SEGA OutRun 2 Special Tours DX arcade game OWNER'S MANUAL

OUTRUN 2 SPECIAL TOURS DX 420-7004-02 1ST PRINTING OWNER'S MANUAL OWNER'S MANUAL © SEGA 420-7004-02 Nissay Aroma Building, 5-37-1, Kamata, Ohta-ku, Tokyo 144-8721, Japan Phone: +81-3-5480-6582 Facsimile: +81-3-5480-6584 IMPORTANT • Before using this product, read this manual carefully to understand the contents herein stated. • After reading this manual, be sure to keep it near the product or in a convenient place for easy reference when necessary. BEFORE USING THE PRODUCT, BE SURE TO READ THE FOLLOWING: To maintain safety: To ensure the safe operation of this product, be sure to read the following before usage. The following instructions are intended for the users, operators and the personnel in charge of the operation of the product. After carefully reading and sufficiently understanding the warning displays and cautions, handle the product appropriately. Be sure to keep this manual close to the product or in a convenient place for future reference. Herein, explanations which require special attention are enclosed with dual lines. Depending on the potentially hazardous degrees, the terms of DANGER, WARNING, CAUTION, etc. are used. Be sure to understand the contents of the displays before reading the text. Indicates that mishandling the product by disregarding this pictograph will cause severe injury or death. Indicates that mishandling the product by disregarding this caution will cause a slight hazardous situation which can result in personal injury and/or material damage. Indicates that mishandling the product by disregarding this warning will cause a potentially hazardous situation which can result in death or serious injury. For the safe usage of the product, the following pictographs are used: Indicates "HANDLE WITH CARE." In order to protect the human body and equipment, this display is attached to places where the Owner's Manual, Serviceman Manual and/or Service Manual should be referred to. Indicates a "Protective Earth Terminal." Before operating the equipment, be sure to connect it to the Ground. (The step may be omitted for products in which a power cord with earth is used.) ❍ Perform work in accordance with the instructions herein stated. Instructions for work are explained by paying attention to the aspect of accident prevention. Failing to perform work as per the instructions can cause accidents. In the case where only those who have technical expertise should perform the work to avoid hazardous situation, the instructions herein state that the site maintenance personnel should perform such work. ❍ Be sure to turn off the power before working on the machine. To prevent an electric shock, be sure to turn off the power before carrying out any work that requires direct contact with the interior of the product. If the work is to be performed in the power-on status, the Instruction Manual herein always states to that effect. ❍ Be sure to ground the Earth Terminal. (This is not required in the case where a power cord with earth is used.) This product is equipped with the Earth Terminal. When installing the product, connect the Earth Terminal to the "accurately grounded indoor earth terminal" by using an earth wire. Unless the product is grounded appropriately, the user can be subject to an electric shock. After performing repair, etc. for the control equipment, ensure that the Earth Wire is firmly connected to the control equipment. ❍ Ensure that the Power Supply used is equipped with an Earth Leakage Breaker. This product does not incorporate the Earth Leakage Breaker. Using a power supply which is not equipped with the Earth Leakage Breaker can cause a fire when earth leakage occurs. ❍ Be sure to use fuses which meet the specified rating. (Only for the machines which use fuses.) Using fuses exceeding the specified rating can cause a fire and an electric shock. ❍ Specification changes (removal of equipment, conversion and addition) not designated by SEGA are not allowed. The parts of the product include warning labels for safety, covers for personal protection, etc. It is very hazardous to operate the product by removing parts and/or modifying the circuits. Should doors, lids and protective parts be damaged or lost, refrain from operating the product, and contact where the product was purchased