de ejecución – Instalación del refrigerador
20 minutos
Instalación de la línea de agua
30 minutos
La instalación apropiada es la responsabilidad
del instalador.
La falla del producto debido a una instalación
inadecuada no está cubierta por la garantía.
Destornillador de casquillo
de 3/8” y de 5/16”
Llave ajustable
Tuerca de compresión
de 1/4” y férula (manga)
(modelos con máquina
de hielos solamente)
Destornillador Phillips
Llaves Allen de 3/32”,
1/8” y 3/16”
Broca de perforadora
de 1/8” y perforadora
eléctrica o de mano
PREPARACIÓN
CÓMO MOVER EL REFRIGERADOR AL INTERIOR
Si el refrigerador no entra por una puerta, se pueden
retirar la puerta del refrigerador y la gaveta del
congelador.
• Para retirar la puerta del refrigerador, consulte el Paso 1
en la sección Cómo invertir el vaivén de la puerta.
• Para retirar la gaveta del congelador, consulte la sección
Cómo retirar la gaveta del congelador.
SUMINISTRO DE AGUA HACIA LA MÁQUINA DE HIELOS
Y EL DISPENSADOR (EN ALGUNOS MODELOS)
Si el refrigerador tiene una máquina de hielos, se tendrá
que conectar a una tubería de agua potable fría. Un kit
de suministro de agua (contiene tubería, válvula de cierre,
accesorios e instrucciones) está disponible con un costo
adicional a través de su proveedor, visitando nuestra
página Web GEAppliances.com o bien a través de Partes y
Accesorios, 800.626.2002.
97
Cinta métrica
Lápiz
Llave de tuercas de 1/4”
Pinza corta alambres
Nivel
Instrucciones para la instalación
INSTALACIÓN DEL REFRIGERADOR
RETIRO DE LA TAPA SUPERIOR (cont.)
UBICACIÓN DEL REFRIGERADOR
(en algunos modelos)
REINSTALACIÓN DE LAS PUERTAS, GAVETAS Y
LA TAPA SUPERIOR
• No instale el refrigerador donde la temperatura baje de
60°F (16°C) ya que no correrá con suficiente frecuencia
para mantener las temperaturas apropiadas.
• No instale el refrigerador donde la temperatura suba
por encima de 100°F (37°C) ya que no funcionará
correctamente.
• No instale el refrigerador en una ubicación expuesta al
agua (lluvia, etc.) o en contacto directo con la luz solar.
• Instálelo en un piso fuerte para que lo soporte con
carga completa.
E Baje la puerta cuidadosamente a la bisagra central.
Reinstale la bisagra superior. NOTA: Cerciórese que la puerta
se encuentre alineada apropiadamente con la parte superior
de la tapa para evitar el reajuste de la puerta durante
la reinstalación de la tapa superior.
F Coloque la tapa sobre la parte superior del refrigerador.
Reinstale los tornillos originales en la parte superior
y la trasera de la tapa.
G Reinstale la gaveta
A
inferior del congelador.
Consulte la sección
titulada “Cómo
reemplazar
la gaveta del
congelador”.
ESPACIO LIBRE
Para despejar el espacio a fin de facilitar la instalación,
contar con una circulación de aire y plomería y
electricidad adecuadas, consulte la placa de calificación
en la pared superior izquierda del refrigerador.
RETIRO DE LA TAPA SUPERIOR
(en algunos modelos)
• NOTA IMPORTANTE: Este refrigerador tiene una
profundidad de 341/2 pulgadas. Las puertas y los
pasillos que llevan a la ubicación de la instalación
deben tener un ancho depor lo menos 36 pulgadas
para dejar las puertas y las manijas conectadas al
refrigerador mientras éste se transporta a la ubicación
de la instalación. Si los pasillos tiene menos que 36
pulgadas, las puertas y las manijas del refrigerador
se pueden rayar y dañar con facilidad. Se pueden
retirar la tapa superior y las puertas para permitir el
traslado seguro del refrigerador al interior. Empiece
con el Paso A.
• Omita el Paso A si no se necesita retirar las puertas.
Deje la cinta y todo el embalaje en las puertas hasta
que el refrigerador se encuentre en su destino final.
• REMOCIÓN DE LA CORREDERA: Incline el refrigerador
hacia ambos lados para retirar la corredera.
• NOTA: Utilice una carretilla de mano almohadillada
para trasladar el refrigerador. Coloque el refrigerador
en la carretilla de mano con un costado contra la
carretilla. Recomendamos fuertemente que DOS
PERSONAS trasladen y completen la instalación.
A Localice y retire los dos tornillos de cabeza Phillips en
la parte superior del refrigerador. Retire los dos tornillos
en cada lado en la parte posterior de la tapa superior.
Despegue y retire la tapa superior.
B Retire la puerta de la comida fresca. Consulte los Pasos
1, 2 y 3 en la sección titulada “Cómo invertir el vaivén de
la puerta”.
C Retire la gaveta inferior del congelador. Consulte la
sección titulada “Cómo retirar la gaveta del congelador”.
D Traslade el refrigerador a la ubicación de la instalación.
Bisagra
superior B
1 CÓMO CONECTAR EL REFRIGERADOR
A LA LÍNEA DE AGUA DE LA CASA
(los modelos de máquinas de hielo y de dispensadores)
Se requiere un suministro de agua fría para la operación
de la máquina de hielos. Si no existe un suministro de agua
fría, usted necesitará hacer uno. Ver la sección Instalación
de la tubería de agua.
NOTAS:
• Antes de hacer la conexión, cerciórese de que el cable
eléctrico del refrigerador no esté conectado al interruptor
de la pared.
• Si el refrigerador no tiene un filtro de agua, recomendamos
que instale uno si su suministro de agua tiene arena o
partículas que pudieran obstruir la pantalla de la válvula
de agua del refrigerador. Instálelo en la línea de agua cerca
del refrigerador. Si usted está usando un kit de tubería
de refrigeración GE SmartConnect,™ usted necesitará
una tubería adicional (WX08X10002) para conectar
el filtro. No corte tuberías plásticas para instalar el filtro.
Si
usted está usando tubería de cobre, coloque una tuerca
A
de compresión y una férula (manga) en el extremo de
la tubería que viene del suministro de agua fría de la casa.
Si se encuentra usando tuberías de GE SmartConnect,™
las tuercas están ya ensambladas a la tubería.
98
Instrucciones para la instalación
2 ACTIVE LA CONEXIÓN DE AGUA
(modelos con la máquina de hielos
y el dispensador)
1 CÓMO CONECTAR EL REFRIGERADOR
A LA LÍNEA DE AGUA DE LA CASA (cont.)
B Si usted está usando tubería de cobre, inserte
el extremo de la tubería en la conexión del refrigerador,
en la parte posterior del refrigerador, hasta donde
sea posible. Mientras sostiene la tubería, apriete
el accesorio.
Si se encuentra usando tuberías de
GE SmartConnect,™ inserte el extremo moldeado de
la tubería en la conexión del refrigerador en la parte
posterior del refrigerador, y apriete la tuerca de
compresión hasta que esté apretada a mano. Entonces
apriete una vuelta adicional con una llave. Si la aprieta
demasiado causará fugas.
C Apriete la tubería en la abrazadera proporcionada para
sostenerla en su posición. Es posible que usted necesite
levantar la abrazadera haciendo palanca.
Haga pasar la corriente
de agua en la válvula de cierre
(el suministro de agua de
la casa) e inspeccione en
busca de fugas.
3 CONECTE EL REFRIGERADOR
En modelos con
la máquina de hielos:
antes del conectar
el refrigerador, cerciórese
de que el interruptor de
la máquina de hielos está
colocada en la posición
O (apagado).
Ver la información adjunta sobre la conexión a tierra
del cable eléctrico.
Una de las ilustraciones siguientes será
el aspecto de la conexión que tendrá
su refrigerador.
Modelos preparados por la instalación
de la máquina de hielo
Tubería de
cobre de 1/4”
Abrazadera
de la tubería
Tuerca de
compresión
de 1/4”
Férula
(manga)
Conexión del
refrigerador
4 COLOQUE EL REFRIGERADOR
EN SU LUGAR
Traslade el refrigerador a su ubicación final.
5 NIVELE EL REFRIGERADOR
Deben instalarse patas ajustables
en las esquinas frontales del refrigerador para
que éste se encuentre bien asentado en el
piso, y el frente debe estar lo suficientemente
elevado para que la puerta cierre con facilidad
cuando se abre hasta alrededor de la mitad.
Tubería de
SmartConnect™
Modelos con máquina de hielo instalada
Conexión del
refrigerador
Férula
(manga)
Tuerca de
compresión de 1/4”
Para ajustar las patas niveladoras,
gire las patas en sentido de las agujas del
reloj para levantar el refrigerador o en sentido
contrario a las agujas del reloj para bajarlo.
Tubería de
SmartConnect™
Tubería de 1/4”
Abrazadera
de la tubería
99
Instrucciones para la instalación
INSTALACIÓN DEL REFRIGERADOR (cont.)
7 RETIRE LA MANIJA DE LA PUERTA
6 RETIRE LA MANIJA DE LA PUERTA
DE ALIMENTOS FRESCOS
DEL CONGELADOR
(Para la colocación en el lugar de
instalación o la inversión de las manijas –
en algunos modelos)
Manijas de acero inoxidable y plástico:
Afloje los tornillos de fijación ubicados en la parte
inferior de la manija con una llave Allen de 1/8”
y retire la manija.
