QGIS User Guide - QGIS Documentation

QGIS User Guide - QGIS Documentation

QGIS User Guide

Versão 2.6

QGIS Project

22/05/2015

Sumário

1 Preâmbulo

3

2 Convenções

5

2.1

Convenções da Interface Gráfica

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

5

2.2

Convenções do Texto ou Teclado

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

5

2.3

Instruções especificas da Plataforma

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

6

3 Preâmbulo

7

4 Feições

9

4.1

Visualização de dados

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

9

4.2

Exploração de dados e compositores de mapas

. . . . . . . . . . . . . . . . . . . . . . . . . . .

9

4.3

Criar, editar, gerir e exportar dados

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

10

4.4

Análise de dados

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

10

4.5

Publicação de mapas na internet

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

10

4.6

Funcionalidades do QGIS expandida através de complementos

. . . . . . . . . . . . . . . . . . .

10

4.7

Console Python

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

11

4.8

Problemas conhecidos

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

12

5 O que há de novo no QGIS 2.6

13

5.1

Aplicação e opções de projeto

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

13

5.2

Provedor de arquivos

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

13

5.3

Compositor de impressão

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

13

5.4

Servidor QGIS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

14

5.5

Simbologia

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

14

5.6

Interface de usuário

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

14

6 Iniciando

15

6.1

Instalação

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

15

6.2

Amostra de Dados

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

15

6.3

Sessão Amostra

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

16

6.4

Iniciar e Parar QGIS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

17

6.5

Opções da Linha de Comandos

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

17

6.6

Projetos

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

19

6.7

Arquivo de Saída

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

20

7 QGIS GUI

21

7.1

Barra de Menu

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

22

7.2

Barra de Ferramentas

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

28

7.3

Legenda do Mapa

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

29

7.4

Visualização do mapa

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

31

7.5

Barra de Status

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

32

i

8 Ferramentas Gerais

33

8.1

Atalhos de teclado

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

33

8.2

Conteúdo da ajuda

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

33

8.3

Renderização

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

33

8.4

Medição

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

35

8.5

Identificar feições

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

37

8.6

Decorações

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

38

8.7

Ferramentas de anotação

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

40

8.8

Favoritos Espaciais

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

41

8.9

Projetos animados

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

43

9 Configuração QGIS

45

9.1

Painéis e Barras de Ferramentas

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

45

9.2

Propriedades do Projeto

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

46

9.3

Opções

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

46

9.4

Personalização

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

55

10 Trabalhando com Projeções

57

10.1 Visão geral do Suporte a Projeções

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

57

10.2 Especificação de Projeção Global

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

57

10.3 Definir Reprojeção Dinâmica Voo Livre (OTF)

. . . . . . . . . . . . . . . . . . . . . . . . . . .

59

10.4 Sistema de Referência de Coordenadas personalizado

. . . . . . . . . . . . . . . . . . . . . . .

60

10.5 transformações de datum padrão

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

61

11 QGIS Pesquisador

63

12 Trabalhando com Dados Vetoriais

65

12.1 Formatos de dados suportados

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

65

12.2 A Biblioteca de Símbolos

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

77

12.3 Janela de Propriedades de Vetor

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

80

12.4 Expressões

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109

12.5 Editando

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116

12.6 Ferramenta de Consulta

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133

12.7 Calculadora de Campo

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135

13 Trabalhando com Dados Raster

137

13.1 Trabalhando com dados raster

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 137

13.2 Diálogo de propriedades do Raster

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 138

13.3 Calculadora Raster

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 147

14 Trabalhando com dados OGC

149

14.1 QGIS como Cliente de Dados OGC

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 149

14.2 QGIS com Servidor de Dados OGC

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 158

15 Trabalhando com dados GPS

165

15.1 Complemento GPS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 165

15.2 Rastreio GPS em tempo real

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169

16 Integração com SIG GRASS

175

16.1 Iniciando o complemento GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 175

16.2 Carregando camadas raster e vetorial GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . 176

16.3 Localização e MAPSET GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 176

16.4 Importando dados para uma localização GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . 179

16.5 O modelo de dados vetorial do GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 179

16.6 Criando uma nova camada vetorial GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 180

16.7 Digitalizando e editando uma camada vetorial GRASS

. . . . . . . . . . . . . . . . . . . . . . . 180

16.8 A ferramenta região GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 184

16.9 Ferramentas GRASS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 184

ii

17 QGIS estrutura de processamento

193

17.1 Introdução

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 193

17.2 A caixa de ferramentas

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 194

17.3 O modelador gráfico

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 203

17.4 A interface do processamento em lote

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 209

17.5 Usando os algoritmos do processamento a partir do Terminal Python.

. . . . . . . . . . . . . . . 211

17.6 Gerenciador do histórico

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 217

17.7 Escrevendo novos algoritmos de processamento com scripts python

. . . . . . . . . . . . . . . . 218

17.8 Entregando os dados produzidos pelo algoritmo

. . . . . . . . . . . . . . . . . . . . . . . . . . . 220

17.9 Comunicação com o usuário

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 220

17.10 Documentando seus scripts

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 220

17.11 Exemplos de scripts

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 220

17.12 Melhores práticas para algoritmos de script escrito

. . . . . . . . . . . . . . . . . . . . . . . . . 221

17.13 Pré e pós-execução de ganchos de script

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221

17.14 Configurando as aplicações externas

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221

17.15 O QGIS Comando

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 228

18 Fornece algoritmos e processamento

231

18.1 Provedor de algoritmo GDAL

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231

18.2 LAStools

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 264

18.3 Modeler Tools

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 289

18.4 OrfeoToolbox algorithm provider

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 291

18.5 QGIS algorithm provider

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 366

18.6 Provedor de algoritmo R

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 420

18.7 SAGA algorithm provider

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 430

18.8 TauDEM algorithm provider

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 601

19 Compositor de Impressão

633

19.1 Primeiros passos

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 634

19.2 Modo de Renderização

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 638

19.3 Itens do Compositor

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 640

19.4 Gerenciar ítens

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 663

19.5 Ferramentas de Reverter e Restaurar

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 665

19.6 Geração de Atlas

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 665

19.7 Criando um arquivo de Saída

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 667

19.8 Gerir o Compositor

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 669

20 Complementos

671

20.1 Complementos QGIS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 671

20.2 Usando os Complementos Core QGIS

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 676

20.3 Complemento de Captura de Coordenadas

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 677

20.4 Complemento Gerenciador BD

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 677

20.5 Complemento dxf2shp

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 678

20.6 Complemento eVis

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 679

20.7 Complemento fTools

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 689

20.8 Complemento Ferramentas GDAL

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 692

20.9 Complemento Georreferenciador

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 695

20.10 Complemento de Interpolação

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 700

20.11 Complemento Edição Offiine

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701

20.12 Complemento GeoRaster Espacial Oracle

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701

20.13 Complemento Análise do Terreno

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 704

20.14 Complemento Mapa de Densidade

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 705

20.15 Catálogo do Cliente MetaBusca

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 708

20.16 Complemento Menor Distância

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 712

20.17 Complemento de Consulta Espacial

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 713

20.18 Complemento SPIT

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715

20.19 Complemento SQL Anywhere

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 715

20.20 Complemento Verificador de Topologia

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 717

20.21 Complemento Estatística Zonal

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 718

iii

21 Ajuda e Suporte

721

21.1 Listas de Discurssão

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 721

21.2 IRC

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 722

21.3 Rastreador de Erros

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 722

21.4 Blog

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 723

21.5 Plugins

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 723

21.6 Wiki

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 723

22 Apêndice

725

22.1 Licença Pública Geral GNU

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 725

22.2 GNU Licença de Documentação Gratuíta

. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 728

23 Referências Bibliográficas e Web

Índice

735

737

iv

.

.

QGIS User Guide, Versão 2.6

Sumário 1

QGIS User Guide, Versão 2.6

2 Sumário

CAPÍTULO

1

Preâmbulo

Este documento é o guia do usuário original do software descrito QGIS. O software e hardware descrito neste documento são, na maioria dos casos, marcas registradas e são, portanto, sujeitas a requisitos legais. QGIS está sujeito à Licença Pública Geral GNU. Encontre mais informações sobre o QGIS na página, http://www.qgis.org

.

Os detalhes, dados e resultados neste documento podem ter sido escritos e verificados para melhorar o conhecimento e a responsabilidade dos autores e editores. No entanto, erros relativos ao conteúdo são possíveis.

Portanto, os dados não estão sujeitos a quaisquer direitos ou garantias. Os autores, editores e editoras não têm qualquer responsabilidade por falhas e suas consequências. Você é sempre bem-vindo para relatar possíveis erros.

Este documento foi elaborado com reStruturedText. Ele está disponível como código-fonte reST via github e on-line como HTML e PDF via http://www.qgis.org/en/docs/ . As versões traduzidas deste documento também podem ser baixadas em vários formatos através da área de documentação do projeto QGIS. Para mais informações sobre a contribuir para este documento e sobre a tradução, por favor visite http://www.qgis.org/wiki/ .

Links neste Documento

Este documento contém links internos e externos. Clicando sobre um link interno move-se dentro do documento, ao clicar em um link externo abre um endereço de internet. Em formato PDF, links internos e externos são mostradas em azul e são tratados pelo navegador do sistema. Em formato HTML, o navegador exibe e trata ambos de forma idêntica.

Usuário, Instalação e Código Guia dos Autores e Editores:

Tara Athan

Peter Ersts

Radim Blazek

Anne Ghisla

Godofredo Contreras Otto Dassau

Stephan Holl N. Horning

Werner Macho Carson J.Q. Farmer Tyler Mitchell

Claudia A. Engel Brendan Morely David Willis

K. Koy

Jürgen E. Fischer

Larissa Junek

Tim Sutton

Astrid Emde

Diethard Jansen

Alex Bruy

Yves Jacolin

Paolo Corti

Raymond Nijssen

Alexandre Neto

Gavin Macaulay

Richard Duivenvoorde

Andy Schmid

Martin Dobias

Magnus Homann

Lars Luthman

Marco Hugentobler

Gary E. Sherman

Andreas Neumann

Hien Tran-Quang

Copyright (c) 2004 - 2014 QGIS Equipe de Desenvolvimento

Internet: http://www.qgis.org

Licença deste documento

.

Permissão é garantida para cópia, distribuição e/ou modificação deste documento sobre os termos da Licença de Documentação Livre GNU, Versão 1.3 ou versão mais recente publicada pela Fundação Software Livre; sem

Seções Invariantes, sem textos de Capa e sem textos de Contra-Capa. A cópia da licença é incluída no Apêndice

GNU Licença de Documentação Gratuíta .

3

QGIS User Guide, Versão 2.6

4 Capítulo 1. Preâmbulo

CAPÍTULO

2

Convenções

Esta seção descreve os estilos uniformes que serão utilizados ao longo deste manual.

2.1 Convenções da Interface Gráfica

Os estilos convenção da GUI, são destinados a similar a aparência gráfica. Em geral, um estilo vai refletir a aparência, para que um usuário possa verificar visualmente a GUI e encontrar algo semelhante com as instruções no manual.

• Menu Opções: Camada → Adicionar uma camada Raster ou Configurações → Barra de Ferramentas →

Digitalizar

• Ferramenta:

Adiciona uma camada Raster

• Botão : [Salvar como padrão]

• Caixa de diálogo Título: Propriedades da camada

• Aba: Geral

• Caixa de seleção: Renderizar

• Botão de opção: Postgis SRID EPSG ID

• Selecione um número:

• Selecione uma frase:

• Procure pelo arquivo:

• Selecione uma cor:

• Barra deslizante:

• Entrada de texto:

Uma sombra indica um componente GUI clicável.

2.2 Convenções do Texto ou Teclado

Este manual também inclui estilos relacionados ao texto, comandos de teclado e de codificação para indicar diferentes entidades, tais como classes ou métodos. Estes estilos não correspondem à aparência real de qualquer texto ou codificação dentro do QGIS.

• Hyperlinks: http://qgis.org

5

QGIS User Guide, Versão 2.6

• A Combinação das teclas: Press Ctrl+B, ou seja, pressione e segure a tecla Ctrl e, em seguida, pressione a tecla B.

• Nome de um arquivo: lakes.shp

• Nome de uma classe: NewLayer

• Método: classFactory

• Servidor: myhost.de

• Texto de Usuário: qgis --help

Linhas de código serão indicadas por uma fonte de tamanho fixo:

PROJCS["NAD_1927_Albers",

GEOGCS["GCS_North_American_1927",

2.3 Instruções especificas da Plataforma

Sequências de GUI e pequenas quantidades de texto podem ser formatadas em linha: Clique Arquivo

QGIS

→ Sair para fechar o QGIS. Isso indica que em plataformas Linux, Unix e Windows, você deve clicar primeiro no menu Arquivo, em seguida, Sair, enquanto nas plataformas Macintosh OS X, você deve clicar primeiro no menu QGIS e, em seguida Sair.

Grandes quantidades de texto podem ser formatados com uma lista:

• Faz isso

• Faz aquilo

• Faz outro ou um parágrafo:

Faz isso, isso e isso. Então faz isso, isso e isso e isso, isso e isso, e isso, isso e isso.

Faz aquilo. E faz aquilo e aquilo e aquilo, e aquilo e aquilo e aquilo, e aquilo e aquilo e aquilo, e aquilo e aquilo e aquilo, e aquilo e aquilo e aquilo.

.

Imagens que aparecem ao longo do guia do usuário foram criadas em diferentes plataformas, a plataforma é indicada pelo ícone específico da plataforma no final da legenda da figura.

6 Capítulo 2. Convenções

CAPÍTULO

3

Preâmbulo

.

Bem vindo ao mundo maravilhoso dos Sistemas de Informação Geográficas (SIG)!

QGIS é um Sistema de Informação Geográfica de Código Aberto. O projeto nasceu em maio de 2002 e foi criado como um projeto no SourceForge, em junho do mesmo ano. Nós trabalhamos duro para tornar o software SIG

(que é um software proprietário tradicionalmente caro) uma perspectiva viável para qualquer pessoa com acesso básico a um computador pessoal. QGIS atualmente funciona na maioria das plataformas Unix, Windows e OS

X. QGIS é desenvolvido usando o Qt toolkit ( http://qt.digia.com

) e C ++. Isso significa que QGIS é considerado amigável e tem uma interface gráfica (GUI) agradável e fácil de usar.

QGIS pretende ser um SIG de fácil utilização, fornecendo funções e feições comuns. O objetivo inicial do projeto era fornecer um visualizador de dados SIG. QGIS chegou ao ponto em sua evolução, onde ele está sendo usado por muitos para as suas necessidades de visualização de dados SIG diárias. QGIS suporta um grande número de formatos de dados raster e vetoriais, com o novo formato, suporta facilmente a sua adição de outros, usando a arquitetura de complementos.

QGIS é distribuído sob a GNU General Public License (GPL)/Licença Publica Geral. Desenvolvendo QGIS sob esta licença significa que você pode inspecionar e modificar o código-fonte, e garante que você, nosso feliz usuário, sempre terá acesso a um programa de SIG que é livre de custos e podem ser livremente modificado. Você deve ter recebido uma cópia completa da licença com a sua cópia do QGIS, e você também pode encontrá-la no Apêndice: ref: gpl_appendix.

Dica: Atualização da Documentação

A versão mais recente deste documento pode ser encontrada na área de documentação do QGIS website em http://www.qgis.org/en/docs/ .

7

QGIS User Guide, Versão 2.6

8 Capítulo 3. Preâmbulo

CAPÍTULO

4

Feições

QGIS oferece muitas funcionalidades SIG comuns fornecidas com funções núcleo e complementos. Um breve resumo de seis categorias gerais de funções e complementos é apresentado a seguir, seguido de primeiros insights sobre o console Python integrado.

4.1 Visualização de dados

Pode ver ou sobrepor dados vetoriais e matriciais em diferentes formatos e projeções sem conversão para um formato interno ou comum. Os formatos suportados incluídos são:

• Tabelas ativadas espacialmente e visualização usando PostGIS, SpatiaLite e MS SQL Spatial, Oracle Spatial, formatos vetoriais suportados pela biblioteca OGR instalada, incluindo arquivos de forma ESRI, Map-

Info, SDTS, GML e muitos mais. Consulte a seção

Trabalhando com Dados Vetoriais .

• Formatos de imagens e Raster suportados pela biblioteca GDAL instalada (Geospatial Data Abstraction

Library), como GeoTIFF, ERDAS IMG, ArcInfo ASCII GRID, JPEG, PNG e muitos mais. Consulte a seção

Trabalhando com Dados Raster .

• Dados vetoriais e raster GRASS para base de dados GRASS (location.mapset). Ver seção

Integração com

SIG GRASS .

• Servidores de dados espaciais online como Serviços Web OGC, incluem WMS, WMTS, WCS, WFS, e

WFS-T. Ver seção

Trabalhando com dados OGC

.

4.2 Exploração de dados e compositores de mapas

Você pode compor mapas e interativamente explorar dados espaciais com uma interface gráfica amigável. As muitas ferramentas úteis disponíveis na GUI incluem:

• Pesquisador QGIS

• Reprojeção On-the-fly

• Gerenciador BD

• Compositor de Mapas

• Painel de Vista Global

• Marcadores espaciais

• Ferramentas de anotação

• Identificar/selecionar feições

• Editar/ver/procurar atributos

• Rotulagem de feição Dado-definido

9

QGIS User Guide, Versão 2.6

• Ferramentas de simbologia raster e vetorial dado definido

• Compositor de Atlas com camada grade

• rótulos de Norte, barra de escala e copyright para o mapa

• Suporte para salvamento e restauração de projetos

4.3 Criar, editar, gerir e exportar dados

Você pode criar, editar, gerenciar e exportar camadas vetoriais e raster em vários formatos.

|gg| oferece a seguir:

• Ferramentas de digitalização para formatos suportados OGR e camadas vetoriais GRASS

• Habilitado para criar e editar camadas vetoriais shapefile e GRASS

• Complemento Georreferenciador para geocodificar imagens

• Ferramentas de GPS para importar e exportar formatos GPX, e converter outros formatos GPS para GPX ou baixar/carregar diretamente para uma unidade GPS (No Linux, usb: pode ser adicionado na lista de dispositivos GPS.)

• Suporte para visualização e edição de dados OpenStreetMap

• Habilitado para criar tabelas de base de dados espaciais a partir de shapefiles com complemento Gerenciador

BD

• Tratamento melhorado de tabelas de bases de dados espaciais

• Ferramentas para gerenciamento de tabelas de atributos vetoriais

• Opção para salvar as imagens como imagens georreferenciadas

4.4 Análise de dados

Você pode executar análise de dados espaciais em bancos de dados espaciais e outros formatos OGR suportados.

QGIS atualmente oferece análise vetorial, amostragem, geoprocessamento, geometria e ferramentas de gerenciamento de banco de dados. Você também pode usar as ferramentas do GRASS integradas, que incluem a funcionalidade GRASS completa de mais de 400 módulos. (Consulte a seção

Integração com SIG GRASS .) Ou, você

pode trabalhar com os Complementos de Processamento, que fornece um quadro de análise geoespacial poderoso para chamar algoritmos nativos e de terceiros a partir do QGIS, como GDAL, Saga, GRASS, fTools e muito mais.

(Consulte a seção

Introdução .)

4.5 Publicação de mapas na internet

QGIS pode ser usado como um cliente WMS, WMTS, WMS-C ou WFS and WFS-T, e um servidor WMS, WCS ou WFS. (Ver seção

Trabalhando com dados OGC .) Além disso, você pode publicar seus dados na Internet usando

um servidor web com UMN MapServer ou GeoServer instalada.

4.6 Funcionalidades do QGIS expandida através de complementos

QGIS pode ser adaptado às suas necessidades especiais, com a arquitetura de complemento extensível e bibliotecas que podem ser usadas para criar complementos. Você pode até mesmo criar novas aplicações com C++ ou Python!

10 Capítulo 4. Feições

QGIS User Guide, Versão 2.6

4.6.1 Complementos Core

Complementos incluídos no programa

1. Captura de Coordenadas (Captura coordenadas com o mouse em diferentes SRC’s)

2. Gerenciador BD (Troca, edição, e visualização de camadas e tabelas; execução de consultas SQL)

3. Diagrama Overlay (Coloque diagramas em camadas vetoriais)

4. Conversor Dxf2Shp (Converte arquivos DXF para shapefiles)

5. eVIS (Visualiza eventos)

6. fTools (Analiza e gerencia dados vetoriais)

7. GDALTools (Integração das Ferramentas GDAL no QGIS)

8. Georeferenciador GDAL (Adiciona a informação de projeção usando raster GDAL)

9. Ferramentas de GPS (Carrega e importa dados de GPS)

10. GRASS (Integra o SIG GRASS)

11. Mapa de calor (Gera uma mapa de calor raster a partir de dados de pontos)

12. Complemento Interpolação (Interpolação baseada em vértices de uma camada vetorial)

13. Edição Offline (Permitir a edição offline e sincronização com bancos de dados)

14. Oracle GeoRaster Espacial

15. Processamento (anteriormente chamado SEXTANTE)

16. Análise de terreno (Análise de terreno baseada em raster)

17. Caminho mais curto (Analisa uma rede com caminho mais curto)

18. Complemento de Consulta Espacial

19. SPIT (Importa shapefiles para PostgreSQL/PostGIS)

20. Complemento SQL Anywhere (Armazena camadas vetoriais dentro de base de dados SQL Anywhere)

21. Verificador de topologia (Encontra os erros topológicos em camadas vetoriais)

22. Complemento Estatística Zonal (Calcule contagem, soma e média de um raster para cada polígono de uma camada vetorial)

4.6.2 Complementos Externos Python

QGIS oferece um número crescente de complementoss externos Python que são fornecidos pela comunidade.

Esses complementos alocan-se no repositório oficial de complementos e podem ser facilmente instalados usando o instalador de complementos Python. Consulte a Seção

Diálogo de Complementos .

4.7 Console Python

Para scripts, é possível tirar proveito de um Terminal Python integrado, que pode ser aberto a partir do menu:

Complementos

→ Terminal Python. O terminal irá abrir como uma janela do utilitário não-modal. Para a interação com o ambiente QGIS, há a variável qgis.utils.iface, que é uma instância de QgsInterface. Esta interface permite o acesso ao mapa em tela, menus, barras de ferramentas e outras partes do aplicativo QGIS.

Para mais informações sobre como trabalhar com o console Python e programação de complementos e aplicativos

QGIS, por favor consulte http://www.qgis.org/html/en/docs/pyqgis_developer_cookbook/index.html

.

4.7. Console Python 11

QGIS User Guide, Versão 2.6

4.8 Problemas conhecidos

4.8.1 Limitação no número de arquivos abertos

Se você está abrindo um grande projeto QGIS e você tem certeza de que todas as camadas são válidas, mas algumas camadas são sinalizadas como ruim, você provavelmente irá se confrontar com esta questão. O Linux

(e outros sistemas operacionais, da mesma forma) tem um limite de arquivos abertos por processo. Limites de recursos por processo e hereditária. O comando ulimit, que é um shell integrado, muda os limites apenas para o processo de shell atual; o novo limite será herdado por quaisquer processos filhos.

Você pode ver todos os atuais limites de informações digitando [email protected]:~$ ulimit -aS

Você pode ver o número permitido atual de arquivos abertos por processos com o seguinte comando em um console [email protected]:~$ ulimit -Sn

Para alterar os limites para uma sessão existente, você pode ser capaz de usar algo como [email protected]:~$ ulimit -Sn #number_of_allowed_open_files [email protected]:~$ ulimit -Sn [email protected]:~$ qgis

Para fixar isso sempre

Na maioria dos sistemas Linux, limites de recursos são definidos no login pelo módulo pam_limits de acordo com as definições contidas no

/etc/security/limits.conf

ou

/etc/security/limits.d/*.conf. Você será capaz de editar os arquivos, se você tem privilégios de root (também via sudo), mas você vai precisar fazer login novamente para que as alterações tenham efeito.

.

Mais informações: http://www.cyberciti.biz/faq/linux-increase-the-maximum-number-of-open-files/ http://linuxaria.com/article/openfiles-in-linux?lang=en

12 Capítulo 4. Feições

CAPÍTULO

5

O que há de novo no QGIS 2.6

Esta versão contém novas características e se estende a interface de programação com respeito as versões anteriores. Se recomenda que utilize esta versão sobre as versões anteriores.

Esta versão inclui centenas de correções de erros e muitas novas características e melhoras que são descritas neste manual. Também pode revisar a lista de mudanças visuais em http://changelog.linfiniti.com/qgis/version/2.6.0/ .

5.1 Aplicação e opções de projeto

• Nome do arquivo de projeto em propriedades: Agora pode ver o caminho completo para o arquivo de projeto do QGIS no diálogo de propriedades do projeto.

5.2 Provedor de arquivos

• Melhoras nas ferramentas de Exportação DXF:

– Visão de árvore e a seleção de atributos para a camada assinada no diálogo

– apoio chegado a polígonos/HATCH

– representar textos como MTEXT em lugar de TEXT (incluindo a fonte, inclinação e peso)

– suporte as cores RGB quando não existe coincidência exata da cor

– utilizar AutoCAD 2000 DXF (R15) no lugar de R12

5.3 Compositor de impressão

• Atualizar extensão de tela do mapa a partir da extensão do desenho do mapa: Não articulado propriedades de um elemento de mapa na agora existe dois botões adicionais que lhe permite (1) estabelece a extensão da tela do mapa de acordo com a extensão de seu elemento e (2) a visão em visão do mapa, atualmente a extensão se estabelece em seu elemento Mapa.

• Múltiplo suporte de rede: Agora é possível ter mais de uma quadrícula de seu elemento de mapa. Cada rede é totalmente personalizável e pode-se assinalar um SRC diferente. Isto significa, por exemplo, agora pode-se ter um desenho de mapa com quadrícula tanto geográfica como projetada.

• Exportação seletiva: Para todos os elementos de seu desenho de impressão do mapa, baixa Opções de representação, pode excluir estes objetos de exportação do mapa.

13

QGIS User Guide, Versão 2.6

5.4 Servidor QGIS

5.5 Simbologia

.

5.6 Interface de usuário

14 Capítulo 5. O que há de novo no QGIS 2.6

CAPÍTULO

6

Iniciando

Este capítulo da uma visão geral rápida sobre a instalação do QGIS, alguns dados de exemplo na web sobre o

QGIS e rodar uma primeira seção simples visualizando camadas raster e vetoriais.

6.1 Instalação

A instalação do QGIS é muito simples. Estão disponíveis pacotes de instalação padrão para MS Windows e Mac

OS X. Se proporcionam pacotes binários (rpm e deb) ou repositórios de software para adquirir o seu gerenciador de instalação de pacotes para diversos servidores de GNU/Linux. Consiga as últimas informações sobre pacotes binários na página do QGIS na internet em http://download.qgis.org

.

6.1.1 Instalação à partir da fonte

Se necessitar compilar o QGIS a partir da fonte, por favor consulte as instruções de instalação. São distribuídas com o código fonte do QGIS em um arquivo chamado INSTALL. Tambem pode encontrar em linha de comando em http://htmlpreview.github.io/?https://raw.github.com/qgis/QGIS/master/doc/INSTALL.html

6.1.2 Instalação no dispositivo de armazenamento externo

QGIS te permite definir uma opção --configpath que sobrepõe uma rota pré-determinada pela configuração do usuário (ex.: ~/.qgis2 bajo Linux) e também força uma QSettings ao usar esse diretório. Ele te permite, por exemplo, levar uma instalação do QGIS em uma memória flash junto com todos os complementos e a configuração.

Veja a seção

Menu Sistema

para informações adicionais.

6.2 Amostra de Dados

O guia de utilizador contém exemplos baseados no conjunto de amostra de dados do QGIS.

O instalador do Windows tem uma opção para baixar o conjunto de dados de amostra do QGIS. Ao marcar a opção, os dados serão baixados em sua pasta Meus Documentos e ficarão locados em uma pasta chamada GIS

Database

. Pode-se usar o Windows Explorador para mover esta pasta para um local adequado. Se não marcar a caixa de seleção para instalação do conjunto de dados de amostra durante a instalação inicial do QGIS, pode optar por uma das seguintes:

• Usar dados SIG que já possuo

• Baixar dados de amostra de http://download.osgeo.org/qgis/data/qgis_sample_data.zip

• Desinstalar QGIS e reinstalar com a opção baixar dados marcada (só recomendado de as soluções anteriores não funcionarem)

15

QGIS User Guide, Versão 2.6

Para GNU/Linux e Mac OS X, ainda não existe disponível pacotes de instalação de dados no formato rpm, deb ou dmg. Para usar o conjunto de dados de amostra, baixe o arquivo qgis_sample_data como um arquivo

ZIP de http://download.osgeo.org/qgis/data/qgis_sample_data.zip

e descompacte os arquivos no seu sistema.

O banco de dados Alaska inclue todos dados SIG que voce usará nos exemplos e verá nas imagens do manual do usuário; também inclui uma pequena base de dados do GRASS. A projeção usada nos dados de exemplo do QGIS

é Alaska Albers Equal Área em unidade pés. O código EPSG é 2964.

PROJCS[ "Albers Equal Area" ,

GEOGCS[ "NAD27" ,

DATUM[ "North_American_Datum_1927" ,

SPHEROID[ "Clarke 1866" , 6378206.4

, 294.978698213898

,

AUTHORITY[ "EPSG" , "7008" ]],

TOWGS84[ 3 , 142 , 183 , 0 , 0 , 0 , 0 ],

AUTHORITY[ "EPSG" , "6267" ]],

PRIMEM[ "Greenwich" , 0 ,

AUTHORITY[ "EPSG" , "8901" ]],

UNIT[ "degree" , 0.0174532925199433

,

AUTHORITY[ "EPSG" , "9108" ]],

AUTHORITY[ "EPSG" , "4267" ]],

PROJECTION[ "Albers_Conic_Equal_Area" ],

PARAMETER[ "standard_parallel_1" , 55 ],

PARAMETER[ "standard_parallel_2" , 65 ],

PARAMETER[ "latitude_of_center" , 50 ],

PARAMETER[ "longitude_of_center" , 154 ],

PARAMETER[ "false_easting" , 0 ],

PARAMETER[ "false_northing" , 0 ],

UNIT[ "us_survey_feet" , 0.3048006096012192

]]

Se você pretende usar o QGIS como um visualizador gráfico para o GRASS, você pode encontrar uma seleção de localizações de amostra (ex.:, Spearfish or South Dakota) no site oficial do SIG GRASS, http://grass.osgeo.org/download/sample-data/ .

6.3 Sessão Amostra

Agora que você tem o QGIS instalado e um conjunto de dados de amostra disponível, nós gostaríamos de demostrar uma corta e simples seção no QGIS.

Usaremos a camada raster qgis_sample_data/raster/landcover.img

, e o camada vetor lakes , qgis_sample_data/gml/lakes.gml

.

6.3.1 Iniciar o QGIS

• Iniciar QGIS teclando “QGIS” um uma linha de comando prompt, ou usando-se um binário précombinado, usando o menu de Aplicativos.

• Inicie o QGIS usando o menu Iniciar ou o atalho do ambiente de trabalho, ou de duplo clique no arquivo de projeto QGIS.

• de duplo clique no ícone na sua pasta de Aplicações.

6.3.2 Carregue camadas vetoriais ou raster a partir do conjunto de amostras de dados

1. Clique no ícone

Carregar Raster

2. Navegue até a pasta qgis_sample_data/raster/

, selecione o arquivo ERDAS IMG landcover.img

e clique [Abrir].

16 Capítulo 6. Iniciando

QGIS User Guide, Versão 2.6

3. Se o arquivo não estiver na lista, verifique se está listado Tipo de arquivos na parte inferior da caixa de diálogo e encontra-se no tipo correto, neste caso “Erdas Imagine Images (*.img, *.IMG)”.

4. Agora clique no ícone

Carregar Vetor

5.

Arquivo deveria estar selecionado como Tipo de origem na nova janela Adicionar camada vetorial.

Agora clique [Navegar] para selecionar a camada vetorial.

6. Navegue na pasta qgis_sample_data/gml/, selecione ‘Geography Markup Language [GML] [OGR]

(.gml,.GML)’ da lista Tipo de arquivos , a continuação selecione o arquivo GML lakes.gml e cique [Abrir]. No diálogo Adicionar camada vetorial, clique [Abrir]. O diálogo Seletor do Sistema de

Referência de Coordenadas se abrirá com NAD27 / Alaska Alberts selecionado, clicando [Aceitar].

7. Amplie um pouco até à sua área favorita com alguns lagos.

8. De duplo clique na camada lakes da legenda do mapa para abrir o diálogo Propriedades

9. Clique na janela Estilo e selecione um preenchimento de cor azul.

10. Clique na janela Etiquetas e marque a caixa de seleção Etiquetar esta camada com para habilitar o etiqueta. Selecione o campo “NOMES” com o campo que contêm as etiquetas.

11. Para melhoras a leitura das etiquetas, pode adicionar um buffer branco ao redor dando um clique no “Buffer” na lista da esquerda, marcando

Desenhar buffer no texto e escolhendo 3 como tamanho do buffer

12. Clique [Aplicar]. Confira se o resultado ficou bom e clique finalizar [OK].

Pode ver como é fácil visualizar camadas raster e vetoriais no QGIS. Vamos até a seção seguinte para aprender mais sobre as funções, características e configurações disponíveis e como usar-las.

6.4 Iniciar e Parar QGIS

Na seção

Sessão Amostra

você aprenderá como iniciar o QGIS. Repetiremos isto e verá que o QGIS também proporciona outras opções de linha de comandos.

• Assumindo que o QGIS está instalado no PATH, inicie QGIS teclando qgis no console ao dando duplo clique no link do aplicativo QGIS (ou atalho) no desktop ou no menu do aplicativo.

• Inicie o QGIS usando o menu Iniciar ou o atalho do ambiente de trabalho, ou de duplo clique no arquivo de projeto QGIS.

• Duplo clique no ícone na sua pasta Aplicações.

Se necessita iniciar QGIS na shell, execute

/path-to-installation-executable/Contents/MacOS/Qgis

.

Para finalizar o QGIS, clique na opção do menu Arquivo QGIS

→ Sair, ou use o atalho Ctrl+Q.

6.5 Opções da Linha de Comandos

QGIS suportam um número de opções quando iniciam pelas linhas de comando. Para obter uma lista das opções, introduza qgis --help na linha de comando. A sentença de uso para o QGIS é: qgis --help

QGIS - 2.6.0-Brighton ’Brighton’ (exported)

QGIS is a user friendly Open Source Geographic Information System.

Usage: /usr/bin/qgis.bin [OPTION] [FILE]

OPTION:

[--snapshot filename] emit snapshot of loaded datasets to given file

[--width width] width of snapshot to emit

[--height height]

[--lang language] height of snapshot to emit use language for interface text

6.4. Iniciar e Parar QGIS 17

QGIS User Guide, Versão 2.6

[--project projectfile] load the given QGIS project

[--extent xmin,ymin,xmax,ymax] set initial map extent

[--nologo] hide splash screen

[--noplugins] don’t restore plugins on startup

[--nocustomization] don’t apply GUI customization

[--customizationfile] use the given ini file as GUI customization

[--optionspath path]

[--configpath path]

[--code path]

[--defaultui]

[--help] use the given QSettings path use the given path for all user configuration run the given python file on load start by resetting user ui settings to default this text

FILE:

Files specified on the command line can include rasters, vectors, and QGIS project files (.qgs):

1. Rasters - supported formats include GeoTiff, DEM and others supported by GDAL

2. Vectors - supported formats include ESRI Shapefiles and others supported by OGR and PostgreSQL layers using the PostGIS extension

Dica: Exemplo do Uso dos argumentos da linha de comandos

Inicie o QGIS para especificar um ou mais arquivos de dados na linha de comando. Por exemplo, assumindo ser o diretório qgis_sample_data, voce inicia QGIS com uma camada de arquivo vetorial e uma raster estabelecidos para que se carregue no inicio, usando-se os seguintes comandos: qgis ./raster/landcover.img

./gml/lakes.gml

Opção da linha de comandos --snapshot

Esta opção permite que possa criar uma captura de ecrã no formato PNG da visão atual. Isto vem a calhar quando tem vários projetos e quer gerar capturas de tela dos seus dados.

Currently, it generates a PNG file with 800x600 pixels. This can be adjusted using the --width and --height command line arguments. A filename can be added after --snapshot.

Opção da linha de comandos --lang

Based on your locale, QGIS selects the correct localization.

If you would like to change your language, you can specify a language code. For example, --lang=it starts QGIS in italian localization. A list of currently supported languages with language code and status is provided at http://hub.qgis.org/wiki/quantumgis/GUI_Translation_Progress .

Opção da linha de comandos --projeto

Iniciar o QGIS com um arquivo de projeto existente também é possível. Só adicione na linha de comando a opção --project seguido do nome de seu projeto e QGIS irá abrir com todas as camadas carregadas no arquivo indicado.

Opção da linha de comandos --extent

Use esta opção para iniciar com uma extensão de mapa específica. Necessita adicionar uma quadro delimitador da sua extensão na seguinte ordem, seguido por uma vírgula:

--extent xmin,ymin,xmax,ymax

Opção da linha de comandos --nologo

Este argumento de linha de comando oculta a tela inicial quando você iniciar o QGIS.

Opção da linha de comandos --noplugins

Se você tiver problemas ao iniciar os complementos, poderá evitar iniciar-los com essa opção. Estarão sendo disponíveis depois no gerenciador de complementos.

Opção de linha de comando --customizationfile

18 Capítulo 6. Iniciando

QGIS User Guide, Versão 2.6

Usando este argumento de linha de comando, você pode definir um arquivo GUI personalizado, que será aplicado ao iniciar.

Opção da linha de comandos --nocustomization

Usando este argumento de linha de comando, um arquivo GUI personalizado existente, não será aplicado ao iniciar.

Opção da linha de comandos --optionspath

Pode ter várias configurações e decidir qual utilizar ao iniciar QGIS com esta opção. Verá-se

Opções

para confirmar onde armazenar os arquivos de configuração o sistema operacional. Atualmente, não existe forma de especificar um arquivo para escrever a configuração; portanto pode criar uma cópia do arquivo de configuração original e trocar o nome. A opção específica de caminho ao diritório com os ajustes. Por exemplo, para utilizar o arquivo de configuração /path/to/config/QGIS/QGIS2.ini , use a opção.

--optionspath /path/to/config/

Opção da linha de comandos --configpath

Esta opção é similar a anterior, mas no entanto, anula o caminho predeterminado pela configuração do usuário

(~/.qgis2) e força QSettings para também usar esse diretório. Isto permite aos usuários, por exemplo, carregar uma instalação QGIS na unidade flash, junto com todos os complementos e configurações.

Opção de linha de comandos --código

Esta opção pode ser utilizada para executar um arquivo python dado diretamente depois que QGIS foi iniciado.

Por exemplo, quando se tem um arquivo python chamado load_alaska.py com o seguinte conteúdo:

from qgis.utils

import

iface raster_file = "/home/gisadmin/Documents/qgis_sample_data/raster/landcover.img" layer_name = "Alaska" iface .

addRasterLayer(raster_file, layer_name)

Supondo que esta no diretório onde o arquivo load_alaska.py se encontra, pode iniciar QGIS, cargue o arquivo raster landcover.img e de uma camada de nome ‘Alaska’ utilizando o seguinte comando: qgis

--code load_alaska.py

6.6 Projetos

O estado de sua seção QGIS é considerado um projeto. QGIS trabalha em um projeto por vez. Configurações são consideradas por projeto, ou como padrão pré-determinado para novos projetos (ver seção

Opções ). QGIS pode

salvar o estado de sua área de trabalho dentro do arquivo do projeto, usando a opção do menu Projeto →

Salvar ou Projeto →

Salvar como...

.

Carregue o projeto salvo em uma seção QGIS usando Projeto → modelo ou Projeto → Abrir projeto recente →.

Abrir...

, Projeto → Novo a partir de um

Se você deseja cancelar sua seção e iniciar outra escolha Projeto → Novo . Ou das opções do menu será solicitado que você salve o projeto existente se houve mudanças desde a última vez que ele foi aberto ou salvo.

O tipo de informação salva num arquivo de projeto inclui:

• Camadas adicionadas

• Propriedades da Camada, incluindo a simbolização

• Projeção para a vista do mapa

• Última extensão visualizada

6.6. Projetos 19

QGIS User Guide, Versão 2.6

O arquivo do projeto é salvo em formato XML, assim é possível editar o arquivo em outras versões do QGIS se conhecer o que está fazendo. O formato do arquivo tem sido atualizado constantemente comparado com as versões anteriores do QGIS. Os arquivos de projeto de versões antigas do QGIS não podem funcionar corretamente. Para fazer isto, na janela Geral aba Configurações → Opções você pode selecionar:

• Avisar para salvar o projeto e alterações de fontes de dados quando necessário

• Avisar quando abrir um projeto salvo com uma versão antiga do |qg|

Sempre que salvar um projeto no QGIS 2.2 irá criar uma cópia de segurança do projeto.

6.7 Arquivo de Saída

.

Existem muitas maneiras de gerar uma saída para seção QGIS. Já discutimos isso na seção

Projetos , salvando

como um arquivo de projeto. Aqui apresentamos outras formas de produzir arquivos de saída.

• A opção do menu Projecto →

Salvar como Imagem abre um diálogo de arquivo onde pode selecionar nome, caminho e tipo de imagem (formato PNG ou JPG). Um arquivo world file com a extensão PNGW ou JPGW

é salvo na mesma pasta georeferenciando a imagem.

• Opção do menu Projeto → Exportar DXF ... abrirá a janela onde deve definir o ‘Modo da simbologia’, a

‘Escala da simbologia’ e a camada vetorial que irá exportar para DXF.

• Na opção de menu Projeto →

Novo compositor de impressão abrirá a janela onde pode criar ou imprimir o mapa atual (ver seção

Compositor de Impressão

).

20 Capítulo 6. Iniciando

CAPÍTULO

7

QGIS GUI

Quando QGIS começa, você será apresentado a interface gráfica, como mostrado nas figuras (os números de 1 a 5 em círculos amarelos são discutidas abaixo).

Figura 7.1: GUI do QGIS com dados amostra do Alaska

Nota: Suas decorações de janela (barra de título, etc) podem parecer diferentes dependendo do seu sistema operacional e gerenciador de janelas.

O GUI do QGIS é dividido em cinco áreas:

1. Barra de Menu

2. Barra de Ferramentas

3. Legenda do Mapa

4. Visualização do mapa

5. Barra de Status

Estes cinco componentes da interface do QGIS são descritos em mais detalhe nas seguintes seções. Mais duas seções apresentam atalhos de teclado e ajuda do contexto.

21

QGIS User Guide, Versão 2.6

7.1 Barra de Menu

A barra de menu fornece acesso a diversas feições QGIS usando um menu hierárquico padrão. Os menus de nível superior e um resumo de algumas das opções do menu estão listados abaixo, juntamente com os ícones associados como eles aparecem na barra de ferramentas e atalhos de teclado. Os atalhos apresentados nesta seção são os padrões; no entanto, os atalhos de teclado também podem ser configurados manualmente usando o :guilabel: janela Configurar atalhos, aberto a partir de :menuselection: ‘ Configurações –> Configurar Atalhos...

‘ .

Embora a maioria das opções de menu tem uma ferramenta correspondente e vice-versa, os menus não são organizados exatamente como as barras de ferramentas. A barra de ferramentas que contém as ferramentas que estão listadas depois de cada opção habilitada no menu de entrada. Algumas opções de menu aparecem somente se o complemento correspondente for carregado. Para mais informações sobre as ferramentas e barras de ferramentas, consulte a seção :ref: label_toolbars.

7.1.1 Projeto

Opção de menu

Novo

Abrir

Novo a partir do modelo

Abrir Recente

Salvar

Salvar Como...

Salvar como Imagem...

Exportar DXF ...

Atalho

Ctrl+N

Ctrl+O

Ctrl+S

Ctrl+Shift+S

Novo compositor de impressão

Ctrl+P

Gerenciador de compositores ...

Imprimir Compositores

Sair do QGIS

Ctrl+Q

Referência ver

Projetos

ver

Projetos

ver

Projetos

ver

Projetos

ver

Projetos

ver ver

Arquivo de Saída

ver

Arquivo de Saída

ver

Projetos

Compositor de Impressão

Barra de Ferramentas

Projeto

Projeto

Projeto

Projeto

Projeto

Projeto ver

Compositor de Impressão

Projeto ver

Compositor de Impressão

22 Capítulo 7. QGIS GUI

QGIS User Guide, Versão 2.6

7.1. Barra de Menu 23

QGIS User Guide, Versão 2.6

7.1.2 Editar

Opção de menu

Desfazer

Refazer

Recortar Feições

Copiar feições

Colar feições

Colar feição como

Adicionar feição

Mover Elemento(s)

Excluir Selecionado(s)

Rodar Elemento(s)

Simplificar feições

Adicionar Anel

Adicionar Parte

Preenchimento Anel

Excluir Anel

Excluir Parte

Remodelar feições

Curva de deslocamento

Quebras Feições

Partes Split

Juntar Elementos Selecionados

Juntar Atributos dos Elementos

Ferramenta de nós

Rotacionar pontos com simbolos

Atalho

Ctrl+Z

Ctrl+X

Ctrl+C

Ctrl+V

Ctrl+.

Referência ver

Ctrl+Shift+Z

Digitalização Avançada

Digitalização Avançada

Barra de

Ferramentas

Digitalização

Avançada

Digitalização

Avançada

Digitalização ver

Digitalizar uma camada existente

ver

Digitalizar uma camada existente

ver

Digitalizar uma camada existente

Veja

Trabalhando com a Tabela de Atributos

ver

Digitalizar uma camada existente

ver

Digitalizar uma camada existente

ver

Digitalizar uma camada existente

ver

Digitalização Avançada

Digitalização

Digitalização

Digitalização

Digitalização

Digitalização

Digitalização

Avançada ver ver ver ver

Digitalização Avançada

Digitalização Avançada

Digitalização Avançada

Digitalização Avançada

Digitalização

Avançada

Digitalização

Avançada

Digitalização

Avançada

Digitalização

Avançada ver

Digitalização Avançada

Digitalização

Avançada ver ver ver ver ver ver

Digitalização Avançada

Digitalização Avançada

Digitalização Avançada

Digitalização Avançada

Digitalização Avançada

Digitalização Avançada

Digitalização

Avançada

Digitalização

Avançada

Digitalização

Avançada

Digitalização

Avançada

Digitalização

Avançada

Digitalização

Avançada ver

Digitalização Avançada

Digitalização

Avançada

Digitalização ver

Digitalizar uma camada existente

ver

Digitalização Avançada

Digitalização

Avançada

QGIS User Guide, Versão 2.6

Após ativar o

Modo de edição para uma camada, irá encontrar o ícone Adicionar Elemento no menu Editar dependendo do tipo de camada (ponto, linha ou polígono).

7.1.3 Editar (extra)

Opção de menu

Adicionar feição

Adicionar feição

Adicionar feição

Atalho Referência Barra de Ferramentas ver

Digitalizar uma camada existente

Digitalização ver

Digitalizar uma camada existente

Digitalização ver

Digitalizar uma camada existente

Digitalização

7.1.4 Ver

Opção de menu Atalho Referência

Panorâmica no Mapa

Mover mapa para seleção

Aproximar

Afastar

Selecionar

Ctrl++

Ctrl+-

Ctrl+Shift+I ver

Medição

Ctrl+Shift+F ver

Selecionar e desselecionar feições

Identificar feições

Medir

Ver tudo

Aproximar à camada

Aproximar à seleção

Última visualização

Próxima visualização

Aproximar à Resolução

Natural

Decorações

Dicas do Mapa

Novo Favorito...

Mostrar Favoritos

Atualizar

Ctrl+J

Ctrl+B ver

Favoritos Espaciais

Ctrl+Shift+B ver

Favoritos Espaciais

Ctrl+R ver decorações

Barra de

Ferramentas

Navegação no Mapa

Navegação no Mapa

Navegação no Mapa

Navegação no Mapa

Atributos

Atributos

Atributos

Navegação no Mapa

Navegação no Mapa

Navegação no Mapa

Navegação no Mapa

Navegação no Mapa

Navegação no Mapa

Atributos

Atributos

Atributos

Navegação no Mapa

7.1.5 Camada

Opção de menu

Novo

Incorporar camadas e grupos...

Adicionar Camada Vetorial

Adicionar camada raster

Atalho Referência veja

Criando novas camadas Vetoriais

ver

Projetos animados

Barra de Ferramentas

Gerenciar camadas

Ctrl+Shift+V ver

Trabalhando com Dados Vetoriais

Gerenciar camadas

Ctrl+Shift+R ver

Carregando dados raster no QGIS

Gerenciar camadas

Continuação na próxima página

7.1. Barra de Menu 25

QGIS User Guide, Versão 2.6

Opção de menu

Adicionar Camada PostGIS

Adicionar camada SpatiaLite

Adicionar Camada Espacial MSSQL

Adicionar camada Oracle GeoRaster

Adicionar camada SQL Anywhere

Adicionar Camada WMS/WMTS

Adicionar Camada WCS

Adicionar camada WFS

Adicionar Camada de Texto Delimitado

Copiar estilo

Colar estilo

Abrir tabela de Atributos

Opções de Ressalto

Salvar edições da camada

Edições Atuais

Salvar como...

Salvar arquivo vetor como...

Remover Camada(s)

Camada (s) Duplicada

Definir SRC da(s) Camada(s)

Definir o SRC do projeto a partir da camada

Propriedades...

Pesquisa...

Tabela 7.1 – continuação da página anterior

Atalho Referência

Ctrl+Shift+D ver

Camadas PostGIS

Ctrl+Shift+L ver

Camadas SpatiaLite

Ctrl+Shift+M veja

Camadas Espaciais MSSQL

Barra de Ferramentas

Gerenciar camadas

Gerenciar camadas

Gerenciar camadas ver

Complemento GeoRaster Espacial Oracle

Gerenciar camadas ver

Complemento SQL Anywhere

Ctrl+Shift+W ver

Cliente WMS/WMTS

Gerenciar camadas

Gerenciar camadas veja veja

WCS Cliente

WFS e WFS-T Cliente

ver

Arquivos de texto delimitado

veja

Menu Estilo

veja

Menu Estilo

Gerenciar camadas

Gerenciar camadas

Gerenciar camadas

Ctrl+D

Ctrl+Shift+C

Veja

Trabalhando com a Tabela de Atributos

Atributos ver

Digitalizar uma camada existente

ver

Digitalizar uma camada existente

ver

Digitalizar uma camada existente

ver

Trabalhando com a Tabela de Atributos

Digitalização

Digitalização

Digitalização

Rotular

Adicionar para a Visão Geral

Adicionar tudo para a Visão Geral

Remover tudo da Visão Geral

Mostrar todas as camadas

Ocultar todas as camadas

Ctrl+Shift+O

Ctrl+Shift+U

Ctrl+Shift+H

Gerenciar camadas

Gerenciar camadas

Gerenciar camadas

26 Capítulo 7. QGIS GUI

QGIS User Guide, Versão 2.6

7.1.6 Configurações

Opção de menu Atalho Referência

Painéis

Barra de Ferramentas

Mudar para o modo de tela inteira

Propriedades do

Projeto ...

SRC Personalizado...

F 11 veja veja

Painéis e Barras de Ferramentas

Painéis e Barras de Ferramentas

Ctrl+Shift+P

Projetos

ver

Sistema de Referência de Coordenadas personalizado

ver

Apresentação

Gerenciador de estilos...

Configurar atalhos...

Personalização ...

Opções ...

Opções de ajuste ...

ver ver

Personalização

Opções

Barra de

Ferramentas

7.1.7 Complementos

Opção de menu Atalho Referência

Gerenciar e Instalar Complementos

Terminal Python ver

Diálogo de Complementos

O começo do QGIS pela primeira vez não carrega todos os somplementos core.

Barra de Ferramentas

7.1.8 Vetor

Opção de menu Atalho Referência

Open Street Map

→ veja

Carregando vetores

OpenStreetMap

ver

Complemento fTools

Ferramenta de Análise

Ferramenta de pesquisa

Ferramenta de Geoprocessamento

Ferramenta de Geometria

→ ver

Complemento fTools

ver

Complemento fTools

ver

Complemento fTools

Ferramenta de Gerenciamento de

Dados

→ ver

Complemento fTools

O começo do QGIS pela primeira vez não carrega todos os somplementos core.

7.1.9 Raster

Opção de menu

Calculadora raster ...

Atalho Referência ver

Calculadora Raster

Barra de Ferramentas

O começo do QGIS pela primeira vez não carrega todos os somplementos core.

Barra de

Ferramentas

7.1. Barra de Menu 27

QGIS User Guide, Versão 2.6

7.1.10 Processamento

Opção de menu Atalho Referência

Caixa de

Ferramentas

Modelador Gráfico veja

A caixa de ferramentas

veja

O modelador gráfico

Historia e log

Opções e configurações

Visualizador de resultados veja

Gerenciador do histórico

veja

Configurando a infraestrutura do processamento

veja

Configurando as aplicações externas

Comandos

Ctrl+Alt+M veja

O QGIS Comando

O começo do QGIS pela primeira vez não carrega todos os somplementos core.

Barra de

Ferramentas

7.1.11 Ajuda

Opção de menu

Conteúdo da Ajuda

O que é isto?

Documentação API

Precisa de suporte comercial?

Página do QGIS

Verificar a versão do QGIS

Sobre

Patrocinadores

Atalho

F1

Shift+F1

Ctrl+H

Referência Barra de Ferramentas

Ajuda

Ajuda

Por favor, note que para Linux , os itens do menu de barras listados acima são os padrões da janela gerenciadora do KDE. No GNOME, o menu Configurações tem um conteúdo diferente e seus itens têm de ser encontradas aqui:

Propriedades do Projeto

Opções

Configurar Atalhos

Gerenciar estilo

Projeto

Editar

Editar

Editar

SRC personalizado

Painéis

Barra de Ferramentas

Editar

Exibir

Exibir

Mudar para o Modo de Tela Inteira Exibir

Escala deslizante

Live GPS tracking

Exibir

Exibir

7.2 Barra de Ferramentas

A barra de ferramentas permite o acesso à maioria das mesmas funções dos menus, além de ferramentas adicionais para interagir com o mapa. Cada item da barra de ferramentas pop-up tem ajuda disponível. Mantenha o mouse sobre o item e uma breve descrição a respeito da ferramenta será exibida.

28 Capítulo 7. QGIS GUI

QGIS User Guide, Versão 2.6

Cada menu pode ser movido de acordo com suas necessidades. Além disso cada menu pode ser desligado com o botão direito do mouse sobre o menu de contexto, segurando o botão do mouse sobre a barra de ferramentas. (leia também

Painéis e Barras de Ferramentas ).

Dica: Restaurar barra de ferramentas

Se você tiver acidentalmente escondido todas as barras de ferramentas, você pode recuperá-las, escolhendo a opção do menu Exibir → Barras de ferramentas →.

Se uma barra de ferramentas desaparece no Windows, o que parece ser um problema no QGIS de vez em quando, você deve remover a chave

\HKEY_CURRENT_USER\Software\QGIS\qgis\UI\state no registro. Quando você reiniciar o QGIS, a chave estará escrita novamente com o estado padrão, e todas as barras serão visíveis novamente.

7.3 Legenda do Mapa

A área da legenda do mapa registra todas as camadas do projeto. A caixa de verificação de cada entrada da legenda pode ser utilizada para mostrar ou ocultar a camada. A barra de ferramentas da legenda na legenda do mapa esta lista permite Adicionar grupo, Gerenciamento de visibilidade da camada de todas as camadas ou gerenciamento de combinação de camadas pré-definidas, Filtrar legenda pelo conteúdo do mapa, Expandir tudo** ou

Comprimir tudo e Eliminar grupo ou camada. O botão lhe permite adicionar vista Preestabelecidos na legenda. Isto significa que pode eleger se mostra alguma camada com organização específica e adiciona esta vista a lista de Preestabelecidos. Para adicionar uma vista preestabelecida simplesmente de um clique em eleja Adicionar preestabelecido... do menu em cascata e de um nome ao preestabelecido. Depois verá uma lista

, com todos os preestabelecidos que pode chamar precionando o botão .

Todos os preestabelecidos adicionados estarão presentes no desenho de impressão afim de permitir a criação de um desenho de mapa de mapa com base em seus pontos de visão específicos (ver

Propriedades principais ).

Uma camada pode ser selecionada e arrastada para cima ou para baixo na legenda para mudar a Z-ordenação. Zordenação significa que as camadas listadas mais perto do topo da legenda são desenhadas sobre camadas listadas mais abaixo na legenda.

Nota: Este comportamento pode ser substituído pelo painel ‘Ordem das Camadas’.

Camadas na janela legenda podem ser organizadas em grupos. Há duas maneiras de fazer isso:

1. Precione o ícone para adicionar um novo grupo. Escreva um nome para o grupo e precione Enter.

Agora de um clique na camada existente e arraste-a para o grupo.

2. Selecione algumas camadas, clique direito na janela de legenda e escolha Grupo selecionado. As camadas selecionadas serão automaticamente colocadas em um novo grupo.

Para trazer uma camada de um grupo, você pode arrastá-la de fora, ou clique direito sobre ela e escolha Faça o item toplevel . Os grupos também podem ser aninhados dentro de outros grupos.

A caixa de seleção de um grupo vai mostrar ou ocultar todas as camadas do grupo com apenas um clique.

O conteúdo do menu de contexto do botão direito do mouse depende se o item de legenda selecionado é uma camada raster ou vetorial. Para camadas GRASS vetor, :sup: Alternar edição não está disponível. Consulte a seção

Digitalizando e editando uma camada vetorial GRASS

para obter informações sobre a edição de camadas vetoriais GRASS.

Menu botão direito do mouse para camadas raster

• Aproximar à extensão da camada

• Adicionar ao enquadramento

• Ampliar à Melhor Escala (100%)

• Esticar Usando o Enquadramento Atual

7.3. Legenda do Mapa 29

QGIS User Guide, Versão 2.6

• Remover

• Duplicar

• Estabelecer escala de visibilidade da camada

• Definir SRC da Camada

• Definir SRC do projeto a partir da Camada

• Salvar como ...

• Salvar como Estilo de definição de camada

• Propriedades...

• Renomear

• Copiar Estilo

Adicionalmente, de acordo com a posição da camada e seleção

• Faça Item de Topo

• Agrupar Selecionados

Menu botão direito do mouse para camadas vetor

• Aproximar à Extensão da Camada

• Adicionar ao Enquadramento

• Remover

• Duplicar

• Estabelecer escala de visibilidade da camada

• Definir SRC da Camada

• Definir SRC do projeto a partir da Camada

• Abrir Tabela de Atributos

• Alternar Edição (não está disponível para camadas GRASS)

• Salvar Como ...

• Salvar como Estilo de definição de camada

• Filtrar

• Exibir Contagem de Elementos

• Propriedades...

• Renomear

• Copiar Estilo

Adicionalmente, de acordo com a posição da camada e seleção

• Faça Item de Topo

• Agrupar Selecionados

Menu botão direito do mouse para grupo de camadas

• Ampliação ao Grupo

• Remover

• Definir SRC do Grupo

• Renomear

• Adicionar grupo

30 Capítulo 7. QGIS GUI

QGIS User Guide, Versão 2.6

É possível selecionar mais de uma camada ou grupo ao mesmo tempo segurando a tecla Ctrl enquanto seleciona as camadas com o botão esquerdo do mouse. Pode mover todas as camadas selecionadas para um novo grupo ao mesmo tempo.

Você também é capaz de excluir mais de uma camada ou um grupo de uma só vez, selecionando várias camadas com Ctrl e pressianando Ctrl+D depois. Desta forma, todas as camadas ou grupos selecionados serão removidos da lista de camadas.

7.3.1 Trabalhando com a Ordem da legenda de camada independente

Há um painel que permite que você defina uma ordem de desenho independente para a legenda do mapa. Você pode ativar ele no menu Exibir → Painéis → Ordem da camada. Esta funcionalidade permite-lhe, por exemplo, ordenar suas camadas em ordem de importância, mas ainda exibi-las na ordem correta (ver

figura_layer_order ).

Checando a caixa Controle da ordem de renderização por baixo da lista de camadas irá causar um voltar ao comportamento padrão.

Figura 7.2: Definir a ordem da legenda de camada independente

7.4 Visualização do mapa

Este é o ‘’fim do negócio” do QGIS — mapas são exibidos nesta área! O mapa exibido nesta janela dependerá das camadas vetoriais e raster que você escolheu para carregar (ver seções a seguir para obter mais informações sobre como carregar camadas). A vista do mapa pode ser deslocada, mudando o foco da exibição do mapa para outra região e zoom in e out. Várias outras operações podem ser realizadas sobre o mapa, tal como descrito na descrição acima da barra de ferramentas. A vista do mapa e a legenda estão fortemente ligados uns aos outros — os mapas em vista refletem as alterações feitas na área de legenda.

Dica: Ampliando o mapa com a roda do mouse

Você pode usar a roda do mouse para zoom in e out no mapa. Coloque o cursor do mouse dentro da área do mapa e gire a roda para a frente (longe de você) para ampliar e para trás (para você) para diminuir o zoom. A posição do cursor do mouse é o centro onde o zoom ocorre. Você pode personalizar o comportamento do zoom roda do mouse usando o :guilabel: aba Ferramentas do mapa sob o menu Configurações → Opções.

7.4. Visualização do mapa 31

QGIS User Guide, Versão 2.6

Dica: Percorrendo o mapa com as setas e a barra de espaço

Você pode usar as setas do teclado para se deslocar no mapa. Coloque o cursor do mouse dentro da área do mapa e clique na seta para a direita para pan Leste, seta para a esquerda para pan Oeste, seta para cima para pan Norte e para baixo seta para deslocar Sul. Você também pode deslocar o mapa utilizando a barra de espaço ou clique na roda do mouse.

7.5 Barra de Status

A barra de status mostra sua posição atual nas coordenadas do mapa (por exemplo, metros ou graus decimais) como o ponteiro do mouse é movido através da visualização do mapa. Para a esquerda da tela de coordenadas na barra de status tem um pequeno botão que irá alternar entre mostrar posição coordenada ou como você está visualizando as extensões do mapa como pan e zoom in e out.

Próximo à coordenada mostrar que você encontra a exibição de escala. Ele mostra a escala de visualização do mapa. Se você ampliar ou QGIS mostra a escala atual. Este é um seletor de escala que permite que você escolha entre as escalas pré-definidas a partir de 1:500 até 1:1000000.

Uma barra de progresso na barra de status mostra o progresso de renderização como cada camada é atraída para a visualização do mapa. Em alguns casos, como a coleta de estatísticas em camadas raster, a barra de progresso será usada para mostrar o status de operações longas.

Se um novo complemento ou uma atualização de complemento está disponível, você verá uma mensagem na barra de status. No lado direito da barra de status existe uma pequena caixa que pode ser usada para impedir temporariamente que camadas sendo renderizadas sejam vistas no mapa (ver Seção

Renderização

abaixo). O

ícone imediatamente interrompe o processo de renderização atual mapa.

À direita da edição das funções, você encontra o código EPSG do SRC do projeto atual e um ícone projetor.

Clicando sobre ele abre as propriedades de projeção do projeto atual.

Dica: Calculando a escala correta do seu Mapa da tela/visualização

Quando você inicia o QGIS, graus é a unidade padrão, e quer diz que qualquer QGIS coordenadas em sua camada está em graus. Para obter valores de escala correta, você pode mudar isso para metros manualmente no :guilabel: guia Geral em :menuselection: Configurações –> ‘Propriedades do projeto ou você pode selecionar um projeto de coordenadas referência do Sistema SRC clicando no ícone :sup: status SRC no canto inferior direito da barra de status. No último caso, as unidades estão definidas para que a projeção projeto especifico, por exemplo,

‘+unidades=m’.

|Atualizardireitos|

32 Capítulo 7. QGIS GUI

CAPÍTULO

8

Ferramentas Gerais

8.1 Atalhos de teclado

QGIS fornece atalhos de teclado padrão para muitas funções. Pode achá-los na seção Barramenu_etiquetas.

Adicionalmente, o menu da opção Settings → Configure Atalhos. permite mudar os atalhos de teclado padrão e adicionar nuevos atalhos as funções de QGIS.

Figura 8.1: Defina as opções de atalho (Gnome)

A configuração é simples. Apenas selecione uma função da lista e clique em [Mudar], [Definir nenhum] ou

[Definir Padrão]. Uma vez finalizada a sua configuração, pode salvar a mesma como arquivo XML e carregá-la em numa outra instalação QGIS.

8.2 Conteúdo da ajuda

Quando precisar de ajuda num tópico específico, pode acessar a ajuda de contexto [Help], através do botão disponível na maioria dos diálogos– por favor, veja que plugins de terceiras partes podem apontar para páginas web específicas.

8.3 Renderização

Por padrão, QGIS representa todos as camadas visíveis toda vez que a tela do mapa é refeita. Os eventos que refazem a tela do mapa incluem:

33

QGIS User Guide, Versão 2.6

• Adicionar uma camada

• Pan ou zoom

• Redimensionando a janela QGIS

• Mudanças na visibilidade de uma camada ou camadas

QGIS permite controlar o processo de representação em diferentes formas.

8.3.1 Escala dependente da renderização

A representação dependente da escala, permite especificar as escalas mínima e máxima as quais a camada será visível. Para definir uma visualização dependente da escala, abra o diálogo Propriedades, clicando duas vezes sobre a legenda da camada. Na aba Geral, clique na caixa função, depois coloque os valores de escala mínimo e máximo.

Visibilidade dependente da Escala para ativar a

Pode-se determinar os valores da escala, primeiro fazendo um zoom ao nível desejado e verificando o valor da escala no barra QGIS .

8.3.2 Controlando a renderização do mapa

A visualização do mapa pode ser controlada de diversas formas, como descritas na sequencia.

Suspensão de edição

Para suspender a visualização do mapa, clique na caixa Representação na esquina inferior da barra de estado.

Quando a caixa Representação no está marcada, QGIS não refaz a tela em resposta a qualquer dos eventos descritos na seção:ref:redesenho_eventos. Exemplos de quando você pode querer suspender a renderização incluem:

• Adicionando várias camadas e simbolizando antes do desenho.

• Adicionando uma ou mais camadas grandes e definindo a dependência de escala antes do desenho.

• Adicionando uma ou várias camadas grandes e definindo a escala de visualização antes do desenho.

• Qualquer combinação dos anteriores

Caixa de seleção :guilabel: caixa de seleção Renderizar permite renderização e causa uma atualização imediata na tela do mapa.

Opções de adicionar configurações da camada

Pode-se definir uma opção para que possa carregar novas camadas sem visualizá-las. Isto implica que a camada será adicionada ao mapa, mas a caixa de visibilidade na legenda estará desmarcada por padrão. Para definir esta opção, escolha o menu de opções Definições → Opções e clique em Representação. Desmarque a caixa Por

Padrão novas camadas adicionadas ao mapa serão visualizadas . Qualquer camada adicionada depois ao mapa estará deligada (invisível) por padrão.

Parar rendirização

Para parar o desenho no mapa, pressione a tecla ESC. Isto irá parar a atualização da tela do mapa e deixar o mapa parcialmente desenhado. Pode levar um pouco de tempo entre pressionar ESC e o tempo que o desenho do mapa será interrompido.

Nota: No momento não é possível parar a representação ou visualização — isto foi desabilitado no porta Qt4 devido a que a Interface do usuário (UI) ocasiona problemas e colapsa.

34 Capítulo 8. Ferramentas Gerais

QGIS User Guide, Versão 2.6

Atualização da tela durante a edição do mapa

Pode-se definir uma opção para a atualização da tela do mapa na medida em que as feições são desenhadas. Como padrão, QGIS não apresenta qualquer feição numa camada até que a totalidade da camada tinha sido representada.

Para atualizar a visualização na medida em que as feições são lidas da base de dados, escolha a opção do menu

Definições

→ Opções e clique na aba Representação. Coloque a contagem de feições a um valor apropriado para atualizar a tela enquanto realiza a representação. Colocando um valor de 0, desabilita a atualização enquanto desenha (este é o padrão). Colocar um valor muito baixo resultará num desempenho ruim, já que a tela do mapa estará continuamente se atualizando a medida que lê as feições. Um valor sugerido para começar é 500.

Influência da qualidade da edição

Para melhorar a qualidade da visualização do mapa, tem-se duas opções. Escolher a opção do menu Definições→

Opções , clicar na aba Representação e selecionar ou desabilitar as seguintes caixas:

Fazer linhas aparecem com menos definição para não peder performance ao renderizar

Ajustar problemas com polígonos preenchidos incorretamente

Acelerando a visualização

Existem duas definições que permitem melhorar a velocidade da visualização. Abra a opção de diálogo QGIS

Definições

→ Opções, e na aba Representação e selecionar ou desabilitar as seguintes caixas:

• Ativar buffer anterior . Isso proporciona melhor desempenho gráfico ao custo de perder a possibilidade de cancelar a visualização e além disso, desenhar feições. Se não está selecionado, pode-se definir o Número de feições a desenhar antes de atualizar a tela , senão esta opção está desabilitada.

• :guilabel:‘ Usar o cache de visualização quando possível para agilizar re-desenhos‘

8.4 Medição

Medindo em dados com sistemas de coordenadas projetadas (ex. UTM) e não projetadas. Se o mapa carregado está definido em sistema de coordenadas geográficas (latitude/longitude), os resultados de medir uma línea ou

área serão incorrectos. Para corrigir isto, necesitamos definir um sistema de coordenadas de mapa apropriado

(veja a seção

Trabalhando com Projeções ). Todos os módulos de medição também usam as definições de atrair

do módulo de digitalização. Isso é útil se deseja medir ao longo de líneas ou áreas em camadas vectoriais.

Para escolher uma ferramenta de medição, clique em |mAçãoMedir| e selecione a ferramenta que deseje usar.

8.4.1 Medição de linha, áreas ou ângulos

Measure Line

: QGIS is able to measure real distances between given points according to a defined ellipsoid. To configure this, choose menu option Settings → Options, click on the Map tools tab and select the appropriate ellipsoid. There, you can also define a rubberband color and your preferred measurement units (meters or feet) and angle units (degrees, radians and gon). The tool then allows you to click points on the map. Each segment length, as well as the total, shows up in the measure window. To stop measuring, click your right mouse button.

Measure Area

: Areas can also be measured. In the measure window, the accumulated area size appears. In addition, the measuring tool will snap to the currently selected layer, provided that layer has its snapping tolerance set (see section

Configurando a Tolerância de Atracção e Raio de Pesquisa ). So, if you want to measure exactly

8.4. Medição 35

QGIS User Guide, Versão 2.6

Figura 8.2: Medição de Distancia (Gnome) along a line feature, or around a polygon feature, first set its snapping tolerance, then select the layer. Now, when using the measuring tools, each mouse click (within the tolerance setting) will snap to that layer.

Figura 8.3: Medição de Área (Gnome)

Measure Angle

: You can also measure angles. The cursor becomes cross-shaped. Click to draw the first segment of the angle you wish to measure, then move the cursor to draw the desired angle. The measure is displayed in a pop-up dialog.

Figura 8.4: Medição de ângulo (Gnome)

8.4.2 Selecionar e desselecionar feições

A barra de ferramentas | qg | oferece várias formas de selecionar feições na tela do mapa. Para selecionar uma ou mais feições, basta clicar sobre | mActionSelect | e selecionar sua ferramenta:

Selecionar uma única feição

Selecionar Feições através de Retangulo

Selecionar Feições através de Polígono

Selecionar Feições por Desenho Livre

Selecionar Feições por Raio

Para desselecionar todos as feições selecionadas clique em

Desselecionar todas feições da camada

.

Selecionar feição usando uma expressão permite ao usuário selecionar feição usando diálogo expressão. Veja capítulo vector_expressions para algum exemplo.

36 Capítulo 8. Ferramentas Gerais

QGIS User Guide, Versão 2.6

Os usuários podem salvar a seleção de feições em uma Novo Arquivo de Camada Vetor ou ** Nova Camada

Vetor** usando Editar → Colar feições como... e escolher o modo desejado.

8.5 Identificar feições

A ferramenta Identificar permite que você interaja com a tela do mapa e obtenha informações sobre as feições, em uma janela pop-up. Para identificar feições, use: menuselection: Ver -> Identificar feições ou pressione: kbd: Ctrl

+ Shift + I , ou clique no ícone | mActionIdentify | : sup: Identificar feições na barra de ferramentas.

Se você clicar em várias feições, o diálogo: guilabel: Identificar resultados irá listar informações sobre todos as feições selecionadas. O primeiro item é o número da feição na lista de resultados, seguido do nome da camada. Em seguida, o seu primeiro item relacionado será o nome do campo com o seu valor. Finalmente, todas as informações sobre a feição são é apresentadas.

Essa janela pode ser personalizada para exibir campos personalizados, mas por padrão ele irá exibir apenas três tipos de informação:

• Ações: Ações podem ser adicionados às janelas de identificação de feições. Ao clicar na etiqueta da ação, a mesma será executada. Por padrão, apenas uma ação para ver feições para edição, é adicionada .

• Derivada: Esta informação é calculada ou derivada de outras informações. Você pode encontrar coordenadas clicadas, coordenadas X e Y, área em unidades de mapa e perímetro em unidades do mapa de polígonos, comprimento em unidades do mapa de linhas e identificação das feições.

• Atributos dos dados: essa é a lista de campos de atributos dos dados.

Figura 8.5: Janela identificar feição (Gnome)

Na parte de baixo da janela, vai encontar cinco ícones:

Expandir árvore

Fechar árvore

Comportamento Padrão

Copiar atributos

Imprimir resposta HTML selecionada

Outras funções podem ser encontrados no menu de contexto do item identificado. Por exemplo, do menu de contexto, você pode:

• Ver o formulário da feição

• Zoom para feição

8.5. Identificar feições 37

QGIS User Guide, Versão 2.6

• Copiar feição: Copiar todos os atributos e a geometria da feição

• Seleção de feição de alternância: Adicionar identificador de feição à seleção

• Copiar o valor do atributo: Copiar apenas o valor do atributo que clicou.

• Copiar atributos da feição: copiar apenas os atributos

• Limpar resultados: apaga os resultados na janela

• Limpar destaques: Remover feiçõesdestacadas no mapa

• Destaque todos

• Destaque a camada

• Ativar camada: escolha uma camada a ser ativada

• Propriedades da camada: Abre a janela de propriedades da camada

• Estender tudo

• Encolher tudo

8.6 Decorações

As Decorações de | qg | incluem a Gride ou malha, o Etiqueta de Direitos Autorais, a Seta do Norte e a Barra de

Escala. Eles são usados para “decorar” o mapa, adicionando elementos cartográficos.

8.6.1 Malha

Grid allows you to add a coordinate grid and coordinate annotations to the map canvas.

38

Figura 8.6: O Diálogo Malha

1. Selecionar do menu Ver → Decorações → Malha. O diálogo abre (veja

figure_decorations_1 ).

2. Marque a guia Abilitar Malha e coloque as definições da malha de acordo as camadas carregadas na tela do mapa.

3. Marque a guia Desenhar anotações e coloque as definições de anotações, de acordo as camadas carregadas na tela do mapa.

4. Clique [Aplicar] para verificar que a apariência é a esperada

Capítulo 8. Ferramentas Gerais

5. Clique [OK] para fechar o diálogo.

8.6.2 Rótulo Copyright

Copyright label adds a copyright label using the text you prefer to the map.

QGIS User Guide, Versão 2.6

Figura 8.7: O diãlogo de Direitos de Cópia

| nix

1. Selecionar no menu Ver → Decorações → Etiqueta de Propriedade Intelectual. O diálogo abre (veja

figure_decorations_2 ).

2. Entre o texto que deseja colocar no mapa. Pode usar HTML como mostrado no exemplo.

3. Escolha o lugar da etiqueta a partir do combo de caixas Localização .

4. Confirme que a caixa

5. Clique [OK].

Abilitar Etiqueta Direito de Cópia está selecionada.

No exemplo acima, que é padrão, QGIS coloca um símbolo de direitos de cópia, seguido pela data, na esquina inferior direita da tela do mapa.

8.6.3 Seta Norte

North Arrow places a simple north arrow on the map canvas. At present, there is only one style available. You can adjust the angle of the arrow or let QGIS set the direction automatically. If you choose to let QGIS determine the direction, it makes its best guess as to how the arrow should be oriented. For placement of the arrow, you have four options, corresponding to the four corners of the map canvas.

8.6. Decorações

Figura 8.8: Janela de indicação do Norte

39

QGIS User Guide, Versão 2.6

8.6.4 Barra de Escala

Scale Bar adds a simple scale bar to the map canvas. You can control the style and placement, as well as the labeling of the bar.

Figura 8.9: A janela da barra de escala

QGIS only supports displaying the scale in the same units as your map frame. So if the units of your layers are in meters, you can’t create a scale bar in feet. Likewise, if you are using decimal degrees, you can’t create a scale bar to display distance in meters.

Para adicionar uma barra de escala:

1. Seleccione a partir do menu: menuselection: Ver -> Decorações -> Barra de Escala. O diálogo abre (veja

figure_decorations_4 ).

2. Selecione a localização a partir do combo de caixas Localização .

3. Selecione o estilo a partir do combo de caixas Estilo da Barra de Escala

4. Selecione a cor da barra Cor da bar

|selecionecor| ou use a cor preto padrão.

.

5. Definir o tamanho da barra e sua etiqueta Tamanho da barra |selecioarnúmero| .

6. Confirme que a caixa Abilitar barra escala , está clicada.

7. Opcionalmente, marque : guilabel: automaticamente arredondará para número inteiro no redimensionamento .

8. Clique [OK].

Dica: Configurações de Decorações

Quando salva um projeto .qgs, qualquer mudança que tenha efetuado ao Gride, Seta do Norte, Barra de Escala e Direitos de Cópia, serão salvos no projeto e restaurados na próxima vez que carregue o projeto.

8.7 Ferramentas de anotação

A ferramenta

Anotação de Texto na barra de ferramentas dos atributos, dão a possibilidade de colocar texto formatado na legenda da tela do mapa QGIS. Use a ferramenta Anotação de Texto e clique na tela do mapa.

Dê um duplo clique no item para abrir o diálogo com várias opções. Tem um editor de texto para entrar texto formatado e definir outros itens. Por exemplo, tem uma forma de colocar um item numa posição do mapa (mostrada por um símbolo marcador) or para ter um item numa posição da tela (não relacionada ao mapa).O artigo pode ser

40 Capítulo 8. Ferramentas Gerais

QGIS User Guide, Versão 2.6

Figura 8.10: Janela texto de anotação movido pela posição do mapa (arrastando o marcador do mapa) ou movendo apenas o balão. Os ícones são parte do tema GIS e podem ser usados como padrão em outros temas também.

A ferramenta

Mover Anotação permite mover a anotação na tela do mapa.

8.7.1 Anotações HTML

A ferramenta

Anotação HTML na barra de ferramentas dos atributos, dâ a possibilidade de colocar conteúdo de em arquivo HTML numa caixa de texto ou na tela do mapa QGIS. Para usar a ferramenta Anotação HTML, clique na tela do mapa e adicione o caminho para o arquivo HTML no diálogo.

8.7.2 Anotações SVG

A ferramenta

Anotação SVG na barra de ferramentas dos atributos, fornece a possibilidade de colocar um símbolo

SVG em uma caixa de texto na tela do mapa QGIS. Para usar a ferramenta Anotação SVG, clique na tela do mapa e adicione o caminho para o arquivo SVG no diálogo.

8.7.3 Anotação de formulário

Além disso, pode-se criar seu próprio formulário de anotação.

A ferramenta

Formulário de Anotação

é útil para mostrar os atributos de uma camada vectorial em formjlário personalizado do tipo Qt Designer (veja

figure_custom_annotation ). Isto é semelhante aos formulários da ferramenta Identificar feições , mas exibido em um

item de anotação. Veja também o vídeo https://www.youtube.com/watch?v=0pDBuSbQ02o de Tim Sutton para informações adicionais.

Nota: Se você pressionar Ctrl+T enquanto uma ferramenta Anotação está ativa (mover anotação, texto de anotação, formulário de anotação), os estados de visibilidade dos itens serão invertidos.

8.8 Favoritos Espaciais

Favoritos espaciais permite que você “marque” uma localização geográfica e volte a ela mais tarde.

8.8. Favoritos Espaciais 41

QGIS User Guide, Versão 2.6

Figura 8.11: Desenho personalizado qt do formulário de anotação

8.8.1 Novo Favorito

Para criar um novo favorito:

1. Zoom ou pan na área de interesse.

2. Selecione a opção de menu Exibir → Novo Favorito ou pressione Ctrl-B.

3. Adicione um nome descritivo para o favorito (no máximo 255 caracteres).

4. Pressione Enter para adicionar um favorito ou [Delete] para remover o favorito.

Note que você pode ter vários favoritos com o mesmo nome.

8.8.2 Trabalhando com favoritos

Para usar ou gerenciar os marcadores, selecione a opção do menu Ver → Mostrar marcadores. O diálogo Marcadores Geospaciais permite focar ou apagar um marcador. Não é possível editar o nome ou as coordenadas de um marcador.

8.8.3 Aproximar para um favorito

A partir do :guilabel: diálogo Favoritos Geoespaciais, selecione o marcador desejado, clicando sobre ele, em seguida, clique [Aproximar para]. Você também pode ampliar até um marcador, clicando duas vezes sobre ele.

8.8.4 Deletando um favorito

Para excluir um marcador do diálogo Marcadores Geospaciais, clique nele e logo clique em [Apagar]. Confirme sua escolha clicando [Sim], ou cancele a operação clicando [Não].

42 Capítulo 8. Ferramentas Gerais

QGIS User Guide, Versão 2.6

8.9 Projetos animados

Se deseja incorporar conteúdo de outros arquivos de projetos no seu projeto, pode escoler Camada →Incorporar

Camadas e Grupos .

8.9.1 Incorporando camadas

Os siguientes diálogos permitem incorporar camadas de outros projetos. Aqui um pequeno exemplo:

1. Pressione para olhar para outro projeto do conjunto de dados Alasca.

2. Selecione o arquivo do projeto :arquivo:‘coberturavegetal‘ Pode ver agora o conteúdo do projeto (veja

figure_embed_dialog ).

3. Pressione Ctrl e clique nas camadas :arquivo:‘coberturavegetal‘ e :arquivo:‘regiões‘ . Pressione [OK].

As camadas selecionadas serão incorporadas na legenda do mapa e na tela do mapa.

Figura 8.12: Selecionar camadas e grupos para incorporar

Enquanto as camadas incorporadas são editáveis, não podem ser mudadas suas propriedades de estilo e rotulação.

8.9.2 Removendo camadas incorporadas

.

Clique com botão direito na camada incorporada e escolha

Apagar

.

8.9. Projetos animados 43

QGIS User Guide, Versão 2.6

44 Capítulo 8. Ferramentas Gerais

CAPÍTULO

9

Configuração QGIS

O QGIS é altamente personalizável através do menu Configurações . Escolha entre Painéis, Caixa de Ferramentas,

Propriedades do Projeto, Opções e Personalização.

Nota: QGIS segue as diretrizes de desktop para a localização das opções e elementos das propriedades do projeto.

Por consequência relacionada com o sistema operacional será utilizando, a localização de alguns dos elementos descritos anteriormente poderiam estar situados no menu :menuselection‘Exibir‘ (Painéis e Barra de ferramentas) ou em Projeto para Opções.

9.1 Painéis e Barras de Ferramentas

No menu Painéis→ pode desligar os widgets do QGIS. O menu Caixa de Ferramentas→ fornece a possibilidade de trocar ativar ou desativar grupos de ícones na barra de ferramentas do QGIS (veja

figure_panels_toolbars ).

Figura 9.1: Os Painéis e o Menu de Barra de Ferramentas

45

QGIS User Guide, Versão 2.6

Dica: Ativando o Enquadramento QGIS

No QGIS pode usar o painel do enquadramento que fornece a extensão total das camadas adicionadas. Pode ser selecionada no menu Configurações

→ Painéis ou

Ver

→ Paineis. Dentro da vista existe um retângulo a mostrar a extensão atual do mapa. Isto permite rapidamente determinar que área do mapa está a ver atualmente. É de notar que os rótulos não serão renderizados no enquadramento do mapa mesmo que seja ativado a rotulagem.

Se clicar e arrastar o retângulo vermelho no enquadramento que mostra a atual extensão, este irá atualizar de acordo como o mapa principal.