from or the office herein stated. SEGA shall not be held responsible for any accidents, compensation for damage to a third party, resulting from the specifications not designated by SEGA. ❍ Ensure that the product meets the requirements of appropriate Electrical Specifications. Before installing the product, check for Electrical Specifications. SEGA products have a nameplate on which Electrical Specifications are described. Ensure that the product is compatible with the power supply voltage and frequency requirements of the location. Using any Electrical Specifications different from the designated Specifications can cause a fire and an electric shock. ❍ Install and operate the product in places where appropriate lighting is available, allowing warning labels to be clearly read. To ensure safety for the customers, labels and printed instructions describing potentially hazardous situations are applied to places where accidents can be caused. Ensure that where the product is operated has sufficient lighting allowing the warnings to be read. If any label is peeled off, apply it again immediately. Please place an order with where the product was purchased from or the office herein stated. ❍ When handling the monitor, be very careful. (Applies only to the product with a monitor.) Some of the monitor (TV) parts are subject to high tension voltage. Even after turning off the power, some portions are still subject to high tension voltage sometimes. Monitor repair and replacement should be performed only by those technical personnel who have knowledge of electricity and technical expertise. ❍ Be sure to adjust the monitor/projector properly. (Applies only to the product with a monitor/projector.) Do not operate the product leaving on-screen flickering or blurring as it is. Using the product with the monitor/projector not properly adjusted may cause dizziness or a headache to an operator, a player, or the customers. ❍ When transporting or reselling this product, be sure to attach this manual to the product. In the case where commercially available monitors and printers are used in this product, only the contents relating to this product are explained herein. Some commercially available equipment has functions and reactions not stated in this manual. Read this manual together with the specific Instruction Manual of such equipment. * Descriptions herein contained may be subject to improvement changes without notice. * The contents described herein are fully prepared with due care. However, should any question arise or errors be found, please contact SEGA. INSPECTIONS IMMEDIATELY AFTER TRANSPORTING THE PRODUCT TO THE LOCATION Normally, at the time of shipment, SEGA products are in a status allowing for usage immediately after transporting to the location. Nevertheless, an irregular situation may occur during transportation. Before turning on the power, check the following points to ensure that the product has been transported in a satisfactory status. ❐ Are there any dented portions or defects (cuts, etc.) on the external surfaces of the cabinet? ❐ Are Casters and Adjusters damaged? ❐ Do the power supply voltage and frequency requirements meet with those of the location? ❐ Are all wiring connectors correctly and securely connected? Unless connected in the correct way, connector connections can not be made accurately. Do not insert connectors forcibly. ❐ Do power cords have cuts and dents? ❐ Do the fuses used meet specified ratings? Is the Circuit Protector in an energized status? ❐ Are all accessories available? ❐ Can all Doors and Lids be opened with the Accessory Keys? Can Doors and Lids be firmly closed? TABLE OF CONTENTS BEFORE USING THE PRODUCT, BE SURE TO READ THE FOLLOWING: INTRODUCTION ................................................................................................ iii 1 HANDLING PRECAUTIONS ......................................................................... 1 2 PRECAUTIONS REGARDING INSTALLATION LOCATION........................ 6 2-1 LIMITATIONS OF USAGE ................................................................................................7 2-2 OPERATION AREA ..........................................................................................................8 TABLE OF CONTENTS TABLE OF CONTENTS ....................................................................................... i 3 PRECAUTIONS REGARDING PRODUCT OPERATION ............................. 