NOTA: Para ajustar o retirar los tornillos de montaje
de la manija, utilice una llave Allen de 3/16”.
Manija de acero inoxidable (en algunos modelos):
CÓMO REMOVER
LA MANIJA DE
LA PUERTA: Afloje
los tornillos de
fijación con una llave
Allen de 3/32”
Insignia
y retire la manija.
del logo
A
NOTA: Para modelos
de doble puerta
siga el mismo
procedimiento en
B
la puerta opuesta.
Tornillos
de montaje
Manija plástica (en algunos modelos):
CÓMO QUITAR LA MANIJA DE LA PUERTA: Baje
la lengüeta ubicada en la parte inferior de la manija
y deslícela hacia arriba, sacándola de las fijaciones.
(la apariencia puede variar)
Manija plástica
(en algunos modelos):
CÓMO QUITAR LA MANIJA DE LA PUERTA: Baje
la lengüeta ubicada en la parte inferior de la manija
y deslícela hacia arriba, sacándola de las fijaciones.
PARA INVERTIR
LA MANIJA DE
LA PUERTA
(en algunos
B
modelos):
•
Insignia
Retire los tornillos
del logo
de montaje de
la manija con una
A
llave Allen
de 3/16”
Tornillos
y traslade
de
los tornillos
montaje
de montaje
de la manija
(la apariencia puede variar)
al lado derecho.
• Quite la insignia del logo.
• Remover y transferir el tapón al lado izquierdo de
la puerta de alimentos frescos. NOTA: Use un elemento
plástico y plano a fin de no dañar la puerta. Quite
los restos de adhesivo de la puerta con un detergente
suave. Retire la cobertura de papel de la parte trasera
de la insignia del logo antes de colocar la chapa sobre
la puerta.
NOTA: Para ajustar o retirar los tornillos de montaje
de la manija, utilice una llave Allen de 3/16”.
(la apariencia puede variar)
100
Instrucciones para la instalación
9 SUJETE LA MANIJA DE LA PUERTA
8 SUJETE LA MANIJA DE LA PUERTA
DE ALIMENTOS FRESCOS
DEL CONGELADOR
Manija de acero inoxidable:
Sujete la manija
a los tornillos de
montaje y ajuste
los tornillos de
fijación con una llave
Allen de 3/32”. NOTA:
Para modelos de
doble puerta
siga el mismo
procedimiento
en la puerta opuesta.
Manijas de acero inoxidable y plástico:
Sujete la manija firmemente a los tornillos de montaje
y ajuste los tornillos de fijación en la parte inferior
de la manija con una llave Allen de 1/8”.
A
Tornillos
de montaje
(la apariencia puede variar)
(la apariencia puede variar)
Manija plástica:
Para sujetar la manija a los tornillos de montaje
alinee las ranuras con los tornillos de montaje.
Deslícela hasta que encaje firmemente en su lugar.
Manija plástica (en algunos modelos):
Para sujetar la manija a los tornillos de montaje alinee
las ranuras con los tornillos de montaje.
Deslícela hasta que encaje firmemente en su lugar.
Ranuras en la parte
posterior de la manija
Ranuras en la parte
posterior de la manija
Tornillos
de montaje
NOTA: Antes de sujetar la manija,
asegúrese que la lengüeta se encuentre
orientada como se muestra.
(la apariencia puede variar)
(la apariencia puede variar)
101
Instrucciones para la instalación
INSTALACIÓN DEL REFRIGERADOR (cont.)
10 CÓMO NIVELAR EL REFRIGERADOR
11 AJUSTE LOS CONTROLES
Las patas niveladoras tienen dos propósitos:
1) Las patas niveladoras se ajustan para que
el refrigerador esté colocado firmemente
en el piso y no tambalee.
2) Las patas niveladoras sirven como un freno
estabilizador para sostener el refrigerador
firmemente en posición durante la operación
y limpieza. Las patas niveladoras también
evitan que el refrigerador se incline.
A Saque la parrilla quitando los dos tornillos
Phillips.
Ajuste los controles donde se recomienda.
12 RETIRE EL EMBALAJE,
INICIE LA MÁQUINA DE HIELO
(modelos con máquina de hielos)
A) Retire toda la cinta y el embalaje protector
y de espuma de las repisas y las gavetas.
B) Retire los amarres de las canastas
del congelador.
C) Coloque la casta de mitad de ancho
en las correderas de la gaveta. Consulte
la sección titulada Acerca del congelador
para las instrucciones.
B Gire las patas niveladoras en sentido de las
agujas del reloj para levantar el refrigerador, y
en contra de las agujas del reloj para bajarlo.
Fije el interruptor de la máquina de hielos
en la posición de I (encendido). La máquina
de hielos no empezará a operar hasta que
alcance su temperatura de operación de
15° F (–9° C) o menor. Luego, empezará a operar
automáticamente. Será necesario de 2 a 3 días
para que se llene el recipiente para hielo.
Interruptor
PRECAUCIÓN
Para evitar posibles lesiones
personales o daños a la propiedad, las patas
niveladoras deben tocar firmemente el piso.
C Vuelva a colocar la parrilla introduciendo
los dos tornillos Phillips.
NOTA:
En condiciones de menor presión del agua,
la válvula de agua puede encenderse hasta
3 veces para suministrar suficiente agua
a la máquina de hielos.
102
Instrucciones para la instalación
CÓMO RETIRAR LA GAVETA DEL CONGELADOR
2 RETIRE EL FRENTE DE LA GAVETA
DESDE LAS CORREDERAS (cont.)
Si es necesario, es posible retirar la gaveta del
congelador para que el refrigerador quepa en áreas
estrechas.
Lea estas instrucciones completa y cuidadosamente.
B Levante ambos lados de la manija de la gaveta
del congelador para separar las correderas
de la gaveta de las ensambladuras de
las correderas.
C Coloque el frente de la gaveta en
una superficie donde no se raye.
D Empuje las ensambladuras de las correderas
hasta la posición de bloqueo.
1 RETIRE LA CANASTA
A Abra la gaveta del congelador hasta que pare.
B La canasta del congelador descansa
en un marco al interior de la gaveta
del congelador. Levante la canasta
en la parte posterior.
C Levante el frente y suba la canasta completa
hacia arriba y afuera de la gaveta.
Ensambladura
de la corredera
Ensambladura
de la gaveta
3 RETIRE LA REJILLA DE LA BASE
(si es necesario)
Si después de retirar la gaveta del congelador
y la puerta del refrigerador, el refrigerador
todavía no cabe a través de una puerta,
se pueden retirar la rejilla de la base.
A Saque la parrilla base quitando
los dos tornillos.
2 RETIRE EL FRENTE DE LA GAVETA
DESDE LAS CORREDERAS
A Retire el tornillo en cada lado de las correderas.
Tornillo
103
Instrucciones para la instalación
CÓMO REEMPLAZAR LA GAVETA DEL CONGELADOR (cont.)
1 UNA Y ASEGURE EL FRENTE DE
Es posible que sean necesarias dos personas
para completar este procedimiento.
LA GAVETA A LAS CORREDERAS (cont.)
E
1 UNA Y ASEGURE EL FRENTE DE
Reemplace los tornillos en ambas
ensambladuras de las correderas.
LA GAVETA A LAS CORREDERAS
A Hale las ensambladuras de las correderas hasta
la máxima longitud en cada lado del gabinete.
Tornillo
2 REEMPLACE LA CANASTA
B Encuentre las ranuras al interior de
las ensambladuras de las correderas cerca
de la parte posterior.
DEL CONGELADOR
Reemplace la canasta más baja del congelador
bajándola hasta el marco.
Ranura
Ensambladura de las correderas
C Inserte los ganchos en la parte posterior
de las correderas de la gaveta en las ranuras
de las ensambladuras de las correderas.
D Baje el frente de la gaveta, cerciorándose de
que las pestañas en los lados de las correderas
calcen en las ranuras delanteras de
las ensambladuras de las correderas.
Gancho
Ranura
Pestaña
104
Instrucciones para la instalación
CÓMO INVERTIR EL VAIVÉN DE LA PUERTA
(Modelos de refrigerador de una sola puerta únicamente)
1 RETIRE LA PUERTA
NOTAS IMPORTANTES
DEL REFRIGERADOR
Al invertir el vaivén de la puerta:
NOTA: El vaivén de la puerta no es reversible en modelos
de acero inoxidable.
• Lea las instrucciones completas antes de empezar.
• Las piezas están incluidas en el conjunto de bisagras
de la puerta.
• Manipule las partes con cuidado para evitar rayar
la pintura.
• Coloque los tornillos según las partes a las que
corresponden para evitar usarlos en el lugar incorrecto.
• Disponga de una superficie de trabajo que no raye para
colocar las puertas.
IMPORTANTE: Una vez empiece, no mueva el gabinete
hasta que la inversión del vaivén de la puerta no esté
completa.
Estas instrucciones son para cambiar las bisagras del lado
GHUHFKRDOODGRL]TXLHUGR³VLDOJXQDYH]GHVHDFDPELDU
nuevamente las bisagras al lado derecho, siga estas mismas
instrucciones e invierta todas las referencias de izquierda
y derecha.
• Una vez que se ha finalizado la inversión del vaivén
de la puerta, retire la cobertura adhesiva de la parte
trasera de la chapa del logo y asegúrese de que ésta
se encuentre correctamente alineada y fijada a la puerta.