Dica: Mostrar Mensagens de Registro

É possível seguir as mensagens do QGIS. Pode ativar o Registo de Mensagens no menu Configurações

Painéis ou Vier

→ Painéis e seguir as mensagens que aparecem nos diferentes separadores durante o carregamento e operação.

9.2 Propriedades do Projeto

Na janela de propriedades do projeto baixo Configuração

→ Propriedades do projeto (kde) ou

→ Propriedades do projeto (Gnome), pode estabelecer opções específicas do projeto. Isto inclue:

Projeto

• No menu Geral podem ser definidos o título do projeto, a cor de seleção e fundo, unidades da camadas, precisão, e os caminhos relativos onde serão salvas as camadas. Se a transformação SRC estiver ligada pode escolher o cálculo de distâncias recorrendo ao elipsóide. Pode definir as unidades do enquadramento

(apenas usado quando a transformação SRC está desativada) e a precisão das casas decimais a usar. Pode definir também uma escala de projeto, que rescreverá sobre as escalas globais pré-definidas.

• O menu SRC permite que escolha o Sistema de Coordenadas Referência para o projeto, e para ativar a reprojeção on-the-fly das camadas matricias e vetoriais na exibição de camadas de diferentes SRC.

• Com o terceiro menu Identificar camadas pode definir (ou desativar) que camadas irão responder à ferramenta identificar. (Veja o parágrafo das “Ferramentas de Mapa” da seção

Opções

Seção para ativar a identificação de múltiplas camadas).

• O menu Estilos padrão te permite controlar como as novas camadas se distribuem quando não tem um estilo existente .qml definido. Também pode estabelecer o nível de transparecia por defeito para novas camadas e se seus símbolos devem ter cores indefinidas para marcar. Também tem uma seção adicional onde pode definir cores específicas para o projeto em execução. Pode encontrar as cores adicionadas no menu em cascata da aba de diálogo de cor presente em cada representação.

• O separador Servidor OWS permite definir a informação sobre as Capacidades do WMS e WFS, a extensão e as restrições SRC do Servidor QGIS.

• O menu Macros é para editar macros Python para os projetos. Atualmente, apenas estão disponíveis três macros: openProject(), saveProject() e closeProject().

• O menu Relations é usado para definir relações 1:n. As relações são definidas no diálogo das propriedades do projeto. Quando existirem relações para uma camada, um novo elemento de interface do utilizador na vista de formulário (p. ex. quando identificar um elemento e abrir o seu formulário) irá listar os elementos relacionados. Isto fornece uma maneira poderosa para expressar p. ex. o histórico de inspeção ao longo de um segmento de tubagem ou estrada. Poderá encontrar mais informação sobre suporte de relações 1:n na

Seção

Criando uma ou mais relações .

9.3 Opções

Algumas opções básicas para QGIS podem ser selecionadas usando o diálogo Options. Selecione a opção de menu Configurações →

Opções

. Os separadores onde poderá personalizar as suas opções são descritos abaixo.

46 Capítulo 9. Configuração QGIS

QGIS User Guide, Versão 2.6

Figura 9.2: Configurações de Macro no QGIS

9.3.1 Menu Geral

Aplicação

• Selecione a Estilo (Necessário reiniciar o QGIS)

‘Plastique’ e ‘Cleanlux’ ( ).

• Definir o Tema de Ícone e escolha entre ‘Oxygen’,’Windows’,’Motif’,’CDE’,

. Atualmente a opção ‘default’ é possível.

• Definir o Tamanho do Ícone .

• Definir a Fonte. Escolha entre QT padrão e uma fonte definida pelo utilizador.

• Altera o Tempo limite para mensagens ou diálogos .

Não exibir a janela inicial

Mostrar dicas ao iniciar

Títulos da caixa de grupos a negrito

• QGIS-estilo das caixas de grupo

Use diálogos seletores de cor para atualizações ao vivo

Arquivos de projeto

• Abrir o projeto no arranque

‘Específico’ use

(escolha entre ‘Novo’. ‘Mais recente’ e ‘Específico’). Quando escolher para definir um projeto.

• Criar um novo projeto como projeto padrão . Tem a possibilidade de carregar em Usar projeto atual com padrão ou em Resetar padrão. Pode navegar através dos seus arquivos e definir um diretório onde encontra os modelos de projeto definidos pelo usuário. Isto será adicionado a Projeto → Novo do modelo. Primeiro ative projeto.

Criar novo projeto como projeto padrão e a seguir salve o projeto dentro da pasta de modelos de

• Avisar para salvar projeto e alterações de fontes de dados quando necessário

9.3. Opções 47

QGIS User Guide, Versão 2.6

• Avisar quando abrir um projeto salvado com uma versão antiga do |qg|

• Enable macros . Esta opção foi criada para lidar com as macros que são escritas para executar uma ação nos eventos do projeto. Pode escolher entre ‘Never’, ‘Ask’, ‘For this session only’ e ‘Always (not recommended)’.

9.3.2 Menu Sistema

Ambiente

Variáveis de ambiente do sistema podem ser vistas agora, e muitas configuradas, no grupo Environment (ver

figure_environment_variables ). Isto é útil para plataformas, tais como Mac, onde um aplicativo GUI não herda

necessariamente o ambiente do utilizador da linha de comandos. Também é útil para configuração e visualização de variáveis de ambiente para os conjuntos de ferramentas externas controlados pela caixa de ferramentas de

Processamento (p. ex., SAGA, GRASS), e para ativar a saída de depuração (“debugging”) para seções específicas do código-fonte.

• Utilize variáveis personalizadas (Reinício necessário - incluem separadores) . Você pode [Adicionar] e [remover] variáveis. Variáveis de ambiente já definidas são exibidos em variáveis de ambiente atual, e é possível filtrá-las ativando Mostrar somente variáveis específicas-QGIS .

Figura 9.3: Variáveis de ambiente do Sistema no QGIS

Diretórios dos complementos

[Adicionar] ou [Remover] Caminho(s) para pesquisar bibliotecas de complementos C++ adicionais

9.3.3 Menu Fonte de Dados

Atributos dos elementos e tabela

48 Capítulo 9. Configuração QGIS

QGIS User Guide, Versão 2.6

• Abre a tabela de atributos na janela principal (Necessário reiniciar o QGIS)

• Copiar geometria na representação WKT da tabela de atributos .

copiar linhas selecionadas para área de transferência

Ao utilizar do diálogo :guilabel: tabela de Atributo, isso tem como resultado que as coordenadas dos pontos ou vértices também são copiados para a área de transferência.

• Comportamento da tabela de atributos . Existem três possibilidades: ‘Mostrar todos os elementos’,

‘Mostrar elementos selecionados’ e ‘Mostrar elementos visíveis no mapa’.

• Cache da linha da Tabela de atributos . Esse cache de linha, torna possível para salvar as últimas linhas de atributos N carregadas, de modo que o trabalho com a tabela de atributos seja mais rápido. O cache será excluído ao fechar a tabela de atributos.

• Representação para valores NULL. Aqui, pode definir um valor para os campos de dados que contêm valores NULL.

Manipulação das fontes de dados

• Pesquisar por atributos válidos na janela do navegador

‘Verificar conteúdo do arquivo’.

. Pode escolher entre ‘Verificar extensão’ e

• Pesquisar por conteúdo de arquivos compatados (.zip) na janela do navegador básica’ e ‘Verificação completa’ são possíveis.

. ‘Não’, ‘Verificação

• Solicitar subcamadas raster ao abrir. Alguns rasters suportam subcamadas — elas são chamadas de subdatasets no GDAL. Um exemplo são os arquivos netCDF — se há muitas variáveis netCDF, GDAL verá cada variável como um subdataset. A opção permite que você controle como lidar com subcamadas quando um arquivo é aberto com subcamadas. Você tem as seguintes opções:

– ‘Sempre’: Perguntar sempre (se existem subcamadas)

– ‘Se necessário’: Perguntar se a camada não tem bandas, mas tem subcamadas

– ‘Nunca’: Nunca pede, não irá carregar nada

– ‘Carregar tudo’: Nunca pede, mas carrega todas as subcamadas

• Ignora a declaração de codificação do shapefile . Se o shapefile tiver informação de codificação, este será ignorado pelo QGIS.

Adicionar uma camada PostGIS com duplo clique e selecione em modo extendido

Adicione camadas Oracle com duplo clique e selecione em modo extendido

9.3.4 Menu de Renderização

Comportamento da renderização

• Por padrão novas camadas adicionadas ao mapa devem ser exibidas

Use tornar cache sempre que possível para acelerar redesenhos

Representação de camadas em paralelo utilizando muitos núcleos CPU

• Máximo de núcleos para utilizar

• Intervalo de atualização do mapa (por padrão 250 ms)

• Ativar simplificação de camadas por padrão para camadas recém adicionadas

• Simplificação de limiar

Simplifique no provedor ao lado se possível

9.3. Opções 49

QGIS User Guide, Versão 2.6

• Escala máxima a que a camada deve simplificar

Qualidade de renderização

• Faz com que as linhas apareçam menos irregulares, em detrimento de algum desempenho do desenho

Matriciais

• Com a Seleção de banda RGB pode definir o número para a banda Vermelha, Verde e Azul.

Melhora de contraste

• Banda cinza única . Uma banda cinza única pode ter ‘Sem estender’, ‘Estender para MinMax’,

‘Estender e Cortar para MinMax’ e também ‘Cortar para MinMax’.

• Cor de Multi banda (byte/banda) . As opções são ‘Não estender’, ‘Estender para MinMax’, ‘Estender e cortar para MinMax’ e ‘Cortar para MinMax’.

• Cor de Multi banda (>byte/banda) . As opções são ‘Não estender’, ‘Estender para MinMax’, ‘Estender e cortar para MinMax’ e ‘Cortar para MinMax’.

• Limites (mínimo/máximo) .

As opções são ‘Corte de contagem de pixel cumulativa’, ‘Mínimo/Máximo’, ‘Média +/- desvio padrão’.

• Limites de contagem cumulativa de pixeis de corte

• Multiplicador do desvio-padrão

Corrigindo Erros

• Atualiza o mapa da tela

9.3.5 Menu de Cores

Este menu permite adicionar algumas cores personalizadas que possa encontrar em cada janela de diálogo de cor da representação. Verá um conjunto de cores predefinidas na janela: pode eliminar o editar todos eles. Por outra parte pode adicionar a cor que desejar e realizar alguma operação como copiar e colar. Finalmente pode exportar a cor estabelecida como um arquivo gpl ou importar-los.

9.3.6 Menu de Janela e Legenda

Aparência padrão do mapa (reescrita pelas propriedades do projeto)

• Define a Cor da seleção e a Cor de fundo.

Legenda da camada

• Duplo clique na legenda duplo clique.

. Pode ‘Abrir propriedades da camada’ ou ‘Abrir tabela de atributos’ com

• As seguintes Estilos de itens de legenda são possíveis:

Tornar maiúsculo os nomes da camada

Tornar negrito os nomes da camada

Tornar negrito os nomes dos grupos

Mostrar nomes de atributos de classificação

Criar ícones matriciais (pode ser lento)

Adicionar novas camadas ao grupo atual ou selecionado

50 Capítulo 9. Configuração QGIS

QGIS User Guide, Versão 2.6

9.3.7 Menu Ferramentas de Mapa

Este menu oferece algumas opções com respeito ao funcionamento da Ferramenta de Identificação.

• Raio de busca para identificar e visualizar avisos no mapa é um fator de tolerância expressada como uma percentagem do eixo do mapa. Isto significa que a ferramenta de identificação representara os resultados sempre e quando clicar dentro desta tolerância.

• Cor de realce lhe permite eleger com que cor devem ser identificados os objetos espaciais que estão destacados.

• Buffer expressado como uma percentagem do eixo do mapa, determina uma distância de separação que representa a partir do contorno mais destacado para identificar.

• Eixo mínimo expresso como uma percentagem do eixo do mapa, determina a grossura do contorno e como deve ser o objeto destacado.

Ferramenta de medida

• Define Cor do elástico para as ferramentas de medida

• Define Casas decimais

Manter unidade base

• Unidades de medição preferidas (‘Metros’, ‘Pés’, ‘Milhas Nauticas’ ou ‘Graus’)‘

• Unidades de ângulo preferida (‘Graus’, ‘Radianos’ ou ‘Grados’)

Movendo e ampliando

• Define a Ação da roda do rato

‘Nada’)

(‘Visualizar’, ‘Visualizar e Centrar’, ‘Aproximar ao cursor do rato’,

• Define o factor de aproximação/ afastamento para a roda do mouse

Escalas pré-definidas

Aqui, você encontrará uma lista de escalas pré-definidas. Com os botões [+] e [-] que você pode adicionar ou remover suas escalas individuais.

9.3.8 Menu do Compositor

Composição padrão

Você pode definir a fonte Padrão aqui.

Aparência do Gride

• Define o Estilo do Gride

• Define a Cor...

Gride padrão

• Define o Espaçamento

• Define o Espaçamento do Gride

(‘Sólido’, ‘Pontos’, ‘Cruzamentos’) para x e y

• Define o Tolerância de Atração

Guia padrão

• Define o Tolerância de Atração

9.3. Opções 51

QGIS User Guide, Versão 2.6

9.3.9 Menu Digitalizar

Criação de elementos

• Suprimir atributos de janelas pop-up depois de cada elemento criado

Reutilizar últimos valores de atributos inseridos

• Validar geometrias. Edição de linhas complexas e polígonos com muitos nós pode resultar em edição muito lenta. Isso ocorre porque os procedimentos de validação padrão no QGIS pode levar bastante tempo. Para acelerar o processamento, é possível selecionar a validação de geometria GEOS (a partir de GEOS 3.3) ou desligá-la. Validação geometria GEOS é muito mais rápida, mas a desvantagem é que apenas o primeiro problema de geometria será relatado.

Elástico

• Define a Borracha Espessura da linha e Cor da linha

Ajuste

• Abrir opções de atração na janela principal (necessário reiniciar o QGIS)

• Define o Modo de atração padrão gado’)

(‘Ao vértice’, ‘Ao segmento’, ‘Ao vértice e segmento’, ‘Desli-

• Define Tolerância de atração pré-definida em unidades de mapa ou pixeis

• Define o Raio de pesquisa para editar vértices em unidades de mapa ou pixeis

Marcadores de Vértices

• Mostrar marcadores apenas para elementos selecionados

• Define o vértice do Estilo do Marcador

• Definir o vértice Tamanho do Marcador

Ferramenta de curva de afastamento

(‘Cruz’ (padrão), ‘Circulo semi-transparente’ ou ‘Nenhum’)

A 3 opções seguintes referem a ferramentas

Curva Offset no

Digitalização Avançada . Através das várias config-

urações, é possível influenciar a forma da linha de deslocamento. Estas opções são possíveis a partir de GEOS

3.3.

• Juntar estilo

• Quadrante do Segmento

• Limite quadrante

9.3.10 Menu GDAL

GDAL é uma biblioteca de troca de dados para arquivos raster. Neste guia, você pode Edite criar opções e: guilabel: Editar Opções Pirâmides dos formatos raster. Definir que drive GDAL está sendo utilizado para um formato raster, como em alguns casos, mais do que um drive GDAL está disponível.

9.3.11 Menu SRC

SRC padrão para novos projetos

• Não permitir reprojeção ‘on the fly’

Habilitar automaticamente a reprojeção ‘on the fly’ se a camada tiver SRC diferente

Habilitar reprojeção ‘on the fly’ por padrão

52 Capítulo 9. Configuração QGIS

QGIS User Guide, Versão 2.6

• Selecione um SRC em Iniciar sempre um novo projeto com este SRC

SRC para novas camadas

Esta área permite que você defina a ação a ser tomada quando uma nova camada é criada, ou quando uma camada sem SRC é carregada.

Pergunta por SRC

Usar SRC do projeto

• Utilizar SRC padrão mostrado em baixo

Transformação de datum padrão

• Pergunte pela transformação do datum quando nenhum padrão for definido

• Se você trabalhou com a transformação SRC ‘on-the-fly’ você pode ver o resultado da transformação na janela abaixo. Você pode encontrar informações sobre ‘Fonte da SRC’ e ‘Destino do SRC’, bem como

‘Transformação de Datum Fonte’ e ‘Transformação de Datum de Destino’.

9.3.12 Menu local

• Sobrepor idioma do sistema e Idioma a utilizar em alternativa

• Informação sobre a região do sistema ativo local

9.3.13 Menu rede

Geral

• Define Pesquisa de endereço WMS, padrão como http://geopole.org/wms/search?search=\%1\&type=rss

• Define Tempo esgotado para pedidos de rede (ms) - o padrão é 60000

• Define Período padrão de validade para a quadrícula WMSC/WMTS (horas) - o padrão é 24

• Define Máxima repetição no caso de erros na requisição de mosaico

• Define Usuário-Agente

Configurações de cache

Define a Pasta e Tamanho para o cache.

• Usar proxy para acessar à web e define ‘Máquina’, ‘Porta’, ‘Usuário’, e ‘Palavra-chave’.

• Configura o Tipo de proxy de acordo com as necessidades.

– Default Proxy: Proxy é determinado baseando-se na definição do proxy da aplicação em uso

– Socks5Proxy: Proxy genérico para qualquer tipo de ligação. Suporta TCP, UDP, unindo a uma porta

(ligações de entrada) e autenticação.

– HttpProxy: Implementado usando o comando “LIGAR” , apenas suporta ligações TCP de saída; suporta autenticação.

– HttpCachingProxy: Implementado usando comandos HTTP normais, é útil apenas em pedidos no contexto do HTTP.

– FtpCachingProxy: Implementado usando um proxy FTP, é útil no contexto de pedidos FTP.

Alguns URLs excluídos podem ser adicionados na caixa de texto debaixo das configurações de proxy (veja

Figure_Network_Tab ).

Se você precisar de informações mais detalhadas sobre as diferentes configurações de proxy, consulte o manual da documentação da biblioteca QT subjacente a http://doc.trolltech.com/4.5/qnetworkproxy.html#ProxyType-enum .

9.3. Opções 53

QGIS User Guide, Versão 2.6

54

Figura 9.4: Configurações-proxy no QGIS

Capítulo 9. Configuração QGIS

QGIS User Guide, Versão 2.6

Dica: Usando Proxies

Usando proxies, por vezes, pode ser complicado. É útil proceder por “tentativa e erro”, com os tipos de proxy acima, verifique para ver se eles conseguem no seu caso.

Pode modificar as opções de acordo com as suas necessidades. Algumas das alterações pode requerer o reinicio do QGIS antes de ser efetiva.

• A configuração é salva em arquivo de texto: $HOME/.config/QGIS/QGIS2.conf

• pode encontrar as configurações em: $HOME/Library/Preferences/org.qgis.qgis.plist

• As configurações são armazenadas no registo em: HKEY\CURRENT_USER\Software\QGIS\qgis

9.4 Personalização

A ferramenta de personalização permite que (des)ative a maioria dos elementos na interface de utilizador QGIS.

Isto pode ser muito útil se tiver um número elevado de módulos instalados que nunca usa e que estão preenchendo o ecrã.

Figura 9.5: A janela de Personalização

QGIS A Personalização está dividida em cinco grupos. No Menus pode esconder as entradas na Barra Menu.

No Painel pode encontrar o painel de janelas. As janelas do Painel são aplicações que pode ser iniciadas e usadas como flutuantes, janelas de topo de nível ou contidas na janela principal do QGIS como um widget ancorado (veja also

Painéis e Barras de Ferramentas ). Na

Barra de Estado características como a informação das coordenadas podem ser desativadas. Na Caixa de Ferramentas pode (des)ativar os ícones da barra de ferramentas do QGIS e em Widgets pode (des)ativar janelas assim como os seus botões.

.

Com

Mudar para pegar widgets na aplicação principal

, você pode clicar em elementos QGIS que deseja ser escondida e localize a entrada correspondente na personalização (ver

figura_customization ). Você também pode salvar suas

várias configurações também para diferentes casos de uso. Antes das alterações serem aplicadas, você precisa reiniciar QGIS.

9.4. Personalização 55

QGIS User Guide, Versão 2.6

56 Capítulo 9. Configuração QGIS

CAPÍTULO

10

Trabalhando com Projeções

O QGIS permite que os utilizadores definam de forma global e para todo o projecto um SC (Sistema de Coordenadas) para temas que não têm um SC pré-definido. Também permite que o utilizador defina sistemas de coordenadas personalizados e suporta a projecção dinâmica no ecrã de temas com diferentes SCs conseguindo sobrepondo-os correctamente.

10.1 Visão geral do Suporte a Projeções

O QGIS suporta aproximadamente 2.700 SCs conhecidos. Definições para cada SC são guardados numa base de dados SQLite que é instalada com o QGIS. Normalmente, não terá necessidade de manipular a base de dados directamente. De facto, ao fazê-lo poderá causar problemas. SCs definidos manualmente são guardados numa base de dados do utilizador. Veja a secção

Sistema de Referência de Coordenadas personalizado

para informação sobre a gestão dos seus sistemas de coordenadas.

Os SCs disponíveis no QGIS são baseados nos definidos pelo Grupo Europeu de Pequisa Petrolífera (EPSG) e pelo

Instituto Geográfico Nacional Francês (IGNF) e são em grande parte derivados das tabelas de referência espacial usadas pelo GDAL. Os identificadores EPSG presentes na base de dados podem ser usados para especificar um

SC no QGIS.

Para poder usar a projeção dinâmica, os seus dados devem conter informação sobre o seu sistema de coordenadas ou vocês deverá definir um sistema global, para temas ou para o projeto. Para temas PostGIS, o QGIS usa o identificador de referência espacial que foi especificado aquando da criação do tema. Para dados suportados pelo

OGR, o QGIS recorre à presença de um meio reconhecível para especificar o SRC. No caso de shapefiles, isto significa um arquivo contendo um texto bem-conhecido (WKT) especificando o SC. Este arquivo de projeção tem o mesmo nome base que o shapefile e uma extensão .prj. Por exemplo, um shapefile chamado alaska.shp

teria um arquivo de projeção correspondente chamado alaska.prj.

Sempre que selecionar um novo SC, as unidades do temas serão mudadas automaticamente no separador Geral das |mActionsOptions| na janela de Propriedades do Projeto, no menu Projeto (Gnome, OSX) ou Definições

(KDE, Windows).

10.2 Especificação de Projeção Global

O QGIS inicia cada novo projeto usando a projeção global pré-definida. O SRC global por omissão é o EPSG:4326

- WGS 84 (proj=longlat +ellps=WGS84 +datum=WGS84 +no_defs), e vem pré-definido no QGIS.

Este valor pode ser alterado via o botão [Selecionar...] na primeira seção, que é usada para definir o sistema de coordenadas por omissão para novos projetos, como mostrado na

figure_projection_1 . Este opção pode ser

gravada para uso em sessões subsequentes do QGIS.

Quando usa temas que não têm um SC, tem de definir como o QGIS reage a estes temas. Isto pode ser feito globalmente ou por projeto no separador SC no Definições → Opções .

As opções mostradas na

figure_projections_1

são:

57

QGIS User Guide, Versão 2.6

58

Figura 10.1: Separador SRC na Janela de Opções QGIS

Capítulo 10. Trabalhando com Projeções

QGIS User Guide, Versão 2.6

Entrada de SRC

Usar SRC do projeto

• Usar o SRC pré-definido mostrado abaixo

Se quer definir o sistema de coordenadas para um dado tema sem informação de SRC, pode também fazê-lo no separador Geral da janela de propriedade raster e vetor (ver

Menu Geral

para rasters e

Menu Geral

para vectores).

Se o seu tema já tem um SRC definido, este será mostrado como na

Janela de Propriedades do Vetor

.

Dica: SRC na Legenda do Mapa

Clicando com o botão direito num tema na Legenda do Mapa (seção

Legenda do Mapa ) mostra dois atalhos SRC.

Definir SRC do tema abre a janela de Seleção de Sistema de Referência de Coordenadas (ver

figure_projection_2 ).

Definir SRC do projeto a partir do Tema redefine o SRC do projeto usando o SRC do tema.

10.3 Definir Reprojeção Dinâmica Voo Livre (OTF)

O QGIS suporta reprojeção dinâmica OTF para dados raster e vetor. Contudo, OTF não está ativo por omissão.

Para usar projeção dinâmica, deve ativar a caixa de opção Ativar transformação dinâmica de SRC no separador

SRC na janela

Propriedades do Projeto

.

Há três formas de fazer isto:

1. Selecione :menuselecion:‘Propriedades do Projeto‘ no menu Projecto (Gnome, OSX) ou Definições

(KDE, Windows).

2. Clique no ícone estado SRC no canto inferior direito da barra de estado.

3. Ative a projeção dinâmica por omissão no separador SRC da janela Opções selecionando a Ativar reprojeção dinâmica por omissão ou Automaticamente ativar a reprojeção dinâmica se temas têm diferentes

SRC .

Se tem já carregado um tema e quer ativar a projeção dinâmica, a melhor prática é abrir o separador SRC na janela

Propriedades do Projeto , selecionar um SRC, e ativar a caixa de seleção Ativar transformação dinâmica de SRC . O ícone

Estado SRC deixará de estar desativado (cinzento), e todos os temas serão dinamicamente reprojetados para o SRC mostrado junto ao ícone.

O separador SC na janela Propriedades do Projeto contem cinco componentes importantes, como mostrado na

Figure_projections_2

e descritos abaixo:

1. Aivar transformção ‘dinâmica’ de SRC — Esta caixa de seleção é usada para ativar ou desativar a projeção dinâmica. Quando desligada, cada tema é desenhado usando as coordenadas lidas dos seus dados, e os componentes descritos abaixo estão inativos. Quando ligada, as coordenadas de cada tema são projetadas para o sistema de coordenadas definido para o mapa.

2. Filtro — Se conhece o código EPSG, o identificador, ou o nome para um sistema de coordenadas, pode usar a função de pesquisa para o encontrar. Introduza o código EPSG, o identificador ou o nome.

3. Sistemas de coordenadas usados recentemente — Se tem certos SRCs que usa frequentemente no seu trabalho SIG diário, estes serão mostrados nesta lista. Clique num destes itens para selecionar o SRC correspondente.

4. Sistemas de referência de coordenadas do mundo — Esta é a lista de todos os SRCs suportados pelo

QGIS, incluindo sistemas de coordenadas Geográficas, Projetadas, e Personalizados. Para definir um SRC, selecione-o na lista expandindo o nó apropriado e selecionado o SRC. O SRC ativo está pré-selecionado.

5. Texto PROJ.4 — Este é um texto de SRC usado pelo motor de projeções PROJ.4. Este texto é de apenas leitura e fornecido para fins de informação.

10.3. Definir Reprojeção Dinâmica Voo Livre (OTF) 59

QGIS User Guide, Versão 2.6

Figura 10.2: Janela de Propriedades do Projeto

Dica: Janela de Propriedades do Projeto

Se abrir a janela Propriedades do Projeto a partir do menu :menuselecion:‘Projeto‘ , deve clicar no separador

SRC para ver as definições de SRC.

Abrindo a janela a partir do ícone

Estado SRC abrirá automaticamente o separador SRC.

10.4 Sistema de Referência de Coordenadas personalizado

Se o QGIS não fornece o sistema de referência de coordenadas que necessita, pode definir um SRC personalizado.

Para definir um SRC, seleccione SRC personalizado...

a partir do menu Definições. SRCs personalizados são salvos na sua base de dados de utilizador QGIS. Além dos seus SRCs, esta base de dados também contem os seus marcadores espaciais e outros dados personalizados.

Definindo um SRC personalizado no QGIS requer uma boa compreensão da biblioteca de projeções PROJ.4.

Para começar, consulte “Procedimentos cartográficos projeção para o Ambiente UNIX - Manual do Usuário” por Gerald I. Evenden, Serviço Geológico dos EUA Abra o Arquivo Relatório 90-284, 1990 (disponível em ftp://ftp.remotesensing.org/proj/OF90-284.pdf

).

Este manual descreve o uso do proj.4 e utilidades de linha de comando relacionados. Os parâmetros cartográficos usados com o proj.4 são descritos no manual do utilizador e são os mesmo que os usados pelo QGIS.

A janela Definição de Sistema de Referência de Coordenadas personalizado exige apenas dois parâmetros para definir um SRC ao usuário:

1. Um nome descritivo

2. Os parâmetros cartográficos do formato PROJ.4

Para criar um novo SRC, clique no botão

Adicionar novo SRC e digite um nome descritivo e os parâmetros do SRC.

60 Capítulo 10. Trabalhando com Projeções

QGIS User Guide, Versão 2.6

Figura 10.3: Janela de SRC personalizado

Note-se que o: guilabel: Parâmetros deve começar com um bloco + proj=, para representar o novo sistema de referência de coordenadas.

Você pode testar os parâmetros SRC para ver se eles dão bons resultados. Para fazer isso, digite valores conhecidos de latitude e longitude em WGS 84 Norte e :guilabel: Campos Leste, respectivamente. Clique em [Calcular], e comparar os resultados com os valores conhecidos em seu sistema de referência de coordenadas.

10.5 transformações de datum padrão

depende OTF para ser capaz de transformar dados em um ‘SRC padrão’, e QGIS usa WGS84. Para alguns SRC há uma série de transformações disponíveis. QGIS permite que você defina a transformação utilizada para outros fins QGIS usa uma transformação padrão.

Na aba SRC Configurações → Opções você pode:

• QGIS está configurado para perguntar-lhe quando ele precisa definir uma transformação usando abel: ‘Pergunte qual a transformação do datum quando nenhum padrão for definido‘

• editar uma lista dos padrões do usuário para transformações.

:guil-

.

QGIS pede qual a transformação irá usar ao abrir uma caixa de diálogo exibindo texto PROJ.4 descrevendo as transformações de origem e destino. Mais informações podem ser encontradas a respeito de uma transformação.

Os padrões do usuário podem ser salvos, selecionando Lembrar seleção .

10.5. transformações de datum padrão 61

QGIS User Guide, Versão 2.6

62 Capítulo 10. Trabalhando com Projeções

CAPÍTULO

11

QGIS Pesquisador

O Pesquisador QGIS é um painel do QGIS que permite você navegar facilmente nos seus arquivos e gerenciar seus dados geográficos. Você pode acessar os arquivos vetoriais mais conhecidos (ex.: ESRI shapefile ou arquivos

MapInfo), base de dados (ex.: PostGIS, Oracle, Spatiallite ou MSSQL Spatial) e conexões WMS/WFS. Você também pode visualizar os seus dados GRASS (para obter os dados no QGIS, veja :ref: sec_grass)

Figura 11.1: QGIS navegador como aplicação padrão

Use o Navegador QGIS para pré-visualizar seus dados. As funções de arraste e soltar torna mais fácil colocar os dados no visualizador de mapas e na legenda do Mapa.

1. Ative o Pesquisador QGIS: Clique com o direito do mouse na barra de ferramentas e marque a caixa de seleção Pesquisador ou seleccione a partir de Configurações → Paineis.

2. Arraste o painel para a janela de legenda e solte-o.

3. Clique no separador Pesquisar .

4. Pesquise em seu arquivos de sistemas e escolha a pasta shapefile do diretório qgis_sample_data.

5. Pressione a tecla :kbd: Shift e selecione os arquivos :file: airports.shp e alaska.shp.

6. Pressione o botão esquerdo do mouse, então arraste e solte os arquivos para a tela do mapa.

63

QGIS User Guide, Versão 2.6

7. Clique com o direito do mouse na camada e escolha Definir o SRC do projeto a partir da camada . Para mais informações veja

Trabalhando com Projeções .

8. Clique em

Ampliação Total para tornar todas as camadas visíveis.

Existe um segundo pesquisador disponível em Configurações → Painéis. Isto é útil quando você precisa mover arquivos ou camadas entre diferentes locais.

1. Ative o segundo Pesquisador QGIS: Clique com o direito do mouse na barra de ferramentas e marque a caixa de seleção Pesquisador (2) ou selecione a partir de Configurações → Paineis.

2. Arraste o painel para a janela de legenda.

3. Navegue para aba Pesquisador (2) e pesquise pelo shapefile no seu sistema de arquivos.

4. Selecione um arquivo com o botão esquerdo do mouse.

Agora você pode usar o ícone

Adicionar Camadas Selecionadas para adicioná-las no seu projeto atual.

O QGIS procura automaticamente o Sistema Referência de Coordenadas (SRC) e aplica o zoom na extensão da camada se você estiver trabalhando com um projeto QGIS em branco. Se já existirem arquivos no seu projeto, o arquivo será apenas adicionado e no caso que ele tenha a mesma projeção SRC, ele será visualizado. Se o arquivo tiver outro SRC e outra extensão de camada, você deve primeiro clicar com o botão direito do mouse na camada e escolher :gulabel:‘Definir SRC do Projeto na Camada‘ . Em seguida escolha :guilabel:’Zoom na extensão da camada’.

A função

Filtrar arquivos trabalha com níveis de diretório. Pesquise a pasta que deseja filtrar os arquivos e procure com uma palavra ou palavra-chave. O Pesquisador irá mostrar apenas nomes de arquivos correspondentes - outros dados não serão exibidos.

Também é possível rodar o Pesquisador QGIS como uma aplicação padrão.

Iniciar o Pesquisador qgis

• Escreva na linha de comando “qbrowser” .

• Inicie o Pesquisador QGIS utilizando o Menu Iniciar ou tecla de atalho no Desktop.

.

• O Pesquisador QGIS está disponível a partir da pasta de Aplicações.

Na figure_browser_standalone_metadata você pode visualizar as funcionalidades padrão do Pesquisador QGIS.

A aba :guilabel: Param fornece os detalhes de suas conexões de dados, like PostGIS ou MSSQL Spatial. A aba

Metadados cont;em informações gerais sobre o arquivo. (veja

Menu Metadados ). Com a aba Pré-visualização

você pode visualizar seus arquivos sem ter que importá-los para um projeto QGIS. Também é possível prévisualizar os atributos dos seus arquivos na aba Atributos.

64 Capítulo 11. QGIS Pesquisador

CAPÍTULO

12

Trabalhando com Dados Vetoriais

Atualização

12.1 Formatos de dados suportados

QGIS usa a biblioteca OGR para ler e escrever formatos de dados vetoriais, incluindo arquivos de formato

ESRI, MapInfo e formatos de arquivo MicroStation, AutoCAD DXF, PostGIS, SpatiaLite, Oracle Spatial e bancos de dados MSSQL espaciais, e muitos mais. Vetor grama e suporte ao PostgreSQL é fornecido pela nativas | qg | provedores de plugins. Dados vetoriais também podem ser carregados no modo de leitura de arquivos ZIP e GZIP em QGIS. A partir da data deste documento, 69 formatos vetoriais são suportados pela biblioteca OGR (ver OGR-SOFTWARE-SUITE em: ref: literature_and_web). A lista completa está disponível em http://www.gdal.org/ogr/ogr_formats.html

.

Nota: Nem todos os formatos mencionados podem trabalhar no QGIS por várias razões. Por exemplo, alguns exigem bibliotecas comerciais externas, ou a instalação de seu sistema operacional GDAL/OGR pode não ter sido construída para suportar o formato que você deseja usar. Apenas os formatos que foram bem testados irão aparecer na lista de tipos de arquivos ao carregar um raster no QGIS. Outros formatos não testados podem ser carregados selecionando *.*.

Procedimentos com dados vetoriais GRASS são descritos na Seção

Integração com SIG GRASS .

Esta seção descreve como trabalhar com vários formatos comuns: arquivos ESRI, camadas PostGIS, camadas

SpatiaLite, vetores OpenStreetMap e dados Comma Separated (CSV). Muitos dos recursos disponíveis no | QG

| independentemente da fonte de dados vetoriais você pode trabalhar sozinho e isso inclui identificar, selecionar, rotular e atribuir funções.

12.1.1 Shapefiles ESRI

O formato de arquivo vetorial padrão usado pelo QGIS é o Shapefile ESRI. O suporte é fornecido pela OGR

Simple Feature Library ( http://www.gdal.org/ogr/ ).

Um shapefile consiste na verdade de um conjunto de vários arquivos. Os três seguintes são necessários:

1. .shp arquivo que contém as formas vetoriais.

2. .dbf arquivo que contém os atributos no formato dBase..

3. .shx arquivos index.

Shapefiles também podem incluir um arquivo com a extensão .prj que contém as informações de projeção.

Embora seja muito útil um arquivo de projeção, não é obrigatória.

Um conjunto de dados shapefile pode conter arquivos adicionais.

Para mais detalhes veja a especificação técnica ESRI em: http://www.esri.com/library/whitepapers/pdfs/shapefile.pdf

.

65

QGIS User Guide, Versão 2.6

Carregando um Shapefile

Para carregar um arquivo comece o | QG | e clique em mActionAddOgrLayer: Adicionar um Vetor ou simplesmente pressione as teclas ‘Ctrl + Shift + V’. Isso fará com que você crie uma nova janela (ver

figura_vetor_1 ).

Figura 12.1: Diálogo Adicionando Camada Vetorial

Entre as opções disponíveis verificar : guilabel: Arquivo. Clique no [Browse]. Isso fará com que um diálogo de arquivo padrão aberto (ver

figure_vector_2 ), que permite que você navegue no sistema de arquivos e carregue

um shapefile ou outra fonte de dados suportados. A caixa de seleção: guilabel: ‘Filtro’ pré-selecionar alguns formatos de arquivos OGR suportados.

permite você

Você também pode selecionar a codificação para o shapefile, se desejar.

Figura 12.2: Diálogo abrir Camada Vetorial OGR Suportada

Ao selecinar um shapefile a partir da lista e clicando em [Abrir] o QGIS o carregará. A

Figure_vector_3

exibe o

QGIS depois de carregar o arquivo alaska.shp.

Dica: Cores das camadas

Quando você adiciona uma camada ao mapa, é atribuída uma cor aleatória. Na adição de mais de uma camada de uma vez, são atribuídas cores diferentes para cada camada.

66 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.3: QGIS com Shapefile do Alaska carregado

Uma vez carregado, você pode aplicar zoom em todo o shapefile usando as ferramentas de navegação do mapa.

Para alterar o estilo de uma camada, abra a caixa de diálogo Propriedades da Camada clicando duas vezes no nome da camada ou clicando com o botão direito do mouse sobre o nome na legenda e escolha Propriedades a partir do menu context. Consulte a Seção vector_style_tab para mais informações sobre a definição da simbologia das camadas vetoriais.

Dica: Carregando camadas e armazenando projetos em unidades externas no OS X

No OS X, unidades portáteis que são armazenadas além do disco rígido principal não aparecem no File →Open

Project ‘como esperado. Para resolver isso estamos trabalhando em uma forma mais nativa do OS X com caixa de diálogo abrir/salvar. Como alternativa, você pode digitar ‘/Volumes’ no campo Nome do arquivo e pressione

:kbd:‘Voltar . Depois, você pode navegar para unidades externas ou armazenadas em rede.

Melhorando o desempenho de Shapefiles

Para melhorar o desempenho do desenho de um shapefile, você pode criar um índice espacial. Um índice espacial irá melhorar a velocidade do zoom e visão panorâmica. Os índices espaciais utilizados pelo QGIS estão na extensão .qix.

Siga estes passos para criar o índice:

• Carregue um shapefile clicando no | mActionAddOgrLayer

|

: sup: Add Vector Layer ‘ barra de ferramentas ou pressionando camada: kbd: ‘Ctrl + Shift + V

.

• Abra a caixa de diálogo Propriedades da camada clicando duas vezes sobre o nome do shapefile na legenda ou com o botão direito do mouse e escolha Propriedades a partir do menu de contexto.

• Na guia :guilabel:’Geral’, clique no botão [Criar índice espacial].

12.1. Formatos de dados suportados 67

QGIS User Guide, Versão 2.6

Problema ao carregar um arquivo shape .prj

Se você carregar um arquivo shapefile com o :aquivo:‘.prj‘ e QGIS o sistema não é capaz de ler a referência de coordenadas a partir desse arquivo, você tem que definir a projeção adequada manualmente dentro guia :Guilabel:’Geral’ da caixa de diálogo Propriedades da camada. Isto é devido ao fato de que arquivos .prj muitas vezes não fornecem os parâmetros de projeção completos, conforme usado no QGIS e listados na guia CRS.

Por essa razão, se você criar um novo shapefile no QGIS, dois arquivos de projeção diferentes são criados. Um arquivo .prj com os parâmetros limitados de projeção, compatível com o software ESRI, e um arquivo .qpj, fornecendo os parâmetros completos dos SRC usados. Se o QGIS encontra um arquivo .qpj, ele será usado em vez do arquivo prj.

12.1.2 Carregando uma camada MapInfo

Para carregar uma camada MapInfo, clique no botão

Adicionar Camada Vetor da barra de ferramenta; ou tipo

Ctrl+Shift+V

, mudar o arquivo do tipo filtro Arquivos de Tipo

*.tab *.MIF *.TAB)’ e selecione a camada MapInfo que voce irá carregar.

: para ‘Arquivo Mapinfo [OGR] (*.mif

12.1.3 Carregando uma camada ArcInfo Binary

Para carregar um Arquivo/Informação clique no mActionAddOgrLayer: Adicionar Vetor no botão da barra de ferramentas ou pressione as teclas ‘Ctrl + Shift + V’ para abrir o guilabel: Adicionar uma informação ao Vetor.

Selecione o botão do guilabel e o Diretório do guilabel. Altere o tipo de arquivo do guilabel de SelectString para

Arquivo/Informação. Navegue até o diretório que contém o arquivo e selecione.

Da mesma forma, você pode carregar arquivos vetoriais baseados em um diretório no formato UK National Transfer, bem como os formatos TIGER do Census Bureau US.

12.1.4 Arquivos de texto delimitado

Dados em tabelas é um formato muito comum e amplamente utilizado devido à sua simplicidade e facilidade de acesso - os dados podem ser visualizados e editados até mesmo em um editor de texto simples. Um arquivo de texto delimitado é uma tabela de atributos com cada coluna separados por um caracter definido e cada linha separada por uma quebra de linha. A primeira linha geralmente contém os nomes das colunas. Um tipo comum de arquivo de texto delimitado é um arquivo CSV (Comma Separated Values), com cada coluna separado por uma vírgula.

Esses arquivos de dados também podem conter informações sobre a posição em duas formas principais:

• Coordenadas de ponto separadas por colunas

• Texto bem conhecido (WKT) representado por geometria

QGIS allows you to load a delimited text file as a layer or ordinal table. But first check that the file meets the following requirements:

1. O arquivo deve ter uma linha de cabeçalho delimitada de nomes de campo. Esta deve ser a primeira linha do arquivo de texto.

2. A linha de cabeçalho deve conter campo (s) com a definição da geometria. Estes campo (s) pode ter qualquer nome.

3. As coordenadas X e Y (se a geometria for definida pelas coordenadas) deverá ser especificada como números. O sistema de coordenadas não é importante.

Como um exemplo de um arquivo de texto válido, nós importamos o arquivo de elevação de dados de pontos elevp.csv

que vem com o conjunto de dados da amostra do QGIS (ver seção: ref: label_sampledata):

68 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

X;Y;ELEV

300120 ; 7689960 ; 13

654360 ; 7562040 ; 52

1640 ; 7512840 ; 3

[ ...

]

Alguns itens a serem observados sobre o arquivo de texto:

1. O arquivo de texto exemplo usa ; (ponto e vírgula) como delimitador. Qualquer caractére pode ser usado para delimitar os campos.

2. A primeira linha é a linha de cabeçalho. Ela contém os campos X, Y e ELEV.

3. Sem aspas (") são usados para delimitar os campos de texto.

4. A coordenada X está contida no campo X.

5. A coordenada Y está contida no campo Y.

Carregando um arquivo de texto delimitado

Clique no ícone da barra de ferramentas

Adicionar camada de texto Delimitado na barra de ferramentas Gerenciar camadas para abrir o diálogo Criar uma camada a partir de um arquivo de texto delimitado, como mostrado na

figure_delimited_text_1 .

Figura 12.4: Diálogo Texto Delimitado

Primeiro, selecione o arquivo a ser importado (por exemplo: arquivo ‘qgis_sample_data/csv/elevp.csv’) clicando no botão do [navegador]. Quando o arquivo for selecionado, | QG | tenta analisar o arquivo com o delimitador usado mais recentemente. Para ativar o | QG | para analisar corretamente o arquivo, é importante selecionar o delimitador correto. Você pode especificar um delimitador ativando pelo botão no guilabel, pelo delimitador personalizado ou pelo texto no guilabel: ‘Expressão’. Por exemplo, para alterar o delimitador de tabulação, use

“t” (esta é uma expressão para o caracter de tabulação).

Uma vez que o arquivo é analisado, definir o guilabel, selecione o botão: ‘definição de geometria’. As coordenadas são o ponto ‘X’ e o campo ‘Y das listas suspensas. As coordenadas são definidas como graus/minutos/segundos, ative a caixa de seleção no guilabel ‘DMS’.

12.1. Formatos de dados suportados 69

QGIS User Guide, Versão 2.6

Por fim, digite um nome para a camada (por exemplo: arquivo ‘elevp’), como mostrado na

figura_texto_1 . Para

adicionar a camada ao mapa, clique ** [OK] ** . O arquivo de texto delimitado agora se comporta como qualquer outra camada de mapa em | QG |

Há também uma opção de ajuda que permite cortar espaços iniciais e finais dos campos no guilabel: ‘campos da guarnição’. Além disso, é possível no guilabel: descartar campos vazios. Se necessário, você pode forçar uma vírgula para ser o separador decimal ativando no guilabel: ‘separador decimal por vírgula’.

Se a informação espacial é representada por WKT, ative o botão no guilabel: na opção ‘Texto’ e selecione o campo com a definição WKT para ponto, linha ou polígono. Se o arquivo contém dados não-espaciais, ative o botão no guilabel: ‘Não’ e ele será carregado como uma tabela.

Adicionalmente, você pode ativar:

Utilize índice espacial para melhorar o desempenho de exibição e espacialmente a seleção das feições.

Utilize índice de subconjunto .

• Assista arquivo para observar as alterações no arquivo por outros aplicativos enquanto o QGIS está sendo executado.

12.1.5 Dados OpenStreetMap

Nos últimos anos, o projeto OpenStreetMap ganhou popularidade porque, em muitos países há dados geográficos gratuitos, tais como mapas de estradas digitais estão disponíveis. O objetivo do projeto OSM é criar um mapa livre e editável do mundo a partir de dados de GPS, fotografia aérea ou conhecimento local. Para apoiar este objetivo, o QGIS fornece supporte para dados OSM.

Carregando vetores OpenStreetMap

QGIS integra importação OpenStreetMap como funcionalidade principal.

• Para conectar-se aos dados do servidor OSM e de download, abra o menu: ‘Vetor -> OpenStreetMap ->

Carregar dados’. Você pode pular esta etapa se você já obteve um arquivo XML usando .osm, JOSM, API ou qualquer outra fonte.

• No menu ‘Vetor -> OpenStreetMap -> Importar topologia de um arquivo XML’ irá converter o seu: arquivo

.osm em um banco de dados SpatiaLite e criar uma conexão de banco de dados correspondente.

• O menu ‘Vetor -> OpenStreetMap -> Exportar topologia para SpatiaLite’ permite que você abra a conexão de banco de dados, selecione o tipo de dados que você quer (pontos, linhas ou polígonos) e escolher as tags para importação. Isso cria uma camada de geometria SpatiaLite que você pode adicionar ao seu projeto, clicando no ‘Adicionar SpatiaLite Layer’ na barra de ferramentas ou selecionando a | mActionAddSpatiaLiteLayer | : ‘Adicionar Camada SpatiaLite’ opção no menu Camada (ver seção:: ref: label SpatiaLite).

12.1.6 Camadas PostGIS

Camadas PostGIS são armazenados em um banco de dados PostgreSQL. As vantagens do PostGIS são a indexação espacial, filtragem e recursos de consulta. Usando o PostGIS, funções vetoriais, como selecionar e identificar permitem um trabalho com mais precisão do que com camadas OGR no QGIS.

Criando uma conexão armazenada

A primeira vez que você usar uma fonte de dados PostGIS, você deve criar uma conexão com o banco de dados

PostgreSQL que contém os dados. Comece clicando no botão | mActionAddPostgisLayer

|

: sup: ‘Adicionar

PostGIS’, selecionando a | mActionAddPostgisLayer

|

: ‘Adicionar Camada PostGIS’ ou digitando as teclas: ‘Ctrl

+ Shift + D’. Você também pode abrir a guilabel: ‘Adicionar Vetor’ e selecione o botão banco de dados. A guilabel

70 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

‘Adicionar Tabela PostGIS’ será exibida. Para acessar o gerenciador de conexão, clique no [novo] para exibir o guilabel: ‘Criar uma nova conexão PostGIS’. Os parâmetros necessários para uma conexão são:

• Nome: Um nome para esta conexão. Pode ser o mesmo que o da base de dados.

• Serviço: parâmetro de serviço a ser usado como alternativa ao nome do host/porta (e, potencialmente, banco de dados). Esta pode ser definida em: arquivo ‘pg_service.conf’.

• Host: Nome do host no banco de dados. Este deve ser um nome de host usado para abrir uma conexão telnet ou ping. Se o banco de dados está no mesmo computador como | QG | , basta digitar ‘localhost’.

• Porta: Número da porta do servidor de banco de dados PostgreSQL atende. A porta padrão é 5432.

• Banco de dados: Nome do banco de dados.

• Modo SSL: A conexão SSL será negociado com o servidor. Note-se que a velocidade no PostGIS por camada pode ser alcançada desativando o SSL na conexão. As seguintes opções estão disponíveis:

– Desativar: tentar Apenas uma conexão SSL não criptografada.

– Permitir: Tente uma conexão não-SSL. Se isso não funcionar, tente uma conexão SSL.

– Prefira (o padrão): Tente uma conexão SSL. Se isso não funcionar, tente uma conexão não-SSL.

– Exigir: Apenas tentar uma conexão SSL.

• Nome do usuário: Nome do usuário usado para logar na base de dados.

• Senha: Senha usada com Nome do Usuário para conectar ao banco de dados.

Opcionalmente, você pode ativar as seguintes caixas de seleção:

Salvar nome do usuário

Salvar Senha

Apenas olhar na tabela geometry_columns

: guilabel: Não resolve tipo de colunas sem restrições (geometria)

:guilabel:

Apenas olhar no esquema ‘público’

Também listar tabelas sem geometrias

• Usar metadados atribuidos da tabela

Uma vez que todos os parâmetros e as opções estão configuradas, você pode testar a conexão clicando no botão

[Testar Conexão].

Carregando uma camada PostGIS

Uma vez que você tem uma ou mais conexões definidas, você pode carregar as camadas do banco de dados

PostgreSQL. Claro que isso exige ter dados no PostgreSQL. Consulte a Secção

Importação de dados no PostgreSQL

para entender sobre a importação de dados para o banco de dados.

Para colocar uma camada no PostGIS, execute os seguintes passos:

• Se o: guilabel: diálogo ‘Adicionar camadas PostGIS ‘ já não estiver aberto, selecionar o : menuselection:’ Adicionar PostGIS Camada ...‘ opção no: menuselection: Menu camada ou digitando: kbd: ‘ Ctrl +

Shift + D ‘ abre o diálogo.

• Escolha a conexão a partir da lista solta a baixo e clique em [Conectar].

• Marque ou desmarque Listar tabelas sem geometrias

• Opcionalmente, use no guilabel: ‘Opções de pesquisa’ para definir quais recursos carregar a partir da uma camada, ou usar o botão ** [Construtor de consultas] ** .

12.1. Formatos de dados suportados 71

QGIS User Guide, Versão 2.6

• Encontre a camada(s) que deseja adicionar na lista de camadas disponíveis.

• Selecione-a clicando sobre ela. Você pode selecionar várias camadas pressionando a tecla Shift enquanto clica. Consulte a Seção

Ferramenta de Consulta

para obter informações sobre como usar o Query Builder

PostgreSQL para melhor definição da camada.

• Clique no botão [Add] para adicionar a camada ao mapa.

Dica: Camadas PostGIS

Normalmente uma camada PostGIS é definida por um caminho na tabela. A partir da versão 0.9.0 em diante, o QGIS permite carregar camadas que não têm um caminho na tabela geometry_columns. Isto inclui ambas as tabelas e exibições. A definição de uma visão espacial fornece um meio poderoso para visualizar seus dados.

Consulte o manual do PostgreSQL para obter informações sobre a criação de pontos de vista diversos.

Alguns detalhes sobre as camadas PostgreSQL

Esta seção contém alguns detalhes sobre como o QGIS acessa camadas do PostgreSQL. Na maioria das vezes o QGIS simplesmente deve fornecer-lhe uma lista de tabelas do banco de dados que podem ser carregadas, e carregá-las mediante solicitação. No entanto, se você tiver problemas para carregar uma tabela do PostgreSQL no

QGIS, as informações abaixo podem ajudá-lo a entender as mensagens do QGIS e dar-lhe orientações para alterar a tabela de PostgreSQL ou ver definições para permitir o QGIS carregá-la.

QGIS requer que as camadas PostgreSQL contenham uma coluna que pode ser usada como uma chave única para a camada. Para tabelas, isso geralmente significa que a tabela precisa de uma chave primária, ou uma coluna com uma restrição exclusiva sobre ela. No QGIS, esta coluna tem de ser do tipo int4 (um inteiro de 4 bytes).

Alternativamente, a coluna ctid pode ser usada como chave primária. Se uma tabela não tem esses itens, a coluna oid será usado em seu lugar. O desempenho será melhorado se a coluna é indexada (note que as chaves primárias são automaticamente indexadas pelo PostgreSQL).

Se o banco de dados PostgreSQL é um ponto de referência, existe o mesmo requisito, mas não têm chaves ou colunas primárias com restrições exclusivas sobre eles. Você tem que definir um campo de chave primária (tem que ser inteiro) no | QG | antes de você carregar. Se uma coluna adequada não existe como requisito, | QG | não carregará. Se isso ocorrer, a solução é alterar o modo de exibição para ele incluir uma coluna adequada (um tipo inteiro com chave primária ou uma restrição exclusiva, de preferência indexado).

QGIS offers a checkbox Select at id that is activated by default. This option gets the ids without the attributes which is faster in most cases. It can make sense to disable this option when you use expensive views.

12.1.7 Importação de dados no PostgreSQL

Os dados podem ser importados para PostgreSQL/PostGIS utilizando várias ferramentas, incluindo o plugin SPIT e as ferramentas de linha de comando shp2pgsql e ogr2ogr.

Gerenciador BD

QGIS comes with a core plugin named

DB Manager

. It can be used to load shapefiles and other data formats, and it includes support for schemas. See section

Complemento Gerenciador BD

for more information.

shp2pgsql

PostGIS inclui um utilitário chamado shp2pgsql que pode ser usado para importar arquivos em um banco de dados habilitado para PostGIS. Por exemplo, para importar um arquivo denominado ‘lakes.shp’ em um banco de dados PostgreSQL chamado “gis_data”, use o seguinte comando: shp2pgsql -s 2964 lakes.shp lakes_new | psql gis_data

72 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Isso cria uma nova camada chamada lakes_new no banco de dados gis_data. A nova camada terá um identificador de referência espacial (SRID) de 2964. Consulte a Seção

Trabalhando com Projeções

para mais informações sobre os sistemas de referência espacial e projeções.

Dica: Exportando conjuntos de dados do PostGIS

Assim como a ferramenta de importação shp2pgsql, há também uma ferramenta para exportar conjuntos de dados

PostGIS como shapefiles: pgsql2shp. Este é enviado dentro de sua distribuição PostGIS.

ogr2ogr

Junto ao shp2pgsql e ao SPIT existe uma outra ferramenta para a insersão de dados geográficos no PostGIS: ogr2ogr. Esta é parte da instalação do GDAL.

Para importar um shapefile no PostGIS, faça o seguinte : ogr2ogr -f "PostgreSQL" PG:"dbname=postgis host=myhost.de user=postgres password=topsecret" alaska.shp

Isto irá importar o shapefile alaska.shp para o banco de dados PostGIS postgis usando o usuário postgres com a senha topsecret no servidor myhost.de.

Note que o OGR deve ser construído com PostgreSQL para suportar PostGIS. Você pode ver isso digitando (in

) ogrinfo --formats | grep -i post

Se você preferir usar o PostgreSQL com o comando CÓPIA em vez do padrão INSERIR, você pode exportar a seguinte variável de ambiente (pelo menos disponível em | nix | e | OSX | ): export PG_USE_COPY=YES ogr2ogr ** não cria índices espaciais como **shp2pgsl **. Você precisa criá-los manualmente, usando o comando SQL **CRIAR como um passo extra (como descrito na próxima seção: ref: ‘melhorando a performance do vetor’).

melhorando o Desempenho

Recuperando recursos a partir de um banco de dados PostgreSQL pode ser demorado, especialmente através da rede. Você pode melhorar o desempenho do desenho das camadas PostgreSQL, garantindo que o índice espacial

PostGIS existe em cada camada do banco de dados. PostGIS suporta a criação de um índice GiST (Pesquisa em forma de Árvore) para acelerar as pesquisas espaciais dos dados (informações a partir da documentação disponível no PostGIS http://postgis.refractions.net

).

A sintaxe para criar um índice GiST é:

CREATE INDEX [indexname] ON [tablename]

USING GIST ( [geometryfield] GIST_GEOMETRY_OPS );

Observe que para grandes tabelas, a criação do índice pode levar um longo tempo. Uma vez que o índice é criado, você deve realizar um VACUUM ANALYZE. Consulte a documentação do PostGIS (PostGIS-PROJECT

Referências Bibliográficas e Web ) para mais informações.

A seguir um exemplo de criação de um índice GiST: [email protected]:~/current$ psql gis_data

Welcome to psql 8.3.0, the PostgreSQL interactive terminal.

Type: \copyright for distribution terms

\h for help with SQL commands

\? for help with psql commands

12.1. Formatos de dados suportados 73

QGIS User Guide, Versão 2.6

\g or terminate with semicolon to execute query

\q to quit gis_data=# CREATE INDEX sidx_alaska_lakes ON alaska_lakes gis_data-# USING GIST (the_geom GIST_GEOMETRY_OPS);

CREATE INDEX gis_data=# VACUUM ANALYZE alaska_lakes;

VACUUM gis_data=# \q [email protected]:~/current$

12.1.8 Camadas vetoriais que ultrapassam 180 |graus| de longitude

Muitos pacotes de SIG não envolve mapas vetoriais com um sistema geográfico de referência (latitude/longitude) cruzando a linha de longitude de 180 graus ( http://postgis.refractions.net/documentation/manual-

2.0/ST_Shift_Longitude html). Como resultado, se abrirmos esse mapa em | QG | , vamos ver dois pontos, locais distintos, que deve aparecer perto um do outro. Na

Figura_vetor_4 , o ponto minúsculo no canto esquerdo da tela

do mapa (Ilhas Chatham) deve estar dentro da grade, à direita das principais ilhas da Nova Zelândia.

Figura 12.5: Mapa em lat/long atravessando a linha de longitude de 180 |graus|

A solução alternativa é transformar os valores de longitude utilizando PostGIS e a função **

ST_Shift_Longitude**. Esta função lê cada ponto/vértice dos componentes com recursos de geometria, e se coordenar a longitude < 0 graus, se acrescenta 360 graus a ele. O resultado é 0 graus - 360 graus a serem plotados em um 180 graus em um mapa centralizado.

Figura 12.6: Cruzando 180 | graus | longitude aplicação da função ** ST_Shift_Longitude **

Uso

• Importar dados para o PostGIS ( ref: ‘vetor_import_data_in_postgis’ ‘ ), utilizando, por exemplo, o complemento Gerenciador de DB.

74 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

• Use a interface do PostGIS para emitir o seguinte comando (neste exemplo, “tabela” é o nome real da tabela

PostGIS): “gis_data = # update TABELA set the_geom = ST_Shift_Longitude (the_geom);”.

• Se tudo correu bem, você deve receber uma confirmação sobre o número de recursos que foram atualizados.

Então você vai ser capaz de carregar o mapa e veja a diferença ( Figura_vetor_5 ).

12.1.9 Camadas SpatiaLite

A primeira vez que você carregar dados de um banco de dados SpatiaLite, comece clicando no | mActionAddSpatiaLiteLayer| arquivo: ‘Adicionar Camada SpatiaLite, ou selecionando a | mActionAddSpatiaLiteLayer|: ‘Adicionar Camada SpatiaLite’ ... opção do menu de seleção ou digitando as teclas: ‘Ctrl + Shift + L’. Isso abrirá uma janela que permitirá que você se conecte a um banco de dados SpatiaLite já conhecido por | QG | , que você pode escolher entre o menu flutuante, ou definir uma nova conexão com um novo banco de dados. Para definir uma nova conexão, clique em ** [Novo] ** e use o navegador para mostrar o banco de dados SpatiaLite, que é um arquivo com extensão ‘.sqlite’.

Se você quiser salvar uma camada do vetor para o formato SpatiaLite, você pode fazer isso com um clique direito na legenda. Em seguida, clique em ‘Salvar como...’, defina o nome do arquivo final, e selecione ‘SpatiaLite’ como formato e oSRC. Além disso, você pode selecionar ‘SQLite’ como formato e, em seguida, adicionar “SpatiaLite

= SIM” no campo opção da fonte de dados OGR. Isto diz OGR para criar um banco de dados SpatiaLite. Veja também http://www.gdal.org/ogr/drv_sqlite.html

.

QGIS também suporta visualizações editáveis em SpatiaLite.

Criando uma nova camada SpatiaLite

Se você quiser criar uma nova camada SpatiaLite, consulte a seção

Criando uma nova camada SpatialLite

.

Dica: Gestão complementos de dados SpatiaLite

Para o gerenciamento de dados SpatiaLite, você também pode usar vários complementos em Python: QSpatiaLite,

Gerenciamento SpatiaLite ou Gerenciamento de DB (plugin de núcleo, recomendado). Se necessário, eles podem ser baixados e instalados com o Plugin Installer.

12.1.10 Camadas Espaciais MSSQL

QGIS also provides native MS SQL 2008 support. The first time you load MSSQL Spatial data, begin by clicking on the

Add MSSQL Spatial Layer toolbar button or by selecting the from the Layer menu, or by typing Ctrl+Shift+M.

Add MSSQL Spatial Layer...

option

12.1.11 Camadas Espaciais Oracle

As feições espaciais em usuários de próteses Oracle Epacial na gestão de dados geográficos e de localização em um tipo nativo dentro de um banco de dados Oracle. O QGIS agora tem suporte para essas camadas.

Criando uma conexão armazenada

A primeira vez que você usar uma fonte de dados Oracle Espacial, você deve criar uma conexão com o banco de dados que contém os dados. Comece clicando no | mActionAddOracleLayer | : arquivo: ‘Adicionar Oracle

Espacial’, selecionando a | mActionAddOracleLayer | : ‘Adicionar Oracle Camada Espacial ... ‘ opção no menu ou digitando as teclas: ‘Ctrl + Shift + O’. Para acessar o gerenciador de conexão, clique em ** [novo] ** para exibir o guilabel: ‘Criar uma nova conexão com Oracle Espacial’. Os parâmetros necessários para uma conexão são:

• Nome: Um nome para esta conexão. Pode ser o mesmo que base de dados

12.1. Formatos de dados suportados 75

QGIS User Guide, Versão 2.6

• Base de dados: SID ou SERVICE_NAME da instância Oracle.

• Host: Nome do host no banco de dados. Este deve ser um nome de host usado para abrir uma conexão telnet ou ping. Se o banco de dados está no mesmo computador como | QG

|

, basta digitar ‘localhost’.

• Port: Número da porta do servidor de banco de dados PostgreSQL. A porta padrão é 1521.

• Usuário: Nome de usuário usado para acessar o banco de dados.

• Senha: Senha usada com Nome do Usuário para conectar ao banco de dados.

Opcionalmente, você pode ativar caixas de seleção a seguir:

• |caixa| : ‘Salvar Nome de Usuário’ Indica salvar o nome de usuário do banco de dados na configuração da conexão.

• |caixa| : ‘Salvar senha’ Indica se é para salvar a senha do banco de dados nas configurações de conexão.

• : guilabel: Olhe somente na tabela de metadados Restringe as tabelas exibidas para aqueles que estão na visão all_sdo_geom_metadata. Isso pode acelerar a exibição inicial de tabelas espaciais.

• |caixa| : ‘Verificar apenas as tabelas do usuário’ Ao procurar tabelas espaciais, restringir a pesquisa para tabelas que são de propriedade do usuário.

• :guilabel: Também lista tabelas sem geometria Indica que tabelas sem geometria também devem ser listados por padrão.

• Use estimated table statistics for the layer metadata When the layer is set up, various metadata are required for the Oracle table. This includes information such as the table row count, geometry type and spatial extents of the data in the geometry column. If the table contains a large number of rows, determining this metadata can be time-consuming. By activating this option, the following fast table metadata operations are done: Row count is determined from all_tables.num_rows. Table extents are always determined with the SDO_TUNE.EXTENTS_OF function, even if a layer filter is applied. Table geometry is determined from the first 100 non-null geometry rows in the table.

• : guilabel: Somente tipos de geometria existente listar apenas os tipos de geometria existentes e não oferecem para adicionar outros.

Uma vez que todos os parâmetros e as opções estão configuradas, você pode testar a conexão clicando no botão

[Testar Conexão].

Dica: QGIS Configurações do Usuário e Segurança

Dependendo do seu ambiente de computacional, armazenamento de senhas nas suas configurações QGIS pode ser um risco de segurança. As senhas são salvas em texto claro na configuração do sistema e nos arquivos do projeto!

Suas configurações personalizadas para o QGIS são armazenadas com base no sistema operacional:

• As configurações são armazenadas em seu diretório home em ~/.qgis2.

• As configurações são armazenadas no registro.

Carregando uma camada Espacial Oracle

Uma vez que você tem uma ou mais conexões definidas, você pode carregar camadas do banco de dados

Oracle. Claro, isso exige ter dados em Oracle.

Para carregar uma camada Espacial Oracle, execute os seguintes passos:

• Se a caixa de diálogo Oracle Espacial já estiver aberta clique em: ‘Adicionar’ arquivo: | mActionAddOracleLayer | .

• Escolha a conexão a partir da lista solta a baixo e clique em [Conectar].

• Marque ou desmarque Listar tabelas sem geometrias

76 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

.

• Opcionalmente, use o guilabel: ‘Opções de pesquisa’ para definir quais recursos será carregado a partir da camada ou use o botão de ** [Consulta] ** .

• Encontre a camada(s) que deseja adicionar na lista de camadas disponíveis.

• Selecione-o clicando sobre ele. Você pode selecionar várias camadas, mantendo pressionada a: tecla ‘Shift’ enquanto clica. Consulte a seção ref: ‘vetor_query_builder’ para obter informações sobre o uso de Oracle

Consultas para definir a camada.

• Clique no botão [Add] para adicionar a camada ao mapa.

Dica: Camadas Espacial Oracle

Normalmente, uma camada Espacial Oracle é definida por uma entrada na tabela USER_SDO_METADATA.

12.2 A Biblioteca de Símbolos

12.2.1 Apresentação

A Biblioteca de Símbolos é o lugar onde os usuários podem criar símbolos genéricos para serem usados em vários projetos QGIS. Ele permite aos usuários exporte e importe símbolos, grupos de símbolos e adicione, edite e remova os símbolos. Você pode abri-la com a guia Configurações → Biblioteca de Estilo ou do Estilo na camada vetor Propriedades.

Compartilhe e importe símbolos

Os usuários podem exportar e importar símbolos em dois formatos principais: qml (formato QGIS) e SLD (padrão

OGC). Note-se que formato SLD não é totalmente suportado pelo QGIS.

|usuário| compartilhar item exibe uma lista suspensa que permitir que os símbolos de importação ou de exportação do usuário.

Grupos e grupos inteligentes

Os grupos são categorias de símbolos e grupos inteligentes são grupos dinâmicos.

Para criar um grupo, clique com o botão direito em um grupo existente ou sobre os principais diretório Grupos no lado esquerdo da biblioteca. Você também pode selecionar um grupo e clique no botão adicionar item

.

Para adicionar um símbolo em um grupo, você pode clique direito em um símbolo, em seguida, escolha: menuselection: Aplicar ao grup e, em seguida, o nome do grupo adicionado antes. Há uma segunda maneira de adicionar vários símbolos em grupo: basta selecionar um grupo e cliquar | mActionChangeLabelProperties | e escolher Símbolos do Grupo. Todos os símbolos exibem uma caixa de seleção que permite que você adicione o símbolo para os grupos selecionados. Quando terminar, você pode clicar no mesmo botão e escolha Finalizar Agrupamento.

Criar Símbolos inteligentes é semelhante à criação de grupo, mas neste selecione Grupos Inteligentes. A caixa de diálogo permite que o usuário escolha a expressão para selecionar símbolos de forma a aparecer no grupo inteligente (contém algumas tags, membro de um grupo, tem um texto com seu nome, etc.)

Adicionar, editar, remover símbolo

Com o: guilabel: Gerenciador de Estilos do menu [Símbolo] | SelectString|, você pode gerenciar seus símbolos. Você pode | mActionSignPlus |: sup: ‘adicionar item‘, |edição| : sup:editar item, | mActionSignMinus |:

12.2. A Biblioteca de Símbolos 77

QGIS User Guide, Versão 2.6

sup:‘remover item‘ e |usuário|

Compartilhar item

. Símbolos ‘marcador’, símbolos ‘Linha’, padrões de ‘Preenchimento’ e ‘rampas de cores’ podem ser usados para criar os símbolos. Os símbolos são atribuídos a ‘todos os símbolos’, ‘Grupos’ ou ‘grupos inteligentes’.

Para cada tipo de símbolos, você encontrará sempre a mesma estrutura de diálogo:

• na parte superior do lado esquerdo uma representação símbolo

• sob a representação símbolo a árvore símbolo mostrar as camadas símbolo

• à direita você pode configurar algum parâmetro (unidade, transparência, cor, tamanho e rotação)

• sob estes parâmetros você encontra algum símbolo da biblioteca de símbolos

A árvore símbolo permitem adicionar, remover ou proteger novo símbolo simples. Você pode mover para cima ou para baixo da camada de símbolo.

Mais definições detalhadas podem ser feitas ao clicar no segundo nível no diáologo : guilabel: Símbolos da camada . Você pode definir: guilabel: Símbolo da camada que são combinados depois. Um símbolo pode ser composta por vários: guilabel: Símbolo da camada. Configurações serão mostradas mais adiante neste capítulo.

Dica: Note-se que uma vez que você definir o tamanho nos níveis mais baixos do diálogo : guilabel: Símbolos das camadas , o tamanho de todo o símbolo pode ser alterado com o menu Tamanho no primeiro nível novamente.

O tamanho dos níveis mais baixos muda consequentemente, enquanto a proporção de tamanho é mantido.

12.2.2 Marcador de Símbolos

Marcadores de Símbolos possuem vários tipos símbolo da camada:

• Marcador Elipse

• Marcador da Fonte

• Marcado Simples (padrão)

• Marcadores SVG

• Marcadores de campos vetoriais

A seguintes configurações são possíveis:

• : guilabel: Tipo do Símbolo da camada: Você tem a opção de usar marcadores de elipse, marcadores de fonte, marcadores simples, marcadores SVG e marcadores de campo vetorial.

• cores

• Tamanho

• Estilo de contorno

• Largura do contorno

• Ângulo

• : guilabel: ‘Deslocamento X,Y‘: Você pode mudar o símbolo na direção -x ou -y.

• Ancorar ponto

• Definor propriedades dos dados ...

12.2.3 Símbolos de linha

Símbolos marcador de linha têm apenas dois tipos símbolo da camada:

• Marcadores de linha

• Linha simples (padrão)

78 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

O tipo camada símbolo padrão desenha uma linha simples, enquanto a outra tela um marcador de pontos regulares na linha. Você pode escolher diferentes localizações de vértices, intervalos ou pontos centrais. O Marcação de

Linha pode ser compensado ao longo da linha ou linha de deslocamento. Finalmente, rotação permite que você mude a orientação do símbolo.

A seguintes configurações são possíveis:

• Coloração

• Espessura da caneta

• Deslocamento

• Estilo da caneta

• Estilo da união

• Estilo da capa

• Use custom dash pattern

• Unidade padrão do traço

• Definor propriedades dos dados ...

12.2.4 Símbolos do polígono

Marcador de Símbolos do Polígono tem também vários tipos símbolo da camada:

• Preenchimento do centroide

• Preenchimento em gradiente

• Preenchimento de linha padrão

• Preenchimento de ponto padrão

• Preenchimento SVG

• Preenchimento Estourar forma

• Preenchimento Simples (padrão)

• Contorno: linha de marcação (o mesmo que marcador de linha)

• Contorno: linha simples (o mesmo que marcador de linha)

A seguintes configurações são possíveis:

• Cores para a borda e o preenchimento.

• Estilo de preenchimento

• Estilo de borda

• Largura da borda

• Deslocamento X,Y

• Definor propriedades dos dados ...

Usando a caixa de combinação de cores, você pode arrastar e soltar o botão para uma cor do botão, copiar e colar a cor, escolher a cor de algum lugar, escolher uma cor da paleta de cores ou usadas recentemente ou padrão. A caixa de combinação permite que você preencha o feição com transparência. Você também pode simplesmente cliquem no botão para abrir o diálogo paleta. Note que você pode importar a cor de algum software externo como o GIMP.

‘Preenchimento Gradiente’ Tipo da camada de Símbolo permite selecionar entre as configurações | radiobuttonon | : guilabel:Duas cores e | radiobuttonoff | : guilabel: Rampa de cores. Você pode usar a | caixa | : guilabel: centroide da feição como: guilabel:Ponto de Referência. Todos os preenchimentos ‘Preenchimento Gradiente‘ Tipo da camada Símbolo também está disponível através do menu Símbolo da Renderização categorizadas e graduadas e

12.2. A Biblioteca de Símbolos 79

QGIS User Guide, Versão 2.6

através do menu Propriedades da Regra do renderizador baseada em regras. Outra possibilidade é a de escolher um

‘ preenchimento forma estourada’, que é um preenchimento gradiente tamponado, onde um gradiente é desenhado a partir do limite de um polígono em direção ao centro do polígono. Parâmetros configuráveis incluem distância do limite de sombra, uso de rampas de cor ou simples dois gradientes de cor, indefinição opcional do preenchimento e deslocamentos.

É possível apenas desenhar bordas do polígonos dentro do polígono. Usando ‘Contorno: linha simples’ selecionando | caixa | : guilabel: Desenhar linha só dentro polígono.

12.2.5 Rampa de cores

Você pode criar uma rampa de cores personalizada escolha: menuselection: Nova rampa de cor ... a partir do menu suspenso Cor de degradê. Uma caixa de diálogo pedirá o tipo da cor de degradê: Gradiente, Aleatório,

Compositor de cores, ou cpt-city. Os três primeiros têm opções para o número de etapas e / ou múltiplas paragens na rampa de cores. Você pode usar a opção | caixa | : guilabel: Inverter quanto classificar os dados com uma rampa de cores. Veja

figure_symbology_3

para um exemplo de rampa de cores personalizada e

figure_symbology_3a

para o diálogo cpt-city.

Figura 12.7: Exemplo de cor gradiente de rampa personalizado com paradas múltipla

.

A opção cpt-city abrirá um novo diálogo com centenas de temas incluídos ‘fora da caixa’

12.3 Janela de Propriedades de Vetor

A: guilabel: ‘Propriedades da camada diálogo para uma camada vetorial fornece informações sobre a camada, as configurações de simbologia e opções de rotulagem. Se sua camada de vetor foi carregado a partir de um armazenamento de dados PostgreSQL / PostGIS, você também pode alterar o SQL subjacente para a camada invocando o: guilabel: ‘diálogo Query Builder no: guilabel: guia Geral. Para acessar o: guilabel: Propriedades da camada de diálogo, clique duas vezes em uma camada na legenda ou clique com o botão direito sobre a camada e selecione: menuselection: ‘ Propriedades‘ no menu pop-up.

12.3.1 Menu Estilo

O menu Estilo lhe oferece uma ferramenta completa para renderização e simbolizar seus dados vetoriais. Você pode usar: menuselection: Renderização de Camada -> ferramentas que são comuns a todos os dados do vetor,

80 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.8: diálogo cpt-city com centenas de rampas de cores

12.3. Janela de Propriedades de Vetor 81

QGIS User Guide, Versão 2.6

82

Figura 12.9: Janela de Propriedades do Vetor

Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

bem como ferramentas de simbolização especiais que foram projetados para os diferentes tipos de dados vetoriais.

Renderização

O renderizador é responsável por desenhar um feição junto com o símbolo correto. Existem quatro tipos de renderizadores de: símbolos únicos, categorizados, graduados e baseado em regras. Não há nenhum representante de cor contínua, porque é na verdade apenas um caso especial de renderização graduada. Os renderizadores categorizados e graduados podem ser criados, especificando um símbolo e uma rampa de cores - que vai definir as cores de símbolos de forma adequada. Para camadas de ponto, há um renderizador de deslocamento de ponto disponível. Para cada tipo de dados (pontos, linhas e polígonos), tipos de símbolo de camada vetor estão disponíveis. Dependendo do processador escolhido, o menu Estilo fornece diferentes seções adicionais. No canto inferior direito da janela de simbologia, existe o botão [Símbolo], que dá acesso ao Gerenciador de estilo (veja: ref: vector_style_manager).

O Gerenciador de estilo permite que você edite e remova símbolos existentes e adicione novos.

Depois de ter feito as alterações necessárias, o símbolo pode ser adicionado à lista de estilos de símbolos atual

(usando [Símbolo]

Salvar na bibloteca de símbolos

), e então ele pode ser facilmente utilizado no futuro.

Além disso, você pode usar o botão [Salvar Estilo] |SelectString | para salvar o símbolo como um arquivo de estilo de camada (.qml) ou arquivo SLD (.sld) do |qg| . SLDs podem ser exportados a partir de qualquer tipo de processador - símbolos únicos, categorizados, graduados ou baseado em regras - mas quando a importação de um

SLD, é criado um único símbolo ou renderizador baseado em regras. Isso significa que os estilos categorizados ou graduados são convertidos para à base da regra. Se você quiser preservar esses representantes, você tem que ficar com o formato QML. Por outro lado, pode ser muito útil, por vezes, para ter esta maneira fácil de converter estilos para baseado em regras.

Se você alterar o tipo de processador ao definir o estilo de uma camada de vetor as configurações feitas para o símbolo serão mantidas. Esteja ciente de que este procedimento só funciona para uma mudança. Se você repetir a alteração do tipo de renderizador as configurações para o símbolo irão se perder.

Se a fonte de dados da camada é um banco de dados (PostGIS ou SpatiaLite por exemplo), você pode salvar o seu estilo de camada dentro de uma tabela do banco de dados. Apenas Clique na caixa combinada Salvar estilo e escolha o item Salvar na base de dados em seguida, preencha a caixa de diálogo para definir um nome de estilo, adicione uma descrição, um arquivo ui e se o estilo é um estilo padrão. Ao colocar uma camada de banco de dados, se um estilo já existe para essa camada, QGIS carregará a camada e seu estilo. Você pode adicionar vários estilos no banco de dados. Apenas um será o estilo padrão de qualquer maneira.

Figura 12.10: Diálogo Salvar estilo na base de dados

Dica: Seleção e mudança de símbolos multiplos

A simbologia permite que você selecione vários símbolos e clique no direito para mudar de cor, transparência, tamanho ou largura das entradas selecionadas.

Renderizando Símbolo Individual

12.3. Janela de Propriedades de Vetor 83

QGIS User Guide, Versão 2.6

O Renderizador de Único Símbolo é usado para processar todos as características da camada usando um único símbolo definido pelo usuário. As propriedades, que podem ser ajustados no: guilabel: Menu estilo, dependem em parte do tipo de camada, mas todos os tipos podem compartilhar essa estrutura de diálogo. Na parte superior esquerda do menu, há uma pré-visualização do símbolo atual para ser processado. Na parte direita do menu, há uma lista de símbolos já definidos para o estilo atual, preparado para ser utilizado, selecionando-os na lista.

O símbolo atual pode ser modificada usando o menu do lado direito.

Se você clicar no primeiro nível no diálogo Símbolo das camadas no lado esquerdo, é possível definir parâmetros básicos como: guilabel:tamanho, transparência , cor e Rotação. Aqui, as camadas são unidas em conjunto.

Figura 12.11: Propriedades da linha de símbolos simples

Renderizador Categorizado

O Renderizador Baseado em Regras é usado para processar todos os recursos a partir de uma camada, usando um

único símbolo definido pelo usuário cuja cor reflete o valor do atributo de uma feição selecionada. A: guilabel: menu Estilo permite que você selecione:

• O atributo (usando a caixa de listagem Coluna ou a função

Expressões )

• Símbolo (usando a aba Símbolo)

:guilabel: Definir expressão da coluna, veja

• As cores (usando a rampa de cores caixa lista)

Em seguida, clique no botão Classificar para criar classes de valor distinto na coluna atributo. Cada classe pode ser desativada desmarcando a caixa de seleção à esquerda do nome da classe.

Você pode mudar símbolo, valor e / ou rótulo do clique, clicando apenas duas vezes no item que deseja alterar.

Clique com direito mostrará um menu de contexto com Copiar/Colar, Mude a cor, Mudar transparência,

Mudar unidade de saída, Mudar largura do símbolo.

O botão ** [Avançado] ** no canto inferior direito da caixa de diálogo permite que você defina os campos que contenham informações de rotação e escala de tamanho. Para maior comodidade, o centro do menu lista os valores de todos os atributos selecionados no momento em conjunto, incluindo os símbolos que serão renderizados.

O exemplo da

figure_symbology_2

mostra a categoria usando janela de renderização para camada rios dos dados de exemplo do QGIS.

Renderização Graduada

84 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.12: Opções de simbologia categorizada

O Renderizador Baseado em Regras é usado para processar todos os recursos a partir de uma camada, usando um

único símbolo definido pelo usuário cuja cor reflete o valor do atributo do recurso selecionado para uma classe.

Como o Renderizador Categorizado , o Renderizador Graduado permite definir a rotação e escala de tamanho de colunas especificadas.

Além disso, análoga à Edição Categorizada, a guia :guilabel: Estilo permite que você selecione:

• A coluna atributo (usando a caixa de listagem Coluna ou o capítulo vector_expressions‘)

• O símbolo (usando o botão Propriedades do Símbolo)

• As cores (usando a lista de rampa de cores)

Definir expressão dafunção , veja: ref:‘

Além disso, você pode especificar o número de classes e também o modo de classificação das feições dentro das classes (usando a lista Modo). Os modos disponíveis são:

• Intervalo Igual: cada classe tem o mesmo tamanho (por exemplo, valores de 0 a 16 e com 4 classes, cada classe tem um tamanho 4);

• Quantil: cada classe terá o mesmo número de elementos no interior (a idéia de uma caixa de plotagem);

• Quebras naturais (Jenks): a variância dentro de cada classe é mínima, enquanto a variação entre as classes

é máxima;

• Desvio Padrão: classes são construídas de acordo com os valores do desvio padrão;

• Quebras perfeitas: o mesmo de quebras naturais, mas o número extremos de cada classe são inteiros.

A caixa de listagem na parte central da lista do menu Estilo as classes juntamente com as suas faixas, etiquetas e símbolos que serão renderizados.

Clique no botão Classifique para criar classes, utilizando o modo escolhido. Cada classe pode ser desativada desmarcando a caixa de seleção à esquerda do nome da classe.

Você pode mudar símbolo, valor e / ou rótulo do clique, clicando apenas duas vezes no item que deseja alterar.

Clique com direito mostrará um menu de contexto com Copiar/Colar, Mude a cor, Mudar transparência,

Mudar unidade de saída, Mudar largura do símbolo.

12.3. Janela de Propriedades de Vetor 85

QGIS User Guide, Versão 2.6

Figura 12.13: Opções de simbologia graduada

O exemplo da in

figure_symbology_4

mostra a janela de renderização graduada para camada rios dos dados de amostra do QGIS.

Dica: Mapas Temáticos usando uma expressão

Mapas temáticos categorizados e graduados podem agora ser criados usando o resultado de uma expressão. No diálogo para propriedades de camadas vetoriais , o atributo selecionador foi aumentada com a | mActionmIcon-

ExpressionEditorOpen | : guilabel: function Definir expressão da coluna. Então agora você não precisa mais escrever o atributo de classificação para uma nova coluna na sua tabela de atributos, se você quiser que o atributo de classificação para ser um composto de vários campos, ou uma fórmula de algum tipo.

Renderizador baseado em regras

O renderizador baseado em regras é utilizado para renderizar todas as feições de uma camada utilizando símbolos baseados em regras, cujas cores refletem a classificação do atributo de uma feição selecionada para uma classe.