9 3-1 BEFORE OPERATION ....................................................................................................9 3-2 DURING OPERATION (PAYING ATTENTION TO CUSTOMERS) ................................12 4 PART DESCRIPTIONS ................................................................................ 16 5 ACCESSORIES ........................................................................................... 18 6 ASSEMBLY AND INSTALLATION .............................................................. 21 7 PRECAUTIONS WHEN MOVING THE MACHINE...................................... 73 8 PROJECTOR ............................................................................................... 78 8-1 CLEANING THE SCREEN ...........................................................................................79 8-2 PROJECTOR ADJUSTMENT .......................................................................................80 8-3 CHANGING THE LAMP UNIT........................................................................................84 9 STEERING WHEEL MECHANISM .............................................................. 91 9-1 VOLUME ADJUSTMENT AND REPLACEMENT ..........................................................92 9-2 GREASING .....................................................................................................................96 10 GEAR SHIFTER........................................................................................... 97 10-1 GEAR SHIFTER REMOVAL.........................................................................................97 10-2 SWITCH REPLACEMENT............................................................................................98 10-3 GREASING ...................................................................................................................98 11 ACCELERATOR & BRAKE......................................................................... 99 11-1 VOLUME ADJUSTMENT AND REPLACEMENT ........................................................99 11-2 GREASING .................................................................................................................102 12 COIN SELECTOR ...................................................................................... 103 E0-0704 420-7004-02 i 13 GREASING THE RIDE MECHANISMS..................................................... 105 13-1 GREASING THE ACTUATOR ....................................................................................106 13-2 GREASING THE GUIDE ............................................................................................ 111 14 FLUORESCENT LIGHT REPLACEMENT ................................................ 115 15 PERIODIC INSPECTION ........................................................................... 119 TABLE OF CONTENTS 16 TROUBLESHOOTING............................................................................... 122 17 GAME BOARD .......................................................................................... 125 17-1 REMOVING THE LINDBERGH ..................................................................................126 17-2 COMPOSITION OF THE GAME BOARD ..................................................................130 17-3 SOFTWARE INSTALLATION .....................................................................................131 18 DESIGN-RELATED PARTS....................................................................... 139 19 WIRE COLOR CODE TABLE .................................................................... 142 20 WIRING DIAGRAM.................................................................................... 143 ii INTRODUCTION This manual is intended to provide detailed descriptions together with all the necessary information covering the general operation of electronic assemblies, electro-mechanicals, servicing control, spare parts, etc. for the product, “OUTRUN 2 SPECIAL TOURS DX .” In the unlikely event that the product does not function correctly, DO NOT allow anyone other than a technician to touch the internal system. Turn off the power to the machine, making sure to unplug the electrical cord from the RXWOHWDQGFRQWDFWWKHRI¿FHOLVWHGEHORZRUWKHSRLQWRISXUFKDVHIRUWKLVSURGXFW Use of this product is unlikely to cause physical injuries or damage to property. However, points that require special attention are indicated by bold text, the word "IMPORTANT" and the symbol below. TABLE OF CONTENTS This manual is intended for the owners, personnel and managers in charge of operation of the product. 