NOTA: Una insignia del logo de cambio es incluido
en el kit de bisagras.
Desconecte el refrigerador de la toma eléctrica.
Desocupe todos los estantes de la puerta, incluyendo
el compartimiento de productos lácteos.
A Pegue la puerta por completo con cinta.
B Saque la tapa de la bisagra de la parte
superior del refrigerador destrabándola
cuidadosamente con una espátula,
si fuera necesario.
C Con un destornillador de casquillo de 5/16”,
retire los pernos que aseguran la bisagra
superior al gabinete. Luego, levante la bisagra
directamente hacia arriba para liberar
el pasador de la bisagra de la boquilla
en la parte superior de la puerta.
D Con cuidado quite el capuchón de la puerta
desde dentro de la boquilla. Esto se usará de
nuevo cuando vuelva a instalar la puerta sobre
el otro lado.
Tapa de
la bisagra
Bisagra
superior
Capuchón
de la puerta
E
Retire la cinta e incline la puerta en dirección
contraria al gabinete. Levante la puerta
del pasador de la bisagra central. Cerciórese
de que el dedal plástica del pasador de
la bisagra permanezca en el pasador de
la bisagra o al interior del orificio del pasador
de la bisagra de la puerta que se encuentra
en la parte de abajo de la puerta.
F
Coloque la puerta en una superficie que
no raye con la parte interior hacia arriba.
HERRAMIENTAS NECESARIAS
Llave ajustable
Destornillador de casquillo
de 5/16”
Destornillador de pala plana
Cinta de enmascarar
Destornillador Phillips
Llave torx T-20
105
Instrucciones para la instalación
CÓMO INVERTIR EL VAIVÉN DE LA PUERTA (cont.)
(Modelos de refrigerador de una sola puerta únicamente)
2 RETIRE LA BISAGRA CENTRAL
4 TRASLADE EL FRENO DE LA PUERTA
A Quite el perno de la bisagra desde el soporte
de la bisagra. El perno de la bisagra se usará
de nuevo con el nuevo soporte de la bisagra
en el otro lado.
A
DEL REFRIGERADOR
B
C
B Mediante una llave de cubo de 5/16”, quite
los pernos que sujetan la bisagra central
al gabinete. Coloque llos pernos a un lado.
3 INSTALE LA BISAGRA CENTRAL
Retire el freno de la puerta en el lado derecho
de la parte inferior de la puerta del refrigerador
retirando los dos tornillos.
Mueva el dedal plástico del orificio de la bisagra
hacia el orificio opuesto.
Instale el freno de la puerta en el lado
izquierdo, cerciorándose de alinear los orificios
de los tornillos en el freno de la puerta con
los orificios en la parte inferior de la puerta.
Parte inferior de la puerta
del refrigerador
(lado derecho)
A Pase al lado derecho el botón obturador
y tapa de orificio de tornillo de los orificios
de la bisagra del lado izquierdo.
5
Parte inferior de la puerta
del refrigerador
(lado izquierdo)
TRASLADE LA MANIJA
DE LA PUERTA DEL REFRIGERADOR
HACIA LA DERECHA
Para obtener las instrucciones
correspondientes, consulte las secciones
“Cómo retirar la manija de la puerta de
alimentos frescos” y “Cómo sujetar la manija
de la puerta de alimentos frescos.”
B Se necesitará un nuevo soporte de la bisagra
para el lado izquierdo (incluido en el kit de
bisagras para puerta). Instale la bisagra central
del kit en el lado izquierdo.
C Instale el perno de la bisagra dentro del nuevo
soporte de la bisagra.
106
Instrucciones para la instalación
6 VUELVA A COLGAR LA PUERTA
7 INSTALE LA INSIGNIA DEL LOGO
DEL REFRIGERADOR
A
Baje la puerta del refrigerador en el pasador
de la bisagra central. Cerciórese de que
el dedal plástica del pasador de la bisagra
esté en el pasador de la bisagra central o
al interior del orificio del pasador de la bisagra
de la puerta que se encuentra en la parte
de abajo de la puerta.
B
Introduzca el capuchón de la puerta dentro
del orificio de la bisagra de la parte superior
del refrigerador y luego introduzca el pasador
de la bisagra superior. Cerciórese de que
la puerta esté alineada con el gabinete.
Una la bisagra a la parte superior del gabinete
libremente con los pernos.
Cerciórese de que el sello magnético
en la puerta esté nivelado contra el gabinete
y no esté doblado. Apoye la puerta en el lado
de la manija y cerciórese de que esté recta
y el espacio entre las puertas sea uniforme
al frente. Mientras sostiene la puerta en
su lugar, apriete los pernos de la bisagra
superior. Reemplace la tapa de la bisagra.
C
Quite el papel que cubre el adhesivo y alinee
los pernos de la parte trasera de la insignia
con los orificios de la puerta. Aplique presión a
la insignia para garantizar que se haya pegado
a la puerta.
107
Instrucciones para la instalación
CÓMO RETIRAR LAS PUERTAS
(Modelos de refrigerador de doble puerta únicamente)
1 RETIRE LAS PUERTAS
NOTAS IMPORTANTES
DEL REFRIGERADOR
NOTA: El vaivén de la puerta no es reversible.
• Lea las instrucciones completas antes de empezar.
• Manipule las partes con cuidado para evitar rayar
la pintura.
• Coloque los tornillos según las partes a las que
corresponden para evitar usarlos en el lugar incorrecto.
• Disponga de una superficie de trabajo que no raye para
colocar las puertas.
IMPORTANTE: Una vez empiece, no mueva el gabinete.
Estas instrucciones son para retirar las puertas.
Desconecte el refrigerador de la toma eléctrica.
Desocupe todos los estantes de la puerta, incluyendo
el compartimiento de productos lácteos.
A Pegue las puertas por completo con cinta.
(para modelos con dispensador de agua)
B Comience primero con la puerta de
la izquierda: Quite el tornillo que ajusta la tapa
de la bisagra central, levante la tapa de
la bisagra y coloque a un costado sobre
el refrigerador.
HERRAMIENTAS NECESARIAS
Quite la tapa
de la bisagra
(1 tornillo Phillips)
Destornillador de casquillo
de 3/8” y de 10 mm
Llave ajustable
Cinta de enmascarar
(para modelos con dispensador de agua)
Destornillador
de pala plana
C Quite las conexiones de agua y de energía.
C1
Conexión de agua
Quite la abrazadera
de resorte de metal.
Utilice
un destornillador
para presionar y
sacar la abrazadera
de trabado plástica
roja hacia abajo.
Destornillador Phillips
C2
Tire
del tubo.
C3
Para desconectar, separe
la conexión de energía
108
Conexión
de agua
Presione
el anillo rojo y
sostenga.
Conexión
de energía
Marca negra
alineada con
el montaje
de anillo.
Instrucciones para la instalación
1 RETIRE LA PUERTA
2 CÓMO QUITAR LA BISAGRA CENTRAL
DEL REFRIGERADOR (cont.)
Mediante una llave de cubo de 5/16”, quite
los pernos que sujetan la bisagra central
al gabinete. Coloque la bisagra y los pernos
a un lado.
D Saque la tapa de la bisagra en la parte superior
del refrigerador quitando el tornillo Phillips
y tirando hacia arriba.
E Mediante una llave de cubo de 5/16”, quite
los pernos que sujetan la bisagra superior
al gabinete. Luego levante la bisagra hacia
arriba para liberar el perno de la bisagra del
receptáculo de la parte superior de la puerta.
Tapa de
la bisagra
3 RETIRE LA PUERTA OPUESTA
Siga el mismo procedimiento en la puerta
opuesta. No hay alambres, líneas de agua o
tapas de bisagras centrales en el lado opuesto.
Bisagra
superior
4 RETIRE LA GAVETA DEL CONGELADOR
Para obtener las instrucciones
correspondientes, ver la sección de
Cómo retirar la gaveta del congelador.
F
Quite la cinta e incline la puerta en sentido
contrario al gabinete. Levante la puerta
sacándola del pasador de la bisagra central.
Verifique que el capuchón plástico del pasador
de la bisagra no se salga del pasador
de la bisagra o del orificio del pasador
de la bisagra de la puerta ubicado
en la parte inferior de la puerta.
G Coloque la puerta sobre una superficie que
no raye, con la parte interna hacia arriba.
109
Instrucciones para la instalación
CÓMO VOLVER A COLOCAR LAS PUERTAS
(Modelos de refrigerador de doble puerta únicamente)
2 VUELVA A COLGAR LAS PUERTAS DEL
1 INSTALE LA BISAGRA CENTRAL
REFRIGERADOR (CONT.)
Instale la bisagra central en cada lado.
D En las puertas de la izquierda, pase
los cables y línea de agua a través del pasador
de la bisagra central. Luego conecte la línea
de agua y el empalme de 4 pasadors.
Pasador
de bisagra
central
2 VUELVA A COLGAR LAS PUERTAS
DEL REFRIGERADOR
A
Conector
de 4 pernos
Baje la puerta del refrigerador en el pasador
de la bisagra central. Cerciórese de que
el dedal plástica del pasador de la bisagra
permanezca en el pasador de la bisagra
central o al interior del orificio del pasador
de la bisagra de la puerta que se encuentra
en la parte de abajo de la puerta.
E Cerciórese de que el sello magnético en
la puerta esté nivelado contra el gabinete
y no esté doblado. Cerciórese de que esté recta
y el espacio entre las puertas sea uniforme
al frente. Mientras sostiene la puerta alineada
en su lugar, apriete los pernos de la bisagra
superior. Reemplace la tapa de la bisagra
y el tornillo.