As regras são baseadas em declarações SQL. A janela permite agrupar as regras através de filtros e escala e você pode decidir se quer habilitar níveis de símbolos ou usar somente a primeira regra correspondente.

O exemplo da

figure_symbology_5

mostra a janela de renderização baseada em regra para a camada rios dos dados de amostra do QGIS.

Para criar uma regra, ativar uma linha existente, clicando duas vezes sobre ela, ou clique em ‘+’ e clique sobre a nova regra. No diálogo Propriedade da Regra, você pode definir um rótulo para a regra. Pressione o botão para abrir o construtor de expressão de texto. Na Lista de funções, clique em: guilabel:Campos e Valores para ver todos os atributos da tabela de atributos a serem pesquisados. Para adicionar um atributo na calculadora de campo no campo Expressão, clique duas vezes em seu nome na lista Campos e Valores. Geralmente, você pode usar nos campos diversos, valores e funções para construir a expressão de cálculo, ou você pode simplesmente digitá-las na caixa (veja: ref: vector_expressions). Você pode criar uma nova regra, copiando e colando uma regra existente com o botão direito do mouse. Você também pode usar a regra de ‘ELSE’ que será executada se nenhuma das outras regras desse nível forem usadas. Desde QGIS 2.6 a etiqueta para as regras aparece em uma pseudo árvore na legenda do mapa. Basta fazer duplo clique nas regras da legenda do mapa e do menu Estilo que as propriedades da camada aparecerão mostrando a regra de que é o fundo para o símbolo na pseudo árvore.

86 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.14: Opções simbologia baseada em regra

Deslocamento de ponto

O Renderizador de Deslocamento de Ponto oferece a visualização de todas as feições de uma camada de pontos, mesmo se eles tem a mesma localização. Para para isso, os símbolos dos pontos são postos em um círculo de deslocamento ao redor de um símbolo.

Dica: Exportar simbologia vetorial

Você tem a opção de exportar simbologia de um vetor QGIS do Google *.kml, *.dxf e MapInfo* em arquivos de tabulação. Basta abrir o menu do botão direito do mouse da camada e clique em Salvar seleção como → para especificar o nome do arquivo de saída e seu formato. Na caixa de diálogo, use o menu de Exportar Simbologia para salvar a simbologia quer como Simbologia da feição → ‘ ou como :menuselection:‘Simbologia para camada símbolo

→. Se você já usou camadas de símbolos, recomenda-se usar a segunda configuração.

Polígono invertido

Renderizador de polígono invertido permite ao usuário definir um símbolo para preencher fora da camada do polígono. Como antes, você pode selecionar um subrenderizador. Estes subrenderizadores são os mesmos que para os principais representantes.

Seletor de Cores

Independentemente do tipo de estilo que será usado, o diálogo selecionar cor mostrará quando você clica para escolher uma cor - ou a borda ou cor de preenchimento. Este diálogo tem quatro guias diferentes que permitem que você selecionar cores por | mIconColorBox |: sup: ‘Rampa de cores‘, |mIconColorWheel|

Roda de cores

,

Amostra de cor ou

Obter cor

.

Seja qual for o método utilizado, a cor selecionada é sempre descrita através de seletores de cores para valores

HSV (Hue, Saturation, Value) e RGB (Red, Green, Blue). Há também uma deslizante :guilabel: opacidade para definir o nível de transparência. Na parte inferior esquerda da janela, você pode ver uma comparação entre o Atual e o Nova cor onde está atualmente a seleção e na parte inferior direita, você tem a opção de adicionar a cor que você acabou formar com o botão para o compartimento de cores.

Com

Rampa de cor ou com

Roda de cor

, você pode navegar em todas as possíveis combinações de cores. Embora existem outras possibilidades. Usando Amostra de cor você pode escolher a partir de uma lista préselecionada. Esta lista selecionada é preenchida com um dos três métodos: Cores recentes, :guilabel:‘Cores padrão ou Cores do Projeto

12.3. Janela de Propriedades de Vetor 87

QGIS User Guide, Versão 2.6

88

Figura 12.15: Diálogo deslocamento dos pontos

Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.16: Diálogo Inverter Polígono

Figura 12.17: Guia Rampa de seleção de cores

12.3. Janela de Propriedades de Vetor 89

QGIS User Guide, Versão 2.6

Figura 12.18: Guia swatcher de seleção de cores

Outra opção é usar o | mIconColorPicker | : sup: seletor de cor que lhe permite experimentar uma cor sob o ponteiro do mouse em qualquer parte do QGIS ou até mesmo de outro aplicativo, pressionando a barra de espaço.

Por favor, note que o seletor de cores é dependente de sistema operacional e não é suportada atualmente pelo OSX.

Dica: Seletor de Cor rápido + copia / cola cores

Você pode rapidamente escolher pelas cores recentes, a partir das Cores padrão ou simplesmente copiar ou colar uma cor clicando na seta arrastar para baixo, que segue uma cor atual na caixa.

Figura 12.19: Menu seletor rápido de cores

Renderização da camada

• : guilabel: Transparência da camada | deslizante | : Você pode fazer a camada subjacente na tela do mapa visível com esta ferramenta. Use o controle deslizante para se adaptar a visibilidade de sua camada de vetor para suas necessidades. Você também pode fazer uma definição precisa do percentual de visibilidade no menu ao lado do controle deslizante.

• : guilabel: Modo de mesclagem da camada e: guilabel: Modo de mesclagem de recursos: você pode conseguir efeitos especiais de renderização com essas ferramentas que você fazia antes só com programas gráficos. Os pixels da sua sobreposição e camadas sobpostas são misturados através das configurações descritas abaixo.

90 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

– Normal: Este é o modo de mistura padrão, que usa o canal alfa do pixel superior para se misturar com o pixel abaixo dela. As cores não se misturam.

– Clarear: Seleciona o máximo de cada um dos componentes do primeiro plano e pixels de fundo. Esteja ciente de que os resultados tendem a ser irregulares e duros.

– Tela: Pixels claros da fonte são pintados sobre o destino, enquanto pixeis escuros não. Este modo é muito útil para misturar a textura de uma camada com outra (por exemplo, você pode usar um monte sombreado para textura de outra camada).

– Subexposição: A subexposição irá clarear e saturar os pixeis subjacentes baseados na luminosidade do pixel superior. A maior claridade do pixel superior causa o aumento da saturação e brilho dos pixeis subjacentes. Isto funciona melhor nos pixeis superiores que não brilham muito, caso contrário o efeito

é muito extremo.

– Adição: Este modo de renderização simplesmente adiciona os valores dos pixeis de uma camada noutra. Nos casos que os valores são acima de 1 (no caso do RGB), o branco é exibido. Este modo é adequado para destacar elementos.

– Escurecer: Isso cria um pixel resultante que mantém os menores componentes de primeiro plano e dos pixeis de fundo. Como clarear, os resultados tendem a ser irregulares e permanentes.

– Multiplicar: Aqui, os números para cada pixel da camada superior são multiplicados com os números para o pixel correspondente da camada inferior. Os resultados são imagens mais escuras.

– Queimar: As cores escuras da camada superior tornam mais escuro as camadas subjacentes. Pode ser usado para ajustar e colorizar camadas subjacentes.

– Sobreposição: Este modo combina os modos multiplos e tela de mistura. Na imagem resultante, peças leves tornam-se mais leve e partes escuras ficam mais escuras.

– Luz suave: Este é muito semelhante ao sobrepor, mas em vez de usar multiplicar / tela que usa a cor queimar / esquivar. Este modo deve emular brilhar uma luz suave em uma imagem.

– Muita luz: Este modo é muito semelhante ao modo de sobreposição. É suposto simular a projecção de uma luz muito intensa numa imagem.

– Diferença: Diferença subtrai o pixel superior a partir do pixel inferior, ou o contrário, para obter sempre um valor positivo. A mesclagem com preto não produz alterações, como a diferença com todas as cores é zero.

– Subtracção: Este modo de renderização simplesmente subtrair os valores do pixel de uma camada à outra. Em caso de valores negativos, o preto é exibido.

12.3.2 Menu Rótulos

A | mActionLabeling | : sup: Camadas aplicação do núcleo fornece rotulagem inteligente para o ponto do vetor, linha e camadas de polígonos, e requer apenas alguns parâmetros. Esta nova aplicação também suporta on-the-fly camadas transformadas. As funções principais da aplicação foram redesenhadas. Em | qg

|

, há um número de outras características que melhoram a rotulagem. Os seguintes menus foram criados para identificar as camadas de vetores:

• Texto

• Formatação

• Buffer

• Pano de fundo

• Sombra

• Localização

• Desenhando

12.3. Janela de Propriedades de Vetor 91

QGIS User Guide, Versão 2.6

Vamos ver como os novos menus podem ser usados nas várias camadas vetoriais. Rotulando camadas de pontos

Iniciar | qg | e coloque uma camada de ponto vetor. Ative a camada na legenda e clique no | mActionLabeling | : sup: ícone Opções Camada Rotulagem no | qg | menu de barra de ferramentas.

O primeiro passo é ativar o | checkbox

|

: guilabel: ‘Rotular esta camada com

‘ checkbox e selecione uma coluna de atributo a ser usado para a rotulagem. Clique | mActionmIconExpressionEditorOpen | se você quiser definir etiquetas com base em expressões - Veja

labeling_with_expressions .

Os passos seguintes descrevem uma rotulagem simples sem usar o: guilabel: funções Substituição de Dados

Definido , que estão situados ao lado dos menus drop-down.

Você pode definir o estilo de texto no: guilabel: Menu Text (ver

Figure_labels_1 ). Use o: guilabel: opção Caso

Tipo de influenciar o processamento de texto. Você tem a possibilidade de tornar o texto ‘Todo Maiúscula’, ‘Todo

Minúsculas’ ou ‘Maiúscula a primeira letra’. Utilize os modos de mesclagem para criar efeitos conhecidos de programas gráficos (ver

blend_modes ).

No: guilabel: Menu Formatação ‘‘ , você pode definir um personagem para uma quebra de linha nos rótulos com a função ‘Caráter envolto ”. Use o | checkbox | : guilabel: Números Formatados opção para formatar os números em uma tabela de atributos. Aqui, decimais pode ser inseridos. Se você ativar esta opção, três casas decimais são inicialmente definidas por padrão.

Para criar uma zona de amortecimento, apenas ative a | checkbox

|

: guilabel: ‘Desenhe zona de amortecimento de texto ‘ checkbox no: guilabel: Menu‘ buffer’. A cor da zona de amortecimento é variável. Aqui você também pode usar modos de mistura (ver

blend_modes ).

Se a caixa de seleção |caixa| Cor de preenchimento da borda for ativada, ela irá interagir com o texto parcialmente transparente e dar resultados mistos de transparência da cor. Desligar o preenchimento de borda corrige essa questão (exceto quando o aspecto interior do traçado da borda cruza com o preenchimento do texto) e também permite que você faça o texto esboçado.

No: guilabel: Menu Fundo, você pode definir com: guilabel: Tamanho X e : guilabel: ‘Tamanho Y a forma do seu fundo. Use: guilabel: ‘Tamanho Tipo para inserir um ‘buffer’ adicional em seu fundo. O tamanho do buffer

é definido por padrão aqui. A imagem de fundo então consiste na imagem mais a fundo em: guilabel: Tamanho

X e : guilabel: ‘Tamanho Y . Você pode definir um: guilabel: ‘Rotação’, onde você pode escolher entre ‘Sync com etiqueta’, ‘Compensação de etiqueta’ e ‘fixo’. Usando ‘Compensação de etiqueta’ e ‘fixo’, você pode girar o plano de fundo. Definir um: guilabel: ‘X offset, Y com valores X e Y, e o fundo será deslocado. Ao aplicar: guilabel: ‘Raio X, Y

, o fundo fica com cantos arredondados. Novamente, é possível misturar o fundo com as camadas subjacentes na tela do mapa usando o: guilabel:

Blend mode ‘(ver

blend_modes ).

Use o: guilabel: menu sombra para uma: guilabel: definida pelo usuário Drop Shadow. O desenho do fundo é muito variável. Escolha entre o “componente mais baixo da etiqueta ‘,’ Texto ‘,’ Buffer ‘e” Fundo ”. A: guilabel:

ângulo offset depende da orientação da etiqueta. Se você escolher a | caixa | : guilabel: checkbox Utilize mundial sombra , logo o ponto do ângulo zero é sempre orientada para o norte e não depende da orientação do rótulo.

Você pode influenciar o aparecimento da sombra com a: guilabel: borrão raio. Quanto maior for o número, mais as sombras. A aparência da sombra também pode ser alterada pela escolha de um modo de mistura (ver

blend_modes ).

Escolha o: guilabel: Menu Colocação para a colocação da etiqueta e a prioridade rotulagem. Usando o | radiobuttonon | : guilabel: ‘Deslocamento a partir do ponto da configuração , agora você tem a opção de usar: guilabel:

Quadrantes‘ para colocar a sua marca. Além disso, você pode alterar o ângulo da colocação de etiqueta com o: guilabel: ‘ Definição de Rotação‘. Assim, um posicionamento em um determinado quadrante, com uma certa rotação é possível.

No: guilabel: Menu Rendering, você pode definir opções de etiqueta e de recursos. Under: guilabel: ‘ Opções de Etiqueta‘, você encontra a visibilidade baseada em escala definindo agora. Você pode impedir | qg | de prestar apenas rótulos selecionados com o | checkbox | : guilabel: ‘Mostrar todos os rótulos para esta camada (incluindo colidindo rótulos) checkbox. Under: guilabel: ‘Opções de Funções , você pode definir se cada parte de uma característica de várias partes devem ser rotulados. É possível definir se o número de recursos a ser rotulado é limitada e | checkbox | : guilabel: Desencorajar rótulos de cobertura características.

Rotulando camadas de linhas

O primeiro passo é ativar o | checkbox | : guilabel: ‘Rotular esta camada com ‘ checkbox e selecione uma coluna de atributo a ser usado para a rotulagem. Clique | mActionmIconExpressionEditorOpen | se você quiser definir

92 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.20: Rotulagem inteligente de camadas de pontos vetoral etiquetas com base em expressões - Veja

labeling_with_expressions .

Depois disso, você pode definir o estilo de texto no: guilabel: Menu Text. Aqui, você pode usar as mesmas configurações de camadas de pontos.

Além disso, no Menu :guilabel: Formatação, as mesmas configurações para as camadas de pontos são possíveis.

O Menu Buffer tem as mesmas funções conforme descrito na seção

labeling_point_layers .

O Menu Pano de Fundo tem as mesmas funções conforme descrito na seção

labeling_point_layers .

Além disso, o menu Sombra tem as mesmas funções conforme descrito na seção

labeling_point_layers .

No: guilabel: Menu Adaptação, você encontrará configurações especiais para as camadas de linha. O rótulo pode ser colocado | radiobuttonon

|

: guilabel: Paralelo, | radiobuttonoff

|

: guilabel: ou Curvo | radiobuttonoff

|

: guilabel:

Horizontal

. Com a | radiobuttonon | : guilabel: Paralela e | radiobuttonoff | : guilabel: opção Curvo , você pode definir a posição | caixa | : guilabel: ‘Acima de linha , | caixa |: guilabel: On line e | caixa |: guilabel: ‘Abaixo da linha ‘. É possível selecionar várias opções ao mesmo tempo. Nesse caso, | qg | irá procurar a posição ideal do rótulo. Lembre-se que aqui você também pode usar a linha de orientação para a posição da rótulo. Além disso, você pode definir um: guilabel: ‘Ângulo máximo entre caracteres curvas ‘ao selecionar o | radiobuttonoff

|: guilabel: opção Curvo ‘ (ver

Figure_labels_2 ).

Você pode configurar uma distância mínima para repetição de etiquetas. A distância pode ser em mm ou em unidades do mapa.

Alguns configuração posicionamento irá exibir mais opções, por exemplo, localização Curvada e Paralela irá permitir que o usuário configure a posição da etiqueta (acima, belw ou na linha),: guilabel: distancia a partir da linha e para: guilabel:‘ Curvado‘, o usuário também pode configurar dentro / fora ângulo máximo entre rótulo curvo.

O: guilabel: Menu Rendering tem quase as mesmas entradas como para as camadas de pontos. No: guilabel: ‘‘ opções de funções, você pode agora: guilabel: rotulagem Repressão de recursos menores do que o.

Rotulando camadas de polígonos

12.3. Janela de Propriedades de Vetor 93

QGIS User Guide, Versão 2.6

Figura 12.21: Rotulagem inteligente de camadas de linha vetorial

O primeiro passo é ativar o | checkbox | : guilabel: ‘Rotular esta camada com ‘ checkbox e selecione uma coluna de atributo a ser usado para a rotulagem. Clique | mActionmIconExpressionEditorOpen | se você quiser definir etiquetas com base em expressões - Veja

labeling_with_expressions .

No menu Texto, define o estilo de texto. A entrada pode ser com camadas de ponto e linha.

O menu Formatação permite formatar várias linhas, também semelhantes aos casos de camadas de ponto e linha.

Tal como acontece com as camadas ponto e linha, você pode criar um buffer de texto no Menu buffer.

Use o menu Pano de Fundo para criar um fundo definido pelo usuário complexo para a camada de polígono. Você pode usar o menu também como com as camadas de ponto e de linha.

As entradas no menu Sombra são as mesmas que para as camadas de ponto e linha.

No: guilabel: Menu Adaptação, você encontrar configurações especiais para as camadas de polígonos (ver

Figure_labels_3 ). | radiobuttonon

| : guilabel: ‘Deslocamento da centróide , | radiobuttonoff |: guilabel: Horizontal

(lento) , | radiobuttonoff |: guilabel: Por volta centroid , | radiobuttonoff |: guilabel: e gratuito | radiobuttonoff |: guilabel: ‘Usando perímetro são possíveis.

No | radiobuttonon | : guilabel: configuração Compensação a partir centróide, você pode especificar se o centróide

é da | radiobuttonon | : guilabel: polígono visível or | radiobuttonoff | : guilabel: todo polígono ‘. Isso significa que ou o centróide é usado para o polígono que você pode ver no mapa, ou o centróide é determinada para todo o polígono, não importa se você pode ver toda a funcionalidade no mapa. Você pode colocar a sua marca com os quadrantes aqui, e definir a compesação e rotação. A | radiobuttonoff |: guilabel: configuração ‘Por volta centróide torna possível colocar a etiqueta em torno do centróide com uma certa distância. Mais uma vez, você pode definir | radiobuttonon | : guilabel: ‘‘ ou polígono visível | radiobuttonoff | : guilabel: todo polígono ‘‘ para o centróide. Com a | radiobuttonoff | : guilabel: configurações Usando perímetro , você pode definir uma posição e uma distância para o rótulo. Para a posição, | checkbox

|

: guilabel: ‘Acima de linha , | checkbox |: guilabel:

On line , | checkbox |: guilabel:’ Abaixo da linha e | caixa

|

: guilabel: orientação Linha posição dependente são possíveis.

Relacionado com a escolha de local da etiqueta, várias opções aparecerão. Quanto ao ponto de colocação, você pode escolher a distância para o contorno do polígono, repita o rótulo ao redor do perímetro do polígono.

As entradas no menu Desenhando são as mesmas que para as camadas de linha. Você também pode usar Suprimir rotulagem de feição menor do que no Opções de feições.

Definir rótulos baseados nas expressões

94 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.22: Rotulagem inteligente de camadas de polígono vetorial

QGIS permite usar expressões características do rótulo. Basta clicar no | mActionmIconExpressionEditorOpen |

ícone no | mActionLabeling | : sup: Menu ‘ Rótulos’ da caixa de diálogo propriedades. Em

figure_labels_4

você vê a expressão de exemplo para rotular as regiões do Alasca com nome e tamanho da área, com base no campo

‘NAME_2’, um texto descritivo e a função ‘$ area () “em combinação com” format_number ()’ para torná-la mais agradável.

Expressão baseado rotulagem é fácil de trabalhar com ele. Tudo que você tem que tomar cuidado é que você precisa combinar todos os elementos (string, campos e funções) com um sinal de concatenação ‘||’ e que os campos um escrito em “aspas duplas” e strings em ‘aspas simples’. Vamos dar uma olhada em alguns exemplos:

# label based on two fields ’name’ and ’place’ with a comma as separater

"name" || ’, ’ || "place"

-> John Smith, Paris

# label based on two fields ’name’ and ’place’ separated by comma

’My name is ’ || "name" || ’and I live in ’ || "place"

-> My name is John Smith and I live in Paris

# label based on two fields ’name’ and ’place’ with a descriptive text

# and a line break (\n)

’My name is ’ || "name" || ’\nI live in ’ || "place"

-> My name is John Smith

I live in Paris

# create a multi-line label based on a field and the $area function

# to show the place name and its area size based on unit meter.

’The area of ’ || "place" || ’has a size of ’ || $area || ’m²’

-> The area of Paris has a size of 105000000 m²

12.3. Janela de Propriedades de Vetor 95

QGIS User Guide, Versão 2.6

Figura 12.23: Usando expressões para rotulagem

# create a CASE ELSE condition. If the population value in field

# population is <= 50000 it is a town, otherwise a city.

’This place is a ’ || CASE WHEN "population <= 50000" THEN ’town’ ELSE ’city’ END

-> This place is a town

Como você pode ver no construtor de expressão, você tem centenas, se as funções disponíveis para criar expressões simples e muito complexas para rotular os seus dados no QGIS. Veja: ref: capítulo vector_expressions para mais informações e exemplo em expressões.

Usando substituição definida em dados para rotulagem

Com as funções de substituição definido em dados, as configurações para a rotulagem são substituídas pelas entradas na tabela de atributo. Você pode ativar e desativar a função com o botão direito do mouse. Passe o mouse sobre o símbolo e você verá as informações sobre a substituição definida por dados, incluindo o campo de definição atual. Vamos agora descrever um exemplo usando a função de substituição definido em dados para o | mActionMoveLabel | : sup: function Mover rótulo (ver

figure_labels_5 ).

1. Importar lakes.shp para os dados de amostra QGIS.

2. Clique duas vezes na camada para abrir as Propriedades da Camada. Clique em: guilabel: ‘‘ e Labels: guilabel: ‘‘ colocação. Selecione | radiobuttonon | : guilabel: ‘Deslocamento da centróide ‘ .

3. Procure o: guilabel: Os dados definidos entradas. Clique no | mIconDataDefine | ícone para definir o tipo de campo para o: guilabel: Coordenar. Escolha ‘xlabel’ para X e ‘ylabel’ Y. Os ícones agora estão destacados em amarelo.

4. Zoom em um lago

5. Vá para a barra de ferramentas e clique no rótulo | mActionMoveLabel | ícone. Agora você pode mudar o rótulo manualmente para outra posição (ver

figure_labels_6 ). A nova posição do rótulo é guardado na

‘xlabel’ e colunas ‘ylabel’ da tabela de atributos.

96 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.24: Rotulagem de camadas vetorial de polígono com substituição de dados definida

Figura 12.25: Mover rótulos

12.3. Janela de Propriedades de Vetor 97

QGIS User Guide, Versão 2.6

12.3.3 Menu campos

Within the Fields menu, the field attributes of the selected dataset can be manipulated. The buttons

New Column and

Delete Column can be used when the dataset is in

Editing mode

.

Edição de Widget

Figura 12.26: De diálogo para selecionar um widget de edição para um atributo de coluna

No: guilabel: Menu Campos, você também encontrará uma coluna ** ferramenta de edição ** . Esta coluna pode ser utilizada para definir os valores ou variedade de valores que são permitidos para serem adicionados à coluna da tabela de atributos específicos. Se você clicar no ** [edit widget] ** botão, uma janela se abre, onde você pode definir diferentes elementos. Estes elementos são:

• ** Caixa de seleção

**

: Exibe uma caixa de seleção e você pode definir qual atributo é adicionado na coluna quando a caixa de seleção é ativada ou não.

• ** Classificação ** : Exibe uma caixa de combinação com os valores utilizados para a classificação, se você tiver escolhido “valor único” como o tipo de lenda no: guilabel: Estilo menu da caixa de diálogo propriedade

• Cor: Exibe um botão de cor permitindo que o usuário escolha uma cor na janela de diálogo de cor.

• Data / Hora: Exibe um campo de linha que pode se abre um widget de calendário para introduzir uma data, uma hora ou ambos. Tipo de coluna deve ser um texto. Você pode selecionar um formato personalizado, pop-up de um calendário, etc.

• ** Enumeração ** : Abre uma caixa de combinação com valores que podem ser usados dentro no tipo de colunas. Atualmente é suportado apenas por provedores de PostgreSQL.

• ** Nome do Arquivo

**

: Simplifica a seleção, adicionando uma janela de seleção de arquivos.

98 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

• ** Oculto ** : Uma coluna de atributo oculto é invisível. O usuário não é capaz de ver o seu conteúdo.

• Foto: Campo que contém o nome do arquivo para a imagem. A largura e altura do campo podem ser definidos.

• Tamanho: Permite definir valores numéricos de um tamanho específico. A edição do Widget pode ser um controle deslizante ou uma caixa de rotação.

• ** Relação Referência ** : Este elemento permite que você incorpore a forma característica da camada de referência sobre a forma característica da camada atual. Ver: ref: vector_relations.

• ** Edição de texto ** (padrão): Isto abre um campo de edição de texto que permite que o texto simples ou múltiplas linhas a sejam utilizados. Se você escolher várias linhas você também pode escolher o conteúdo html.

• ** Valores únicos ** : O usuário pode selecionar um dos valores já utilizados na tabela de atributos. Se editável é ativado, uma linha de edição é mostrada com suporte para autocompletar, caso contrário, uma caixa de combinação é utilizada.

• ** Gerador UUID ** : Gera um campo UUID (identificador exclusivo universal) somente para leitura, se vazio.

• ** Mapa de Valor

**

: uma caixa de combinação com itens pré-definidos. O valor é armazenado no atributo, a descrição é mostrada na caixa de combinação. Você pode definir valores manualmente ou carregá-los a partir de uma camada ou um arquivo CSV.

• ** Relação de Valor ** : Oferece valores de uma tabela relacionada em um combobox. Você pode selecionar camada, coluna de chave e na coluna valor.

• Webview: Campo que contém o nome do arquivo para a imagem. A largura e altura do campo podem ser definidos.

Com o ** Attribute editor layout** , agora você pode definir embutido formulários para trabalhos de entrada de dados (ver

figure_fields_2 ). Escolha ‘Arrastar e soltar design’ e uma coluna de atributo. Use o ícone | mAc-

tionSignPlus | para criar uma categoria que você quer serão mostradas durante a sessão de digitalização (ver

figure_fields_3 ). O próximo passo será o de atribuir os campos relevantes para a categoria com o | mActionAr-

rowRight | ícone. Você pode criar mais categorias e utilizar os mesmos campos novamente. Ao criar uma nova categoria,

| qg | irá inserir uma nova guia para a categoria no built-in formulário.

Outras opções na caixa de diálogo são “Autogenerate” e “Fornecer arquivo ui ‘. ‘Autogenerate “apenas cria editores para todos os campos e tabula-os. A opção ‘Fornecer arquivo ui’ permite que você use os diálogos complexas feitas com o Qt Designer. Usando um arquivo de interface do usuário permite uma grande liberdade na criação de um diálogo. Para obter informações detalhadas, consulte http://nathanw.net/2011/09/05/qgis-tipscustom-feature-forms-with-python-logic/ .

QGIS diálogos podem ter uma função Python que é chamado quando a caixa de diálogo é aberta. Use esta função para adicionar lógica extra para seus diálogos. Um exemplo é (no módulo MyForms.py): def open(dialog,layer,feature): geom = feature.geometry() control = dialog.findChild(QWidged,"My line edit")

Referência na Função Python Init como: MyForms.open

MyForms.py deve existir em PYTHONPATH, em .qgis2/python, ou dentro da pasta do projeto.

12.3.4 Menu Geral

Use this menu to make general settings for the vector layer. There are several options available:

Informação da Camada

• Alterar o nome de exibição da camada em: guilabel: apresentado como

• Define o: guilabel: source Camada da camada de vetor

12.3. Janela de Propriedades de Vetor 99

QGIS User Guide, Versão 2.6

Figura 12.27: Diálogo para criar categorias com o **

|

Editor Disposição Atributo **

100

Figura 12.28: Resultando formulário embutido em uma sessão de entrada de dados

Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

• Defina o: guilabel: codificação de fonte de dados para definir opções específicas do provedor e ser capaz de ler o arquivo

Sistema de Referência de Coordenadas

• : guilabel: Especificar o sistema de referência de coordenadas. Aqui, você pode visualizar ou alterar a projeção da camada vetorial específica.

• Crie um índice espacial (somente para formatos OGR suportados)

• : guilabel: informação Atualizar Extensões para uma camada

• Exibir ou alterar a projeção da camada de vetor específico, clicando em: guilabel: Especifique ...

|caixa de seleção| : guilabel: Escala dependente visibilidade

• Você pode definir o: guilabel: máximo (inclusivo) e: guilabel: mínima (exclusivo) escala. A escala também pode ser definido pelas ** [Atuais] ** botões.

Características subconjuntos

• Com o botão [Construtor de consulta], você pode criar um subconjunto dos feições na camada que será visualizada (consulte também a seção: ref: vector_query_builder).

Figura 12.29: Menu geral no vetor camadas propriedades diálogo | nix |

12.3.5 Menu Renderizador

QGIS 2.2 introduz suporte para generalização de feição on-the-fly. Isso pode melhorar o tempo de edição ao desenhar muitas unidades complexas em pequenas escalas. Esta feição pode ser ativada ou desativada nas configurações de camada usando a opção

|caixa|

:guilabel: Simplifique geometria. Há também uma nova configuração global que permite a generalização, por padrão, para as camadas recém-adicionadas (ver seção :ref: gui_options). Nota:

12.3. Janela de Propriedades de Vetor 101

QGIS User Guide, Versão 2.6

generalização de feições pode introduzir resquícios em sua saída editada em alguns casos. Isto podem incluir lascas entre polígonos e prestação imprecisa quando usando camadas de símbolos baseadas em deslocamento.

12.3.6 Menu Visualização

This menu is specifically created for Map Tips. It includes a new feature: Map Tip display text in HTML.

While you can still choose a Field to be displayed when hovering over a feature on the map, it is now possible to insert HTML code that creates a complex display when hovering over a feature. To activate Map Tips, select the menu option View → MapTips. Figure Display 1 shows an example of HTML code.

Figura 12.30: Código HTML para dica de mapa

102

Figura 12.31: Dica de mapa feito com código HTML

Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

12.3.7 Menu de Ações

QGIS fornece a capacidade de executar uma ação com base nos atributos de uma feição. Isso pode ser usado para executar qualquer número de ações, por exemplo, a execução de um programa com argumentos construídos a partir dos atributos de uma feição ou passar parâmetros ao uma ferramenta de comunicação web.

Figura 12.32: Visão geral do diálogo de ação com algumas ações de amostra | nix |

Ações são úteis quando você frequentemente deseja executar uma aplicação externa ou visualizar uma página web com base em um ou mais valores em sua camada de vetor. Elas são divididas em seis tipos e pode ser usadas assim:

• Iniciar ações genéricas, Mac, Windows e Unix em um processo externo.

• Executar ações Python uma expressão Python.

• Ações genéricas e Python são visíveis em toda parte.

• Ações Mac, Windows e Unix são visíveis apenas na respectiva plataforma (ou seja, você pode definir ações de três “Editar” para abrir um editor e os usuários só podem ver e executar a ação “Editar” na sua plataforma para executar o editor) .

Existem vários exemplos incluídos na caixa de diálogo. Você pode carregá-los clicando no [Adicionar ações padrão]. Um exemplo é a realização de uma pesquisa com base em um valor de atributo. Este conceito é usado na discussão a seguir.

** Definição de Ações **

Atributo ações são definidas a partir do vetor: guilabel: diálogo ‘Propriedades da Camada . Para: índice: ‘Definir uma Ação , abra o vetor: guilabel: ‘Propriedades da Camada ‘ de diálogo e clique no: guilabel: Menu‘ Ações .

Vá para o: guilabel: ‘propriedades Ação . Selecione ‘genérico’ como tipo e fornecer um nome descritivo para a ação. A própria ação deve conter o nome do aplicativo que será executado quando a ação é invocado. Você pode adicionar um ou mais valores de campos de atributos como argumentos para a aplicação. Quando a ação

é chamada, qualquer conjunto de caracteres que começam com um ‘‘ % ‘‘ , seguido do nome de um campo será substituído pelo valor desse campo. Os caracteres especiais: índice: %% será substituído pelo valor do campo

12.3. Janela de Propriedades de Vetor 103

QGIS User Guide, Versão 2.6

que foi selecionado da tabela identificam resultados ou atributo (ver

using_actions

abaixo). Aspas duplas podem ser usadas ao texto do grupo em um único argumento para o programa, script ou comando. Aspas duplas serão ignoradas se precedido por uma barra invertida.

Se você tem os nomes de campo que são substrings de outros nomes de campo (por exemplo,‘‘ col1‘‘ e col10

), você deve indicar, cercando o nome do campo (e do %caráter) entre colchetes (por exemplo, [%col10] ).

Isso impedirá que o campo com nome %Col10 seja confundido com o campo de nome %col1 com um 0 no final. Os suportes serão removidos por QGIS quando se substitui no valor do campo. Se você deseja que o campo substituído seja cercado por colchetes, utilizar um segundo conjunto da seguinte maneira: [[% Col10]].

Usando o: guilabel: ferramenta Identificar as Características, você pode abrir o: guilabel: diálogo Identificar resultados . Ele inclui um item * (Derivado) * que contém informações relevantes para o tipo de camada. Os valores deste item pode ser acessados de maneira semelhante a outros campos fazendo preceder o nome do campo derivado com ‘‘ (Derivado).

‘‘ . Por exemplo, uma camada de pontos tem um campo ‘‘ X ‘‘ e ‘‘ Y ‘‘ , e os valores destes campos pode ser utilizado no processo com ‘‘ % (derivado).X ‘‘ e ‘‘ % (Derived ). Y ‘‘ . Os atributos derivados só estão disponíveis a partir do: guilabel: Identificar Resultados caixa de diálogo, e não o: guilabel: caixa de diálogo ‘ Attribute Table ‘.

Dois: índice: ações exemplo são mostradas abaixo:

• konqueror http://www.google.com/search?q=%nam

• konqueror http://www.google.com/search?q=%%

No primeiro exemplo, o navegador Konqueror é consultado e passou uma URL para abrir.

A URL executa uma pesquisa no Google sobre o valor do campo ‘‘ nam‘‘ da nossa camada vetorial.

Note-se que a aplicação ou script chamado pela ação devem estar no caminho, ou você deve fornecer o caminho completo.

Para ter certeza, poderíamos reescrever o primeiro exemplo como: ‘‘ /opt/kde3/bin/konqueror http://www.google.com/search?q=%nam ‘‘ . Isto irá assegurar que a aplicação konqueror será executado quando a ação é consultada.

O segundo exemplo usa a notação % % , que não depende de um campo específico para o seu valor. Quando a ação é consultado, o % % será substituído pelo valor do campo selecionado na tabela de identificar resultados ou atributo. ** Utilizando Ações **

As ações podem ser chamados a partir de qualquer: guilabel: ‘‘ Identificar resultados de diálogo, uma: guilabel: diálogo Tabela de Atributos ‘ ou a partir de: guilabel:’Execute Ação de Recurso (lembre-se que esses diálogos podem ser abertos clicando | mActionIdentify

|

: sup : identificar as características ou | mActionOpenTable

|

: sup:

Open Table Atributo or | mAction

|

: sup: Ação recurso Execute o). Para chamar uma ação, clique direito sobre o disco e escolha a ação a partir do menu pop-up. As ações são listadas no menu pop-up com o nome que você atribuiu ao definir a ação. Clique na ação que você deseja executar.

Se você está chamando uma ação que usa o ‘‘ % ‘‘ % notação, clique com o botão direito sobre o valor do campo na: guilabel: ‘‘ Identificar resultados de diálogo ou o: guilabel: ‘Tabela de atributos‘ diálogo que você deseja passar para a aplicação ou script.

Aqui está outro exemplo que puxa os dados de uma camada vetorial e os insere em um arquivo usando o bash e o comando‘‘eco‘‘ (por isso só vai funcionar no|nix| ou talvez no|osx|). A camada em questão tem campos para um nome da espécie taxon_name , latitude lat e longitude long . Eu gostaria de ser capaz de fazer uma seleção espacial das localidades e exportar esses campos de valores em um arquivo de texto para o registro selecionado

(mostrado em amarelo na área do mapa do QGIS). Aqui é a ação para atingir este objectivo: bash -c "echo \"%taxon_name %lat %long\" >> /tmp/species_localities.txt"

Depois de selecionar algumas localidades e executar a ação em cada um, a abertura do arquivo de saída irái mostrar algo como isto:

Acacia mearnsii -34.0800000000 150.0800000000

Acacia mearnsii -34.9000000000 150.1200000000

Acacia mearnsii -35.2200000000 149.9300000000

Acacia mearnsii -32.2700000000 150.4100000000

Como um exercício, criamos uma ação que faz uma pesquisa no Google sobre o a camada lagos. Primeiro, precisamos determinar o URL necessário para realizar uma pesquisa sobre a palavra-chave. Isso póde ser realizado facilmente indo ao Google e realizando uma pesquisa simples, em seguida, pegar a URL na barra de endereços do

104 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

seu navegador. A partir deste pequeno esforço, vemos que o formato é: http://google.com/search?q=qgis , onde

QGIS é o termo de pesquisa. Armado com esta informação, podemos prosseguir:

1. Verifique se a camada lagos está carregada.

2. Abra a caixa de diálogo Propriedades da camada clicando duas vezes sobre o nome do shapefile na legenda ou com o botão direito do mouse e escolha Propriedades a partir do menu pop-up.

3. Clique em :guilabel: menu ‘Ações’.

4. Digite um nome para a ação, por exemplo ‘‘ Google Search ‘‘ .

5. Para a ação, precisamos fornecer o nome do programa externo a ser executado. Neste caso, podemos usar o

Firefox. Se o programa não estiver em seu caminho, você precisará fornecer o caminho completo.

6. Seguindo o nome da aplicação externa, adicione a URL usada para fazer uma pesquisa no Google, mas não inclua o termo de busca: ‘‘ http://google.com/search ?q=‘‘

7. O texto no campo de ação será mostrado como este: ‘‘ firefox http://google.com/search?q

=‘‘

8. Clique na caixa oculta que contém os nomes dos campos para camada ” lagos”. Ele está localizado logo ao lado esquerdo do botão [Inserir Campo] .

9. A partir da caixa drop-down, selecione ‘NOMES’ e clique ** [Inserir campo]. **

10. Seu texto ação agora se parecerá como este: firefox http://google.com/search?q=%NAMES

11. Para finalizar a ação, clique no botão [Adicionar à lista de ações].

Isso completa a ação, e ele está pronto para usar. O texto final da ação deve ser semelhante a este: firefox http://google.com/search?q=%NAMES

Agora podemos utilizar a ação. Feche a: aba de diálogo: ‘Propriedades da camada ‘ e aplique um zoom em uma

área de interesse. Certifique-se que a camada lagos está ativa e identifique um lago. Na caixa o resultado que você poderá visualizar que a nossa ação está visível:

Figura 12.33: Selecione a característica e escolha ação

Quando clicamos sobre a ação, ela faz o Firefox e navegar para o URL http://www.google.com/search?q=Tustumena .

Também é possível adicionar outros campos de atributo para essa açao. Para isso basta um + ao final do texto de ação, selecionar outro campo e clicar em [Inserir Campo].

Nesse exemplo não temos outro campo disponível para efetuarmos a busca.

Você pode definir várias ações para uma camada, e cada um vai aparecer no diálogo Identificar resultados.

12.3. Janela de Propriedades de Vetor 105

QGIS User Guide, Versão 2.6

Há todos os tipos de usos para as ações. Por exemplo, se você tem uma camada de pontos que contém as localizações de imagens ou fotos, juntamente com um nome de arquivo, você pode criar uma ação para lançar um visualizador para exibir a imagem. Você também pode usar ações para lançar relatórios baseados na web para um campo de atributo ou combinação de campos, especificando-as da mesma forma que fizemos no nosso exemplo de busca Google.

Nós também podemos fazer exemplos mais complexos, por exemplo, usando ações Python.

Normalmente, quando nós criamos uma ação para abrir um arquivo com uma aplicação externa, podemos usar caminhos absolutos, ou, eventualmente, caminhos relativos. No segundo caso, o caminho é relativo ao local do arquivo executável do programa externo. Mas o que dizer se precisamos usar caminhos relativos, em relação à camada selecionada (um baseado em arquivo, como um shapefile ou SpatiaLite)? O código a seguir irá fazer o truque: command = "firefox"; imagerelpath = "images_test/test_image.jpg"; layer = qgis.utils.iface.activeLayer(); import os.path; layerpath = layer.source() if layer.providerType() == ’ogr’ else (qgis.core.QgsDataSourceURI(layer.source()).database() if layer.providerType() == ’spatialite’ else None); path = os.path.dirname(str(layerpath)); image = os.path.join(path,imagerelpath); import subprocess; subprocess.Popen( [command, image ] );

Nós apenas temos que lembrar que a ação é um do tipo variáveis Python e o comando e imagerelpath devem ser alteradas para atender as necessidades.

Mas o que dizer se o caminho relativo deve ser relativo ao arquivo de projeto (salvo)? O código da ação Python seria: command = "firefox" ; imagerelpath = "images/test_image.jpg" ; projectpath = qgis .

core .

QgsProject .

instance() .

fileName();

import os.path

; path = os .

path .

dirname( str (projectpath))

if

projectpath != ’’

else

None ; image = os .

path .

join(path, imagerelpath);

import subprocess

; subprocess .

Popen( [command, image ] );

Outro exemplo de ação Python é a que nos permite adicionar novas camadas ao projeto. Por exemplo, os exemplos a seguir irão adicionar ao projeto, respectivamente, um vetor e raster. Os nomes dos arquivos a serem adicionados ao projeto e os nomes a serem indicados para as camadas são conduzidos de dados (nome do arquivo e nome da camada são nomes da tabela de atributos do vetor, onde a ação foi criada coluna): qgis .

utils .

iface .

addVectorLayer( ’/yourpath/[% "filename" %].shp’ , ’[% "layername" %]’ ,

’ogr’ )

Para adicionar um raster (uma imagem TIF neste exemplo), ele se torna: qgis.utils.iface.addRasterLayer(’/yourpath/[% "filename" %].tif’,’[% "layername" %]

’)

12.3.8 Menu Juntar

|juntar| O menu Juntar permite juntar uma tabela de atributos a uma camada de vetor carregada. Depois de clicar

, aparecerá o diálogo Juntar ao vetor adicionado. Como colunas de chave, você tem que definir um juntar camada que você deseja se conectar com a camada de vetor alvo. Então, você tem que especificar o campo de associação que é comum a ambos as camada de aderir e a camada de destino. Agora você também pode especificar um subconjunto de campos da camada se juntou com base na caixa |caixa| Escolha quais campos serão juntados .

Como um resultado da junção, todas as informações da camada de junção e a camada de destino são apresentados

106 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

na tabela de atributos da camada de informações de destino como se juntou. Se você especificou um subconjunto de campos somente esses campos são exibidos na tabela de atributos da camada de destino.

QGIS atualmente tem suporte para juntar formatos de tabela não-espaciais suportados pela OGR (por exemplo,

CSV, DBF e Excel), texto delimitado e o provedor do PostgreSQL (veja

figure_joins_1 ).

Figura 12.34: Junte uma tabela de atributos de uma camada de vetor existente | nix |

Além disso, o diálogo juntar vetor adicionado permite:

• Cache join layer in virtual memory

• Create attribute index on the join field

12.3.9 Menu Diagramas

The Diagrams menu allows you to add a graphic overlay to a vector layer (see

figure_diagrams_1 ).

A implementação atual do núcleo de diagramas fornece suporte para gráficos de pizza, diagramas de texto e histogramas.

O menu é dividido em quatro abas: Aspecto, Tamanho, Posição e Opções.

Nos casos de o diagrama de texto e gráfico de pizza, valores de texto de diferentes colunas de dados são exibidos um abaixo do outro, com um círculo ou uma caixa e divisores. Na guia :guilabel: Tamanho, tamanho diagrama

é baseado em um tamanho fixo ou em escala linear de acordo com um atributo de classificação. A colocação dos diagramas, o que é feito na guia Posição, interage com a nova rotulagem, assim conflitos de posição entre os diagramas e os rótulos são detectados e resolvidos. Além disso, as posições de gráfico pode ser corrigidas manualmente.

Vamos demonstrar um exemplo e sobrepor sobre a camada limite Alaska um diagrama de texto mostrando dados de temperatura a partir de uma camada vetorial climática. Ambas as camadas de vetores fazem parte do conjunto de dados da amostra do QGIS (ver seção :ref: label_sampledata).

12.3. Janela de Propriedades de Vetor 107

QGIS User Guide, Versão 2.6

Figura 12.35: Diálogo propriedades Vetoriais com menu diagrama

1. Primeiro, clique no ícone

Carregar Vecor

, procure a pasta conjunto de dados da amostra do QGIS, e carrege as duas camadas shape vetorial :file: alaska.shp e :file: ‘ climate.shp

‘ .

2. Dê um clique duplo na camada clima na legenda do mapa para abrir a aba de diálogo ‘Propriedades da camada ‘ .

3. Clique no menu Diagramas, ative

|caixa|

Exibição de diagramas , e o tipo Diagrama caixa de combinação

, selecione ‘diagrama de Texto’.

4. Na guia Aparência, escolhemos um azul claro como cor de fundo, e na guia Tamanho, montamos um tamanho fixo de 18 mm.

5. Na guia Posição, a colocação pode ser definida como ‘em torno do ponto’.

6. Iremos mostrar os valores das três colunas T_F_JAN, T_F_JUL e T_F_MEAN. Primeiro, seleccione

T_F_JAN como atributos e clique no botão , e de seguida T_F_JUL e finalmente T_F_MEAN.

7. Agora clique ** [Aplicar] ** para exibir o diagrama no | qg | janela principal.

8. Você pode adaptar o tamanho do gráfico no: guilabel: guia ‘ Tamanho‘. Desative a | checkbox | : guilabel:

Tamanho Fixo e defina o tamanho dos diagramas com base em um atributo com o ** [Encontrar valor máximo] ** botão e o: guilabel: menu Tamanho. Se os diagramas aparecerem muito pequeno na tela, você pode ativar o | checkbox | : guilabel: ‘Aumentar o tamanho de pequenos diagramas ‘ e definir o tamanho mínimo dos diagramas.

9. Mude as cores de atributos clicando duas vezes sobre os valores de cor no campo atributos atribuídos.

Figure_diagrams_2

dá uma idéia do resultado.

10. Finalmente, clique [Ok].

Lembre-se que no: guilabel: guia ‘ Posição‘, a | checkbox | : guilabel: Dados posição definida dos diagramas

é possível. Aqui você pode usar atributos para definir a posição do diagrama. Você também pode definir a visibilidade dependente escala no: guilabel: guia ‘ Aparência‘.

108 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.36: Diagrama de dados de temperatura sobrepostos no mapa | nix |

O tamanho e os atributos também pode ser uma expressão. Use o botão ref: capítulo vector_expressions para obter mais informações e exemplo.

para adicionar uma expressão. Veja:

12.3.10 Menu Metadados

The Metadata menu consists of Description, Attribution, MetadataURL and Properties sections.

No: guilabel: seção Propriedades, você obter informações gerais sobre a camada, incluindo especificações sobre o tipo e localização, número de recursos, tipo de recursos e capacidades de edição. A: guilabel: tabela Extensões fornece informações camada de extensão e a: guilabel: ‘ Camada Sistema de Referência Espacial ‘, é a informação sobre o CRS da camada. Esta é uma forma rápida de obter informações sobre a camada.

.

Além disso, você pode adicionar ou editar um título e resumo para a camada no: guilabel: seção Descrição.

Também é possível definir um: guilabel: lista de palavras-chave . Estas listas de palavras-chave podem ser utilizada em um catálogo de metadados. Se você quiser usar um título de um arquivo de metadados XML, você tem que preencher um link no: guilabel: campo DataURL. Use: guilabel: Atribuição para obter dados de atributos de um catálogo de metadados XML. In: guilabel: MetadataUrl, você pode definir o caminho geral para o catálogo de metadados XML. Esta informação será salva no | qg | arquivo de projeto para as sessões subseqüentes e será utilizado para | qg | servidor.

12.4 Expressões

Os recursos Expressões estão disponíveis através da calculadora de campo ou no botão adicionar uma nova coluna na tabela de atributo ou a guia de campo nas propriedades da camada; através do graduado, categorizados e renderização baseada em regra na guia Estilo de as propriedades da camada; através da rotulagem baseado na expressão | browsebutton | na aplicação do núcleo | mActionLabeling | : sup: Rotulagem; através da seleção de feições e através da guia diagrama das propriedades da camada.

Há uma maneira poderosa para manipular valor do atributo a fim de mudar dinamicamente o valor final, a fim de mudar o estilo de geometria, o conteúdo do rótulo, o valor para o diagrama, selecione algumas feições ou criar um campo virtual.

12.4. Expressões 109

QGIS User Guide, Versão 2.6

Figura 12.37: Menu Metadata no diálogo das propriedades das camadas de vetor | nix |

12.4.1 Lista de funções

A Lista de funções contêm funções bem como os campos e valores. Veja a ajuda da função em Ajuda da Função

Selecionada. Em Expressão voce verá a expressão para calculo que voce criou com a Lista de Funções. Para ver as operações mais comuns usadas, veja Operadores.

No Lista de funções, clique em: guilabel: Campos e Valores para ver todos os atributos da tabela de atributos a serem pesquisados. Para adicionar um atributo para a calculadora campo no campo Expressão, clique duas vezes em seu nome na lista Campos e Valores. Geralmente, você pode usar nos campos diversos, valores e funções para construir a expressão de cálculo, ou você pode simplesmente digitá-la na caixa. Para exibir os valores de um campo, você apenas clique direito sobre o campo apropriado. Você pode escolher entre: guilabel:carregar os 10 valores únicos de topo carregar todos valores únicos . No lado direito, a lista dos valores dos campos abrirá com os valores exclusivos. Para adicionar um valor na calculadora de campo na caixa Expressão, clique duas vezes em seu nome na lista Valores dos Campos.

Os grupos :guilabel: Operadores, Matemática, Conversões, String, Geometria e Registro fornecem várias funções.

Em Operadores, você encontra operadores matemáticos. Procura em Matemática as funções matemáticas. O grupo Conversões contém funções que convertem um tipo de dados para outro. O grupo String fornece funções para cadeias de dados. No grupo Geometria, você encontra funções para objetos de geometria. Com as funções do grupo Registro, você pode adicionar uma numeração para o seu conjunto de dados. Para adicionar uma função na calculadora de campo na caixa Expression, clique no > e, em seguida, clicar duas vezes sobre a função.

Operadores

O grupo operadores contem (ex.: +, -, *).

a + b a - b a * b a / b a % b a ^ b a plus b a minus b a multiplied by b a divided by b a modulo b (for example, 7 % 2 = 1, or 2 fits into 7 three times with remainder 1) a power b (for example, 2^2=4 or 2^3=8)

110 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

a = b a > b a < b a <> b a != b a <= b a >= b a ~ b

+ a

- a

||

LIKE

ILIKE a and b are equal a is larger than b a is smaller than b a and b are not equal a and b are not equal a is less than or equal to b a is larger than or equal to b a matches the regular expression b positive sign negative value of a joins two values together into a string ’Hello’ || ’ world’ returns 1 if the string matches the supplied pattern returns 1 if the string matches case-insensitive the supplied pattern (ILIKE can be used instead of LIKE to make the match case-insensitive)

IS

OR

AND

NOT returns 1 if a is the same as b returns 1 when condition a or b is true returns 1 when condition a and b are true returns 1 if a is not the same as b column name "column name" value of the field column name, take care to not be confused with simple quote, see below

’string’

NULL a IS NULL a IS NOT NULL a IN (value[,value]) a NOT IN (value[,value]) a string value, take care to not be confused with double quote, see above null value a has no value a has a value a is below the values listed a is not below the values listed

Alguns exemplos:

• Juntando um texto e um valor a partir de um nome de coluna:

’My feature’s id is: ’ || "gid"

• Teste se a “descrição” campo de atributo começa com o texto a ‘Olá’ do valor (observe a posição do caractere

%):

"description" LIKE ’Hello%’

Condicionais

Este grupo contém funções para lidar com verificações condicionais em expressões.

CASE

CASE ELSE coalesce regexp_match evaluates multiple expressions and returns a result evaluates multiple expressions and returns a result returns the first non-NULL value from the expression list returns true if any part of a string matches the supplied regular expression

Alguns exemplos:

• Enviar de volta um valor se a primeira condição é verdade, outra coisa manda outro valor:

CASE WHEN "software" LIKE ’%QGIS%’ THEN ’QGIS’ ELSE ’Other’

12.4. Expressões 111

QGIS User Guide, Versão 2.6

Funções Matemáticas

Este grupo contém funções matemáticas (por exemplo, raiz quadrada, sen e cos).

sqrt(a) abs sin(a) cos(a) tan(a) asin(a) acos(a) atan(a) atan2(y,x) exp ln log10 log round rand randf max min clamp scale_linear scale_exp floor ceil

$pi square root of a returns the absolute value of a number sine of a cosine of a tangent of a arcsin of a arccos of a arctan of a arctan of y/x using the signs of the two arguments to determine the quadrant of the result exponential of a value value of the natural logarithm of the passed expression value of the base 10 logarithm of the passed expression value of the logarithm of the passed value and base round to number of decimal places random integer within the range specified by the minimum and maximum argument (inclusive) random float within the range specified by the minimum and maximum argument (inclusive) largest value in a set of values smallest value in a set of values restricts an input value to a specified range transforms a given value from an input domain to an output range using linear interpolation transforms a given value from an input domain to an output range using an exponential curve rounds a number downwards rounds a number upwards pi as value for calculations

Conversões

Este grupo contém funções para converter um tipo de dado para outro (por exemplo, texto para inteiro, inteiro para texto).

toint toreal tostring todatetime todate totime tointerval converts a string to integer number converts a string to real number converts number to string converts a string into Qt data time type converts a string into Qt data type converts a string into Qt time type converts a string to an interval type (can be used to take days, hours, months, etc. off a date)

Funções Data e hora

Este grupo contém funções para trabalhar datas e hora data.

112 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

$now age year month week day hour minute second current date and time difference between two dates extract the year part from a date, or the number of years from an interval extract the month part from a date, or the number of months from an interval extract the week number from a date, or the number of weeks from an interval extract the day from a date, or the number of days from an interval extract the hour from a datetime or time, or the number of hours from an interval extract the minute from a datetime or time, or the number of minutes from an interval extract the second from a datetime or time, or the number of minutes from an interval

Alguns exemplos:

• Obter o mês e o ano de hoje no formato “02/2015” month($now) || ’/’ || year($now)

Funções String

Este grupo contém funções que operam em textos (por exemplo, quer substituir, converter para maiúsculas).

lower upper title trim wordwrap convert string a to lower case convert string a to upper case converts all words of a string to title case (all words lower case with leading capital letter) removes all leading and trailing white space (spaces, tabs, etc.) from a string returns a string wrapped to a maximum/ minimum number of characters length replace replaced regexp_replace(a,this,that) returns a string with the supplied regular expression replaced regexp_substr length of string a returns a string with the supplied string substr(*a*,from,len) concat strpos returns the portion of a string which matches a supplied regular expression returns a part of a string concatenates several strings to one left returns the index of a regular expression in a string returns a substring that contains the n right rpad leftmost characters of the string returns a substring that contains the n rightmost characters of the string returns a string with supplied width padded lpad format format_number format_date using the fill character returns a string with supplied width padded using the fill character formats a string using supplied arguments returns a number formatted with the locale separator for thousands (also truncates the number to the number of supplied places) formats a date type or string into a custom string format

12.4. Expressões 113

QGIS User Guide, Versão 2.6

Funções Cor

Este grupo contém funções para manipulação de cores.

color_rgb color_rgba ramp_color color_hsl color_hsla color_hsv color_hsva color_cmyk color_cmyka returns a string representation of a color based on its red, green, and blue components returns a string representation of a color based on its red, green, blue, and alpha (transparency) components returns a string representing a color from a color ramp returns a string representation of a color based on its hue, saturation, and lightness attributes returns a string representation of a color based on its hue, saturation, lightness and alpha (transparency) attributes returns a string representation of a color based on its hue, saturation, and value attributes returns a string representation of a color based on its hue, saturation, value and alpha (transparency) attributes returns a string representation of a color based on its cyan, magenta, yellow and black components returns a string representation of a color based on its cyan, magenta, yellow, black and alpha (transparency) components

Funções Geometria

Este grupo contém funções que operam na geometria dos objetos (por exemplo, comprimento, área).

$geometry

$area

$length

$perimeter

$x

$y xat yat xmin xmax ymin ymax geomFromWKT geomFromGML bbox disjoint returns the geometry of the current feature (can be used for processing with other functions) returns the area size of the current feature returns the length size of the current feature returns the perimeter length of the current feature returns the x coordinate of the current feature returns the y coordinate of the current feature retrieves the nth x coordinate of the current feature.

n given as a parameter of the function retrieves the nth y coordinate of the current feature.

n given as a parameter of the function returns the minimum x coordinate of a geometry.

Calculations are in the Spatial Reference System of this

Geometry returns the maximum x coordinate of a geometry.

Calculations are in the Spatial Reference System of this

Geometry returns the minimum y coordinate of a geometry.

Calculations are in the Spatial Reference System of this

Geometry returns the maximum y coordinate of a geometry.

Calculations are in the Spatial Reference System of this

Geometry returns a geometry created from a well-known text (WKT) representation returns a geometry from a GML representation of geometry intersects touches crosses returns 1 if the geometries do not share any space together returns 1 if the geometries spatially intersect

(share any portion of space) and 0 if they don’t returns 1 if the geometries have at least one point in common, but their interiors do not intersect returns 1 if the supplied geometries have some, but not

114 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

contains overlaps within buffer centroid bounds bounds_width bounds_height convexHull difference distance intersection symDifference combine union geomToWKT all, interior points in common returns true if and only if no points of b lie in the exterior of a, and at least one point of the interior of b lies in the interior of a returns 1 if the geometries share space, are of the same dimension, but are not completely contained by each other returns 1 if geometry a is completely inside geometry b returns a geometry that represents all points whose distance from this geometry is less than or equal to distance returns the geometric center of a geometry returns a geometry which represents the bounding box of an input geometry. Calculations are in the Spatial

Reference System of this Geometry.

returns the width of the bounding box of a geometry.

Calculations are in the Spatial Reference System of this Geometry.

returns the height of the bounding box of a geometry.

Calculations are in the Spatial Reference System of this Geometry.

returns the convex hull of a geometry (this represents the minimum convex geometry that encloses all geometries within the set) returns a geometry that represents that part of geometry a that does not intersect with geometry b returns the minimum distance (based on spatial ref) between two geometries in projected units returns a geometry that represents the shared portion of geometry a and geometry b returns a geometry that represents the portions of a and b that do not intersect returns the combination of geometry a and geometry b returns a geometry that represents the point set union of the geometries returns the well-known text (WKT) representation of the geometry without SRID metadata

Funções Registro

Este grupo contém funções que operam na identificação da registros.

$rownum

$id

$currentfeature

$scale

$uuid getFeature attribute

$map returns the number of the current row returns the feature id of the current row returns the current feature being evaluated.

This can be used with the ’attribute’ function to evaluate attribute values from the current feature.

returns the current scale of the map canvas generates a Universally Unique Identifier (UUID) for each row. Each UUID is 38 characters long.

returns the first feature of a layer matching a given attribute value.

returns the value of a specified attribute from a feature.

returns the id of the current map item if the map is being drawn in a composition, or "canvas" if the map is being drawn within the main QGIS window.

12.4. Expressões 115

QGIS User Guide, Versão 2.6

Campo e Valores

Contém uma lista de campos para a camada. Valores simples podem ser acessados via clique direito.

Selecione o nome do campo da lista, em seguida, clique com o botão direito para acessar um menu de contexto com opções para carregar os valores da amostra do campo selecionado.

.

Nome campos devem estar entre aspas. Valores ou texto deverá estar cotado-simples.

12.5 Editando

QGIS suporta vários recursos para tabelas e camadas vetoriais

:índice:‘Edição‘

OGR, SpatiaLite, PostGIS, Espacial MSSQL e Oracle.

Nota: O procedimento para editar camadas do GRASS é diferente - consulte a seção

Digitalizando e editando uma camada vetorial GRASS

para mais detalhes.

Dica: Edições Simultâneas

Esta versão do QGIS não controla se alguém mais está editando uma feição ao mesmo tempo que você. A última pessoa a salvar suas edições ganha.

12.5.1 Configurando a Tolerância de Atracção e Raio de Pesquisa

Antes de podermos editar os vértices, necessitamos de configurar a tolerância e o raio de pesquisa para um valor que nos permita uma edição ideal das geometrias da camada vetorial.

Tolerância de Atração

Tolerância de Atração é a distância que o QGIS usa para pesquisar por vértice mais próximo e / ou segmento que você está tentando conectar-se quando você define um novo vértice ou move um vértice existente. Se você não estiver dentro da tolerância de atração, o QGIS deixará o vértice onde você soltar o botão do mouse, em vez de agarrar-lo a um vértice e / ou segmento existente. A configuração da tolerância de atração afeta todas as ferramentas que trabalham com tolerância.

1. Em geral, a tolerância de encaixe pode ser definida escolhendo Definições →

Opções

. No Mac, vá para

QIS

Preferencias...

. No Linux: Editar → Opções . Na aba Digitalização, você pode escolher entre

‘ao vértice’, ‘ao segmento’ ou ‘ao vértice e segmento’ como modo de encaixe padrão. Você também pode definir uma tolerância de encaixe padrão e um raio de buscas de edições de vértices. A tolerância pode ser definida em unidades do mapa ou em pixels. A vantagem de escolher pixels é que a tolerância de encaixe não precisa ser mudada depois da operação de aproximação. No nosso menor projeto digitalizado (trabalhando com o conjunto de dados do Alaska), nós definimos as unidades de encaixe em pé. Seus resultados podem variar, mas algo na ordem de 300 pés em uma escala de 1:10000 deve ser uma configuração razoável.

2. Uma tolerância de encaixe com base em camadas pode ser escolhido pela escolha Definições→ (or

Arquivo

→) Opções de encaixe... para permitir e ajustar o modo de encaixe e tolerância em uma base de camada (ver

figure_edit_1 ).

Note que estes encaixes com base em camadas substitui a opção de encaixe global na aba Digitalização. Então, se você precisa editar uma camada e encaixar seus vértices para outra camada, em seguida habilitando apenas encaixe na camada “encaixar para”, depois diminuir o encaixe global para um valor menor. Além disso, encaixar nunca ocorrerá para uma camada que não está marcada a opção encaixar, independentemente da tolerância de encaixe global. Então tenha certeza de marcar a caixa de seleção para estas camadas que você precisa encaixar.

116 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.38: Edição das opções de atração numa camada base

Raio de pesquisa

Pesquisa raio é a distância que p QGIS usa para buscar para o vértice mais próximo que você está tentando mover quando você clicar no mapa. Se você não estiver dentro do raio de busca, o QGIS não vai encontrar e selecionar nenhum vértice para edição, e vai aparecer um aviso irritante para o efeito. Acerte a tolerância e o raio de busca é definido em unidades do mapa ou pixels, para que você possa encontrar o que você precisa experimente definir direito para obtê-los. Se você especificar uma tolerância muito grande, QGIS pode agarrar o vértice errado, especialmente se você está lidando com um grande número de vértices nas proximidades. Defina o raio de busca muito pequeno, e não vai encontrar outro para confundir.

O raio de busca de edições de vértices em unidades da camada pode ser definido no guia Digitizando em :menuselection: ‘Configurações ->‘|mActionOptions| :menuselection: opções. Este é o mesmo lugar onde você define o geral, projeto- atração tolerância.

12.5.2 Ampliando e Movendo

Antes de editar uma camada, deve fazer uma ampliação à zona da área de interesse. Isto evita que espere enquanto os marcadores dos vértices são renderizados em toda a camada.

Além de usar os ícones mover mapa e aproximar

/ afastar na barra de ferramentas com o mause, a navegação pode também ser feita com a roda do mouse, espaço e as teclas de direção.

Ampliando e movendo com a roda do mouse

Enquanto a digitalização, você pode pressionar a roda do mouse para se deslocar dentro da janela principal, e você pode rolar a roda do mouse para ampliar e reduzir o mapa. Para zoom, coloque o cursor do mouse dentro da área do mapa e rodá-lo para a frente (longe de você) para aumentar o zoom; e para trás (na sua direção) para diminuir o zoom. A posição do cursor do mouse será o centro da área ampliada de interesse. Você pode personalizar o comportamento do zoom da roda do mouse usando o :guilabel: aba Ferramentas do Mapa sob o :menuselection:

‘Configurações ->‘ :menuselection: menu de opções.

Movendo a direção com as setas do teclado

Panorâmica no mapa durante a digitalização é possível com as teclas de seta. Coloque o cursor do mouse dentro da área do mapa, e clique na seta para a direita para se deslocar a leste, seta para a esquerda para mover oeste, seta para cima para deslocar para o norte, e para baixo chave de seta para se deslocar para o sul.

12.5. Editando 117

QGIS User Guide, Versão 2.6

Você também pode usar a barra de espaço para fazer com que temporariamente os movimentos do mouse para percorrer o mapa. A: kbd: PgUp e: kbd:‘ chaves PgDown‘ do seu teclado fará a apresentação do mapa para ampliar ou reduzir, sem interromper a sessão de digitalização.

12.5.3 Edição Topológica

Além de opções de ajuste com base em camadas, você também pode definir funcionalidades topológicas no :guilabel: menu de opções Tirando ... diálogo no :menuselection: Configurações (Arquivo ou:: menuselection). Aqui, você pode definir |caixa| :guilabel: ‘Ativar edição‘ topológica, e / ou para as camadas de polígonos, você pode ativar a coluna |caixa| :guilabel: Evite Int., o que evita intersecção de novos polígonos.

Ativar edição topológica

A opção |caixa| :guilabel: ‘Ativar edição‘ topológica é para edição e manutenção de limites comuns em mosaicos poligonais. O QGIS ‘detecta’ uma fronteira compartilhada em um mosaico de polígonos, assim você só tem que mover o vértice uma vez, e o QGIS cuidará de atualizar o outro limite.

Evitar intersecções de novos polígonos

A segunda opção topológica na |caixa| :guilabel: Evite coluna Int., chamado :guilabel:‘ Evite interseções de novo polígonos‘, evita sobreposições em mosaicos poligonais. É por digitalização mais rápida de polígonos adjacentes.

Se você já tem um polígono, é possível com esta opção para digitalizar o segundo de tal forma que ambos se cruzam, e o QGIS corta então o segundo polígono da fronteira comum. A vantagem é que você não tem que digitalizar todos os vértices da fronteira comum.

Activar atracção nas intersecções

Outra opção é usar |caixa| :guilabel: Habilitar encaixe em intersecção. Ele permite que você encaixe em uma intersecção de camadas de fundo, mesmo se não há nenhum vértice na interseção.

12.5.4 Digitalizar uma camada existente

Por padrão, QGIS carrega camadas de leitura. Esta é uma salvaguarda para evitar que acidentalmente a edição de uma camada se houver um deslize do mouse. No entanto, você pode optar por editar qualquer camada, enquanto o provedor de dados suporta, e a fonte de dados subjacente é gravável (ou seja, seus arquivos não são somente leitura).

Em uma geral, barra ferramentas de

Ícone Finalidade de digitalização edição ou de camadas digitalização vetoriais avançada,

Ícone Finalidade estão descrita divididas na seção em

Edições actuais

Adicionando Elementos: Capturar Ponto

Alternar edição

Adicionando Elementos: Capturar Linha

Adicionando Elementos: Capturar Polígono

Ferramenta de Nós

Cortar Elementos

Mover Elemento

Apagar Selecionados

Copiar Elementos

Colar Elementos Salvar edições da camada

Edição da Tabela: Edição básica da camada vectorial pela barra de ferramentas

Todas as sessões de edição começa escolhendo o :sup: opção edição alternância. Isto pode ser encontrado no menu de contexto depois botão direito sobre a entrada de legenda para uma determinada camada.

118 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Alternativamente, você pode usar a opção :index: Alternar Edição | mActionToggleEditing | : sup:‘ botão edição‘ alternância na barra de ferramentas de digitalização para iniciar ou parar o modo de edição. Uma vez que a camada está em modo de edição, marcadores aparecerá nos vértices, e botões de ferramentas adicionais na barra de ferramentas de edição ficará disponível.

Dica: Salvar Regularmente

Lembre-se de as alterações.

Salvar Edições da Camada regularmente. Isto irá também verificar que a sua fonte de dados aceita todas

Adicionando Elementos

Pode usar os ícones

Adicionar Elemento

, o cursor QGIS no modo de digitalização.

Adicionar Elemento ou

Adicionar Elemento da barra de ferramentas para por

Para cada elemento, primeiro digitaliza a geometria, e de seguida introduz os atributos. Para digitalizar a geometria, clique com o botão direito do mouse na área do mapa para criar o primeiro ponto do seu novo elemento.

Para linhas e polígonos, mantenha o clique com o botão direito do mouse para cada ponto adicional que pretende capturar. Quando acabar de adicionar os pontos, clique com o direito do rato em qualquer sítio da área do mapa para confirmar a finalização da introdução da geometria desse elemento.

A janela de atributo aparecerá, permitindo que você insira as informações para a nova feição.

Figure_edit_2

mostra definir atributos para um novo rio fictício no Alasca. No :guilabel: menu de Digitalização sob o :menuselection:

‘Configurações -> opções‘ menu, você também pode ativar | caixa

|

: guilabel:‘ Repressão atributos janelas pop-up após cada feição‘ criado e | caixa | : guilabel: ‘ Reuse último entrou atributo Valor-.

Figura 12.39: Introduza os Valores dos atributos na Janela após a digitalização do novo elemento vetorial

Com o ícone :sup: Mover Feição (ões) na barra de ferramentas, você pode mover as feições existentes.

Dica: Tipos de Valores de Atributo

Para a edição, os tipos de atributos são validados durante a entrada. Devido a isso, não é possível inserir um número em uma coluna de texto na caixa de diálogo: guilabel: Digite Atributo Valor-ou vice-versa. Se você precisar fazer isso, você deve editar os atributos em uma segunda etapa dentro de: guilabel: ‘diálogo table atributo.

Edições Atuais

Esta nova funcionalidade permite a digitalização de múltiplas camadas. Escolha :guilabel: ‘Salve para Camada Selecionada‘ para salvar todas as alterações feitas em várias camadas. Você também tem a oportunidade de :guilabel: Reversão para camada selecionada, de forma que a digitalização pode ser retirada para todas as camadas selecionadas. Se você quiser parar de editar as camadas selecionadas, camada selecionada (s) é uma maneira fácil.

:guilabel: Cancelar para

12.5. Editando 119

QGIS User Guide, Versão 2.6

As mesmas funções estão disponíveis para a edição de todas as camadas do projeto.

Ferramenta de Nós

Para camadas baseadas em shapefile, bem como tabelas SpatialLite, PostgreSQL / PostGIS, MSSQL Spatial e

Oracle Spatial, o :sup: Ferramenta de Nós fornece capacidades de manipulação de vértices de feições semelhantes aos programas de CAD. É possível simplesmente selecionar vários vértices de uma vez e para se mover, adicionar ou excluí-los por completo. A ferramenta nó também trabalha com ‘on the fly’ projeção ligado, e ele suporta a edição topológica de feições. Esta ferramenta é, ao contrário de outras ferramentas no QGIS, persistente, por isso, quando alguma operação for feito, a seleção permanece ativo por essa ferramenta de feição. Se a ferramenta de nós não é capaz de encontrar todas as feições, um aviso será exibido.

É importante definir a propriedade: menuselection: ‘Configurações –> |mActionOptions|: menuselection:‘Opções

–> Digitalização –> :guilabel:‘ Pesquisa Raio: ‘ para um número maior que zero (isto é, 10). Caso contrário, QGIS não será capaz de dizer qual vértice está sendo editado.

Dica: Marcadores de Vértice

A versão atual do QGIS suporta três tipos de marcadores de vértice: ‘círculo semi-transparente’, ‘Cruz’ e ‘Nenhum’. Para alterar o estilo de marcador, escolha :menuselection: opções do menu de :menuselection: Configurações , clique na guia :guilabel: Digitalização e selecione a entrada apropriada.

Operações Básicas

Comece por ativar a

Ferramenta de Nós e selecione um elemento clicando em cima de um, As caixas vermelhos irão aparecer em cada vértice deste elemento.

• Selecionando vértices: Você pode selecionar vértices, clicando sobre eles um de cada vez, clicando em uma borda para selecionar os vértices em ambas as extremidades, ou clicando e arrastando um retângulo em torno de alguns vértices. Quando um vértice é selecionado, sua cor muda para azul. Para adicionar mais vértices para a seleção atual, mantenha pressionada a :kbd: tecla Ctrl enquanto clica. Mantenha pressionado

:kbd: Ctrl ou Shift ao clicar para alternar o estado de seleção de vértices (vértices que estão atualmente desmarcada serão selecionados como de costume, mas também vértices que já estão selecionados será desmarcada).

• Adicionando vértices: Para adicionar um vértice, basta clicar duas vezes perto de uma borda e um novo vértice aparecerá na borda perto do cursor. Note-se que o vértice aparecerá na borda, não na posição do cursor; por conseguinte, deve ser transferida, se necessário.

• Eliminar vértices: Depois de selecionar os vértices para eliminar, clique na tecla Delete. Note-se que não pode usar a

Node Tool para eliminar um elemento completo; QGIS vais assegurar que mantém o número mínimo de vértices necessários para o tipo de elemento que está a trabalhar. Para eliminar um elemente completo, utilize a ferramenta

Delete Selected

.

• Mover vértices: Selecione todos os vértices que pretende mover. Clique num vértice selecionado ou na extreminade e arraste na direção que pretende mover. Todos os vértices selecionados serão movidos em conjunto. Se a ferramenta snapping está ativa, toda a seleção pode saltar para o vértice ou linha mais próximos.

Cada alteração feita com a ferramenta de nó é armazenado como uma entrada separada no diálogo Desfazer.

Lembre-se que todas as operações de suporte à edição topológica quando este for ligado. Projeção on-the-fly também é suportada, e a ferramenta de nó fornece dicas para identificar um vértice ao passar o ponteiro do mouse sobre ele.

120 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Cortando, Copiando e Colando Elementos

Feições selecionadas podem ser recortadas, copiadas e coladas entre camadas do mesmo projeto do QGIS contanto que a camada de destino estejam selecionadas como :sup: Alternar edição previamente.

As feições também podem ser coladas para aplicações externas como texto. Ou seja, as feições são representadas no formato CSV, com os dados de geometria que aparece no formato de texto bem delimitado OGC (WKT).

No entanto, nesta versão do QGIS, feições de texto de fora do QGIS não pode ser colado a uma camada dentro de QGIS. Em que a função copiar e colar vir a calhar? Bem, acontece que você pode editar mais de uma camada de cada vez e funcionalidades copiar / colar entre as camadas. Por que iríamos querer fazer isso? Diga o que precisamos fazer algum trabalho em uma nova camada, mas só precisa de um ou dois lagos, e não a 5000 em nosso camada big_lakes‘‘. Podemos criar uma nova camada e use copiar / colar para plop os lagos necessários para ele.

Como exemplo, vamos copiar alguns lagos para uma nova camada:

1. Carregue a camada que quer copiar a partir (camada de origem)

2. Carregue ou crie a camada que quer copiar para (camada de destino)

3. Começar a editar a camada de destino

4. Ative a camada de origem clicando nela na legenda

5. Use a ferramenta

Selecione Elemento Único para selecionar os elemento(s) na camada fonte

6. Clique na ferramenta

Copiar Elementos

7. Ative a camada de destino clicando na legenda

8. Clique na ferramenta

Colar Elementos

9. Parar a edição e salvar as alterações

O que acontece se as camadas de origem e de destino têm esquemas diferentes (nomes de campo e tipos não são a mesma coisa)? QGIS preenche o que corresponde e ignora o resto. Se você não se importa com os atributos que está sendo copiado para a camada de destino, não importa como você projeta os campos e tipos de dados. Se você quer ter certeza de tudo - a feição e seus atributos - é copiada, verifique se o jogo esquemas.

Dica: Congruência dos Elementos Colados

Se as camadas de fonte e de destino usar a mesma projecção, em seguida, as feições coladas terão geometria idêntica à da camada de fonte. No entanto, se a camada de destino é uma projeção diferente, então QGIS não pode garantir a geometria é idêntica. Isto é simplesmente porque existem erros pequenos arredondamentos envolvidos na conversão entre projeções.

Apagando os Elementos Selecionados

Se quisermos apagar o polígono todo, podemos faze-lo seleccionando o polígono usando a ferramenta

Selecionar Elemento Único

. Pode selecionar múltiplos elementos para apagar. Uma vez feita a seleção do conjunto, use a ferramenta

Apagar Selecionados para apagar os elementos.

A ferramenta :sup: Cortar feições na barra de ferramentas de digitalização também pode ser usado para excluir recursos. Isso exclui efetivamente a feição, mas também coloca-lo em uma “área de transferência espacial”. Então, cortamos a feição para excluir. Poderíamos, então, usar a ferramenta :sup: Colar Feições para colocá-lo de volta, dando-nos a capacidade de desfazer de um nível. Recortar, copiar e colar o trabalho sobre as feições selecionadas no momento, o que significa que pode operar em mais de um de cada vez.

12.5. Editando 121

QGIS User Guide, Versão 2.6

Salvando as Camadas Editadas

Quando uma camada está no modo de edição, as alterações permanecem na memória de QGIS. Portanto, eles não estão comprometidos / salvos imediatamente à fonte de dados ou disco. Se você quiser salvar as edições da camada atual, mas quero continuar editando sem sair do modo de edição, você pode clicar no botão :sup:

Salvar Camadas Editadas . Quando você ativar o modo de edição off com :sup: editando Alternar (ou sair

QGIS para que o assunto), você também perguntado se você deseja salvar as alterações ou descartá-las.

Se as alterações não podem ser salvas (por exemplo, disco cheio, ou os atributos têm valores que estão fora de alcance), o estado em memória do QGIS é preservado. Isso permite que você ajuste as suas edições e tente novamente.

Dica: Integridade dos dados

É sempre boa ideia fazer cópias de segurança da sua fonte de dados antes de começar a editar. Enquanto os autores do QGIS fizeram todo o esforço para preservar a integridade dos seus dados, nós não oferecemos garantia neste sentido.

12.5.5 Digitalização Avançada

Ícone Finalidade

Retroceder

Ícone Finalidade

Retomar

Rodar Elemento(s)

Adicionar Anel

Simplificar elemento

Adicionar Parte

Preenchimento Anel Apagar Anel

Apagar Parte

Curva de Afastamento

Refazer elementos

Dividir Elementos

Dividindo partes Juntar Elementos Selecionados

Juntar Atributos dos Elementos Selecionados Rodar Símbolos de Pontos

Tabela de edição avançada: Barra de ferramentas de edição avançada de camadas vetoriais

Retroceder e Retomar

As ferramentas :sup: Desfazer e

Refazer permitem desfazer ou refazer operações de edição de vetores. Há também uma tela acoplável, que mostra toda o histórico de todas operações desfazer / refazer (veja

Figure_edit_3 ).

Este elemento não é exibido por padrão; ele pode ser exibido com um clique direito na barra de ferramentas e ativando a opção Desfazer / Refazer. Desfazer / Refazer é no entanto ativo, mesmo que a tela não esteja sendo exibida.

Quando Desfzer é atingido, o estado de todas as feições e atributos são revertidos para o estado antes da reversão da operação acontecer. Outras mudanças para além das operações normais de edição vetorial (por exemplo, alterações feitas por um complemento), podem ou não podem serem revertidas, dependendo de como as mudanças foram realizadas.

Para usar a tela histórico de desfazer / refazer, basta clicar para selecionar uma operação na lista de histórico.

Todas as feições serão revertidas para o estado em que estavam depois da operação selecionada.

122 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.40: Refazer e desfazer passos de digitalização

Rodar Elemento(s)

Use

Rotação de feição(s) para rodar uma ou várias feições selecionadas na tela do mapa. Você primeiro precisa selecionar as feições e, em seguida, pressione o ícone

Rotação de feição(s)

. O centro de gravidade da feição(s) aparece e será o ponto de ancoragem da rotação. Se você tiver selecionado várias feições, o ponto de ancoragem da rotação será o centro comum das feições. Pressione e arraste o botão esquerdo do mouse na direção desejada para girar as feições selecionadas.

Também é possível criar um ponto de ancoragem de rotação definido pelo usuário em torno do qual a feição selecionada irá rodar. Selecione as feições para girar e ativar a ferramenta :sup: Rotação de feição(s). Pressione e segure o botão :kbd: Ctrl e mova o ponteiro do mouse (sem pressionar o botão do mouse) para o local onde deseja que a âncora de rotação seja movida. Solte o botão Ctrl no ponto de ancoragem de rotação desejada. Agora, pressione e arraste o botão esquerdo do mouse na direção desejada para girar a função selecionada (s).

Simplificar elemento

A ferramenta

Simplificar feição permite reduzir o número de vértices de uma feição, desde que a geometria não mude. Primeiro, selecione uma feição. Ela será realçada por um elástico vermelho e uma barra aparecerá.

Movendo o controle deslizante, a banda de borracha vermelha vai mudar a sua forma de mostrar como a feição está sendo simplificada. Clique [OK], para armazenar a nova geometria simplificada. Se uma feição não pode ser simplificada (por exemplo, multi-polígonos), uma mensagem aparecerá.

Adicionar Anel

Você pode criar :índice:‘polígonos anéis‘ usando o ícone

Adicionar Anel na barra de ferramentas. Isto significa que no interior de uma área existente, é possível digitalizar outros polígonos que ocorrem como um “orifício”, de modo que apenas a zona entre as fronteiras dos polígonos exterior e interior continua sendo um anel poligonal.

Adicionar Parte

Você pode adicionar parte no polígonos selecionado :índice:‘multipolígono‘ . A nova parte do polígono deve ser digitadas fora do multi-polígono selecionado.

Preenchimento Anel

Você pode usar a função

Preenchimento Anel para adicionar um toque a um polígono e adicionar uma nova feição para a camada ao mesmo tempo. Assim, você não precisa usar primeiro o ícone

Adicionar Anel e então a função

12.5. Editando 123

QGIS User Guide, Versão 2.6

a mais

Adicionar feição

.

Apagar Anel

A ferramenta | mActionDeleteRing

|

: sup: Excluir Anel permite excluir polígonos anel dentro de uma área existente. Esta ferramenta só funciona com camadas de polígonos. Isso não muda nada quando ele é usado no anel externo do polígono. Esta ferramenta pode ser utilizada em polígonos e multi-funções poligonais. Antes de selecionar os vértices de um anel, ajuste a tolerância na edição do vértice.

Apagar Parte

A ferramenta | mActionDeletePart | : sup: Excluir Parte permite apagar partes de multifeições (por exemplo, para excluir os polígonos de uma feição de multi-polígono). Não vai apagar a última parte da feição; esta última parte vai ficar intocada. Esta ferramenta funciona com todas as geometrias multi-parte: ponto, linha e polígono. Antes de selecionar os vértices de um papel, ajustar a tolerância de edição do vértice.

Refazer elementos

Você pode alterar feições de linha e polígono usando o ícone | mActionReshape | : sup: Remodelar Feições na barra de ferramentas. Ele substitui a linha ou polígono parte da primeira para a última intersecção com a linha original. Com polígonos, às vezes isso pode levar a resultados indesejados. É útil principalmente para substituir partes menores de um polígono, não para grandes reparações, e a linha de remodelar não é permitido atravessar vários anéis de polígonos, pois isso geraria um polígono inválido.

Por exemplo, pode editar o limite de um polígono com esta ferramenta. Primeiro, clique na área interna do polígono junto do ponto onde pretende adicionar o novo vértice. Depois, atravesse o limite e adicione os vértices no exterior do polígono. Para finalizar, clique com o botão direito na área interna do polígono. A ferramenta vai adicionar um nó automaticamente no ponto onde a linha atravessa o limite. Também é possível remover parte da

área do polígono, começa-se a nova linha no exterior do polígono, adicionam-se vértices no interior e termina-se a linha no exterior do polígono com um clique no botão direito.