2SHUDWHWKHSURGXFWDIWHUFDUHIXOO\UHDGLQJDQGVXI¿FLHQWO\XQGHUVWDQGLQJWKHLQVWUXFWLRQV Indicates important information that, if ignored, may result in the mishandling of the product and cause faulty operation or damage to the product. Sega Amusements U.S.A., Inc. 800 Arthur Avenue, Elk Grove Village, IL 60007-5215, U.S.A. TEL: 1-847-364-9787 TOLL FREE: 1-888-877-2669 FAX: 1-847-427-1065 SPECIFICATIONS Installation space: 4,000 mm (157.5in.) [Width] x 3,200 mm (126.0 in.) [Depth] Height: Weight: 2,250 mm (88.6 in.) 1,850 kg (4,078.6 lbs.) Power, maximum current: [Per cabinet] Single phase AC 208 V, 4.8 A NOTE: The contents herein described are subject to change without notice. iii 'H¿QLWLRQRIµ6LWH0DLQWHQDQFH3HUVRQQHORU2WKHU4XDOL¿HG,QGLYLGXDOV¶ INTRODUCTION Procedures not described in this manual or marked as 'to be carried out by site maintenance personnel or other qualified professionals' should not be carried out by personnel without the necessary skill or technology. Work carried out by XQTXDOLÀHGSHUVRQVPD\FDXVHVHULRXVDFFLGHQWVLQFOXGLQJHOHFWURFXWLRQ Parts replacement, maintenance inspections and troubleshooting should be carried out by site maintenance personnel RURWKHUTXDOL¿HGSURIHVVLRQDOV7KLVPDQXDOLQFOXGHVGLUHFWLRQVIRUSRWHQWLDOO\GDQJHURXVSURFHGXUHVZKLFKVKRXOG only be carried out by professionals with the appropriate specialized knowledge. 7KHVLWHPDLQWHQDQFHSHUVRQQHORURWKHUTXDOL¿HGSURIHVVLRQDOVPHQWLRQHGLQWKLVPDQXDODUHGH¿QHGDVIROORZV Site maintenance personnel: Individuals with experience in maintaining amusement equipment, vending machines, etc., working under the supervision of the owner/operator of this product to maintain machines within amusement facilities or similar premises by carrying out everyday procedures such as assembly, maintenance inspections, and replacement of units/ expendable parts. Activities to be carried out by site maintenance personnel: Amusement equipment/vending machine assembly, maintenance inspection and replacement of units/expendable parts. 2WKHUTXDOL¿HGSURIHVVLRQDOV Persons employed by amusement equipment manufacturers, or involved in design, production, testing or maintenance of amusement equipment. The individual should have either graduated from technical school or hold VLPLODUTXDOL¿FDWLRQVLQHOHFWULFDOHOHFWURQLFVPHFKDQLFDOHQJLQHHULQJ $FWLYLWLHVWREHFDUULHGRXWE\RWKHUTXDOL¿HGSURIHVVLRQDOV Amusement equipment/vending machine assembly, repair/adjustment of electrical/electronic/mechanical parts. iv 1 HANDLING PRECAUTIONS When installing or inspecting the machine, be very careful of the following points and pay attention to ensure that the player can enjoy the game safely. Non-compliance with the following points or inappropriate handling running counter to the cautionary matters herein stated can cause personal injury or damage to the machine. 1 • Do not expose power cords or earth wires on the surface, (floor, passage, etc.). If exposed, the power cords and earth wires are susceptible to damage. Damaged cords and wires can cause an electric shock or short circuit. 7RDYRLGFDXVLQJDÀUHRUDQHOHFWULFVKRFNGRQRWSXWWKLQJVRQRUGDPDJHWKH power cords. HANDLING PRECAUTIONS • Before performing work, be sure to turn the power off. Performing the work without turning the power off can cause an electric shock or short circuit. In the case work should be performed in the status of power on, this manual always states to that effect. • When or after installing the product, do not unnecessarily pull the power cord. If GDPDJHGWKHSRZHUFRUGFDQFDXVHDÀUHRUDQHOHFWULFVKRFN • In case the power cord is damaged, ask for a replacement through where the product was purchased from or the office herein stated. Using the cord as is GDPDJHGFDQFDXVHÀUHDQHOHFWULFVKRFNRUOHDNDJH • Be sure to perform grounding appropriately. Inappropriate grounding can cause an electric shock. • Be sure to use fuses meeting the specified rating. Using fuses exceeding the VSHFLÀHGUDWLQJFDQFDXVHDÀUHRUDQHOHFWULFVKRFN • Completely make connector connections for IC BD and others. Insufficient insertion can cause an electric shock. 