Pasador de
la bisagra
B
C
Línea
de agua
Pegue firmemente la puerta con cinta
o pida a otra persona que sostenga la puerta.
Dirija los cables a través de la ranura
del pasador de la bisagra izquierda inferior.
Inserte el pasador de la bisagra superior
en el orificio de la bisagra encima de la puerta
del refrigerador. Cerciórese de que la puerta
esté alineada con el gabinete y la puerta
opuesta. Una la bisagra a la parte superior
del gabinete libremente con los pernos.
Tapa de
la bisagra
Pernos
de la bisagra
superior
(la apariencia puede variar)
3 REEMPLACE LA PUERTA OPUESTA
Siga el mismo procedimiento en la puerta
opuesta. No hay línea de agua o tapa de
bisagra.
Ranura
del pasador
de la bisagra
izquierda
inferior
(la apariencia puede variar)
110
Instrucciones para la instalación
CÓMO VOLVER A COLOCAR LAS PUERTAS
(Modelos de refrigerador de doble puerta únicamente) (cont.)
4 CÓMO ALINEAR LAS PUERTAS DOBLES
Si la parte superior de las puertas está
desigual, primero intente levantar la puerta
más baja girando la pata niveladora en
el mismo costado de la puerta hasta que
las puertas estén niveladas. Si la unidad
permanece inestable, vuelva a ajustar las
patas niveladoras hasta que la unidad esté
estable.
Si las puertas continúan desparejas, gire
el perno ajustable para elevar, o bajar,
la puerta izquierda para que esté al mismo
nivel de la derecha. Utilice una llave Allen
de 1/4” para girar el pasador.
Perno ajustable
5 REEMPLACE LA GAVETA
DEL CONGELADOR
Para obtener las instrucciones
correspondientes, ver la sección de Cómo
reemplazar la gaveta del congelador.
111
Instrucciones para la instalación
INSTALACIÓN DE LA TUBERÍA DEL AGUA
(MODELOS CON MÁQUINA DE HIELOS)
QUÉ NECESITA
ANTES DE INICIAR
Los kits de cobre recomendados para el suministro
de agua son WX8X2, WX8X3 o WX8X4, dependiendo
de la cantidad de tubería necesaria. Las tuberías
plásticas aprobadas para el suministro de agua
son las tuberías para el refrigerador SmartConnect™
de GE (WX08X10006, WX08X10015 y WX08X10025).
Al conectar su refrigerador a un Sistema de Agua
de Ósmosis Inversa de GE, la única instalación
aprobada es con un RVKIT de GE. Para otros
sistemas de agua de ósmosis inversa, siga
las instrucciones del fabricante.
Si el suministro de agua hacia el refrigerador es
desde un Sistema de Filtro de Agua de Ósmosis
Inversa y el refrigerador también tiene un filtro
de agua, use el tapón de derivación del filtro del
refrigerador. Usar el cartucho de filtro del agua
del refrigerador en conjunto con el filtro de Ósmosis
Inversa puede resultar en cubos de hielo huecos.
Esta instalación de la tubería del agua no está
garantizada por el fabricante del refrigerador o
de la máquina de hielos. Siga estas instrucciones
cuidadosamente para minimizar el riesgo de
un daño costoso por el agua.
El martilleo del agua (agua golpeando contra
la tubería) en la tubería de la casa puede causar
daños a las partes del refrigerador y conducir
a un goteo o inundación por agua. Llame a
un plomero calificado para corregir el martilleo
del agua antes de instalar la tubería del agua
al refrigerador.
Para evitar quemaduras y daños con el producto,
no conecte la tubería del agua a la tubería del agua
caliente.
Si usa el refrigerador antes de conectar la tubería,
asegúrese de que el interruptor de corriente de la
máquina de hielos esté en la posición O (apagado).
No instale la tubería de la máquina de hielos en
lugares donde la temperatura caiga por debajo
del nivel de congelamiento.
Al usar cualquier aparato eléctrico (como un taladro
eléctrico) durante la instalación, asegúrese de que
el aparato esté aislado o conectado de manera
que evite el peligro de una descarga eléctrica,
o se opere por baterías.
Todas las instalaciones se deben realizar según
los requisitos del código local de plomería.
• Kit de tubería de cobre para el refrigerador o
SmartConnect ™ de GE, 1/4” de diámetro externo
para conectar el refrigerador al suministro de
agua. Si usa cobre, asegúrese de que ambos
extremos de la tubería se corten uniformemente.
Para determinar la cantidad de tubería que
necesita: mida la distancia desde la válvula del
agua en la parte posterior del refrigerador hasta
el tubo de suministro de agua. Asegúrese de que
haya suficiente tubería adicional para permitir
que el refrigerador se pueda mover de la pared
después de la instalación.
Los kits de tubería para el refrigerador
SmartConnect ™ de GE están disponibles
en las siguientes longitudes:
8’ (2,4 m) – WX08X10006
15’ (4,6 m) – WX08X10015
25’ (7,6 m) – WX08X10025
NOTA: La única tubería de plástico aprobada de
GE es la que viene provista con los kits de tubería
para el refrigerador SmartConnect ™ de GE. No use
ninguna otra tubería plástica para el suministro
del agua ya que la tubería está bajo presión todo
el tiempo. Ciertos tipos de plástico se fracturarán
o se romperán con el tiempo y causarán daños
en su casa debido al agua.
• Un kit de suministro de agua de GE (contiene
tubería, válvula de apagado y accesorios
enumerados abajo) está disponible a un costo
adicional en su tienda o por medio de Partes y
Accesorios, 800.626.2002.
• Un suministro de agua fría. La presión del agua
debe estar entre 20 y 120 p.s.i. (1,4–8,1 bar).
• Taladro eléctrico.
• Llave de 1/2” o ajustable.
• Destornillador plano y de estrella.
112
Instrucciones para la instalación
Instale la válvula de apagado en la tubería del agua
de consumo más frecuentemente utilizada.
QUÉ NECESITA (CONT.)
1 CIERRE EL SUMINISTRO
PRINCIPAL DE AGUA
• Dos tuercas de compresión de 1/4 ” de diámetro
exterior y 2 férulas (mangas)³SDUDFRQHFWDU
la tubería de cobre a la válvula de apagado
y la válvula del agua del refrigerador.
O bien
• Si está usando un kit de tubería para el
refrigerador SmartConnect ™ de GE, los accesorios
necesarios ya vienen preinstalados en la tubería.
Abra el grifo más cercano por suficiente tiempo
para limpiar la tubería del agua.
2 SELECCIONE LA UBICACIÓN
DE LA VÁLVULA
Seleccione una ubicación para la válvula
que sea fácilmente accesible. Es mejor
conectarla en el costado de una tubería vertical
de agua. Cuando sea necesario conectarla
en una tubería horizontal de agua, haga
la conexión en la parte superior o al lado,
en vez de hacerlo en la parte de abajo, para
evitar retirar cualquier sedimento de la tubería
del agua.
• Si su tubería existente de cobre para el agua tiene
un accesorio con vuelo en el extremo, necesitará
un adaptador (disponible en las tiendas de
suministros de plomería) para conectar la línea
del agua al refrigerador O BIEN, podrá cortar
el accesorio con vuelo con un cortador de tubos y
luego usar un accesorio de compresión.
No corte el extremo formado de la tubería
para el refrigerador SmartConnect ™ de GE.
• Válvula de cierre para conectar a la línea
del agua fría. La válvula de apagado deberá tener
una entrada de agua con un diámetro interno
mínimo de 5/32” en el punto de conexión
a la TUBERÍA DEL AGUA FRÍA. Las válvulas
de apagado tipo silla vienen incluidas en muchos
kits de suministro de agua. Antes de comprar,
asegúrese de que una válvula tipo silla cumple
con los códigos de plomería en su localidad.
3 PERFORE EL ORIFICIO
PARA LA VÁLVULA
Perfore un orificio de 1/4” en la tubería del
agua (incluso si está usando una válvula auto
perforadora), usando una broca afilada. Retire
cualquier sobrante que resulte de perforar
el orificio en la tubería.
Tenga cuidado de no permitir que se filtre
agua hacia el taladro.
No perforar un orificio de 1/4” puede resultar
en menor producción de hielo o cubos más
pequeños.
113
Instrucciones para la instalación
INSTALACIÓN DE LA TUBERÍA DEL AGUA (cont.)
4 INSTALE LA VÁLVULA
7 CONECTE LA TUBERÍA
DE APAGADO
A LA VÁLVULA
Coloque la tuerca de compresión y férula para
la tubería de cobre (manga) en el extremo de
la tubería y conéctela a la válvula de apagado.
Una la válvula de apagado a la tubería de agua
fría con la abrazadera para el tubo.
Abrazadera
para el tubo
Válvula de
apagado tipo silla
Asegúrese de que la tubería esté complemente
insertada en la válvula. Apriete la tuerca de
compresión firmemente.
Para tubería de plástico de un kit de tubería
para el refrigerador SmartConnect ™ de GE,
inserte el extremo moldeado de la tubería
en la válvula de apagado y apriete la tuerca de
compresión hasta que esté firmemente apretada
a mano, luego apriete un giro adicional con una
llave. Apretar demasiado puede causar fugas.