Nota: A ferramenta de mudança de forma pode alterar a posição inicial de um anel ou de uma linha poligonal fechada. Assim, o ponto que está representada ‘duas vezes’ não será o mesmo mais. Isto pode não ser um problema para a maioria das aplicações, mas é algo a considerar.

Curvas de Afastamento

A ferramenta | mActionOffsetCurve

|

: sup: Deslocamento de curvas cria cópias paralelas de camadas de linha.

O ferramenta pode ser aplicada à camada editado (as geometrias são modificadas) ou também para as camadas de fundo (no caso em que se cria cópias das linhas / anéis e adiciona-los para a camada do editada). É, assim, ideal para a criação de camadas de linhas equidistantes. O deslocamento é mostrado no canto inferior esquerdo da barra de tarefas. Para criar uma mudança de uma camada de linha, você deve primeiro entrar em modo de edição e, em seguida, selecione a função. Você pode usar a ferramenta | mActionOffsetCurve | : sup: ‘ Deslocamento de curvas‘ ativa e arraste a cruz para a distância desejada. As alterações podem ser salvas com a ferramenta | mActionSaveEdits | : sup: Salvar Edições da Camada.

Para criar um deslocamento, de uma camada de linha, você precisa primeiro entrar no modo de edição desta, então selecionar a feição desejada. Com a ferramenta

Deslocamento de Curva ativa clique sobre a linha desejada segure o botão, mova a cruz sobre o local desejado e solte o botão do mouse. Para que as mudanças sejam salvas clique na ferramenta

Salvar Edição da Camada

.

QGIS opções diálogo (guia Digitalização então Ferramentas de compensar Curva seção) permite configurar alguns parâmetros como Juntar estilo Segmentos no Quadrante, Limite Mitra.

124 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Dividir Elementos

Pode dividir elementos usando o ícone longo do elemento que quer dividir.

Dividir Elementos da barra de ferramentas. Apenas desenhe uma linha ao

Dividindo partes

No QGIS 2.0, é possível dividir as partes de uma feição de multi parte de modo a que o número de peças é aumentado. Basta desenhar uma linha em toda a parte que você quer dividir com o ícone

Dividir Partes

.

Juntar elementos selecionados

A ferramenta

Mesclar Feições Selecionadas permite a você mesclar feições que tem bordas em comum. Uma nova janela de diálogo permitirá a você escolher quais características serão mantidas para a nova feição criada com base nas demais mescladas, ou poderá ser usada uma função de (Mínimo, Máximo, Média, Soma, Pular Atributo), usada em cada coluna da nova feição com base nas feições de origem.

Juntar os atributos dos elementos selecionados

A ferramenta :sup: Mesclar Atributos das Feições escolhidas permite :índice:‘mesclar atributos de feições‘ com fronteiras comuns fundir e atributos sem a fusão de suas fronteiras. Primeiro, selecione várias feições ao mesmo tempo. Em seguida, pressione o botão mActionMergeFeatureAttributes | |: sup: ‘Mesclar Atributos de feições selecionadas‘. Agora |qg| pede-lhe os atributos que devem ser aplicados a todos os objetos selecionados.

Como resultado, todos os objetos selecionados têm as mesmas entradas de atributos.

Rodar Símbolos de Pontos

Rotate Point Symbols allows you to change the rotation of point symbols in the map canvas. You must first define a rotation column from the attribute table of the point layer in the Advanced menu of the Style menu of the Layer

Properties

. Also, you will need to go into the ‘SVG marker’ and choose Data defined properties .... Activate

Angle and choose ‘rotation’ as field. Without these settings, the tool is inactive.

Figura 12.41: Rodar Símbolos de Pontos

Para alterar a rotação, selecione um recurso ponto na tela do mapa e gire-o, segurando o botão esquerdo do mouse pressionado. A seta vermelha com o valor de rotação será visualizado (ver

Figura_editada_4 ). Quando você soltar

o botão esquerdo do mouse novamente, o valor será atualizado na tabela de atributos.

Nota: Se segurar a tecla Ctrl premido, a rotação irá ser feita em passos de 15 graus.

12.5. Editando 125

QGIS User Guide, Versão 2.6

12.5.6 Criando novas camadas Vetoriais

QGIS allows you to create new shapefile layers, new SpatiaLite layers, and new GPX layers. Creation of a new

GRASS layer is supported within the GRASS plugin. Please refer to section

Criando uma nova camada vetorial

GRASS

for more information on creating GRASS vector layers.

Criando uma nova camada Shapefile

Para criar uma nova camada de forma para edição, escolha: seleção de menu: Novo -> | mActionNewVectorLayer

|

: seleção de menu Novo Shapefile Camada ... do: menu de seleção: menu de Camada. A: guilabel: diálogo Novo

Vetor de Camada será exibido como mostrado na

Figure_editada_5 . Escolha o tipo de camada (ponto, linha ou

polígono) e CRS (sistema de coordenadas de referência).

Note-se que o QGIS ainda não suporta a criação de feições 2.5D (ou seja, com características X, Y, Z).

Figura 12.42: Janela de criação de uma nova camada Shapefile

Para concluir a criação da nova camada arquivo shape, adicione os atributos desejados clicando no botão **

[Adicionar à lista de atributos] ** e especificar um nome e tipo para o atributo. A primeira coluna ‘código’ é adicionado como padrão, mas pode ser removido, se não quiser. Apenas: guilabel: Tipo: real | String | ,: guilabel:‘

Tipo: inteiro’ | String | ,: guilabel: Tipo: string | String | e: guilabel:‘ Tipo: data‘ | String | atributos são suportados.

Além disso e de acordo com o tipo de atributo, você também pode definir a largura e a precisão da nova coluna de atributo. Quando estiver satisfeito com os atributos, clique ** [OK] ** e forneça um nome para o arquivo shape.

| QG | irá adicionar automaticamente um: arquivo: .shp extensão para o nome que você especificar. Uma vez que a camada foi criado, ele será adicionado ao mapa, e você pode editá-lo da mesma forma como descrito na seção: ref: sec_edit_existing_layer acima.

Criando uma nova camada SpatialLite

Para criar uma nova camada SpatialLite para edição, escolha Novo → Nova Camada SpatiaLite...

do menu

Camada . O diálogo Nova Camada SpatiaLite irá aparecer como é mostrado na

Figure_edit_6 .

126 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

12.5. Editando

Figura 12.43: Janela de criação de uma nova camada SpatialLite

127

QGIS User Guide, Versão 2.6

A primeira etapa consiste em selecionar um banco de dados SpatiaLite existente ou criar uma nova base de dados

SpatiaLite. Isso pode ser feito com o botão de navegação | browsebutton | à direita do campo de banco de dados.

Em seguida, adicione um nome para a nova camada, definir o tipo de camada, e especificar o sistema de referência de coordenadas com ** [Especificar CRS]

**

. Se desejar, você pode selecionar | caixa

|

: guilabel: ‘Criar uma chave‘ primária auto incrementol.

Para definir uma tabela de atributos para a nova camada SpatiaLite, adicione os nomes das colunas de atributos que você deseja criar com o tipo de coluna correspondente e clique no botão ** [Adicionar à lista de atributos] ** .

Quando estiver satisfeito com os atributos, clique ** [OK] ** . | QG | adiciona automaticamente a nova camada com a legenda, e você pode editá-lo da mesma forma como descrito na seção: ref: sec_edit_existing_layer acima.

O tratamento adicional das camadas SpatiaLite pode ser feito com o Gerenciador BD. Veja

Complemento Gerenciador BD .

Criando uma nova camada GPX

Para criar um novo arquivo GPX, você precisa carregar o plugin GPS em primeiro lugar. : menu de seleção:

Plugins -> | mActionShowPluginManager | : menu de seleção: ‘Gerenciador de Plugin ...‘ abre o Gerenciador de diálogo de Plugin. Ative a | caixa | : guilabel: ‘Ferramentas GPS’.

Quando este plugin é carregado, escolha: menu de seleção: Novo -> | icon_newgpx | : menu de seleção: ‘Criar nova camada GPX ... do: menu de seleção: menu de Camada‘. No: guilabel: ‘Salvar como novo arquivo GPX‘, você pode escolher onde deseja salvar a nova camada GPX.

12.5.7 Trabalhando com a Tabela de Atributos

O: índice: atributo da tabela exibe características de uma camada selecionada. Cada linha na tabela representa um recurso de mapa, e cada coluna contém uma determinada parte das informações sobre o recurso. Recursos na tabela pode ser pesquisado, selecionado, movido ou mesmo editadas.

Para abrir a tabela de atributos de uma camada do vetor, fazer a camada ativa, clicando sobre ela na área do mapa legenda. Então, a partir do principal: menu de seleção: menu de Camada, escolha | mActionOpenTable | : menu de seleção: ‘Abrir Tabela de Atributos‘. Também é possível fazer um clique direto sobre a camada e escolha

| mActionOpenTable | : menu de seleção: ‘Abrir Tabela de Atributos‘ a partir do menu suspenso, e clique no | mActionOpenTable | : guilabel: botão Abrir Tabela de Atributos na barra de ferramentas.

Isto irá abrir uma nova janela que exibe os atributos do recurso para a camada ( figura_atributos_1 ). O número de

recursos e o número de recursos selecionados são mostrados no título da tabela de atributos.

128

Figura 12.44: Tabela de Atributos para a camada regiões

Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Selecionando elementos na tabela de atributos

Cada linha selecionada na tabela de atributos representa os atributos de um determinado elemento da camada.

Se o conjunto de elementos selecionados na janela principal é alterado, a seleção também é atualizada na tabela de atributos. Da mesma forma, se um conjunto de linhas selecionadas na tabela de atributos é modificada, o conjunto de elementos selecionado na janela principal será atualizado.

As linhas podem ser selecionadas ao clicar no número da linha, do lado esquerdo desta. Podem ser marcadas

Linhas múltiplas manter a tecla Ctrl primida. Pode ser feita uma seleção contínua se manter primida a tecla

Shift e clicar na entrada de várias linha, do lado esquerdo. Todas as linhas entre a posição atual do cursor e a linha clicada serão selecionados. Ao mover a posição do cursor na tabela de atributos, ao clicar um célula na tabela, não tem influência na seleção de linhas. Modificar a seleção na tela principal não altera a posição do cursor na tabela de atributos.

A tabela pode ser ordenada por qualquer coluna, clicando no cabeçalho da coluna. Uma pequena seta indica a forma de ordenação (apontar para baixo significa valores descendentes do topo da linha, apontar para cima significa valores descendentes do topo da linha).

Para uma simples busca por atributos em apenas uma coluna, escolha o: menu de seleção: filtrar Coluna -> a partir do menu no canto inferior esquerdo. Selecione o campo (coluna) em que a pesquisa deve ser realizada a partir do menu suspenso, e acertar o botão [Aplicar] . Então, apenas os recursos relacionados são mostrados na tabela de atributos.

Para fazer uma seleção, você tem que usar o | mIconExpressionSelect | : sup: SELECIONAR recursos usando o

ícone Expressão‘ no topo da tabela de atributos. | mIconExpressionSelect | : sup: SELECIONAR recursos usando uma Expressão‘ permite definir um subconjunto de uma tabela usando um: guilabel: Lista de Funções como no

| mActionCalculateField | : sup:‘ Campo Calculadora‘ (veja: ref: vetor_campo_calculadora). Os resultados da consulta podem ser salvos como uma nova camada vetorial. Por exemplo, se você quiser encontrar regiões que são bairros de: arquivo: regiões.shp do | QG | dados de exemplo, você tem que abrir o: guilabel:‘ Campos e

Valor-menu e escolher o campo que você deseja consultar. Clique duas vezes no campo ‘TIPO_2’ e também **

[Carregar todos os valores únicos]

**

. A partir da lista, selecione e clique duas vezes em Cidade. No: guilabel: campo Expressão , a consulta a seguir será exibida

"TYPE_2" = ’Borough’

Aqui você também pode usar o: menu de seleção: lista de Funções -> recente (Seleção) para fazer uma seleção que você usou antes. O construtor de expressão se lembra dos últimos 20 expressões usadas.

As linhas correspondentes serão selecionados, e o número total de linhas correspondentes será exibida na barra de título da tabela de atributos, bem como na barra de status da janela principal.

Para pesquisas que apresentam características só selecionadas no mapa, use o Construtor de Consultas descrito na seção: ref: vetor_consultas_construtor .

Para mostrar apenas os registros selecionados, use Mostrar feições selecionadas a partir do menu na parte inferior esquerda.

Os outros botões na parte superior da janela de tabela de atributos fornecem as seguintes funcionalidades:

Alternar o modo de edição para editar valores individuais e permitir funcionalidades descritas abaixo (também com Ctrl+E)

Salvar Editados

(também com Ctrl+S)

Desselecionar todosl

(também com Ctrl+U)

Mover seleção para o topo

(também com Ctrl+T)

Inverter seleção

(também com Ctrl+R)

Copiar linhas selecionadas para área de transferência

(também com Ctrl+C)

Zoom no mapa para linhas selecionadas

(também com Ctrl+J)

12.5. Editando 129

QGIS User Guide, Versão 2.6

Pan no mapa para linhas selecionadas

(também com Ctrl+P)

Deletar feição selecionada

(também com Ctrl+D) •

Nova Coluna para camadas PostGIS e para camadas OGR com versão GDAL >= 1.6 (também com

Ctrl+W

)

Deletar Coluna para camadas PostGIS e para camadas OGR com versão >= 1.9 (também com Ctrl+L)

Abrir calculadora de campo

(também com Ctrl+I)

Abaixo destes botões está a barra Calculadora de Campo, que permite que cálculos sejam aplicados rapidamente a atributos visíveis na tabela. Esta barra utiliza as mesmas expressões da de Campos em Vetores ).

Calculadora de Campo

(veja Calculadora

Dica: Ignorar geometria WKT

Se você quiser usar dados de atributos em programas externos (como Excel), use o | mActionCopySelected | : sup:

Copiar as linhas selecionadas para o botão clipe. Você pode copiar as informações sem geometrias vetoriais se você desativar: menu de seleção: ‘Configurações -> Opções -> Fontes de dados do menu | caixa | : guilabel:

Copiar geometria na representação WKT de atributo tabela .

Salvar elementos selecionados como nova camada

As feições selecionadas podem ser salvas em qualquer formato vetorial OGR-suportado e também transformado em um outro sistema de referência de coordenadas (SRC). Basta abrir o menu do botão direito do mouse da camada e clique em Salvar como para definir o nome do arquivo de saída, seu formato e SRC (ver seção

Legenda do

Mapa ). Para salvar a seleção garantir que a

|caixa| salvar apenas feição selecionada esteja selecionada. Também

é possível especificar opções de criação de OGR no diálogo.

Colar dentro de nova camada

Recursos que estão na área de transferência pode ser colado em uma nova camada. Para fazer isso, primeiro faça uma camada editável. Selecione algumas características, copiá-los para a área de transferência e colá-los em uma nova camada usando: menu de seleção: Editar -> Colar Características e escolher: menu de seleção:‘ Nova

Camada‘ no vetor ou: menu de seleção: Nova Camada na memória .

Isso se aplica a recursos selecionados e copiados dentro | QG | e também para recursos de outra fonte definida de acordo com o texto conhecido (WKT).

Trabalhando com tabelas de atributos não espaciais

QGIS allows you also to load non-spatial tables. This currently includes tables supported by OGR and delimited text, as well as the PostgreSQL, MSSQL and Oracle provider. The tables can be used for field lookups or just generally browsed and edited using the table view. When you load the table, you will see it in the legend field. It can be opened with the

Open Attribute Table tool and is then editable like any other layer attribute table.

Como exemplo, você pode usar colunas da tabelas não espaciais para definir valores de atributos, ou um intervalo de valores que são permitidos, para ser adicionado a uma camada de vetor específico durante a digitalização. Dê uma olhada mais de perto o widget de edição na seção: ref: vetor_atributos_menu para saber mais.

12.5.8 Criando uma ou mais relações

As relações são uma técnica frequentemente utilizada em bancos de dados. O conceito é, que as características

(linhas) de diferentes camadas (tabelas) podem pertencer a um ao outro.

130 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Como um exemplo, você tem uma camada com todas as regiões do Alasca (polígono), que fornece alguns atributos sobre o seu nome e tipo de região e um código único (que atua como chave primária).

Chaves Externas

Então você começa uma outra camada de ponto ou tabela com informações sobre aeroportos que estão localizados nas regiões e também querem manter o controle deles. Se você deseja adicioná-los à camada região, você precisa criar uma relação de um para muitos usando chaves estrangeiras, porque existem vários aeroportos na maioria das regiões.

Figura 12.45: Região Alaska com aeroportos

Além dos atributos já existentes na tabela de atributos de airport outro campo fk_region que atua como uma chave estrangeira (se você tiver um banco de dados, você provavelmente vai querer definir uma restrição sobre ele).

Este campo fk_região sempre conterá um codigo de uma região. Pode ser visto como um indicador para a região a que pertence. E você pode criar um formulário de edição personalizada para a edição e QGIS se preocupa com a configuração. Ele trabalha com diversos fornecedores (para que você também pode usá-lo com os arquivos de vários formatos e csv) e tudo o que você tem a fazer é as relações entre as tabelas QGIS.

Camadas

QGIS não faz diferença entre uma tabela e uma camada vetorial. Basicamente, uma camada de vetor é uma tabela com uma geometria. Então, pode adicionar sua tabela como uma camada vetorial. Para demostrar você pode carregar o arquivo shape “região” (com geometrias) e a tabela ‘aeroporto’ csv (sem geometrias) e uma chave estrangeira (fk_região) para a região da camada. Isto significa que cada aeroporto pertence a exatamente uma região, enquanto cada região pode ter qualquer número de aeroportos (a típica relação de um para muitos).

Definição (Gerenciador de relação)

A primeira coisa que vamos fazer é deixar QGIS saber sobre as relações entre a camada. Isso é feito em: menu de seleção: ‘Configurações -> : menu de seleção: Projeto Propriedades‘. Abra o: guilabel: menu de Relações e clique em: guilabel:‘ Adicionar‘.

• nome vai ser utilizado como um título. Deve ser um texto legível, descrevendo, para que a relação é utilizada. Vamos apenas dizer chamada “Airports” neste caso.

• camada de referência é o único com o campo de chave estrangeira sobre ele. No nosso caso, esta é a camada airports

12.5. Editando 131

QGIS User Guide, Versão 2.6

• campo referência dirá, quais os pontos de campo para a outra camada de modo que este será fk_region neste caso

• camada referenciada é a única com a chave primária, apontada, então aqui está a camada de regiões

• campo referenciado é a chave primária da camada referenciada por isso é ID

• ** código ** será usado para fins internos e tem de ser único. Você pode precisar dele para criar formulários personalizados uma vez que este é suportado. Se você deixá-lo vazio, será gerada para você, mas você pode atribuir um para obter que é mais fácil de manusear.

Figura 12.46: Gerenciador de relações

Formas

Agora que QGIS conhece a relação, ele vai ser usado para melhorar as formas que são gerados. Como nós não alteramos o método de formulário padrão (gerada automaticamente) ele vai apenas adicionar um novo widget em nosso formulário. Então, vamos selecionar a região de camada na legenda e use a ferramenta para identificar.

Dependendo das configurações, o formulário pode ser aberto diretamente ou você terá que optar por abri-lo na janela de identificação no âmbito de ações.

Como você pode ver, os aeroportos atribuídos a esta região em particular são todos mostrados em uma tabela. E há também alguns botões disponíveis. Vamos revê-los em breve

• O botão | mActionToggleEditing | serve para alternar o modo de edição. Esteja ciente de que ele alterna o modo de edição da camada de aeroporto, apesar de estarmos na forma de uma característica da camada região. Mas o quadro está representando características da camada aeroporto.

• O botão | mActionSignPlus | irá adicionar um novo recurso para a camada de aeroporto. E vai atribuir um novo aeroporto para a região atual por padrão.

• O botão apagará o aeroporto selecionado permanentemente.

• O símbolo | mActionLink | irá abrir uma nova janela onde você pode selecionar qualquer aeroporto existente, que será, então, atribuído à região atual. Isto pode ser útil se você criou o aeroporto na região errada por acidente.

• O símbolo | mActionUnlink | desvincula o aeroporto selecionado da região atual, deixando-os não atribuído

(a chave estrangeira é definida como NULO) de forma eficaz.

132 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

Figura 12.47: Diálogo identificação regions com relação a airports

• Os dois botões para a chave de visualização da tabela e formulário, onde o deixou-nos mais tarde, você vê todos os aeroportos no seu respectivo formulário.

Se você trabalha na tabela aeroporto, um novo tipo de widget está disponível que permite que você incorpore a forma característica da região referenciada na forma característica dos aeroportos. Ele pode ser usado quando você abre as propriedades da camada da tabela de aeroportos, mude para o: menu de seleção: menu de campos e mudar o tipo de widget do campo de chave estrangeira ‘fk_região’ a relação de referência.

Se você olhar para a caixa de diálogo agora, você vai ver, que a forma de a região estar inserida dentro do formulário aeroportos e até mesmo ter um caixa de combinações, que permite atribuir o atual aeroporto para outra região.

Figura 12.48: Diálogo identificação aeroportos com relação a regiões

.

12.6 Ferramenta de Consulta

A ferramenta de consulta permite que você defina um subconjunto de uma tabela utilizando uma condição SQL como a cláusula WHERE e mostrar o resultado na tela principal. O resultado da consulta pode ser salvo como uma nova camada vetorial.

12.6. Ferramenta de Consulta 133

QGIS User Guide, Versão 2.6

12.6.1 Consulta

Abra a Ferramenta de Consulta abrindo as propriedades da camada e no menu escolha a guia Geral. Abaixo da guia [subdivisão de feição], clique no botão Ferramenta de Consulta para abrir a janela Ferramenta de Consulta.

Por exemplo, se você tem uma camada de regiões com um campo TYPE_2, você pode selecionar apenas as regiões que são bairros na caixa Fornecedor de expressão de filtragem específica da Ferramenta de Consulta. A

Figure_attributes_2 mostra um exemplo da construção da Ferramenta de Consulta com a camada regions.shp

do dados de exemplo do QGIS. As seções dos campos, valores e Operadores ajudam você a contruir uma consulta

SQL.

Figura 12.49: Ferramenta de Consulta

A Lista campos contém todas as colunas de atributo da tabela de atributos a serem pesquisadas. Para adicionar uma coluna de atributo para o campo cláusula do SQL WHERE, clique duas vezes em seu nome na lista Campos.

Geralmente, você pode usar os vários campos, valores e operadores para construir a consulta, ou você pode simplesmente digitá-lo na caixa de SQL.

A Lista valores lista os valores de uma tabela de atributos. Para listar todos os valores possíveis de um atributo, selecione o atributo na lista Campos e clique no botão [todos]. Para listar os primeiros 25 valores exclusivos de uma coluna de atributo, selecione a coluna atributo na lista Campos e clique no botão [Simples]. Para adicionar um valor para o campo SQL WHERE cláusula, clique duas vezes em seu nome na lista de valores.

A Seção Operadores contém todos os operadores utilizáveis. Para adicionar um operador para o campo cláusula

SQL WHERE, clique no botão apropriado. Os operadores relacionais ( =, >, ...), operador de comparação de texto

( como), e os operadores lógicos (e, ou, ... ) estão disponíveis.

O botão [Teste] mostra uma caixa de mensagem com o número de feições que satisfazem a consulta atual, que é

útil no processo de construção de consulta. O botão [Limpar] limpa o texto no campo de texto da cláusula SQL

WHERE. O botão [OK] fecha a janela e seleciona as feições que satisfazem a consulta. O botão [Cancelar] fecha a janela sem alterar a seleção atual.

QGIS trata os atos de subconjunto resultantes como se onde toda a camada. Por exemplo, se você aplicou o filtro acima para ‘Bairro’, você não pode exibir, consultar, salvar ou editar o Município de Ankorage, porque isso é um

‘Município’ e, portanto, não faz parte do subconjunto.

134 Capítulo 12. Trabalhando com Dados Vetoriais

QGIS User Guide, Versão 2.6

.

A única exceção é que, a menos que sua camada faz parte de um banco de dados, utilizando um subconjunto irá evitar que edite a camada.

12.7 Calculadora de Campo

O botão

Calculadora de Campo na tabela de atributos permite-lhe executar cálculos com base em valores de atributos ou funções existentes definidas, por exemplo, para calcular o comprimento ou área da feição geométrica. Os resultados podem ser colocados em uma nova coluna para o atributo, um campo virtual, ou serem usados para atualizar os valores de uma coluna já existente.

Dica: Campo Virtual

• Campos virtuais não são permanentes e não são salvos.

• Para fazer com que um campo virtual que será feito quando o campo é feito.

A calculadora de campo já está disponível em qualquer camada que suporta edição. Quando você clica no ícone da calculadora de campo o diálogo é aberto (ver

figure_attributes_3 ). Se a camada não estiver em modo de edição,

será exibido um aviso e usando a calculadora de campo fará com que a camada seja colocada em modo de edição antes do cálculo ser feito.

A barra da calculadora de campo rápida no topo da tabela de atributo é visível somente se a camada estiver editável.

Rápidamente na barra da calculadora de campo, você primeiro seleciona o nome do campo existente, em seguida, abre o diálogo de expressão para criar a sua expressão ou escrevê-la diretamente no campo, em seguida, clique no botão Atualizar tudo.

Na caixa de diálogo da calculadora de campo, primeiro você deve selecionar se deseja apenas atualizar feições selecionadas, crie um novo campo de atributo onde serão adicionados os resultados do cálculo ou atualize um campo existente.

Se optar por adicionar um novo campo, você precisa digitar um nome do campo, o tipo do campo (inteiro, real ou texto), a largura total do campo, e a precisão do campo (ver

figure_attributes_3 ). Por exemplo, se você escolher

uma largura de campo de 10 e uma precisão de 3, significa que você tem 6 números antes do ponto, depois o ponto em si e por ultimo mais 3 dígitos indicando a precisão.

Um breve exemplo ilustra como a calculadora de campo funciona. Nós queremos calcular o comprimento em km na camada railroads do conjunto de dados amostra do QGIS:

1. Carregue a Shapefile railroads.shp no QGIS e pressione

Abrir Tabela de Atributos

.

2. Clique no

Alternar o modo de edição e abra a janela da

Calculadora de Campo

.

3. Seleciona a caixa de verificação

Criar novo campo para salvar os cálculos em um novo campo.

4. Adicione comprimento como campo de saída do nome, real como o tipo de campo de saída e defina o comprimento do campo de saída de 10 e Precisão 3.

5. agora de duplo clique na função $length no grupo Geometria para adiciona-lo à caixa de expressões da

Calculadora de campo.

6. Complete a expressão introduzindo “/ 1000” na caixa de expressões da Calculadora de campo e clique [OK].

7. Agora você pode encontrar um novo campo length na tabela de atributos.

.

As funções disponíveis são listadas no capítulo

Expressões .

12.7. Calculadora de Campo 135

QGIS User Guide, Versão 2.6

136

Figura 12.50: Calculadora de Campo

Capítulo 12. Trabalhando com Dados Vetoriais

CAPÍTULO

13

Trabalhando com Dados Raster

.

13.1 Trabalhando com dados raster

Esta seção descreve como visualizar e definir as propriedades da camada raster. QGIS usa a biblioteca GDAL para ler e gravar os formatos de dados raster, incluindo Grid ArcInfo Binary, Grid ArcInfo ASCII, GeoTIFF, ERDAS

IMAGINE, e muitos mais. Apoio raster GRASS é fornecido por um complemento nativo do provedor de dados do QGIS. Os dados raster também podem ser carregados no modo de leitura de arquivos ZIP e GZIP no QGIS.

A partir da data deste documento, mais de 100 formatos raster são suportados pela biblioteca GDAL (ver

GDAL-SOFTWARE-SUITE em

Referências Bibliográficas e Web ).

A lista completa está disponível em http://www.gdal.org/formats_list.html

.

Nota: Nem todos os formatos mencionados podem trabalhar no QGIS por várias razões. Por exemplo, alguns exigem bibliotecas comerciais externas, ou a instalação de seu sistema operacional GDAL pode não ter sido construída para suportar o formato que você deseja usar. Apenas os formatos que foram bem testados irão aparecer na lista de tipos de arquivos ao carregar um raster no QGIS. Outros formatos não testados podem ser carregados, selecionando o filtro [GDAL] Todos os arquivos (*).

Trabalhando com dados raster GRASS é descrita na seção

Integração com SIG GRASS .

13.1.1 O que são dados raster?

Dados raster em SIG são matrizes de células distintas que representam feições sobre, acima ou abaixo da superfície da terra. Cada célula da grade raster é do mesmo tamanho, e as células são geralmente retangular (no QGIS elas vão sempre ser retangulares). Conjuntos de dados raster típicos incluem dados de sensoriamento remoto, como fotografias aéreas ou imagens de satélite e dados modelados, como uma matriz de elevação.

Ao contrário dos dados vetoriais, dados raster, normalmente, não têm um registro de banco de dados associado a cada célula. Eles estão georreferenciados por pixels de resolução e coordenadas x/y de um pixel de canto da camada raster. Isso permite o QGIS posicionar os dados corretamente na tela do mapa.

QGIS faz uso de informações de georreferenciamento dentro da camada raster (por exemplo,: índice: GeoTiff ) ou em um arquivo mundo apropriado para exibir corretamente os dados.

13.1.2 Carregando dados raster no QGIS

Camadas raster são carregadas ou clicando no ícone mada

Adicionar Camada Raster

Adicionar Camada Raster ou selecionando a opção de menu Ca-

. Mais de uma camada podem ser carregadas ao mesmo tempo mantendo

137

QGIS User Guide, Versão 2.6

a tecla Ctrl ou Shift pressionada e clicando em vários itens na janela Abrir uma fonte de dados Raster GDAL suportada .

Uma vez que uma camada raster é carregada na legenda do mapa, você pode clicar sobre o nome da camada com o botão direito do mouse para selecionar e ativar feições específicas da camada ou para abrir um diálogo para definir as propriedades raster para a camada.

Menus do Botão direito do mouse para camadas raster

• Zoom para extensão da camada

• Zoom para melhor escala (100%)

• Estenda usando a extensão atual

• Mostrar em visão geral

• Remover

• Duplicado

• Definir SRC da camada

• Definir SRC do projeto para camada

• Salvar como ...

• Propriedades

• Renomear

• Copiar Estilo

• Adicionar novo Grupo

• Expandir tudo

• Fechar tudo

• Atualização da ordem do desenho

|atualizardireitos|

13.2 Diálogo de propriedades do Raster

Para visualizar e definir as propriedades da camada de um layer, dê um duplo clique no nome da camada na legenda do mapa, ou clique com botão direito no nome da camada e escolha:Propriedades a partir do menu de contexto. Isto vai abrir o diálogo :guilabel: ‘ Propriedades da camada Raster ‘ (ver

figura_raster_1 ).

Existem vários menus na janela de dialogo:

• Geral

• Estilo

• Transparência

• Pirâmides

• Histograma

• Metadados

138 Capítulo 13. Trabalhando com Dados Raster

QGIS User Guide, Versão 2.6

Figura 13.1: Diálogo de Propriedades das Camadas do Raster

13.2.1 Menu Geral

Informação da camada

O menu Geral apresenta informação básica do raster selecionado, incluindo o caminho da camada origem, o nome que aparece na legenda (que pode ser modificado), e o número de colunas, linhas e valores nulos do raster.

Sistema de Referência de Coordenadas

Aqui encontra-se a informação do Sistema de Referencia de Coordenadas (SRC), impressa na linha PROJ.4. Se esta definição no é a correta, pode-se modificar, clicando no botão [Especifique]

Visibilidade dependente da escala

Também nesta aba pode acertar a visibilidade dependente da escala. Será necessária clicar a caixa de checagem e colocar uma escala apropriada, na qual seus dados serão visualizados na tela do mapa.

Na parte inferior, pode-se ver uma miniatura da camada, a simbologia da legenda e o mapa de cores.

13.2.2 Menu de Estilos

Representar a banda

QGIS permite quatro diferentes Tipos de Representação. A representação escolhida depende do tipo de dados.

1. Color multibanda - se o arquivo vem como multibanda, com várias bandas (por exemplo, usado para imagens de satélite com várias bandas)

13.2. Diálogo de propriedades do Raster 139

QGIS User Guide, Versão 2.6

2. Mapa de Cores - se um arquivo de banda única vem com um mapa de cores indexado (por exemplo, usado para mapas topográficos digitais)

3. Banda única cinza - (uma banda apenas) a imagem será representada como cinza; QGIS escolherá o método de representação, se o arquivo não é multibandas, não tem um mapa de cores indexado ou não tem um mapa de cores contínuos (por exemplo, usado para mapa de relevo sombreado)

4. Banda única Falsa Cor - este método de representação é usado em arquivos com mapa de cores contínuos ou com mapa de cores (por exemplo, para mapa de elevações)

Multibanda Colorida

Para representar em color multibanda, selecione três bandas da imagem que vai representar, cada banda representa respectivamente, a componente vermelha, verde e azul, que serão usadas para criar a cor da imagem. Podem-se escolher vários métodos para Melhora do contraste : ‘Sem melhora’, ‘Estique para MinMax’, ‘Estique e corte no

MinMax’ e ‘Corte no min max’.

Figura 13.2: Representação do Raster - Multibanda Colorida

Esta seleção lhe oferece uma ampla variedade de opções para modificar a aparência da sua camada raster. Primeiramente, deve-se ter a amplitude dos dados da sua imagem. Isto pode ser visto escolhendo Extensão e clicando

[Carregar]. QGIS pode lento) Precisão .

Estimar (mais rápido) os valores Mín e Máx das bandas ou use o Real (mais

Agora pode-se criar uma escala de cores com ajuda da seção Carregar valores mín/máx ‘ . Muitas imagens tem valores muito baixos ou muito altos. Estes valores discrepantes, ou outliers, podem ser eliminados usando o

|radiobuttonon| :guilabel:‘Corte na Contagem acumulativa para definir a eliminação. A amplitude padrão está fixada entre 2% a 98% dos valores dos dados e pode ser modificada manualmente. Com esta definição, o tipo cinza da imagem pode desaparecer. Com a opção de escala

Mín/máx

, QGIS cria uma tabela de cores com todos os dados incluídos na imagem original (por exemplo, QGIS cria uma tabela de cor com 256 valores, se temos uma imagem com banda de 8 bits). Pode-se calcular também uma tabela de cores usando :guilabel: ‘ Média +/- x desvio padrão ‘ . Assim, apenas valores dentro do desvio padrão o dentro de múltiplos desvios padrão serão considerados na tabela de cores. Isto é útil quando se tem uma ou duas células com valores sumamente altos em uma gride raster que tem um impacto negativo na representação da imagem raster

Todos os cálculos pode ser feitos também através da extensão Atual

Dica: Visualizando uma única banda do Raster Multibanda

Se deseja ver uma única banda de uma imagem multibanda (por exemplo apenas a Vermelha), pode-se colocar as bandas Verde e Azul como “Não definidas”, mas isto não é a forma correta. Para mostrar apenas a banda

Vermelha, coloque o tipo da imagem como ‘Banda única Cinza’, depois selecione o Vermelho como a banda para usar no Cinza.

140 Capítulo 13. Trabalhando com Dados Raster

QGIS User Guide, Versão 2.6

Mapa de Cores

Esta é a opção padrão de representação para arquivos de uma banda que incluem uma tabela de cores, onde a cada valor de pixel é atribuída uma determinada cor. Nesse caso, o mapa de cores é gerado automaticamente. SE deseja cambiar as cores atribuídas a determinados valores, apenas de clique duplo no color e a janela de diálogo

Selecione cor vai aparecer.Também em QGIS 2.2. agora é possível atribuir um rótulo aos valores das cores. Assim o rótulo aparece na legenda da camada raster.

Figura 13.3: Representação do Raster - Mapa de cores

Melhora do contraste

Nota: Quando adicionamos camadas GRASS, a opção Melhorar o Contraste será automaticamente definida como esticar ao mín máx, independentemente de estar definido outro valor na QGIS opções gerais.

Banda única cinza

Esse método permite representar uma camada de uma banda através de Gradiente de Cores: Preto para Branco’ ou ‘Branco para Preto’. Pode definir os valores Mín e Máx escolhendo primeiro a Extensão e depois clicando em

[Carregar]. QGIS pode Estimar (mais rápido) os valores Mín e Máx das bandas ou usar Real (mais lento)

Precisão .

Pode-se criar uma escala de cores com ajuda da seção Carregar valores mín/máx. Os valores discrepantes podem ser eliminados usando o :guilabel:Com esta definição, os valores cinza da imagem podem desaparecer. Outras definições podem ser determinadas com o Mín/máx e Média +/- x desvio padrão . Enquanto a primeira opção cria uma tabela de cores com todos os dados incluídos na imagem original, a segunda cria uma tabela de cores que considera apenas dentro do desvio padrão ou dentro de vários desvios pad‘Corte na Contagem acumulativa‘ para definir a eliminação. A amplitude padrão está fixada entre 2% a 98% dos valores dos dados e pode ser modificada manualmente. rão. Isto é util quando se tem uma ou duas células com valores anormalmente altos numa gride raster que provocam um impacto negativo na representação da imagem raster.

Singleband pseudocolor

Este é um opção de representação para arquivos de uma banda, que incluem um mapa de cores contínuo. Pode-se também aqui criar mapas de cores individuais para uma banda.

Existem três tipos de interpolação de cores:

1. Método Discreto

2. Método Linear

13.2. Diálogo de propriedades do Raster 141

QGIS User Guide, Versão 2.6

Figura 13.4: Representação do Raster - Banda única cinza

142

Figura 13.5: Representação do Raster - Banda única Falsa Cor

Capítulo 13. Trabalhando com Dados Raster

QGIS User Guide, Versão 2.6

3. Método Exato

No bloco da esquerda, o botão

Adicionar valores manualmente

, adiciona um valor individual na tabela de cores. O botão

Apagar a linha selecionada

, apaga um valor individual da tabela e o botão

, Ordene os valores do mapa de cores ordena a tabela de acordo ao valor de pixel da coluna valor. Também é possível adicionar rótulos para cada cor,

, mas esse valor não será mostrado quando se use o identificador feição ferramenta. Também pode clicar no botão

Carregar mapa de cor da banda

, o qual tenta carregar uma tabela de cores a partir da banda (se tem alguma). Pode-se usar também os botões

Carregar mapa de cor de arquivo o

Exportar mapa de color map para arquivo de cor já existente o salvar uma tabela de cor para uso futuro.

, para carregar uma tabela

No bloco da direita, Generar novo mapa de cor, permite criar novos mapas de cor categorizados. Em Modo

Classificação ‘Intervalos iguais’, apenas necessita selecionar o Número de classes e clicar o botão

Classificar . Pode-se inverter as cores do mapa de cores clicando na caixa de seleção Invertir . Em caso de

Modo ‘Contínuo’, QGIS cria as classes automáticamente, dependo dos valores Mín and Máx. A definição dos valores Mín/Máx, pode ser feita com ajuda da seção Carregar valores mín/máx. Muitas imagens tem uns poucos valores com dados muito altos e baixos. Esses valores discrepantes ou outliers, podem ser eliminados usando o botão :guilabel: ‘‘ Corte na Contagem acumulativa‘ para definir a eliminação. A amplitude padrão está fixada entre 2% a 98% dos valores dos dados e pode ser modificada manualmente. Com esta definição, os valores cinzas na imagem podem desaparecer. Com a opção de escala Mín/máx , QGIS cria uma tabela de cores com todos os dados incluídos na imagem original (por exemplo, QGIS cria uma tabela de cores com 256 valores, dado o fato de tersetemos uma imagem com banda de 8 bit). Pode-se calcular também uma tabela de cores usado o botão

Média +/- x desvio padrão

. Assim, são considerados para a tabela de cores, apenas os valores dentro do desvio padrão ou dentro de vários desvios padrão

Representação das cores

Em cada Representação da banda, é possível encontrar uma Representação da cor

Podem-se fazer efeitos especias de representação para seus arquivo(s) raster, usando um dos modos de combinação

(veja

Janela de Propriedades de Vetor ).

Definições adicionais podem ser estabelecidas modificanco em Brilho, Saturação e Contraste. Pode usar também a opção Escala de cinzas, onde pode escolher entre ‘ Por claridade’, ‘Por luminosidade’ e ‘Por média’. Por um determinado matiz na tabela de cores, você pode modificar a ‘Força’.

Reamostragem

A opção Reamostragem, faz a representação da imagem quando se dá mais ou menos zoom nela. Os modos de reamostragem podem melhorar a apariência do mapa. Eles calculam um novo valor de cinza através de uma transformação geométrica.

Quando aplicamos o método ‘Vizinho mais próximo’, o mapa pode ter uma estrutura tipo pixelada, quando damos mais zoom. Essa apariència pode ser melhorada usando os métodos ‘Bilinear’ ou ‘Cúbico’., o qual causa que as feições mais afiadas, se suavizem.

13.2.3 Menu de transparência

QGIS mostra cada camada raster com um nível diferente de transparência. Use a barra deslizante de transparência para indicar a que nível as camadas de baixo (se houver alguma) devem ser vísiveis através da camada em uso. Isto é muito útil se deseja sobrepor mais de uma camada (por exemplo um mapa de relevo sombreado sobreposto a um mapa raster com classificação). Assim o mapa terá um aspecto mais tridimensional.

Além disso pode-se colocar um valor de pixel que será considerado como SEMDADOS no menu Valor adicional sem dados

13.2. Diálogo de propriedades do Raster 143

QGIS User Guide, Versão 2.6

Figura 13.6: Representação Raster - Reamostragem

Uma maneira ainda mais flexível de modificar a banda de transparência poder ser feita no :guilabel: Modificações das opções de transparência . Aqui podemos definir a transparência de cada pixel.

Como exemplo, desejamos colocar a água de nosso arquivo raster de exemplo :Arquivo:‘landcover.tif‘ , com transparência de 20%. Os seguintes passos são necessários:

1. Carregar o arquivo raster: Arquivo:landcover.tif.

2. Abra o diálogo Propriedades fazendo clique duplo no nome do raster na legenda, o clicando com botão e selecionando:Propriedades do menu pop-up.

3. Selecione o menu Transparência

4. No menu Transparência da banda, escolher ‘Nenhum’.

5. Clique no botão

Adicionar valores manualmente uma nova linha vai aparecer na lista de pixels.

6. Entre o valor raster na coluna ‘De’ e ‘Até’ (usamos 0 aqui), e ajuste a transparência a 20%.

7. Pressione o botão [Aplicar] e visualize no mapa as modificações feitas.

Podemos repetir os passos 5 e 6 para definir mais valores com a transparência desejada.

Como podemos ver, é fácil definir uma transparência desejada, mas requer um grande esforço. Aliás, pode-se

Importar do arquivo usar o botão

Exportar para arquivo para gravar sua lista de transparências num arquivo. O botão carrega sua definição de transparências e a aplica à camada do raster em uso.

13.2.4 Menu de Pirâmides

Grandes camadas raster com grande resolução, podem tornar a navegação lenta em QGIS. Criando cópias em baixa resolução dos dados (pirâmides), o desempenho pode ser melhorado consideravelmente, já que QGIS, seleciona a resolução mais apropriada dependendo do nível do zoom.

Você deve pode ter direito de gravação no diretório onde os dados originais são armazenados para construir pirâmides.

Vários métodos de reamostragem podem ser usados para calcular as piramides.

• Vizinho mais próximo

• Média

• Gauss

144 Capítulo 13. Trabalhando com Dados Raster

QGIS User Guide, Versão 2.6

• Cúbico

• Modo

• Nenhum

Se seleciona ‘Interno (se possível)’ do menu Formato Overview , QGIS tenta calcular as pirâmides internamente.

Pode-se selecionar também ‘Externo’ e ‘Erdas Externo (Formato Erdas Imagine).

Figura 13.7: The Pyramids Menu

Note que o cálculo de pirâmides pode modificar o arquivo original de dados, e uma vez criado, não pode ser apagado. Se deseja preservar uma versão ‘sem pirâmides’ de seu raster, faça uma copia de segurança antes do cálculo das pirâmides.

13.2.5 Menu Histograma

O menu The Histograma permite ver a distribuição das bandas ou cores no raster. O histograma é gerado automaticamente quando se abre o menu Histograma. Todas as bandas presentes som apresentadas juntas. Pode-se salvar o histograma como imagem com o botão |mAçãoSalvarArquivo| . Com a opção With the Visibilidade do menu Prefs/Ações , podem se mostrar histogramas individuais de bandas. Para isto, selecione a opção

Mostrar banda selecionada

. O Opções Mín/máx permite ‘Sempre mostrar marcadores mín/máx ‘, a ‘Zoom para mín/máx’ e ‘Atualizar estilo para mín/máx’. Depois de escolher Opções Mín/máx usando a opção Ações pode-se

‘Redefinir’ e ‘Recalcular o histograma’ .

13.2.6 Menu Metadados

.

O menu Metadados, mostra o estado da informação da camada do raster, incluindo estatísticas de cada banda na camada do raster em uso. A partir deste menu, podem ser definidas entradas na guia Descrição, Atribuição,

MetadadosUrl e Propriedades. Na guia:guilabel:Propriedades, são geradas estatísticas na base de ‘é preciso saber’ ou seja é possível que uma determinada e específica estatística da camada, no tenha sido ainda coletada.

13.2. Diálogo de propriedades do Raster 145

QGIS User Guide, Versão 2.6

Figura 13.8: Histograma do raster

146

Figura 13.9: Metadados do raster

Capítulo 13. Trabalhando com Dados Raster

QGIS User Guide, Versão 2.6

13.3 Calculadora Raster

A Calculadora Raster no menu Raster permite realizar cálculos com base em valores de pixel raster existentes

(ver

figure_raster_10 ). Os resultados são gravados em uma nova camadar com um formato suportado-GDAL.

Figura 13.10: Calculador Raster

As lista Bandas raster contêm todas camadas raster carregadas e que podem ser usadas. Você pode então usar os operadores para construir expressões de cálculo, ou você pode simplesmente digitá-las na caixa.

Na seção camada resultado, você precisará definir uma camada de saída. Você pode, então, definir a extensão da área de cálculo baseado em uma camada raster de entrada, ou com base nas coordenadas X, Y e em colunas e linhas, para definir a resolução da camada de saída. Se a camada de entrada tem uma resolução diferente, os valores serão redefinidos com o algoritmo vizinho mais próximo.

A seção operadores contém todos os operadores disponíveis. Para adicionar um operador de caixa de expressão na calculadora raster, clique no botão apropriado. Cálculos Matemáticos (‘‘ + , ‘‘ - ‘‘, ‘‘ * ‘‘, ...) e funções trigonométricas (‘‘sen

, cos, tan, ... ) estão disponíveis. Fique ligado para mais operadores que poderão surgir!

Com a caixa Adicionar resultado para projetar , a camada resultado será adicionada automaticamente à área de legenda e poderá ser visualizada.

13.3.1 Exemplos

Converter valores de elevação de metros para pés

Criar um raster de elevação em pés de uma varredura em metros, você precisa usar o fator de conversão de metros para pés: 3.28. A expressão é:

13.3. Calculadora Raster 147

QGIS User Guide, Versão 2.6

"[email protected]"

*

3.28

Usando uma máscara

Se você quer mascarar partes de um raster – digamos, por exemplo, porque você está interessado apenas em altitudes superiores a 0 metros – você pode usar a seguinte expressão para criar uma máscara e aplicar o resultado de uma varredura em uma única etapa.

( "[email protected]" >= 0 )

*

"[email protected]"

Em outras palavras, para cada célula maior ou igual a 0, defina seu valor para 1. Caso contrário, defina-o como 0.

Isso cria a máscara sobreposta.

Se você quiser classificar um raster - digamos, por exemplo, em duas classes de elevação, você pode usar a seguinte expressão para criar um raster com dois valores 1 e 2 em uma única etapa.

( "[email protected]" < 50 )

*

1 + ( "[email protected]" >= 50 )

*

2

.

Em outras palavras, para cada célula menor que 50 defina seu valor como 1. Para cada célula maior ou igual a 50 defina seu valor como 2.

148 Capítulo 13. Trabalhando com Dados Raster

CAPÍTULO

14

Trabalhando com dados OGC

.

14.1 QGIS como Cliente de Dados OGC

O Consórcio Geoespacial Aberto (OGC), é uma organização internacional como mais de 300 organizações em todo mundo do tipo comerciais, sem fins lucrativos e de investigação. Os membros desenvolvem e implementam padrões para os conteúdos e serviços geoespaciais, processamento e troca de dados SIG.

Descrevendo um modelo básico de dados para elementos geográficos e um número crescente de específicações estão desenvolvidos para servir necessidades específicas para localização interoperável e tecnologia geoespacial, incluindo o SIG. Mais informação é encontrada em http://www.opengeospatial.org/ .

As especificações OGC importantes suportadas pelo QGIS são:

• WMS — Serviço de Mapas Web ( Cliente WMS/WMTS )

• WMTS — Serviço de Mosaicos de Mapa Web ( Cliente WMS/WMTS )

• WFS — Serviços de Elementos Web ( WFS e WFS-T Cliente )

• WFS-T — Serviços de Elementos Web - Transacionais ( WFS e WFS-T Cliente )

• WCS — Serviços de Cobertura Web (

WCS Cliente

)

• SFS — Elementos Simples para SQL (

Camadas PostGIS

)

• GML — Linguagem de Marcadores Geográfico

Os serviços OGC estão a ser crescentemente usados para troca de dados geoespaciais de diferentes implementações SIG e armazenamento de dados. O QGIS consegue lidar com as especificações em baixo como cliente, sendo SFS (através do suporte do fornecedor PostgreSQL/ PostGIS, veja Seção

Camadas PostGIS ).

14.1.1 Cliente WMS/WMTS

Visão Global do Suporte WMS

O QGIS atualmente pode funcionar como cliente WMS que entende servidores WMS 1.1, 1.1.1 e 1.3. Foi particularmente testado contra serviços públicos de acesso como os DEMIS.

Os servidores WMS funcionam através de pedidos pelo cliente (ex.: QGIS) para mapas raster com uma dada extensão, conjunto de camadas, estilos de simbolização, e transparência. O servidor WMS de seguida consulta as suas fontes de dados locais, matricializa num mapa e manda de volta ao cliente em formato raster. Para o QGIS isto tipicamente vem em JPEG ou PNG.

WMS é um serviço REST genérico (Estado de Transferência Representativo) mais que um Serviço Web completamente fundido. Como tal, pode realmente obter os URLs gerados pelo QGIS e usá-los num navegador da web para recuperar as mesmas imagens que o QGIS usa internamente. Isto pode ser útil para resolver problemas, uma

149

QGIS User Guide, Versão 2.6

vez que existem várias marcas de servidores WMS no mercado e todos eles têm a sua própria interpretação da norma WMS.

As camadas WMS podem ser adicionadas facilmente, desde que conheça o acesso URL para o servidor WMS, tenha uma ligação de serviço a esse servidor, e o servidor compreenda HTTP como um mecanismos de transporte de dados.

Visão Global do Suporte WMTS

O QGIS pode também agir como um cliente WMTS. O WMTS é um padrão OGC para a distribuição de conjuntos de mosaicos de dados geoespaciais. Isto é uma forma mais rápida e mais eficiente para distribuir dados que o WMS porque com o WMTS os conjuntos de mosaicos são pré-gerados e o cliente apenas faz pedidos de transmissão dos mosaicos e não os produz. Um pedido típico do WMS envolve a geração e transmissão de dados. Um exemplo conhecido de um padrão não-OGC para a visualização de mosaicos de dados geoespaciais é o Google Maps.

De maneira a exibir os dados a várias escalas perto do que o utilizador queira ver, os conjuntos de mosaicos WMTS são produzidos em vários diferentes níveis de escala e são disponibilizados para o cliente SIG a seu pedido.

Este diagrama ilustra o conceito dos conjuntos de mosaicos

Figura 14.1: Conceito dos conjuntos de mosaicos do WMTS

Os dois tipos de interfaces WMTS que o QGIS suporta são via Key-Value-Pairs (KVP) e RESTful. Estas duas interfaces são diferentes e necessita especificá-los ao QGIS de forma diferente.

1) In order to access a WMTS KVP service, a QGIS user must open the WMS/WMTS interface and add the following string to the URL of the WMTS tile service:

"?SERVICE=WMTS&REQUEST=GetCapabilities"

Um exemplo deste tipo de endereço é http://opencache.statkart.no/gatekeeper/gk/gk.open_wmts?\ service=WMTS&request=GetCapabilities

A camada topo2 funciona lindamente para testar neste WMTS. Adicionando esta linha e texto indica que é um serviço web WMTS que deverá ser usado em vez de o serviço WMS.

2. O serviço WMTS RESTful torna-se uma forma diferente, é um URL simples, a forma recomendada pela

OGC é:

{WMTSBaseURL}/1.0.0/WMTSCapabilities.xml

Este formato ajuda-o a reconhecer que isto é um endereço RESTful. O WMTS RESTful é acedido no QGIS adicionando simplesmente o endereço na configuração do WMS no campo do URL da forma. Como exemplo para um mapa base Austríaco deste tipo de endereço é http://maps.wien.gv.at/basemap/1.0.0/WMTSCapabilities.xml

.

150 Capítulo 14. Trabalhando com dados OGC

QGIS User Guide, Versão 2.6

Nota: Pode encontrar alguns serviços antigos chamados de WMS-C. Esses serviços são muito semelhantes ao WMTS com a mesma finalidade mas trabalham ligeiramente diferente).

Pode gerilos da mesma forma que faz nos serviços WMTS. Apenas adicione ?tiled=true no final do url.

Veja http://wiki.osgeo.org/wiki/Tile_Map_Service_Specification para mais informações sobre esta especificação.

Quando lê o WMTS pode muitas vezes pensar em WMS-C.

Selecionando os Servidores WMS/WMTS

Na primeira vez que usa o elemento WMS no QGIS, não existem servidores definidos.

Comece clicando no botão cionar Camada WMS ...

.

Adicionar camada WMS na barra de ferramentas, ou através do menu Camada → Adi-

A janela Adicionar Camada(s) do Servidor para adicionar camadas dos servidores WMS aparecem.

Pode adicionar alguns servidores para brincar clicando no botão [Adicionar servidores padrões] . Isto irá adicionar dois servidores WMS demonstração para que possa usar, os servidores WMS do DM Solutions Group e

Lizardtech. Para definir uma novo servidor WMS no separador Camadas, selecione o botão [Novo] . De seguida introduza os parâmetros de ligação que deseja para o Servidor WMS, como está listado na

table_OGC_1 :

Nome Um nome para esta ligação. Este nome será usado para a lista de Ligações do Servidor para

URL que possa distingui-la de outros Servidores WMS.

URL do servidor que fornece os dados. Isto deverá ser um nome de alojamento válido – o

Usuário

Senha mesmo formato que irá usar para abrir a ligação telnet ou o ping a um alojamento.

Nome de Utilizador para aceder a um Servidor WMS protegido. Este parâmetro é opcional.

Senha para autenticação básica no Servidor WMS. Este parâmetro é opcional.

Ignorar

GetMap URI

Ignorar

GetFeatureInfo

URI

Ignorar GetMap URI reportado nas capacidades . Use um URI dado em cima para o campo URL.

Ignorar GetMap URI reportado nas capacidades , use um URI dado em cima para o campo URL.

Tabela 1 OGC : Parâmetros de Ligação do WMS

Se precisar de configurar um servidor proxy para receber serviços WMS da internet, pode adicionar o seu servidor proxy nas opções. Escolha o menu Configurações → Opções e clique no separador Rede & Proxy. De seguida pode adicionar as suas configurações de proxy e ativá-las configurando o

Certifique-se que selecionou o tipo proxy correto da lista de menu Tipo de Proxy

Use o proxy para acesso web .

.

Uma vez a nova ligação do Servidor WMS for criada, será preservada para sessões futuras do QGIS.

Dica: Ligar URLs dos Servidores WMS

Certifique-se, que quando introduzir o URL do servidor WMS, seja o URL base. Por exemplo, não deve ter fragmentos como request=GetCapabilities ou version=1.0.0 no seu URL.

Carregando as camadas WMS/WMTS

Uma vez preenchido os parâmetros com sucesso pode usar o botão [Ligar] para responder às capacidades do servidor selecionado. Isto inclui a codificação da imagem, Camadas, Estilos de Camadas, e Projeções. Uma vez que isto é uma operação de rede, a velocidade de resposta depende da qualidade da ligação da sua rede ao servidor

WMS. Enquanto faz a transferência de dados do servidor WMS, o progresso da transferência é visualizada no canto inferior esquerdo da janela do WMS.

O seu ecrã irá ficar parecido um pouco como

figure_OGR_1 , que mostra a resposta fornecida pelo servidor WMS

do DM Solutions Group.

Codificação da Imagem

14.1. QGIS como Cliente de Dados OGC 151

QGIS User Guide, Versão 2.6

152

Figura 14.2: Janela para adicionar servidores WMS, mostra as camadas disponíveis

Capítulo 14. Trabalhando com dados OGC

QGIS User Guide, Versão 2.6

A seção Codificação de Imagem agora apresenta uma lista de formatos suportados pelo cliente e servidor. Escolha de acordo com as exigências de precisão da sua imagem.

Dica: Codificação da Imagem

Tipicamente irá encontrar servidores WMS que oferecem a escolha da codificação de imagem JPEG ou PNG. O

JPEG é um formato de perda de compressão, enquanto que o PNG reprodução fielmente os dados raster brutos.

Use JPEG se espera dados WMS para fotografia na natureza e/ou não se importa da perda de alguma qualidade na imagem. Este típico trade-off reduz em 5 vezes o requerimento de transferência comparado ao PNG.

Use o PNG se necessitar representações precisas dos dados originais, e não se importa dos requerimentos de transferência de dados.

Opções

O campo Opções fornece um campo de texto onde pode adicionar Nome da Camada para a camada WMS. Este nome irá ser apresentado na legenda após carregamento da camada.

Em baixo do nome da camada pode definir Tamanho do mosaico, se quiser configurar os tamanhos do mosaico

(ex.: 256x256) para dividir o pedido do WMS em pedidos múltiplos.

O Limite de elementos para GetFeatureInfo define quais os elementos do servidor para consulta.

Se selecionou um WMS da lista, um campo com a projeção padrão, fornecida pelo mapserver, aparece. Se o botão [Change...] está ativo, pode clicar e mudar para a projeção padrão do WMS para outro SRC fornecido pelo

Servidor WMS.

Ordem das Camadas

O separador Ordem de Camada tem uma lista das camadas selecionadas disponíveis do WMS actual ligado.

Poderá reparar que algumas camadas expansíveis, isto significa que a camada pode ser exibida na escolha dos estilos de imagem.

Pode selecionar várias camadas de uma só vez, mas apenas um estilo de imagem por camada. Quando várias camadas são selecionadas, elas serão combinadas no Servidor WMS e transmitido ao QGIS de uma só vez.

Dica: Ordenação das Camadas WMS

As camadas WMS renderizadas por um servidor são sobrepostas na ordem da lista da seção de Camadas, de cima para baixo da lista. Se quiser alterar a ordem de sobreposição, pode usar o separador Ordem de camadas.

Transparência

Nesta versão do QGIS, a configuração Transparência Global da Propriedades da Camada está codificado para estar sempre ligado, quando disponível.

Dica: Transparência da Camada WMS

Disponibilidade da transparência da imagem do WMS depende da codificação da imagem usada: PNG e GIF suportam transparência enquanto que o JPEG deixa como não suportado.

Sistema de Referência de Coordenadas

O Sistema de Coordenadas Referência (SRC) é a terminologia OGC para uma projeção QGIS.

Cada Camada WMS pode ser apresentada em múltiplos SRC, depedendo da capacidade do servidor WMS.

Para escolher o SRC selecione [Alterar...] e a janela semelhante à da Figura Projeção 3 na

Trabalhando com

Projeções

aparecerá. A diferença principal com a versão do WMS do ecrã é que neste apenas os SRC suportados apareceram no Servidor WMS.

14.1. QGIS como Cliente de Dados OGC 153

QGIS User Guide, Versão 2.6

Pesquisa de servidor

Dentro do QGIS pode pesquisar por servidores WMS.

Figure_OGC_2

mostra o separador Pesquisar Servidor com a janela Adicionar Camada(s) do Servidor.

Figura 14.3: Janela de pesquisa de servidores WMS depois de algumas palavras-chave

Como pode ver é possível introduzir uma cadeia de texto de pesquisa no campo de texto e pressionar o botão

[Pesquisar]. Após pouco tempo o resultado da pesquisa será preenchido na lista debaixo do campo de texto.

Procure a lista de resultados dentro da tabela. Para visualizar os resultados, selecione uma entrada da tabela, prima o botão [Adicionar a linha selecionada à lista WMS] e mude para o separador Camadas. O QGIS automaticamente atualiza a sua lista de servidores e o resultado selecionado da pesquisa está disponível na lista de servidores WMS salvados no separador Camadas. Apenas precisará de pedir a lista de camadas clicando no botão

[Ligar]. Esta opção é especialmente útil quando quer pesquisar mapas por palavras-chave específicas.

Basicamente esta opção é um dianteira para a API do http://geopole.org

.

Mosaicos

Ao usar Serviços WMTS (WMS em cache) como http://opencache.statkart.no/gatekeeper/gk/gk.open_wmts?\ service=WMTS&request=GetCapabilities pode procurar através do separador Conjuntos de Mosaicos dados pelo servidor. Informação adicional como o tamanho do mosaico, formatos e SRC suportados estão na lista desta tabela. Em combinação com esta feição pode usar a escala da quadrícula do Configurações → Painéis (KDE e Windows) ou Ver → Painéis (Gnome e

MacOSX) e de seguida escolha Escala da quadrícula, que dá escalas disponíveis do servidor de mosaicos com uma barra de deslizamento acoplada.

154 Capítulo 14. Trabalhando com dados OGC

QGIS User Guide, Versão 2.6

Usando a Ferramenta Identificar

Uma vez adicionado o servidor WMS, e se qualquer camada do servidor WMS é consultável, pode usar a ferramenta

Identificar para selecionar o pixel do enquadramento do mapa. A consulta é feita ao servidor WMS para cada seleção feita. Os resultados da consulta vêm na forma de um texto plano. A formatação desse texto depende do servidor WMS particular usado. Seleção do formato

Se múltiplos formatos são suportados pelo servidor, uma caixa de combinação com os formatos suportados é automaticamente adicionado aos resultados da janela de identificação e o formato selecionado irá armazenar no projeto para a camada. Suporte do formato GML

A ferramenta

Identificar suporta respostas do Servidor WMS (GetFeatureInfo) no formato GML (é chamado de

Elemento no GUI do|qg| neste contexto). Se o formato “Elemento” for suportado pelo servidor e selecionado, os resultados da ferramenta Identificar são elementos vetoriais como normais camadas vetoriais. Quando um elemento é selecionado na árvore, é destacada no mapa e pode ser copiada para a área de transferência e colada em outra camada vetorial. Veja o exemplo da instalação em baixo do UMN Mapserver para suportar o formato

GML GetFeatureInfo.

# in layer METADATA add which fields should be included and define geometry (example):

"gml_include_items"

"ows_geometries"

"ows_mygeom_type"

"all"

"mygeom"

"polygon"

# Then there are two possibilities/formats available, see a) and b):

# a) basic (output is generated by Mapserver and does not contain XSD)

# in WEB METADATA define formats (example):

"wms_getfeatureinfo_formatlist" "application/vnd.ogc.gml,text/html"

# b) using OGR (output is generated by OGR, it is send as multipart and contains XSD)

# in MAP define OUTPUTFORMAT (example):

OUTPUTFORMAT

NAME "OGRGML"

MIMETYPE "ogr/gml"

DRIVER "OGR/GML"

FORMATOPTION "FORM=multipart"

END

# in WEB METADATA define formats (example):

"wms_getfeatureinfo_formatlist" "OGRGML,text/html"

Propriedades de Visualização

Uma vez ter adicionado o servidor WMS, pode ver as suas propriedades clicando com o direito do mouse na legenda, e selecionando Propriedades. Separador de Metadados

O separador Metadados exibem a riqueza de informação sobre o servidor WMS, geralmente recolhidos a partir da declaração de de Capacidades devolvidos a partir desse servidor. Muitas das definições podem ser removidas através da leitura dos padrões WMS (veja OPEN-GEOSPATIAL-CONSORTIUM

Referências Bibliográficas e

Web ), mas aqui estão algumas definições úteis:

• Propriedades do Servidor

– Versão do WMS — Versão do WMS suportada pelo servidor.

– Formatos de Imagem — A lista de MIME-types que o servidor pode responder com o desenho do mapa. O QGIS formata qualquer que seja as bibliotecas Qt subjacentes que foram construídas, que é pelo menos tipicamente a image/png e image/jpeg.

– Formatos de Identidade — A lista dos MIME-types do servidor pode responder quando usa a ferramenta identificar. Atualmente o QGIS suporta o tipo text-plain.

• Propriedades da Camada

14.1. QGIS como Cliente de Dados OGC 155

QGIS User Guide, Versão 2.6

– Selecionado — Querendo ou não esta camada selecionado quando o seu servidor foi adicionado a este projeto.

– Visível — Seja ou não essa camada esta é selecionada como visível na legenda. (Ainda não é usado nesta versão do QGIS.)

– Pode Identificar — Camada que retorna ou não resultados através do uso da ferramenta Identificar.

– Pode ser Transparente — Quando uma camada pode ou não pode ser editada com transparência.

Esta versão do QGIS irá sempre usar a transparência se esta é Sim e a codificação da imagem suportar transparência

– Permite Aproximar — Quando uma camada pode ou não pode ser ampliada neste servidor. Esta versão do QGIS assume que todas as camadas WMS têm esta definida como Sim. Camadas deficientes podem ser renderizadas de forma estranha.

– Contagem em cascata — Os servidores WMS pode funcionar como proxy para outros servidores

WMS para obter dados raster para uma camada. Esta entrada mostra quantas vezes o pedido para esta camada é avançada por peer nos servidores WMS para o resultado.

– Largura Fixa, Altura Fixa — Quando uma camada pode ou não pode ter dimensões de pixeis da fonte fixadas. Esta versão QGIS assume que todas as camadas WMS têm esta definição como nada.

Camadas deficientes podem ser renderizadas de forma estranha.

– Caixa de Enquadramento WGS 84 — A caixa de enquadramento desta camada, nas coordenadas

WGS 84. Alguns servidores WMS não configuram esta situação corretamente (ex.: usam as coordenadas UTM). Se for esse o caso, então a vista inicial desta camada pode ser editada com uma aparência ‘afastada’ pelo QGIS. O webmaster do WMS deve informar deste erro, que pode ser conhecido como elementos WMS XML LatLonBoundingBox, EX_GeographicBoundingBox ou CRS:84 BoundingBox.

– SRC disponíveis — As projeções desta camada podem ser renderizadas pelo servidor WMS. Os mesmos estão listados num formato nativo WMS.

– Disponível em estilo — Os estilos da imagem desta camada podem ser renderizadas pelo o servidor

WMS.

Mostra a legenda gráfica do WMS na tabela de conteúdos e compositor

O provedor de dados WMS QGIS é capaz de exibir um gráfico legenda na tabela da lista de camadas conteúdos e no compositor mapa. A legenda WMS será exibida somente se o servidor WMS suportar GetLegendGraphic e a camada tiver getCapability url especificado, para que você também tenha como escolher um estilo para a camada.

Se uma legendGraphic está disponível, será mostrada abaixo da camada. É pequena, e você tem que clicar sobre ela para abrir na dimensão real (devido à limitação arquitetônica QgsLegendInterface). Clicando sobre a legenda da camada abrirá um quadro com a legenda em resolução máxima.

No compositor de impressão, a legenda será integrada a ele (baixando) dimensão originária. Resolução do gráfico da legenda pode ser definido nas propriedades do item sob Legenda -> WMS LegendGraphic para atender às suas necessidades de impressão

A legenda irá exibir informações contextuais com base em sua escala atual. A legenda WMS será exibida somente se o servidor WMS tiver capacidade GetLegendGraphic e a camada getCapability url for especificada, então você tem que selecionar um estilo.

Limitações do Cliente WMS

Nem todas as funcionalidades possíveis do cliente WMS foram incluídas nesta versão do QGIS. Seguem-se algumas das mais notáveis exceções .

Editando as Configurações da Camada WMS

156 Capítulo 14. Trabalhando com dados OGC

QGIS User Guide, Versão 2.6

Uma vez completo o procedimento

Adicionar camada WMS

, não existe forma para alterar as configurações. Uma forma alternativa é apagar a camada completamente e começar de novo.

Servidores WMS que Requerem Autenticação

Atualmente o acesso público e serviços WMS protegidos são suportados. Os servidores WMS protegidos podem ser acedidos pela autenticação pública. Pode adicionar credenciais (opcionais) quando adiciona o servidor WMS.

Veja a seção

Selecionando os Servidores WMS/WMTS

para detalhes.

Dica: Acedendo a camadas protegidas OGC

Se necessitar de proteger camadas com outros métodos seguros além da autenticação básica, pode usar o InteProxy como proxy transparente, que suporta vários métodos de suporte. Mais informação pode ser encontrada no manual

InteProxy no sítio na internet http://inteproxy.wald.intevation.org

.

Dica: QGIS WMS Mapserver

Desde a Versão 1.7. o QGIS tem uma implementação própria do Mapserver WMS 1.3.0. Leia mais sobre este assunto no capítulo

QGIS com Servidor de Dados OGC .

14.1.2 WCS Cliente

O Serviço Web de Cobertura (WCS) fornecem acesso aos dados matriciais de forma a serem úteis à renderização cliente, como entrada a modelos científicos, e para outros clientes. O WCS pode ser comprado ao WFS e ao WMS. Como as instâncias WMS e WFS, o WCS permite aos clientes escolher porções de informação salvadas de servidores baseados condicionantes espaciais e outros critérios de consulta.

O QGIS tem um fornecedor WCS nativo e suporta a versão 1.0 e 1.1 (que são significativamente diferentes), mas atualmente se dá preferência ao 1.0, porque o 1.1 tem vários problemas (ex.: cada servidor implementa de formas diferentes com várias particularidades).

O fornecedor WCS nativo gere todos pedidos de rede e usa as configurações padrões de rede do QGIS (especialmente o proxy). É também possível selecionar o modo de cache (‘sempre cache’, ‘preferir cache’, ‘preferir rede’,

‘sempre rede’) e fornece também suporte à seleção de posição do tempo se o domínio temporal é oferecido pelo servidor.

14.1.3 WFS e WFS-T Cliente

No QGIS, a camada WFS comporta-se de forma semelhante a uma camada vetorial. Pode identificar e selecionar elementos e ver a tabela de atributos. Desde o QGIS 1.6 a edição WFS-T é também suportada.

De uma forma geral adicionar uma camada WFS é muito semelhante ao procedimento usado com o WMS. A diferença é que não existe servidores padrões definidos, portanto nós teremos de adicionar o nosso.

Carregando uma camada WFS

Como exemplo nós usaremos o servidor WFS DM Solutions e exibiremos uma camada, O URL é: http://www2.dmsolutions.ca/cgi-bin/mswfs_gmap

1. Clique na ferramenta

Adicionar Camada WFS

WFS do Servidor aparecerá.

na barra de ferramentas Camadas, a janela Adicionar Camada

2. Clique em [Novo].

3. Introduza ‘DM Solutions’ como nome.

4. Introduza o URL (veja em cima).

5. Clique [OK].

6. Escolha ‘DM Solutions’ da lista Ligações do Servidor .

14.1. QGIS como Cliente de Dados OGC 157

QGIS User Guide, Versão 2.6

7. Clique [Ligar].

8. Espera pela lista de camadas a ser preenchida.

9. Selecione a camada Parques da lista.

10. Clique [Aplicar] para adicionar a camada ao mapa.

Repare que as configurações proxy que definiu nas suas preferências são também reconhecidas.

Figura 14.4: Adicionando uma camada WFS

.

Você notará que o progresso do download é visualizado no canto inferior esquerdo da janela principal QGIS.

Uma vez que a camada é carregada, você pode identificar e selecionar uma província ou duas e vê-la na tabela de atributos.

Apenas o WFS 1.0.0 é suportado. Até este momento não houve muitos testes contra versões WFS implementadas em outros servidores WFS. Se encontrar problemas com outros servidores WFS, por favor não hesite em contatar a equipe de desenvolvimento. Por favor dirija-se à Seção

Ajuda e Suporte

para mais informação sobre as listas de discussões.

Dica: Encontrando Servidores WFS

Pode encontrar servidores WFS adicionais usando o Google ou outro motor de busca favorito. Existe um número de listas com URLs públicos, alguns têm manutenção outros não.

14.2 QGIS com Servidor de Dados OGC

O Servidor QGIS é uma implementação WMS 1.3, WFS 1.0.0 e WCS 1 1.1.1 de código aberto que, em adição, implementam características avançadas de cartografia para mapas temáticos. O Servidor QGIS é uma aplicação

FastCGI/CGI (Common Gateway Interface) escrita em C++ que funciona juntamente com um Servidor Web (ex.:

Apache, Lighttpd). Foi fundado pelos Projetos EU Orchestra, Sany e a cidade de Uster na Suíça.

O servidor QGIS usa o QGIS como fundo para a lógica SIG e renderização de mapas. Além disso, a biblioteca

Qt é usada para gráficos e para a programação independente C++. Em contraste com outros softwares WMS, o

Servidor QGIS usa regras cartográficas como linguagem de configuração, quer na configuração do servidor quer nas regras cartográficas definidas pelo utilizador.

158 Capítulo 14. Trabalhando com dados OGC

QGIS User Guide, Versão 2.6

Uns desktop QGIS e Servidores QGIS usam as mesmas bibliotecas de visualização, os mapas que são publicados na web na mesma aparência como no SIG do desktop.

Num dos seguintes manuais iremos fornecer um exemplo de configuração para definir um Servidor | qg | . Mas, por agora, nós recomendamos que leia um dos seguintes URLs para obter mais informações:

• http://karlinapp.ethz.ch/qgis_wms/

• http://hub.qgis.org/projects/quantum-gis/wiki/QGIS_Server_Tutorial

• http://linfiniti.com/2010/08/qgis-mapserver-a-wms-server-for-the-masses/

14.2.1 Instalação simples no Debian Squeeze

A este ponto nós daremos um exemplo simples e curto de Como fazer uma instalação para o Debian Squeeze. Os outros SO também fornecem pacotes para o Servidor QGIS. Se tiver de construir tudo da fonte, por favor consulte os URLs em baixo.

Além do QGIS e Servidor QGIS necessita de um Servidor web, no nosso caso o apache2. Você pode instalar todos os pacotes aptitude ou apt-get install juntos com outros pacotes dependentes necessários. Depois da instalação, você deve testar se o servidor web e o Servidor QGIS funcionam como esperado. Certifique-se que o servidor apache está iniciando em /etc/init.d/apache2 start. Abra o browser da internet e digite o

URL: http://localhost. Se o apache estiver funcionando, você deverá ver a mensagem ‘It works!’.

Agora nós testamos a instalação do QGIS Servidor.

O qgis_mapserv.fcgi está disponível em

/usr/lib/cgi-bin/qgis_mapserv.fcgi

e fornece um wms padrão que mostra os limites do estado do Alaska. Adicione o WMS com o URL http://localhost/cgi-bin/qgis_mapserv.fcgi como está descrito no

Selecionando os Servidores WMS/WMTS .

Figura 14.5: WMS padrão com os limites dos EUA incluído no Servidor QGIS (KDE)

14.2. QGIS com Servidor de Dados OGC 159

QGIS User Guide, Versão 2.6

14.2.2 Criando um WMS/WFS a partir de um projeto QGIS

Para fornecer um novo Servidor QGIS WMS, WFS or WCS nós tivemos de criar um ficheiro de projeto QGIS com alguns dados. Aqui usamos a shapefile ‘alaska’ do conjunto de dados de amostra do QGIS. Defina as cores e estilo das camadas no QGIS e defina o SRC do projeto, se não estiver definido.

Figura 14.6: Definições para o projeto do Servidor QGIS WMS/WFS/WCS (KDE)

Em seguida vá ao menu Servidor OWS da janela Projeto → Propriedades do Projeto ‘ e dê alguma informação sobre o OWS nos campos das :guilabel:‘Capacidades do Serviço . Isto irá aparecer na resposta GetCapabilities do

WMS, WFS or WCS. Se você não ativar a Capacidades do Serviço o Servidor|qg| irá usar a informação dada no arquivo wms_metadata.xml localizado na pasta cgi-bin .

Capacidades WMS

Na seção Capacidades WMS você pode definir a extensão aconselhada na resposta GetCapabilities do WMS ao introduzir os valores mínimos e máximos de X e Y nos campos da Extensão aconselhável. Clicando Usar

Extensão atual do Mapa define estes valores para a extensão Atualmente exibida no enquadramento do mapa

QGIS. Ao ativar Restrições SRC pode restringir os sistemas de coordenas referência (SRC) que o Servidor

QGIS poderá oferecer para renderizar mapas. Use o botão em baixo para selecionar os SRC a partir do

Selecionador de Sistemas de Coordenadas Referência, ou clique Usado para adicionar o SRC usado no projeto

QGIS à lista.

Se você tiver um compositor de impressão definido no seu projeto, ele aparecerá na lista da resposta GetCapa-

160 Capítulo 14. Trabalhando com dados OGC

QGIS User Guide, Versão 2.6

bilities, e podem ser usados pelo pedido GetPrint para criar impressões, usando um dos layouts do compositor de impressão como modelo. Isto é uma extensão específica do QGIS para a especificação do WMS 1.3.0. Se quiser excluir qualquer compositor de impressão de ser publicado pelo WMS, ative Excluir compositores e clique no botão em baixo . Em seguida selecione o compositor de impressão da janela Selecione o compositor de impressão de forma a adicionar ou excluir a lista de compositores.

Se você desejar excluir uma camada ou um grupo de camadas da publicação pelo WMS, ative checkbox| Excluir

Camadas e clique no botão abaixo. Isto abrirá a janela Selecione camadas e grupos restritos que irá permitir escolher as camadas e grupos que não quer que sejam publicados. Use a Shift ou Ctrl se quiser selecionar múltiplas entradas de uma vez só.

Você pode receber o GetFeatureInfo solicitado como texto simples, XML e GML. O padrão é XML, texto ou formato GML depende do formato de saída escolhido para no pedido GetFeatureInfo.

Se desejar você pode ativar o Adicionar geometria à resposta de informação do elemento . Isto irá incluir na resposta GetFeatureInfo das geometrias dos elementos em formato de texto. Se quiser que o Servidor QGIS aviseo dos pedidos específicos dos URLs na resposta do GetCapabilities do WMS, introduza o URL correspondente no campo URL Anunciado. Além disso, você pode restringir o tamanho máximo dos mapas trazido pelo pedido

GetMap ao introduzir a altura e largura máxima nos campos respectivos no Máximos para pedidos GetMap.

Se uma das suas camadas usa a exibição Tipo do Mapa (ou seja, para mostrar expressões de texto usandas) isso vai ser listados no interior da saída GetFeatureInfo. Se a camada usa um valor Mapa para um de seus atributos, também estas informações serão mostrados na saída GetFeatureInfo.

Capacidades WFS

Na área Capacidades WFS você pode selecionar camadas que quer fornecer ao WFS, e especificar permissões para efetuar operações para atualizar, inserir ou apagar. Se introduzir um URL no campo URL Anunciado da secção

Capacidades WFS , o Servidor QGIS irá informá-lo este URL específico na resposta GetCapabilities do WFS.

Capacidades WCS

Na área Capacidades WCS você pode selecionar camadas que quer fornecer ao WCS. Se introduzir um URL no campo URL Anunciado da secção Capacidades WCS, o Servidor QGIS irá informá-lo este URL específico na resposta GetCapabilities do WCS.

Agora salve a sessão em um arquivos de projeto alaska.qgs. Para fornecer ao projeto como um WMS/WFS, nós criamos uma nova pasta /usr/lib/cgi-bin/project com privilégios de administrador e adicionamos o arquivo do projeto alaska.qgs e a cópia do arquivo do qgis_mapserv.fcgi - e é tudo.

Agora testamos o nosso projeto WMS, WFS e WCS. Adicione o WMS, WFS e WCS. como está descrito em

Carregando as camadas WMS/WMTS

e

WFS e WFS-T Cliente

ao QGIS e carregue os dados. O URL é: http://localhost/cgi-bin/project/qgis_mapserv.fcgi

Afinando o seu OWS

Para camadas vectoriais, o menu Campos da janela Camada → Propriedades permite que você defina para cada atributos se irá ser ou não publicado. Por padrão, todos os atributos são publicados pelo seu WMS ou WFS. Se quiser um atributo específico que não estiver publicado, desative a caixa correspondente na coluna WMS ou WFS.

Você pode sobrepor marcas de água sobre mapas produzidos no seu WMS adicionando anotações de texto ou anotações SVG através do arquivos de projeto. Veja sec_annotations para instruções para a criação de anotações.

Para anotações exibidas como marcas de água na saída do WMS, a caixa de verificação Posição fixa do mapa na janela Anotação de texto deve estar desativada. Isto pode ser acessado através de um clique duplo na anotação enquanto que uma das ferramentas de anotação está ativa. Para as anotações SVG você necessitará de configurar o projeto para salvar os diretórios absolutos (no menu the Geral menu da janela Projeto → Propriedades do Projeto

) ou modificar manualmente o diretório para a imagem SVG numa forma que represente um diretório relativo válido.

14.2. QGIS com Servidor de Dados OGC 161

QGIS User Guide, Versão 2.6

Os parâmetros extra suportados pelo pedido WMS GetMap

No pedido GetMap WMS o Servidor QGIS aceita um par de parâmetros extra em adição aos parâmetros padrão correspondendo à especificação da OGC WMS 1.3.0:

• Parâmetro MAPA: Semelhante ao MapServer, o parâmetro MAPA pode ser usado para especificar o caminho para o ficheiro de projecto QGIS. Pode especificar um caminho absoluto ou relativo para a localização do executável do servidor (qgis_mapserv.fcgi). Se não estiver especificado, o Servidor QGIS procura por ficheiros .qgs no directório onde o executável do servidor está localizado.

Exemplo: http://localhost/cgi-bin/qgis_mapserv.fcgi?\

REQUEST=GetMap&MAP=/home/qgis/mymap.qgs&...

• Parâmetro DPI : O parâmetro DPI pode ser usado para especificar o pedido de saída da resolução.

Exemplo: http://localhost/cgi-bin/qgis_mapserv.fcgi?REQUEST=GetMap&DPI=300&...

• Parâmetro OPACIDADE: A opacidade pode se definida numa camada ou ao nível do grupo. O intervalo de valores permitido vai de 0 (totalmente trasnaprente) a 255 (totalmente opaco).

Exemplo: http://localhost/cgi-bin/qgis_mapserv.fcgi?\

REQUEST=GetMap&LAYERS=mylayer1,mylayer2&OPACITIES=125,200&...

QGIS registro no servidor

Para registrar as solicitações de enviar ao servidor, defina as seguintes variáveis de ambiente:

• ** QGIS_SERVER_LOG_FILE ** : Especifique o caminho e o nome do arquivo. Certifique-se de que o servidor tem permissões adequadas para escrever no arquivo. Arquivo deve ser criado automaticamente, basta enviar algumas solicitações ao servidor. Se ele não estiver lá, verifique as permissões.

• ** QGIS_SERVER_LOG_LEVEL ** : Especifique o nível de log desejado. Os valores disponíveis são:

– 0 INFO (log todos os pedidos),

– 1 AVISO,

– 2 CRÍTICO (log apenas erros críticos, adequado para fins de produção).

Exemplo:

SetEnv QGIS_SERVER_LOG_FILE /var/tmp/qgislog.txt

SetEnv QGIS_SERVER_LOG_LEVEL 0

** Nota **

• Ao usar o módulo Fcgid usar FcgidInitialEnv em vez de SetEnv!

• Servidor de registro está habilitado também se executável é compilado no modo release.

Variáveis ambientais

• ** QGIS_OPTIONS_PATH ** : A variável especifica o caminho para o diretório com as configurações.

Ele funciona da mesma forma opção –optionspath aplicação QGIS como. Ele está à procura de arquivo de configurações em <QGIS_OPTIONS_PATH> /QGIS/QGIS2.ini. Para exaple, para definir servidor QGIS em Apache para usar o arquivo de configurações /path/to/config/QGIS/QGIS2.ini, adicione a configuração do Apache:

162 Capítulo 14. Trabalhando com dados OGC

.