6SHFLÀFDWLRQFKDQJHVUHPRYDORIHTXLSPHQWFRQYHUVLRQDQGRUDGGLWLRQQRW designated by SEGA are not permitted. )DLOXUHWRREVHUYHWKLVPD\FDXVHDÀUHRUDQHOHFWULFVKRFN1RQFRPSOLDQFH ZLWKWKLVLQVWUXFWLRQFDQKDYHDEDGLQÁXHQFHXSRQSK\VLFDOFRQGLWLRQVRIWKH players or the onlookers, or result in injury during play. - SEGA shall not be held responsible for damage, compensation for damage to DWKLUGSDUW\FDXVHGE\VSHFLÀFDWLRQFKDQJHVQRWGHVLJQDWHGE\6(*$ • If work or parts replacement not indicated in this manual is carried out, an accident may occur. If it is necessary to carry out work not indicated in this PDQXDOEHVXUHWRKDYHLWGRQHE\WKHRIÀFHLQGLFDWHGLQWKLVPDQXDORUE\WKH SRLQWRISXUFKDVH$OVRSOHDVHLQTXLUHUHJDUGLQJGHWDLOVRIWKHZRUNLQYROYHG • Be sure to perform periodic maintenance inspections herein stated. 1 • For the IC board circuit inspections, only the logic tester is allowed. The use of a multiple-purpose tester is not permitted, so be careful in this regard. 1 HANDLING PRECAUTIONS 2 • This product uses a projector. The projector’s screen can be easily damaged so exercise caution when cleaning it. For details, read the chapter on “Projector.” • Some parts are not designed and manufactured specifically for this game PDFKLQH7KHPDQXIDFWXUHUVPD\GLVFRQWLQXHRUFKDQJHWKHVSHFLÀFDWLRQVRI such general-purpose parts. If this is the case, SEGA cannot repair or replace a failed game machine whether or not a warranty period has expired. &21&(51,1*:$51,1*',63/$<6 This SEGA product has stickers attached describing the product manufacture No. (Serial No.) and Electrical 6SHFL¿FDWLRQV,WDOVRKDVD6WLFNHUGHVFULELQJZKHUHWR contact for repair and for purchasing parts. When inquiring about or asking for repairs, mention the Serial No. and Name of Machine indicated on the Sticker. The Serial Number indicates the product UHJLVWHU,GHQWLFDOPDFKLQHVFRXOGKDYHGLIIHUHQW parts depending on the date of production. Also, LPSURYHPHQWVDQGPRGL¿FDWLRQVPLJKWKDYHEHHQPDGH DIWHUWKHSXEOLFDWLRQRIWKLVPDQXDO,QRUGHUWRHQVXUH you order the correct parts, mention the Serial No. when contacting the applicable places. This SEGA product has warning displays on stickers, labels and/or printed instructions adhered/attached to or incorporated in the places where a potentially hazardous situation could arise. The warning displays are intended for accident prevention for customers and for avoiding hazardous situations relating to maintenance and servicing work. Some portions of the cabinet contain high voltage and may cause accidents if touched. When performing maintenance, be very careful of the warning GLVSOD\V,WLVHVSHFLDOO\LPSRUWDQWWKDWDQ\FRPSOH[ repair and replacement work not mentioned herein should be performed by those technical personnel who KDYHNQRZOHGJHRIHOHFWULFLW\DQGWHFKQLFDOH[SHUWLVH ,QRUGHUWRSUHYHQWDFFLGHQWVFDXWLRQDQ\FXVWRPHU ignoring the warnings to cease and desist immediately. NOTE: The stickers referred to in this manual are all attached to each machine. ㆑࿈ ㆑࿈ វ㞹ࡌࡾ༱㝜࠿࠵ࡽࡱࡌ ࡡ࡚㸡షᴏ๑࡞ࡢᚪࡍࠈࠈ 㞹″ࢅวࡖ࡙ࡂࡓࡈ࠷㸣 វ㞹ࡌࡾ༱㝜࠿࠵ࡽࡱࡌ ࡡ࡚㸡షᴏ๑࡞ࡢᚪࡍࠈࠈ 㞹″ࢅวࡖ࡙ࡂࡓࡈ࠷㸣 1 HANDLING PRECAUTIONS &21&(51,1*7+(67,&.(5',63/$< ᮇࣗࢼࢴࢹ㈹㔖㹠㹜 3 1 HANDLING PRECAUTIONS 4 1 HANDLING PRECAUTIONS 5 2 PRECAUTIONS REGARDING INSTALLATION LOCATION 2 PRECAUTIONS REGARDING INSTALLATION LOCATION 6 This product is an indoor game machine. Do not install it outside. Even indoors, avoid installing in places mentioned below so as not to cause a fire, electric VKRFNLQMXU\DQGRUPDOIXQFWLRQ - Places subject to rain or water leakage, or places subject to high humidity in WKHSUR[LPLW\RIDQLQGRRUVZLPPLQJSRRODQGRUVKRZHUHWF - Places subject to direct sunlight, or places subject to high temperatures in the proximity of heating units, etc. 3ODFHVÀOOHGZLWKLQÁDPPDEOHJDVRUSODFHVLQWKHYLFLQLW\RIKLJKO\LQÁDPPDEOH volatile chemicals or hazardous matter. - Dusty places. - Sloped surfaces. - Places subject to any type of violent impact. 3ODFHVLQWKHYLFLQLW\RIDQWLGLVDVWHUIDFLOLWLHVVXFKDVÀUHH[LWVDQGÀUHH[WLQJXLVKHUV - Areas where the temperature exceeds the applicable temperature (ambient temperature) range of 5 to 30 degrees centigrade. 