Tubería vertical
de agua fría
NOTA: Se deberán seguir los Códigos 248CMR de
Plomería para el Estado de Massachusetts. Las
válvulas tipo silla son ilegales y su uso
no está permitido en Massachusetts. Consulte
con un plomero licenciado.
Tuerca de compresión
Válvula de
apagado tipo silla
Tubería
SmartConnect ™
5 APRIETE LA ABRAZADERA
DEL TUBO
Tuerca de empaque
Válvula de salida
Apriete los tornillos de la abrazadera hasta
que la arandela sellante empiece a hincharse.
NOTA: Se deberán seguir los Códigos 248CMR
de Plomería para el Estado de Massachusetts.
Las válvulas tipo silla son ilegales y su uso
no está permitido en Massachusetts.
Consulte con un plomero licenciado.
NOTA: No apriete demasiado la tubería ya
que podría romperse.
Arandela
Abrazadera para el tubo
Férula (manga)
Extremo de entrada
Tornillo de
la abrazadera
8 LAVE LA TUBERÍA
Abra el suministro principal de agua y lave
la tubería hasta que el agua esté limpia.
Cierre el agua en la válvula después de que
un cuarto (1 litro) se haya eliminado por
la tubería.
6 DIRIJA LA TUBERÍA
Rote la tubería entre la línea del agua fría
y el refrigerador.
Rote la tubería a través de un orificio perforado
en la pared o en el piso (detrás del refrigerador
o del gabinete de la base adyacente) lo más
cerca posible a la pared.
Para completar la instalación del refrigerador,
regrese al Paso 1 en Instalación del refrigerador.
114
Sonidos normales de la operación.
GEAppliances.com
Los refrigeradores más nuevos producen sonidos diferentes a los modelos más antiguos. Los
refrigeradores modernos tienen más funciones y usan tecnología más reciente.
¿Usted escucha lo que yo escucho? Estos sonidos son normales.
¡WHIR!
HMMMM...
WHOOSH....
„ El nuevo compresor de alta eficiencia puede funcionar
más rápido y durar más que el de su refrigerador
anterior y puede escuchar un zumbido de tono
alto o un sonido pulsante mientras opera.
„ Puede escuchar un sonido de soplido cuando
las puertas se cierran. Esto se debe a que la presión
se está estabilizando dentro del refrigerador.
„ Puede escuchar los ventiladores moviéndose a gran
velocidad. Esto pasa cuando el refrigerador se conecta por
primera vez, cuando las puertas se abren frecuentemente
o cuando se guarda gran cantidad de alimentos en el
refrigerador o en los compartimientos del congelador. Los
ventiladores están ayudando a mantener las temperaturas
correctas.
„ Los ventiladores cambian la velocidad para suministrar
enfriamiento óptimo y ahorrar energía.
CHASQUIDOS, ESTALLIDOS,
CRUJIDO
„ Puede escuchar sonidos como de crujido o estallidos
cuando el refrigerador se conecta por primera vez.
Esto pasa a medida que el refrigerador se enfría hasta
la temperatura correcta.
„ El control del congelador produce un chasquido
cuando el compresor inicia o para.
„ El reloj del descongelador produce un chasquido
al iniciar y terminar el ciclo de descongelación.
„ Expansión y contracción de las bobinas durante o
después del ciclo de descongelación puede causar
sonidos como de crujido o estallidos.
„ En modelos con máquina de hielos, después de
completar un ciclo de hacer hielo, se pueden escuchar
los cubos de hielo cuando caen a la bandeja de hielos.
„ En modelos con un dispensador, durante la distribución
de agua, puede escuchar el movimiento de las líneas
de agua a la distribución inicial y después la liberación
del botón del dispensador.
SONIDOS DE AGUA
„ El fluido del refrigerante a través de las bobinas puede
producir un sonido de borboteo como de agua hirviendo.
„ El agua que cae en el calentador de descongelación puede
causar un chisporroteo, estallido o zumbido durante el ciclo
de descongelación.
„ Un ruido de agua cayendo se puede escuchar durante el
ciclo de descongelación a medida que el hielo se derrite del
evaporador y fluye hacia la bandeja de drenaje.
„ El cierre de las puertas puede producir un sonido
de gorgoteo debido a la estabilización de la presión.
Para información adicional sobre los ruidos
normales de la máquina de hielos, consulte
la sección Sobre la máquina de hielos
automática.
Antes de solicitar un servicio…
Solucionar problemas
¡Ahorre tiempo y dinero! Revise las tablas en las siguientes
páginas y tal vez no necesitará de solicitar un servicio.
Problema
Causas Posibles
Qué hacer
El refrigerador
no funciona
Refrigerador en ciclo de
descongelar.
• Espere 30 minutos para que la descongelación
se termine.
Control en posición 0 (apagado). • Mueva el control hasta un ajuste de temperatura.
El refrigerador esté desconectado. • Empuje la clavija completamente en el enchufe.
Fusible fundido/interruptor
de circuito roto.
• Reemplace el fusible o reajuste el interruptor.
115
Antes de solicitar un servicio…
Problema
Causas Posibles
Qué hacer
Vibraciones o sacudidas Las patas niveladoras
(una vibración ligera
requieren un ajuste.
es normal)
• Vea Cómo nivelar el refrigerador.
El motor opera durante
períodos prolongados o
se arranca y se para con
frecuencia. (Refrigeradores
modernos con más espacio
de almacenamiento y un
congelador más grande
requieren más tiempo de
operación. Se arrancan y
se paran a menudo para
mantener temperaturas
Es normal cuando
el refrigerador es recién
instalado en su casa.
• Espere 24 horas para que el refrigerador se enfríe
completamente.
Ocurre cuando hay largas
cantidades de alimentos
en el refrigerador.
• Eso es normal.
Se dejó abierta la puerta.
• Revise si un paquete mantiene la puerta abierta.
Clima caluroso o aperturas
frecuentes de la puerta.
• Eso es normal.
Controles de temperatura
ajustados al punto más frío.
• Vea Los controles.
Se ha activado la función
TurboCool.
• Esto es normal cuando la función TurboCool está activada.
Ver Sobre TurboCool para más información.
Compartimiento del
El control de temperatura
refrigerador o congelador no se fijó bastante frío.
demasiado cálido
Clima caluroso o aperturas
frecuentes de la puerta.
• Vea Los controles.
• Fije el control de temperatura un paso más frío.
Vea Los controles.
Se dejó abierta la puerta.
• Revise si hay un paquete que mantiene la puerta abierta.
Escarcha o cristales
de hielo en alimentos
congelados (escarcha
en paquete es normal)
Se dejó abierta la puerta.
• Revise si hay un paquete que mantiene la puerta abierta.
Apertura de puertas muy
frecuente o muy prolongada.
• Eso es normal.
Formación lenta del hielo
Se dejó abierta la puerta.
• Revise si hay un paquete que mantiene la puerta abierta.
El control de temperatura
no es bastante frío.
• Vea Los controles.
La máquina de hielos
automática no funciona
(en algunos modelos)
El interruptor de corriente de • Mueva el interruptor a la posición de I (encendido).
de la máquina de hielos no está La luz de encendido del dispositivo de hacer hielo
encendido.
será de color verde cuando el interruptor de la luz del
congelador esté pulsado o cuando la puerta del congelador
se encuentre cerrada.
El suministro del agua está
• Consulte la sección Cómo instalar la tubería del agua.
apagado o no está conectado.
El compartimiento del
congelador no es muy frío.
• Espere 24 horas para que el refrigerador se enfríe
completamente.
Hay cubos amontonados en
• Nivele los cubos con la mano.
el recipiente de almacenamiento
que causan que la máquina de
hielos se apague.
Los cubos de hielo están
• Apague la máquina de hielos, retire los cubos y vuelva
obstruidos en la máquina
a encender la máquina de hielos.
de hielos. (La luz verde de la
máquina dehielos está intermitente).
La luz del dispositivo de hacer
hielo no está encendida.
116
• Esto es normal cuando la puerta del congelador está abierta.
La luz de encendido del dispositivo de hacer hielo será de color
verde cuando el interruptor de la luz del congelador esté pulsado
o cuando la puerta del congelador se encuentre cerrada.
GEAppliances.com
Problema
Causas Posibles
Qué hacer
Sonido de zumbido
frecuente
El interruptor del suministro
eléctrico de la máquina de
hielos está en la posición
I (encendido), pero el suministro
de agua hacia el refrigerador
no ha sido conectado.
• Coloque el interruptor en la posición 0 (apagado).
Mantenerlo en la posición I (encendido) dañará
la válvula de agua.
Cubos pequeños o
huecos
Filtro de agua tapado.
• Reemplace el cartucho del filtro con uno nuevo
o con el tapón.
Los cubos tienen mal
olor/sabor
Alimentos transmitiendo
olor/sabor a los cubos.
• Envuelva bien los alimentos.
El interior del refrigerador
requiere limpieza.
• Vea Cuidado y limpieza.
• Mantenga una caja abierta de bicarbonato de sodio
en el refrigerador; cámbiela cada tres meses.
Alimentos transmitiendo
olores al refrigerador.
• Alimentos con olores fuertes deben estar tapados.
• Guarde una caja de bicarbonato de sodio en
el refrigerador; cámbiela cada tres meses.
El interior requiere limpieza.
• Vea Cuidado y limpieza.
No es extraño durante
periodos de alta humedad.
• Seque la superficie con un paño suave y ajuste
el control del refrigerador una marca más hacia lo frío.