SetEnv QGIS_OPTIONS_PATH "/path/to/config/"

QGIS User Guide, Versão 2.6

14.2. QGIS com Servidor de Dados OGC 163

QGIS User Guide, Versão 2.6

164 Capítulo 14. Trabalhando com dados OGC

CAPÍTULO

15

Trabalhando com dados GPS

atualizações

15.1 Complemento GPS

15.1.1 O que é GPS?

GPS, o Sistema de Posicionamento por Satélite, é um sistema baseado em satélites que permite que qualquer pessoa com um receptor de GPS possa encontrar sua posição exata em qualquer lugar do mundo. O GPS é usado como uma ajuda nas rotas, por exemplo, em aviões, em barcos e por pedestres. O receptor de GPS utiliza os sinais de satélites para calcular a sua latitude, longitude e (às vezes) altitude. A maioria dos receptores também têm a capacidade de armazenar locais (conhecidos como “trilhas”), sequências de locais que compõem a rota prevista ou pista de circulação do pedestre ao longo do tempo. Pontos de passagem, rotas e trilhas são os três tipos de funcionalidades básicas em dados de GPS. QG mostra locais em camadas de pontos, enquanto rotas e trilhas são exibidos em cadeia de camadas de linhas.

15.1.2 Carregando dados GPS de um arquivo

Existem dezenas de diferentes formatos de arquivo para armazenar dados de GPS. O formato que QGIS usa

é chamado GPX (GPS eXchange format), que é um formato padrão de intercâmbio que pode conter qualquer número de waypoints, rotas e trilhas no mesmo arquivo.

Para carregar um arquivo GPX, primeiro você precisa carregar o plugin: selecione no menu: Plugins -> mActionShow PluginManager: marque no menu: Plugin manager, vai abrir uma caixa de diálogo e ative GPS Tools.

Quando este plugin é carregado, dois botões com um pequeno dispositivo GPS portátil vai aparecer na barra de ferramentas:

• Criar uma um GPX novo

• Importar GPX através da barra de ferramentas GPS

Para trabalhar com os dados do GPS, nós fornecemos um arquivo GPX exemplo disponível no QG com um conjunto de dados de amostra:: file: qgis_sample_data / gps / national_monuments.gpx. Consulte a seção: ref: label_sampledata‘ para obter mais informações sobre os dados do exemplo.

1. Selecione no menu: Vector -> GPS -> GPS Tools ou clique gpx importação: no ícone GPS Tools na barra de ferramentas e abra a aba: guilabel: Carregue o arquivo GPX. (ver figura

GPS_1 ).

2. Navegue até a pasta qgis_sample_data/gps/

, national_monuments.gpx

e clique ** [Abrir]. ** selecione o arquivo GPX

Use o botão [Procurar...] para selecionar o arquivo GPX, então use as caixas de seleção para escolher os tipos de recursos que você deseja carregar a partir desse arquivo GPX. Cada tipo de recurso será carregado em uma camada separada quando você clicar [OK]. O arquivo national_monuments.gpx inclui apenas waypoints.

165

QGIS User Guide, Versão 2.6

Figura 15.1: Janela de diálogo Ferramentas GPS

Nota: Unidades de GPS permitem armazenar dados em diferentes sistemas de coordenadas. Ao baixar um arquivo GPX (a partir de sua unidade de GPS ou site) e, em seguida, colocá-lo no QG, certifique-se de que os dados armazenados no arquivo GPX utiliza WGS 84 (latitude / longitude). QG espera que esta é a especificação oficial do GPX. Veja em: http://www.topografix.com/GPX/1/1/ .

15.1.3 GPSBabel

Como QG usa arquivos GPX como padrão, você precisa encontrar uma maneira de converter outros formatos de arquivos GPS para GPX. Isto pode ser feito por muitos formatos usando o programa GPSBabel que está disponível em http://www.gpsbabel.org

. Este programa também pode transferir dados GPS entre um computador e um dispositivo GPS. QG usa GPSBabel para fazer essas coisas, por isso é recomendado que você instale. No entanto, se você quiser apenas para carregar os dados de GPS a partir de arquivos GPX você não vai precisar dele.

A versão 1.2.3 do GPSBabel é conhecido por trabalhar com QG, mas você pode usar versões posteriores, sem problemas.

15.1.4 Importando dados GPS

Para importar dados de GPS de um arquivo que não é GPX, você irá usar a ferramenta: guilabel: na caixa de diálogo Ferramentas GPS. Aqui, você seleciona o arquivo que deseja importar (e o tipo de arquivo), e onde você deseja armazenar o arquivo GPX convertido e qual o nome da nova camada. Note-se que nem todos os formatos de dados GPS irá suportar todos os três tipos de recurso, portanto, para muitos formatos você só será capaz de escolher entre um ou dois tipos.

15.1.5 Descarregando dados de um receptor GPS

QG pode usar GPSBabel para baixar dados de um dispositivo GPS diretamente comnovas camadas vetoriais. Para isso, use o: guilabel: -> ‘Faça o download da guia GPS‘ na caixa de diálogo Ferramentas GPS (ver

Figure_GPS_2 ).

Aqui, selecionamos o tipo de dispositivo GPS, a porta que ele está conectado (ou USB se o seu GPS suporta isso), local onde deseja fazer o download, o arquivo GPX onde os dados devem ser armazenados e o nome da nova camada.

O tipo de dispositivo que você selecionar no menu do aparelho GPS determina como GPSBabel tenta se comunicar com o seu dispositivo GPS. Se nenhum dos tipos disponíveis funcionar com o seu dispositivo GPS, você pode criar um novo tipo (ver seção ref: definindo-novo-dispositivo).

A porta pode ser um nome de arquivo ou algum outro nome que o seu sistema operacional utiliza como referência para a porta física em seu computador que o dispositivo GPS está conectado. Também pode ser simplesmente

USB, para unidades de GPS habilitados para USB.

166 Capítulo 15. Trabalhando com dados GPS

QGIS User Guide, Versão 2.6

Figura 15.2: Ferramenta de download

• On Linux, this is something like /dev/ttyS0 or /dev/ttyS1.

• No Windows, é “COM1” ou “COM2”.

Quando você clica [OK], os dados serão transferidos a partir do dispositivo e aparece como uma camada em QG.

15.1.6 Carregando dados no receptor GPS

Você também pode enviar dados diretamente de uma camada de vetor em QGIS a um dispositivo GPS usando o guilabel: ‘Carregar o GPS: caixa de diálogo Ferramentas GPS‘. Para fazer isso, basta selecionar a camada que você deseja carregar (que deve ser uma camada GPX), o tipo de dispositivo de GPS, e a porta (ou USB) que está conectado. Assim com a ferramenta de download, você pode especificar novos tipos de dispositivos caso o dispositivo não estiver na lista.

Esta ferramenta é muito útil em combinação com as capacidades de edição de vetores de QGIS. Ela permite que você carregue um mapa, crie pontos de passagem e rotas, para enviá-los e usá-los no seu dispositivo GPS.

15.1.7 Definindo novos tipos de dispositivo

Há lotes de diferentes tipos de dispositivos GPS. A QGIS desenvolvedores não pode testar todos eles, por isso, se você tem um dispositivo que não funciona com qualquer um dos tipos listados no guilabel: -> download a partir de GPS e -> guilabel: Carregar o GPS, você pode definir o seu próprio tipo de dispositivo. Você pode fazer isso usando o editor de dispositivo GPS, que você inicia clicando em: [Editar dispositivos] -> botão download ou upload.

Para definir um novo dispositivo, basta clicar no botão [Novo dispositivo], digite um nome, digite os comandos de download e upload para o seu dispositivo e clique no botão [Atualizar]. O nome será listado nos menus do aparelho nas janelas de Atualizar e Baixar - pode ser qualquer linha. O comando de download é o comando que é usado para baixar os dados do dispositivo para um arquivo GPX. Este será, provavelmente, um comando GPSBabel, mas você pode usar qualquer outro programa com linha de comando para criar um arquivo GPX. QGIS irá substituir as palavras-chave “% type”, “% in”, e “% out” quando executar o comando.

“% type” será substituído por “-w” se você estiver baixando “Locais”, “-r” para “Rotas” e “-t” para “Trilhas”.

Estas são as opções de comando que o GPSBabel possui para download.

“% in” será substituído pelo nome da porta que você escolher durante o download e “% out” será substituído pelo nome que você escolher para o arquivo GPX onde os dados baixados devem ser armazenados. Então, se você criar um tipo de dispositivo com o comando “gpsbabel % -i Garmin -o gpx% em% out” (este é o comando de download para um tipo de dispositivo pré-definido ‘Garmin série’) e, em seguida, usá-lo para baixar locais de porta “/ dev / ttyS0” para o arquivo “output.gpx”. QGIS irá substituir as palavras-chave e executará o comando “gpsbabel -w -i

Garmin -o gpx / dev / ttyS0 saída. gpx”.

15.1. Complemento GPS 167

QGIS User Guide, Versão 2.6

Os comandos indicados nas linhas de ‘Carregar’ são aqueles utilizados para carregar os dados no dispositivo. As mesmas palavras-chave são utilizadas, porém %in é substituído pelo nome do arquivo GPS que é utilizado e %out

é substituído pelo nome da porta.

Você pode aprender mais sobre GPSBabel e as opções de linha de comando disponíveis em http://www.gpsbabel.org

.

Depois de ter criado um novo tipo de dispositivo, ele aparecerá na lista de dispositivos para baixar e atualizar as ferramentas.

15.1.8 Download de pontos/trilhas para GPS

Conforme descrito nas seções anteriores, o QGIS usa GPSBabel para baixar pontos / caminhos diretamente no projeto. QGIS abre a caixa com um perfil pré-definido para baixar de dispositivos Garmin. Infelizmente há um bug #6318 que não permite criar outros perfis, por isso o download diretamente no QGIS usando as ferramentas de GPS está no momento limitado a unidades USB Garmin.

Garmin GPSMAP 60cs

MS Windows

Instalar os drivers USB da Garmin através do link http://www8.garmin.com/support/download_details.jsp?id=591

Ligue o aparelho de GPS, abra e digite “type = serial Garmin” e “port = usb”. Preencha os campos guilabel:

‘Nome da Camada’ e: guilabel: ‘Arquivo de Saída’. Às vezes, parece ter problemas em uma determinada pasta, use algo como “c:temp” que geralmente funciona.

Ubuntu/Mint GNU/Linux

É necessário em primeiro lugar discutir sobre as permissões do dispositivo, conforme descrito no site: https://wiki.openstreetmap.org/wiki/USB_Garmin_on_GNU/Linux . Você pode tentar criar um arquivo: ‘/ etc / udev / rules.d / 51 garmin.rules’ contendo esta regra

ATTRS{idVendor}=="091e", ATTRS{idProduct}=="0003", MODE="666"

Depois disso, é necessário ter certeza de que o módulo do kernel “garmin_gps” não está carregando.

rmmod garmin_gps e, em seguida, você pode usar as ferramentas de GPS. Infelizmente, não parece ser um bug#7182 e, geralmente, o

QGIS congela várias vezes antes do bom trabalho de operação.

Registro de dados BTGP-38KM (somente Bluetooth)

MS Windows

O erro já referido não permite fazer o download dos dados a partir do QGIS, por isso é necessário utilizar o

GPSBabel a partir do comando ou usando a sua interface.

gpsbabel -t -i skytraq,baud=9600,initbaud=9600 -f COM9 -o gpx -F C:/GPX/aaa.gpx

Ubuntu/Mint GNU/Linux

Use o mesmo comando (ou as configurações do GPSBabel GUI) no Windows. No Linux de alguma forma pode obter uma mensagem skytraq: Too many read errors on serial port seria a questão de desligar e ligar o registro de dados novamente.

168 Capítulo 15. Trabalhando com dados GPS

QGIS User Guide, Versão 2.6

Registro de dados BlueMax GPS-4044 (BT e USB).

MS Windows

Nota: Precisa instalar os drivers antes de usá-lo no Windows 7. Veja no site do fabricante qual o download adequado.

Baixando com GPSBabel, ambos com USB e BT retorna sempre um erro.

gpsbabel -t -i mtk -f COM12 -o gpx -F C:/temp/test.gpx

mtk_logger: Can’t create temporary file data.bin

Error running gpsbabel: Process exited unsucessfully with code 1

Ubuntu/Mint GNU/Linux

Com USB

Depois de ter ligado o cabo e utilizar o comando “dmesg” para a porta que está sendo usada, digite por exemplo

“/dev/ttyACM3”. Então,será usado o GPSBabel para CLI ou GUI.

gpsbabel -t -i mtk -f /dev/ttyACM3 -o gpx -F /home/user/bluemax.gpx

.

Com Bluetooth

Use Blueman como gerenciador de dispositivos para associar o dispositivo e disponibilizá-lo através de uma porta do sistema executando o GPSBabel.

gpsbabel -t -i mtk -f /dev/rfcomm0 -o gpx -F /home/user/bluemax_bt.gpx

15.2 Rastreio GPS em tempo real

Para ativar o rastreamento GPS ao vivo QGIS, você precisa selecionar :menuselection: ‘Exibir –> Paineis‘ |caixa| informação do GPS . Você receberá uma nova janela ancorada no lado esquerdo da tela.

Existem quatro telas possíveis nesta janela de monitoramento GPS

• coordenadas de posição do GPS e uma interface para inserir manualmente vértices e feições força conexões do sinal GPS via satélite

• tela GPS mostrando número e posição polar dos satélites

• tela de opções do GPS (ver

figure_gps_options )

Com um receptor GPS conectado (tem de ser compatível com o seu sistema operacional), um simples clique em

[Conectar] liga o GPS no QGIS. Um segundo clique (agora em [Desconectar]) desliga o receptor GPS do seu computador. Para GNU / Linux, suporte gpsd é integrado para apoiar a conexão para a maioria dos receptores

GPS. Portanto, você primeiro tem que configurar gpsd corretamente para conectar ele ao QGIS.

Aviso: Se você quer gravar a sua posição para a tela, você tem que criar uma nova camada vetorial primeiro e mudar para o estado editável para gravar o seu caminho.

15.2.1 Posição e atributos adicionais

Se o GPS está recebendo sinais de satélites, você vai ver a sua posição em latitude, longitude e altitude, juntamente com atributos adicionais.

15.2. Rastreio GPS em tempo real 169

QGIS User Guide, Versão 2.6

170

Figura 15.3: Posição GPS e atributos adicionais

Capítulo 15. Trabalhando com dados GPS

QGIS User Guide, Versão 2.6

15.2.2 Força do sinal GPS

Aqui, você pode ver a intensidade do sinal dos satélites que está recebendo sinais.

Figura 15.4: Intensidade do sinal de rastreamento GPS

15.2.3 Posiçao polar GPS

Se você quer saber onde estão todos os satélites conectados, é preciso mudar para a tela polar. Você também pode ver os números de identificação dos satélites conectados.

Figura 15.5: Posição polar de rastreamento GPS

15.2.4 Opções GPS

Em caso de problemas de conexão, você pode alternar entre:

Autodetectar

Interno

Dispositivo serial

• gpsd (selecionando o anfitrião, porta e o dispositivo GPS que está ligado)

Um clique sobre ** [Conectar] ** reinicia a ligação ao receptor GPS.

Você pode ativar |caixa| salvar automaticamente feições adicionadas quando você está em modo de edição. Ou você pode ativar |caixa| :guilabel:’Adicionar pontos automaticamente‘ para a tela mapa com uma determinada largura e cor.

15.2. Rastreio GPS em tempo real 171

QGIS User Guide, Versão 2.6

172

Figura 15.6: Janela de opções de rastreamento GPS

Capítulo 15. Trabalhando com dados GPS

QGIS User Guide, Versão 2.6

Ativando |caixa| Cursor , você pode usar um controle deslizante |barra| para diminuir e aumentar a posição do cursor na tela.

Ativando Centragem do Mapa permite decidir de que forma a tela será atualizada. Isto inclui ‘sempre’, ‘quando sair’, se suas coordenadas registradas começar a se mover para fora da tela, ou ‘nunca’, para manter a extensão do mapa.

Finalmente, você pode ativar |caixa|

Arquivo Log e definir um caminho e um arquivo onde as mensagens de log sobre o rastreamento GPS serão registradas.

Se você quiser definir uma feição manualmente, você tem que voltar para ou [Adicionar ponto de passagem].

Posição e clique em [Adiconar Ponto]

15.2.5 Conectar um GPS com Bluetooth para rasteamento ao vivo

Com QGIS você pode conectar um GPS via Bluetooth para a coleta de dados em campo. Para executar esta tarefa, você precisa de um dispositivo GPS com Bluetooth e um receptor Bluetooth em seu computador.

Em primeiro lugar você deve deixar seu aparelho de GPS ser reconhecido e emparelhado com o computador.

Ligue o GPS, vá até o ícone Bluetooth na área de notificação e busca de um novo dispositivo.

No lado direito da máscara de Seleção do aparelho certifique-se que todos os dispositivos são selecionados para que a sua unidade de GPS provavelmente aparecerá entre os disponíveis. Na próxima etapa, um serviço de conexão serial deve estar disponível, selecione-o e clique no botão [Configurar].

Lembre-se o número da porta COM atribuído à conexão GPS como resultante pelas propriedades Bluetooth.

Depois que o GPS foi reconhecido, faça o emparelhamento para a conexão. Normalmente, o código de autorização são 0000.

Agora abra o painel Informação GPS e mudar para tela de opções de GPS . Selecione a porta COM atribuído à conexão GPS e clique em [Conectar]. Depois de um tempo um cursor indicando a sua posição deve aparecer.

Se QGIS não pode receber dados do GPS, então você deve reiniciar seu dispositivo GPS, espere 5-10 segundos, em seguida, tente se conectar novamente. Normalmente este trabalho soluciona. Se você receber um erro de conexão novamente certifique-se que você não tem outro receptor Bluetooth perto de você, emparelhado com a mesma unidade GPS.

15.2.6 Utilizando GPSMAP 60cs

MS Windows

Maneira mais fácil de fazer o trabalho é a utilização de um middleware (freeware, não aberto) chamado GPSGate

<http://update.gpsgate.com/install/GpsGateClient.exe> _.

O lançamento do programa, faça a varredura para dispositivos GPS (funciona tanto para USB e os BT) e depois no QGIS basta clicar [Conectar] no painel de monitoramento ao vivo usando o modo Autodetecção .

Ubuntu/Mint GNU/Linux

Como para Windows a maneira mais fácil é usar um servidor no meio, neste caso GPSD, assim sudo apt-get install gpsd

Em seguida, carregar o módulo do kernel garmin_gps sudo modprobe garmin_gps

E, em seguida, ligue a unidade. Em seguida, verifique com dmesg o dispositivo real que está sendo utilizado bu da unidade, por exemplo /dev/ttyUSB0. Agora você pode iniciar gpsd

15.2. Rastreio GPS em tempo real 173

QGIS User Guide, Versão 2.6

gpsd / dev / ttyUSB0

E, finalmente, conectar-se com a ferramenta de acompanhamento ao vivo do QGIS.

15.2.7 Usando BTGP-38KM datalogger (somente Bluetooth)

Usando GPSD (no Linux) ou GPSGate (no Windows) é fácil.

15.2.8 Usando datalogger BlueMax GPS-4044 (ambos BT e USB)

MS Windows

O acompanhamento ao vivo funciona tanto para modos BT USB e, usando GPSGate ou mesmo sem ele, é só usar o modo Autodetectar , ou apontar a ferramenta da porta direita.

Ubuntu/Mint GNU/Linux

Para USB

O acompanhamento ao vivo funciona tanto com GPSD gpsd / dev / ttyACM3 ou sem ela, ligando a ferramenta de acompanhamento ao vivo QGIS diretamente para o dispositivo (por exemplo,

/dev/ttyACM3 ).

Para Bluetooth

O acompanhamento ao vivo funciona tanto com GPSD gpsd / dev / rfcomm0 ou sem ela, ligando a ferramenta de acompanhamento ao vivo QGIS diretamente para o dispositivo (por exemplo,

/dev/rfcomm0

).

Atualizações

174 Capítulo 15. Trabalhando com dados GPS

CAPÍTULO

16

Integração com SIG GRASS

O complemento GRASS oferece acesso ao SIG GRASS bases de dados e funcionalidades (ver GRASS-PROJECT

Referências Bibliográficas e Web ). Isto inclui a visualização de camadas raster GRASS e vetoriais, digitalização

camadas vetoriais, atributos vetor de edição, criando novas camadas de vetores e análise de dados GRASS em 2D e 3D com mais de 400 módulos do GRASS.

Nesta seção, nós vamos apresentar as funcionalidades do complemento e dar alguns exemplos de gestão e trabalhos com dados do GRASS. As seguintes características principais são fornecidas com o menu da barra de ferramentas, quando você inicia o complento GRASS, como descrito na seção: ref: sec_starting_grass:

Abrir mapset

Novo mapset

Fechar mapset

Adicionar uma camada vetorial do GRASS

Adicionar uma camada raster do GRASS

Criar um novo vetor do GRASS

Editar camada vetorial do GRASS

Abrir ferramentas GRASS

Mostrar a região atual do GRASS

Edita região atual do GRASS

16.1 Iniciando o complemento GRASS

Para usar as funcionalidades GRASS e/ou visualizar camadas vetoriais e raster GRASS no QGIS, você deve selecionar e carregar o complemento GRASS com o Gerenciador de complementos. Para isso, clique no menu: menuselection: Complementos –> clique [OK].

Gerenciador de complementos , selecione :guilabel: ‘ GRASS –>‘e

Agora você pode começar a carregar camadas raster e vetoriais a partir de um GRASS existente: arquivo: LO-

CALIZAÇÃO (ver seção: ref: sec_load_grassdata). Ou você cria um novo GRASS: arquivo: LOCALIZAÇÃO com

QGIS (ver seção: ref: sec_create_loc) e importa alguns dados raster e vetor (ver Seção: ref: sec_import_loc_data) para futura análise com a caixa de ferramentas GRASS (ver seção: ref: subsec_grass_toolbox).

175

QGIS User Guide, Versão 2.6

16.2 Carregando camadas raster e vetorial GRASS

Com o complemento GRASS, você pode carregar camadas vetoriais ou raster utilizando o botão apropriado no menu da barra de ferramentas. Como exemplo, vamos usar o conjunto de dados Alaska do QGIS (ver seção

Amostra de Dados ). Ele inclui uma pequena amostra GRASS LOCALIZAÇÃO com três camadas vetoriais e um

mapa de elevação raster.

1. Crie uma nova pasta chamada grassdata, baixe o banco de dados ‘Alaska’ do QGIS qgis_sample_data.zip

de http://download.osgeo.org/qgis/data/ e descompacte o arquivo em grassdata

.

2. Inicie o QGIS.

3. Se ainda não tiver feito em uma seção anterior QGIS, carrege o complemento GRASS clicando no Complementos

Gerenciador de Complementos e ativar

|caixa|

GRASS . A barra de ferramentas do GRASS aparecerá na janela principal QGIS.

4. Na barra de ferramentas GRASS. clique no

MAPSET .

:sup: ícone Abrir mapset para abrir o :guilabel: assistente

5. Pelo Gisdbase, procure e selecione ou digite o caminho para a pasta recém-criada grassdata.

6. Você agora será capaz de selecionar o LOCATION alaska e o MAPSET demo

.

7. Clique [OK]. Observe que algumas ferramentas anteriormente desabilitadas na barra de ferramentas

GRASS agora estão habilitadas.

8. Clique em

Adicionar camada raster GRASS camada de elevação será visualizada.

, escolha o nome do mapa: arquivo: gtopo30 e clique [OK]. A

9. Clique em

Adicionar camada vetorial GRASS

, escolher nome do mapa alaska e clique [OK]. Os limites da camada vetor Alaska será coberto na parte superior do mapa gtopo30. Voce poderá adaptar as propriedades da camada descrita no capítulo

Janela de Propriedades de Vetor

(e.x., mudar opacidade, cor de contorno e preenchimento).

10. Também carregar as outras duas camadas vetoriais, rios e aeroportos, e adaptar suas propriedades.

Como você vê, é muito simples carregar camadas raster e vetor GRASS no QGIS. Consulte as seguintes seções para a edição de dados GRASS e criar uma nova LOCALIZAÇÃO. Mais amostra GRASS locais estão disponíveis no site do GRASS em http://grass.osgeo.org/download/sample-data/ .

Dica: Carregando dados GRASS

Se você tiver problemas ao carregar dados ou o QGIS termina de forma anormal, certifique-se de ter carregado o complemento GRASS corretamente conforme descrito na seção

Iniciando o complemento GRASS .

16.3 Localização e MAPSET GRASS

Dados do GRASS são armazenados em um diretório chamado de GISDBASE. Este diretório, muitas vezes chamado grassdata, deve ser criado antes de começar a trabalhar com o complemento GRASS no QGIS.

Dentro deste diretório, os dados SIG GRASS são organizados por projetos armazenados em subdiretórios chamados LOCATIONs. Cada location é definido por seu sistema de coordenadas, projeção de mapa e fronteiras geográficas. Cada location pode ter vários MAPSETs (subdiretórios do location) que são usados para subdividir o projeto em diferentes tópicos ou sub-regiões, ou como espaços de trabalho para os membros da equipe

(ver Neteler & Mitasova de 2008, em

Referências Bibliográficas e Web ). A fim de analisar as camadas vetoriais

e raster com módulos do GRASS, você deve importá-los para um GRASS location. (Isto não é estritamente verdadeiro - com os módulos Grass r.external e v.external você pode criar somente leitura links para

GDAL externo / conjuntos de dados OGR suportados, sem importar-lhes Mas porque esta não é a maneira usual para iniciantes para trabalhar com GRASS, esta funcionalidade não será descrita aqui.)

176 Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

Figura 16.1: Dados GRASS em LOCATION alaska

16.3.1 Criando uma nova Localização GRASS

Como exemplo, aqui está a amostra GRASS LOCALIZAÇÃO alaska, que é projetada na projeção Albers Equal

Area com unidade pés foi criada para o conjunto de dados de amostra QGIS. Esta amostra GRASS alaska local será usado para todos os exemplos e exercícios nas seções seguintes, relacionadas com GRASS. Elas são úteis para baixar e instalar o conjunto de dados em seu computador (veja

Amostra de Dados ).

1. Iniciar QGIS e certifique-se o complemento GRASS está carregado.

2. Visualize o shapefile alaska.shp (ver seção: ref:‘ vector_load_shapefile‘) do conjunto de dados

Alaska do QGIS (veja: ref: label_sampledata).

3. Na barra de ferramentas GRASS, clique no ícone

Abrir mapset para abrir o :arquivo: Assistente‘MAPSET‘.

4. Selecione uma pasta existente do banco de dados GRASS (GISDBASE) :arquivo:‘grassdata‘ , ou criar uma para o novo

:arquivo:‘local‘ usando um gerenciador de arquivos em seu computador. Em seguida, clique [Próximo].

5. Podemos usar este assistente para criar um novo :arquivo: MAPSET dentro de um já existente :arquivo:‘LOCATION‘ (ver seção :ref:‘ sec_add_mapset ) ou para criar um novo: arquivo:‘LOCATION.

Selecione Criar nova location (ver

figure_grass_location_2 ).

6. Digite um nome para o :arquivo‘local‘ – que usa ‘alaska’ - e clique [Próximo].

7. Defina a projeção, clicando no botão de rádio :guilabel: Projeção para habilitar a lista de projeções.

8. Nós estamos usando (pés) projeção Albers Equal Area Alaska. Desde que descobri que ela é representada pelo ID EPSG 2964, entramos ele na caixa de pesquisa. (Nota: Se você quiser repetir esse processo para outro location e projeção e não memorizei o ID EPSG, clique no inferior direito da barra de status (veja a seção :ref: label_projections)).

:sup:‘ ícone status SRC‘ no canto

9. Na Filtro, insira 2964 para selecionar a projeção.

10. Clique [Próximo].

11. Para definir a região padrão, temos que entrar no arquivo: limites ‘LOCALIZAÇÃO’ norte, sul, leste, oeste e direções. Aqui, basta clicar no botão ** [Conjunto| QG | medida]

**

, para aplicar a extensão da camada carregado: arquivo: alaska.shp com a extensão padrão GRASS.

12. Clique [Próximo].

13. Também precisamos definir um: arquivo: ‘CONJUNTO DE MAPAS’ dentro do novo: arquivo: local (isto

é necessário quando criar um novo: arquivo: LOCAL). Você pode nomeá-lo o que quiser - foi utilizado

‘demonstração’. GRASS cria automaticamente um arquivo: CONJUNTO DE MAPAS chamado: arquivo

16.3. Localização e MAPSET GRASS 177

QGIS User Guide, Versão 2.6

‘PERMANENTE’, projetado para armazenar os dados básicos para o projeto, a sua extensão padrão e coordenar as definições do sistema (ver Neteler & Mitasova 2008 em: ref:‘ literature_and_web‘).

14. Confira o resumo para ter certeza que está correto e clique [Fim].

15. O novo: arquivo ‘LOCALIZAÇÃO’: ‘Alaska’, e dois: arquivos: CONJUNTO DE MAPAS, demonstração e” permanente ”, são criados. O conjunto de trabalho aberto no momento é ‘demonstração’, como você definiu.

16. Note que algumas das ferramentas na barra de ferramentas GRASS que foram desativadas estão agora habilitadas.

Figura 16.2: Criando um novo LOCATION GRASS ou um novo MAPSET no QGIS

Se isso parecia uma série de etapas, não é realmente tão ruim assim é uma maneira muito rápida de criar um: arquivo: local.

O arquivo: local ‘Alaska’ está pronto para importação de dados (ver seção: ref:‘ sec_import_loc_data‘). Você também pode usar os dados já existentes vetoriais e amostra quadricular no: arquivo: local ‘Alaska’, incluídas no | QG | base de ados ‘Alaska’: ref: dados, e ir para a seção: ref: ‘ modelo vetorial’

16.3.2 Adicionando um novo MAPSET

Um usuário tem acesso apenas ao GRASS: arquivo: ‘CONJUNTO DE MAPAS’ que criou. Isso significa que, além do acesso ao seu próprio: arquivo: ‘CONJUNTO DE MAPAS’, você pode ler mapas de outros usuários de arquivo ‘CONJUNTO DE MAPAS’, mas você pode modificar ou remover apenas os mapas em seu próprio: arquivo ‘CONJUNTO DE MAPAS’.

Todos: arquivos: ‘CONJUNTO DE MAPAS’ inclui um arquivo ‘WIND’ que armazena as coordenadas dos valores e a resolução selecionada (ver Neteler & Mitasova de 2008, em: ref:‘ literatura web‘ e seção: ref: sec_regiao_grass ) .

1. Iniciar QGIS e certifique-se o complemento GRASS está carregado.

2. Na barra de ferramentas GRASS, clique no ícone

Abrir mapset para abrir o :arquivo: Assistente‘MAPSET‘.

3. Selecione a pasta do banco de dados GRASS (GISDBASE): arquivo grassdata com o arquivo:‘ local‘

‘Alaska’, onde queremos adicionar mais um: arquivo: CONJUNTO DE MAPAS chamado ‘teste’.

4. Clique [Próximo].

5. Podemos usar este assistente para criar um novo :arquivo:‘MAPSET‘ dentro de um já existente :arquivo:‘LOCATION‘ ou para criar um completamente novo :arquivo:‘LOCATION‘ . Clique no botão de rádio Selecionar a localização (ver

figure_grass_location_2 ) e clique [Próximo].

178 Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

6. Digite o nome: arquivo: texte para o novo: arquivo:‘ CONJUNTO DE MAPAS‘. Abaixo no assistente, você verá uma lista existente arquivo: CONJUNTO DE MAPAS e seus proprietários

7. Clique [Próximo], confira o resumo para se certificar de que está tudo correto e clique [Fim].

16.4 Importando dados para uma localização GRASS

Esta seção fornece um exemplo de como importar dados e vetores para o ‘Alaska’ GRASS: arquivo: ‘local’ fornecido pelo | QG | dados ‘Alaska’. Por isso, usamos o mapa: arquivo: landcover.img e o arquivo-vetor GML : arquivo:‘ lakes.gml‘ do | QG | dados ‘Alaska’ (veja: ref: label_sampledata).

1. Iniciar QGIS e certifique-se o complemento GRASS está carregado.

2. Na barra de ferramentas GRASS, clique no ícone

Abrir MAPSET para abrir o :gulabel: assistente MAPSET.

3. Escolha como banco de dados GRASS a pasta:arquivo: grassdata no QGIS base de dados Alasca, como: arquivo: local ‘Alaska’, como: arquivo:‘ CONJUNTO DE MAPAS‘ ‘demonstração’ e clique ** [OK] ** .

4. Agora, clique no ícone | grass_tools | : sup: ‘Abrir ferramentas GRASS . A caixa de ferramentas GRASS

(ver secção: ref: ‘subsec_grass_toolbox ) aparece o diálogo.

5. Para importar o mapa raster: arquivo: landcover.img, clique no módulo: arquivo:‘ r.in.gdal‘ no: guilabel: guia módulos em árvore. Este módulo GRASS permite importar arquivos raster GDAL que suporta GRASS: arquivo: ‘local’. O módulo para: arquivo: aparece r.in.gdal.

6. Navegue até a pasta: arquivo: raster no QGIS base de dados ‘Alaska’ e selecione o arquivo: ‘ landcover.img‘.

7. Como nome de saída raster, definir: arquivo: landcover_grass e clique ** [Rodar]

**

. Na: guilabel: guia

Saída

, você vê o comando GRASS atualmente em execução‘ ‘ r.in.gdal -o input=/path/to/landcover.img

output= landcover_grass

8. Quando se diz ** Com sucesso**, clique ** [saída] ** . O arquivo: camada landcover_grass é agora importada para a GRASS e vai ser visualizado no QGIS.

9. Para importar o arquivo vetorial GML: arquivo lakes.gml, clique no módulo: arquivo:‘ v.in.ogr‘ no: guilabel: módulos em árvores . Este módulo GRASS permite importar arquivos vetoriais OGR apoiados na GRASS: arquivo: local. A caixa de diálogo para o arquivo aparece v.in.ogr.

10. Navegue até a pasta: arquivo: gml no QGIS base de dados ‘Alaska’ e selecione o arquivo:‘ lakes.gml‘ como arquivo OGR.

11. Como o nome de saída do vetor, defina: arquivo: lakes_grass e clique ** [Ir] ** . Você não tem de se preocupar com as outras opções neste exemplo. No: guilabel: saídat você vê o comando GRASS atualmente em execução‘ v.in.ogr -o dsn = / path / to / lakes.gml output = lagos _grass‘.

12. Quando se diz finalizado com sucesso , clique ** [saída] ** . O arquivo: vetorial lakes_grass agora é importado para o GRASS e será visualizado no QGIS.

16.5 O modelo de dados vetorial do GRASS

É importante compreender o modelo de dados vetor GRASS antes da digitalização.

Em geral, GRASS utiliza um modelo de vetor topológico.

Isto significa que as áreas não são representadas como polígonos fechados, mas por um ou mais limites. A fronteira entre duas áreas adjacentes é digitalizada apenas uma vez, e é compartilhada por ambas as áreas. Limites precisam estar conectados e fechados sem lacunas. Uma área é identificada (e rotulada) pelo ** centróide** da área.

Além de limites e centróides, um mapa vetor também pode conter pontos e linhas. Todos estes elementos de geometria podem ser misturados em um vetor e será representado em diferentes ‘camadas’ dentro de um GRASS vetor. Então, no GRASS, uma camada não é um vetor ou raster, mas um nível dentro de uma camada vetorial. Isso

16.4. Importando dados para uma localização GRASS 179

QGIS User Guide, Versão 2.6

é importante para distinguir cuidadosamente. (Embora seja possível misturar elementos de geometria, é incomum e, mesmo no GRASS, utilizado somente em casos especiais, tais como rede de análise vetorial. Normalmente, você deve preferir armazenar diferentes elementos geométricos em diferentes camadas.)

É possível armazenar várias “camadas” em um conjunto de dados vetoriais. Por exemplo, campos, florestas e lagos pode ser armazenado em um vetor. Uma floresta adjacente e um lago podem compartilhar o mesmo limite, mas eles têm tabelas de atributos separados. Também é possível fixar atributos limites. Um exemplo pode ser o caso em que a fronteira entre um lago e uma floresta é um caminho, para que ele possa ter uma tabela de atributos diferentes.

A “camada” do recurso é definido pela “camada” dentro do GRASS. ‘Camada’ é o número que define, se houver mais do que uma camada interior do conjunto de dados (por exemplo, se a geometria for uma floresta ou lago).

Por enquanto, ele pode ser apenas um número. No futuro, o GRASS também apoiará nomes como campos na interface do usuário.

Os atributos podem ser armazenados dentro do GRASS: arquivo: ‘local’: como dBase ou SQLite3 ou em tabelas de banco de dados externos, por exemplo, PostgreSQL, MySQL, Oracle, etc

Atributos em tabelas de base de dados estão ligados a elementos geométricos usando um valor ‘categoria’.

‘Categoria’ (chave, ID) é um número inteiro ligado a geometrias primitivas, e que é usada como ligação a uma coluna chave na tabela de base de dados.

Dica: Aprendendo um Modelo Vetor GRASS

A melhor maneira de aprender os modelos de vetores GRASS, e as suas capacidades é baixando um dos muitos tutoriais GRASS onde o modelo de vetor é descrito mais profundamente.

Veja http://grass.osgeo.org/documentation/manuals/ Para mais informações, livros e tutoriais em várias línguas.

16.6 Criando uma nova camada vetorial GRASS

Para criar uma nova camada GRASS vetor com o plugin GRASS, clique no ícone

Criar novo vetor GRASS na barra de ferramentas. Digite um nome na caixa de texto, e você pode começar a digitalização das geometrias de ponto, linha ou polígono seguindo o procedimento descrito na seção: ref: ‘digitalização_grass’.

No GRASS, é possível organizar todos os tipos de tipos de geometria (ponto, linha e área) em uma camada, porque

GRASS usa um modelo de vetor topológico, assim você não precisa selecionar o tipo de geometria ao criar um novo vetor no GRASS. Isso é diferente da criação de arquivos modelos com | QG | porque arquivos modelos usam o modelo de vetor (consulte a seção: ref: ‘Criação de Vetor’).

Dica: Criando uma tabela de atributos para uma nova camada vetorial GRASS

Se você deseja atribuir atributos a seus recursos de geometria digitalizados, certifique-se de criar uma tabela de atributos com colunas antes de começar a digitalização (ver

figure_grass_digitizing_5 ).

16.7 Digitalizando e editando uma camada vetorial GRASS

As ferramentas de digitalização para as camadas vetor GRASS são acessadas usando o | grass_edit | : sup:ícone Editar camada vetorial GRASS na barra de ferramentas. Certifique-se de que você tenha carregado um vetor GRASS e é a camada selecionada na legenda antes de clicar na ferramenta de edição. Figura

figure_grass_digitizing_2

mostra o diálogo de edição GRASS que é exibido quando você clica na ferramenta de edição. As ferramentas e as configurações serão discutidas nas seções seguintes.

Dica: Digitalizando polígonos no GRASS

Se você quiser criar um polígono no GRASS, primeiro você digitaliza o limite do polígono, definindo o modo como ‘Sem categoria’. Em seguida, você adiciona um centróide (ponto de etiqueta) no limite fechado, definindo

180 Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

o modo para a ‘próximo não usado’. A razão para isto é que um modelo vetorial topológico liga a informação de atributos de um polígono para o centro e não para o limite.

Barra de Ferramentas

Na figura

grass_digitalização_1 ,

você vê os ícones de digitalização GRASS fornecidas pelo complemento GRASS. Tabela

grass_digitalização_1

explica as funcionalidades disponíveis.

Figura 16.3: Barra de ferramentas de Digitalização GRASS

Ícone Ferramenta Propósito

Novo Ponto Digitaliza novo ponto

Nova Linha

Nova

Fronteira

Novo

Centróide

Digitaliza nova linha

Digitaliza novo limite (acaba ao selecionar nova ferramenta)

Digitaliza novo centróide (etiqueta da área existente)

Mova vértice Mova um vértice da linha ou limite existente e identifique nova posição

Adiciona vértice

Adiciona novo vértice à uma linha existente

Exclua vértice

Mova elemento

Exclua vértice da linha existente (confirme vértice selecionado por outro clique)

Mova limite, linha, ponto ou centróide selecionado e clique em nova posição

Dividir linha Dividir uma linha existente em duas partes

Exclua elemento

Exclua limite existente, linha, ponto ou centróide (confirme elemento selecionado por outro clique)

Editar atributos

Editar atributos do elemento selecionado (note que um elemento pode representar mais recursos, veja acima)

Fechar Fechar sessão e salvar o estado atual (reconstrói topologia depois)

GRASS Digitalização de Tabela 1: GRASS Ferramentas de Digitalização

Aba Categoria

A: guilabel: guia Categoria permite definir a forma em que os valores da categoria serão atribuídos à um novo elemento geométrico.

• Modo: O valor da categoria que será aplicado aos novos elementos de geometria.

– Seguinte não usado - Aplicar próximo valor categoria ainda não utilizados para a geometria do elemento.

– Entrada Manual - definir manualmente o valor da categoria para o elemento geometria no campo de entrada ‘Categoria’.

– Sem categoria - Não aplique um valor de categoria para o elemento de geometria. Isto é usado, por exemplo, para os limites da área, pois os valores de categoria são ligados através do centróide.

• Categoria - O número (ID) que está ligado a cada elemento geometria digitalizado. Ele é usado para ligar cada elemento de geometria com os seus atributos.

• ** Campo (camada)** - Cada elemento de geometria pode ser conectado a diferentes tabelas de atributos usando diferentes camadas de geometria GRASS. A camada padrão é 1.

16.7. Digitalizando e editando uma camada vetorial GRASS 181

QGIS User Guide, Versão 2.6

Figura 16.4: Aba Categoria Digitalização GRASS

Dica: Criando uma ‘camada’ adicional GRASS com o |qg|

Se você gostaria de adicionar mais camadas para o conjunto de dados, basta adicionar um novo número no ‘Campo

(camada) ” e pressione enter. Na guia Tabela, você pode criar sua nova tabela ligada a sua nova camada.

Aba Configurações

A: guilabel: guia Configurações permite que você defina o encaixe em pixels da tela. O limite que define qual distância para novos pontos de linha ou extremidades são agarrados por nós existentes. Isso ajuda a evitar lacunas ou oscilações entre fronteiras. O padrão é definido como 10 pixels.

Figura 16.5: Aba Configurações de Digitalização GRASS

Aba Simbologia

A: guilabel: ‘Simbologia’ permite visualizar e definir as configurações de simbologia e as cores para vários tipos de geometria e seu estado topológico (por exemplo, abriu/fechou limite).

Aba Tabela

A: guilabel: ‘tabela’ fornece informações sobre a tabela de banco de dados para uma determinada ” camada ”.

Aqui, você pode adicionar novas colunas a uma tabela de atributos já existente ou criar uma nova tabela de banco de dados para uma nova camada do vetor GRASS (ver seção: ref: ‘criar_novo_vetor_GRASS’).

Dica: GRASS Edita Permissões

Você deve ser o proprietário do GRASS: arquivo: ‘CONJUNTO DE MAPAS’ que deseja editar. É impossível editar camadas de dados em: arquivo: ‘CONJUNTO DE MAPAS’ que não é seu, mesmo que você tenha permissão

182 Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

Figura 16.6: Guia Digitalizando Simbologia GRASS

Figura 16.7: Aba Tabela de Digitalização GRASS

16.7. Digitalizando e editando uma camada vetorial GRASS 183

QGIS User Guide, Versão 2.6

de gravação.

16.8 A ferramenta região GRASS

A região (definição de uma janela de trabalho espacial) no GRASS é importante para trabalhar com camadas.

Análise Vetorial é, por padrão, não se limitando a quaisquer definições de região definida. Mas todos os vetores recém-criados terá a extensão espacial e a resolução da região GRASS atualmente definido, independentemente da sua extensão e da resolução original. A região GRASS atual é armazenado no: arquivo: ‘$ LOCAL / $ mapset

/ WIND’, e define o norte, sul, leste e oeste como limites, o número de colunas e linhas, resolução espacial horizontal e vertical.

É possível ligar e desligar a visualização da região de GRASS no | QG | usando o | grass_região | : sup: botão

GRASS região Exibição.

Com a | grass_região_editar

|: sup: ‘Editar ícone região GRASS’, você pode abrir uma caixa de diálogo para alterar a região atual e a simbologia de retângulo para a região grass no |qg|

. Digite os novos limites e resolução de região e clique ** [OK] ** . A caixa de diálogo também permite selecionar uma nova região de forma interativa com o mouse sobre a tela do QGIS. Por isso, clique com o botão esquerdo do mouse no QGIS, abra um retângulo, feche-o novamente usando o botão esquerdo do mouse e clique ** [OK] ** .

O módulo GRASS: arquivo: g.região fornece muito mais parâmetros para definir uma medida para a região e resolução adequados para sua análise. Você pode usar esses parâmetros com as Ferramentas GRASS, descrito na seção: ref: subseção_grass_ferramentas.

16.9 Ferramentas GRASS

O |grass_ferramentas| :sup: ‘Abrir ferramentas GRASS’ fornece funcionalidades do módulo GRASS para trabalhar com dados dentro do GRASS selecionado: arquivo: ‘local’ e arquivo: ‘CONJUNTO DE MAPAS’. Para usar as Ferramentas GRASS você precisa para abrir um: arquivo: ‘local’ e: arquivo: ‘CONJUNTO DE DADOS’ que você tem permissão para gravar (geralmente concedido, se você criou o: arquivo: ‘CONJUNTO DE MA-

PAS’). Isso é necessário, pois novas camadas vetoriais serão criados durante a análise e precisa ser escrito para ser selecionado: arquivo: ‘local’ e: arquivo: ‘Coleção de Mapas’.

184

Figura 16.8: Ferramentas do GRASS e Modulo de Árvore

Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

16.9.1 Trabalhando com módulos GRASS

O comando GRASS dentro do GRASS Ferramentas fornece acesso a quase todos os módulos (mais de 300) grass em uma interface de linha de comando. Para oferecer um ambiente de trabalho mais amigável, cerca de 200 dos módulos GRASS disponíveis e funcionalidades também são fornecidos por gráficos dentro do plugin Ferramentas

GRASS.

A lista completa dos módulos GRASS disponíveis na caixa de ferramentas gráfica em | QG | versão | ATUAL| estão disponíveis no wiki grass em http://grass.osgeo.org/wiki/GRASS-QGIS_relevant_module_list .

Também é possível personalizar o conteúdo Ferramentas GRASS. Este procedimento é descrito na seção: ref: sec_customizacao_ferramentas .

Como mostrado na

figura_grass_ferramentas_1 , você pode olhar para o módulo GRASS apropriado usando o

temática agrupada: guilabel: Módulos em Árvores ou pesquisar: guilabel: ‘Lista de Modelos’.

Clicando em um ícone do módulo gráfico, uma nova aba será adicionada ao diálogo da caixa de ferramentas, oferecendo três novas sub-abas :guilabel: ‘Opções’, :guilabel:’Saída’ e :guilabel:’Manual’.

Opções

A: guilabel: ‘Opções’ proporciona um módulo simplificado onde normalmente você pode selecionar uma camada ou vector visualizado na tela do QGIS e entrar com outros parâmetros específicos do módulo para executá-lo.

Figura 16.9: Ferramentas GRASS Opções de Módulo

Os parâmetros do módulo fornecidas muitas vezes não são completos para manter um diálogo claro. Se você quiser usar outros parâmetros do módulo e sinalizadores, você precisa iniciar o comando grass e executar o módulo na linha de comando.

Um novo recurso desde | QG | 1.8 é o suporte para a: guilabel: ‘Mostrar Opções Avançadas’ abaixo do módulo simplificado no: guilabel: ‘opções’. No momento, só é adicionado ao módulo: arquivo: v.in.ascii como um exemplo, mas ele provavelmente irá fazer parte de todos os módulos no grass Ferramentas em versões futuras do

| QG | . Isso permite que você use as opções de módulos GRASS completos sem a necessidade de mudar para o comando grass.

Saída

16.9. Ferramentas GRASS 185

QGIS User Guide, Versão 2.6

Figura 16.10: Ferramentas GRASS Modulo de Saída

The Output tab provides information about the output status of the module. When you click the [Run] button, the module switches to the Output tab and you see information about the analysis process. If all works well, you will finally see a Successfully finished message.

Manual

A: guilabel: ‘Manual’ mostra a página de ajuda em HTML do módulo grass. Você pode usá-lo para verificar outros parâmetros do módulo e sinalizadores ou para obter um conhecimento mais profundo sobre o objetivo do módulo. No final de cada página do manual, você vê outras ligações a: arquivo: ‘Ajuda’, o arquivo: ‘Temática’ e do: arquivo: ‘Completo’. Estas ligações fornecem a mesma informação que o módulo: arquivo: g.manual.

Dica: Mostra Resultados Imediatamente

Se você quiser exibir os resultados de cálculo imediatamente em sua tela do mapa, você pode usar o botão “Ver

Saída” na parte inferior da aba módulo.

16.9.2 Exemplos de módulos GRASS

Os exemplos seguintes demonstrarão o poder de alguns dos módulos grama.

Criando linhas de contorno

O primeiro exemplo cria um mapa de contorno vetorial de elevação (DEM). Aqui, presume-se que você tem o

Alasca: arquivo: ‘local’ configurado como explicado na seção: ref:‘ sec_import_loc_data

• Primeiro, abra o local clicando no | grass_open_mapset | : sup: ‘Abrir conjunto de mapas’ e escolher o local

Alaska.

• Agora carregue o raster gtopo30 elevação clicando : sup: Adicionar camada raster GRASS’ e selecionando o raster ‘‘gtopo30‘ a partir do local de demonstração.

186 Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

Figura 16.11: Ferramentas GRASS Modulo Manual

• Agora, abra a caixa de ferramentas com o : sup: botão ‘Abrir ferramentas GRASS‘.

• Na lista de categorias de ferramentas, clique duas vezes no: menu: ‘Raster -> Gestão de Superfície -> Gerar linhas de contorno do vetor’.

• Agora, um simples clique na ferramenta ** r.contour ** irá abrir uma janela, conforme explicado acima

(veja: ref: grass_módulos). O “raster gtopo30” deve aparecer como o: guilabel: ‘Nome de entrada’.

• Digite no Incremento entre os níveis de contorno intervalos de 100 metros.) o valor 100. (Isto criará linhas de contorno em

• Digite no :guilabel: Nome para a saída do vetor mapa o nome ctour_100.

• Clique [Rodar] para iniciar o processo. Aguarde alguns instantes até que a mensagem Terminado com sucesso apareça na janela de saída. Então, clique [Ver saída] e [fechar].

Como se trata de uma grande região, vai demorar um pouco para exibir. Depois de terminar a renderização, você pode abrir a janela de propriedades da camada para alterar a cor da linha para que os contornos apareçam claramente sobre o raster elevação, como em: ref: vector_properties_dialog.

Em seguida, amplie uma pequena área montanhosa no centro do Alasca. Aproxima-se, você vai notar que os contornos têm cantos afiados. GRASS oferece a ferramenta v.generalize para alterar ligeiramente mapas vetoriais, mantendo sua forma original. A ferramenta usa diversos algoritmos diferentes, com finalidades diferentes. Alguns dos algoritmos (ie, Douglas Peuker e redução da Vertex) simplificam a linha removendo alguns dos vértices. O vetor resultante irá carregar mais rápido. Este processo é útil quando você tem um vetor altamente detalhado, mas você está criando um mapa muito pequena em escala, de modo que o detalhe é desnecessário.

Dica: A ferramenta simplificar

Note-se que o | QG | plugin Ferramentas tem um: menu: ‘Simplificar geometrias’ -> ferramenta que funciona exatamente como o GRASS v.generalize no algoritmo Douglas-Peuker.

No entanto, o objetivo do exemplo é diferente. As linhas de contorno criado pelo “r.contour” têm ângulos agudos que devem ser suavizadas. Entre o algoritmo ** v.generalize ** , há Chaiken que faz exatamente isso (também ranhuras de Hermite). Esteja ciente de que estes algoritmos podem ** adicionar vértices** ao vetor, fazendo-a carregar ainda mais lentamente.

16.9. Ferramentas GRASS 187

QGIS User Guide, Versão 2.6

• Abra o GRASS Ferramentas e clique duas vezes na categoria: menu: ‘Vetor -> Desenvolver mapa -> Geral’, em seguida, clique no módulo v.generalize para abrir a janela de opções.

• Verifique se o vetor ‘ctour_100’ aparece como Nome do vetor de entrada.

• A partir da lista de algoritmos, escolha Chaiken. Deixe todas as outras opções em padrão, e desça até a

última fila para entrar no campo: guilabel: ‘Nome de saída do vetor mapa’ ‘ctour_100_smooth ‘, e clique

** [Ir] ** .

• O processo leva vários minutos. Após o “Finalizado com Sucesso”‘ aparece as janelas de saída, clique **

[Saída] ** e ** [Fechar] ** .

• É possível mudar a cor do vetor para apresentar claramente o fundo matricial e para contrastar com as linhas de contorno originais. Você notará que as novas linhas de contorno têm cantos mais suaves do que o original, enquanto permanecer fiel à forma geral de origem.

Figura 16.12: Modulo GRASS v.generalize para visualizar um mapa vetorial

Dica: Outros usos para r.contour

O processo descrito acima pode ser utilizado em outras situações equivalentes. Se você tem um mapa de dados de precipitação, por exemplo, então o mesmo método será utilizado para criar um mapa de vetor de linhas (chuvas constantes).

Criando um efeito de sombreamento 3D

Vários métodos são usados para exibir as camadas de elevação e dar um efeito 3-D para mapas. O uso de curvas de nível, como mostrado acima, é um método popular, muitas vezes escolhido para produzir mapas topográficos.

Outra forma de apresentar um efeito 3-D é de sombreamento. O efeito Sombra é criado a partir de um DEM

(elevação) que calcula a inclinação e o aspecto de cada célula, em seguida, simula a posição do sol no céu dando um valor de reflexo para cada célula. Assim, você tem pistas virada para o sol; as encostas viradas longe do sol

(na sombra) são escurecidas.

188 Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

• Comece este exemplo carregando o ‘raster de elevação gtopo30’. Inicie o GRASS Ferramentas, e sob a categoria Raster, clique duas vezes para abrir: menu: ‘Análise espacial -> Análise do Terreno’.

• Então, clique r.shaded.relief para abrir o módulo.

• Altere o ângulo azimute 270 a 315.

• Digite gtopo30_shade para o novo raster sombreado e clique [rodar].

• Quando o processo termina, adicione o raster sombreado ao mapa. Você deve vê-lo exibido em escala de cinza.

• Para visualizar tanto o sombreamento da colina e as cores do “gtopo30”, mova o mapa sombreado abaixo

“mapa gtopo30” na tabela de conteúdo, em seguida, abra o: menu: ‘Propriedades de’ ‘ “GTOPO30”, mude para o: guilabel: ‘transparência’: e defina seu nível de transparência a cerca de 25%.

Agora você deve ter a elevação gtopo30 com o seu mapa de cores e configuração de transparência apresentada acima o tons de cinza mapa sombreado. Para ver os efeitos visuais do sombreamento, desligue o mapa gtopo30_shade em seguida, ligue-o novamente.

Usando a linha de comando GRASS

O plugin GRASS em | QG | é projetado para usuários que são novos para o grass e não está familiarizado com todos os módulos e opções. Como tal, alguns módulos na caixa de ferramentas não mostram todas as opções disponíveis, e alguns módulos não aparecem. O comando GRASS (ou console) dá ao usuário acesso aos módulos adicionais GRASS que não aparecem na caixa de ferramentas, e também algumas opções adicionais aos módulos que estão na caixa de ferramentas com os parâmetros padrão mais simples. Este exemplo demonstra o uso de uma opção adicional para o módulo ** r.shaded.relief ** que foi mostrado acima.

Figura 16.13: A shell GRASS, módulo r.shaded.relief

O módulo ** r.shaded.relief ** pode ter um parâmetro “zmult”, que multiplica os valores de elevação em relação ao XY unidades de coordenadas de modo a que o efeito de sombreamento é ainda a mais usada.

• Coloque o “raster elevação gtopo30”, e depois inicie o GRASS Ferramentas e clique no comando grass. Na janela de comando, digite: “mapa r.shaded.relief = sombra GTOPO30 = gtopo30_shade2 azimute = 315 = zmult 3” e pressione ** [Entrar] ** .

16.9. Ferramentas GRASS 189

QGIS User Guide, Versão 2.6

• Após terminar o processo, mude para o: guilabel: ‘Navegador’ e clique duas vezes sobre o novo “raster gtopo30_shade2” para exibi-lo no | QG | .

• Como explicado acima, mova o raster com o relevo sombreado abaixo da tabela de conteúdo “raster gtopo30” em seguida, verifique a transparência da “camada gtopo30” colorida. Você deverá ver que o efeito 3-D se destaca mais fortemente em relação ao primeiro mapa com relevo sombreado.

Figura 16.14: Exibindo relevo sombreado criado com o módulo GRASS r.shaded.relief

Estatísticas Raster em um mapa vetor

O próximo exemplo mostra como um módulo GRASS pode agregar dados raster e adicionar colunas de estatísticas para cada polígono em um mapa vetor.

• Novamente usando os dados do Alasca, consulte a: ref: sec_import_loc_data para importar o shapefile

árvores do diretório shapefiles no GRASS.

• Agora, um passo intermediário é necessária: centroides deve ser adicionado ao mapa importando as árvores para torná-lo num vetor de área de grass completo (incluindo os limites e centróide).

• Na caixa de ferramentas, escolha: menu: ‘ Vetor -> Gerenciar recursos, e abra o módulo ** v.centroids

** .

• Digite como mapa vetor de saída ‘forest_areas’ e rode o módulo.

• Agora carregue o vetor ‘‘ forest_areas‘‘ e exiba os tipos de florestas - Deciduais, verde, misturado - em cores diferentes: na camada janela :guilabel: Propriedades, guia Simbologia, escolha: guilabel:‘ Tipo de

Legenda‘ ‘valor único’ e definir o campo Classificação para ‘VEGDESC’. (Consulte a explicação da guia simbologia em: ref:. Vector_style_menu da seção vetor.)

• Em seguida, reabrir o GRASS Ferramentas no: menu: ‘Vetor -> Atualização do Vetor’ para outros mapas.

• Clique no módulo v.rast.stats. Digite “gtopo30” e “forest_areas”.

• Apenas um parâmetro adicional é necessária: Entra no: guilabel: ‘prefixo’ coluna ‘elev’‘ e clique ** [Ir] ** .

Esta é uma operação computacionalmente pesada, que será executado por um longo tempo (provavelmente até duas horas).

190 Capítulo 16. Integração com SIG GRASS

QGIS User Guide, Versão 2.6

• Finalmente, abra o “areas_floresta” na tabela de atributos, e verifique que várias novas colunas foram adicionadas, incluindo ‘ elev_min‘‘, ‘‘ elev_max‘‘, ‘‘ elev_média‘‘, etc, para cada polígono florestal.

16.9.3 Trabalhando com o buscador LOCALIZAÇÃO GRASS

Outro recurso útil dentro do GRASS Ferramentas é o GRASS: arquivo: ‘navegador local’.

Na

figura_grass_modula_7 , você pode ver o trabalho atual: arquivo: local com seu: arquivo: ‘Conjunto de Mapas’.

A esquerda das janelas do navegador , você pode navegar através de todos: arquivo: ‘Conjunto de Mapas’ dentro do atual: arquivo:‘ local‘. A direita da janela do navegador mostra alguns meta-informação para camadas vetoriais selecionados (por exemplo, resolução, caixa, fonte de dados, tabela de atributos conectado para dados vetoriais, e um histórico de comandos delimitador).

Figura 16.15: Buscador de LOCALIZAÇÃO GRASS

A barra de ferramentas dentro do: guilabel: ‘Navegador’ oferece as seguintes ferramentas para gerenciar o selecionado: arquivo: ‘local’

:

: guilabel:Adicione mapa selecionado à tela

: guilabel:’Copiar mapa selecionado‘

:guilabel:’Renomeia mapa selecionado‘

: guilabel: ‘Exclua mapa selecionado‘

: guilabel:’Defina região atual de mapa selecionado‘

: guilabel: Atualizar janela de busca

A guilabel: : Renomeia mapa selecionado e guilabel: : ‘Exclua mapa selecionado‘só trabalha com os mapas dentro do seu selecionado: arquivo:MAPSET. Todas as outras ferramentas também trabalham com camadas vetoriais e raster em outro: arquivo: MAPSET.

16.9. Ferramentas GRASS 191

QGIS User Guide, Versão 2.6

16.9.4 Personalizando a caixa de ferramentas GRASS

Quase todos os módulos de GRASS podem ser adicionados a caixa de ferramentas. Uma interface XML é fornecido para analisar os arquivos mais simples que configuram a aparência e os parâmetros dos módulos dentro da caixa de ferramentas.

Um exemplo de arquivo XML para gerar o módulo v.buffer (v.buffer.qgm) se parece com isto:

<?xml version="1.0" encoding="UTF-8"?>

<!DOCTYPE qgisgrassmodule SYSTEM "http://mrcc.com/qgisgrassmodule.dtd">

<qgisgrassmodule label="Vector buffer" module="v.buffer">

<option key="input" typeoption="type" layeroption="layer" />

<option key="buffer"/>

<option key="output" />

</qgisgrassmodule>

.

O analisador lê esta definição e cria uma nova aba no interior da caixa de ferramentas quando você seleciona o módulo.

Uma descrição mais detalhada para a adição de novos módulos, mudando o grupo de um módulo, etc, pode ser encontrado na | qg | wiki em http://hub.qgis.org/projects/quantumgis/wiki/Adding_New_Tools_to_the_GRASS_Toolbox .

192 Capítulo 16. Integração com SIG GRASS

CAPÍTULO

17

QGIS estrutura de processamento

.

17.1 Introdução

Este capítulo apresenta a estrutura de processamento QGIS, um ambiente de geoprocessamento, que pode ser usado para chamar algoritmos nativos e de terceiros a partir do QGIS, fazendo suas tarefas de análise espacial mais produtivas e fáceis de realizar.

Nas seções seguintes, vamos analisar como usar os elementos gráficos deste quadro e tirar o máximo proveito de cada um deles.

Existem quatro elementos básicos no quadro da GUI, que são usados para executar algoritmos para diferentes fins. Escolher uma ferramenta ou outra vai depender do tipo de análise que está sendo realizada e das características particulares de cada usuário e do projeto. Todos eles (exceto para a interface de processamento em lote, que é chamado a partir da caixa de ferramentas, como veremos) podem ser acessados a partir do ítem de menu

:menuselection: Processamento. (Você vai ver mais de quatro entradas. Os restantes não são usados para executar algoritmos e será explicado mais adiante neste capítulo.)

• A caixa de ferramentas. O elemento principal do GUI, é usado para executar um algoritmo único ou rodar um processo batch baseado nesse algoritmo.

Figura 17.1: Caixa de Ferramentas Processamento

193

QGIS User Guide, Versão 2.6

• O modelador gráfico. Vários algoritmos podem ser combinados graficamente usando o modelador para definir um fluxo de trabalho, a criação de um único processo que envolve vários subprocessos.

Figura 17.2: Modelador do Processamento

• O gerenciador do histórico. Todas as ações realizadas usando qualquer um dos elementos acima mencionados são armazenados em um arquivo de histórico e pode ser facilmente reproduzida mais tarde usando o gerenciador do histórico.

• A interface de processamento batch. Esta interface permite que possa executar processos batch e automaticamente a execução de um único algoritmo num múltiplo conjunto de dados.

.

Nas seções seguintes, vamos analisar cada um desses elementos em detalhe.

17.2 A caixa de ferramentas

A Caixa de ferramenta é o elemento principal da GUI de processamento, e o que você mais usará provável em seu trabalho diário. Ele mostra a lista de todos os algoritmos disponíveis agrupados em diferentes blocos, e é o ponto de acesso para executá-los, seja como um processamento único ou em lote que envolve várias execuções do mesmo algoritmo em diferentes conjuntos de entradas.

A caixa de ferramentas contém todos os algoritmos disponíveis, divididos em grupos pré-definidos. Todos esses grupos podem ser encontrados numa árvore única com uma entrada que se chama Geoalgoritmos

Além disso, mais duas entradas são encontradas, ou seja, Modelos e Scripts. Estes incluem algoritmos criados pelo usuário, e eles permitem que você definir seus próprios fluxos de trabalho e tarefas de processamento. Vamos dedicar uma seção completa a eles um pouco mais tarde.

Na parte superior da caixa de ferramentas, você vai encontrar uma caixa de texto. Para reduzir o número de algoritmos mostrados na caixa de ferramentas e tornar mais fácil de encontrar o que você precisa, você pode digitar qualquer palavra ou frase na caixa de texto. Observe que, enquanto você digita, o número de algoritmos na caixa de ferramentas é reduzido para apenas aqueles que contêm o texto que introduziu o nome.

194 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Figura 17.3: Histórico do Processamento

Figura 17.4: Interface de Processamento Batch

17.2. A caixa de ferramentas 195

QGIS User Guide, Versão 2.6

Figura 17.5: Caixa de Ferramentas Processamento

Na parte inferior, você encontrará uma caixa que lhe permite alternar entre a lista algoritmo simplificado (aquele explicado acima) e a lista avançada. Se você mudar para o modo avançado, a caixa de ferramentas será parecida com esta:

Na exibição avançada, cada grupo representa um chamado “provedor algoritmo’, que é um conjunto de algoritmos que vêm da mesma fonte, por exemplo, a partir de um aplicativo de terceiros com recursos de geoprocessamento.

Alguns destes grupos representam algoritmos de aplicativos de terceiros, como SAGA, GRASS ou R, enquanto outros contêm algoritmos diretamente codificado como parte do complemento de processamento, não dependendo de nenhum software adicional.

Esta vista é recomendado para aqueles usuários que têm um certo conhecimento das aplicações que estão apoiando os algoritmos, uma vez que eles serão mostrados com seus nomes originais e grupos.

Além disso, alguns algoritmos adicionais estão disponíveis apenas na visualização avançada, tais como ferramentas de LiDAR e scripts com base no software de computação estatística R, entre outros. Independente QGIS complementos que adicionam novos algoritmos para a caixa de ferramentas só serão mostrado na exibição avançada.

Particularmente, a vista simplificada contém algoritmo dos seguintes fornecedores:

• GRASS

• SAGA

• OTB

• Algoritmos nativos QGIS

No caso de execução QGIS com o Windows, estes algoritmos são totalmente funcionais em uma nova instalação do QGIS, e eles podem ser executados sem a necessidade de nenhuma instalação adicional. Além disso, executálos não requer nenhum conhecimento prévio dos aplicativos externos que usam, tornando-as mais acessível para usuários de primeira viagem.

Se você quiser usar um algoritmo não fornecido por qualquer dos provedores acima, mude para o modo avançado, selecionando a opção correspondente na parte inferior da caixa de ferramentas.

Para executar um algoritmo, de duplo clique no seu nome na caixa de ferramentas.

196 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Figura 17.6: Caixa de Ferramentas Processamento (modo avançado)

17.2.1 O diálogo do algoritmo

Uma vez que você clicar duas vezes sobre o nome do algoritmo que você deseja executar, uma caixa de diálogo semelhante à da figura abaixo é mostrado (neste caso, o diálogo corresponde ao algoritmo ‘índice de Convergência’ do SAGA).

Este diálogo é utilizado para definir os valores de entrada que o algoritmo precisa para ser executado. Ele mostra uma tabela onde os valores de entrada e os parâmetros de configuração serão definidos. É, obviamente, tem um teor diferente, dependendo dos requisitos do algoritmo a ser executado, e é criado automaticamente, com base em tais requisitos. No lado esquerdo, o nome do parâmetro é mostrado. No lado direito, o valor do parâmetro pode ser definido.

Embora o número e tipo de parâmetros dependerem das características do algoritmo, a estrutura é semelhante para todos eles. Os parâmetros encontrados na tabela podem ser de um dos seguintes tipos.

• Uma camada raster, selecione a partir de uma lista de todas as camadas disponíveis (atualmente abertas) no

QGIS. O seletor contém também um botão no seu lado direito, para que você escolha nomes que representam as camadas atualmente não carregadas no QGIS.

• Uma camada de vetor, selecione a partir de uma lista de todas as camadas de vetores disponíveis no QGIS.

Camadas não carregadas no QGIS podem ser selecionadas, bem como, como no caso de camadas raster, mas somente se o algoritmo não necessita de um campo da tabela selecionada a partir da tabela de atributos da camada. Nesse caso, apenas as camadas abertas podem ser selecionadas, uma vez que precisa ser aberta, de modo a recuperar a lista de nomes de campos disponíveis.

Irá ver um botão por cada selecionador de camada vetorial, como é exibido na figura em baixo.

Se o algoritmo contém vários deles, você será capaz de alternar apenas um deles. Se o botão que corresponde a um vetor de entrada é alternado, o algoritmo será executado de forma iterativa em cada uma de suas características, em vez de apenas uma vez para toda a camada, produzindo o maior número de saídas em vezes do algoritmo ser executado. Isto permite a automatização do processo quando todas as características de uma camada ter que ser tratada separadamente.

• Uma tabela, selecione a partir de uma lista de todos os disponíveis no QGIS. Tabelas não-espaciais são carregados para QGIS como camadas vetoriais, e na verdade, eles são tratados como tal pelo programa.

Atualmente, a lista de tabelas disponíveis que você verá ao executar um algoritmo que precisa de um deles é

17.2. A caixa de ferramentas 197

QGIS User Guide, Versão 2.6

Figura 17.7: Diálogo dos Parâmetros

198

Figura 17.8: Botão de interação vetorial restrito às tabelas provenientes de arquivos em formatos dBase (:file:. dbf ) ou valores separados por vírgula

(:file:.

‘ csv

).

• Uma opção, para escolher de uma lista de seleção de uma lista de opções possíveis.

• Um valor numérico, a ser introduzido na caixa de texto. Você vai encontrar um botão ao seu lado. Clicando nele, você verá uma caixa de diálogo que permite que você digite uma expressão matemática, para que você possa usá-lo como uma calculadora de mão. Algumas variáveis úteis relacionados com dados carregados em QGIS pode ser adicionado à sua expressão, de modo que você pode selecionar um valor derivado de qualquer uma dessas variáveis, como o tamanho das células de uma camada ou a mais setentrional de coordenadas do outro.

• Um intervalo, com valores min e máx para serem introduzidos em duas caixas de texto.

• Uma cadeia de texto, para ser introduzida na caixa de texto.

• Um campo, para escolher a partir de uma tabela de atributos de uma camada vetorial ou uma tabela única de outro parâmetro.

• Um sistema de coordenadas de referência. Você pode digitar o código EPSG diretamente na caixa de texto, ou selecione-o na janela de seleção de SRC que aparece quando você clica com o botão do lado direito.

• Uma medida, a ser celebrada por quatro números que representam os seus limites xmin, xmax, ymin, ymax

. Clicando no botão no lado direito do seletor de valor, um menu pop-up será exibido, dando-lhe duas opções: para selecionar o valor de uma camada ou a extensão da tela atual, ou defini-la arrastando diretamente na mapa de lona.

Se selecione a primeira opção, irá ver uma janela igual a próxima.

Se selecionar o segundo, os parâmetros da janela irão esconder-se, para que possa clicar e arrastar para o enquadramento. Uma vez definido o retângulo selecionado, o diálogo irá reaparecer, contendo os valores

Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Figura 17.9: Selecionador de Números

Figura 17.10: Selecionador de Extensão

17.2. A caixa de ferramentas

Figura 17.11: Lista de Extensão

199

QGIS User Guide, Versão 2.6

na caixa de texto da extensão.

Figura 17.12: Arrastamento para Extensão

• A lista de elementos (se as camadas raster, camadas de vetor ou tabelas), para selecionar a partir da lista de tais camadas disponíveis no QGIS. Para fazer a seleção, clique no pequeno botão do lado esquerdo da linha correspondente para ver uma janela como a seguinte.

Figura 17.13: Múltipla Seleção

• Uma pequena tabela para ser editada pelo utilizador. Estes são usados para definir os parâmetros como tabelas lookup ou kernels de convolução, entre outros.

Clique no botão do lado direito para ver a tabela e editar os seus valores.

Dependendo do algoritmo, o número de linhas pode ser modificado ou não, utilizando os botões do lado direito da janela.

Você vai encontrar uma guia [Ajuda] na caixa de diálogo dos parâmetros. Se um arquivo de ajuda estiver disponível, ele será mostrado, dando-lhe mais informações sobre o algoritmo e descrições detalhadas do que cada parâmetro faz. Infelizmente, a maioria dos algoritmos não têm uma boa documentação, mas se você sentir vontade de contribuir com o projeto, este seria um bom lugar para começar.

Uma nota nas projeções

Algoritmos executados a partir da estrutura de processamento — isso também é verdade para a maioria das aplicações externas cujos algoritmos são expostos através dele. Não realize nenhuma reprojeção em camadas de entrada e assuma que todos elas já estão em um sistema de coordenadas comum e pronto para serem analisadas.

Sempre que você usar mais de uma camada como entrada para um algoritmo, se vetor ou raster, irá perguntar a você para se certificar que elas estão todas no mesmo sistema de coordenadas.

200 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Figura 17.14: Tabela Fixa

Note-se que, devido a capacidades de reprojeção on-the-fly do QGIS, apesar de duas camadas pode parecer sobrepor e corresponder, que pode não ser verdade, se as suas coordenadas originais são usadas sem reprojeção em um sistema de coordenadas comum. Essa reprojeções deve ser feita manualmente, e, em seguida, os arquivos resultantes devem ser utilizados como entrada para o algoritmo. Também, notar que o processo reprojeções pode ser realizada com os algoritmos que estão disponíveis na própria estrutura de processamento.

Por padrão, a caixa de diálogo parâmetros mostrará uma descrição do SRC de cada camada, juntamente com o seu nome, tornando mais fácil para selecionar as camadas que compartilham o mesmo SRC para ser usado como camadas de entrada. Se você não quer ver essas informações adicionais, você pode desativar essa funcionalidade na janela de configuração de processamento, desmarcando a opção Mostrar SRC.

Se você tentar executar um algoritmo utilizando como entrada duas ou mais camadas com sem correspondência de SRC, um diálogo de aviso será exibido.

Pode continuar a executar o algoritmo, mas tenha atenção que na maioria dos casos irá produzir resultados errados, tais como, camadas vazias devido à falta de sobreposição das camadas usadas como arquivos de entrada.

17.2.2 Objetos de dados gerados por algoritmos

Objetos de dados gerado por um algoritmo podem ser dos seguintes tipos:

• Uma camada raster

• Uma camada vetorial

• Uma tabela

• Um arquivo HTML (usado para arquivo de saída de texto e gráficos)

Estes todos são salvos em disco, e a tabela de parâmetros irá conter uma caixa de texto correspondente a cada uma dessas saídas, onde você pode digitar o canal de saída e usar para salvá-la. Um canal de saída contém as informações necessárias para salvar o objeto resultante em algum lugar. No caso mais comum, você vai salvá-lo em um arquivo, mas a arquitetura permite a qualquer outra forma de armazenamento. Por exemplo, uma camada vetorial pode ser armazenada em um banco de dados ou até mesmo enviada para um servidor remoto usando um serviço WFS-T. Embora as soluções como estas ainda não estão implementadas, a estrutura de processamento está preparada para lidar com elas, e esperamos adicionar novos tipos de canais de saída em uma próxima feição.

Para selecionar um canal de saída, basta clicar no botão do lado direito da caixa de texto. Isso vai abrir uma caixa de diálogo salvar arquivo, onde você pode selecionar o caminho desejado para o arquivo. Extensões de arquivos suportadas são mostradas no seletor de formato de arquivo da caixa de diálogo, dependendo do tipo do produto e do algoritmo.

17.2. A caixa de ferramentas 201

QGIS User Guide, Versão 2.6

O formato da saída é definido pela extensão do arquivo. Os formatos suportados dependem do que é suportado pelo próprio algoritmo. Para selecionar um formato, basta selecionar a extensão do arquivo correspondente (ou em vez adicioná-la, se você estiver digitando diretamente o caminho do arquivo). Se a extensão do caminho do arquivo que você digitou não corresponde a nenhum dos formatos suportados, uma extensão do padrão (normalmente .dbf

para tabelas, .tif para camadas raster e .shp para camadas vetoriais) será anexado ao caminho do arquivo e o formato de arquivo correspondente a essa extensão será usado para salvar a camada ou tabela.

Se você não digitar qualquer nome de arquivo, o resultado será salvo como um arquivo temporário no formato de arquivo padrão correspondente, e ele vai ser excluído depois de sair QGIS (tome cuidado com isso, no caso de você salvar seu projeto e contém camadas temporárias).

Você pode definir uma pasta padrão para objetos de dados de saída. Vá para a janela de configuração (você pode abri-la a partir do Menu :menuselection: Processamento), e no grupo Geral, você vai encontrar um parâmetro chamado pasta de saída. Esta pasta de saída é usada como o caminho padrão no caso de você digitar apenas um nome de arquivo sem caminho (isto é, myfile.shp) durante a execução de um algoritmo.

Ao executar um algoritmo que usa uma camada de vetor no modo interativo, o caminho do arquivo digitado é utilizado como o caminho de base para todos os arquivos gerados, que são nomeados com o nome de base e acrescentando-se um número que representa o índice da iteração. A extensão do arquivo (e formato) é usado para todos esses arquivos gerados.

Além de camadas raster e tabelas, algoritmos também geram gráficos e textos em arquivos HTML. Estes resultados estão apresentados no final da execução do algoritmo em uma nova caixa de diálogo. Este diálogo vai manter os resultados produzidos por qualquer algoritmo durante a seção atual, e pode ser mostrado em qualquer momento selecionando Processamento → visualizador de resultados do menu principal QGIS.

Algumas aplicações externas podem ter arquivos (sem restrições de extensão particulares) como saída, mas elas não pertencem a nenhuma das categorias acima. Os arquivos de saída não serão processados pelo QGIS (aberto ou incluído no atual projeto QGIS), uma vez que a maior parte do tempo, eles correspondem a formatos de arquivo ou elementos não suportados pelo QGIS. Este é, por exemplo, o caso com os arquivos LAS usados para dados

LiDAR. Os arquivos são criados, mas você não vai ver nada de novo no sua seção de trabalho QGIS.

Para todos os outros tipos de saída, você encontrará uma caixa de verificação que você pode usar para dizer o algoritmo para saber se carregará o arquivo, uma vez que é gerado pelo algoritmo ou não. Por padrão, todos os arquivos são abertos.

Saídas opcionais não são suportadas. Ou seja, todas as saídas são criadas. No entanto, você pode desmarcar a caixa correspondente, se você não está interessado em um determinado produto, que essencialmente torna comportar-se como uma saída opcional (em outras palavras, a camada é criada de qualquer jeito, mas se você deixar a caixa de texto vazia, será salvo em um arquivo temporário e apagado quando sair QGIS).

17.2.3 Configurando a infraestrutura do processamento

Como foi mencionado, o menu de configuração dá acesso a um novo diálogo onde pode configurar a forma como o algoritmo trabalha. Os parâmetros de configuração são estruturados em blocos separados que podem ser seleccionados no lado esquerdo do diálogo.

Juntamente com o que já foi mencionada da entrada Pasta de saída, o bloco Geral contem parâmetros para configuração de estilos de renderização padrão para camadas de saída (ou seja, camadas geradas pela utilização de algoritmo de qualquer componente da infraestrutura do GUI). Basta criar um estilo que quer usar no QGIS, salva-lo num arquivo, e de seguida introduzir um caminho para o arquivo nas configurações para que sejam usado pelos algoritmos. Cada vez que a camada for carregada pelo SEXTANTE e adicionada ao enquadramento do

QGIS, esta será renderizada com esse estilo.

Os estilos de renderização podem ser configurados individualmente para cada algoritmo e cada um para os seus arquivos de saída. Apenas clique com o direito do mouse no nome do algoritmo na caixa de ferramentas e selecione

Editar estilos de renderização . Irá ver um diálogo como o que é exibido a seguir.

Selecione o arquivo de estilo (.qml) que quer para cada arquivo de saída e pressione [OK].

Os outros parâmetros de configuração no grupo Geral estão em baixo referidos:

202 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Figura 17.15: Estilos de Renderização

• Use nome da camada como nome do arquivo. O nome de cada camada resultante criada por um algoritmo

é definido pelo próprio algoritmo. Em alguns casos, um nome fixo pode ser utilizado, o que significa que o mesmo nome de saída vai ser usado, não importa qual a camada de entrada é usada. Em outros casos, o nome pode depender do nome da camada de entrada ou de alguns dos parâmetros usados para executar o algoritmo. Se esta opção for assinalada, o nome será retirado o nome do arquivo de saída em seu lugar.

Observe que, se a saída é salvo em um arquivo temporário, o nome deste arquivo temporário é geralmente uma longo e sem sentido que se destina a evitar a conflito com outros nomes de arquivos já existentes.

• Use somente recursos selecionados. Se essa opção for selecionada, sempre que uma camada de vetor é usada como entrada para um algoritmo, apenas suas feições selecionadas serão usadas. Se a camada não tiver feições selecionadas, todas as feições serão utilizadas.

.

• arquivo de pré-execução do script e arquivo de script pós-execução. Estes parâmetros se referem aos scripts escritos usando a funcionalidade de script de processamento e são explicados na seção cobertura scripting e do terminal.

Além de o bloco Geral na caixa de diálogo de configurações, você também vai encontrar um bloco para provedores de algoritmo. Cada entrada neste bloco contém um ítem Ativar que você pode usar para fazer algoritmos aparecer ou não na caixa de ferramentas. Além disso, alguns provedores de algoritmo têm seus próprios itens de configuração, que explicaremos mais tarde, quando cobrindo determinados provedores de algoritmo.

17.3 O modelador gráfico

O modelador gráfico permite que possa criar modelos complexos usando uma simples interface fácil-de-usar.

Quando trabalha com um SIG, a maioria das operações de análises não são isoladas, mas sim parte das cadeias de operações. Usando um modelador gráfico, a cadeia de processos podem ser agregados num único processo, sendo mais fácil e mais conveniente a sua execução de um processo único num conjunto de diferentes dados de entrada.

Não importa o número de etapas e os diferentes algoritmos envolvidos, o modelo é executado como um algoritmo

único, desta forma vai poupar tempo e esforços, especialmente para modelos largos.

O modelador pode ser aberto a partir do menu processamento.

O modelador tem uma área de trabalho onde a estrutura do modelo e o sue fluxo de trabalho são representados como está exibido. Na parte esquerda da janela, um painel com dois separadores podem ser usados para adicionar novos elementos ao modelo.

A criação de um modelo envolve dois passos:

17.3. O modelador gráfico 203

QGIS User Guide, Versão 2.6

Figura 17.16: Modelador

1. Definição dos dados de entrada necessários. Estes dados de entrada serão adicionados na janela de parâmetros, para que o utilizador possa configurar os seus valores quando executa o modelo. O modelo por si é um algoritmo, portanto os parâmetros da janela é gerado automaticamente como acontece em todos os algoritmos disponíveis na infraestrutura de processamento.

2. Definição do fluxo de trabalho. Usando os dados de entrada do modelo, o fluxo de trabalho é definido adicionando algoritmos e selecionando como vão usar esses arquivos de entrada ou de saída gerados por outros algoritmos que já existem no modelo

17.3.1 Definição das entradas

O primeiro passo para criar um modelo é definir as entradas que necessita. Os seguintes elementos são encontrados no separador Entradas no lado esquerdo da janela do modelador:

• Camada raster

• Camada vetorial

• Cadeia de texto

• Campo da tabela

• Tabela

• Extensão

• Número

• Booleano

• Arquivo

Faça duplo clique em qualquer um, e será exibido um diálogo para definir as suas características. Dependendo do parâmetro, o diálogo irá conter apenas um elemento básico (a descrição, que será o que o usuário irá ver quando

204 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

executar o modelo) ou outros. Por exemplo, quando quer adicionar um valor numérico, como aparece na próxima figura, além da descrição do parâmetro tem um conjunto de valor por defeito e um intervalo de valores válidos.

Figura 17.17: Parâmetros do Modelo

Para cada entrada adicionada, um novo elemento é adicionado ao enquadramento do modelador.

Figura 17.18: Parâmetros do Modelo

Pode também adicionar arquivos de entrada arrastando o tipo de entrada a partir de uma lista e largar no enquadramento do modelador, na posição onde quer que fique.