2-1 LIMITATIONS OF USAGE • A dedicated breaker and grounding mechanism are necessary for the control tower and each cabinet of this product. Failure to heed this warning can cause DÀUHRUHOHFWULFVKRFN • Use wires of the following capacity for the indoor power wiring. The use of wires RIGLIIHUHQWHOHFWULFDOVSHFLÀFDWLRQVFDQFDXVHDÀUHRUHOHFWULFVKRFN Per cabinet: Single phase AC 208 V, 15 A min. %HVXUHWRXVHDQLQGHSHQGHQWSRZHUVXSSO\HTXLSSHGZLWKDQHDUWKOHDNDJH breaker. Using a power supply without an earth leakage breaker can cause an RXWEUHDNRIÀUHLIDSRZHUVXUJHRFFXUV • Putting many loads on one electrical outlet can cause generation of heat and a ÀUHUHVXOWLQJIURPRYHUORDG • Use cable as rated below for the power cable. Use of a rated cable that does QRWVDWLVI\WKHSUHVFULEHGUDWLQJFDQFDXVHÀUHDQGHOHFWULFVKRFN Single phase AC 208 V, 15 A min. 2 PRECAUTIONS REGARDING INSTALLATION LOCATION • Be sure to check the Electrical Specifications. Ensure that this product LV FRPSDWLEOH ZLWK WKH ORFDWLRQ V SRZHU VXSSO\ YROWDJH DQG IUHTXHQF\ UHTXLUHPHQWV $ SODWH GHVFULELQJ (OHFWULFDO 6SHFLILFDWLRQV LV DWWDFKHG WR WKH SURGXFW 1RQFRPSOLDQFH ZLWK WKH (OHFWULFDO 6SHFLILFDWLRQV FDQ FDXVH D ILUH and electric shock. Electricity Consumption: [Per cabinet] MAX. 4.8 A (Single phase AC 208 V) 7 2-2 OPERATION AREA 2 PRECAUTIONS REGARDING INSTALLATION LOCATION • For the operation of this machine, secure a minimum area of 4.9 m (W) x 4.9 m (D). These dimensions are necessary to enable the customer to walk around the PDFKLQHDQGDOVRWRSURYLGH DGHTXDWH YHQWLODWLRQ 7KLV PDFKLQH LV D ULGH VR there is a possibility of a player falling off. In such an event, if a player strikes his or her head, a serious accident may occur, so be sure to secure the minimum DUHDDURXQGWKHPDFKLQHVSHFLÀHGLQWKLVPDQXDO %HVXUHWRSURYLGHVXIÀFLHQWVSDFHVSHFLÀHGLQWKLVPDQXDO'RQRWDOORZREMHFWV WREORFNWKHYHQWLODWLRQSRUWV,WFDQFDXVHJHQHUDWLRQRIKHDWDQGDÀUH • SEGA shall not be held responsible for damage or compensation for damage to a third party, resulting from the failure to observe this instruction. ,IWKHPDFKLQHGRHVQRWÀWWKURXJKWKHHQWU\ZD\WRWKHLQVWDOODWLRQORFDWLRQGR QRWGLVDVVHPEOHLWZLWKRXWÀUVWFRQVXOWLQJWKHLQVWUXFWLRQV7KHPDFKLQHVKRXOG only be disassembled in accordance with the instructions listed in this manual; GRQRWDWWHPSWWRGLVDVVHPEOHLWLQDQ\RWKHUZD\6SHFLÀFWRROVDQGDGMXVWPHQW SURFHGXUHVDUHUHTXLUHGWRDVVHPEOHDQGGLVDVVHPEOHWKHPHFKDQLFDOSDUWV Attempting to assemble or disassemble the machine without consulting the LQVWUXFWLRQVPD\UHVXOWLQDFFLGHQWVGXULQJDVVHPEO\GLVDVVHPEO\DQGHOHFWULF VKRFNVKRUWFLUFXLWVDQGRUSHUVRQDOLQMXU\GXULQJRSHUDWLRQ,IWKHPDFKLQHVWLOO GRHVQRWÀWWKURXJKWKHHQWU\ZD\DIWHUIROORZLQJWKHSURFHGXUHVLQWKLVPDQXDO FRQWDFW\RXUUHWDLOHURUWKHRIÀFHOLVWHGLQWKLVPDQXDO • If the machine is still too large to fit through the entryway after following the procedures listed in this manual, do not tip the machine on its side. Attempting to transport the machine while it is tipped on its side may cause accidents. It may also damage or warp parts of the machine, resulting in accidents during operation. • To install this product, the entrance must be at least 1.4 m in width and 1.45 m in height. If the entrance is too narrow, do not tilt the product carelessly. If all the product weight is put on the casters at one side only, there could be damage or deformation, causing serious accidents such as workers getting caught underneath. វ㞹ࡌࡾ༱㝜࠿࠵ࡽࡱࡌ ࡡ࡚㸡షᴏ๑࡞ࡢᚪࡍࠈࠈ 㞹″ࢅวࡖ࡙ࡂࡓࡈ࠷㸣 ⇍ࡂ࡝ࡖࡒ⺧ක⅁ࡷ㞹⌣࡞ࡻࡽ ℾഭࢅࡌࡾ༱㝜࠿࠵ࡽࡱࡌ㸣 ஹᥦ᫤࡞ࡢ༎ฦἸណࡊ࡙ࡂࡓࡈ࠷㸣 ㆑࿈ ㆑࿈ ᮇࣗࢼࢴࢹ㈹㔖㹠㹜 វ㞹ࡌࡾ༱㝜࠿࠵ࡽࡱࡌ ࡡ࡚㸡షᴏ๑࡞ࡢᚪࡍࠈࠈ 㞹″ࢅวࡖ࡙ࡂࡓࡈ࠷㸣 ⇍ࡂ࡝ࡖࡒ⺧ක⅁ࡷ㞹⌣࡞ࡻࡽ ℾഭࢅࡌࡾ༱㝜࠿࠵ࡽࡱࡌ㸣 ஹᥦ᫤࡞ࡢ༎ฦἸណࡊ࡙ࡂࡓࡈ࠷㸣 ㆑࿈ ㆑࿈ ᮇࣗࢼࢴࢹ㈹㔖㹠㹜 FIG.2 Operation Area (Unit: mm) 8 3 PRECAUTIONS REGARDING PRODUCT OPERATION To avoid injury and trouble, be sure to pay attention to the behavior of visitors and players. 3-1 BEFORE OPERATION 3 PRECAUTIONS REGARDING PRODUCT OPERATION • Check if all of the adjusters are in contact with the surface. If they are not, the cabinet can move and cause an accident. • To ensure safety, carry out a trial run before starting operation, and be sure to FKHFN WKH VDIHW\ GHYLFHV (DFK ULGH PRYHV VR HDFK LV HTXLSSHG ZLWK VDIHW\ devices. Be sure to check that these safety devices function normally. 