El refrigerador huele
Se forma humedad
en la superficie del
refrigerador
Humedad se forma al
Abrir la puerta con mucha
interior (en clima húmedo, frecuencia o por mucho tiempo.
el aire lleva la humedad
al refrigerador cuando
las puertas se abren)
• Esto es normal.
La luz del compartimiento No hay corriente en el toma
del refrigerador o del
corriente.
congelador no funciona
Bombilla quemada o suelta.
• Reemplace el fusible o vuelva a iniciar el interruptor.
• Consulte la sección Cómo reemplazar la bombilla.
Aire caliente de la parte
de abajo del refrigerador
Motor de enfriamiento normal
del flujo del aire. En el proceso
de refrigeración, es normal
que salga calor de la parte
inferior del refrigerador. Algunas
cubiertas de piso son sensibles
y se decolorarán ante estas
temperaturas normales y seguras.
Congelamiento de
alimentos en el
refrigerador
Los alimentos están muy
• Mueva los alimentos lejos del ventilador.
cercanos al ventilador en
la parte posterior del refrigerador.
Brillo color naranja
en el congelador
El control del refrigerador
está en un nivel demasiado frío.
• Mueva el control del refrigerador a una temperatura
menos fría un incremento a la vez.
El calentador de
descongelación está encendido.
• Esto es normal.
117
Antes de solicitar un servicio…
Problema
Causas Posibles
Qué hacer
La puerta/gaveta
no se cierra sola
Las patas niveladoras
necesitan ajuste.
• Consulte la sección Instalación del refrigerador.
La puerta/gaveta del
congelador se abre
cuando la puerta
del refrigerador
está cerrada
Esto es normal si después de
abrirse, la puerta/gaveta del
congelador se cierra sola.
• Esto indica que hay un buen sellante en la puerta/gaveta
del congelador. Si la puerta/gaveta del congelador no
se cierra automáticamente después de abrirse, entonces
consulte la sección anterior, Problema: La puerta/gaveta
del refrigerador no se cierra sola.
El agua tiene
un sabor/olor malo
El dispensador de agua no
se uso por mucho tiempo.
• Dispense el agua hasta que todo el sistema del agua
se llene de nuevo.
El agua en el primer
vaso está tibia
Eso es normal con un
refrigerador recién instalado.
• Espere 24 horas para que se enfríe el refrigerador.
El dispensador de agua no
se uso por mucho tiempo.
• Dispense el agua hasta que todo el sistema del agua
se llene de nuevo.
El sistema de agua se ha
desaguado.
• Espere algunas horas para que se enfrié el agua.
Suministro de agua
apagado o no conectado.
• Vea Instalar la línea de agua.
Filtro de agua tapado.
• Reemplace el cartucho del filtro o remueve el filtro
y instale el tapón.
Aire atrapado en el sistema
del agua.
• Presione el brazo del dispensador por un par de minutos.
El dispensador de agua
no funciona
El agua del depósito está
• Configure el control del refrigerador a una temperatura
congelada porque los controles más elevada y espere 24 horas. Si no sale agua después
están configurados a una
de 24 horas, llame al servicio técnico.
temperatura muy baja.
El agua chorrea
del dispensador
Cartucho del filtro recién
instalado.
• Deje correr el agua desde el dispensador por 3 minutos
(aprox. 11ø2 galóns).
No sale agua y el
dispositivo para hacer
hielo no funciona
Está tapada la línea de agua
o la llave de paso.
• Llame a un plomero.
Filtro de agua tapado.
• Reemplace el cartucho del filtro o remueve el filtro y
instale el tapón.
El cartucho del filtro no está
instalado apropiadamente.
• Remueva y reinstale el cartucho del filtro, cerciorándose
de que encaja en su lugar. La cuchilla en el extremo del
cartucho deberá colocarse verticalmente.
El agua se está fugando
del dispensador
El vaso no está siendo sostenido •
debajo del dispensador por
suficiente tiempo después
de que el botón es liberado.
Puede haber aire presente
en el sistema de la tubería
del agua que causa que
el agua gotee después de que
el agua se haya dispensado.
118
Sostenga el vaso debajo del dispensador por 2 ó 3
segundos después de liberar el botón del dispensador.
El agua podría continuar dispensándose después de
que el botón sea liberado.
• Dispense agua por al menos 2 minutos para retirar
el aire del sistema.
GEAppliances.com
Problema
Causas Posibles
Qué hacer
La pantalla muestra
La función TurboCool
se encuentra activada.
• Ver Sobre TurboCool para más información.
La luz del indicador del
filtro de agua cambió
de color
Esto es normal.
• Ver Sobre el filtro de agua para más información.
La luz del indicador del
filtro de agua continúa
roja aún después de haber
cambiado el filtro de agua
El indicador de filtro de agua
debe resetearse.
• Presione y sostenga por 3 segundos la tecla RESET WATER
FILTER (Resetear el filtro de agua). Ver Sobre el filtro de
agua para más información.
La luz del indicador del
filtro de agua no está
encendida
Esto es normal. Si se enciende • Ver Sobre el filtro de agua para más información.
una luz de color naranja, se debe
cambiar el filtro en poco tiempo.
El cartucho del filtro debe
cambiarse si se enciende
una luz de color rojo.
La manija está floja /
la manija tiene una brecha
La manija debe ajustarse.
• Ver las secciones Cómo sujetar la manija de la puerta de
alimentos frescos y Cómo sujetar la manija del congelador
para información más detallada.
El refrigerador emite
un sonido
Esto es la alarma de la puerta.
• Cierre la puerta.
El ajuste de control
no está encendido
En algunos modelos, las
• Si los ajustes de control no se alumbran, inspeccione
bombillas en la parte superior del para verificar si existe alguna bombilla quemada,
compartimiento del refrigerador y cambie si es necesario.
alumbran los ajustes de control
de la temperatura.
Las puertas del
refrigerador no están
uniformes (en los modelos
de doble puerta)
Es necesario realinear
las puertas.
• Ver la sección Cómo alinear las puertas dobles
localizada bajo Cómo volver a colocar las puertas
(Modelos de refrigerador de doble puerta únicamente).
Las canastas se traban
o bloquean cuando
se abren o cierran
Las canastas están
demasiado llenas.
• Para abrir: Quite algunos productos de la canasta cuando
esté lo más abierta posible. Reorganice los productos que
quedaron en la canasta y trate de abrirla de nuevo.
• Para cerrar: Reorganice los productos de la canasta o quite
cualquier producto que se encuentre por encima del borde
de la canasta y ciérrela.
119
Garantía del Refrigerador.
Todos los servicios de garantía los proporcionan nuestros Centros
de Reparación de Fábrica o nuestros técnicos Customer Care ®
autorizados. Para concertar una cita de reparación, en línea, visíte
nos al GEAppliances.com, o llame al 800.GE.CARES (800.432.2737).
Cuando llame para solicitar servicio, por favor tenga a mano el
número de serie y el número de modelo.
Por el período de:
Grape aquí su recibo.
Se requiere facilitar prueba
de la fecha de compra
original para obtener
un servicio bajo la garantía.
GE reemplazará:
MODELOS GE y GE PROFILE:
Un año
Cualquier parte del refrigerador que falle debido a defectos en los materiales o en
A partir de la fecha
la fabricación. Durante esta garantía limitada de un año, GE también proporcionará, sin costo
de la compra original
algunoWRGDODPDQRGHREUD\HOVHUYLFLRUHODFLRQDGR³SDUDUHHPSOD]DUSDUWHVGHIHFWXRVDV
Treinta días
A partir de la fecha
de compra original
del refrigerador
Cualquier parte del cartucho de filtro de agua que falle debido a defectos en los materiales o
manufactura. Durante esta garantía limitada de treinta días, GE también proporcionará sin costo,
un cartucho de filtro de agua de repuesto.
MODELOS DE GE PROFILE SOLAMENTE:
Cinco años
Cualquier parte del sistema sellado de refrigeración (compresor, condensador, evaporador y
A partir de la fecha
tuberías de conexión) que fallen debido a defectos en los materiales o fabricación. Durante esta
de la compra original
garantía limitada de cinco años del sistema sellado de refrigeración, GE también proporcionará,
sin costo alguno, toda la mano de obra y el servicio relacionado para reemplazar partes
defectuosas del sistema sellado de refrigeración.
Lo que GE no cubrirá:
„ Viajes de servicio a su hogar para enseñarle cómo usar
el producto.
„ Instalación o entrega inapropiada, o mantenimiento
impropio.
„ Fallas del producto si hay abuso, mal uso, o uso para
otros propósitos que los propuestos, o uso para fines
comerciales.
„ Pérdida de alimentos por averías.
„ Daños sobre el acabado, tales como óxido sobre la
superficie, deslustres o manchas pequeñas no informadas
dentro de las 48 horas luego de la entrega.
„ Reemplazo de fusibles de su hogar o reajuste de
interruptores de circuito.
„ Reemplazo del cartucho del filtro para agua, si incluidos,
debido a presión de agua afuera de las limites de operación
especificados o sedimento excesivo en
el suministro de agua.
„ Reemplazo de las bombillas, si incluidos, o los filtros
de agua, si incluidos.
„ Daño al producto causado por accidente, fuego,
inundaciones, o actos de Dios.
„ Daño incidental o consecuencial causado por posibles
defectos con el aparato.
„ Producto no accesible para facilitar el servicio requerido.