17.3.2 Definição do fluxo de trabalho

Uma vez as entradas definidas, é tempo de definir os algoritmos que vamos aplicar. Os algoritmos podem ser encontrados no separador Algoritmos, agrupados na mesma forma que estão na caixa de ferramentas.

A aparência da caixa de ferramentas tem dois modos: simplificado e avançado. Contudo, não existe nenhum elemento para trocar entre as vistas no modelador, e pode fazê-lo na caixa de ferramentas. O modo que é selecionado na caixa de ferramentas é aquele que será usado para a lista de algoritmos no modelador.

Para adicionar um algoritmo ao modelo, clique duas vezes no seu nome. Um diálogo de execução irá aparecer, com um conteúdo similar ao que é encontrado no painel de execução que é exibido quando da execução do algoritmo a partir da caixa de ferramentas, O algoritmo que é exibido corresponde ao algoritmo SAGA ‘Convergence index’, o mesmo que viu na seção dedicada na caixa de ferramentas.

Como pode ver, existem algumas diferenças. Em vez da caixa de saída do arquivo ser usada para configurar o caminho do arquivo para as camadas e tabelas de saída, é usado apenas uma caixa de texto simples. Se a camada gerada pelo algoritmo é apenas um resultado temporário, este será usado como o arquivo de entrada de outro algoritmo e não será mantido como resultado final, mas não edite essa caixa de texto. Introduzindo alguma coisa nela, significa que o resultado é final, e o texto que forneceu será a descrição para o arquivo de saída, que será aquele que o usuário irá ver quando executar o modelo.

A seleção do valor para cada parâmetro é também um pouco diferente, uma vez que existem diferenças importantes entre o contexto do modelador e a caixa de ferramentas. Vamos ver como é introduzido os valores para cada tipo de parâmetro.

• Camadas (raster e vetor) e tabelas. Estas são selecionados de uma lista, mas só em caso dos valores possíveis serem camadas ou tabelas carregadas no QGIS, a lista dos dados de entrada do modelo do tipo correspondente, ou outras camadas ou tabelas geradas por algoritmos que já tenham sido adicionadas ao modelo.

17.3. O modelador gráfico 205

QGIS User Guide, Versão 2.6

Figura 17.19: Parâmetros do Modelo

206

Figura 17.20: Parâmetros do Modelo

Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

• Valores numéricos. Valores literais podem ser introduzidos diretamente na caixa de texto. Mas esta caixa de texto é também uma lista que pode ser usada para selecionar qualquer valor numérico de entrada do modelo.

Nesse caso, o parâmetro irá tomar o valor introduzido pelo utilizador quando executado o modelo.

• Cadeia de texto. Como no caso dos valores numéricos, as cadeias de texto podem ser introduzidas, ou uma cadeia de texto de entrada pode ser selecionada.

• Campo da Tabela. Os campos de uma tabela origem ou camada não podem ser conhecidas na altura do seu desenho, uma vez que dependem da seleção do usuário cada vez que o modelo é executado. Para definir o valor para este parâmetro, introduza o nome do campo diretamente na caixa de texto, ou usa a lista para selecionar a entrada do campo de tabela que já está adicionada no modelo. A validade de um campo selecionado irá ser verificado no seu processo de execução.

Em todos os casos, irá encontrar um parâmetro adicional denominado de Algoritmos Parentes que não está disponível quando é chamado o algoritmo a partir da caixa de ferramentas. Este parâmetro permite que possa definir a ordem de como os algoritmos são executados, definindo explicitamente um algoritmo como parente do atual, que irá força-lo a executá-lo antes.

Quando usa um arquivo de saída de um algoritmo prévio como arquivo de entrada do seu algoritmo, isso implica definir o antigo como parent do atual (e posiciona a seta correspondente no enquadramento do modelador), Contudo, em alguns casos o algoritmo pode depender de outro mesmo que não use um objeto de saída a partir dele

(por exemplo, um algoritmo que executa uma instância SQL numa base de dados PostGIS e outra que importa uma camada para a mesma base de dados). Nesse caso, apenas selecione no parâmetro Algoritmos Parent e eles irão ser executados na ordem correta.

Uma vez todos os parâmetros estiver relacionados a valores válidos, clique no botão [OK] e o algoritmo irá ser adicionado ao enquadramento. Será ligado a todos os outros elementos do enquadramento, sejam eles algoritmos ou arquivos de entrada, o que irá fornecer objetos que foram usados como arquivos de entrada para esse algoritmo.

Os elementos podem ser arrastados para diferentes posições dentro do enquadramento, para alterar a forma como

é exibida a estrutura do módulo e tornar mais claro e intuitivo. As ligações entre os elementos são atualizadas automaticamente. Pode ampliar ou afastar usando a roda do mouse.

Pode correr o seu algoritmo em qualquer altura clicando no botão [Executar]. Contudo, se quiser usá-lo a partir da caixa de ferramentas, é necessário salva-lo e fechar o diálogo do modelador, para permitir que a caixa de ferramentas atualize os seus conteúdos.

17.3.3 Salvando e carregando os modelos

Use o botão [Salvar] para salvar o modelo atual e o [Abrir] para abrir qualquer modelo anteriormente salvo. Os modelos são salvos com a extensão .model. Se o modelo for previamente salvo da janela do modelador, não lhe irá ser solicitado por um nome de arquivo, uma vez que já existe um arquivo associado ao modelo, e será usado.

Antes de salvar o modelo, necessita de introduzir o nome e o grupo do modelo, usando as caixas de texto para parte superior da janela.

Os modelos salvos na pasta modelos (a pasta padrão quando é pedido o nome do arquivo para salvar o modelo) irá aparecer na caixa de ferramentas na ligação correspondente. Quando a caixa de ferramentas é chamada, ele procura na pasta modelos por arquivos com a extensão .model e carrega os modelos salvos. Uma vez que o modelo é um próprio algoritmo, este pode ser adicionado na caixa de ferramentas como qualquer outro algoritmo.

A pasta de modelos pode ser configurada a partir do diálogo de configuração do processamento, no grupo Modelador

Os modelos carregados a partir da pasta modelos aparecem na caixa de ferramentas, mas também na árvore de algoritmos do separador Algoritmos da janela do modelador. Isto significa que pode incorporar o modelo como parte de um modelo maior, tal como adiciona qualquer outro algoritmo.

Em alguns casos, um modelo pode não ser carregado porque nem todos os algoritmos incluídos estão disponíveis.

Se tiver usado um dado algoritmo como parte do seu modelo, este deverá estar disponível (isto é, deverá aparecer na caixa de ferramentas) de forma a carregar o modelo. Desativando um fornecedor de algoritmos nas configurações do da janela do processamento poderá desativar o modelador, o que pode trazer problemas quando carrega os modelos. Tenha isso em atenção quando tiver problemas a carregar ou a executar modelos.

17.3. O modelador gráfico 207

QGIS User Guide, Versão 2.6

17.3.4 Editando um modelo

Pode editar o modelo que criou, redefinindo o fluxo de trabalho e as relações entre os algoritmos e os dados de entrada que defeniu no modelo.

Se clicar com o direito do mouse num algoritmo na área que representa o modelo, irá ver o menu contexto como

é mostrado a seguir:

Figura 17.21: Clique direito do Modelador

Selecionando a opção Remover irá fazer com que o algoritmo seja removido. Um algoritmo só pode ser removido apenas se existir outros algoritmos dependentes dele. Isto é, se não estiver sendo usado num arquivo de saída de um algoritmo usado como arquivo de entrada diferente. Se tentar remover um algoritmo que tenha outros que dependam dele, uma mensagem de aviso igual à que vê aqui em baixo:

Figura 17.22: Não pode apagar o Algoritmo

Selecionando a opção Editar ou fazendo simplesmente duplo clique no ícone do algoritmo, irá ser exibido o diálogo de parâmetros do algoritmo, para que possa mudar os arquivos de entrada e os valores do parâmetro.

Tenha atenção pois nem todos os elementos disponíveis no modelo aparecerão neste caso como arquivos de entrada disponível. Camadas ou valores gerados num passo mais avançado no fluxo de trabalho definido pelo modelo não irá estar disponível se causar dependências em ciclo.

Selecione novos valores e de seguida clique no botão [OK] como comum. As ligações entre os elementos do modelo irão alterar de acordo com o enquadramento do modelador.

17.3.5 Editando os arquivos de ajuda do modelo e a meta-informação

Pode documentar os seus modelos a partir do próprio modelador. Basta apenas clicar no botão [Editar ajuda do modelo] e o diálogo como aquele que irá aparecer.

No lado direito irá ver uma página simples HTML, criada usando a descrição dos parâmetros de entrada e de saída do algoritmo, juntamente com itens adicionais como uma descrição geral do modelo ou o seu autor. A primeira vez que abre o editor da ajuda, todas as ajudas estão vazias, mas pode editá-los usando os elementos do lado esquerdo do diálogo. Selecione um elemento na parte superior e escreva a descrição na caixa de texto em baixo.

A ajuda do Modelo é salva num arquivo na mesma pasta ao pé do seu respectivo modelo. Não tem de ser preocupar como salvá-lo, uma vez ser feito automaticamente.

17.3.6 Sobre os algoritmos disponíveis

Poderá notar que alguns algoritmos podem ser executados a partir da caixa de ferramentas mas não aparecem na lista de algoritmos disponíveis quando está a desenhar o modelo. Para ser incluído no modelo, o algoritmo deve ter uma semântica correta, assim como ligações apropriadas a outros fluxos de trabalho. Se um algoritmo não tiver

208 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Figura 17.23: Edição da Ajuda

.

uma boa semântica bem definida (por exemplo, se o número de camadas de saída não são conhecidas), portanto não é possível usá-lo dentro do modelo, e não aparece na lista na janela do diálogo do modelador.

Adicionalmente, irá ver algoritmos no modelador que não se encontram na caixa de ferramentas. Esses algoritmos são para ser usados exclusivamente como parte do modelo, e eles não têm interesse em outro contexto diferente.

O algoritmo ‘Calculadora’ é um exemplo disso. É apenas uma simples calculadora aritmética que pode usar para modificar valores numéricos (introduzidos pelo utilizador ou gerados por outro tipo de algoritmo). Estas ferramentas são realmente úteis dentro do modelo, mas fora do contexto, não fazem sentido.

17.4 A interface do processamento em lote

17.4.1 Introdução

Todos os algoritmos (incluindo modelos) podem ser executados como um processo descontínuo. Isto é, eles podem ser executados não utilizando apenas um único conjunto de entradas, mas alguns delas, a execução do algoritmo tantas vezes quanto necessário. Isto é útil quando se processa grandes quantidades de dados, uma vez que não será necessário iniciar o algoritmo várias vezes na caixa de ferramentas.

Para executar um algoritmo como um processamento em lote, clique com o direito do mouse na caixa de ferramentas e selecione a opção Executar como processamento em lote no balão de opções que irá aparecer.

Figura 17.24: Clique no botão direito do mouse para processar em lote

17.4. A interface do processamento em lote 209

QGIS User Guide, Versão 2.6

17.4.2 Os parâmetros da tabela

A execução de um processamento em lote é semelhante à execução única de um algoritmo. Os valores do parâmetro têm de ser definidos, mas neste caso nós necessitamos um conjunto de parâmetros, uma para cada vez que o algoritmo é executado. Os valores são introduzidos usando uma tabela como é mostrada a seguir.

Figura 17.25: Processamento em Lote

Cada linha desta tabela representa uma única execução do algoritmo, e cada célula contém o valor de um dos parâmetros. É semelhante aos parâmetros do diálogo que vê quando executa o algoritmo a partir da caixa de ferramentas, mas com uma diferente disposição.

Por defeito, a tabela contém apenas duas linhas. Pode adicionar ou remover linhas usando os botões na parte inferior da janela.

Uma vez que o tamanho da tabela for configurado, terá de ser preenchido com os valores desejados.

17.4.3 Preenchendo os parâmetros da tabela

Para a maioria dos parâmetros, a configuração do valor é trivial. Basta digitar o valor ou selecioná-lo na lista de opções disponíveis, dependendo do tipo de parâmetro.

As principais diferenças são encontradas para os parâmetros que representam camadas ou tabelas, e caminho de arquivo de saída. Quanto camadas de entrada e tabelas, representam um algoritmo que será executado como parte de um processo de grupo, os objetos de dados de entrada são levados diretamente a partir de arquivos, e não a partir do conjunto deles já aberto no QGIS. Por esta razão, qualquer algoritmo pode ser executado como um processo em lote, mesmo que os objetos de dados ao todo não sejam abertos e o algoritmo não possa ser executado a partir da caixa de ferramentas.

Nomes de arquivos de objetos de dados de entrada são introduzidos digitando diretamente ou, mais convenientemente, clicando no botão do lado direito da célula, o que mostra uma janela típica de seleção de arquivos.

Múltiplos arquivos podem ser selecionados de cada vez. Se o parâmetro de entrada representa um único objeto de dados e vários arquivos são selecionados, cada um deles será colocado em uma linha separada, acrescentando novos, se necessário. Se o parâmetro representa uma entrada múltipla, todos os arquivos selecionados serão adicionados a uma única célula, separados por ponto e vírgula (;).

210 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Objetos de dados de saída sempre são salvos em um arquivo e, ao contrário, quando a execução de um algoritmo a partir da caixa de ferramentas, salvar em um arquivo temporário não é permitido. Você pode digitar o nome diretamente ou usar a janela de diálogo de seleção de arquivos que aparece ao clicar no botão que o acompanha.

Um vez selecionado o arquivo, um novo diálogo será exibido para permitir que faça o auto-preenchimento das outras células na mesma coluna (o mesmo parâmetro).

Figura 17.26: Salvar Processamento em Lote

Se o valor padrão (‘Não efetuar auto-preenchimento’) é selecionado, irá apenas por o nome do arquivo selecionado na célula selecionada da tabela de parâmetros. Se alguma das outras opções estiver selecionada, todas as células abaixo da selecionada irão automaticamente ser preenchidas baseando-se no critério definido. Desta forma, é mais fácil preencher a tabela, e o processamento em lote pode ser definido com menor esforço.

O preenchimento automático pode ser feito simplesmente adicionando números relativos ao caminho do arquivo selecionado, ou acrescentando o valor de outro campo na mesma linha. Isto é particularmente útil para nomear objetos de dados de saída de acordo com os de entrada.

Figura 17.27: Caminho do Arquivo do Processamento em Lote

17.4.4 Executando o processo em lote

.

Após a introdução de todos os valores necessários pode executar o processamento em lote, apenas clicando em

[OK]. O progresso global da tarefa de processamento será exibido na barra de progresso na parte inferior do diálogo.

17.5 Usando os algoritmos do processamento a partir do Terminal

Python.

O terminal permite que usuários avançados aumente sua produtividade e execute operações complexas que não podem ser utilizados através dos outros elementos GUI da caixa de processamento. Modelos envolvendo vários algoritmos podem ser definidos usando a interface de linha de comando e operações adicionais como loops e sentenças condicionais podem ser adicionados para criar fluxos de trabalho mais flexíveis e poderosos.

Não há um terminal de processamento específico no QGIS, mas todo os comandos de processamentos estão disponíveis embutidos no Terminal Python em vez do QGIS. Isso significa que poderá incorporar os comandos em seu terminal de trabalho e conectar algoritmos de processamentos de todos os outros recursos disponíveis

(incluindo métodos da | qg | API) a partir deste terminal.

17.5. Usando os algoritmos do processamento a partir do Terminal Python.

211

QGIS User Guide, Versão 2.6

O código que pode executar a partir do Terminal Python, mesmo quando não chama nenhum método específico do processamento, pode ser convertido num novo algoritmo que pode mais tarde chamar da caixa de ferramentas, o modelador gráfico ou qualquer outro componente, como faz para outro algoritmo. De fato, alguns algoritmos que encontra na caixa de ferramentas são scripts simples.

Nesta seção, veremos como usar algoritmos de processamento do QGIS console Python e também a forma de escrever algoritmos usando Python.

17.5.1 Chamando os algoritmos a partir do Terminal Python

A primeira coisa que tem de fazer é importar as funções do processamento com a seguinte linha:

>>> import processing

Agora, basicamente é uma (interessante) coisa que pode fazer a partir do terminal: executar um algoritmo. Isso é feito usando o método runalg(), que toma o nome do algoritmo a ser executado como o seu primeiro parâmetro, então o número da variável de um parâmetro adicional depende dos requisitos do algoritmo. Portanto a primeira coisa que necessita saber é o nome do algoritmo a executar. Não será o nome que vê na caixa de ferramentas, mas um único nome da linha de comando. Para encontrar o nome correto do seu algoritmo, pode usar o método alslist()

. Introduza a seguinte linha no seu terminal:

>>>

processing .

alglist()

Irá ver algo como isto.

Accumulated Cost (Anisotropic)---------------->saga:accumulatedcost(anisotropic)

Accumulated Cost (Isotropic)------------------>saga:accumulatedcost(isotropic)

Add Coordinates to points--------------------->saga:addcoordinatestopoints

Add Grid Values to Points--------------------->saga:addgridvaluestopoints

Add Grid Values to Shapes--------------------->saga:addgridvaluestoshapes

Add Polygon Attributes to Points-------------->saga:addpolygonattributestopoints

Aggregate------------------------------------->saga:aggregate

Aggregate Point Observations------------------>saga:aggregatepointobservations

Aggregation Index----------------------------->saga:aggregationindex

Analytical Hierarchy Process------------------>saga:analyticalhierarchyprocess

Analytical Hillshading------------------------>saga:analyticalhillshading

Average With Mask 1--------------------------->saga:averagewithmask1

Average With Mask 2--------------------------->saga:averagewithmask2

Average With Thereshold 1--------------------->saga:averagewiththereshold1

Average With Thereshold 2--------------------->saga:averagewiththereshold2

Average With Thereshold 3--------------------->saga:averagewiththereshold3

B-Spline Approximation------------------------>saga:b-splineapproximation

...

Esta é a lista de todos os algoritmos disponíveis, ordenados alfabeticamente, juntamente com os seus nomes da linha de comandos correspondentes.

É possível usar uma cadeia de texto como parâmetro para este método. Em vez de retornar a lista completa de algoritmo , ele só irá exibir aqueles que incluem esta cadeia. Se, por exemplo, está procurando um algoritmo para calcular a inclinação de um MDE, digite alglist("slope") para obter o seguinte resultado:

DTM Filter (slope-based)---------------------->saga:dtmfilter(slope-based)

Downslope Distance Gradient------------------->saga:downslopedistancegradient

Relative Heights and Slope Positions---------->saga:relativeheightsandslopepositions

Slope Length---------------------------------->saga:slopelength

Slope, Aspect, Curvature---------------------->saga:slopeaspectcurvature

Upslope Area---------------------------------->saga:upslopearea

Vegetation Index[slope based]----------------->saga:vegetationindex[slopebased]

Este resultado pode mudar dependendo dos algoritmos que estão disponíveis.

Assim é mais fácil encontrar o algoritmo que procura e o seu nome da linha de comandos, neste caso saga:slopeaspectcurvature

.

212 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Uma vez conhecido o nome da linha de comandos do algoritmo, a próxima coisa a fazer é determinar a sintaxe correta para executá-lo. Isto significa saber quais os parâmetros necessários e a ordem que devem passar quando chamado pelo método runalg(). Existe um método para descrever um algoritmo em detalhe, o qual pode ser usado para obter uma lista de parâmetros que requer uns algoritmos e os arquivos de saída que irão gerar. Para fazer isso, pode usar o método alghelp(name_of_the_algorithm). Use o nome do algoritmo na linha de comando, não o nome descritivo completo.

Chamado o método saga:slopeaspectcurvature como parâmetro, você terá a seguinte descrição.

>>>

processing .

alghelp( "saga:slopeaspectcurvature" )

ALGORITHM: Slope, Aspect, Curvature

ELEVATION <ParameterRaster>

METHOD <ParameterSelection>

SLOPE <OutputRaster>

ASPECT <OutputRaster>

CURV <OutputRaster>

HCURV <OutputRaster>

VCURV <OutputRaster>

Agora tem tudo o que necessita para correr qualquer algoritmo. Como já tínhamos mencionado, existe apenas um comando para executar algoritmos: runalg(). A sua síntaxe é como está descrito a seguir:

>>>

processing .

runalg(name_of_the_algorithm, param1, param2, ...

, paramN,

Output1, Output2, ..., OutputN)

A lista de parâmetros e arquivos de saída para adicionar dependem do algoritmo que quer correr, e é exatamente a lista que o método alghelp() lhe dá, na mesma ordem que é exibido.

Dependendo do tipo de parâmetro, os valores são introduzidos diferentemente. A próxima explicação é uma rápida revisão de como introduzir valores para cada tipo de parâmetro de entrada:

• Camada Raster, Camada Vetorial e Tabela. Simplesmente usa uma cadeia de texto com nome que identifica o objeto de dados a usar ( o nome está na Tabela de Conteúdos do QGIS) ou o nome do arquivo (se a camada correspondente não for aberta, mas não adicionada no enquadramento do mapa). Se tiver uma instância do objeto QGIS representado na camada, pode também passá-lo como parâmetro. Se o arquivo de entrada for opcional e não quer usá-lo como qualquer tipo de objeto de dados, use None.

• Seleção. Se algum algoritmo tiver um parâmetro de seleção, o valor desse parâmetro deve ser introduzido usando um valor inteiro. Para saber as opções disponíveis, pode usar o comando algoptions(), como é exibido no seguinte exemplo:

>>>

processing .

algoptions( "saga:slopeaspectcurvature" )

METHOD(Method)

0 - [0] Maximum Slope (Travis et al. 1975)

1 - [1] Maximum Triangle Slope (Tarboton 1997)

2 - [2] Least Squares Fitted Plane (Horn 1981, Costa-Cabral & Burgess 1996)

3 - [3] Fit 2.Degree Polynom (Bauer, Rohdenburg, Bork 1985)

4 - [4] Fit 2.Degree Polynom (Heerdegen & Beran 1982)

5 - [5] Fit 2.Degree Polynom (Zevenbergen & Thorne 1987)

6 - [6] Fit 3.Degree Polynom (Haralick 1983)

Neste caso, o algoritmo tem um dos referidos parâmetros com 7 opções e sua ordenação é iniciada em zero.

• Múltiplas entradas. O valor é uma cadeia de texto com descritores de entrada separados por ponto e vírgula

(;). Como no caso das camadas ou tabelas únicas, cada descritor de entrada pode ser o nome do objeto ou o caminho do arquivo.

• Campo da Tabela de XXX. Use uma cadeia de texto com o nome do campo a usar. O parâmetro é caso sensitivo.

• Tabela Fixa. Digite a lista de todos os valores da tabela separadas por vírgulas (,) e feche entre aspas (").

Os valores começam na linha superior e vai da esquerda para a direita. Pode também usar uma matriz 2D de valores que representam a tabela.

• SRC. Introduza o número do código EPSG do SRC desejado.

17.5. Usando os algoritmos do processamento a partir do Terminal Python.

213

QGIS User Guide, Versão 2.6

• Extensão. Deve usar uma cadeia de texto com xmin, xmax, ymin e ymax valores separados por vírgulas

(,).

Os parâmetros booleanos, de arquivo, cadeia de texto e numéricos não necessitam de explicações adicionais.

Os parâmetros de entrada, como textos, booleanos, ou valores numéricos têm valores padrão. Para usá-los, especificar None na entrada do parâmetro correspondente.

Para objetos de saída de dados, digite o caminho de arquivo a ser utilizado para salvá-lo, como é feito a partir da caixa de ferramentas. Caso queira salvar o resultado em um arquivo temporário, use None. A extensão do arquivo determina o formato do arquivo. Se você digitar uma extensão de arquivo não suportada pelo algoritmo, será utilizado o formato de arquivo padrão para esse tipo de saída e a sua extensão correspondente anexado ao conjunto de arquivos de dados.

Contrariamente, quando o algoritmo é executado a partir da caixa de ferramentas, osarquivos de saída não são adicionados ao enquadramento do mapa se executar o mesmo algoritmo a partir do Terminal Python. Se quiser adicionar um arquivo de saída, você tem de adicioná-lo depois de correr o algoritmo, Para o fazer, pode usar os comandos do API QGIS ou, mais fácil, use um dos métodos úteis para esta tarefa.

O método runalg retorna um dicionário com os nomes de saída (os que são exibidos na descrição do algoritmo) como chaves ou caminhos de arquivo dessas saídas como valores. Pode carregar essas camadas passando o seu caminho de arquivo correspondente pelo método load().

17.5.2 Funções adicionais para a manipulação dos dados

Além das funções usadas para chamar os algoritmos, importar o pacote processamento irá também importar algumas funções adicionais que facilitará o trabalho dos dados, particularmente os dados vetoriais. São funções de conveniência que envolvem alguma funcionalidade a partir da API do QGIS, usualmente com uma sintaxe menos complexa. Estas funções devem ser usadas quando são programados novos algoritmos, para tornar mais fácil a operação com o os dados de entrada.

Abaixo está uma lista de algum dos comandos. Mais informação podem ser encontradas nas classes sob o pacote processing/tools e também nos exemplos de script fornecidos no QGIS.

• getObject(obj): Retorna um objeto QGIS (a camada ou tabela) do objeto passado, o que pode ser um nome ou o nome do objeto no Índice QGIS.

• values(layer,fields): Retorna os valores da tabela de atributos de uma camada vetorial para os campos validados. Os campos podem ser validados como nomes de campos ou índices de campo iniciados em zero. Retorna um dicionário de listas com campos de identificadores validados como chaves. Considera a seleção existente.

• features(layer): Retorna um iterador sobre as feições de uma camada vetorial, considerando a seleção existente.

• UniqueValues (layer, field): Retorna uma lista de valores exclusivos para um determinado atributo. Os atributos podem ser passado como um nome de campo ou um índice de campo baseado em zero. Ele considera a seleção existente.

17.5.3 Criando scripts e correndo-os a partir da caixa de ferramentas

Pode criar os seus próprios algoritmos através da escrita do código Python correspondente e adicionar algumas linhas extras para fornecer informação adicional necessária para definir as semânticas do algoritmo. Pode encontrar um Criar novo script menu sob o :guilabel: Tools no grupo Script bloco de algoritmos da caixa de ferramentas.

Faça duplo clique nele e irá abrir um diálogo de edição do script. É onde deverá digitar o código. Guarde o script na pasta scripts (a pasta padrão quando abre o diálogo de guardar ficheiro), com a extensão .py, irá automaticamente criar o algoritmo correspondente.

O nome do algoritmo (aquele que irá ver na caixa de ferramentas) é criado a partir do nome do arquivo, removendo a extensão e substituindo os hífens inferiores com espaços em branco.

Vamos ter o seguinte código, que calcula o Índice Topográfico de Umidade (ITW) diretamente do MDE.

214 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

##dem=raster

##twi=output ret_slope = processing.runalg("saga:slopeaspectcurvature", dem, 0, None,

None, None, None, None) ret_area = processing.runalg("saga:catchmentarea(mass-fluxmethod)", dem,

0, False, False, False, False, None, None, None, None, None) processing.runalg("saga:topographicwetnessindex(twi), ret_slope[’SLOPE’], ret_area[’AREA’], None, 1, 0, twi)

Como pode ver, o cálculo envolve 3 algoritmos, todos eles provêem do SAGA. O último deles calcula o ITW, mas necessita da camada de dados do declive e outra de acumulação de escoamento. Nós não temos estas camadas, mas uma vez que temos o MDE, podemos calculá-los chamando os algoritmos SAGA correspondentes.

A parte do código onde este processamento tem lugar não é difícil de perceber se leu-o as seções anteriores deste capítulo. Contudo, as primeiras linhas, necessitam de uma explicação adicional. Eles fornecem a informação que

é necessária para tornar o código num algoritmo que possa ser corrido a partir qualquer componente do GUI, como por exemplo a caixa de ferramentas ou o modelador gráfico.

Estas linhas começam com o símbolo de duplo comentário Python (##) e tem a seguinte estrutura:

[parameter_name] = [parameter_type] [optional_values]

Aqui está uma lista de todos os tipos de parâmetros que são suportados nos scripts de processamento, sua sintaxe e alguns exemplos.

• raster. Uma camada raster.

• vector. Uma camada vetorial.

• table. Uma tabela.

• number. Um valor numérico. Um valor padrão deve ser fornecido. Por exemplo, depth=number 2.4

• string. Um campo de texto. Como no caso de valores numéricos, um valor por padrão deve ser adicionado. Por exemplo, name=string Victor

• boolean. Um valor booleano. Adicione True ou False depois de definir o valor padrão. Por exemplo, verbose=boolean True

• múltiplos raster. Um conjunto de camadas rasters de entrada.

• vetores múltiplos. Um conjunto de camadas vetoriais de entrada.

• campo. Um campo da tabela de atributos de uma camada vetorial. O nome da camada tem de ser adicionada depois da etiqueta campo. Por exemplo, se declarou um arquivo de entrada vetorial com mylayer=vector

, poderá usar myfield=field mylayer para adicionar o campo a partir dessa camada como parâmetro.

• folder‘. Uma pasta.

• file‘. Nome do arquivo

O nome do parâmetro é o nome que será exibido ao utilizado quando executa o algoritmo, e também o nome da variável a usar no código do script. O valor introduzido pelo usuário para esse parâmetro será atribuído à variável com esse nome.

Quando é exibido o nome do parâmetro ao usuário, o nome irá ser editado para melhorar a aparência, substituindo o hífen inferior com espaços. Portanto, por exemplo, se quer que o usuário veja o parâmetro chamado Um valor numérico

, pode usar o nome da variável A_numerical_value.

Os valores das camadas e tabelas são cadeias de texto que contêm caminhos de arquivos para o objeto correspondente. Para transformá-los em objetos|qg|, pode usar a função processing.getObjectFromUri(). Os múltiplos dados de entrada também têm um valor de cadeia de texto, que contêm caminhos de arquivos para todos os objetos selecionados, separados por ponto e vírgulas (;).

Os arquivos de saída são definidos numa maneira semelhante, usando as seguintes etiquetas:

• raster de saída

17.5. Usando os algoritmos do processamento a partir do Terminal Python.

215

QGIS User Guide, Versão 2.6

• vetor de saída

• tabela de saída

• html de saída

• arquivo de saída

• número de saída

• cadeia de texto de saída

O valor atribuído às variáveis de saída sempre são conjuntos de caracteres que representam o caminho dos arquivos. Corresponderá a um caminho de arquivos temporários, caso o usuário não inserir um nome de arquivo de saída.

Quando declara um arquivo de saída, o algoritmo irá tentar adicioná-lo no QGIS uma vez finalizado. É por isso que, embora o método runalg() não carrega camadas quando as produz, a camada TWI final será carregada ( usando o caso do nosso exemplo anterior) uma vez que é salvo no arquivo digitado pelo usuário, que é o valor do arquivo de saída correspondente.

Não use a o método load() nos algoritmos, mas apenas quando se trabalha com a linha do terminal. Se a camada é criada como saída de um algoritmo, deve ser declarado como tal. Caso contrário, você não será capaz de usar adequadamente o algoritmo no modelador, desde sua sintaxe (como definido pelas tags, explicado acima) não coincidirá com o que o algoritmo realmente produz.

Saídas ocultas (números e textos) não têm um valor. Em vez disso, o usuário tem que atribuir um valor a eles.

Para isso, basta definir o valor de uma variável com um nome para declarar a saída. Por exemplo, se você usou esta declaração,

##average=output number a linha seguinte irá configurar o valor de saída para 5: average = 5

Em adição às etiquetas para os parâmetros e arquivos de saída, pode também definir o grupo onde o algoritmo será exibido, usando a etiqueta group.

Se o algoritmo leva um longo tempo para processar, é uma boa ideia informar ao usuário. Você tem uma chamada global progress disponível, com dois métodos: setText(text) e ‘‘ setPercentage(percent)‘ para modificar o texto de progresso e a barra de progresso.

Vários exemplos são apresentados. Por favor, verifique-os para ver exemplos reais de como criar algoritmos usando as classes do quadro de processamento. Pode clicar com o botão direito do mouse em qualquer script do algoritmo e selecionar Editar script para editar o seu código ou apenas para vê-lo.

17.5.4 Documentando os seus scripts

Como no caso dos modelos, você pode criar documentação adicional para o seu script, para explicar o que fazem e como são usados. No diálogo de edição do script irá encontrar um botão [Editar ajuda do script]. Clique nele e irá levá-lo para o diálogo de edição da ajuda. Verifique o capítulo sobre o modelador gráfico para saber mais sobre este diálogo e como usá-lo.

Os arquivos de ajuda são salvos na mesma pasta como o próprio script, adicionando a extensão .help ao nome do ficheiro. Note que, você pode editar a ajuda do seu script antes de guardá-lo pela primeira vez. Se fechar mais tarde o diálogo de ajuda do script sem salvar o script (ex.: descartá-lo) o conteúdo da ajuda que escreveu será perdido. Se o seu script já estiver salvo e associado ao nome do arquvio, o conteúdo de ajuda será salvo automaticamente.

17.5.5 Pré- e pós-execução de encaixe da script

Os scripts podem também ser usados para definir um encaixe de pré- e pós-execução que correm antes e depois do algoritmo correr. Isto pode ser usado para automatizar tarefas que serão executados quando qualquer algoritmo é

216 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

executado.

A sintaxe é identica à sintaxe explicada em cima, mas uma variável global alg está disponível, representando o algoritmo que foi (ou está prestes a ser) executado.

.

No grupo General do diálogo de configuração do processamento irá encontrar duas entradas denominados de Préexecução do arquivo script e Post-execution script filet onde os nomes do arquivo dos scripts a serem executados em cada caso podem ser inseridos.

17.6 Gerenciador do histórico

17.6.1 O histórico do processamento

Cada vez que executa um algoritmo, a informação do processo é armazenado no gerenciador do histórico. Juntamente com os parâmetros usados, a data e o tempo de execução são também salvos.

Dessa forma, é fácil rastrear e controlar todo o trabalho que tem sido desenvolvido utilizando a estrutura de processamento e facilmente reproduzi-lo.

O gerenciador do histórico é um conjunto de entradas de registro agrupados de acordo com sua data de execução, tornando-o mais fácil de encontrar informações sobre um algoritmo executado a qualquer momento particular.

Figura 17.28: Histórico

A informação do processo é mantida como uma expressão de linha de comandos, mesmo se o algoritmo seja lançado a partir da barra de ferramentas. Isto permite ser útil para aqueles que querem aprender como se usa a interface da linha de comandos, uma vez que podem chamar o algorítimo usando a barra de ferramentas e verificar o gerenciador do histórico para ver como o mesmo algorítimo pode ser chamado a partir da linha de comandos.

Além de navegar nas entradas no registro, você também pode re-executar os processos, basta um duplo clique sobre a entrada correspondente.

17.6. Gerenciador do histórico 217

QGIS User Guide, Versão 2.6

Junto com a execuções do algoritmo de gravação, a estrutura de processamento se comunica com o usuário por meio de outros grupos de registro, a saber Erros, Advertências e Informações. No caso de algo não está funcionando corretamente, olhando para o Erros poderá ajudá-lo a ver o que está acontecendo. Se você entrar em contato com um desenvolvedor para relatar um bug ou erro, a informação nesse grupo vai ser muito útil para ele ou para ele descobrir o que está acontecendo de errado.

Os algoritmos de terceiros normalmente são executados chamando suas interfaces de linha de comando, que se comunicam com o usuário através do terminal. Embora o terminal não seja mostrado, um despejo completo do que é armazenado no grupo Informações cada vez que você executar um desses algoritmos. Se, por exemplo, você está tendo problemas executando um algoritmo SAGA, procure uma entrada chamada ‘execução do SAGA no terminal de saída’ para verificar todas as mensagens geradas pelo SAGA e tentar descobrir onde está o problema.

Alguns algoritmos, mesmo se eles produzirem um resultado com os dados de entrada fornecidos, pode adicionar comentários ou informações adicionais ao bloco Atenção se detectar possíveis problemas com os dados, a fim de avisá-lo. Certifique-se de verificar essas mensagens se você está tendo resultados inesperados.

17.7 Escrevendo novos algoritmos de processamento com scripts python

Você pode criar seus próprios algoritmos escrevendo com o código Python correspondente e adicionando algumas linhas extras para fornecer informações adicionais necessárias para definir a semântica do algoritmo. Você pode encontrar um menu Criar um novo script no grupo Ferramentas no bloco algoritmo Script da caixa de ferramentas.

Dê um duplo clique sobre ele para abrir o diálogo edição script. É onde você deve digitar seu código. Salvando o script na pasta:‘ scripts‘ (o padrão quando você abrir o diálogo de salvar o arquivo), com: file:‘ extensão .py‘, criará automaticamente o algoritmo correspondente.

O nome do algoritmo (o que você vai ver na caixa de ferramentas) é criado a partir do nome do arquivo, removendo a sua extensão e substituindo baixos hífens com espaços em branco.

Vamos ter o seguinte código, que calcula o índice de vertente topográfica (TWI) diretamente de um MDE

##dem=raster

##twi=output raster ret_slope = processing.runalg("saga:slopeaspectcurvature", dem, 0, None,

None, None, None, None) ret_area = processing.runalg("saga:catchmentarea", dem,

0, False, False, False, False, None, None, None, None, None) processing.runalg("saga:topographicwetnessindextwi, ret_slope[’SLOPE’], ret_area[’AREA’], None, 1, 0, twi)

Como você pode ver, envolve 3 algoritmos, todos eles provenientes da SAGA. O último deles calcula o TWI, mas precisa de uma camada de inclinação e uma camada de acumulação de fluxo. Não temos estas, mas uma vez que temos o MDE, podemos calculá-los chamando os algoritmos SAGA correspondentes.

A parte do código onde esta transformação substitui não é difícil de entender se você já leu o capítulo anterior.

As primeiras linhas, no entanto, precisam de alguma explicação adicional. Eles fornecem a informação que é necessário para transformar o seu código em um algoritmo que pode ser executado a partir de qualquer um dos componentes da GUI, como a caixa de ferramentas ou o modelador gráfico.

Estas linhas de começo com um comentário símbolo duplo Python (##) e tem a seguinte estrutura

[parameter_name] = [parameter_type] [optional_values]

Aqui está uma lista de todos os tipos de parâmetros que são suportadas no processamento de scripts, sua sintaxe e alguns exemplos.

• raster. Uma camada raster

• vetor. Uma camada vetor

• tabela. Uma tabela

218 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

• número.

Um valor numérico.

profundidade=número 2.4

Um valor padrão deve ser fornecido.

Por exemplo,

• string. Uma cadeia de texto. Como no caso de valores numéricos, um valor padrão deve ser adicionado.

Por exemplo, nome=texto Vitor

• longstring. Igual um texto, mas uma caixa de texto maior será mostrado, por isso, é mais adequado para textos longos, como para um script esperam um trecho de código pequeno.

• ‘‘ booleano‘‘. Um valor booleano. Adicionar Verdadeiro ou ‘‘ Falso‘‘ depois dele, para definir o valor padrão. Por exemplo, verbose=booleano Verdadeiro.

• raster multiplo. Um conjunto de camadas raster de entrada.

• vetor multiplo. Um conjunto de camadas vetor de entrada.

• Campo.

Um campo na tabela de atributos de uma camada de vetor.

O nome da camada tem que ser adicionado após a tag Campo.

Por exemplo, se você declarou um vetor de entrada com minhacamada=vetor

, você poderia usar o minhacamada=campo minhacamada para adicionar um campo a partir dessa camada como parâmetro.

• pasta. Um pasta

• arquivo. Um arquivo

• src. Um Sistema de Referência de Coordenada

O nome do parâmetro é o nome que será mostrado para o usuário durante a execução do algoritmo, e também o nome da variável a ser usado no código de script. O valor digitado pelo usuário para esse parâmetro será atribuído a uma variável com esse nome.

Ao mostrar o nome do parâmetro para o nome, o usuário irá editado-lo para melhorar a sua aparência, substituindo hífens baixos com espaços. Assim, por exemplo, se você quiser que o usuário veja um parâmetro denominado Um valor numérico

, você pode usar o nome da variável A_numerical_value.

Valores de tabelas e camadas são sequências contendo o caminho de arquivo do objeto correspondente. Para transformá-los em um objeto do QGIS, você pode usar a função processing.getObjectFromUri().

Várias entradas também têm um valor de texto, que contém os caminhos de arquivos para todos os objetos selecionados, separados por ponto e vírgula (;).

Saídas são definidas de forma semelhante, usando as seguintes etiquetas:

• raster de saída

• vetor de saída

• tabela de saída

• html de saída

• arquivo de saída

• número de saída

• texto de saída

• extensão de saída

O valor atribuído às variáveis de saída é sempre um texto com um caminho de arquivo. Ele vai corresponder a um caminho de arquivo temporário, caso o usuário não informe qualquer arquivo de saída.

Além das marcas para os parâmetros e saídas, você também pode definir o grupo em que o algoritmo será mostrado, usando a etiqueta groupo.

A última marca que você pode usar em seu cabeçalho roteiro é ##nomodeler. Use isso quando você não quer que seu algoritmo seja mostrado na janela de modelador. Isto deve ser utilizado para algoritmos que não têm uma sintaxe clara (por exemplo, se o número de camadas a serem criadas não é conhecido antecipadamente, a tempo de desenho), o que os torna inadequados para a modelagem gráfica

17.7. Escrevendo novos algoritmos de processamento com scripts python 219

QGIS User Guide, Versão 2.6

17.8 Entregando os dados produzidos pelo algoritmo

Quando você declara uma saída que representa uma camada (raster, vetor ou tabela), o algoritmo irá tentar adicioná-la ao QGIS uma vez que ela for concluída. Essa é a razão pela qual, apesar de o método runalg() não carregar as camadas que produz, a camada final TWI será carregada, uma vez que será salva no arquivo digitado pelo usuário, que é o valor da saída correspondente.

Não use o método load() em seus algoritmos de script, mas apenas quando se trabalha com a linha de console.

Se uma camada é criada como saída de um algoritmo, que deve ser declarada como tal. Caso contrário, você não será capaz de usar corretamente o algoritmo no modelador, desde a sua sintaxe (como definido pelas etiquetas explicadas acima) não coincidir com o que o algoritmo realmente cria.

Saídas ocultas (números e textos) não tem um valor. Em vez disso, é você quem tem que atribuir um valor a elas.

Para isso, basta definir o valor de uma variável com o nome usado para declarar que a saída. Por exemplo, se você usou esta declaração,

##average=output number a seguinte linha foi definido o valor de saída para 5: average = 5

17.9 Comunicação com o usuário

Se o algoritmo leva um longo tempo para processar, é uma boa idéia informar ao usuário. Você tem um chamado progresso global disponível, com dois métodos disponíveis: setText(texto) e setPercentage(por cento) para modificar o progresso do texto e a barra de progresso.

Se você tiver que fornecer algumas informações para o usuário, não relacionada com a evolução do algoritmo, você pode usar o método SetInfo (texto), também o progresso do objeto.

Se o seu script tiver algum problema, a maneira correta de propagação é para levantar uma exceção do tipo

GeoAlgorithmExecutionException() . Você pode passar uma mensagem como argumento para o construtor da exceção. Processing vai cuidar de manuseá-lo e se comunicar com o usuário, dependendo de onde o algoritmo estiver sendo executado a partir da (caixa de ferramentas, modelador, console do Python ...)

17.10 Documentando seus scripts

Como no caso dos modelos, você pode criar a documentação adicional para o seu roteiro, para explicar o que eles fazem e como usá-los. Na caixa de diálogo de edição de script que você vai encontrar o botão [Editar roteiro ajuda]. Clique nele e ele irá levá-lo para o diálogo ajuda a edição. Confira o capítulo sobre o modelador gráfico para saber mais sobre este diálogo e como usá-lo.

Arquivos de ajuda são salvos na mesma pasta que o próprio script, acrescentando a extensão .help ao nome do arquivo. Observe que você pode editar a ajuda de seu script antes de salvá-la pela primeira vez. Se mais tarde você fechar o script de diálogo edição sem salvar o script (ou seja, você descartá-lo), o conteúdo da ajuda que você escreveu sera perdidos. Se o seu roteiro já foi salvo e está associado a um nome de arquivo, a gravação será feita automaticamente.

17.11 Exemplos de scripts

Vários exemplos estão disponíveis na coleção on-line de scripts, que podem ser acessados selecionando o script

Adquirir script da coleção on-line a ferramenta sob o Scripts/ferramentas entrada na caixa de ferramentas.

220 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Por favor, verifique-os para ver exemplos reais de como criar algoritmos usando as classes de estrutura de processamento. Você pode clicar o botão direito do mouse em qualquer algoritmo de roteiro e escolha: guilabel: Editar script para editar o seu código ou apenas para vê-lo.

17.12 Melhores práticas para algoritmos de script escrito

Aqui está um rápido resumo das idéias a serem consideradas ao criar seus algoritmos de script e, essecialmente, se você quer compartilhar com outros usuários do QGIS. Seguindo estas regras simples irá assegurar a coerência entre os diferentes elementos de processamento, tais como a caixa de ferramentas, o modelador ou a interface de processamento em lote.

• Não coloque resultados das camadas. Vamos trabalhar o Processamento com seus resultados e carregar suas camadas se necessárias.

• Sempre declare as saídas de seu algoritmo criadas. Evite coisas como decalring uma saída e, em seguida, usando o nome do arquivo de destino definido para que a saída para criar uma coleção deles. Isso vai quebrar a semântica correta do algoritmo e tornar impossível usá-lo com segurança no modelador. Se você tem que escrever um algoritmo assim, certifique-se de adicionar a etiqueta ##nomodeler.

• Não mostrar caixas de mensagens ou usar qualquer elemento GUI do script.

Se você quer se comunicar com o usuário, use o método

SetInfo()‘‘ou lançar uma

‘‘GeoAlgorithmExecutionException

• Como regra geral, não se esqueça que o seu agoritmo pode ser executado em um contexto que não seja a caixa de ferramentas de processamento.

17.13 Pré e pós-execução de ganchos de script

Os scripts também pode serem usados para definir ganchos pré e pós-execução que são executados antes e depois que algoritmo seja executado. Esta pode ser usada para automatizar as tarefas que devem ser executadas sempre que um algoritmo é executado.

A sintaxe é idêntica à sintaxe explicada acima, mas uma variável global adicional chamado alg está disponível, que representa o algoritmo que acaba de ser (ou está prestes a ser) executado.

.

No grupo Geral da janela de configuração de processamento, você vai encontrar duas entradas com o nome

Arquivo de script de pré-execução e Arquivo de script de pós-execução onde o nome do arquivo dos scripts a serem executado em cada caso, podem ser inseridos.

17.14 Configurando as aplicações externas

The processing framework can be extended using additional applications. Currently, SAGA, GRASS, OTB (Orfeo

Toolbox) and R are supported, along with some other command-line applications that provide spatial data analysis functionalities. Algorithms relying on an external application are managed by their own algorithm provider.

Este capítulo irá mostrar como configurar a infraestrutura do processamento para incluir estas aplicações adicionais, e irá explicar algumas características particulares baseado nos algoritmos. Uma vez feita a correta con-

17.12. Melhores práticas para algoritmos de script escrito 221

QGIS User Guide, Versão 2.6

figuração do sistema, terá possibilidade de executar algoritmos externos a partir de qualquer componente como a caixa de ferramentas ou o modelador gráfico, assim como faz para outro geoalgoritmo.

Por padrão, todos os algoritmos que dependem de um aplicativo externo, ou seja, que não são disponibilizado com o QGIS não estão habilitados no programa. Você pode habilitá-los na janela de configurações do SEXTANTE.

Antes de ativá-los, certifique-se de que o aplicativo correspondente já está instalado em seu sistema. A habilitação de um provedor de algoritmos sem ter o programa correspondente instalado no sistema permitirá que os algoritmos apareçam na caixa de ferramentas, mas um erro será exibido quando você tentar executá-los.

Isto porque os procedimentos característicos dos algoritmos (necessário para criar a janela de diálogo de parâmetros e dar as informações necessárias sobre o algoritmo) estão incluídos em cada aplicativo. Isto é, eles fazem parte do QGIS, então você os têm em sua instalação, mesmo que você não tenha instalado outro software qualquer.

Entretanto, a execução do algoritmo, precisa dos códigos binários do software externo para ser instalado em seu sistema.

17.14.1 Uma nota para usuários Windows

Se você não for um usuário avançado e você estiver executando QGIS no Windows, você pode não estar interessado em ler o resto deste capítulo. Certifique-se de instalar QGIS em seu sistema usando o instalador independente.

Isso irá instalar automaticamente SAGA, GRASS e OTB em seu sistema e configurá-los para que eles possam ser executados a partir QGIS. Todos os algoritmos da visão simplificada da caixa de ferramentas estarão prontos para serem executados sem a necessidade de qualquer configuração adicional. Se estiver instalando através da aplicação OSGeo4W, certifique-se que você selecionou SAGA para instalação e também o OTB.

Se desejar saber mais sobre como os fornecedores trabalham, ou deseja usar alguns algoritmos que não estão incluídos na caixa de ferramentas simplificada (como por exemplo os scripts R), continue a leitura.

17.14.2 Uma nota para os formatos dos arquivos

Ao usar um software externo, abrindo um arquivo no QGIS não significa que ele se comportará assim como no outro software. Na maioria dos casos, ele pode ler o que você abriu no QGIS, mas em alguns caos, isso pode dar incompatibilidade de tipo de arquivo. Ao usar bancos de dados ou formatos de arquivos incomuns, seja para camadas raster ou vetoriais, alguns problemas podem surgir. Se isso acontecer, tente usar formatos de arquivos conhecidos, que você tem certeza de que são aceitos por ambos os programas, e verifique a saída do console (na na janela de histórico de registros) para saber mais sobre o que está acontecendo de errado.

Usando as camadas raster GRASS, por exemplo, um dos casos em que pode ter problema e não seja possível completar o seu trabalho é se chamar um algoritmo externo usando uma camada como arquivo de entrada. Por esta razão, essas camadas não irão aparecer como disponíveis para os algoritmos.

Você deve, no entanto, não encontrar problemas sobretudo com camadas vetoriais, pois o qg| converte automaticamente do formato de arquivo original para ser aceito pelo aplicativo externo antes de passar a camada para ele.

Isso adiciona um tempo de processamento extra, que pode ser significativo se a camada tem um tamanho grande, por isso não se surpreenda se for preciso mais tempo para processar uma camada em uma conexão com banco de dados do que uma camada de tamanho similar armazenada num shapefile.

Provedores que não usa aplicações externas podem processar qualquer camada aberta no QGIS.

Quanto aos formatos de saída, todos os formatos suportados pelo QGIS pode ser usado, tanto para camadas raster e vetores. Alguns provedores não suportam determinados formatos, mas todos podem exportar para formatos camada raster em comuns que podem mais tarde ser transformados poelo | qg | automaticamente. Como no caso de camadas de entrada, se for necessária a conversão, pode aumentar o tempo de processamento

Se a extensão do nome de arquivo especificado ao chamar um algoritmo não coincide com a extensão de qualquer um dos formatos suportados pelo | qg

|

, então o sufixo será adicionado para definir um formato padrão. No caso de camadas raster, a: file:. Extensão .tif ‘é usado, enquanto que: file:.‘.sh‘ é usado para camadas vetoriais.

222 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

17.14.3 Uma nota para as seleções da camada vetorial

Aplicações externas podem também estar cientes das seleções que existem em camadas vetoriais dentro do | qg | .

No entanto, isso requer reescrever todas as camadas de entrada de vetores, como se fossem originalmente em um formato não suportado pelo aplicativo externo. Somente quando não houver seleção, ou o Use somente recursos selecionados a opção não está habilitado na configuração geral processamento, pode ser uma camada diretamente passada para um aplicativo externo.

Noutros casos, exportando apenas os elementos seleccionados é necessário, o que em alguns casos os tempos de execução serão mais longos.

SAGA

Algoritmos SAGA pode ser executado a partir de | qg | se você tiver SAGA instalado em seu sistema e configurar a estrutura de processamento adequada para que ele possa encontrar seus executáveis . Em particular, o executável de linha de comando SAGA é necessário para executar seus algoritmos.

Caso esteja utilizando o sistema Windows, os instaladores stand-alone ou o instalador OSGeo4W, ambos instalam o SAGA juntamente com o QGIS, e o caminho é automaticamente configurado, portanto não é necessário fazer mais nada.

Se você instalou o SAGA (lembre-se, você precisará da versão 2.1), o caminho para o executável SAGA deve ser configurado. Para fazer isso, abra a janela de configuração. No: guilabel: ‘‘ SAGA‘ block, você vai encontrar um ambiente com o nome: guilabel: SAGA Folder.. Digite o caminho para a pasta onde está instalado SAGA. Feche a janela de configuração, e agora você está pronto para executar algoritmos de SAGA a partir do QGIS.

Se estiver utilizado o linux, os binários SAGA não estão incluídos no SEXTANTE, portanto precisa baixar e instalar o software. Por favor verifique o sítio na internet do SAGA para maisinformações. É necessário o SAGA

2.1.

Neste caso não necessita de configurar o caminho para o executável SAGA, e não irá ver aquelas pastas. Em vez disso, deve garantir que o SAGA está instalado corretamente e a sua pasta adicionada à variável de ambiente

PATH. Apenas abra o console e digite saga_cmd para verificar se o sistema encontra onde os binários SAGA estão localizados.

17.14.4 Sobre as limitações do sistema de grid do SAGA

A maior parte dos algoritmos SAGA que requerem várias camadas raster de entrada, exigem que elas tenham o mesmo sistema de projeção. Ou seja, para cobrir a mesma área geográfica e tenham uma mesma resolução espacial . Ao chamar algoritmos SAGA do QGIS, você pode usar qualquer camada, independentemente da sua resolução espacial e extensão, de forma individual. Quando múltiplas camadas raster são utilizados como entrada para um algoritmo SAGA, o QGIS irá adaptá-los a um sistema de coordenadas comum e, em seguida, transportará ao SAGA (ao menos que o algoritmo SAGA não possa operar com camadas de diferentes sistemas de projeção).

A definição do sistema de projeção comum é controlado pelo usuário, você vai encontrar vários parâmetros no grupo SAGA da janela de configuração para definí-lo. Existem duas maneiras de definir o sistema de projeção:

• Configure-o manualmente. Você define a extensão configurando os valores dos seguintes parâmetros:

– Reamostragem do X min

– Reamostragem do X máx

– Reamostragem do Y min

– Reamostragem do Y máx

– Reamostragem do tamanho da célula

Tenha em atenção que o QGIS irá reamostrar as camadas de entrada para essa extensão, mesmo que não se sobreponham.

17.14. Configurando as aplicações externas 223

QGIS User Guide, Versão 2.6

• Configurando automaticamente a partir das camadas de entrada. Para selecionar esta opção, verifique a opção:guilabel:Use min covering grid system for resampling. Todas as outras configurações irão ser ignoradas e a extensão mínima que cobre todas as camadas de entrada serão usadas. O tamanho de célula da camada de destino é o máximo de tamanho de célula de todas as camadas de entrada.

Para algoritmos que não usam camadas raster múltiplas, ou para aquelas que não necessitam de um único sistema de grid de entrada, não será feito uma reamostragem antes de chamar o SAGA, e esses parâmetros não serão usados.

17.14.5 Limitações para camadas multi-banda

Ao contrário do | qg | , o SAGA não tem suporte para multi-camadas da banda. Se você quiser usar uma camada multibanda (como um RGB ou imagem multiespectral), você primeiro tem que dividí-la em imagens individuais.

Para fazer isso, você pode usar o ‘SAGA/Grid - Tools/Split RGB image’ algoritmo (que cria três imagens de uma imagem RGB) ou o ‘SAGA/Grid - Tools/Extract band’ algoritmo (para extrair uma única faixa) .

17.14.6 Limitações na resolução espacial

O SAGA pressupõe que as camadas raster têm o mesmo tamanho de célula no eixo X e Y. Se estiver trabalhando com uma camada com diferentes valores para o tamanho de célula horizontal e vertical, deverá obter resultados inesperados. Nesse caso, um aviso será adicionado ao registo do processamento, indicando que a camada de entrada não se adapta de forma a ser processado pelo SAGA.

17.14.7 Registrando

Quando o QGIS chama o SAGA, ele faz isso usando a interface de linha de comando, passando assim um conjunto de comandos para executar toda a operação requerida. O SAGA mostra seu progresso, escrevendo informações para o console, que inclui a porcentagem de processamento já realizado, juntamente com o conteúdo adicional.

Esta saída é filtrada e usada para atualizar a barra de progresso durante a execução do algoritmo.

Ambos os comandos enviados pelo QGIS e as informações adicionais impressas pelo SAGA pode ser registrada juntamente com outras mensagens de registro de processamento, e você pode encontrá-los úteis para acompanhar em detalhes o que está acontecendo quando o | qg | executa um algoritmo SAGA. Você vai encontrar dois cenários, a saber: Log console output e Log execution commands, para ativar esse mecanismo de registro.

A maioria dos outros fornecedores que usam uma aplicação externa e chamam a partir da linha de comandos têm opções semelhantes, portanto irá encontrar noutros sítios da lista de configurações do processamento.

R. Creating R scripts

A integração da linguagem R com o QGIS é diferente do SAGA em que não há um conjunto de algoritmos predefinido que pode rodar (com exceção de alguns exemplos). Em vez disso, você deve escrever seus scripts e chamar os comandos R, e de uma forma muito semelhante ao que vimos no capítulo dedicado ao processamento de scripts. Este capítulo mostra a sintaxe para usar e para chamar os comandos de R no SEXTANTE além de como usar objetos SEXTANTE (camadas, tabelas) nestes scripts.

A primeira coisa que você tem que fazer, como vimos no caso da SAGA, é dizer ao QGIS onde seus binários

R estão localizados. Você pode fazer isso usando o:guilabel:R folder entrando na janela de configuração de processamento. Depois de definir esse parâmetro, você pode começar a criar e executar seus próprios scripts R.

Uma vez mais, isto é diferente no Linux, e só tem de ter certeza que a pasta do R está incluída na variável de ambiente PATH. Se conseguir iniciar o R, apenas introduza R na consola, e estará pronto a começar.

Para adicionar um novo algoritmo que usa uma função R (ou um script R mais complexo que você desenvolveu e que você gostaria de ter disponível a partir do QGIS), você tem que criar um arquivo de script que informa a estrutura de processamento e como proceder com essa operação e inserir os comandos correspondentes em R.

224 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

Os arquivos de script R têm a extensão .rsx e é fácil criá-los se tiver o conhecimento básico da sintaxe do R e do código R. Eles devem ficar armazenados na pasta scripts R. Pode definir esta pasta no grupo de configurações

R (disponível a partir do diálogo de configurações do processamento), como faz com a pasta para scripts normais do processamento.

Vamos dar uma olhada em um arquivo muito simples de script, que chama o método R spsample para criar uma rede aleatória dentro do limite dos polígonos em uma dada camada de polígono. Este método pertencem ao pacote maptools‘.

Uma vez que quase todos os algoritmos que você gostaria de incorporar ao |qg| vai usar ou gerar dados espaciais, conhecimento de pacotes espaciais como ‘‘maptools e, especialmente, sp, é obrigatório.

##polyg=vector

##numpoints=number 10

##output=output vector

##sp=group pts=spsample(polyg,numpoints,type="random") output=SpatialPointsDataFrame(pts, as.data.frame(pts))

As primeiras linhas, que começam com um comentário sinal duplo Python (##), dizem entradas do algoritmo

QGIS descrito no arquivo e as saídas que irá gerar. Eles trabalham com exatamente a mesma sintaxe que os scripts de Sextante que já vimos, para que eles não sejam descritos aqui novamente.

Quando você declara um parâmetro de entrada, o QGIS usa essa informação para duas coisas: criar a interface do usuário para pedi-lo o valor desse parâmetro e criando uma variável de R correspondente, que pode mais tarde ser usado como entrada para os comandos R.

No exemplo acima, estamos declarando uma entrada do tipo vetorial chamado polyg. Ao executar o algoritmo, o QGIS vai abrir em R a camada selecionada pelo usuário e armazená-lá em uma variável também chamado polyg

. Assim, o nome de um parâmetro também é o nome da variável que pode usar em R para concordar com o valor daquele parâmetro (portanto, você deve evitar o uso de palavras reservadas ao R como nomes de parâmetro).

Elementos espaciais como camadas vetoriais e raster são lidos usando os comandos readOGR () ‘‘ e

‘‘brick()

(você não tem que se preocupar com a adição desses comandos para o seu arquivo de descrição pois o QGIS fará) , e eles são armazenados como objetos Spatial*DataFrame . Campos da tabela são armazenados como strings contendo o nome do campo selecionado.

Tabelas são abertas usando o comando read.csv(). Se uma tabela inserida pelo usuário não está no formato

CSV, será convertida antes de importá-la para R.

Adicionalmente, os arquivos raster pode ser lidos usando o comando readGDAL() em vez de brick(), usando o ##usereadgdal.

Se você é um usuário avançado e não quer o | qg | para criar o objeto que representa a camada, você pode usar o ‘‘

# # passfilename ‘‘ tag para indicar que você prefere um texto com o nome do arquivo em seu lugar. Neste caso, cabe a você abrir o arquivo antes de realizar qualquer operação com os dados que ele contém.

Com a informação em cima, podemos agora perceber a primeira linha do nosso primeiro script exemplo (a primeira linha que não começa com o comentário Python).

pts = spsample(polyg,numpoints, type = "random" )

A variável polygon já contém o objecto SpatialPolygonsDataFrame, portanto pode ser usado para chamar o método spsample, tal como o numpoints, que indica o número de pontos a ser adicionados ao grid de amostra criada.

Desde que declarado uma saída do tipo vetor chamado out, temos que criar uma variável chamada out e armazenar um ‘ Spatial*DataFrame objeto nele (neste caso, um SpatialPointsDataFrame). Você pode usar qualquer nome para as variáveis intermediárias. Apenas certifique-se de que a variável que armazena o resultado final tem o mesmo nome que você usou para declará-la, e que contém um valor adequado.

Neste caso, o resultado obtido a partir do método ‘spsample tem que ser convertido diretamente no SpatialPointsDataFrame"objeto, uma vez que é por si só um objeto de classe ‘‘ppp

, o que não é uma classe adequada para ser devolvida ao | qg | .

17.14. Configurando as aplicações externas 225

QGIS User Guide, Versão 2.6

Se o seu algoritmo gera camadas raster, a maneira como eles são salvos vai depender se você tem usado ou não usou a opção ‘‘ #dontuserasterpackag .

O que você tem usado, as camadas são salvas usando o método ‘‘ writeGDAL () ‘‘.

Se não, o ‘‘ writeRaster () ‘‘ método do pacote de ‘‘raster será usado.

Se usou a opção #passfilename, os arquivos de saída são gerados usando o pacote raster (com writeRaster()

), mesmo que não seja usado nos arquivos de entrada.

Se o seu algoritmo não gera qualquer camada, mas sim um resultado de texto no console em vez disso, você tem que indicar que deseja que o console seja exibido uma vez que a execução seja concluída. Para isso, basta começar as linhas de comando que produzem os resultados que você deseja imprimir com a > (‘greater’) sign. A saída de todas as outras linhas não serão mostradas. Por exemplo, aqui está o arquivo de descrição de um algoritmo que realiza um teste de normalidade em um determinado campo (coluna) dos atributos de uma camada vetorial:

##layer=vector

##field=field layer

##nortest=group library(nortest)

>lillie.test(layer[[field]])

A saída da última linha é impressa, mas a saída da primeira não é (e nem são as saídas de outras linhas de comando adicionadas automaticamente pelo QGIS).

Se o seu algoritmo criar qualquer tipo de gráficos (usando o método ‘‘ plot()), adicione a seguinte linha:

##showplots

Isto fará com que o QGIS redirecione todas as saídas gráficas R para um ficheiro temporário, que poderá ser mais tarde aberta quando a execução do R é finalizada.

Tanto os gráficos como os resultados do console serão exibidos no gestor de resultados do processamento.

Para mais informações, consulte os arquivos de script fornecidos com o SEXTANTE. A maioria deles são bastante simples e vai lhe ajudar muito a entender como criar as seus próprios scripts.

Nota:

Bibliotecas rgdal and maptools são carregados por padrão, então você não tem que adicionar os comandos correspondentes library() (você só tem que ter certeza de que esses dois pacotes são instalados no seu R distribuição). No entanto, outras bibliotecas adicionais que você pode precisar ter de ser explicitamente carregado. Basta adicionar os comandos necessários no início do seu script. Você também tem que ter certeza de que os pacotes correspondentes são instalados na distribuição usada por R QGIS. A estrutura de processamento não vai cuidar de qualquer instalação do pacote. Se você executar um script que requer um pacote que não está instalado a execução irá falhar e o SEXTANTE irá tentar detectar quais pacotes estão faltando. Você deve instalar as bibliotecas que faltam manualmente antes de executar o algoritmo.

GRASS

Configurar o GRASS não é muito diferente de configurar o SAGA. Primeiro, o caminho para a pasta GRASS tem de ser definida, mas apenas se estiver a correr o Windows. Adicionalmente, um interpretador shell, (normalmente o msys.exe, que pode ser encontrado na maioria das distribuições do GRASS para o Windows) tem de ser definido e o seu caminho configurado.

Por padrão, a estrutura de processamento tenta configurar seu conector GRASS para usar a distribuição que conecta junto com o | qg | . Isso deve funcionar sem problemas na maioria dos sistemas, mas se você tiver problemas, você pode ter que configurar o conector GRASS manualmente. Além disso, se você quiser usar uma instalação GRASS diferente, você pode alterar essa configuração e aponte para a pasta onde a outra versão está instalada. GRASS 6.4 é necessário para os algoritmos funcionarem corretamente.

Se está a trabalhar em Linux, só necessita de ter a certeza que o GRASS está corretamente instalado, e pode ser executado sem problema a partir do console.

Algoritmos GRASS usar uma região para os cálculos. Esta região pode ser definida manualmente usando valores semelhantes aos encontrados na configuração saga, ou automaticamente, tendo a extensão mínima que abrange

226 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

todas as camadas de entrada usadas para executar o algoritmo de cada vez. Se esta abordagem é o comportamento que você preferir, basta verificar o Use min covering region nos parâmetros de configuração GRASS.

O último parâmetro que tem que ser configurado está relacionada com o mapset. O mapset é necessário para executar o GRASS, e a estrutura de processamento cria um mapset temporário para cada execução. Você tem que informar ao sistema se os dados que você está trabalhando são geográficos (latitude/longitude) ou coordenadas projetadas.

GDAL

Não é necessário configurações adicionais para correr os algoritmos GDAL, uma vez que já está incorporado no

QGIS e os algoritmos podem inferir na sua configuração a partir dele.

Orfeo Toolbox

Algoritmos do Orfeo Toolbox (OTB) pode ser executado a partir de QGIS se este sistema estiver instalado em seu sistema e configurou QGIS corretamente, para que ele possa encontrar todos os arquivos necessários (ferramentas de linha de comando e bibliotecas).

Se estiver utilizado o Linux, os binários SAGA não estarão incluídos no QGIS, portanto precisa de transferir e instalar o software. Por favor verifique o sítio na internet do OTB para mais informação sendo necessário o SAGA

2.1.

Uma vez instalado o OTB, inicie o QGIS, abra a janela de configuração do processamento e configure o provedor de algoritmo OTB. No :guilabel:

Orfeo Toolbox (image analysis)‘bloco, você vai encontrar todas as definições relacionadas com a OTB. Em primeiro lugar, garanta que os algoritmos estão habilitados.

Em seguida, configure o caminho para a pasta onde estão as ferramentas da linha de comandos OTB e as bibliotecas estão instaladas:

• normalmente OTB applications folder encaminha para /usr/lib/otb/applications e OTB command line tools folder é /usr/bin

• | Se você usar o instalador OSGeo4W, instale o pacote otb-bin e entre

C:\OSGeo4W\apps\orfeotoolbox\applications como OTB applications folder e

‘C:\OSGeo4W\bin as OTB command line tools folder.

Estes valores devem ser configurados por padrão, mas se você tiver uma instalação OTB diferente, configure-os para os valores correspondentes no seu sistema.

TauDEM

Para usar este provedor necessita de instalar as ferramentas da linha de comandos do TauDEM.

17.14.8 Windows

Por favor visite o sítio na internet do TauDEM para as instruções de instalação e os binários dos sistemas para

32bit e 64bit precompilados. IMPORTANTE: necessita os executáveis do TauDEM 5.0.6. A versão 5.2 não é suportada atualmente.

17.14.9 Linux

Não existem pacotes para a distribuição Linux, então você deve compilar o TauDEM manualmente. Como o

TauDEM usa MPICH2, tem que instalá-lo primeiro usando algum gerenciador de pacotes de aplicativos. Como alternativa, o TauDEM trabalha bem com o Open MPI, assim é possível usá-lo no lugar do MPICH2.

Baixe o ‘código-fonte do TauDEM 5.0.6 ‘<http://hydrology.usu.edu/taudem/taudem5.0/TauDEM5PCsrc_506.zip>‘_ e extrai-a os arquivos numa pasta.

17.14. Configurando as aplicações externas 227

QGIS User Guide, Versão 2.6

Abra o arrquivo linearpart.h e depois a linha

#include "mpi.h" adicione uma nova linha com

#include <stdint.h> e irá obter

#include "mpi.h"

#include <stdint.h>

Salve as alterações e feche o arquivo.

Agora abra o arquivo tiffIO.h, encontre a linha #include

"stdint.h"e substitua as entre aspas (

“”) com ‘‘<>, para que possa obter

#include <stdint.h>

Salve as alterações e feche o arquivo. Crie um diretório de compilação e cd para ele mkdir build cd build

Configure a sua compilação com o comando

CXX=mpicxx cmake -DCMAKE_INSTALL_PREFIX=/usr/local ..

.

e de seguida compile make

Finalmente, instale o TauDEM em /usr/local/bin e execute sudo make install

17.15 O QGIS Comando

A transformação inclui uma ferramenta prática que permite a execução de algoritmos sem ter que usar a caixa de ferramentas, mas apenas digitando o nome do algoritmo que você deseja executar.

Esta ferramenta é conhecida como o comando QGIS, e é apenas uma caixa de texto simples para autocompletar onde você digita o comando que você deseja executar.

Figura 17.29: O QGIS Comando

O Comando é iniciado a partir do menu Análise ou, da forma mais prática, pressionando Shift + Ctrl + M

(você pode mudar esse atalho de teclado padrão nas configurações QGIS, se você preferir um diferente). Para além da execução de algoritmos de processamento, o Comando lhe dá acesso a maioria das funcionalidades no

228 Capítulo 17. QGIS estrutura de processamento

QGIS User Guide, Versão 2.6

QGIS, o que significa que ele dá-lhe uma maneira prática e eficiente de executar tarefas QGIS e permite que você controle QGIS com uso reduzido de botões e menus.

Além disso, o comando é configurável, assim você pode adicionar seus comandos personalizados e tê-los apenas a algumas teclas de distância, tornando-se uma ferramenta poderosa para ajudá-lo a se tornar mais produtivo no seu trabalho diário com QGIS.

17.15.1 Comandos disponíveis

Os comandos disponíveis no Comando entram nas seguintes categorias:

• Algoritmos de processamento. Estes são mostrados como ‘‘ algoritmo de processamento: <name of the algorithm> ‘‘ .

• Ítens do Menu. Estes são mostrados como item de menu:<menu texto entrada>. Todos os itens de menus disponíveis a partir da interface do QGIS estão disponíveis, mesmo que eles estejam incluídos em um submenu.

• Funções Python. Você pode criar funções Python curtas que serão depois incluídas na lista de comandos disponíveis. Elas são mostradas como Função:

<nome da função>

.

Para executar qualquer um dos acima, basta começar a digitar e, em seguida, selecione o elemento correspondente da lista de comandos disponíveis que aparece depois de filtrar toda a lista de comandos com o texto que você digitou.

No caso de chamar uma função Python, pode selecionar uma entrada da lista, que tem o prefixo de Função: (para a instância, Função: removeall), ou apenas escreva diretamente o nome da função

(‘‘removeall no exemplo anterior). Não existe necessidade de adicionar parêntesis após o nome da função.

17.15.2 Criando funções personalizadas

As funções personalizadas são adicionadas ao introduzir o código Python correspondente no arquivo commands.py

que pode ser encontrado .qgis/sextante/commander directory na pasta do usuário.

É apenas um arquivo Python simples onde pode adicionar as funções que necessita.

O arquivo é criado com alguns exemplo funciona a primeira vez que você abrir o Comandante. Se você ainda não lançou o comandante, no entanto, você pode criar o arquivo você mesmo. Para editar o arquivo de comandos, utilize o seu editor de texto favorito. Você também pode usar um built-in editor chamando o comando edição do Comando. Ele vai abrir o editor com o arquivo de comandos, e você pode editá-lo diretamente e, em seguida, salvar as alterações.

Por exemplo, pode adicionar a seguinte função, que remove todas as camadas:

from qgis.gui

import

*

def

removeall (): mapreg = QgsMapLayerRegistry .

instance() mapreg .

removeAllMapLayers()

Depois de adicionar a função, ele estará disponível no Comando, e você pode chamá-lo digitando removeall.

Não há necessidade de fazer nada além de escrever a própria função.

As funções podem receber parâmetros. Adicionar *args para a sua definição de função para receber argumentos.

Ao chamar a função do Comando, os parâmetros têm de ser passados separados por espaços.

Aqui está um exemplo de uma função que carrega uma camada e que tome como parâmetro o nome do arquivo da camada para carregar.

import processing def

load (

* args): processing .

load(args[ 0 ])

17.15. O QGIS Comando 229

QGIS User Guide, Versão 2.6

.

Se você quiser carregar a camada em

/home/myuser/points.shp

, tipo carregue

/home/myuser/points.shp

na caixa de texto comando.

230 Capítulo 17. QGIS estrutura de processamento

CAPÍTULO

18

Fornece algoritmos e processamento

.

18.1 Provedor de algoritmo GDAL

.

GDAL (Geospatial Data Abstraction Library) é uma biblioteca de tradução para formatos de dados geoespaciais raster e vetor.

18.1.1 Análises GDAL

Aspecto

Descrição

<coloque aqui a descrição do algorítimo>

Parâmetros

Camada de Entrada

[raster] <coloque aqui a descrição do parâmetro>

Número da Banda

[number] <coloque aqui a descrição do parâmetro>

Padrão: 1

Computar bordas

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

Usar fórmula de Zevennbergen&Thorne (e não a de Horn)

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

Retornar ângulo trigonométrico (ao invés de azimute)

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

Retornar 0 para ’flat’ (ao invés de -9999)

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

231

QGIS User Guide, Versão 2.6

Saídas

Arquivo de saída

[raster] <coloque a descrição de saida aqui>

Usando o console

processing .

runalg( ’gdalogr:aspect’ , input , band, compute_edges, zevenbergen, trig_angle, zero_flat, output)

Veja tambem

Cor do relevo

Descrição

<coloque aqui a descrição do algorítimo>

Parâmetros

Camada de Entrada

[raster] <coloque aqui a descrição do parâmetro>

Número da Banda

[number] <coloque aqui a descrição do parâmetro>

Padrão: 1

Computar bordas

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

Arquivo de Configuração de Cores

[file] <coloque aqui a descrição do parâmetro>

Modo de Correspondência

[selection] <coloque aqui a descrição do parâmetro>

Opções:

• 0 — “0,0,0,0” RGBA

• 1 — Cor exata

• 2 — Cor próxima

Padrão: 0

Saídas

Arquivo de saída

[raster] <coloque a descrição de saida aqui>

Usando o console

processing .

runalg( ’gdalogr:colorrelief’ , input , band, compute_edges, color_table, match_mode, output)

Veja tambem

Preencher sem dados

Descrição

<coloque aqui a descrição do algorítimo>

232 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parâmetros

Camada de Entrada

[raster] <coloque aqui a descrição do parâmetro>

Distância de busca

[number] <coloque aqui a descrição do parâmetro>

Padrão: 100

Suavizar interações

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0

Operar na Banda

[number] <coloque aqui a descrição do parâmetro>

Padrão: 1

Máscara de validação

[raster] Opcional.

<coloque aqui a descrição do parâmetro>

Não usar máscara de validação padrão

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

Saídas

Camada de saída

[raster] <coloque a descrição de saida aqui>

Usando o console

processing .

runalg( ’gdalogr:fillnodata’ , input , distance, iterations, band, mask, no_default_mask, output)

Veja tambem

Grid (Média móvel)

Descrição

<coloque aqui a descrição do algorítimo>

Parâmetros

Camada de entrada

[vector: point] <coloque aqui a descrição do parâmetro>

Campo Z

[tablefield: numeric] Opcional.

<coloque aqui a descrição do parâmetro>

Ráio 1

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ráio 2

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Mínimo de Pontos

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ângulo

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

18.1. Provedor de algoritmo GDAL 233

QGIS User Guide, Versão 2.6

Sem dados

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Tipo da saída raster

[selection] <coloque aqui a descrição do parâmetro>

Opções:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

• 10 — CFloat64

Padrão: 5

Saídas

Arquivo de saída

[raster] <coloque a descrição de saida aqui>

Usando o console

processing .

runalg( ’gdalogr:gridaverage’ , input , z_field, radius_1, radius_2, min_points, angle, nodata, rtype, output)

Veja tambem

Grid (Dados métricos)

Descrição

<coloque aqui a descrição do algorítimo>

Parâmetros

Camada de entrada

[vector: point] <coloque aqui a descrição do parâmetro>

Campo Z

[tablefield: numeric] Opcional.

<coloque aqui a descrição do parâmetro>

Métricas

[selection] <coloque aqui a descrição do parâmetro>

Opções:

• 0 — Mínimo

• 1 — Máximo

• 2 — Intervalo

234 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 3 — Contagem

• 4 — Média da distância

• 5 — Média da distância entre pontos

Padrão: 0

Ráio 1

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ráio 2

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Mínimo de Pontos

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ângulo

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Sem dados

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Tipo do raster de saída

[selection] <coloque aqui a descrição do parâmetro>

Opções:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

• 10 — CFloat64

Padrão: 5

Saídas

Arquivo de saída

[raster] <coloque a descrição de saida aqui>

Usando o console

processing .

runalg( ’gdalogr:griddatametrics’ , input , z_field, metric, radius_1, radius_2, min_points, angle, nodata, rtype, output)

18.1. Provedor de algoritmo GDAL 235

QGIS User Guide, Versão 2.6

Veja tambem

Grid (Inverso da Distância à Potência)

Descrição

<coloque aqui a descrição do algorítimo>

Parâmetros

Camada de entrada

[vector: point] <coloque aqui a descrição do parâmetro>

Campo Z

[tablefield: numeric] Opcional.

<coloque aqui a descrição do parâmetro>

Potência

[number] <coloque aqui a descrição do parâmetro>

Padrão: 2.0

Suavização

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ráio 1

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ráio 2

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Máximos de Pontos

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Mínimo de Pontos

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ângulo

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Sem dados

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Tipo da saída raster

[selection] <coloque aqui a descrição do parâmetro>

Opções:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

236 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 10 — CFloat64

Padrão: 5

Saídas

Arquivo de saída

[raster] <coloque aqui a descrição da saída>

Usando o console

processing .

runalg( ’gdalogr:gridinvdist’ , input , z_field, power, smothing, radius_1, radius_2, max_points, min_points, angle, nodata, rtype, output)

Veja tambem

Grid (Vizinho mais próximo)

Descrição

<coloque aqui a descrição do algorítimo>

Parâmetros

Camada de entrada

[vector: point] <coloque aqui a descrição do parâmetro>

Campo Z

[tablefield: numeric] Opcional.

<coloque aqui a descrição do parâmetro>

Ráio 1

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ráio 2

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Ângulo

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Sem dados

[number] <coloque aqui a descrição do parâmetro>

Padrão: 0.0

Tipo da saída raster

[selection] <coloque aqui a descrição do parâmetro>

Opções:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

18.1. Provedor de algoritmo GDAL 237

QGIS User Guide, Versão 2.6

• 9 — CFloat32

• 10 — CFloat64

Padrão: 5

Saídas

Arquivo de saída

[raster] <coloque aqui a descrição da saída>

Usando o console

processing .

runalg( ’gdalogr:gridnearestneighbor’ , input , z_field, radius_1, radius_2, angle, nodata, rtype, output)

Veja tambem

Sombreamento

Descrição

<coloque aqui a descrição do algorítimo>

Parâmetros

Camada de Entrada

[raster] <coloque aqui a descrição do parâmetro>

Número da Banda

[number] <coloque aqui a descrição do parâmetro>

Padrão: 1

Computar bordas

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

Usar fórmula de Zevennbergen&Thorne (e não a de Horn)

[boolean] <coloque aqui a descrição do parâmetro>

Padrão: False

Fator Z (exagero vertical)

[number] <coloque aqui a descrição do parâmetro>

Padrão: 1.0

Escala (razão entre un.

vert.

e horiz.)

[number] <coloque aqui a descrição do parâmetro>

Padrão: 1.0

Azimute de insolação

[number] <coloque aqui a descrição do parâmetro>

Padrão: 315.0

Altitude de insolação

[number] <coloque aqui a descrição do parâmetro>

Padrão: 45.0

Saídas

Arquivo de saída

[raster] <coloque aqui a descrição da saída>

238 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Usando o console

processing .

runalg( ’gdalogr:hillshade’ , input , band, compute_edges, zevenbergen, z_factor, scale, azimuth, altitude, output)

Veja tambem

Preto próximo

Descrição

<coloque a rescrição do algoritmo aqui>

Parâmetros

Camada de entrada

[raster] <coloque a rescrição do parâmetro aqui>

Como longe de preto (branco)

[número] <coloque a rescrição do parâmetro aqui>

Padrão: 15

Procure pixeis quase branco em vez de quase preto

[booleano] <coloque a rescrição do parâmetro aqui>

Padrão: Falso

Saídas

Camada de saída

[raster] <coloque a descrição de saída aqui>

Usando o console

processing .

runalg( ’gdalogr:nearblack’ , input , near, white, output)

ver igual

Proximidade (distância raster)

Descrição

<coloque a descrição do algoritmo aqui>

Parâmetros

Camada de entrada

[raster] <coloque a aqui a descrição do parâmetro>

Valores

[texto] <coloque a aqui a descrição do parâmetro>

Padrão: (não definido)

Unidades de distância

[seleção] <coloque a aqui a descrição do parâmetro>

Opções:

• 0 — GEO

• 1 — PIXEL

18.1. Provedor de algoritmo GDAL 239

QGIS User Guide, Versão 2.6

Padrão: 0

Dist Máx (ignorar valores negativos)

[número] <coloque a aqui a descrição do parâmetro>

Padrão: -1

sem dado (ignorar valores negativos)

[número] <coloque a aqui a descrição do parâmetro>

Padrão: -1

Val buf fixado (ignora valor negativo)

[número] <coloque a aqui a descrição do parâmetro>

Padrão: -1

tipo raster de saída

[seleção] <coloque a aqui a descrição do parâmetro>

Opções:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

• 10 — CFloat64

Padrão: 5

Saídas

Camada de saída

[raster] <coloque aqui a descrição da saída>

Uso do console

processing .

runalg( ’gdalogr:proximity’ , input , values, units, max_dist, nodata, buf_val, rtype, output)

Veja mais

Rugosidade

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetros>

número de banda

[número] <coloque aqui a descrição do parâmetros>

Padrão: 1

240 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Computar bordas

[booleano] <coloque aqui a descrição do parâmetros>

Padrão: Falso

Saídas arquivo de saída

[raster] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:roughness’ , input , band, compute_edges, output)

Veja também

Crivo

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetro>

Limiar

[número] <coloque aqui a descrição do parâmetro>

Padrão: 2

Conexão com pixel

[seleção] <coloque aqui a descrição do parâmetro>

Opções:

• 0 — 4

• 1 — 8

Padrão: 0

Saídas

Camadas de saída

[raster] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:sieve’ , input , threshold, connections, output)

Veja também

Declividade

Descrição

<coloque aqui a descrição do algoritmo>

18.1. Provedor de algoritmo GDAL 241

QGIS User Guide, Versão 2.6

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetro>

Número de banda

[número] <coloque aqui a descrição do parâmetro>

Padrão: 1

Computar bordas

[booleano] <coloque aqui a descrição do parâmetro>

Padrão: Falso

Use fórmula Zevenbergen&Thorne (em vez de aspas)

[booleano] <coloque aqui a descrição do parâmetro>

Padrão: Falso

Declividade expressa em percentual (em vez de graus)

[booleano] <coloque aqui a descrição do parâmetro>

Padrão: Falso

Escala (raio de unidades vert.

para horiz.)