'RHVWKHULGHVWRSZKHQWKH027,216723EXWWRQDWWKHFHQWHURIWKHFRQWURO panel is pressed? • Check each safety device and also check to see if any of the rides move abnormally. Abnormal motion may cause an accident, so do not operate the machine until the cause of the abnormality has been removed. - Does the ride move in the direction corresponding to the direction of operation? - Does the ride move smoothly? - Is there any undesirable looseness in the ride? - Is any unusual noise emitted while the ride is operating? - Is any unusual vibration emitted while the ride is operating? - Does the ride stop at an even position when the game is over? 9 • If an abnormality occurs in the ride mechanism, immediately stop operation, WXUQRIIWKHSRZHUDQGFRQWDFWWKHRIÀFHLQGLFDWHGLQWKLVPDQXDORUWKHSRLQWRI purchase. If you continue to operate the machine while there is an abnormality LQLWDVHULRXVDFFLGHQWVXFKDVDQHOHFWULFVKRFNVKRUWFLUFXLWÀUHRUDIDOOPD\ occur. 3 PRECAUTIONS REGARDING PRODUCT OPERATION • The motion of the ride will not stop when the ride is touched by anybody other than a player. Be sure to monitor the machine during a game. • If a part related to the actuator of the ride mechanism breaks or deforms, IRU H[DPSOH QHFHVVLWDWLQJ UHSODFHPHQW RU UHSDLU RI WKH SDUW UHTXHVW WKH RIÀFHLQGLFDWHGLQWKLVPDQXDORUWKHSRLQWRISXUFKDVHWRFDUU\RXWWKLVZRUN Specialized knowledge, technical expertise, and tools are necessary for carrying out this work. If you attempt to carry out this work yourself, an accident may occur. • Be sure to perform appropriate adjustment of the projector. For operation of this PDFKLQHGRQRWOHDYHPRQLWRU·VÁLFNHULQJRUGHYLDWLRQDVLV)DLOXUHWRREVHUYH this can have a bad influence upon the players’ or the customers’ physical conditions. • It is suggested to prepare a rest space for players who feel sick after playing the game. • Do not put any heavy item on this product. Placing any heavy item on the product can cause an accident fall or parts damage. • Do not climb on the product. Climbing on the product can cause an accident fall. To check the top portion of the product, use a step ladder. • To avoid electric shock, check to see if door & cover parts are damaged or omitted. 7R DYRLG HOHFWULF VKRFN VKRUW FLUFXLW DQGRU SDUWV GDPDJH GR QRW SXW WKH following items on or in the periphery of the product. )ORZHU YDVHV IORZHUSRWV FXSV ZDWHU WDQNV FRVPHWLFV DQG UHFHSWDFOHV FRQWDLQHUVYHVVHOVFRQWDLQLQJFKHPLFDOVDQGZDWHU 10 • Inspect for the following items during a trial run. If there is any type of error, use the Test Mode, etc., to resolve the problem. If you continue use with an error, it can cause an accident or irreparable parts damage. - Do the steering wheel and the ride move smoothly during the initialization operation? (See Chapter 6.) - Is there any abnormality in the steering wheel reaction mechanism? - Is there any improper adjustment of the projector screen? - Are the bellows torn or has a screw dropped out of them? • During daily cleaning, be sure to check the surface of the steering wheel, gear shifter, and other parts that the player touches with his hands for damage, cracks, or loose screws. If a player uses the machine while it is damaged, cracked, or has a loose screw, the player may become injured. • During daily cleaning, be sure to check the seat for any abnormality, wetness, etc. Failure to do this may result in deliberate tampering or negligence being left undetected. • Players directly hold the controller with their bare hands so it is recommended that wet towels (paper towels) be provided. 3 PRECAUTIONS REGARDING PRODUCT OPERATION - Is there any strangeness in the operability of the steering wheels or the pedals? (QGHDYRUWRFOHDQWKHVWHHULQJZKHHODQGVHDWIUHTXHQWO\ • Provide a container or space for storing the customers’ hand luggage, etc. To help prevent an accident and also protect parts, establish measures so that customers do not bring raingear, such as umbrellas, on rainy days, or juice or other beverages, into the area where the machine is installed. • During network play, if communication is interrupted for some reason, each game will continue independently. Also, if communication is interrupted while in Customer Welcome Mode, the Test Screen will appear. • When one cabinet connected for network play enters the Test Mode, the other cabinets will move to the Test Screen. For this reason, do not needlessly put a cabinet in the Test Mode while a customer is playing a game, even if the cabinet is not being used. <RXFDQPDNHJDPHVHWWLQJVDQGFRLQFUHGLWIHHVHWWLQJVLQGLYLGXDOO\HYHQ IRU FDELQHWV WKDW DUH FRQQHFWHG IRU QHWZRUN SOD\ <RX FDQ DOVR FKDQJH WKH settings of an individual cabinet to those for advanced players or beginners, for H[DPSOH1RUPDOO\KRZHYHUVHWDOORIWKHFDELQHWVWRWKHVDPHVHWWLQJV,I\RX make a mistake in the fee setting, it is likely that the balance of payments and other items will be adversely affected. 