(;&/86,Ï1'(*$5$17Ë$6,03/Ë&,7$6³6X~QLFR\H[FOXVLYRGHUHFKRHVODUHSDUDFLyQGHOSURGXFWRWDO\
como se indica en esta Garantía limitada. Cualquier garantía implícita, incluyendo las garantías implícitas
de comerciabilidad o adecuación para un fin determinado, están limitadas a un año o el período de
tiempo más breve permitido por la ley.
Para los clientes de EE.UU. Esta garantía se extiende al comprador original y a cualquier dueño subsiguiente de
productos comprados para uso hogareño dentro de EE.UU. Si el producto está en un área donde no se encuentra
disponible un Proveedor Autorizado del Servicio Técnico de GE, usted será responsable por el costo de un viaje o se
podrá requerir que traiga el producto a una ubicación del Servicio Técnico de GE Autorizado para recibir el servicio.
En Alaska, la garantía excluye el costo de envío o llamadas del servicio a su hogar.
Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía le da derechos
legales específicos y es posible que tenga otros derechos legales que varían entre un estado y otro. Para conocer cuáles
son sus derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado.
Garante: General Electric Company. Louisville, KY 40225
Para los clientes de Canadá : Esta garantía se extiende al comprador original y cualquier comprador posterior
de productos comprados en Canadá para uso residencial dentro de Canadá. El servicio a domicilio warrant será
proporcionado en las áreas donde está disponible y que se considere razonable por MC Commercial para ofrecer.
Mabe Canada Inc., Burlington, ON, L7R 5B6
120
Ficha Técnica de Funcionamiento
6LVWHPDGH)LOWUDFLyQ6PDUW:DWHUŒ³&DUWXFKR*(0:)
Información de los Datos de Rendimiento
Capacidad: 300 Galones (1,135 litros)
/DFRQFHQWUDFLyQGHORVFRQWDPLQDQWHVHYDOXDGRVHQHVWH¿OWURVREUHHODJXDTXHLQJUHVDDOVLVWHPD
fue reducida a la concentración menor que o igual al límite permisible para el agua que deja el
VLVWHPDFRPRVHHVSHFL¿FDHQHO(VWiQGDU\HQHO(VWiQGDUGH16)$16,6LVWHPDHYDOXDGR\
FHUWL¿FDGRSRU16),QWHUQDWLRQDOFRQWUDHO(VWiQGDU\HO(VWiQGDUGH16)$16,
Para acceder a un listado completo de los contaminantes evaluados y las cantidades reducidas,
consulte geappliances.com.
Los siguientes reclamos de reducción farmacéutica no fueron certificados por NSF International ni por el Estado de California.
Reclamos evaluados y verificados por un laboratorio independiente:
Reducción de
contaminantes
Atenolol
Fluoxetina
Ibuprofeno
Progesterona
Trimetoprima
Concentración
Promedio
978 ng/L
QJO
QJ/
QJ/
QJ/
Concentración Máxima
Especificada por NSF
N/A
N/A
N/A
N/A
N/A
Promedio de
% Promedio Concentración del
de Reducción Agua Procesada
QJ/
QJ/
QJ/
QJ/
QJ/
Concentración Máxima Requisitos de
Reducción
Autorizada Aceptable
de Agua Procesada
de NSF
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
N/A
Informe
de Evaluación
de NSF
-
-
-
-
-
Pautas de Aplicación/ Parámetros de Suministro de Agua
)OXMRGH6HUYLFLR
Suministro de Agua
JSPOSP
Agua Potable
Presión del Agua
Temperatura del agua
SVLEDU
ƒ)ƒ)ƒ&ƒ&
Es esencial que se cumpla con los requisitos de instalación, mantenimiento y reemplazo de filtros recomendados por el fabricante, a fin de que el producto funcione de acuerdo a
como fue promocionado. Para acceder a información sobre la Garantía, consulte el Manual de Instalación.
Nota: 2EVHUYHTXHDXQTXHODHYDOXDFLyQVHUHDOL]yGHDFXHUGRFRQFRQGLFLRQHV
HVWiQGDUHVGHODERUDWRULRHOGHVHPSHxRSXHGHYDULDU&DUWXFKRGH5HHPSOD]R
0:)3DUDFRQRFHUFRVWRVHVWLPDGRVGHHOHPHQWRVGHUHHPSOD]RFRPXQtTXHVH
DORYLVLWHQXHVWURVLWLRZHEHQZZZJHDSSOLDQFHSDUWVFRP
ADVERTENCIA
A fin de reducir el riesgo asociado con la ingestión de contaminantes:
• No se deben usar con agua que no sea microbiológicamente segura o de
calidad desconocida sin una desinfección adecuada, antes o después,
del sistema. Los sistemas certificados para la reducción de quistes se pueden
XVDUHQDJXDVGHVLQIHFWDGDVTXHSXHGDQFRQWHQHUTXLVWHVILOWUDEOHV
(VWDEOHFLPLHQWRGH(3$1~PHUR01
3DUDFRQRFHUODVFRQGLFLRQHVGHXVRUHFODPRVPpGLFRVFHUWLILFDGRVSRUHO&DOLIRUQLD
'HSDUWPHQWRI3XEOLF+HDOWK'HSDUWPHQWRGH6DOXG3~EOLFDGH&DOLIRUQLDFRQVXOWHO
DILFKDWpFQLFDGHUHQGLPLHQWR&HUWLILFDFLyQGHO&DOLIRUQLD'HSDUWPHQWRI3XEOLF+HDOWK
'HSDUWDPHQWRGH6DOXG3~EOLFDGH&DOLIRUQLDQž/RVFRQWDPLQDQWHVXRWUDV
VXVWDQFLDVHOLPLQDGDVRUHGXFLGDVSRUHVWHILOWURGHDJXDQRHVWiQQHFHVDULDPHQWHHQ
HODJXDGHWRGRVORVXVXDULRV
ELEMENTOS
DE REEMPLAZO
AVISO
A fin de reducir el riesgo asociado con daños sobre la propiedad debido a pérdidas de agua:
•
• /DLQVWDODFLyQ\XVRDEBERÁN FXPSOLUFRQWRGRVORVFyGLJRVGHSORPHUtDHVWDWDOHV\ORFDOHV
• No VHGHEHUiLQVWDODUVLODSUHVLyQGHODJXDVXSHUDORVSVLEDU6LODSUHVLyQGHODJXD
HVVXSHULRUDORVSVLVHdeberá LQVWDODUXQDYiOYXODOLPLWDGRUDGHSUHVLyQ6LQRHVWi
VHJXURVREUHFyPRFRQWURODUODSUHVLyQGHODJXDFRPXQtTXHVHFRQXQSORPHURSURIHVLRQDO
• No LQVWDOHFXDQGRVHSXHGDQSURGXFLUFRQGLFLRQHVGHJROSHGHDULHWH6LH[LVWHQ
FRQGLFLRQHVGHJROSHGHDULHWHGHEHUi instalar XQVXVSHQVRUGHJROSHVGHDULHWH6LQR
HVWiVHJXURVREUHFyPRFRQWURODUHVWDFRQGLFLyQFRPXQtTXHVHFRQXQSORPHURSURIHVLRQDO
• No LQVWDOHHQOtQHDVGHVXPLQLVWURGHDJXDFDOLHQWH/DWHPSHUDWXUDPi[LPD
GHIXQFLRQDPLHQWRGHODJXDSDUDHVWHVLVWHPDGHILOWURHVGHƒ)ƒ&
• Proteja el filtro de heladas. Drene el filtro cuando las temperaturas sean
LQIHULRUHVDž)ž&
• (OFDUWXFKRGHOILOWURGHVFDUWDEOHdeberá VHUUHHPSOD]DGRFDGDPHVHVOXHJR
GHXQXVRQRUPDORDQWHVVLVHSURGXFHXQDUHGXFFLyQQRWRULDHQHOFDXGDO
Sistema evaluado y certificado por NSF
International contra NSF/ANSI Estándar 42
y Estándar 53 en el modelo GE MWF para
la reducción de los reclamos especificados
en la ficha técnica de rendimiento.
121
Hoja de Datos de Funcionamiento
Sistema de Filtración GE SmartWater
Cartucho GSWF
Este sistema se ha sometido a las pruebas NSF/ANSI 42/53 a fin de reducir las sustancias presentadas a continuación.
Se redujo la concentración de las sustancias indicadas en el agua que ingresan en el sistema a una concentración menor
o igual al límite permitido para el agua que sale del sistema, como se especifica en NSF/ANSI 42/53.*
(Factores de 100% incorporados para la utilización no medida)
Estándar No. 42: Efectos estéticos
Parámetros
Cloro
72
Partículas
USEPA
MCL
³
³
³
Promedio
influente
PJ/
³
P/
Calidad del
influente concentración
PJ/+ 10%
³
10.000 partículas/mL mínimo
Effluent
Promedio
Máximo
< 0,05 mg/L
0,05 mg/L
³
³
P/
P/
% de reducción
Promedio
Mínimo
>97,29%
96,43%
³
³
Reducción
mínima necesaria
> 50%
³
> 85%
% de reducción
Promedio
Mínimo
98,97%
98,61%
!
!
> 99,33%
> 99,33%
> 99,29%
97,86%
99,07%
98,75%
> 76,12%
> 66,67%
Reducción
mínima necesaria
0,5 NTU
!