[número] <coloque aqui a descrição do parâmetro>

Padrão: 1.0

Saídas arquivo de saída

[raster] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:slope’ , input , band, compute_edges, zevenbergen, as_percent, scale, output)

Veja também

IPT (Indice de Posição Topográfica)

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetros>

número de bandas

[número] <coloque aqui a descrição do parâmetros>

Padrão: 1

Computar bordas

[booleano] <coloque aqui a descrição do parâmetros>

Padrão: Falso

Saídas arquivo de saída

[raster] <coloque aqui a descrição da saída>

242 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Usar console

processing .

runalg( ’gdalogr:tpitopographicpositionindex’ , input , band, compute_edges, output)

Veja também

IRT (Índice de Rugosidade do Terreno)

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetros>

número de bandas

[número] <coloque aqui a descrição do parâmetros>

Padrão: 1

Computar bordas

[booleano] <coloque aqui a descrição do parâmetros>

Padrão: Falso

Saídas arquivo de saída

[raster] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:triterrainruggednessindex’ , input , band, compute_edges, output)

.

Veja também

18.1.2 Conversão GDAL

gdal2xyz

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetros>

número de banda

[número] <coloque aqui a descrição do parâmetros>

Padrão: 1

18.1. Provedor de algoritmo GDAL 243

QGIS User Guide, Versão 2.6

Saídas arquivo de saída

[raster] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:gdal2xyz’ , input , band, output)

Veja também

PCT para RGB

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetros>

número de banda

[número] <coloque aqui a descrição do parâmetros>

Opções:

• 0 — 1

• 1 — 2

• 2 — 3

• 3 — 4

• 4 — 5

• 5 — 6

• 6 — 7

• 7 — 8

• 8 — 9

• 9 — 10

• 10 — 11

• 11 — 12

• 12 — 13

• 13 — 14

• 14 — 15

• 15 — 16

• 16 — 17

• 17 — 18

• 18 — 19

• 19 — 20

• 20 — 21

244 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 21 — 22

• 22 — 23

• 23 — 24

• 24 — 25

Padrão: 0

Saídas

Camada de saída

[raster] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:pcttorgb’ , input , nband, output)

Veja também

Poligonizar (raster para vetor)

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetros>

Nome do campo de saída

[texto] <coloque aqui a descrição do parâmetros>

Padrão: DN

Saídas

Camada de saída

[vetor] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:polygonize’ , input , field, output)

Veja também

Rasterizar (vetor para raster)

Descrição

<coloque aqui a descrição do algoritmo>

18.1. Provedor de algoritmo GDAL 245

QGIS User Guide, Versão 2.6

Parâmetros

Camada de entrada

[vetor: qualquer] <coloque aqui a descrição do parâmetros>

Tabela de atributo

[campo da tabela: qualquer] <coloque aqui a descrição do parâmetros>

Adicione valores dentro de uma camada raster existente(*) [booleano] <coloque aqui a descrição do parâmetros>

Padrão: Falso

Defina o tamanho do raster de saída (ignorada se a opção acima for verificada)

[seleção]

<coloque aqui a descrição do parâmetros>

Opções:

• 0 — tamanho de saída em pixels

• 1 — Resolução de saída em unidades do mapa por pixel

Padrão: 1

Horizontal

[número] <coloque aqui a descrição do parâmetros>

Padrão: 100.0

Vertical

[número] <coloque aqui a descrição do parâmetros>

Padrão: 100.0

Tipo do Raster

[seleção] <coloque aqui a descrição do parâmetros>

Opções:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

• 10 — CFloat64

Padrão: 0

Saídas

Camada de saída:

obrigatório escolher uma camada existente, se a opção (*) for selecionada [raster]

<coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:rasterize’ , input , field, writeover, dimensions, width, height, rtype, output)

246 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Veja também

RGB para PCT

Descrição

<coloque aqui a descrição do algoritmo>

Parâmetros

Camada de entrada

[raster] <coloque aqui a descrição do parâmetros>

Número de cores

[número] <coloque aqui a descrição do parâmetros>

Padrão: 2

Saídas

Camada de saída

[raster] <coloque aqui a descrição da saída>

Usar console

processing .

runalg( ’gdalogr:rgbtopct’ , input , ncolors, output)

Veja também

Translate (convert format)

Description

<put algortithm description here>

Parameters

Input layer

[raster] <put parameter description here>

Set the size of the output file (In pixels or %)

[number] <put parameter description here>

Default: 100

Output size is a percentage of input size

[boolean] <put parameter description here>

Default: True

Nodata value, leave as none to take the nodata value from input

[string] <put parameter description here>

Default: none

Expand

[selection] <put parameter description here>

Options:

• 0 — none

• 1 — gray

• 2 — rgb

18.1. Provedor de algoritmo GDAL 247

QGIS User Guide, Versão 2.6

• 3 — rgba

Default: 0

Output projection for output file [leave blank to use input projection]

[crs]

<put parameter description here>

Default: None

Subset based on georeferenced coordinates

[extent] <put parameter description here>

Default: 0,1,0,1

Copy all subdatasets of this file to individual output files

[boolean] <put parameter description here>

Default: False

Additional creation parameters

[string] Optional.

<put parameter description here>

Default: (not set)

Output raster type

[selection] <put parameter description here>

Options:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

• 10 — CFloat64

Default: 5

Outputs

Output layer

[raster] <put output description here>

Console usage

processing .

runalg( ’gdalogr:translate’ , input , outsize, outsize_perc, no_data, expand, srs, projwin, sds, extra, rtype, output)

.

See also

248 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

18.1.3 Extração GDAL

Clip raster by extent

Description

<put algortithm description here>

Parameters

Input layer

[raster] <put parameter description here>

Nodata value, leave as none to take the nodata value from input

[string] <put parameter description here>

Default: none

Clipping extent

[extent] <put parameter description here>

Default: 0,1,0,1

Additional creation parameters

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Output layer

[raster] <put output description here>

Console usage

processing .

runalg( ’gdalogr:cliprasterbyextent’ , input , no_data, projwin, extra, output)

See also

Clip raster by mask layer

Description

<put algortithm description here>

Parameters

Input layer

[raster] <put parameter description here>

Mask layer

[vector: polygon] <put parameter description here>

Nodata value, leave as none to take the nodata value from input

[string] <put parameter description here>

Default: none

Create and output alpha band

[boolean] <put parameter description here>

Default: False

18.1. Provedor de algoritmo GDAL 249

QGIS User Guide, Versão 2.6

Keep resolution of output raster

[boolean] <put parameter description here>

Default: False

Additional creation parameters

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Output layer

[raster] <put output description here>

Console usage

processing .

runalg( ’gdalogr:cliprasterbymasklayer’ , input , mask, no_data, alpha_band, keep_resolution, extra, output)

See also

Contour

Description

<put algortithm description here>

Parameters

Input layer

[raster] <put parameter description here>

Interval between contour lines

[number] <put parameter description here>

Default: 10.0

Attribute name (if not set, no elevation attribute is attached)

[string]

Optional.

<put parameter description here>

Default: ELEV

Additional creation parameters

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Output file for contour lines (vector)

[vector] <put output description here>

Console usage

processing .

runalg( ’gdalogr:contour’ , input_raster, interval, field_name, extra, output_vector)

250 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

.

See also

18.1.4 Miscelaneos GDAL

Build Virtual Raster

Description

<put algortithm description here>

Parameters

Input layers

[multipleinput: rasters] <put parameter description here>

Resolution

[selection] <put parameter description here>

Options:

• 0 — average

• 1 — highest

• 2 — lowest

Default: 0

Layer stack

[boolean] <put parameter description here>

Default: True

Allow projection difference

[boolean] <put parameter description here>

Default: False

Outputs

Output layer

[raster] <put output description here>

Console usage

processing .

runalg( ’gdalogr:buildvirtualraster’ , input , resolution, separate, proj_difference, output)

See also

Merge

Description

<put algortithm description here>

18.1. Provedor de algoritmo GDAL 251

QGIS User Guide, Versão 2.6

Parameters

Input layers

[multipleinput: rasters] <put parameter description here>

Grab pseudocolor table from first layer

[boolean] <put parameter description here>

Default: False

Layer stack

[boolean] <put parameter description here>

Default: False

Output raster type

[selection] <put parameter description here>

Options:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

• 10 — CFloat64

Default: 5

Outputs

Output layer

[raster] <put output description here>

Console usage

processing .

runalg( ’gdalogr:merge’ , input , pct, separate, rtype, output)

See also

Build overviews (pyramids)

Description

<put algortithm description here>

Parameters

Input layer

[raster] <put parameter description here>

Overview levels

[string] <put parameter description here>

Default: 2 4 8 16

252 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Remove all existing overviews

[boolean] <put parameter description here>

Default: False

Resampling method

[selection] <put parameter description here>

Options:

• 0 — nearest

• 1 — average

• 2 — gauss

• 3 — cubic

• 4 — average_mp

• 5 — average_magphase

• 6 — mode

Default: 0

Overview format

[selection] <put parameter description here>

Options:

• 0 — Internal (if possible)

• 1 — External (GTiff .ovr)

• 2 — External (ERDAS Imagine .aux)

Default: 0

Outputs

Output layer

[raster] <put output description here>

Console usage

processing .

runalg( ’gdalogr:overviews’ , input , levels, clean, resampling_method, format)

See also

Information

Description

<put algortithm description here>

Parameters

Input layer

[raster] <put parameter description here>

Suppress GCP info

[boolean] <put parameter description here>

Default: False

Suppress metadata info

[boolean] <put parameter description here>

Default: False

18.1. Provedor de algoritmo GDAL 253

QGIS User Guide, Versão 2.6

Outputs

Layer information

[html] <put output description here>

Console usage

processing .

runalg( ’gdalorg:rasterinfo’ , input , nogcp, nometadata, output)

.

See also

18.1.5 Projeções GDAL

Extract projection

Description

<put algortithm description here>

Parameters

Input file

[raster] <put parameter description here>

Create also .prj file

[boolean] <put parameter description here>

Default: False

Outputs

Console usage

processing .

runalg( ’gdalogr:extractprojection’ , input , prj_file)

See also

Warp (reproject)

Description

<put algortithm description here>

Parameters

Input layer

[raster] <put parameter description here>

Source SRS (EPSG Code)

[crs] <put parameter description here>

Default: EPSG:4326

Destination SRS (EPSG Code)

[crs] <put parameter description here>

Default: EPSG:4326

254 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Output file resolution in target georeferenced units (leave 0 for no change)

[number]

<put parameter description here>

Default: 0.0

Resampling method

[selection] <put parameter description here>

Options:

• 0 — near

• 1 — bilinear

• 2 — cubic

• 3 — cubicspline

• 4 — lanczos

Default: 0

Additional creation parameters

[string] Optional.

<put parameter description here>

Default: (not set)

Output raster type

[selection] <put parameter description here>

Options:

• 0 — Byte

• 1 — Int16

• 2 — UInt16

• 3 — UInt32

• 4 — Int32

• 5 — Float32

• 6 — Float64

• 7 — CInt16

• 8 — CInt32

• 9 — CFloat32

• 10 — CFloat64

Default: 5

Outputs

Output layer

[raster] <put output description here>

Console usage

processing .

runalg( ’gdalogr:warpreproject’ , input , source_srs, dest_srs, tr, method, extra, rtype, output)

.

See also

18.1. Provedor de algoritmo GDAL 255

QGIS User Guide, Versão 2.6

18.1.6 Conversão OGR

Convert format

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Destination Format

[selection] <put parameter description here>

Options:

• 0 — ESRI Shapefile

• 1 — GeoJSON

• 2 — GeoRSS

• 3 — SQLite

• 4 — GMT

• 5 — MapInfo File

• 6 — INTERLIS 1

• 7 — INTERLIS 2

• 8 — GML

• 9 — Geoconcept

• 10 — DXF

• 11 — DGN

• 12 — CSV

• 13 — BNA

• 14 — S57

• 15 — KML

• 16 — GPX

• 17 — PGDump

• 18 — GPSTrackMaker

• 19 — ODS

• 20 — XLSX

• 21 — PDF

Default: 0

Creation Options

[string] Optional.

<put parameter description here>

Default: (not set)

256 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’gdalogr:convertformat’ , input_layer, format, options, output_layer)

.

See also

18.1.7 Geoprocessamento OGR

Clip vectors by extent

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Clip extent

[extent] <put parameter description here>

Default: 0,1,0,1

Additional creation Options

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’gdalogr:clipvectorsbyextent’ , input_layer, clip_extent, options, output_layer)

See also

Clip vectors by polygon

Description

<put algortithm description here>

18.1. Provedor de algoritmo GDAL 257

QGIS User Guide, Versão 2.6

Parameters

Input layer

[vector: any] <put parameter description here>

Clip layer

[vector: polygon] <put parameter description here>

Additional creation Options

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’gdalogr:clipvectorsbypolygon’ , input_layer, clip_layer, options, output_layer)

.

See also

18.1.8 Miscelaneos OGR

Execute SQL

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

SQL

[string] <put parameter description here>

Default: (not set)

Outputs

SQL result

[vector] <put output description here>

Console usage

processing .

runalg( ’gdalogr:executesql’ , input , sql, output)

258 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Import Vector into PostGIS database (available connections)

Description

<put algortithm description here>

Parameters

Database (connection name)

[selection] <put parameter description here>

Options:

• 0 — local

Default: 0

Input layer

[vector: any] <put parameter description here>

Output geometry type

[selection] <put parameter description here>

Options:

• 0 —

• 1 — NONE

• 2 — GEOMETRY

• 3 — POINT

• 4 — LINESTRING

• 5 — POLYGON

• 6 — GEOMETRYCOLLECTION

• 7 — MULTIPOINT

• 8 — MULTIPOLYGON

• 9 — MULTILINESTRING

Default: 5

Input CRS (EPSG Code)

[crs] <put parameter description here>

Default: EPSG:4326

Output CRS (EPSG Code)

[crs] <put parameter description here>

Default: EPSG:4326

Schema name

[string] Optional.

<put parameter description here>

Default: public

Table name, leave blank to use input name

[string] Optional.

<put parameter description here>

Default: (not set)

Primary Key

[string] Optional.

<put parameter description here>

Default: id

18.1. Provedor de algoritmo GDAL 259

QGIS User Guide, Versão 2.6

Geometry column name

[string] Optional.

<put parameter description here>

Default: geom

Vector dimensions

[selection] <put parameter description here>

Options:

• 0 — 2

• 1 — 3

Default: 0

Distance tolerance for simplification

[string] Optional.

<put parameter description here>

Default: (not set)

Maximum distance between 2 nodes (densification)

[string] Optional.

<put parameter description here>

Default: (not set)

Select features by extent (defined in input layer CRS)

[extent] <put parameter description here>

Default: 0,1,0,1

Clip the input layer using the above (rectangle) extent

[boolean] <put parameter description here>

Default: False

Select features using a SQL "WHERE"statement (Ex: column="value")

[string]

Optional.

<put parameter description here>

Default: (not set)

Group "n"features per transaction (Default: 20000)

[string] Optional.

<put parameter description here>

Default: (not set)

Overwrite existing table?

[boolean] <put parameter description here>

Default: True

Append to existing table?

[boolean] <put parameter description here>

Default: False

Append and add new fields to existing table?

[boolean] <put parameter description here>

Default: False

Do not launder columns/table name/s?

[boolean] <put parameter description here>

Default: False

Do not create Spatial Index?

[boolean] <put parameter description here>

Default: False

Continue after a failure, skipping the failed feature

[boolean] <put parameter description here>

Default: False

260 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Additional creation options

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Console usage

processing .

runalg( ’gdalogr:importvectorintopostgisdatabaseavailableconnections’ , database, input_layer, gtype, s_srs, t_srs, schema, table, pk, geocolumn, dim, simplify, segmentize, spat, clip, where, gt, overwrite, append, addfields, launder, index, skipfailures, options)

See also

Import Vector into PostGIS database (new connection)

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Output geometry type

[selection] <put parameter description here>

Options:

• 0 —

• 1 — NONE

• 2 — GEOMETRY

• 3 — POINT

• 4 — LINESTRING

• 5 — POLYGON

• 6 — GEOMETRYCOLLECTION

• 7 — MULTIPOINT

• 8 — MULTIPOLYGON

• 9 — MULTILINESTRING

Default: 5

Input CRS (EPSG Code)

[crs] <put parameter description here>

Default: EPSG:4326

Output CRS (EPSG Code)

[crs] <put parameter description here>

Default: EPSG:4326

Host

[string] <put parameter description here>

Default: localhost

Port

[string] <put parameter description here>

Default: 5432

18.1. Provedor de algoritmo GDAL 261

QGIS User Guide, Versão 2.6

Username

[string] <put parameter description here>

Default: (not set)

Database Name

[string] <put parameter description here>

Default: (not set)

Password

[string] <put parameter description here>

Default: (not set)

Schema name

[string] Optional.

<put parameter description here>

Default: public

Table name, leave blank to use input name

[string] Optional.

<put parameter description here>

Default: (not set)

Primary Key

[string] Optional.

<put parameter description here>

Default: id

Geometry column name

[string] Optional.

<put parameter description here>

Default: geom

Vector dimensions

[selection] <put parameter description here>

Options:

• 0 — 2

• 1 — 3

Default: 0

Distance tolerance for simplification

[string] Optional.

<put parameter description here>

Default: (not set)

Maximum distance between 2 nodes (densification)

[string] Optional.

<put parameter description here>

Default: (not set)

Select features by extent (defined in input layer CRS)

[extent] <put parameter description here>

Default: 0,1,0,1

Clip the input layer using the above (rectangle) extent

[boolean] <put parameter description here>

Default: False

Select features using a SQL "WHERE"statement (Ex: column="value")

[string]

Optional.

<put parameter description here>

Default: (not set)

262 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Group "n"features per transaction (Default: 20000)

[string] Optional.

<put parameter description here>

Default: (not set)

Overwrite existing table?

[boolean] <put parameter description here>

Default: True

Append to existing table?

[boolean] <put parameter description here>

Default: False

Append and add new fields to existing table?

[boolean] <put parameter description here>

Default: False

Do not launder columns/table name/s?

[boolean] <put parameter description here>

Default: False

Do not create Spatial Index?

[boolean] <put parameter description here>

Default: False

Continue after a failure, skipping the failed feature

[boolean] <put parameter description here>

Default: False

Additional creation options

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Console usage

processing .

runalg( ’gdalogr:importvectorintopostgisdatabasenewconnection’ , input_layer, gtype, s_srs, t_srs, host, port, user, dbname, password, schema, table, pk, geocolumn, dim, simplify, segmentize, spat, clip, where, gt, overwrite, append, addfields, launder, index, skipfailures, options)

See also

Information

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Outputs

Layer information

[html] <put output description here>

18.1. Provedor de algoritmo GDAL 263

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’gdalogr:information’ , input , output)

.

See also

18.2 LAStools

LAStools is a collection of highly efficient, multicore command line tools for LiDAR data processing.

18.2.1 las2las_filter

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

filter (by return, classification, flags)

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — keep_last

• 2 — keep_first

• 3 — keep_middle

• 4 — keep_single

• 5 — drop_single

• 6 — keep_double

• 7 — keep_class 2

• 8 — keep_class 2 8

• 9 — keep_class 8

• 10 — keep_class 6

• 11 — keep_class 9

• 12 — keep_class 3 4 5

• 13 — keep_class 2 6

• 14 — drop_class 7

• 15 — drop_withheld

264 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Default: 0

second filter (by return, classification, flags)

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — keep_last

• 2 — keep_first

• 3 — keep_middle

• 4 — keep_single

• 5 — drop_single

• 6 — keep_double

• 7 — keep_class 2

• 8 — keep_class 2 8

• 9 — keep_class 8

• 10 — keep_class 6

• 11 — keep_class 9

• 12 — keep_class 3 4 5

• 13 — keep_class 2 6

• 14 — drop_class 7

• 15 — drop_withheld

Default: 0

filter (by coordinate, intensity, GPS time, ...)

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — clip_x_above

• 2 — clip_x_below

• 3 — clip_y_above

• 4 — clip_y_below

• 5 — clip_z_above

• 6 — clip_z_below

• 7 — drop_intensity_above

• 8 — drop_intensity_below

• 9 — drop_gps_time_above

• 10 — drop_gps_time_below

• 11 — drop_scan_angle_above

• 12 — drop_scan_angle_below

• 13 — keep_point_source

• 14 — drop_point_source

• 15 — drop_point_source_above

18.2. LAStools 265

QGIS User Guide, Versão 2.6

• 16 — drop_point_source_below

• 17 — keep_user_data

• 18 — drop_user_data

• 19 — drop_user_data_above

• 20 — drop_user_data_below

• 21 — keep_every_nth

• 22 — keep_random_fraction

• 23 — thin_with_grid

Default: 0

value for filter (by coordinate, intensity, GPS time, ...)

[string] <put parameter description here>

Default: (not set)

second filter (by coordinate, intensity, GPS time, ...)

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — clip_x_above

• 2 — clip_x_below

• 3 — clip_y_above

• 4 — clip_y_below

• 5 — clip_z_above

• 6 — clip_z_below

• 7 — drop_intensity_above

• 8 — drop_intensity_below

• 9 — drop_gps_time_above

• 10 — drop_gps_time_below

• 11 — drop_scan_angle_above

• 12 — drop_scan_angle_below

• 13 — keep_point_source

• 14 — drop_point_source

• 15 — drop_point_source_above

• 16 — drop_point_source_below

• 17 — keep_user_data

• 18 — drop_user_data

• 19 — drop_user_data_above

• 20 — drop_user_data_below

• 21 — keep_every_nth

• 22 — keep_random_fraction

• 23 — thin_with_grid

Default: 0

266 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

value for second filter (by coordinate, intensity, GPS time, ...)

[string] <put parameter description here>

Default: (not set)

Outputs output LAS/LAZ file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:las2lasfilter’ , verbose, input_laslaz, filter_return_class_flags1, filter_return_class_flags2, filter_coords_intensity1, filter_coords_intensity1_arg, filter_coords_intensity2, filter_coords_intensity2_arg, output_laslaz)

See also

18.2.2 las2las_project

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

source projection

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — utm

• 2 — sp83

• 3 — sp27

• 4 — longlat

• 5 — latlong

Default: 0

source utm zone

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — 1 (north)

• 2 — 2 (north)

• 3 — 3 (north)

• 4 — 4 (north)

• 5 — 5 (north)

• 6 — 6 (north)

18.2. LAStools 267

QGIS User Guide, Versão 2.6

• 7 — 7 (north)

• 8 — 8 (north)

• 9 — 9 (north)

• 10 — 10 (north)

• 11 — 11 (north)

• 12 — 12 (north)

• 13 — 13 (north)

• 14 — 14 (north)

• 15 — 15 (north)

• 16 — 16 (north)

• 17 — 17 (north)

• 18 — 18 (north)

• 19 — 19 (north)

• 20 — 20 (north)

• 21 — 21 (north)

• 22 — 22 (north)

• 23 — 23 (north)

• 24 — 24 (north)

• 25 — 25 (north)

• 26 — 26 (north)

• 27 — 27 (north)

• 28 — 28 (north)

• 29 — 29 (north)

• 30 — 30 (north)

• 31 — 31 (north)

• 32 — 32 (north)

• 33 — 33 (north)

• 34 — 34 (north)

• 35 — 35 (north)

• 36 — 36 (north)

• 37 — 37 (north)

• 38 — 38 (north)

• 39 — 39 (north)

• 40 — 40 (north)

• 41 — 41 (north)

• 42 — 42 (north)

• 43 — 43 (north)

• 44 — 44 (north)

• 45 — 45 (north)

268 Capítulo 18. Fornece algoritmos e processamento

• 46 — 46 (north)

• 47 — 47 (north)

• 48 — 48 (north)

• 49 — 49 (north)

• 50 — 50 (north)

• 51 — 51 (north)

• 52 — 52 (north)

• 53 — 53 (north)

• 54 — 54 (north)

• 55 — 55 (north)

• 56 — 56 (north)

• 57 — 57 (north)

• 58 — 58 (north)

• 59 — 59 (north)

• 60 — 60 (north)

• 61 — 1 (south)

• 62 — 2 (south)

• 63 — 3 (south)

• 64 — 4 (south)

• 65 — 5 (south)

• 66 — 6 (south)

• 67 — 7 (south)

• 68 — 8 (south)

• 69 — 9 (south)

• 70 — 10 (south)

• 71 — 11 (south)

• 72 — 12 (south)

• 73 — 13 (south)

• 74 — 14 (south)

• 75 — 15 (south)

• 76 — 16 (south)

• 77 — 17 (south)

• 78 — 18 (south)

• 79 — 19 (south)

• 80 — 20 (south)

• 81 — 21 (south)

• 82 — 22 (south)

• 83 — 23 (south)

• 84 — 24 (south)

18.2. LAStools

QGIS User Guide, Versão 2.6

269

QGIS User Guide, Versão 2.6

• 85 — 25 (south)

• 86 — 26 (south)

• 87 — 27 (south)

• 88 — 28 (south)

• 89 — 29 (south)

• 90 — 30 (south)

• 91 — 31 (south)

• 92 — 32 (south)

• 93 — 33 (south)

• 94 — 34 (south)

• 95 — 35 (south)

• 96 — 36 (south)

• 97 — 37 (south)

• 98 — 38 (south)

• 99 — 39 (south)

• 100 — 40 (south)

• 101 — 41 (south)

• 102 — 42 (south)

• 103 — 43 (south)

• 104 — 44 (south)

• 105 — 45 (south)

• 106 — 46 (south)

• 107 — 47 (south)

• 108 — 48 (south)

• 109 — 49 (south)

• 110 — 50 (south)

• 111 — 51 (south)

• 112 — 52 (south)

• 113 — 53 (south)

• 114 — 54 (south)

• 115 — 55 (south)

• 116 — 56 (south)

• 117 — 57 (south)

• 118 — 58 (south)

• 119 — 59 (south)

• 120 — 60 (south)

Default: 0

source state plane code

[selection] <put parameter description here>

Options:

270 Capítulo 18. Fornece algoritmos e processamento

• 0 — —

• 1 — AK_10

• 2 — AK_2

• 3 — AK_3

• 4 — AK_4

• 5 — AK_5

• 6 — AK_6

• 7 — AK_7

• 8 — AK_8

• 9 — AK_9

• 10 — AL_E

• 11 — AL_W

• 12 — AR_N

• 13 — AR_S

• 14 — AZ_C

• 15 — AZ_E

• 16 — AZ_W

• 17 — CA_I

• 18 — CA_II

• 19 — CA_III

• 20 — CA_IV

• 21 — CA_V

• 22 — CA_VI

• 23 — CA_VII

• 24 — CO_C

• 25 — CO_N

• 26 — CO_S

• 27 — CT

• 28 — DE

• 29 — FL_E

• 30 — FL_N

• 31 — FL_W

• 32 — GA_E

• 33 — GA_W

• 34 — HI_1

• 35 — HI_2

• 36 — HI_3

• 37 — HI_4

• 38 — HI_5

18.2. LAStools

QGIS User Guide, Versão 2.6

271

QGIS User Guide, Versão 2.6

• 39 — IA_N

• 40 — IA_S

• 41 — ID_C

• 42 — ID_E

• 43 — ID_W

• 44 — IL_E

• 45 — IL_W

• 46 — IN_E

• 47 — IN_W

• 48 — KS_N

• 49 — KS_S

• 50 — KY_N

• 51 — KY_S

• 52 — LA_N

• 53 — LA_S

• 54 — MA_I

• 55 — MA_M

• 56 — MD

• 57 — ME_E

• 58 — ME_W

• 59 — MI_C

• 60 — MI_N

• 61 — MI_S

• 62 — MN_C

• 63 — MN_N

• 64 — MN_S

• 65 — MO_C

• 66 — MO_E

• 67 — MO_W

• 68 — MS_E

• 69 — MS_W

• 70 — MT_C

• 71 — MT_N

• 72 — MT_S

• 73 — NC

• 74 — ND_N

• 75 — ND_S

• 76 — NE_N

• 77 — NE_S

272 Capítulo 18. Fornece algoritmos e processamento

• 78 — NH

• 79 — NJ

• 80 — NM_C

• 81 — NM_E

• 82 — NM_W

• 83 — NV_C

• 84 — NV_E

• 85 — NV_W

• 86 — NY_C

• 87 — NY_E

• 88 — NY_LI

• 89 — NY_W

• 90 — OH_N

• 91 — OH_S

• 92 — OK_N

• 93 — OK_S

• 94 — OR_N

• 95 — OR_S

• 96 — PA_N

• 97 — PA_S

• 98 — PR

• 99 — RI

• 100 — SC_N

• 101 — SC_S

• 102 — SD_N

• 103 — SD_S

• 104 — St.Croix

• 105 — TN

• 106 — TX_C

• 107 — TX_N

• 108 — TX_NC

• 109 — TX_S

• 110 — TX_SC

• 111 — UT_C

• 112 — UT_N

• 113 — UT_S

• 114 — VA_N

• 115 — VA_S

• 116 — VT

18.2. LAStools

QGIS User Guide, Versão 2.6

273

QGIS User Guide, Versão 2.6

• 117 — WA_N

• 118 — WA_S

• 119 — WI_C

• 120 — WI_N

• 121 — WI_S

• 122 — WV_N

• 123 — WV_S

• 124 — WY_E

• 125 — WY_EC

• 126 — WY_W

• 127 — WY_WC

Default: 0

target projection

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — utm

• 2 — sp83

• 3 — sp27

• 4 — longlat

• 5 — latlong

Default: 0

target utm zone

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — 1 (north)

• 2 — 2 (north)

• 3 — 3 (north)

• 4 — 4 (north)

• 5 — 5 (north)

• 6 — 6 (north)

• 7 — 7 (north)

• 8 — 8 (north)

• 9 — 9 (north)

• 10 — 10 (north)

• 11 — 11 (north)

• 12 — 12 (north)

• 13 — 13 (north)

• 14 — 14 (north)

• 15 — 15 (north)

274 Capítulo 18. Fornece algoritmos e processamento

• 16 — 16 (north)

• 17 — 17 (north)

• 18 — 18 (north)

• 19 — 19 (north)

• 20 — 20 (north)

• 21 — 21 (north)

• 22 — 22 (north)

• 23 — 23 (north)

• 24 — 24 (north)

• 25 — 25 (north)

• 26 — 26 (north)

• 27 — 27 (north)

• 28 — 28 (north)

• 29 — 29 (north)

• 30 — 30 (north)

• 31 — 31 (north)

• 32 — 32 (north)

• 33 — 33 (north)

• 34 — 34 (north)

• 35 — 35 (north)

• 36 — 36 (north)

• 37 — 37 (north)

• 38 — 38 (north)

• 39 — 39 (north)

• 40 — 40 (north)

• 41 — 41 (north)

• 42 — 42 (north)

• 43 — 43 (north)

• 44 — 44 (north)

• 45 — 45 (north)

• 46 — 46 (north)

• 47 — 47 (north)

• 48 — 48 (north)

• 49 — 49 (north)

• 50 — 50 (north)

• 51 — 51 (north)

• 52 — 52 (north)

• 53 — 53 (north)

• 54 — 54 (north)

18.2. LAStools

QGIS User Guide, Versão 2.6

275

QGIS User Guide, Versão 2.6

• 55 — 55 (north)

• 56 — 56 (north)

• 57 — 57 (north)

• 58 — 58 (north)

• 59 — 59 (north)

• 60 — 60 (north)

• 61 — 1 (south)

• 62 — 2 (south)

• 63 — 3 (south)

• 64 — 4 (south)

• 65 — 5 (south)

• 66 — 6 (south)

• 67 — 7 (south)

• 68 — 8 (south)

• 69 — 9 (south)

• 70 — 10 (south)

• 71 — 11 (south)

• 72 — 12 (south)

• 73 — 13 (south)

• 74 — 14 (south)

• 75 — 15 (south)

• 76 — 16 (south)

• 77 — 17 (south)

• 78 — 18 (south)

• 79 — 19 (south)

• 80 — 20 (south)

• 81 — 21 (south)

• 82 — 22 (south)

• 83 — 23 (south)

• 84 — 24 (south)

• 85 — 25 (south)

• 86 — 26 (south)

• 87 — 27 (south)

• 88 — 28 (south)

• 89 — 29 (south)

• 90 — 30 (south)

• 91 — 31 (south)

• 92 — 32 (south)

• 93 — 33 (south)

276 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 94 — 34 (south)

• 95 — 35 (south)

• 96 — 36 (south)

• 97 — 37 (south)

• 98 — 38 (south)

• 99 — 39 (south)

• 100 — 40 (south)

• 101 — 41 (south)

• 102 — 42 (south)

• 103 — 43 (south)

• 104 — 44 (south)

• 105 — 45 (south)

• 106 — 46 (south)

• 107 — 47 (south)

• 108 — 48 (south)

• 109 — 49 (south)

• 110 — 50 (south)

• 111 — 51 (south)

• 112 — 52 (south)

• 113 — 53 (south)

• 114 — 54 (south)

• 115 — 55 (south)

• 116 — 56 (south)

• 117 — 57 (south)

• 118 — 58 (south)

• 119 — 59 (south)

• 120 — 60 (south)

Default: 0

target state plane code

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — AK_10

• 2 — AK_2

• 3 — AK_3

• 4 — AK_4

• 5 — AK_5

• 6 — AK_6

• 7 — AK_7

• 8 — AK_8

18.2. LAStools 277

QGIS User Guide, Versão 2.6

• 9 — AK_9

• 10 — AL_E

• 11 — AL_W

• 12 — AR_N

• 13 — AR_S

• 14 — AZ_C

• 15 — AZ_E

• 16 — AZ_W

• 17 — CA_I

• 18 — CA_II

• 19 — CA_III

• 20 — CA_IV

• 21 — CA_V

• 22 — CA_VI

• 23 — CA_VII

• 24 — CO_C

• 25 — CO_N

• 26 — CO_S

• 27 — CT

• 28 — DE

• 29 — FL_E

• 30 — FL_N

• 31 — FL_W

• 32 — GA_E

• 33 — GA_W

• 34 — HI_1

• 35 — HI_2

• 36 — HI_3

• 37 — HI_4

• 38 — HI_5

• 39 — IA_N

• 40 — IA_S

• 41 — ID_C

• 42 — ID_E

• 43 — ID_W

• 44 — IL_E

• 45 — IL_W

• 46 — IN_E

• 47 — IN_W

278 Capítulo 18. Fornece algoritmos e processamento

• 48 — KS_N

• 49 — KS_S

• 50 — KY_N

• 51 — KY_S

• 52 — LA_N

• 53 — LA_S

• 54 — MA_I

• 55 — MA_M

• 56 — MD

• 57 — ME_E

• 58 — ME_W

• 59 — MI_C

• 60 — MI_N

• 61 — MI_S

• 62 — MN_C

• 63 — MN_N

• 64 — MN_S

• 65 — MO_C

• 66 — MO_E

• 67 — MO_W

• 68 — MS_E

• 69 — MS_W

• 70 — MT_C

• 71 — MT_N

• 72 — MT_S

• 73 — NC

• 74 — ND_N

• 75 — ND_S

• 76 — NE_N

• 77 — NE_S

• 78 — NH

• 79 — NJ

• 80 — NM_C

• 81 — NM_E

• 82 — NM_W

• 83 — NV_C

• 84 — NV_E

• 85 — NV_W

• 86 — NY_C

18.2. LAStools

QGIS User Guide, Versão 2.6

279

QGIS User Guide, Versão 2.6

• 87 — NY_E

• 88 — NY_LI

• 89 — NY_W

• 90 — OH_N

• 91 — OH_S

• 92 — OK_N

• 93 — OK_S

• 94 — OR_N

• 95 — OR_S

• 96 — PA_N

• 97 — PA_S

• 98 — PR

• 99 — RI

• 100 — SC_N

• 101 — SC_S

• 102 — SD_N

• 103 — SD_S

• 104 — St.Croix

• 105 — TN

• 106 — TX_C

• 107 — TX_N

• 108 — TX_NC

• 109 — TX_S

• 110 — TX_SC

• 111 — UT_C

• 112 — UT_N

• 113 — UT_S

• 114 — VA_N

• 115 — VA_S

• 116 — VT

• 117 — WA_N

• 118 — WA_S

• 119 — WI_C

• 120 — WI_N

• 121 — WI_S

• 122 — WV_N

• 123 — WV_S

• 124 — WY_E

• 125 — WY_EC

280 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 126 — WY_W

• 127 — WY_WC

Default: 0

Outputs output LAS/LAZ file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:las2lasproject’ , verbose, input_laslaz, source_projection, source_utm, source_sp, target_projection, target_utm, target_sp, output_laslaz)

See also

18.2.3 las2las_transform

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

transform (coordinates)

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — translate_x

• 2 — translate_y

• 3 — translate_z

• 4 — scale_x

• 5 — scale_y

• 6 — scale_z

• 7 — clamp_z_above

• 8 — clamp_z_below

Default: 0

value for transform (coordinates)

[string] <put parameter description here>

Default: (not set)

second transform (coordinates)

[selection] <put parameter description here>

Options:

• 0 — —

18.2. LAStools 281

QGIS User Guide, Versão 2.6

• 1 — translate_x

• 2 — translate_y

• 3 — translate_z

• 4 — scale_x

• 5 — scale_y

• 6 — scale_z

• 7 — clamp_z_above

• 8 — clamp_z_below

Default: 0

value for second transform (coordinates)

[string] <put parameter description here>

Default: (not set)

transform (intensities, scan angles, GPS times, ...)

[selection] <put description here> parameter

Options:

• 0 — —

• 1 — scale_intensity

• 2 — translate_intensity

• 3 — clamp_intensity_above

• 4 — clamp_intensity_below

• 5 — scale_scan_angle

• 6 — translate_scan_angle

• 7 — translate_gps_time

• 8 — set_classification

• 9 — set_user_data

• 10 — set_point_source

• 11 — scale_rgb_up

• 12 — scale_rgb_down

• 13 — repair_zero_returns

Default: 0

value for transform (intensities, scan angles, GPS times, ...)

[string] <put parameter description here>

Default: (not set)

second transform (intensities, scan angles, GPS times, ...)

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — scale_intensity

• 2 — translate_intensity

• 3 — clamp_intensity_above

• 4 — clamp_intensity_below

282 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 5 — scale_scan_angle

• 6 — translate_scan_angle

• 7 — translate_gps_time

• 8 — set_classification

• 9 — set_user_data

• 10 — set_point_source

• 11 — scale_rgb_up

• 12 — scale_rgb_down

• 13 — repair_zero_returns

Default: 0

value for second transform (intensities, scan angles, GPS times, ...)

[string]

<put parameter description here>

Default: (not set)

operations (first 7 need an argument)

[selection] <put parameter description here>

Options:

• 0 — —

• 1 — set_point_type

• 2 — set_point_size

• 3 — set_version_minor

• 4 — set_version_major

• 5 — start_at_point

• 6 — stop_at_point

• 7 — remove_vlr

• 8 — auto_reoffset

• 9 — week_to_adjusted

• 10 — adjusted_to_week

• 11 — scale_rgb_up

• 12 — scale_rgb_down

• 13 — remove_all_vlrs

• 14 — remove_extra

• 15 — clip_to_bounding_box

Default: 0

argument for operation

[string] <put parameter description here>

Default: (not set)

Outputs output LAS/LAZ file

[file] <put output description here>

18.2. LAStools 283

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’lidartools:las2lastransform’ , verbose, input_laslaz, transform_coordinate1, transform_coordinate1_arg, transform_coordinate2, transform_coordinate2_arg, transform_other1, transform_other1_arg, transform_other2, transform_other2_arg, operation, operationarg, output_laslaz)

See also

18.2.4 las2txt

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

parse_string

[string] <put parameter description here>

Default: xyz

Outputs

Output ASCII file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:las2txt’ , verbose, input_laslaz, parse_string, output)

See also

18.2.5 lasindex

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

is mobile or terrestrial LiDAR (not airborne)

[boolean] <put parameter description here>

Default: False

284 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Console usage

processing .

runalg( ’lidartools:lasindex’ , verbose, input_laslaz, mobile_or_terrestrial)

See also

18.2.6 lasinfo

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

Outputs

Output ASCII file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:lasinfo’ , verbose, input_laslaz, output)

See also

18.2.7 lasmerge

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

files are flightlines

[boolean] <put parameter description here>

Default: True

input LAS/LAZ file

[file] Optional.

<put parameter description here>

2nd file

[file] Optional.

<put parameter description here>

18.2. LAStools 285

QGIS User Guide, Versão 2.6

3rd file

[file] Optional.

<put parameter description here>

4th file

[file] Optional.

<put parameter description here>

5th file

[file] Optional.

<put parameter description here>

6th file

[file] Optional.

<put parameter description here>

7th file

[file] Optional.

<put parameter description here>

Outputs output LAS/LAZ file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:lasmerge’ , verbose, files_are_flightlines, input_laslaz, file2, file3, file4, file5, file6, file7, output_laslaz)

See also

18.2.8 lasprecision

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

Outputs

Output ASCII file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:lasprecision’ , verbose, input_laslaz, output)

286 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

18.2.9 lasquery

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

area of interest

[extent] <put parameter description here>

Default: 0,1,0,1

Outputs

Console usage

processing .

runalg( ’lidartools:lasquery’ , verbose, aoi)

See also

18.2.10 lasvalidate

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

Outputs

Output XML file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:lasvalidate’ , verbose, input_laslaz, output)

18.2. LAStools 287

QGIS User Guide, Versão 2.6

See also

18.2.11 laszip

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

input LAS/LAZ file

[file] Optional.

<put parameter description here>

only report size

[boolean] <put parameter description here>

Default: False

Outputs output LAS/LAZ file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:laszip’ , verbose, input_laslaz, report_size, output_laslaz)

See also

18.2.12 txt2las

Description

<put algortithm description here>

Parameters verbose

[boolean] <put parameter description here>

Default: False

Input ASCII file

[file] Optional.

<put parameter description here>

parse lines as

[string] <put parameter description here>

Default: xyz

skip the first n lines

[number] <put parameter description here>

Default: 0

resolution of x and y coordinate

[number] <put parameter description here>

Default: 0.01

288 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

resolution of z coordinate

[number] <put parameter description here>

Default: 0.01

Outputs output LAS/LAZ file

[file] <put output description here>

Console usage

processing .

runalg( ’lidartools:txt2las’ , verbose, input , parse_string, skip, scale_factor_xy, scale_factor_z, output_laslaz)

.

See also

18.3 Modeler Tools

18.3.1 Calculator

Description

<put algortithm description here>

Parameters

Formula

[string] <put parameter description here>

Default: (not set)

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

18.3. Modeler Tools 289

QGIS User Guide, Versão 2.6

dummy

[number] <put parameter description here>

Default: 0.0

dummy

[number] <put parameter description here>

Default: 0.0

Outputs

Result

[number] <put output description here>

Console usage

processing .

runalg( ’modelertools:calculator’ , formula, number0, number1, number2, number3, number4, number5, number6, number7, number8, number9)

See also

18.3.2 Raster layer bounds

Description

<put algortithm description here>

Parameters

Layer

[raster] <put parameter description here>

Outputs min X

[number] <put output description here>

max X

[number] <put output description here>

min Y

[number] <put output description here>

max Y

[number] <put output description here>

Extent

[extent] <put output description here>

Console usage

processing .

runalg( ’modelertools:rasterlayerbounds’ , layer)

See also

18.3.3 Vector layer bounds

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

290 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs min X

[number] <put output description here>

max X

[number] <put output description here>

min Y

[number] <put output description here>

max Y

[number] <put output description here>

Extent

[extent] <put output description here>

Console usage

processing .

runalg( ’modelertools:vectorlayerbounds’ , layer)

.

See also

18.4 OrfeoToolbox algorithm provider

.

Orfeo ToolBox (OTB) is an open source library of image processing algorithms. OTB is based on the medical image processing library ITK and offers particular functionalities for remote sensing image processing in general and for high spatial resolution images in particular. Targeted algorithms for high resolution optical images

(Pleiades, SPOT, QuickBird, WorldView, Landsat, Ikonos), hyperspectral sensors (Hyperion) or SAR (TerraSarX,

ERS, Palsar) are available.

Nota: Please remember that Processing contains only the interface description, so you need to install OTB by yourself and configure Processing properly.

18.4.1 Calibração

Optical calibration

Description

<put algortithm description here>

Parameters

Input

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Calibration Level

[selection] <put parameter description here>

Options:

• 0 — toa

Default: 0

18.4. OrfeoToolbox algorithm provider 291

QGIS User Guide, Versão 2.6

Convert to milli reflectance

[boolean] <put parameter description here>

Default: True

Clamp of reflectivity values between [0, 100]

[boolean] <put parameter description here>

Default: True

Relative Spectral Response File

[file] Optional.

<put parameter description here>

Outputs

Output

[raster] <put output description here>

Console usage

processing.runalg(’otb:opticalcalibration’, -in, -ram, -level, -milli, -clamp, -rsr, -out)

.

See also

18.4.2 Extração de feição

BinaryMorphologicalOperation (closing)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — closing

Default: 0

292 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:binarymorphologicaloperationclosing’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -out)

See also

BinaryMorphologicalOperation (dilate)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — dilate

Default: 0

Foreground Value

[number] <put parameter description here>

Default: 1

Background Value

[number] <put parameter description here>

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

18.4. OrfeoToolbox algorithm provider 293

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’otb:binarymorphologicaloperationdilate’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -filter.dilate.foreval, -filter.dilate.backval, -out)

See also

BinaryMorphologicalOperation (erode)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — erode

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:binarymorphologicaloperationerode’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -out)

See also

BinaryMorphologicalOperation (opening)

Description

<put algortithm description here>

294 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — opening

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:binarymorphologicaloperationopening’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -out)

See also

EdgeExtraction (gradient)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Edge feature

[selection] <put parameter description here>

Options:

18.4. OrfeoToolbox algorithm provider 295

QGIS User Guide, Versão 2.6

• 0 — gradient

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:edgeextractiongradient’, -in, -channel, -ram, -filter, -out)

See also

EdgeExtraction (sobel)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Edge feature

[selection] <put parameter description here>

Options:

• 0 — sobel

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:edgeextractionsobel’, -in, -channel, -ram, -filter, -out)

See also

EdgeExtraction (touzi)

Description

<put algortithm description here>

296 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Edge feature

[selection] <put parameter description here>

Options:

• 0 — touzi

Default: 0

The Radius

[number] <put parameter description here>

Default: 1

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:edgeextractiontouzi’, -in, -channel, -ram, -filter, -filter.touzi.xradius, -out)

See also

GrayScaleMorphologicalOperation (closing)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

18.4. OrfeoToolbox algorithm provider 297

QGIS User Guide, Versão 2.6

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — closing

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:grayscalemorphologicaloperationclosing’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -out)

See also

GrayScaleMorphologicalOperation (dilate)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — dilate

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

298 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’otb:grayscalemorphologicaloperationdilate’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -out)

See also

GrayScaleMorphologicalOperation (erode)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — erode

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:grayscalemorphologicaloperationerode’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -out)

See also

GrayScaleMorphologicalOperation (opening)

Description

<put algortithm description here>

18.4. OrfeoToolbox algorithm provider 299

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Structuring Element Type

[selection] <put parameter description here>

Options:

• 0 — ball

Default: 0

The Structuring Element Radius

[number] <put parameter description here>

Default: 5

Morphological Operation

[selection] <put parameter description here>

Options:

• 0 — opening

Default: 0

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:grayscalemorphologicaloperationopening’, -in, -channel, -ram, -structype, -structype.ball.xradius, -filter, -out)

See also

Haralick Texture Extraction

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

X Radius

[number] <put parameter description here>

Default: 2

300 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Y Radius

[number] <put parameter description here>

Default: 2

X Offset

[number] <put parameter description here>

Default: 1

Y Offset

[number] <put parameter description here>

Default: 1

Image Minimum

[number] <put parameter description here>

Default: 0

Image Maximum

[number] <put parameter description here>

Default: 255

Histogram number of bin

[number] <put parameter description here>

Default: 8

Texture Set Selection

[selection] <put parameter description here>

Options:

• 0 — simple

• 1 — advanced

• 2 — higher

Default: 0

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:haralicktextureextraction’, -in, -channel, -ram, -parameters.xrad, -parameters.yrad, -parameters.xoff, -parameters.yoff, -parameters.min, -parameters.max, -parameters.nbbin, -texture, -out)

See also

Line segment detection

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

No rescaling in [0, 255]

[boolean] <put parameter description here>

Default: True

18.4. OrfeoToolbox algorithm provider 301

QGIS User Guide, Versão 2.6

Outputs

Output Detected lines

[vector] <put output description here>

Console usage

processing.runalg(’otb:linesegmentdetection’, -in, -norescale, -out)

See also

Local Statistic Extraction

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Selected Channel

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Neighborhood radius

[number] <put parameter description here>

Default: 3

Outputs

Feature Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:localstatisticextraction’, -in, -channel, -ram, -radius, -out)

See also

Multivariate alteration detector

Description

<put algortithm description here>

302 Capítulo 18. Fornece algoritmos e processamento

18.4. OrfeoToolbox algorithm provider

QGIS User Guide, Versão 2.6

Parameters

Input Image 1

[raster] <put parameter description here>

Input Image 2

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Change Map

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:multivariatealterationdetector’ , in1, in2, ram, out)

See also

Radiometric Indices

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Blue Channel

[number] <put parameter description here>

Default: 1

Green Channel

[number] <put parameter description here>

Default: 1

Red Channel

[number] <put parameter description here>

Default: 1

NIR Channel

[number] <put parameter description here>

Default: 1

Mir Channel

[number] <put parameter description here>

Default: 1

Available Radiometric Indices

[selection] <put parameter description here>

Options:

• 0 — ndvi

• 1 — tndvi

• 2 — rvi

303

QGIS User Guide, Versão 2.6

• 3 — savi

• 4 — tsavi

• 5 — msavi

• 6 — msavi2

• 7 — gemi

• 8 — ipvi

• 9 — ndwi

• 10 — ndwi2

• 11 — mndwi

• 12 — ndpi

• 13 — ndti

• 14 — ri

• 15 — ci

• 16 — bi

• 17 — bi2

Default: 0

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:radiometricindices’, -in, -ram, -channels.blue, -channels.green, -channels.red, -channels.nir, -channels.mir, -list, -out)

.

See also

18.4.3 Geometria

Image Envelope

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Sampling Rate

[number] <put parameter description here>

Default: 0

304 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Projection

[string] Optional.

<put parameter description here>

Default: None

Outputs

Output Vector Data

[vector] <put output description here>

Console usage

processing.runalg(’otb:imageenvelope’, -in, -sr, -proj, -out)

See also

OrthoRectification (epsg)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Output Cartographic Map Projection

[selection] <put parameter description here>

Options:

• 0 — epsg

Default: 0

EPSG Code

[number] <put parameter description here>

Default: 4326

Parameters estimation modes

[selection] <put parameter description here>

Options:

• 0 — autosize

• 1 — autospacing

Default: 0

Default pixel value

[number] <put parameter description here>

Default: 0

Default elevation

[number] <put parameter description here>

Default: 0

Interpolation

[selection] <put parameter description here>

Options:

• 0 — bco

• 1 — nn

• 2 — linear

18.4. OrfeoToolbox algorithm provider 305

QGIS User Guide, Versão 2.6

Default: 0

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Resampling grid spacing

[number] <put parameter description here>

Default: 4

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:orthorectificationepsg’, -io.in, -map, -map.epsg.code, -outputs.mode, -outputs.default, -elev.default, -interpolator, -interpolator.bco.radius, -opt.ram, -opt.gridspacing, -io.out)

See also

OrthoRectification (fit-to-ortho)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Parameters estimation modes

[selection] <put parameter description here>

Options:

• 0 — orthofit

Default: 0

Model ortho-image

[raster] Optional.

<put parameter description here>

Default pixel value

[number] <put parameter description here>

Default: 0

Default elevation

[number] <put parameter description here>

Default: 0

Interpolation

[selection] <put parameter description here>

Options:

• 0 — bco

• 1 — nn

• 2 — linear

Default: 0

306 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Resampling grid spacing

[number] <put parameter description here>

Default: 4

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:orthorectificationfittoortho’, -io.in, -outputs.mode, -outputs.ortho, -outputs.default, -elev.default, -interpolator, -interpolator.bco.radius, -opt.ram, -opt.gridspacing, -io.out)

See also

OrthoRectification (lambert-WGS84)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Output Cartographic Map Projection

[selection] <put parameter description here>

Options:

• 0 — lambert2

• 1 — lambert93

• 2 — wgs

Default: 0

Parameters estimation modes

[selection] <put parameter description here>

Options:

• 0 — autosize

• 1 — autospacing

Default: 0

Default pixel value

[number] <put parameter description here>

Default: 0

Default elevation

[number] <put parameter description here>

Default: 0

Interpolation

[selection] <put parameter description here>

Options:

18.4. OrfeoToolbox algorithm provider 307

QGIS User Guide, Versão 2.6

• 0 — bco

• 1 — nn

• 2 — linear

Default: 0

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Resampling grid spacing

[number] <put parameter description here>

Default: 4

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:orthorectificationlambertwgs84’, -io.in, -map, -outputs.mode, -outputs.default, -elev.default, -interpolator, -interpolator.bco.radius, -opt.ram, -opt.gridspacing, -io.out)

See also

OrthoRectification (utm)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Output Cartographic Map Projection

[selection] <put parameter description here>

Options:

• 0 — utm

Default: 0

Zone number

[number] <put parameter description here>

Default: 31

Northern Hemisphere

[boolean] <put parameter description here>

Default: True

Parameters estimation modes

[selection] <put parameter description here>

Options:

• 0 — autosize

• 1 — autospacing

Default: 0

308 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Default pixel value

[number] <put parameter description here>

Default: 0

Default elevation

[number] <put parameter description here>

Default: 0

Interpolation

[selection] <put parameter description here>

Options:

• 0 — bco

• 1 — nn

• 2 — linear

Default: 0

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Resampling grid spacing

[number] <put parameter description here>

Default: 4

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:orthorectificationutm’, -io.in, -map, -map.utm.zone, -map.utm.northhem, -outputs.mode, -outputs.default, -elev.default, -interpolator, -interpolator.bco.radius, -opt.ram, -opt.gridspacing, -io.out)

See also

Pansharpening (bayes)

Description

<put algortithm description here>

Parameters

Input PAN Image

[raster] <put parameter description here>

Input XS Image

[raster] <put parameter description here>

Algorithm

[selection] <put parameter description here>

Options:

• 0 — bayes

Default: 0

Weight

[number] <put parameter description here>

Default: 0.9999

18.4. OrfeoToolbox algorithm provider 309

QGIS User Guide, Versão 2.6

S coefficient

[number] <put parameter description here>

Default: 1

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output image

[raster] <put output description here>

Console usage

processing.runalg(’otb:pansharpeningbayes’, -inp, -inxs, -method, -method.bayes.lambda, -method.bayes.s, -ram, -out)

See also

Pansharpening (lmvm)

Description

<put algortithm description here>

Parameters

Input PAN Image

[raster] <put parameter description here>

Input XS Image

[raster] <put parameter description here>

Algorithm

[selection] <put parameter description here>

Options:

• 0 — lmvm

Default: 0

X radius

[number] <put parameter description here>

Default: 3

Y radius

[number] <put parameter description here>

Default: 3

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:pansharpeninglmvm’ , inp, inxs, method, method .

lmvm .

radiusx, method .

lmvm .

radiusy, ram, out)

310 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Pansharpening (rcs)

Description

<put algortithm description here>

Parameters

Input PAN Image

[raster] <put parameter description here>

Input XS Image

[raster] <put parameter description here>

Algorithm

[selection] <put parameter description here>

Options:

• 0 — rcs

Default: 0

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:pansharpeningrcs’ , inp, inxs, method, ram, out)

See also

RigidTransformResample (id)

Description

<put algortithm description here>

Parameters

Input image

[raster] <put parameter description here>

Type of transformation

[selection] <put parameter description here>

Options:

• 0 — id

Default: 0

X scaling

[number] <put parameter description here>

Default: 1

18.4. OrfeoToolbox algorithm provider 311

QGIS User Guide, Versão 2.6

Y scaling

[number] <put parameter description here>

Default: 1

Interpolation

[selection] <put parameter description here>

Options:

• 0 — nn

• 1 — linear

• 2 — bco

Default: 2

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output image

[raster] <put output description here>

Console usage

processing.runalg(’otb:rigidtransformresampleid’, -in, -transform.type, -transform.type.id.scalex, -transform.type.id.scaley, -interpolator, -interpolator.bco.radius, -ram, -out)

See also

RigidTransformResample (rotation)

Description

<put algortithm description here>

Parameters

Input image

[raster] <put parameter description here>

Type of transformation

[selection] <put parameter description here>

Options:

• 0 — rotation

Default: 0

Rotation angle

[number] <put parameter description here>

Default: 0

X scaling

[number] <put parameter description here>

Default: 1

Y scaling

[number] <put parameter description here>

Default: 1

312 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Interpolation

[selection] <put parameter description here>

Options:

• 0 — nn

• 1 — linear

• 2 — bco

Default: 2

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output image

[raster] <put output description here>

Console usage

processing.runalg(’otb:rigidtransformresamplerotation’, -in, -transform.type, -transform.type.rotation.angle, -transform.type.rotation.scalex, -transform.type.rotation.scaley, -interpolator, -interpolator.bco.radius, -ram, -out)

See also

RigidTransformResample (translation)

Description

<put algortithm description here>

Parameters

Input image

[raster] <put parameter description here>

Type of transformation

[selection] <put parameter description here>

Options:

• 0 — translation

Default: 0

The X translation (in physical units)

[number] <put parameter description here>

Default: 0

The Y translation (in physical units)

[number] <put parameter description here>

Default: 0

X scaling

[number] <put parameter description here>

Default: 1

Y scaling

[number] <put parameter description here>

Default: 1

18.4. OrfeoToolbox algorithm provider 313

QGIS User Guide, Versão 2.6

Interpolation

[selection] <put parameter description here>

Options:

• 0 — nn

• 1 — linear

• 2 — bco

Default: 2

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output image

[raster] <put output description here>

Console usage

processing.runalg(’otb:rigidtransformresampletranslation’, -in, -transform.type, -transform.type.translation.tx, -transform.type.translation.ty, -transform.type.translation.scalex, -transform.type.translation.scaley, -interpolator, -interpolator.bco.radius, -ram, -out)

See also

Superimpose sensor

Description

<put algortithm description here>

Parameters

Reference input

[raster] <put parameter description here>

The image to reproject

[raster] <put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Spacing of the deformation field

[number] <put parameter description here>

Default: 4

Interpolation

[selection] <put parameter description here>

Options:

• 0 — bco

• 1 — nn

• 2 — linear

Default: 0

Radius for bicubic interpolation

[number] <put parameter description here>

Default: 2

314 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:superimposesensor’ , inr, inm, elev .

default, lms, interpolator, interpolator .

bco .

radius, ram, out)

.

See also

18.4.4 Filtragem de imagem

DimensionalityReduction (ica)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Algorithm

[selection] <put parameter description here>

Options:

• 0 — ica

Default: 0

number of iterations

[number] <put parameter description here>

Default: 20

Give the increment weight of W in [0, 1]

[number] <put parameter description here>

Default: 1

Number of Components

[number] <put parameter description here>

Default: 0

Normalize

[boolean] <put parameter description here>

Default: True

Outputs

Output Image

[raster] <put output description here>

‘‘ Inverse Output Image‘‘ [raster] <put output description here>

Transformation matrix output

[file] <put output description here>

18.4. OrfeoToolbox algorithm provider 315

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’otb:dimensionalityreductionica’, -in, -method, -method.ica.iter, -method.ica.mu, -nbcomp, -normalize, -out, -outinv, -outmatrix)

See also

DimensionalityReduction (maf)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Algorithm

[selection] <put parameter description here>

Options:

• 0 — maf

Default: 0

Number of Components.

[number] <put parameter description here>

Default: 0

Normalize.

[boolean] <put parameter description here>

Default: True

Outputs

Output Image

[raster] <put output description here>

Transformation matrix output

[file] <put output description here>

Console usage

processing.runalg(’otb:dimensionalityreductionmaf’, -in, -method, -nbcomp, -normalize, -out, -outmatrix)

See also

DimensionalityReduction (napca)

Description

<put algortithm description here>

316 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Algorithm

[selection] <put parameter description here>

Options:

• 0 — napca

Default: 0

Set the x radius of the sliding window.

[number] <put parameter description here>

Default: 1

Set the y radius of the sliding window.

[number] <put parameter description here>

Default: 1

Number of Components.

[number] <put parameter description here>

Default: 0

Normalize.

[boolean] <put parameter description here>

Default: True

Outputs

Output Image

[raster] <put output description here>

‘‘ Inverse Output Image‘‘ [raster] <put output description here>

Transformation matrix output

[file] <put output description here>

Console usage

processing.runalg(’otb:dimensionalityreductionnapca’, -in, -method, -method.napca.radiusx, -method.napca.radiusy, -nbcomp, -normalize, -out, -outinv, -outmatrix)

See also

DimensionalityReduction (pca)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Algorithm

[selection] <put parameter description here>

Options:

• 0 — pca

Default: 0

Number of Components.

[number] <put parameter description here>

Default: 0

18.4. OrfeoToolbox algorithm provider 317

QGIS User Guide, Versão 2.6

Normalize.

[boolean] <put parameter description here>

Default: True

Outputs

Output Image

[raster] <put output description here>

‘‘ Inverse Output Image‘‘ [raster] <put output description here>

Transformation matrix output

[file] <put output description here>

Console usage

processing.runalg(’otb:dimensionalityreductionpca’, -in, -method, -nbcomp, -normalize, -out, -outinv, -outmatrix)

See also

Mean Shift filtering (can be used as Exact Large-Scale Mean-Shift segmentation, step 1)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Spatial radius

[number] <put parameter description here>

Default: 5

Range radius

[number] <put parameter description here>

Default: 15

Mode convergence threshold

[number] <put parameter description here>

Default: 0.1

Maximum number of iterations

[number] <put parameter description here>

Default: 100

Range radius coefficient

[number] <put parameter description here>

Default: 0

Mode search.

[boolean] <put parameter description here>

Default: True

Outputs

Filtered output

[raster] <put output description here>

Spatial image

[raster] <put output description here>

318 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’otb:meanshiftfilteringcanbeusedasexactlargescalemeanshiftsegmentationstep1’, -in, -spatialr, -ranger, -thres, -maxiter, -rangeramp, -modesearch, -fout, -foutpos)

See also

Smoothing (anidif)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Smoothing Type

[selection] <put parameter description here>

Options:

• 0 — anidif

Default: 2

Time Step

[number] <put parameter description here>

Default: 0.125

Nb Iterations

[number] <put parameter description here>

Default: 10

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:smoothinganidif’, -in, -ram, -type, -type.anidif.timestep, -type.anidif.nbiter, -out)

See also

Smoothing (gaussian)

Description

<put algortithm description here>

18.4. OrfeoToolbox algorithm provider 319

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Smoothing Type

[selection] <put parameter description here>

Options:

• 0 — gaussian

Default: 2

Radius

[number] <put parameter description here>

Default: 2

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:smoothinggaussian’, -in, -ram, -type, -type.gaussian.radius, -out)

See also

Smoothing (mean)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Smoothing Type

[selection] <put parameter description here>

Options:

• 0 — mean

Default: 2

Radius

[number] <put parameter description here>

Default: 2

Outputs

Output Image

[raster] <put output description here>

320 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’otb:smoothingmean’, -in, -ram, -type, -type.mean.radius, -out)

.

See also

18.4.5 Manipulação de imagem

ColorMapping (continuous)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Operation

[selection] <put parameter description here>

Options:

• 0 — labeltocolor

Default: 0

Color mapping method

[selection] <put parameter description here>

Options:

• 0 — continuous

Default: 0

Look-up tables

[selection] <put parameter description here>

Options:

• 0 — red

• 1 — green

• 2 — blue

• 3 — grey

• 4 — hot

• 5 — cool

• 6 — spring

• 7 — summer

• 8 — autumn

• 9 — winter

• 10 — copper

18.4. OrfeoToolbox algorithm provider 321

QGIS User Guide, Versão 2.6

• 11 — jet

• 12 — hsv

• 13 — overunder

• 14 — relief

Default: 0

Mapping range lower value

[number] <put parameter description here>

Default: 0

Mapping range higher value

[number] <put parameter description here>

Default: 255

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:colormappingcontinuous’, -in, -ram, -op, -method, -method.continuous.lut, -method.continuous.min, -method.continuous.max, -out)

See also

ColorMapping (custom)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Operation

[selection] <put parameter description here>

Options:

• 0 — labeltocolor

Default: 0

Color mapping method

[selection] <put parameter description here>

Options:

• 0 — custom

Default: 0

Look-up table file

[file] <put parameter description here>

322 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:colormappingcustom’, -in, -ram, -op, -method, -method.custom.lut, -out)

See also

ColorMapping (image)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Operation

[selection] <put parameter description here>

Options:

• 0 — labeltocolor

Default: 0

Color mapping method

[selection] <put parameter description here>

Options:

• 0 — image

Default: 0

Support Image

[raster] <put parameter description here>

NoData value

[number] <put parameter description here>

Default: 0

lower quantile

[number] <put parameter description here>

Default: 2

upper quantile

[number] <put parameter description here>

Default: 2

Outputs

Output Image

[raster] <put output description here>

18.4. OrfeoToolbox algorithm provider 323

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’otb:colormappingimage’, -in, -ram, -op, -method, -method.image.in, -method.image.nodatavalue, -method.image.low, -method.image.up, -out)

See also

ColorMapping (optimal)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Operation

[selection] <put parameter description here>

Options:

• 0 — labeltocolor

Default: 0

Color mapping method

[selection] <put parameter description here>

Options:

• 0 — optimal

Default: 0

Background label

[number] <put parameter description here>

Default: 0

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:colormappingoptimal’, -in, -ram, -op, -method, -method.optimal.background, -out)

See also

ExtractROI (fit)

Description

<put algortithm description here>

324 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Extraction mode

[selection] <put parameter description here>

Options:

• 0 — fit

Default: 0

Reference image

[raster] <put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:extractroifit’, -in, -ram, -mode, -mode.fit.ref, -mode.fit.elev.default, -out)

See also

ExtractROI (standard)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Extraction mode

[selection] <put parameter description here>

Options:

• 0 — standard

Default: 0

Start X

[number] <put parameter description here>

Default: 0

Start Y

[number] <put parameter description here>

Default: 0

18.4. OrfeoToolbox algorithm provider 325

QGIS User Guide, Versão 2.6

Size X

[number] <put parameter description here>

Default: 0

Size Y

[number] <put parameter description here>

Default: 0

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:extractroistandard’, -in, -ram, -mode, -startx, -starty, -sizex, -sizey, -out)

See also

Images Concatenation

Description

<put algortithm description here>

Parameters

Input images list

[multipleinput: rasters] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output Image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:imagesconcatenation’ , il, ram, out)

See also

Image Tile Fusion

Description

<put algortithm description here>

326 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input Tile Images

[multipleinput: rasters] <put parameter description here>

Number of tile columns

[number] <put parameter description here>

Default: 0

Number of tile rows

[number] <put parameter description here>

Default: 0

Outputs

Output Image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:imagetilefusion’ , il, cols, rows, out)

See also

Read image information

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Display the OSSIM keywordlist

[boolean] <put parameter description here>

Default: True

GCPs Id

[string] <put parameter description here>

Default: None

GCPs Info

[string] <put parameter description here>

Default: None

GCPs Image Coordinates

[string] <put parameter description here>

Default: None

GCPs Geographic Coordinates

[string] <put parameter description here>

Default: None

Outputs

Console usage

processing.runalg(’otb:readimageinformation’, -in, -keywordlist, -gcp.ids, -gcp.info, -gcp.imcoord, -gcp.geocoord)

18.4. OrfeoToolbox algorithm provider 327

QGIS User Guide, Versão 2.6

See also

Rescale Image

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Output min value

[number] <put parameter description here>

Default: 0

Output max value

[number] <put parameter description here>

Default: 255

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:rescaleimage’, -in, -ram, -outmin, -outmax, -out)

See also

Split Image

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output Image

[file] <put output description here>

328 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’otb:splitimage’, -in, -ram, -out)

.

See also

18.4.6 Aprendizado

Classification Map Regularization

Description

<put algortithm description here>

Parameters

Input classification image

[raster] <put parameter description here>

Structuring element radius (in pixels)

[number] <put parameter description here>

Default: 1

Multiple majority: Undecided(X)/Original

[boolean] <put parameter description here>

Default: True

Label for the NoData class

[number] <put parameter description here>

Default: 0

Label for the Undecided class

[number] <put parameter description here>

Default: 0

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output regularized image

[raster] <put output description here>

Console usage

processing.runalg(’otb:classificationmapregularization’, -io.in, -ip.radius, -ip.suvbool, -ip.nodatalabel, -ip.undecidedlabel, -ram, -io.out)

See also

ComputeConfusionMatrix (raster)

Description

<put algortithm description here>

18.4. OrfeoToolbox algorithm provider 329

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Ground truth

[selection] <put parameter description here>

Options:

• 0 — raster

Default: 0

Input reference image

[raster] <put parameter description here>

Value for nodata pixels

[number] <put parameter description here>

Default: 0

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Matrix output

[file] <put output description here>

Console usage

processing.runalg(’otb:computeconfusionmatrixraster’, -in, -ref, -ref.raster.in, -nodatalabel, -ram, -out)

See also

ComputeConfusionMatrix (vector)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Ground truth

[selection] <put parameter description here>

Options:

• 0 — vector

Default: 0

Input reference vector data

[file] <put parameter description here>

Field name

[string] Optional.

<put parameter description here>

Default: Class

Value for nodata pixels

[number] <put parameter description here>

Default: 0

330 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Matrix output

[file] <put output description here>

Console usage

processing.runalg(’otb:computeconfusionmatrixvector’, -in, -ref, -ref.vector.in, -ref.vector.field, -nodatalabel, -ram, -out)

See also

Compute Images second order statistics

Description

<put algortithm description here>

Parameters

Input images

[multipleinput: rasters] <put parameter description here>

Background Value

[number] <put parameter description here>

Default: 0.0

Outputs

Output XML file

[file] <put output description here>

Console usage

processing .

runalg( ’otb:computeimagessecondorderstatistics’ , il, bv, out)

See also

FusionOfClassifications (dempstershafer)

Description

<put algortithm description here>

Parameters

Input classifications

[multipleinput: rasters] <put parameter description here>

Fusion method

[selection] <put parameter description here>

Options:

18.4. OrfeoToolbox algorithm provider 331

QGIS User Guide, Versão 2.6

• 0 — dempstershafer

Default: 0

Confusion Matrices

[multipleinput: files] <put parameter description here>

Mass of belief measurement

[selection] <put parameter description here>

Options:

• 0 — precision

• 1 — recall

• 2 — accuracy

• 3 — kappa

Default: 0

Label for the NoData class

[number] <put parameter description here>

Default: 0

Label for the Undecided class

[number] <put parameter description here>

Default: 0

Outputs

The output classification image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:fusionofclassificationsdempstershafer’ , il, method, method .

dempstershafer .

cmfl, method .

dempstershafer .

mob, nodatalabel, undecidedlabel, out)

See also

FusionOfClassifications (majorityvoting)

Description

<put algortithm description here>

Parameters

Input classifications

[multipleinput: rasters] <put parameter description here>

Fusion method

[selection] <put parameter description here>

Options:

• 0 — majorityvoting

Default: 0

Label for the NoData class

[number] <put parameter description here>

Default: 0

Label for the Undecided class

[number] <put parameter description here>

Default: 0

332 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

The output classification image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:fusionofclassificationsmajorityvoting’ , il, method, nodatalabel, undecidedlabel, out)

See also

Image Classification

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Input Mask

[raster] Optional.

<put parameter description here>

Model file

[file] <put parameter description here>

Statistics file

[file] Optional.

<put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:imageclassification’, -in, -mask, -model, -imstat, -ram, -out)

See also

SOM Classification

Description

<put algortithm description here>

18.4. OrfeoToolbox algorithm provider 333

QGIS User Guide, Versão 2.6

Parameters

InputImage

[raster] <put parameter description here>

ValidityMask

[raster] Optional.

<put parameter description here>

TrainingProbability

[number] <put parameter description here>

Default: 1

TrainingSetSize

[number] <put parameter description here>

Default: 0

StreamingLines

[number] <put parameter description here>

Default: 0

SizeX

[number] <put parameter description here>

Default: 32

SizeY

[number] <put parameter description here>

Default: 32

NeighborhoodX

[number] <put parameter description here>

Default: 10

NeighborhoodY

[number] <put parameter description here>

Default: 10

NumberIteration

[number] <put parameter description here>

Default: 5

BetaInit

[number] <put parameter description here>

Default: 1

BetaFinal

[number] <put parameter description here>

Default: 0.1

InitialValue

[number] <put parameter description here>

Default: 0

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

OutputImage

[raster] <put output description here>

SOM Map

[raster] <put output description here>

Console usage

processing.runalg(’otb:somclassification’, -in, -vm, -tp, -ts, -sl, -sx, -sy, -nx, -ny, -ni, -bi, -bf, -iv, -ram, -rand, -out, -som)

334 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

TrainImagesClassifier (ann)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — ann

Default: 0

Train Method Type

[selection] <put parameter description here>

Options:

• 0 — reg

• 1 — back

Default: 0

Number of neurons in each intermediate layer

[string] <put parameter description here>

Default: None

Neuron activation function type

[selection] <put parameter description here>

Options:

• 0 — ident

• 1 — sig

18.4. OrfeoToolbox algorithm provider 335

QGIS User Guide, Versão 2.6

• 2 — gau

Default: 1

Alpha parameter of the activation function

[number] <put parameter description here>

Default: 1

Beta parameter of the activation function

[number] <put parameter description here>

Default: 1

Strength of the weight gradient term in the BACKPROP method

[number] <put parameter description here>

Default: 0.1

Strength of the momentum term (the difference between weights on the 2 previous iterations)

[number]

<put parameter description here>

Default: 0.1

Initial value Delta_0 of update-values Delta_{ij} in RPROP method

[number]

<put parameter description here>

Default: 0.1

Update-values lower limit Delta_{min} in RPROP method

[number] <put parameter description here>

Default: 1e-07

Termination criteria

[selection] <put parameter description here>

Options:

• 0 — iter

• 1 — eps

• 2 — all

Default: 2

Epsilon value used in the Termination criteria

[number] <put parameter description here>

Default: 0.01

Maximum number of iterations used in the Termination criteria

[number] <put parameter description here>

Default: 1000

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifierann’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

ann .

t, classifier .

ann .

sizes, classifier .

ann .

f, classifier .

ann .

a, classifier .

ann .

b, classifier .

ann .

bpdw, classifier .

ann .

bpms, classifier .

ann .

rdw, classifier .

ann .

rdwm, classifier .

ann .

term, classifier .

ann .

eps, classifier .

ann .

iter, rand, io .

confmatout, io .

out)

336 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

TrainImagesClassifier (bayes)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — bayes

Default: 0

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifierbayes’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, rand, io .

confmatout, io .

out)

18.4. OrfeoToolbox algorithm provider 337

QGIS User Guide, Versão 2.6

See also

TrainImagesClassifier (boost)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — boost

Default: 0

Boost Type

[selection] <put parameter description here>

Options:

• 0 — discrete

• 1 — real

• 2 — logit

• 3 — gentle

Default: 1

Weak count

[number] <put parameter description here>

Default: 100

Weight Trim Rate

[number] <put parameter description here>

Default: 0.95

338 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Maximum depth of the tree

[number] <put parameter description here>

Default: 1

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifierboost’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

boost .

t, classifier .

boost .

w, classifier .

boost .

r, classifier .

boost .

m, rand, io .

confmatout, io .

out)

See also

TrainImagesClassifier (dt)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — dt

18.4. OrfeoToolbox algorithm provider 339

QGIS User Guide, Versão 2.6

Default: 0

Maximum depth of the tree

[number] <put parameter description here>

Default: 65535

Minimum number of samples in each node

[number] <put parameter description here>

Default: 10

Termination criteria for regression tree

[number] <put parameter description here>

Default: 0.01

Cluster possible values of a categorical variable into K <= cat clusters to find a suboptimal split

[number]

<put parameter description here>

Default: 10

K-fold cross-validations

[number] <put parameter description here>

Default: 10

Set Use1seRule flag to false

[boolean] <put parameter description here>

Default: True

Set TruncatePrunedTree flag to false

[boolean] <put parameter description here>

Default: True

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifierdt’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

dt .

max, classifier .

dt .

min, classifier .

dt .

ra, classifier .

dt .

cat, classifier .

dt .

f, classifier .

dt .

r, classifier .

dt .

t, rand, io .

confmatout, io .

out)

See also

TrainImagesClassifier (gbt)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

340 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — gbt

Default: 0

Number of boosting algorithm iterations

[number] <put parameter description here>

Default: 200

Regularization parameter

[number] <put parameter description here>

Default: 0.01

Portion of the whole training set used for each algorithm iteration

[number]

<put parameter description here>

Default: 0.8

Maximum depth of the tree

[number] <put parameter description here>

Default: 3

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifiergbt’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

gbt .

w, classifier .

gbt .

s, classifier .

gbt .

p, classifier .

gbt .

max, rand, io .

confmatout, io .

out)

18.4. OrfeoToolbox algorithm provider 341

QGIS User Guide, Versão 2.6

See also

TrainImagesClassifier (knn)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — knn

Default: 0

Number of Neighbors

[number] <put parameter description here>

Default: 32

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

342 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’otb:trainimagesclassifierknn’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

knn .

k, rand, io .

confmatout, io .

out)

See also

TrainImagesClassifier (libsvm)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — libsvm

Default: 0

SVM Kernel Type

[selection] <put parameter description here>

Options:

• 0 — linear

• 1 — rbf

• 2 — poly

• 3 — sigmoid

Default: 0

18.4. OrfeoToolbox algorithm provider 343

QGIS User Guide, Versão 2.6

Cost parameter C

[number] <put parameter description here>

Default: 1

Parameters optimization

[boolean] <put parameter description here>

Default: True

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifierlibsvm’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

libsvm .

k, classifier .

libsvm .

c, classifier .

libsvm .

opt, rand, io .

confmatout, io .

out)

See also

TrainImagesClassifier (rf)

Description

<put algortithm description here>

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

344 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — rf

Default: 0

Maximum depth of the tree

[number] <put parameter description here>

Default: 5

Minimum number of samples in each node

[number] <put parameter description here>

Default: 10

Termination Criteria for regression tree

[number] <put parameter description here>

Default: 0

Cluster possible values of a categorical variable into K <= cat clusters to find a suboptimal split

[number]

<put parameter description here>

Default: 10

Size of the randomly selected subset of features at each tree node

[number]

<put parameter description here>

Default: 0

Maximum number of trees in the forest

[number] <put parameter description here>

Default: 100

Sufficient accuracy (OOB error)

[number] <put parameter description here>

Default: 0.01

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifierrf’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

rf .

max, classifier .

rf .

min, classifier .

rf .

ra, classifier .

rf .

cat, classifier .

rf .

var, classifier .

rf .

nbtrees, classifier .

rf .

acc, rand, io .

confmatout, io .

out)

See also

TrainImagesClassifier (svm)

Description

<put algortithm description here>

18.4. OrfeoToolbox algorithm provider 345

QGIS User Guide, Versão 2.6

Parameters

Input Image List

[multipleinput: rasters] <put parameter description here>

Input Vector Data List

[multipleinput: any vectors] <put parameter description here>

Input XML image statistics file

[file] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Maximum training sample size per class

[number] <put parameter description here>

Default: 1000

Maximum validation sample size per class

[number] <put parameter description here>

Default: 1000

On edge pixel inclusion

[boolean] <put parameter description here>

Default: True

Training and validation sample ratio

[number] <put parameter description here>

Default: 0.5

Name of the discrimination field

[string] <put parameter description here>

Default: Class

Classifier to use for the training

[selection] <put parameter description here>

Options:

• 0 — svm

Default: 0

SVM Model Type

[selection] <put parameter description here>

Options:

• 0 — csvc

• 1 — nusvc

• 2 — oneclass

Default: 0

SVM Kernel Type

[selection] <put parameter description here>

Options:

• 0 — linear

• 1 — rbf

• 2 — poly

• 3 — sigmoid

Default: 0

Cost parameter C

[number] <put parameter description here>

Default: 1

Parameter nu of a SVM optimization problem (NU_SVC / ONE_CLASS)

[number] <put parameter description here>

Default: 0

346 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameter coef0 of a kernel function (POLY / SIGMOID)

[number] <put parameter description here>

Default: 0

Parameter gamma of a kernel function (POLY / RBF / SIGMOID)

[number] <put parameter description here>

Default: 1

Parameter degree of a kernel function (POLY)

[number] <put parameter description here>

Default: 1

Parameters optimization

[boolean] <put parameter description here>

Default: True

set user defined seed

[number] <put parameter description here>

Default: 0

Outputs

Output confusion matrix

[file] <put output description here>

Output model

[file] <put output description here>

Console usage

processing .

runalg( ’otb:trainimagesclassifiersvm’ , io .

il, io .

vd, io .

imstat, elev .

default, sample .

mt, sample .

mv, sample .

edg, sample .

vtr, sample .

vfn, classifier, classifier .

svm .

m, classifier .

svm .

k, classifier .

svm .

c, classifier .

svm .

nu, classifier .

svm .

coef0, classifier .

svm .

gamma, classifier .

svm .

degree, classifier .

svm .

opt, rand, io .

confmatout, io .

out)

See also

Unsupervised KMeans image classification

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Validity Mask

[raster] Optional.

<put parameter description here>

Training set size

[number] <put parameter description here>

Default: 100

Number of classes

[number] <put parameter description here>

Default: 5

Maximum number of iterations

[number] <put parameter description here>

Default: 1000

18.4. OrfeoToolbox algorithm provider 347

QGIS User Guide, Versão 2.6

Convergence threshold

[number] <put parameter description here>

Default: 0.0001

Outputs

Output Image

[raster] <put output description here>

Centroid filename

[file] <put output description here>

Console usage

processing.runalg(’otb:unsupervisedkmeansimageclassification’, -in, -ram, -vm, -ts, -nc, -maxit, -ct, -out, -outmeans)

.

See also

18.4.7 Miscelaneos

Band Math

Description

<put algortithm description here>

Parameters

Input image list

[multipleinput: rasters] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Expression

[string] <put parameter description here>

Default: None

Outputs

Output Image

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:bandmath’ , il, ram, exp, out)

See also

ComputeModulusAndPhase-one (OneEntry)

Description

<put algortithm description here>

348 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Number Of inputs

[selection] <put parameter description here>

Options:

• 0 — one

Default: 0

Input image

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Modulus

[raster] <put output description here>

Phase

[raster] <put output description here>

Console usage

processing.runalg(’otb:computemodulusandphaseoneoneentry’, -nbinput, -nbinput.one.in, -ram, -mod, -pha)

See also

ComputeModulusAndPhase-two (TwoEntries)

Description

<put algortithm description here>

Parameters

Number Of inputs

[selection] <put parameter description here>

Options:

• 0 — two

Default: 0

Real part input

[raster] <put parameter description here>

Imaginary part input

[raster] <put parameter description here>

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Modulus

[raster] <put output description here>

Phase

[raster] <put output description here>

18.4. OrfeoToolbox algorithm provider 349

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’otb:computemodulusandphasetwotwoentries’ , nbinput, nbinput .

two .

re, nbinput .

two .

im, ram, mod, pha)

See also

Images comparaison

Description

<put algortithm description here>

Parameters

Reference image

[raster] <put parameter description here>

Reference image channel

[number] <put parameter description here>

Default: 1

Measured image

[raster] <put parameter description here>

Measured image channel

[number] <put parameter description here>

Default: 1

Start X

[number] <put parameter description here>

Default: 0

Start Y

[number] <put parameter description here>

Default: 0

Size X

[number] <put parameter description here>

Default: 0

Size Y

[number] <put parameter description here>

Default: 0

Outputs

Console usage

processing.runalg(’otb:imagescomparaison’, -ref.in, -ref.channel, -meas.in, -meas.channel, -roi.startx, -roi.starty, -roi.sizex, -roi.sizey)

See also

Image to KMZ Export

Description

<put algortithm description here>

350 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input image

[raster] <put parameter description here>

Tile Size

[number] <put parameter description here>

Default: 512

Image logo

[raster] Optional.

<put parameter description here>

Image legend

[raster] Optional.

<put parameter description here>

Default elevation

[number] <put parameter description here>

Default: 0

Outputs

Output .kmz product

[file] <put output description here>

Console usage

processing.runalg(’otb:imagetokmzexport’, -in, -tilesize, -logo, -legend, -elev.default, -out)

.