0,010 mg/L
0,010 mg/L
0,0002 mg/L
0,003 mg/L
Estándar No. 53: Efectos Relativos a la Salud
Parámetros
Turbidez
Quistes
Plomo a pH 6,5
Plomo a pH 8,5
Lindane
Atrazine
USEPA
Promedio
MCL
influente
1 NTU***
10,3 NTU***
99,95% Reducción /
0,015 mg/L
0,15 mg/L
0,015 mg/L
0,14 mg/L
0,0002 mg/L
0,0216 mg/L
0,003 mg/L
0,008 mg/L
Calidad del
influente concentración
1 + 1 NTU***
/PtQLPR
0,15 mg/L + 10%
0,15 mg/L + 10%
0,002 mg/L + 10%
0,009 mg/L + 10%
Effluent
Promedio
Máximo
0,106 NTU
0,14 NTU
< 0,001 mg/L
< 0,001 mg/L
0,001 mg/L
0,003 mg/L
< 0,00002 mg/L
< 0,00002 mg/L
< 0,002 mg/L
< 0,002 mg/L
* Probado utilizando una tasa de flujo de 0,5 gpm (1,8927 l/min.); presión de 60 psig (4,218 Kg/cm2); pH de 7,5 ± 0,5; temp. de 20° ± 3°C
** Medición en partículas/ml. Las partículas usadas eran de 0,5–1 micrón.
8QLGDGHVGHWXUELGH]1HIHORPpWULFD³178
Especificaciones de Operación
„
„
„
„
Capacidad: certificado para hasta 750 galones (2838 litros); hasta seis meses
Requerimientos de presión: 40–120 psi (2,8–8,2 bar), sin choque
Temperatura: 33°–100°F (0,6°–38°C)
Tasa de flujo: 0,5 gpm (1,9 lpm)
Requerimientos Generales de Instalación/Operación/Mantenimiento
„ Lave el nuevo cartucho a la tasa máxima por 3 minutos para sacar el aire atrapado.
„ Reemplace el cartucho cuando el flujo se haga muy lento.
Avisos Especiales
„ Las instrucciones de instalación, las piezas, la información sobre la disponibilidad de servicio y la garantía estándar se incluyen con el producto
al enviarlo.
„ Este sistema de agua potable debe mantenerse conforme a las instrucciones del fabricante, incluyendo el reemplazo de los cartuchos.
„ No se utiliza en los sitios donde el agua es de calidad microbiológicamente dudosa, ni con aguas de calidad desconocida, sin una desinfección
adecuada antes o después del sistema; el sistema puede utilizarse con aguas desinfectadas que puedan contener quistes filtrables.
„ Los contaminantes u otras substancias que este sistema de tratamiento de agua puede remover o reducir, no están presentes, necesariamente,
en su agua.
„ Verifique el acatamiento de las leyes y reglamentos estatales y locales.
„ Tome en cuenta que aunque las pruebas se realizaron bajo condiciones estándar de laboratorio, el resultado real puede variar.
Los sistemas se deben instalar y operar de acuerdo con los procedimientos y las pautas que recomienda el fabricante.
Sistema probado y certificado por NSF Internacional contra norma 42 de ANSI/NSF para
la reducción de cloro, sabor y olor, partículas Clase I, y contra norma 53 para la reducción
de quistes, plomo, Lindane, Atrazine y turbidez.
Hecho por General Electric, Appliance Park, Louisville, KY 40225
122
NSF
®
Notas…
123
Notas…
124
Notas…
125
Notas…
126
Servicio al consumidor.
Página Web de GE Appliances
GEAppliances.com
¿Tiene alguna pregunta sobre su electrodoméstico? ¡Pruebe la página Web de GE Appliances 24 horas al día,
cualquier día del año! Para mayor conveniencia y servicio más rápido, ya puede descargar los Manuales de
los Propietarios, pedir piezas o incluso hacer una cita en línea para que vengan a realizar una reparación.
Solicite una reparación
GEAppliances.com
El servicio de expertos GE está a tan sólo un paso de su puerta. ¡Entre en línea y solicite su reparación cuando
le venga cualquier día del año! O llame al 800.GE.CARES (800.432.2737) durante horas normales de oficina.
Real Life Design Studio
(Estudio de diseño para la vida real)
GEAppliances.com
*(DSR\DHOFRQFHSWRGH'LVHxR8QLYHUVDO³SURGXFWRVVHUYLFLRV\DPELHQWHVTXHSXHGHQXVDUJHQWHGHWRGDV
las edades, tamaños y capacidades. Reconocemos la necesidad de diseñar para una gran gama de habilidades
y dificultades físicas y mentales. Para más detalles cobre las aplicaciones de GE Diseño Universal, incluyendo
ideas de diseño para la cocina para personas con discapacidades, mire nuestra página Web hoy mismo.
Para personas con dificultades auditivas, favor de llamar al 800.TDD.GEAC (800.833.4322).
Garantías ampliadas
GEAppliances.com
Compre una garantía ampliada y obtenga detalles sobre descuentos especiales disponibles mientras su garantía
está aún activa. Puede comprarla en línea en cualquier momento, o llamar al (800.626.2224) durante horas
normales de oficina. GE Consumer Home Services estará aún ahí cuando su garantía termine.
Piezas y accesorios
GEApplianceParts.com
Aquellos individuos con la calificación necesaria para reparar sus propios electrodomésticos pueden
pedir que se les manden las piezas o accesorios directamente a sus hogares (aceptamos las tarjetas
VISA, MasterCard y Discover). Haga su pedido en línea hoy, 24 horas cada día o llamar por teléfono
al 800.626.2002 durante horas normales de oficina.
Las instrucciones descritas en este manual cubren los procedimientos a seguir por cualquier usuario.
Cualquier otra reparación debería, por regla general, referirse a personal calificado autorizado. Debe
ejercerse precaución ya que las reparaciones incorrectas pueden causar condiciones de funcionamiento
inseguras.
Póngase en contacto con nosotros
GEAppliances.com
Si no está satisfecho con el servicio que recibe de GE, póngase en contacto con nosotros en nuestra
página Web indicando todos los detalles así como su número de teléfono o escríbanos a:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
Registre su electrodoméstico
GEAppliances.com
£5HJLVWUHVXQXHYRHOHFWURGRPpVWLFRHQOtQHD³FXDQGRXVWHGSUHILHUD El registrar su producto a tiempo
le proporcionará, si surgiera la necesidad, una mejor comunicación y un servicio más rápido bajo los términos
de su garantía. También puede enviar su tarjeta de registro pre-impresa que se incluye en el material de
embalaje o recorte y use el formulario de este Manual del Propietario.
127
Consumer Support.
GE Appliances Website
In the U.S.: GEAppliances.com
Have a question or need assistance with your appliance? Try the GE Appliances Website 24 hours a day,
any day of the year! For greater convenience and faster service, you can now download Owner’s Manuals,
order parts or even schedule service on-line. In Canada: www.GEAppliances.ca
Schedule Service
In the U.S.: GEAppliances.com
Expert GE repair service is only one step away from your door. Get on-line and schedule your service at your
convenience any day of the year! Or call 800.GE.CARES (800.432.2737) during normal business hours.
In Canada, call 1.800.561.3344
Real Life Design Studio
In the U.S.: GEAppliances.com
*(VXSSRUWVWKH8QLYHUVDO'HVLJQFRQFHSW³SURGXFWVVHUYLFHVDQGHQYLURQPHQWVWKDWFDQEHXVHGE\SHRSOHRI
all ages, sizes and capabilities. We recognize the need to design for a wide range of physical and mental abilities
and impairments. For details of GE’s Universal Design applications, including kitchen design ideas for people with
disabilities, check out our Website today. For the hearing impaired, please call 800.TDD.GEAC (800.833.4322).
In Canada, contact: Manager, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Extended Warranties
In the U.S.: GEAppliances.com
Purchase a GE extended warranty and learn about special discounts that are available while your warranty is still
in effect. You can purchase it on-line anytime, or call 800.626.2224 during normal business hours. GE Consumer Home
Services will still be there after your warranty expires. In Canada, call 1.888.261.2133
Parts and Accessories
In the U.S.: GEApplianceParts.com
Individuals qualified to service their own appliances can have parts or accessories sent directly to their homes
(VISA, MasterCard and Discover cards are accepted). Order on-line today, 24 hours every day or by phone at
800.626.2002 during normal business hours.
Instructions contained in this manual cover procedures to be performed by any user. Other servicing generally
should be referred to qualified service personnel. Caution must be exercised, since improper servicing may cause
unsafe operation.
Customers in Canada should consult the yellow pages for the nearest Mabe service center, or call 1.800.661.1616.
Contact Us
In the U.S.: GEAppliances.com
If you are not satisfied with the service you receive from GE, contact us on our Website with all the details including your
phone number, or write to:
General Manager, Customer Relations
GE Appliances, Appliance Park
Louisville, KY 40225
In Canada: www.GEAppliances.ca, or write to:
Director, Consumer Relations, Mabe Canada Inc.
Suite 310, 1 Factory Lane
Moncton, N.B. E1C 9M3
Register Your Appliance
In the U.S.: GEAppliances.com
5HJLVWHU\RXUQHZDSSOLDQFHRQOLQH³DW\RXUFRQYHQLHQFH Timely product registration will allow for enhanced
communication and prompt service under the terms of your warranty, should the need arise. You may also
mail in the pre-printed registration card included in the packing material. In Canada: www.GEAppliances.ca
Printed in Mexico

advertisement

Was this manual useful for you? Yes No
Thank you for your participation!

* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project

Related manuals

advertisement