See also

18.4.8 Segmentação

Connected Component Segmentation

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Mask expression

[string] Optional.

<put parameter description here>

Default: None

Connected Component Expression

[string] <put parameter description here>

Default: None

Minimum Object Size

[number] <put parameter description here>

Default: 2

18.4. OrfeoToolbox algorithm provider 351

QGIS User Guide, Versão 2.6

OBIA Expression

[string] Optional.

<put parameter description here>

Default: None

Default elevation

[number] <put parameter description here>

Default: 0

Outputs

Output Shape

[vector] <put output description here>

Console usage

processing.runalg(’otb:connectedcomponentsegmentation’, -in, -mask, -expr, -minsize, -obia, -elev.default, -out)

See also

Exact Large-Scale Mean-Shift segmentation, step 2

Description

<put algortithm description here>

Parameters

Filtered image

[raster] <put parameter description here>

Spatial image

[raster] Optional.

<put parameter description here>

Range radius

[number] <put parameter description here>

Default: 15

Spatial radius

[number] <put parameter description here>

Default: 5

Minimum Region Size

[number] <put parameter description here>

Default: 0

Size of tiles in pixel (X-axis)

[number] <put parameter description here>

Default: 500

Size of tiles in pixel (Y-axis)

[number] <put parameter description here>

Default: 500

Directory where to write temporary files

[file] Optional.

<put parameter description here>

Temporary files cleaning

[boolean] <put parameter description here>

Default: True

352 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:exactlargescalemeanshiftsegmentationstep2’, -in, -inpos, -ranger, -spatialr, -minsize, -tilesizex, -tilesizey, -tmpdir, -cleanup, -out)

See also

Exact Large-Scale Mean-Shift segmentation, step 3 (optional)

Description

<put algortithm description here>

Parameters

Input image

[raster] <put parameter description here>

Segmented image

[raster] <put parameter description here>

Minimum Region Size

[number] <put parameter description here>

Default: 50

Size of tiles in pixel (X-axis)

[number] <put parameter description here>

Default: 500

Size of tiles in pixel (Y-axis)

[number] <put parameter description here>

Default: 500

Outputs

Output Image

[raster] <put output description here>

Console usage

processing.runalg(’otb:exactlargescalemeanshiftsegmentationstep3optional’, -in, -inseg, -minsize, -tilesizex, -tilesizey, -out)

See also

Exact Large-Scale Mean-Shift segmentation, step 4

Description

<put algortithm description here>

18.4. OrfeoToolbox algorithm provider 353

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Segmented image

[raster] <put parameter description here>

Size of tiles in pixel (X-axis)

[number] <put parameter description here>

Default: 500

Size of tiles in pixel (Y-axis)

[number] <put parameter description here>

Default: 500

Outputs

Output GIS vector file

[vector] <put output description here>

Console usage

processing.runalg(’otb:exactlargescalemeanshiftsegmentationstep4’, -in, -inseg, -tilesizex, -tilesizey, -out)

See also

Hoover compare segmentation

Description

<put algortithm description here>

Parameters

Input ground truth

[raster] <put parameter description here>

Input machine segmentation

[raster] <put parameter description here>

Background label

[number] <put parameter description here>

Default: 0

Overlapping threshold

[number] <put parameter description here>

Default: 0.75

Correct detection score

[number] <put parameter description here>

Default: 0.0

Over-segmentation score

[number] <put parameter description here>

Default: 0.0

Under-segmentation score

[number] <put parameter description here>

Default: 0.0

Missed detection score

[number] <put parameter description here>

Default: 0.0

354 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Colored ground truth output

[raster] <put output description here>

Colored machine segmentation output

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:hoovercomparesegmentation’ , ingt, inms, bg, th, rc, rf, ra, rm, outgt, outms)

See also

Segmentation (cc)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Segmentation algorithm

[selection] <put parameter description here>

Options:

• 0 — cc

Default: 0

Condition

[string] <put parameter description here>

Default: None

Processing mode

[selection] <put parameter description here>

Options:

• 0 — vector

Default: 0

Writing mode for the output vector file

[selection] <put parameter description here>

Options:

• 0 — ulco

• 1 — ovw

• 2 — ulovw

• 3 — ulu

Default: 0

Mask Image

[raster] Optional.

<put parameter description here>

8-neighbor connectivity

[boolean] <put parameter description here>

Default: True

18.4. OrfeoToolbox algorithm provider 355

QGIS User Guide, Versão 2.6

Stitch polygons

[boolean] <put parameter description here>

Default: True

Minimum object size

[number] <put parameter description here>

Default: 1

Simplify polygons

[number] <put parameter description here>

Default: 0.1

Layer name

[string] <put parameter description here>

Default: layer

Geometry index field name

[string] <put parameter description here>

Default: DN

Tiles size

[number] <put parameter description here>

Default: 1024

Starting geometry index

[number] <put parameter description here>

Default: 1

OGR options for layer creation

[string] Optional.

<put parameter description here>

Default: None

Outputs

Output vector file

[vector] <put output description here>

Console usage

processing.runalg(’otb:segmentationcc’, -in, -filter, -filter.cc.expr, -mode, -mode.vector.outmode, -mode.vector.inmask, -mode.vector.neighbor, -mode.vector.stitch, -mode.vector.minsize, -mode.vector.simplify, -mode.vector.layername, -mode.vector.fieldname, -mode.vector.tilesize, -mode.vector.startlabel, -mode.vector.ogroptions, -mode.vector.out)

See also

Segmentation (edison)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Segmentation algorithm

[selection] <put parameter description here>

Options:

• 0 — edison

Default: 0

Spatial radius

[number] <put parameter description here>

Default: 5

356 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Range radius

[number] <put parameter description here>

Default: 15

Minimum region size

[number] <put parameter description here>

Default: 100

Scale factor

[number] <put parameter description here>

Default: 1

Processing mode

[selection] <put parameter description here>

Options:

• 0 — vector

Default: 0

Writing mode for the output vector file

[selection] <put parameter description here>

Options:

• 0 — ulco

• 1 — ovw

• 2 — ulovw

• 3 — ulu

Default: 0

Mask Image

[raster] Optional.

<put parameter description here>

8-neighbor connectivity

[boolean] <put parameter description here>

Default: True

Stitch polygons

[boolean] <put parameter description here>

Default: True

Minimum object size

[number] <put parameter description here>

Default: 1

Simplify polygons

[number] <put parameter description here>

Default: 0.1

Layer name

[string] <put parameter description here>

Default: layer

Geometry index field name

[string] <put parameter description here>

Default: DN

Tiles size

[number] <put parameter description here>

Default: 1024

Starting geometry index

[number] <put parameter description here>

Default: 1

OGR options for layer creation

[string] Optional.

<put parameter description here>

Default: None

18.4. OrfeoToolbox algorithm provider 357

QGIS User Guide, Versão 2.6

Outputs

Output vector file

[vector] <put output description here>

Console usage

processing.runalg(’otb:segmentationedison’, -in, -filter, -filter.edison.spatialr, -filter.edison.ranger, -filter.edison.minsize, -filter.edison.scale, -mode, -mode.vector.outmode, -mode.vector.inmask, -mode.vector.neighbor, -mode.vector.stitch, -mode.vector.minsize, -mode.vector.simplify, -mode.vector.layername, -mode.vector.fieldname, -mode.vector.tilesize, -mode.vector.startlabel, -mode.vector.ogroptions, -mode.vector.out)

See also

Segmentation (meanshift)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Segmentation algorithm

[selection] <put parameter description here>

Options:

• 0 — meanshift

Default: 0

Spatial radius

[number] <put parameter description here>

Default: 5

Range radius

[number] <put parameter description here>

Default: 15

Mode convergence threshold

[number] <put parameter description here>

Default: 0.1

Maximum number of iterations

[number] <put parameter description here>

Default: 100

Minimum region size

[number] <put parameter description here>

Default: 100

Processing mode

[selection] <put parameter description here>

Options:

• 0 — vector

Default: 0

Writing mode for the output vector file

[selection] <put parameter description here>

Options:

• 0 — ulco

• 1 — ovw

• 2 — ulovw

358 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 3 — ulu

Default: 0

Mask Image

[raster] Optional.

<put parameter description here>

8-neighbor connectivity

[boolean] <put parameter description here>

Default: True

Stitch polygons

[boolean] <put parameter description here>

Default: True

Minimum object size

[number] <put parameter description here>

Default: 1

Simplify polygons

[number] <put parameter description here>

Default: 0.1

Layer name

[string] <put parameter description here>

Default: layer

Geometry index field name

[string] <put parameter description here>

Default: DN

Tiles size

[number] <put parameter description here>

Default: 1024

Starting geometry index

[number] <put parameter description here>

Default: 1

OGR options for layer creation

[string] Optional.

<put parameter description here>

Default: None

Outputs

Output vector file

[vector] <put output description here>

Console usage

processing.runalg(’otb:segmentationmeanshift’, -in, -filter, -filter.meanshift.spatialr, -filter.meanshift.ranger, -filter.meanshift.thres, -filter.meanshift.maxiter, -filter.meanshift.minsize, -mode, -mode.vector.outmode, -mode.vector.inmask, -mode.vector.neighbor, -mode.vector.stitch, -mode.vector.minsize, -mode.vector.simplify, -mode.vector.layername, -mode.vector.fieldname, -mode.vector.tilesize, -mode.vector.startlabel, -mode.vector.ogroptions, -mode.vector.out)

See also

Segmentation (mprofiles)

Description

<put algortithm description here>

18.4. OrfeoToolbox algorithm provider 359

QGIS User Guide, Versão 2.6

Parameters

Input Image

[raster] <put parameter description here>

Segmentation algorithm

[selection] <put parameter description here>

Options:

• 0 — mprofiles

Default: 0

Profile Size

[number] <put parameter description here>

Default: 5

Initial radius

[number] <put parameter description here>

Default: 1

Radius step.

[number] <put parameter description here>

Default: 1

Threshold of the final decision rule

[number] <put parameter description here>

Default: 1

Processing mode

[selection] <put parameter description here>

Options:

• 0 — vector

Default: 0

Writing mode for the output vector file

[selection] <put parameter description here>

Options:

• 0 — ulco

• 1 — ovw

• 2 — ulovw

• 3 — ulu

Default: 0

Mask Image

[raster] Optional.

<put parameter description here>

8-neighbor connectivity

[boolean] <put parameter description here>

Default: True

Stitch polygons

[boolean] <put parameter description here>

Default: True

Minimum object size

[number] <put parameter description here>

Default: 1

Simplify polygons

[number] <put parameter description here>

Default: 0.1

Layer name

[string] <put parameter description here>

Default: layer

360 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Geometry index field name

[string] <put parameter description here>

Default: DN

Tiles size

[number] <put parameter description here>

Default: 1024

Starting geometry index

[number] <put parameter description here>

Default: 1

OGR options for layer creation

[string] Optional.

<put parameter description here>

Default: None

Outputs

Output vector file

[vector] <put output description here>

Console usage

processing.runalg(’otb:segmentationmprofiles’, -in, -filter, -filter.mprofiles.size, -filter.mprofiles.start, -filter.mprofiles.step, -filter.mprofiles.sigma, -mode, -mode.vector.outmode, -mode.vector.inmask, -mode.vector.neighbor, -mode.vector.stitch, -mode.vector.minsize, -mode.vector.simplify, -mode.vector.layername, -mode.vector.fieldname, -mode.vector.tilesize, -mode.vector.startlabel, -mode.vector.ogroptions, -mode.vector.out)

See also

Segmentation (watershed)

Description

<put algortithm description here>

Parameters

Input Image

[raster] <put parameter description here>

Segmentation algorithm

[selection] <put parameter description here>

Options:

• 0 — watershed

Default: 0

Depth Threshold

[number] <put parameter description here>

Default: 0.01

Flood Level

[number] <put parameter description here>

Default: 0.1

Processing mode

[selection] <put parameter description here>

Options:

• 0 — vector

Default: 0

Writing mode for the output vector file

[selection] <put parameter description here>

Options:

18.4. OrfeoToolbox algorithm provider 361

QGIS User Guide, Versão 2.6

• 0 — ulco

• 1 — ovw

• 2 — ulovw

• 3 — ulu

Default: 0

Mask Image

[raster] Optional.

<put parameter description here>

8-neighbor connectivity

[boolean] <put parameter description here>

Default: True

Stitch polygons

[boolean] <put parameter description here>

Default: True

Minimum object size

[number] <put parameter description here>

Default: 1

Simplify polygons

[number] <put parameter description here>

Default: 0.1

Layer name

[string] <put parameter description here>

Default: layer

Geometry index field name

[string] <put parameter description here>

Default: DN

Tiles size

[number] <put parameter description here>

Default: 1024

Starting geometry index

[number] <put parameter description here>

Default: 1

OGR options for layer creation

[string] Optional.

<put parameter description here>

Default: None

Outputs

Output vector file

[vector] <put output description here>

Console usage

processing.runalg(’otb:segmentationwatershed’, -in, -filter, -filter.watershed.threshold, -filter.watershed.level, -mode, -mode.vector.outmode, -mode.vector.inmask, -mode.vector.neighbor, -mode.vector.stitch, -mode.vector.minsize, -mode.vector.simplify, -mode.vector.layername, -mode.vector.fieldname, -mode.vector.tilesize, -mode.vector.startlabel, -mode.vector.ogroptions, -mode.vector.out)

.

See also

362 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

18.4.9 Estéreo

Stereo Framework

Description

<put algortithm description here>

Parameters

Input images list

[multipleinput: rasters] <put parameter description here>

Couples list

[string] Optional.

<put parameter description here>

Default: None

Image channel used for the block matching

[number] <put parameter description here>

Default: 1

Default elevation

[number] <put parameter description here>

Default: 0

Output resolution

[number] <put parameter description here>

Default: 1

NoData value

[number] <put parameter description here>

Default: -32768

Method to fuse measures in each DSM cell

[selection] <put parameter description here>

Options:

• 0 — max

• 1 — min

• 2 — mean

• 3 — acc

Default: 0

Parameters estimation modes

[selection] <put parameter description here>

Options:

• 0 — fit

• 1 — user

Default: 0

Upper Left X

[number] <put parameter description here>

Default: 0.0

Upper Left Y

[number] <put parameter description here>

Default: 0.0

Size X

[number] <put parameter description here>

Default: 0

18.4. OrfeoToolbox algorithm provider 363

QGIS User Guide, Versão 2.6

Size Y

[number] <put parameter description here>

Default: 0

Pixel Size X

[number] <put parameter description here>

Default: 0.0

Pixel Size Y

[number] <put parameter description here>

Default: 0.0

Output Cartographic Map Projection

[selection] <put parameter description here>

Options:

• 0 — utm

• 1 — lambert2

• 2 — lambert93

• 3 — wgs

• 4 — epsg

Default: 3

Zone number

[number] <put parameter description here>

Default: 31

Northern Hemisphere

[boolean] <put parameter description here>

Default: True

EPSG Code

[number] <put parameter description here>

Default: 4326

Step of the deformation grid (in pixels)

[number] <put parameter description here>

Default: 16

Sub-sampling rate for epipolar grid inversion

[number] <put parameter description here>

Default: 10

Block-matching metric

[selection] <put parameter description here>

Options:

• 0 — ssdmean

• 1 — ssd

• 2 — ncc

• 3 — lp

Default: 0

p value

[number] <put parameter description here>

Default: 1

Radius of blocks for matching filter (in pixels)

[number] <put parameter description here>

Default: 2

Minimum altitude offset (in meters)

[number] <put parameter description here>

Default: -20

364 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Maximum altitude offset (in meters)

[number] <put parameter description here>

Default: 20

Use bijection consistency in block matching strategy

[boolean] <put parameter description here>

Default: True

Use median disparities filtering

[boolean] <put parameter description here>

Default: True

Correlation metric threshold

[number] <put parameter description here>

Default: 0.6

Input left mask

[raster] Optional.

<put parameter description here>

Input right mask

[raster] Optional.

<put parameter description here>

Discard pixels with low local variance

[number] <put parameter description here>

Default: 50

Available RAM (Mb)

[number] <put parameter description here>

Default: 128

Outputs

Output DSM

[raster] <put output description here>

Console usage

processing .

runalg( ’otb:stereoframework’ , input .

il, input .

co, input .

channel, elev .

default, output .

res, output .

nodata, output .

fusionmethod, output .

mode, output .

mode .

user .

ulx, output .

mode .

user .

uly, output .

mode .

user .

sizex, output .

mode .

user .

sizey, output .

mode .

user .

spacingx, output .

mode .

user .

spacingy, map , map .

utm .

zone, map .

utm .

northhem, map .

epsg .

code, stereorect .

fwdgridstep, stereorect .

invgridssrate, bm .

metric, bm .

metric .

lp .

p, bm .

radius, bm .

minhoffset, bm .

maxhoffset, postproc .

bij, postproc .

med, postproc .

metrict, mask .

left, mask .

right, mask .

variancet, ram, output .

out)

.

See also

18.4.10 Vetor

Concatenate

Description

<put algortithm description here>

Parameters

Input VectorDatas to concatenate

[multipleinput: any vectors] <put parameter description here>

18.4. OrfeoToolbox algorithm provider 365

QGIS User Guide, Versão 2.6

Outputs

Concatenated VectorData

[vector] <put output description here>

Console usage

processing .

runalg( ’otb:concatenate’ , vd, out)

.

See also

18.5 QGIS algorithm provider

.

QGIS algortihm provider implements various analysis and geoprocessing operations using mostly only QGIS API.

So almost all algorthms from this provider will work “out of the box” without any additional configuration.

This provider incorporates fTools functionality, some algorithms from mmQGIS plugin and also adds its own algorithms.

18.5.1 Database

Import into PostGIS

Description

<put algortithm description here>

Parameters

Layer to import

[vector: any] <put parameter description here>

Database (connection name)

[selection] <put parameter description here>

Options:

• 0 — local

Default: 0

Schema (schema name)

[string] <put parameter description here>

Default: public

Table to import to (leave blank to use layer name)

[string] <put parameter description here>

Default: (not set)

Primary key field

[tablefield: any] Optional.

<put parameter description here>

Geometry column

[string] <put parameter description here>

Default: geom

366 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Overwrite

[boolean] <put parameter description here>

Default: True

Create spatial index

[boolean] <put parameter description here>

Default: True

Convert field names to lowercase

[boolean] <put parameter description here>

Default: True

Drop length constraints on character fields

[boolean] <put parameter description here>

Default: False

Outputs

Console usage

processing .

runalg( ’qgis:importintopostgis’ , input , database, schema, tablename, primary_key, geometry_column, overwrite, createindex, lowercase_names, drop_string_length)

See also

PostGIS execute SQL

Description

<put algortithm description here>

Parameters

Database

[string] <put parameter description here>

Default: (not set)

SQL query

[string] <put parameter description here>

Default: (not set)

Outputs

Console usage

processing .

runalg( ’qgis:postgisexecutesql’ , database, sql)

.

See also

18.5. QGIS algorithm provider 367

QGIS User Guide, Versão 2.6

18.5.2 Raster general

Set style for raster layer

Description

<put algortithm description here>

Parameters

Raster layer

[raster] <put parameter description here>

Style file

[file] <put parameter description here>

Outputs

Styled layer

[raster] <put output description here>

Console usage

processing .

runalg( ’qgis:setstyleforrasterlayer’ , input , style)

.

See also

18.5.3 Raster

Hypsometric curves

Description

Calculate hypsometric curves for features of polygon layer and save them as CSV file for further processing.

Parameters

DEM to analyze

[raster] DEM to use for calculating altitudes.

Boundary layer

[vector: polygon] Polygonal vector layer with boundaries of areas used to calculate hypsometric curves.

Step

[number] Distanse between curves.

Default: 100.0

Use % of area instead of absolute value

[boolean] Write area percentage to “Area” field of the

CSV file instead of absolute area value.

Default: False

368 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Output directory

[directory] Directory where output will be saved. For each feature from input vector layer CSV file with area and altitude values will be created.

File name consists of prefix hystogram_ followed by layer name and feature ID.

Console usage

processing .

runalg( ’qgis:hypsometriccurves’ , input_dem, boundary_layer, step, use_percentage, output_directory)

See also

Raster layer statistics

Description

Calculates basic statistics of the raster layer.

Parameters

Input layer

[raster] Raster to analyze.

Outputs

Statistics

[html] Analysis results in HTML format.

Minimum value

[number] Minimum cell value.

Maximum value

[number] Maximum cell value.

Sum

[number] Sum of all cells values.

Mean value

[number] Mean cell value.

valid cells count

[number] Number of cell with data.

No-data cells count

[number] Number of NODATA cells.

Standard deviation

[number] Standard deviation of cells values.

Console usage

processing .

runalg( ’qgis:rasterlayerstatistics’ , input , output_html_file)

See also

Zonal Statistics

Description

Calculates some statistics values for pixels of input raster inside certain zones, defined as polygon layer.

Following values calculated for each zone:

• minimum

18.5. QGIS algorithm provider 369

QGIS User Guide, Versão 2.6

• maximum

• sum

• count

• mean

• standard deviation

• number of unique values

• range

• variance

Parameters

Raster layer

[raster] Raster to analyze.

Raster band

[number] Number of raster band to analyze.

Default: 1

Vector layer containing zones

[vector: polygon] Layer with zones boundaries.

Output column prefix

[string] Prefix for output fields.

Default: _

Load whole raster in memory

[boolean] Determines if raster band will be loaded in memory (True) or readed by chunks (False). Useful only when disk IO or raster scanning inefficiencies are your limiting factor.

Default: True

Outputs

Output layer

[vector] The resulting layer. Basically this is same layer as zones layer with new columns containing statistics added.

Console usage

processing .

runalg( ’qgis:zonalstatistics’ , input_raster, raster_band, input_vector, column_prefix, global_extent, output_layer)

.

See also

18.5.4 Table

Frequency analysis

Description

<put algortithm description here>

370 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters input

[vector: any] <put parameter description here>

fields

[string] <put parameter description here>

Default: (not set)

Outputs output

[table] <put output description here>

Console usage

processing .

runalg( ’qgis:frequencyanalysis’ , input , fields, output)

.

See also

18.5.5 Vector analysis

Count points in polygon

Description

Counts the number of points present in each feature of a polygon layer.

Parameters

Polygons

[vector: polygon] Polygons layer.

Points

[vector: point] Points layer.

Count field name

[string] The name of the attribute table column containing the points number.

Default: NUMPOINTS

Outputs

Result

[vector] Resulting layer with the attribute table containing the new column of the points count.

Console usage

processing .

runalg( ’qgis:countpointsinpolygon’ , polygons, points, field, output)

18.5. QGIS algorithm provider 371

QGIS User Guide, Versão 2.6

See also

Count points in polygon (weighted)

Description

Counts the number of points in each feature of a polygon layer and calculates the mean of the selected field for each feature of the polygon layer. These values will be added to the attribute table of the resulting polygon layer.

Parameters

Polygons

[vector: polygon] Polygons layer.

Points

[vector: point] Points layer.

Weight field

[tablefield: any] Weight field of the points attribute table.

Count field name

[string] Name of the column for the new weighted field.

Default: NUMPOINTS

Outputs

Result

[vector] The resulting polygons layer.

Console usage

processing .

runalg( ’qgis:countpointsinpolygonweighted’ , polygons, points, weight, field, output)

See also

Count unique points in polygon

Description

Counts the number of unique values of a points in a polygons layer. Creates a new polygons layer with an extra column in the attribute table containing the count of unique values for each feature.

Parameters

Polygons

[vector: polygon] Polygons layer.

Points

[vector: point] Points layer.

Class field

[tablefield: any] Points layer column name of the unique value chosen.

Count field name

[string] Column name containing the count of unique values in the resulting polygons layer.

Default: NUMPOINTS

Outputs

Result

[vector] The resulting polygons layer.

372 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:countuniquepointsinpolygon’ , polygons, points, classfield, field, output)

See also

Distance matrix

Description

<put algortithm description here>

Parameters

Input point layer

[vector: point] <put parameter description here>

Input unique ID field

[tablefield: any] <put parameter description here>

Target point layer

[vector: point] <put parameter description here>

Target unique ID field

[tablefield: any] <put parameter description here>

Output matrix type

[selection] <put parameter description here>

Options:

• 0 — Linear (N*k x 3) distance matrix

• 1 — Standard (N x T) distance matrix

• 2 — Summary distance matrix (mean, std. dev., min, max)

Default: 0

Use only the nearest (k) target points

[number] <put parameter description here>

Default: 0

Outputs

Distance matrix

[table] <put output description here>

Console usage

processing .

runalg( ’qgis:distancematrix’ , input_layer, input_field, target_layer, target_field, matrix_type, nearest_points, distance_matrix)

See also

Distance to nearest hub

Description

<put algortithm description here>

18.5. QGIS algorithm provider 373

QGIS User Guide, Versão 2.6

Parameters

Source points layer

[vector: any] <put parameter description here>

Destination hubs layer

[vector: any] <put parameter description here>

Hub layer name attribute

[tablefield: any] <put parameter description here>

Output shape type

[selection] <put parameter description here>

Options:

• 0 — Point

• 1 — Line to hub

Default: 0

Measurement unit

[selection] <put parameter description here>

Options:

• 0 — Meters

• 1 — Feet

• 2 — Miles

• 3 — Kilometers

• 4 — Layer units

Default: 0

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:distancetonearesthub’ , points, hubs, field, geometry, unit, output)

See also

Generate points (pixel centroids) along line

Description

<put algortithm description here>

Parameters

Raster layer

[raster] <put parameter description here>

Vector layer

[vector: line] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

374 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:generatepointspixelcentroidsalongline’ , input_raster, input_vector, output_layer)

See also

Generate points (pixel centroids) inside polygons

Description

<put algortithm description here>

Parameters

Raster layer

[raster] <put parameter description here>

Vector layer

[vector: polygon] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:generatepointspixelcentroidsinsidepolygons’ , input_raster, input_vector, output_layer)

See also

Hub lines

Description

Creates hub and spoke diagrams with lines drawn from points on the Spoke Point layer to matching points in the Hub Point layer. Determination of which hub goes with each point is based on a match between the Hub

ID field on the hub points and the Spoke ID field on the spoke points.

Parameters

Hub point layer

[vector: any] <put parameter description here>

Hub ID field

[tablefield: any] <put parameter description here>

Spoke point layer

[vector: any] <put parameter description here>

Spoke ID field

[tablefield: any] <put parameter description here>

Outputs

Output

[vector] The resulting layer.

18.5. QGIS algorithm provider 375

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:hublines’ , hubs, hub_field, spokes, spoke_field, output)

See also

Mean coordinate(s)

Description

Calculates the mean of the coordinates of a layer starting from a field of the attribute table.

Parameters

Input layer

[vector: any] <put parameter description here>

Weight field

[tablefield: numeric] Optional.

Field to use if you want to perform a weighted mean.

Unique ID field

[tablefield: numeric] Optional.

Unique field on which the calculation of the mean will be made.

Outputs

Result

[vector] The resulting points layer.

Console usage

processing .

runalg( ’qgis:meancoordinates’ , points, weight, uid, output)

See also

Nearest neighbour analysis

Description

<put algortithm description here>

Parameters

Points

[vector: point] <put parameter description here>

Outputs

Result

[html] <put output description here>

Observed mean distance

[number] <put output description here>

Expected mean distance

[number] <put output description here>

Nearest neighbour index

[number] <put output description here>

376 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Number of points

[number] <put output description here>

Z-Score

[number] <put output description here>

Console usage

processing .

runalg( ’qgis:nearestneighbouranalysis’ , points, output)

See also

Sum line lengths

Description

<put algortithm description here>

Parameters

Lines

[vector: line] <put parameter description here>

Polygons

[vector: polygon] <put parameter description here>

Lines length field name

[string] <put parameter description here>

Default: LENGTH

Lines count field name

[string] <put parameter description here>

Default: COUNT

Outputs

Result

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:sumlinelengths’ , lines, polygons, len_field, count_field, output)

.

See also

18.5.6 Vector creation

Create grid

Description

Creates a grid.

18.5. QGIS algorithm provider 377

QGIS User Guide, Versão 2.6

Parameters

Grid type

[selection] Grid type.

Options:

• 0 — Rectangle (line)

• 1 — Rectangle (polygon)

• 2 — Diamond (polygon)

• 3 — Hexagon (polygon)

Default: 0

Width

[number] Horizontal extent of the grid.

Default: 360.0

Height

[number] Vertical extent of the grid.

Default: 180.0

Horizontal spacing

[number] X-axes spacing between the lines.

Default: 10.0

Vertical spacing

[number] Y-axes spacing between the lines.

Default: 10.0

Center X

[number] X-coordinate of the grid center.

Default: 0.0

Center Y

[number] Y-coordinate of the grid center.

Default: 0.0

Output CRS

[crs] Coordinate reference system for grid.

Default: EPSG:4326

Outputs

Output

[vector] The resulting grid layer (lines or polygons).

Console usage

processing .

runalg( ’qgis:creategrid’ , type , width, height, hspacing, vspacing, centerx, centery, crs, output)

See also

Points layer from table

Description

Creates points layer from geometryless table with columns that contain point coordinates.

378 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input layer

[table] Input table

X field

[tablefield: any] Table column containing the X coordinate.

Y field

[tablefield: any] Table column containing the Y coordinate.

Target CRS

[crs] Coordinate reference system to use for layer.

Default: EPSG:4326

Outputs

Output layer

[vector] The resulting layer.

Console usage

processing .

runalg( ’qgis:pointslayerfromtable’ , input , xfield, yfield, target_crs, output)

See also

Points to path

Description

<put algortithm description here>

Parameters

Input point layer

[vector: point] <put parameter description here>

Group field

[tablefield: any] <put parameter description here>

Order field

[tablefield: any] <put parameter description here>

Date format (if order field is DateTime)

[string] Optional.

<put parameter description here>

Default: (not set)

Outputs

Paths

[vector] <put output description here>

Directory

[directory] <put output description here>

Console usage

processing .

runalg( ’qgis:pointstopath’ , vector, group_field, order_field, date_format, output_lines, output_text)

18.5. QGIS algorithm provider 379

QGIS User Guide, Versão 2.6

See also

Random points along line

Description

<put algortithm description here>

Parameters

Input layer

[vector: line] <put parameter description here>

Number of points

[number] <put parameter description here>

Default: 1

Minimum distance

[number] <put parameter description here>

Default: 0.0

Outputs

Random points

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randompointsalongline’ , vector, point_number, min_distance, output)

See also

Random points in extent

Description

<put algortithm description here>

Parameters

Input extent

[extent] <put parameter description here>

Default: 0,1,0,1

Points number

[number] <put parameter description here>

Default: 1

Minimum distance

[number] <put parameter description here>

Default: 0.0

Outputs

Random points

[vector] <put output description here>

380 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:randompointsinextent’ , extent, point_number, min_distance, output)

See also

Random points in layer bounds

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon] <put parameter description here>

Points number

[number] <put parameter description here>

Default: 1

Minimum distance

[number] <put parameter description here>

Default: 0.0

Outputs

Random points

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randompointsinlayerbounds’ , vector, point_number, min_distance, output)

See also

Random points inside polygons (fixed)

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon] <put parameter description here>

Sampling strategy

[selection] <put parameter description here>

Options:

• 0 — Points count

• 1 — Points density

Default: 0

18.5. QGIS algorithm provider 381

QGIS User Guide, Versão 2.6

Number or density of points

[number] <put parameter description here>

Default: 1.0

Minimum distance

[number] <put parameter description here>

Default: 0.0

Outputs

Random points

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randompointsinsidepolygonsfixed’ , vector, strategy, value, min_distance, output)

See also

Random points inside polygons (variable)

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon] <put parameter description here>

Sampling strategy

[selection] <put parameter description here>

Options:

• 0 — Points count

• 1 — Points density

Default: 0

Number field

[tablefield: numeric] <put parameter description here>

Minimum distance

[number] <put parameter description here>

Default: 0.0

Outputs

Random points

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randompointsinsidepolygonsvariable’ , vector, strategy, field, min_distance, output)

382 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Regular points

Description

<put algortithm description here>

Parameters

Input extent

[extent] <put parameter description here>

Default: 0,1,0,1

Point spacing/count

[number] <put parameter description here>

Default: 0.0001

Initial inset from corner (LH side)

[number] <put parameter description here>

Default: 0.0

Apply random offset to point spacing

[boolean] <put parameter description here>

Default: False

Use point spacing

[boolean] <put parameter description here>

Default: True

Outputs

Regular points

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:regularpoints’ , extent, spacing, inset, randomize, is_spacing, output)

See also

Vector grid

Description

<put algortithm description here>

Parameters

Grid extent

[extent] <put parameter description here>

Default: 0,1,0,1

X spacing

[number] <put parameter description here>

Default: 0.0001

Y spacing

[number] <put parameter description here>

Default: 0.0001

18.5. QGIS algorithm provider 383

QGIS User Guide, Versão 2.6

Grid type

[selection] <put parameter description here>

Options:

• 0 — Output grid as polygons

• 1 — Output grid as lines

Default: 0

Outputs

Grid

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:vectorgrid’ , extent, step_x, step_y, type , output)

.

See also

18.5.7 Vector general

Delete duplicate geometries

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:deleteduplicategeometries’ , input , output)

See also

Join atributes by location

Description

<put algortithm description here>

384 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Target vector layer

[vector: any] <put parameter description here>

Join vector layer

[vector: any] <put parameter description here>

Attribute summary

[selection] <put parameter description here>

Options:

• 0 — Take attributes of the first located feature

• 1 — Take summary of intersecting features

Default: 0

Statistics for summary (comma separated)

[string] <put parameter description here>

Default: sum,mean,min,max,median

Output table

[selection] <put parameter description here>

Options:

• 0 — Only keep matching records

• 1 — Keep all records (including non-matching target records)

Default: 0

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:joinatributesbylocation’ , target, join, summary, stats, keep, output)

See also

Join attributes table

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Input layer 2

[table] <put parameter description here>

Table field

[tablefield: any] <put parameter description here>

Table field 2

[tablefield: any] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

18.5. QGIS algorithm provider 385

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:joinattributestable’ , input_layer, input_layer_2, table_field, table_field_2, output_layer)

See also

Merge vector layers

Description

<put algortithm description here>

Parameters

Input layer 1

[vector: any] <put parameter description here>

Input layer 2

[vector: any] <put parameter description here>

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:mergevectorlayers’ , layer1, layer2, output)

See also

Polygon from layer extent

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Calculate extent for each feature separately

[boolean] <put parameter description here>

Default: False

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:polygonfromlayerextent’ , input_layer, by_feature, output)

386 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Reproject layer

Description

Reprojects a vector layer in a different CRS.

Parameters

Input layer

[vector: any] Layer to reproject.

Target CRS

[crs] Destination coordinate reference system.

Default: EPSG:4326

Outputs

Reprojected layer

[vector] The resulting layer.

Console usage

processing .

runalg( ’qgis:reprojectlayer’ , input , target_crs, output)

See also

Save selected features

Description

Saves the selected features as a new layer.

Parameters

Input layer

[vector: any] Layer to process.

Outputs

Output layer with selected features

[vector] The resulting layer.

Console usage

processing .

runalg( ’qgis:saveselectedfeatures’ , input_layer, output_layer)

18.5. QGIS algorithm provider 387

QGIS User Guide, Versão 2.6

See also

Set style for vector layer

Description

<put algortithm description here>

Parameters

Vector layer

[vector: any] <put parameter description here>

Style file

[file] <put parameter description here>

Outputs

Styled layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:setstyleforvectorlayer’ , input , style)

See also

Snap points to grid

Description

<put algortithm description here>

Parameters

Input Layer

[vector: any] <put parameter description here>

Horizontal spacing

[number] <put parameter description here>

Default: 0.1

Vertical spacing

[number] <put parameter description here>

Default: 0.1

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:snappointstogrid’ , input , hspacing, vspacing, output)

388 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Split vector layer

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Unique ID field

[tablefield: any] <put parameter description here>

Outputs

Output directory

[directory] <put output description here>

Console usage

processing .

runalg( ’qgis:splitvectorlayer’ , input , field, output)

.

See also

18.5.8 Vector geometry

Concave hull

Description

<put algortithm description here>

Parameters

Input point layer

[vector: point] <put parameter description here>

Threshold (0-1, where 1 is equivalent with Convex Hull)

[number] <put parameter description here>

Default: 0.3

Allow holes

[boolean] <put parameter description here>

Default: True

Split multipart geometry into singleparts geometries

[boolean] <put parameter description here>

Default: False

18.5. QGIS algorithm provider 389

QGIS User Guide, Versão 2.6

Outputs

Concave hull

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:concavehull’ , input , alpha, holes, no_multigeometry, output)

See also

Convert geometry type

Description

Converts a geometry type to another one.

Parameters

Input layer

[vector: any] Layer in input.

New geometry type

[selection] Type of conversion to perform.

Options:

• 0 — Centroids

• 1 — Nodes

• 2 — Linestrings

• 3 — Multilinestrings

• 4 — Polygons

Default: 0

Outputs

Output

[vector] The resulting layer.

Console usage

processing .

runalg( ’qgis:convertgeometrytype’ , input , type , output)

See also

Convex hull

Description

<put algortithm description here>

390 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input layer

[vector: any] <put parameter description here>

Field (optional, only used if creating convex hulls by classes)

[tablefield: any]

Optional.

<put parameter description here>

Method

[selection] <put parameter description here>

Options:

• 0 — Create single minimum convex hull

• 1 — Create convex hulls based on field

Default: 0

Outputs

Convex hull

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:convexhull’ , input , field, method, output)

See also

Create points along lines

Description

<put algortithm description here>

Parameters lines

[vector: any] <put parameter description here>

distance

[number] <put parameter description here>

Default: 1

startpoint

[number] <put parameter description here>

Default: 0

endpoint

[number] <put parameter description here>

Default: 0

Outputs output

[vector] <put output description here>

18.5. QGIS algorithm provider 391

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:createpointsalonglines’ , lines, distance, startpoint, endpoint, output)

See also

Delaunay triangulation

Description

<put algortithm description here>

Parameters

Input layer

[vector: point] <put parameter description here>

Outputs

Delaunay triangulation

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:delaunaytriangulation’ , input , output)

See also

Densify geometries given an interval

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon, line] <put parameter description here>

Interval between Vertices to add

[number] <put parameter description here>

Default: 1.0

Outputs

Densified layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:densifygeometriesgivenaninterval’ , input , interval, output)

392 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Densify geometries

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon, line] <put parameter description here>

Vertices to add

[number] <put parameter description here>

Default: 1

Outputs

Densified layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:densifygeometries’ , input , vertices, output)

See also

Dissolve

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon, line] <put parameter description here>

Dissolve all (do not use field)

[boolean] <put parameter description here>

Default: True

Unique ID field

[tablefield: any] Optional.

<put parameter description here>

Outputs

Dissolved

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:dissolve’ , input , dissolve_all, field, output)

18.5. QGIS algorithm provider 393

QGIS User Guide, Versão 2.6

See also

Eliminate sliver polygons

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon] <put parameter description here>

Use current selection in input layer (works only if called from toolbox)

[boolean]

<put parameter description here>

Default: False

Selection attribute

[tablefield: any] <put parameter description here>

Comparison

[selection] <put parameter description here>

Options:

• 0 — ==

• 1 — !=

• 2 — >

• 3 — >=

• 4 — <

• 5 — <=

• 6 — begins with

• 7 — contains

Default: 0

Value

[string] <put parameter description here>

Default: 0

Merge selection with the neighbouring polygon with the

[selection] <put parameter description here>

Options:

• 0 — Largest area

• 1 — Smallest Area

• 2 — Largest common boundary

Default: 0

Outputs

Cleaned layer

[vector] <put output description here>

394 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:eliminatesliverpolygons’ , input , keepselection, attribute, comparison, comparisonvalue, mode, output)

See also

Explode lines

Description

<put algortithm description here>

Parameters

Input layer

[vector: line] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:explodelines’ , input , output)

See also

Extract nodes

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon, line] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:extractnodes’ , input , output)

18.5. QGIS algorithm provider 395

QGIS User Guide, Versão 2.6

See also

Fill holes

Description

<put algortithm description here>

Parameters

Polygons

[vector: any] <put parameter description here>

Max area

[number] <put parameter description here>

Default: 100000

Outputs

Results

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:fillholes’ , polygons, max_area, results)

See also

Fixed distance buffer

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Distance

[number] <put parameter description here>

Default: 10.0

Segments

[number] <put parameter description here>

Default: 5

Dissolve result

[boolean] <put parameter description here>

Default: False

Outputs

Buffer

[vector] <put output description here>

396 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’qgis:fixeddistancebuffer’ , input , distance, segments, dissolve, output)

See also

Keep n biggest parts

Description

<put algortithm description here>

Parameters

Polygons

[vector: polygon] <put parameter description here>

To keep

[number] <put parameter description here>

Default: 1

Outputs

Results

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:keepnbiggestparts’ , polygons, to_keep, results)

See also

Lines to polygons

Description

<put algortithm description here>

Parameters

Input layer

[vector: line] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:linestopolygons’ , input , output)

18.5. QGIS algorithm provider 397

QGIS User Guide, Versão 2.6

See also

Multipart to singleparts

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:multiparttosingleparts’ , input , output)

See also

Points displacement

Description

Moves overlapped points at small distance, that they all become visible. The result is very similar to the output of the “Point displacement” renderer but it is permanent.

Parameters

Input layer

[vector: point] Layer with overlapped points.

Displacement distance

[number] Desired displacement distance NOTE: displacement distance should be in same units as layer.

Default: 0.00015

Horizontal distribution for two point case

[boolean] Controls distrobution direction in case of two overlapped points. If True points wwill be distributed horizontally, otherwise they will be distributed vertically.

Default: True

Outputs

Output layer

[vector] The resulting layer with shifted overlapped points.

Console usage

processing .

runalg( ’qgis:pointsdisplacement’ , input_layer, distance, horizontal, output_layer)

398 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Polygon centroids

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:polygoncentroids’ , input_layer, output_layer)

See also

Polygonize

Description

<put algortithm description here>

Parameters

Input layer

[vector: line] <put parameter description here>

Keep table structure of line layer

[boolean] <put parameter description here>

Default: False

Create geometry columns

[boolean] <put parameter description here>

Default: True

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:polygonize’ , input , fields, geometry, output)

18.5. QGIS algorithm provider 399

QGIS User Guide, Versão 2.6

See also

Polygons to lines

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:polygonstolines’ , input , output)

See also

Simplify geometries

Description

<put algortithm description here>

Parameters

Input layer

[vector: polygon, line] <put parameter description here>

Tolerance

[number] <put parameter description here>

Default: 1.0

Outputs

Simplified layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:simplifygeometries’ , input , tolerance, output)

400 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Singleparts to multipart

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Unique ID field

[tablefield: any] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:singlepartstomultipart’ , input , field, output)

See also

Variable distance buffer

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Distance field

[tablefield: any] <put parameter description here>

Segments

[number] <put parameter description here>

Default: 5

Dissolve result

[boolean] <put parameter description here>

Default: False

Outputs

Buffer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:variabledistancebuffer’ , input , field, segments, dissolve, output)

18.5. QGIS algorithm provider 401

QGIS User Guide, Versão 2.6

See also

Voronoi polygons

Description

<put algortithm description here>

Parameters

Input layer

[vector: point] <put parameter description here>

Buffer region

[number] <put parameter description here>

Default: 0.0

Outputs

Voronoi polygons

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:voronoipolygons’ , input , buffer , output)

.

See also

18.5.9 Vector overlay

Clip

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Clip layer

[vector: any] <put parameter description here>

Outputs

Clipped

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:clip’ , input , overlay, output)

402 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Difference

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Difference layer

[vector: any] <put parameter description here>

Outputs

Difference

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:difference’ , input , overlay, output)

See also

Intersection

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Intersect layer

[vector: any] <put parameter description here>

Outputs

Intersection

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:intersection’ , input , input2, output)

18.5. QGIS algorithm provider 403

QGIS User Guide, Versão 2.6

See also

Line intersections

Description

<put algortithm description here>

Parameters

Input layer

[vector: line] <put parameter description here>

Intersect layer

[vector: line] <put parameter description here>

Input unique ID field

[tablefield: any] <put parameter description here>

Intersect unique ID field

[tablefield: any] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:lineintersections’ , input_a, input_b, field_a, field_b, output)

See also

Symetrical difference

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Difference layer

[vector: any] <put parameter description here>

Outputs

Symetrical difference

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:symetricaldifference’ , input , overlay, output)

404 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Union

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Input layer 2

[vector: any] <put parameter description here>

Outputs

Union

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:union’ , input , input2, output)

See also

|ignoraratualização|

18.5.10 Selecionar vetor

Extract by attribute

Description

<put algortithm description here>

Parameters

Input Layer

[vector: any] <put parameter description here>

Selection attribute

[tablefield: any] <put parameter description here>

Operator

[selection] <put parameter description here>

Options:

• 0 — =

• 1 — !=

• 2 — >

• 3 — >=

• 4 — <

• 5 — <=

• 6 — begins with

18.5. QGIS algorithm provider 405

QGIS User Guide, Versão 2.6

• 7 — contains

Default: 0

Value

[string] <put parameter description here>

Default: (not set)

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:extractbyattribute’ , input , field, operator, value, output)

See also

Extract by location

Description

<put algortithm description here>

Parameters

Layer to select from

[vector: any] <put parameter description here>

Additional layer (intersection layer)

[vector: any] <put parameter description here>

Include input features that touch the selection features

[boolean] <put parameter description here>

Default: False

Include input features that overlap/cross the selection features

[boolean] <put parameter description here>

Default: False

Include input features completely within the selection features

[boolean] <put parameter description here>

Default: False

Outputs

Selection

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:extractbylocation’ , input , intersect, touches, overlaps, within, output)

406 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Random extract

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Method

[selection] <put parameter description here>

Options:

• 0 — Number of selected features

• 1 — Percentage of selected features

Default: 0

Number/percentage of selected features

[number] <put parameter description here>

Default: 10

Outputs

Selection

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randomextract’ , input , method, number, output)

See also

Random extract within subsets

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

ID Field

[tablefield: any] <put parameter description here>

Method

[selection] <put parameter description here>

Options:

• 0 — Number of selected features

• 1 — Percentage of selected features

Default: 0

18.5. QGIS algorithm provider 407

QGIS User Guide, Versão 2.6

Number/percentage of selected features

[number] <put parameter description here>

Default: 10

Outputs

Selection

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randomextractwithinsubsets’ , input , field, method, number, output)

See also

Random selection

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Method

[selection] <put parameter description here>

Options:

• 0 — Number of selected features

• 1 — Percentage of selected features

Default: 0

Number/percentage of selected features

[number] <put parameter description here>

Default: 10

Outputs

Selection

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randomselection’ , input , method, number)

See also

Random selection within subsets

Description

<put algortithm description here>

408 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input layer

[vector: any] <put parameter description here>

ID Field

[tablefield: any] <put parameter description here>

Method

[selection] <put parameter description here>

Options:

• 0 — Number of selected features

• 1 — Percentage of selected features

Default: 0

Number/percentage of selected features

[number] <put parameter description here>

Default: 10

Outputs

Selection

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:randomselectionwithinsubsets’ , input , field, method, number)

See also

Select by attribute

Description

Selects and saves as new layer all features from input layer that satisfy condition.

NOTE

: algorithm is case-sensitive (“qgis” is different from “Qgis” and “QGIS”)

Parameters

Input Layer

[vector: any] Layer to process.

Selection attribute

[tablefield: any] Field on which perform the selection.

Operator

[selection] Comparison operator.

Options:

• 0 — =

• 1 — !=

• 2 — >

• 3 — >=

• 4 — <

• 5 — <=

• 6 — begins with

• 7 — contains

18.5. QGIS algorithm provider 409

QGIS User Guide, Versão 2.6

Default: 0

Value

[string] Value to compare.

Default: (not set)

Outputs

Output

[vector] The resulting layer.

Console usage

processing .

runalg( ’qgis:selectbyattribute’ , input , field, operator, value, output)

See also

Select by expression

Description

<put algortithm description here>

Parameters

Input Layer

[vector: any] <put parameter description here>

Expression

[string] <put parameter description here>

Default: (not set)

Modify current selection by

[selection] <put parameter description here>

Options:

• 0 — creating new selection

• 1 — adding to current selection

• 2 — removing from current selection

Default: 0

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:selectbyexpression’ , layername, expression, method)

410 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Select by location

Description

<put algortithm description here>

Parameters

Layer to select from

[vector: any] <put parameter description here>

Additional layer (intersection layer)

[vector: any] <put parameter description here>

Include input features that touch the selection features

[boolean] <put parameter description here>

Default: False

Include input features that overlap/cross the selection features

[boolean] <put parameter description here>

Default: False

Include input features completely within the selection features

[boolean] <put parameter description here>

Default: False

Modify current selection by

[selection] <put parameter description here>

Options:

• 0 — creating new selection

• 1 — adding to current selection

• 2 — removing from current selection

Default: 0

Outputs

Selection

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:selectbylocation’ , input , intersect, touches, overlaps, within, method)

See also

|ignoraratualização|

18.5. QGIS algorithm provider 411

QGIS User Guide, Versão 2.6

18.5.11 Vetor da tabela

Add autoincremental field

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:addautoincrementalfield’ , input , output)

See also

Add field to attributes table

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Field name

[string] <put parameter description here>

Default: (not set)

Field type

[selection] <put parameter description here>

Options:

• 0 — Integer

• 1 — Float

• 2 — String

Default: 0

Field length

[number] <put parameter description here>

Default: 10

Field precision

[number] <put parameter description here>

Default: 0

412 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:addfieldtoattributestable’ , input_layer, field_name, field_type, field_length, field_precision, output_layer)

See also

Advanced Python field calculator

Description

<put algorithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Result field name

[string] <put parameter description here>

Default: NewField

Field type

[selection] <put parameter description here>

Options:

• 0 — Integer

• 1 — Float

• 2 — String

Default: 0

Field length

[number] <put parameter description here>

Default: 10

Field precision

[number] <put parameter description here>

Default: 0

Global expression

[string] Optional.

<put parameter description here>

Default: (not set)

Formula

[string] <put parameter description here>

Default: value =

Outputs

Output layer

[vector] <put output description here>

18.5. QGIS algorithm provider 413

QGIS User Guide, Versão 2.6

Console usage

processing.runalg(’qgis:advancedpythonfieldcalculator’, input_layer, field_name, field_type, field_length, field_precision, global, formula, output_layer)

See also

Basic statistics for numeric fields

Description

<put algortithm description here>

Parameters

Input vector layer

[vector: any] <put parameter description here>

Field to calculate statistics on

[tablefield: numeric] <put parameter description here>

Outputs

Statistics for numeric field

[html] <put output description here>

Coefficient of Variation

[number] <put output description here>

Minimum value

[number] <put output description here>

Maximum value

[number] <put output description here>

Sum

[number] <put output description here>

Mean value

[number] <put output description here>

Count

[number] <put output description here>

Range

[number] <put output description here>

Median

[number] <put output description here>

Number of unique values

[number] <put output description here>

Standard deviation

[number] <put output description here>

Console usage

processing .

runalg( ’qgis:basicstatisticsfornumericfields’ , input_layer, field_name, output_html_file)

See also

Basic statistics for text fields

Description

<put algortithm description here>

414 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Input vector layer

[vector: any] <put parameter description here>

Field to calculate statistics on

[tablefield: string] <put parameter description here>

Outputs

Statistics for text field

[html] <put output description here>

Minimum length

[number] <put output description here>

Maximum length

[number] <put output description here>

Mean length

[number] <put output description here>

Count

[number] <put output description here>

Number of empty values

[number] <put output description here>

Number of non-empty values

[number] <put output description here>

Number of unique values

[number] <put output description here>

Console usage

processing .

runalg( ’qgis:basicstatisticsfortextfields’ , input_layer, field_name, output_html_file)

See also

Create equivalent numerical field

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Class field

[tablefield: any] <put parameter description here>

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:createequivalentnumericalfield’ , input , field, output)

18.5. QGIS algorithm provider 415

QGIS User Guide, Versão 2.6

See also

Delete column

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Field to delete

[tablefield: any] <put parameter description here>

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:deletecolumn’ , input , column, output)

See also

Export/Add geometry columns

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Calculate using

[selection] <put parameter description here>

Options:

• 0 — Layer CRS

• 1 — Project CRS

• 2 — Ellipsoidal

Default: 0

Outputs

Output layer

[vector] <put output description here>

Console usage

416 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

processing .

runalg( ’qgis:exportaddgeometrycolumns’ , input , calc_method, output)

See also

Field calculator

Description

<put algortithm description here>

Parameters

Input layer

[vector: any] <put parameter description here>

Result field name

[string] <put parameter description here>

Default: (not set)

Field type

[selection] <put parameter description here>

Options:

• 0 — Float

• 1 — Integer

• 2 — String

• 3 — Date

Default: 0

Field length

[number] <put parameter description here>

Default: 10

Field precision

[number] <put parameter description here>

Default: 3

Create new field

[boolean] <put parameter description here>

Default: True

Formula

[string] <put parameter description here>

Default: (not set)

Outputs

Output layer

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:fieldcalculator’ , input_layer, field_name, field_type, field_length, field_precision, new_field, formula, output_layer)

18.5. QGIS algorithm provider 417

QGIS User Guide, Versão 2.6

See also

List unique values

Description

Lists unique values of an attribute table field and counts their number.

Parameters

Input layer

[vector: any] Layer to analyze.

Target field

[tablefield: any] Field to analyze.

Outputs

Unique values

[html] Analysis results in HTML format.

Total unique values

[number] Total number of unique values in given field.

Unique values

[string] List of all unique values in given field.

Console usage

processing .

runalg( ’qgis:listuniquevalues’ , input_layer, field_name, output)

See also

Number of unique values in classes

Description

<put algortithm description here>

Parameters input

[vector: any] <put parameter description here>

class field

[tablefield: any] <put parameter description here>

value field

[tablefield: any] <put parameter description here>

Outputs output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:numberofuniquevaluesinclasses’ , input , class_field, value_field, output)

418 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Statistics by categories

Description

<put algortithm description here>

Parameters

Input vector layer

[vector: any] <put parameter description here>

Field to calculate statistics on

[tablefield: numeric] <put parameter description here>

Field with categories

[tablefield: any] <put parameter description here>

Outputs

Statistics

[table] <put output description here>

Console usage

processing .

runalg( ’qgis:statisticsbycategories’ , input_layer, values_field_name, categories_field_name, output)

See also

Text to float

Description

<put algortithm description here>

Parameters

Input Layer

[vector: any] <put parameter description here>

Text attribute to convert to float

[tablefield: string] <put parameter description here>

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’qgis:texttofloat’ , input , field, output)

.

See also

18.5. QGIS algorithm provider 419

QGIS User Guide, Versão 2.6

18.6 Provedor de algoritmo R

.

R também chamado de GNU S, é uma linguagem fortemente funcional e ambiente para explorar estatisticamente conjuntos de dados, fazem muitas representações gráficas de dados a partir de conjuntos de dados personalizados

Nota: Por favor, lembre-se que o processamento contém apenas scripts R, então você precisa instalar R sozinho e configurar corretamente o Processamento.

18.6.1 Estatísticas básicas

Tabela de frequencia

Descricao

<colocar algoritmo descrição aqui>

Parametros

Camada

[vetor: any] <colocar parametro de descrição aqui>

Campo

[tablefield: any] <colocar parametro de descrição aqui>

Saidas

Saida do R Console

[html] <colocar a descrição da saída aqui>

Utilizacao do console

processing .

runalg( ’r:frequencytable’ , layer, field, r_console_output)

Veja tambem

Teste Kolmogrov-Smirnov

Descrição

<ponha a descrição do algoritmo aqui>

Parâmetros

Camada

[vetor: qualquer] <ponha o parâmetro do algoritmo aqui>

Campo

[tablefield: qualquer] <ponha o parâmetro do algoritmo aqui>

Saídas

Arquivo de Saída da Linha de comandos R

[html] <ponha a descrição de saída aqui>

420 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Uso da Linha de Comandos

processing .

runalg( ’r:kolmogrovsmirnovtest’ , layer, field, r_console_output)

Veja também

Estatísticas resumidas

Descricao

<coloque a descrição do algoritmo aqui>

Parametros

Camada

[vetor: any] <coloque a descrição do parametro aqui>

Campo

[tablefield: any] <coloque a descrição do parametro aqui>

Saida

Saida do R Console

[html] <coloque a descrição da saida aqui>

Uso do console

processing .

runalg( ’r:summarystatistics’ , layer, field, r_console_output)

.

Veja também

18.6.2 Home range

Characteristic hull method

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Field

[tablefield: any] <put parameter description here>

Outputs

Home_ranges

[vector] <put output description here>

18.6. Provedor de algoritmo R 421

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’r:characteristichullmethod’ , layer, field, home_ranges)

See also

Kernel h ref

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Field

[tablefield: any] <put parameter description here>

Grid

[number] <put parameter description here>

Default: 10.0

Percentage

[number] <put parameter description here>

Default: 10.0

Folder

[directory] Optional.

<put parameter description here>

Outputs

Home_ranges

[vector] <put output description here>

Console usage

processing .

runalg( ’r:kernelhref’ , layer, field, grid, percentage, folder, home_ranges)

See also

Minimum convex polygon

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Percentage

[number] <put parameter description here>

Default: 10.0

Field

[tablefield: any] <put parameter description here>

422 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

Home_ranges

[vector] <put output description here>

Console usage

processing .

runalg( ’r:minimumconvexpolygon’ , layer, percentage, field, home_ranges)

See also

Single-linkage cluster analysis

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Field

[tablefield: any] <put parameter description here>

Percentage

[number] <put parameter description here>

Default: 10.0

Outputs

R Plots

[html] <put output description here>

Home_ranges

[vector] <put output description here>

Console usage

processing .

runalg( ’r:singlelinkageclusteranalysis’ , layer, field, percentage, rplots, home_ranges)

.

See also

18.6.3 Point pattern

F function

Description

<put algortithm description here>

18.6. Provedor de algoritmo R 423

QGIS User Guide, Versão 2.6

Parameters

Layer

[vector: any] <put parameter description here>

Nsim

[number] <put parameter description here>

Default: 10.0

Outputs

R Plots

[html] <put output description here>

Console usage

processing .

runalg( ’r:ffunction’ , layer, nsim, rplots)

See also

G function

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Nsim

[number] <put parameter description here>

Default: 10.0

Outputs

R Plots

[html] <put output description here>

Console usage

processing .

runalg( ’r:gfunction’ , layer, nsim, rplots)

See also

Monte-Carlo spatial randomness

Description

<put algortithm description here>

424 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Layer

[vector: any] <put parameter description here>

Simulations

[number] <put parameter description here>

Default: 100.0

Optional plot name

[string] <put parameter description here>

Default: (not set)

Outputs

R Plots

[html] <put output description here>

R Console Output

[html] <put output description here>

Console usage

processing .

runalg( ’r:montecarlospatialrandomness’ , layer, simulations, optional_plot_name, rplots, r_console_output)

See also

Quadrat analysis

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Outputs

R Plots

[html] <put output description here>

R Console Output

[html] <put output description here>

Console usage

processing .

runalg( ’r:quadratanalysis’ , layer, rplots, r_console_output)

See also

Gride de amostragem aleatória

Descricao

<coloque o algoritmo de descrição aqui>

18.6. Provedor de algoritmo R 425

QGIS User Guide, Versão 2.6

Parametros

Camada

[vetor: any] <coloque o parâmetro de descrição aqui>

Tamanho

[numero] <coloque o parâmetro de descrição aqui>

Padrao: 10.0

Saidas

Saida

[vetor] <coloque a descrição de saida aqui>

Usando o console

processing .

runalg( ’r:randomsamplinggrid’ , layer, size, output)

Veja tambem

Regular sampling grid

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Size

[number] <put parameter description here>

Default: 10.0

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’r:regularsamplinggrid’ , layer, size, output)

See also

Relative distribution (distance covariate)

Description

<put algortithm description here>

426 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Layer

[vector: any] <put parameter description here>

Covariate

[vector: any] <put parameter description here>

Covariate name

[string] <put parameter description here>

Default: mandatory_covariate_name_(no_spaces)

x label

[string] <put parameter description here>

Default: (not set)

Plot name

[string] <put parameter description here>

Default: (not set)

Legend position

[string] <put parameter description here>

Default: float

Outputs

R Plots

[html] <put output description here>

Console usage

processing .

runalg( ’r:relativedistributiondistancecovariate’ , layer, covariate, covariate_name, x_label, plot_name, legend_position, rplots)

See also

Relative distribution (raster covariate)

Description

<put algortithm description here>

Parameters points

[vector: any] <put parameter description here>

covariate

[raster] <put parameter description here>

covariate name

[string] <put parameter description here>

Default: mandatory_covariate_name_(no_spaces)

x label

[string] <put parameter description here>

Default: (not set)

plot name

[string] <put parameter description here>

Default: (not set)

legend position

[string] <put parameter description here>

Default: float

18.6. Provedor de algoritmo R 427

QGIS User Guide, Versão 2.6

Outputs

R Plots

[html] <put output description here>

Console usage

processing .

runalg( ’r:relativedistributionrastercovariate’ , points, covariate, covariate_name, x_label, plot_name, legend_position, rplots)

See also

Ripley - Rasson spatial domain

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Outputs

Output

[vector] <put output description here>

Console usage

processing .

runalg( ’r:ripleyrassonspatialdomain’ , layer, output)

.

See also

18.6.4 Raster processing

Advanced raster histogram

Description

<put algortithm description here>

Parameters

Layer

[raster] <put parameter description here>

Dens or Hist

[string] <put parameter description here>

Default: Hist

428 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Outputs

R Plots

[html] <put output description here>

Console usage

processing .

runalg( ’r:advancedrasterhistogram’ , layer, dens_or_hist, rplots)

See also

Raster histogram

Description

<put algortithm description here>

Parameters

Layer

[raster] <put parameter description here>

Outputs

R Plots

[html] <put output description here>

Console usage

processing .

runalg( ’r:rasterhistogram’ , layer, rplots)

.

See also

18.6.5 Vector processing

Histogram

Description

<put algortithm description here>

Parameters

Layer

[vector: any] <put parameter description here>

Field

[tablefield: any] <put parameter description here>

Outputs

R Plots

[html] <put output description here>

18.6. Provedor de algoritmo R 429

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’r:histogram’ , layer, field, rplots)

.

See also

18.7 SAGA algorithm provider

.

SAGA (System for Automated Geoscientific Analyses) is a free, hybrid, cross-platform GIS software. SAGA provides many geoscientific methods which are bundled in so-called module libraries.

Nota: Please remember that Processing contains only the interface description, so you need to install SAGA by yourself and configure Processing properly.

18.7.1 Geostatistics

Directional statistics for single grid

Description

<put algortithm description here>

Parameters

Grid

[raster] <put parameter description here>

Points

[vector: any] Optional.

<put parameter description here>

Direction [Degree]

[number] <put parameter description here>

Default: 0.0

Tolerance [Degree]

[number] <put parameter description here>

Default: 0.0

Maximum Distance [Cells]

[number] <put parameter description here>

Default: 0

Distance Weighting

[selection] <put parameter description here>

Options:

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

430 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 1

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 1.0

Outputs

Arithmetic Mean

[raster] <put output description here>

Difference from Arithmetic Mean

[raster] <put output description here>

Minimum

[raster] <put output description here>

Maximum

[raster] <put output description here>

Range

[raster] <put output description here>

Variance

[raster] <put output description here>

Standard Deviation

[raster] <put output description here>

Mean less Standard Deviation

[raster] <put output description here>

Mean plus Standard Deviation

[raster] <put output description here>

Deviation from Arithmetic Mean

[raster] <put output description here>

Percentile

[raster] <put output description here>

Directional Statistics for Points

[vector] <put output description here>

Console usage

processing .

runalg( ’saga:directionalstatisticsforsinglegrid’ , grid, points, direction, tolerance, maxdistance, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, mean, difmean, min , max , range , var, stddev, stddevlo, stddevhi, devmean, percent, points_out)

See also

Fast representativeness

Description

<put algortithm description here>

Parameters

Input

[raster] <put parameter description here>

Level of Generalisation

[number] <put parameter description here>

Default: 16

18.7. SAGA algorithm provider 431

QGIS User Guide, Versão 2.6

Outputs

Output

[raster] <put output description here>

Output Lod

[raster] <put output description here>

Output Seeds

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:fastrepresentativeness’ , input , lod, result, result_lod, seeds)

See also

Geographically weighted multiple regression (points/grids)

Description

<put algortithm description here>

Parameters

Predictors

[multipleinput: rasters] <put parameter description here>

Output of Regression Parameters

[boolean] <put parameter description here>

Default: True

Points

[vector: point] <put parameter description here>

Dependent Variable

[tablefield: any] <put parameter description here>

Distance Weighting

[selection] <put parameter description here>

Options:

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 1

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 1.0

Search Range

[selection] <put parameter description here>

Options:

• 0 — [0] search radius (local)

• 1 — [1] no search radius (global)

432 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Default: 0

Search Radius

[number] <put parameter description here>

Default: 100

Search Mode

[selection] <put parameter description here>

Options:

• 0 — [0] all directions

• 1 — [1] quadrants

Default: 0

Number of Points

[selection] <put parameter description here>

Options:

• 0 — [0] maximum number of observations

• 1 — [1] all points

Default: 0

Maximum Number of Observations

[number] <put parameter description here>

Default: 10

Minimum Number of Observations

[number] <put parameter description here>

Default: 4

Outputs

Regression

[raster] <put output description here>

Coefficient of Determination

[raster] <put output description here>

Regression Parameters

[raster] <put output description here>

Residuals

[vector] <put output description here>

Console usage

processing .

runalg( ’saga:geographicallyweightedmultipleregressionpointsgrids’ , predictors, parameters, points, dependent, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, range , radius, mode, npoints, maxpoints, minpoints, regression, quality, slopes, residuals)

See also

Geographically weighted multiple regression (points)

Description

<put algortithm description here>

Parameters

Points

[vector: any] <put parameter description here>

Dependent Variable

[tablefield: any] <put parameter description here>

Distance Weighting

[selection] <put parameter description here>

Options:

18.7. SAGA algorithm provider 433

QGIS User Guide, Versão 2.6

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 1

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 1.0

Search Range

[selection] <put parameter description here>

Options:

• 0 — [0] search radius (local)

• 1 — [1] no search radius (global)

Default: 0

Search Radius

[number] <put parameter description here>

Default: 100

Search Mode

[selection] <put parameter description here>

Options:

• 0 — [0] all directions

• 1 — [1] quadrants

Default: 0

Number of Points

[selection] <put parameter description here>

Options:

• 0 — [0] maximum number of observations

• 1 — [1] all points

Default: 0

Maximum Number of Observations

[number] <put parameter description here>

Default: 10

Minimum Number of Observations

[number] <put parameter description here>

Default: 4

Outputs

Regression

[vector] <put output description here>

434 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’saga:geographicallyweightedmultipleregressionpoints’ , points, dependent, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, range , radius, mode, npoints, maxpoints, minpoints, regression)

See also

Geographically weighted multiple regression

Description

<put algortithm description here>

Parameters

Points

[vector: point] <put parameter description here>

Dependent Variable

[tablefield: any] <put parameter description here>

Target Grids

[selection] <put parameter description here>

Options:

• 0 — [0] user defined

Default: 0

Distance Weighting

[selection] <put parameter description here>

Options:

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 1

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 1

Search Range

[selection] <put parameter description here>

Options:

• 0 — [0] search radius (local)

• 1 — [1] no search radius (global)

Default: 0

Search Radius

[number] <put parameter description here>

Default: 100

Search Mode

[selection] <put parameter description here>

Options:

18.7. SAGA algorithm provider 435

QGIS User Guide, Versão 2.6

• 0 — [0] all directions

• 1 — [1] quadrants

Default: 0

Number of Points

[selection] <put parameter description here>

Options:

• 0 — [0] maximum number of observations

• 1 — [1] all points

Default: 0

Maximum Number of Observations

[number] <put parameter description here>

Default: 10

Minimum Number of Observations

[number] <put parameter description here>

Default: 4

Output extent

[extent] <put parameter description here>

Default: 0,1,0,1

Cellsize

[number] <put parameter description here>

Default: 100.0

Outputs

Quality

[raster] <put output description here>

Intercept

[raster] <put output description here>

Quality

[raster] <put output description here>

Intercept

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:geographicallyweightedmultipleregression’ , points, dependent, target, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, range , radius, mode, npoints, maxpoints, minpoints, output_extent, user_size, user_quality, user_intercept, grid_quality, grid_intercept)

See also

Geographically weighted regression (points/grid)

Description

<put algortithm description here>

Parameters

Predictor

[raster] <put parameter description here>

Points

[vector: point] <put parameter description here>

Dependent Variable

[tablefield: any] <put parameter description here>

Distance Weighting

[selection] <put parameter description here>

Options:

436 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 1

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 1.0

Search Range

[selection] <put parameter description here>

Options:

• 0 — [0] search radius (local)

• 1 — [1] no search radius (global)

Default: 0

Search Radius

[number] <put parameter description here>

Default: 0

Search Mode

[selection] <put parameter description here>

Options:

• 0 — [0] all directions

• 1 — [1] quadrants

Default: 0

Number of Points

[selection] <put parameter description here>

Options:

• 0 — [0] maximum number of observations

• 1 — [1] all points

Default: 0

Maximum Number of Observations

[number] <put parameter description here>

Default: 10

Minimum Number of Observations

[number] <put parameter description here>

Default: 4

Outputs

Regression

[raster] <put output description here>

Coefficient of Determination

[raster] <put output description here>

Intercept

[raster] <put output description here>

Slope

[raster] <put output description here>

Residuals

[vector] <put output description here>

18.7. SAGA algorithm provider 437

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’saga:geographicallyweightedregressionpointsgrid’ , predictor, points, dependent, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, range , radius, mode, npoints, maxpoints, minpoints, regression, quality, intercept, slope, residuals)

See also

Geographically weighted regression

Description

<put algortithm description here>

Parameters

Points

[vector: point] <put parameter description here>

Dependent Variable

[tablefield: any] <put parameter description here>

Predictor

[tablefield: any] <put parameter description here>

Target Grids

[selection] <put parameter description here>

Options:

• 0 — [0] user defined

Default: 0

Distance Weighting

[selection] <put parameter description here>

Options:

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 0

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 0.0

Search Range

[selection] <put parameter description here>

Options:

• 0 — [0] search radius (local)

• 1 — [1] no search radius (global)

Default: 0

Search Radius

[number] <put parameter description here>

Default: 100

438 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Search Mode

[selection] <put parameter description here>

Options:

• 0 — [0] all directions

• 1 — [1] quadrants

Default: 0

Number of Points

[selection] <put parameter description here>

Options:

• 0 — [0] maximum number of observations

• 1 — [1] all points

Default: 0

Maximum Number of Observations

[number] <put parameter description here>

Default: 10

Minimum Number of Observations

[number] <put parameter description here>

Default: 4

Output extent

[extent] <put parameter description here>

Default: 0,1,0,1

Cellsize

[number] <put parameter description here>

Default: 100.0

Outputs

Grid

[raster] <put output description here>

Quality

[raster] <put output description here>

Intercept

[raster] <put output description here>

Slope

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:geographicallyweightedregression’ , points, dependent, predictor, target, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, range , radius, mode, npoints, maxpoints, minpoints, output_extent, user_size, user_grid, user_quality, user_intercept, user_slope)

See also

Global moran’s i for grids

Description

<put algortithm description here>

Parameters

Grid

[raster] <put parameter description here>

Case of contiguity

[selection] <put parameter description here>

Options:

18.7. SAGA algorithm provider 439

QGIS User Guide, Versão 2.6

• 0 — [0] Rook

• 1 — [1] Queen

Default: 0

Outputs

Result

[table] <put output description here>

Console usage

processing .

runalg( ’saga:globalmoransiforgrids’ , grid, contiguity, result)

See also

Minimum distance analysis

Description

Performs a complete distance analysis of a point layer:

• minimum distance of points

• maximum distance of points

• average distance of all the points

• standard deviation of the distance

• duplicated points

Parameters

Points

[vector: point] Layer to analyze.

Outputs

Minimum Distance Analysis

[table] The resulting table.

Console usage

processing .

runalg( ’saga:minimumdistanceanalysis’ , points, table)

See also

Multi-band variation

Description

<put algortithm description here>

440 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Grids

[multipleinput: rasters] <put parameter description here>

Radius [Cells]

[number] <put parameter description here>

Default: 1

Distance Weighting

[selection] <put parameter description here>

Options:

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 1

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 1.0

Outputs

Mean Distance

[raster] <put output description here>

Standard Deviation

[raster] <put output description here>

Distance

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:multibandvariation’ , bands, radius, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, mean, stddev, diff)

See also

Multiple regression analysis (grid/grids)

Description

<put algortithm description here>

Parameters

Dependent

[raster] <put parameter description here>

Grids

[multipleinput: rasters] <put parameter description here>

Grid Interpolation

[selection] <put parameter description here>

Options:

18.7. SAGA algorithm provider 441

QGIS User Guide, Versão 2.6

• 0 — [0] Nearest Neighbor

• 1 — [1] Bilinear Interpolation

• 2 — [2] Inverse Distance Interpolation

• 3 — [3] Bicubic Spline Interpolation

• 4 — [4] B-Spline Interpolation

Default: 0

Include X Coordinate

[boolean] <put parameter description here>

Default: True

Include Y Coordinate

[boolean] <put parameter description here>

Default: True

Method

[selection] <put parameter description here>

Options:

• 0 — [0] include all

• 1 — [1] forward

• 2 — [2] backward

• 3 — [3] stepwise

Default: 0

P in

[number] <put parameter description here>

Default: 5

P out

[number] <put parameter description here>

Default: 5

Outputs

Regression

[raster] <put output description here>

Residuals

[raster] <put output description here>

Details: Coefficients

[table] <put output description here>

Details: Model

[table] <put output description here>

Details: Steps

[table] <put output description here>

Console usage

processing .

runalg( ’saga:multipleregressionanalysisgridgrids’ , dependent, grids, interpol, coord_x, coord_y, method, p_in, p_out, regression, residuals, info_coeff, info_model, info_steps)

See also

Multiple regression analysis (points/grids)

Description

<put algortithm description here>

442 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Grids

[multipleinput: rasters] <put parameter description here>

Shapes

[vector: any] <put parameter description here>

Attribute

[tablefield: any] <put parameter description here>

Grid Interpolation

[selection] <put parameter description here>

Options:

• 0 — [0] Nearest Neighbor

• 1 — [1] Bilinear Interpolation

• 2 — [2] Inverse Distance Interpolation

• 3 — [3] Bicubic Spline Interpolation

• 4 — [4] B-Spline Interpolation

Default: 0

Include X Coordinate

[boolean] <put parameter description here>

Default: True

Include Y Coordinate

[boolean] <put parameter description here>

Default: True

Method

[selection] <put parameter description here>

Options:

• 0 — [0] include all

• 1 — [1] forward

• 2 — [2] backward

• 3 — [3] stepwise

Default: 0

P in

[number] <put parameter description here>

Default: 5

P out

[number] <put parameter description here>

Default: 5

Outputs

Details: Coefficients

[table] <put output description here>

Details: Model

[table] <put output description here>

Details: Steps

[table] <put output description here>

Residuals

[vector] <put output description here>

Regression

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:multipleregressionanalysispointsgrids’ , grids, shapes, attribute, interpol, coord_x, coord_y, method, p_in, p_out, info_coeff, info_model, info_steps, residuals, regression)

18.7. SAGA algorithm provider 443

QGIS User Guide, Versão 2.6

See also

Polynomial regression

Description

<put algortithm description here>

Parameters

Points

[vector: any] <put parameter description here>

Attribute

[tablefield: any] <put parameter description here>

Polynom

[selection] <put parameter description here>

Options:

• 0 — [0] simple planar surface

• 1 — [1] bi-linear saddle

• 2 — [2] quadratic surface

• 3 — [3] cubic surface

• 4 — [4] user defined

Default: 0

Maximum X Order

[number] <put parameter description here>

Default: 4

Maximum Y Order

[number] <put parameter description here>

Default: 4

Maximum Total Order

[number] <put parameter description here>

Default: 4

Trend Surface

[selection] <put parameter description here>

Options:

• 0 — [0] user defined

Default: 0

Output extent

[extent] <put parameter description here>

Default: 0,1,0,1

Cellsize

[number] <put parameter description here>

Default: 100.0

Outputs

Residuals

[vector] <put output description here>

Grid

[raster] <put output description here>

444 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Console usage

processing .

runalg( ’saga:polynomialregression’ , points, attribute, polynom, xorder, yorder, torder, target, output_extent, user_size, residuals, user_grid)

See also

Radius of variance (grid)

Description

<put algortithm description here>

Parameters

Grid

[raster] <put parameter description here>

Standard Deviation

[number] <put parameter description here>

Default: 1.0

Maximum Search Radius (cells)

[number] <put parameter description here>

Default: 20

Type of Output

[selection] <put parameter description here>

Options:

• 0 — [0] Cells

• 1 — [1] Map Units

Default: 0

Outputs

Variance Radius

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:radiusofvariancegrid’ , input , variance, radius, output, result)

See also

Regression analysis

Description

<put algortithm description here>

18.7. SAGA algorithm provider 445

QGIS User Guide, Versão 2.6

Parameters

Grid

[raster] <put parameter description here>

Shapes

[vector: any] <put parameter description here>

Attribute

[tablefield: any] <put parameter description here>

Grid Interpolation

[selection] <put parameter description here>

Options:

• 0 — [0] Nearest Neighbor

• 1 — [1] Bilinear Interpolation

• 2 — [2] Inverse Distance Interpolation

• 3 — [3] Bicubic Spline Interpolation

• 4 — [4] B-Spline Interpolation

Default: 0

Regression Function

[selection] <put parameter description here>

Options:

• 0 — [0] Y = a + b * X (linear)

• 1 — [1] Y = a + b / X

• 2 — [2] Y = a / (b - X)

• 3 — [3] Y = a * X^b (power)

• 4 — [4] Y = a e^(b * X) (exponential)

• 5 — [5] Y = a + b * ln(X) (logarithmic)

Default: 0

Outputs

Regression

[raster] <put output description here>

Residuals

[vector] <put output description here>

Console usage

processing .

runalg( ’saga:regressionanalysis’ , grid, shapes, attribute, interpol, method, regression, residual)

See also

Representativeness

Description

<put algortithm description here>

446 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Grid

[raster] <put parameter description here>

Radius (Cells)

[number] <put parameter description here>

Default: 10

Exponent

[number] <put parameter description here>

Default: 1

Outputs

Representativeness

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:representativeness’ , input , radius, exponent, result)

See also

Residual analysis

Description

<put algortithm description here>

Parameters

Grid

[raster] <put parameter description here>

Radius (Cells)

[number] <put parameter description here>

Default: 7

Distance Weighting

[selection] <put parameter description here>

Options:

• 0 — [0] no distance weighting

• 1 — [1] inverse distance to a power

• 2 — [2] exponential

• 3 — [3] gaussian weighting

Default: 0

Inverse Distance Weighting Power

[number] <put parameter description here>

Default: 1

Inverse Distance Offset

[boolean] <put parameter description here>

Default: True

Gaussian and Exponential Weighting Bandwidth

[number] <put parameter description here>

Default: 1.0

18.7. SAGA algorithm provider 447

QGIS User Guide, Versão 2.6

Outputs

Mean Value

[raster] <put output description here>

Difference from Mean Value

[raster] <put output description here>

Standard Deviation

[raster] <put output description here>

Value Range

[raster] <put output description here>

Minimum Value

[raster] <put output description here>

Maximum Value

[raster] <put output description here>

Deviation from Mean Value

[raster] <put output description here>

Percentile

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:residualanalysis’ , grid, radius, distance_weighting_weighting, distance_weighting_idw_power, distance_weighting_idw_offset, distance_weighting_bandwidth, mean, diff, stddev, range , min , max , devmean, percent)

See also

Spatial point pattern analysis

Description

<put algortithm description here>

Parameters

Points

[vector: point] <put parameter description here>

Vertex Distance [Degree]

[number] <put parameter description here>

Default: 5

Outputs

Mean Centre

[vector] <put output description here>

Standard Distance

[vector] <put output description here>

Bounding Box

[vector] <put output description here>

Console usage

processing .

runalg( ’saga:spatialpointpatternanalysis’ , points, step, centre, stddist, bbox)

See also

Statistics for grids

Description

<put algortithm description here>

448 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Parameters

Grids

[multipleinput: rasters] <put parameter description here>

Outputs

Arithmetic Mean

[raster] <put output description here>

Minimum

[raster] <put output description here>

Maximum

[raster] <put output description here>

Variance

[raster] <put output description here>

Standard Deviation

[raster] <put output description here>

Mean less Standard Deviation

[raster] <put output description here>

Mean plus Standard Deviation

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:statisticsforgrids’ , grids, mean, min , max , var, stddev, stddevlo, stddevhi)

See also

Variogram cloud

Description

<put algortithm description here>

Parameters

Points

[vector: point] <put parameter description here>

Attribute

[tablefield: any] <put parameter description here>

Maximum Distance

[number] <put parameter description here>

Default: 0.0

Skip Number

[number] <put parameter description here>

Default: 1

Outputs

Variogram Cloud

[table] <put output description here>

Console usage

processing .

runalg( ’saga:variogramcloud’ , points, field, distmax, nskip, result)

18.7. SAGA algorithm provider 449

QGIS User Guide, Versão 2.6

See also

Variogram surface

Description

<put algortithm description here>

Parameters

Points

[vector: point] <put parameter description here>

Attribute

[tablefield: any] <put parameter description here>

Number of Distance Classes

[number] <put parameter description here>

Default: 10

Skip Number

[number] <put parameter description here>

Default: 1

Outputs

Number of Pairs

[raster] <put output description here>

Variogram Surface

[raster] <put output description here>

Covariance Surface

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:variogramsurface’ , points, field, distcount, nskip, count, variance, covariance)

See also

Zonal grid statistics

Description

<put algortithm description here>

Parameters

Zone Grid

[raster] <put parameter description here>

Categorial Grids

[multipleinput: rasters] Optional.

<put parameter description here>

Grids to analyse

[multipleinput: rasters] Optional.

<put parameter description here>

Aspect

[raster] Optional.

<put parameter description here>

450 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

Short Field Names

[boolean] <put parameter description here>

Default: True

Outputs

Zonal Statistics

[table] <put output description here>

Console usage

processing .

runalg( ’saga:zonalgridstatistics’ , zones, catlist, statlist, aspect, shortnames, outtab)

.

See also

18.7.2 Grid analysis

Accumulated cost (anisotropic)

Description

<put algortithm description here>

Parameters

Cost Grid

[raster] <put parameter description here>

Direction of max cost

[raster] <put parameter description here>

Destination Points

[raster] <put parameter description here>

k factor

[number] <put parameter description here>

Default: 1

Threshold for different route

[number] <put parameter description here>

Default: 0

Outputs

Accumulated Cost

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:accumulatedcostanisotropic’ , cost, direction, points, k, threshold, acccost)

18.7. SAGA algorithm provider 451

QGIS User Guide, Versão 2.6

See also

Accumulated cost (isotropic)

Description

<put algortithm description here>

Parameters

Cost Grid

[raster] <put parameter description here>

Destination Points

[raster] <put parameter description here>

Threshold for different route

[number] <put parameter description here>

Default: 0.0

Outputs

Accumulated Cost

[raster] <put output description here>

Closest Point

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:accumulatedcostisotropic’ , cost, points, threshold, acccost, closestpt)

See also

Aggregation index

Description

<put algortithm description here>

Parameters

Input Grid

[raster] <put parameter description here>

Max.

Number of Classes

[number] <put parameter description here>

Default: 5

Outputs

Result

[table] <put output description here>

Console usage

processing .

runalg( ’saga:aggregationindex’ , input , maxnumclass, result)

452 Capítulo 18. Fornece algoritmos e processamento

QGIS User Guide, Versão 2.6

See also

Analytical hierarchy process

Description

<put algortithm description here>

Parameters

Input Grids

[multipleinput: rasters] <put parameter description here>

Pairwise Comparisons Table

[table] <put parameter description here>

Outputs

Output Grid

[raster] <put output description here>

Console usage

processing .

runalg( ’saga:analyticalhierarchyprocess’ , grids, table, output)

See also

Cross-classification and tabulation

Description

<put algortithm description here>

Parameters

Input Grid 1

[raster] <put parameter description here>

Input Grid 2

[raster] <put parameter description here>

Max.

Number of Classes

[number] <put parameter description he