11 3-2 DURING OPERATION (PAYING ATTENTION TO CUSTOMERS) ,QRUGHUWRSUHYHQWDQDFFLGHQWRUXQQHFHVVDU\WURXEOHWKHDWWHQGDQWRURSHUDWRUPXVWHQGHDYRUWRDOZD\VSD\ attention to the behavior of the players and customer. This machine has movable rides of about the same size as an DXWRPRELOH6RPHWLPHVDSOD\HURUDFXVWRPHUPD\EHKDYHLQDQXQH[SHFWHGZD\%HDGHTXDWHO\DZDUHRIVDIHW\ and stop any behavior that is considered dangerous. 3 PRECAUTIONS REGARDING PRODUCT OPERATION • For safety, do not allow any of the following people to play the game. - Those who have high blood pressure or a heart problem. - Those who have experienced muscle convulsion or loss of consciousness when playing video games, etc. - Those who have neck or spinal cord problems. 7KRVHZKRDUHLQWR[LFDWHGRUXQGHUWKHLQÁXHQFHRIGUXJV - Pregnant women or those who could be pregnant. - Those who are not in good health. - Those who do not follow the attendant’s instructions. - Those who cannot grasp the Control Unit securely because of immobility in ÀQJHUVKDQGVRUDUPV - Persons who disregard the product’s warning displays. The game cannot be played while sitting in a wheelchair. • For safety’s sake, a person of less than 140 cm in height cannot play games on this machine. Because of the dimensions of the seat and the place where the player puts his or her feet, there is a risk that when the ride moves the player may fail to support their weight, causing the player to fall off the ride. • Even players who have never been adversely affected by light stimulus might experience dizziness or headache depending on their physical condition when playing the game. Small children are especially likely to experience these symptoms. Caution guardians of small children to keep watch on their children during play. • Instruct those who feel sick during play to have a medical examination. • To avoid injury from falls and electric shocks due to spilled drinks, instruct the player not to place heavy items or drinks on the product. • To avoid electric shocks and short circuits, do not allow customers to put KDQGVDQGÀQJHUVRUH[WUDQHRXVPDWWHULQWKHRSHQLQJVRIWKHSURGXFWRUVPDOO openings in or around the doors. • For safety’s sake, warning indicators such as stickers are placed on the PDFKLQH+RZHYHUDFDUHOHVVSOD\HUZLOOJHQHUDOO\IDLOWRUHDGWKHVHZDUQLQJV The attendant must point out steps and level differences on the ride in order to prevent the occurrence of an accident. • To avoid falls and resulting injury, immediately stop customers from leaning against or climbing on the product, etc. 12 1R PRUH WKDQ SHUVRQV VKRXOG VLW RQ HDFK ULGH RI WKLV PDFKLQH ,QVWUXFW customers that 3 or more players must not sit on a ride. Failure to observe this precaution may result in players striking their bodies against each other, causing them to receive blows, fall over, or fall off the ride. • Entering the cabinet with a wet umbrella or wet shoes is strictly forbidden. There are electrical parts and wiring underneath the cabinet floor. If these become wet, this can cause an electric shock or short circuit. Be especially careful in managing the product on rainy days. • Take care not to place a heavy object on a ride or seat. This may cause the object to strike the player when the ride moves. • Instruct customers not to play a game with a child on their knees. This may cause an accident such as the child becoming caught between the control panel and the player or the child falling off the ride. • Instruct players not to stand during a game in which the ride moves. This may result in the player falling off the ride or falling over. • Instruct persons other than players to keep away from the machine while a game is in progress. If a person touches the moving ride, this may result in an DFFLGHQWVXFKDVWKHSHUVRQIDOOLQJRYHURUJHWWLQJKLVRUKHUÀQJHUVFDXJKWLQ the bellows. 3 PRECAUTIONS REGARDING PRODUCT OPERATION • Instruct customers not to get on or in any ride part, such as the rear of the ride or behind the back of the seat, other than the seat. Failure to observe this precaution may results in players falling over, falling off, or catching body parts in the ride. • An infant is unable to recognize danger, so instruct the guardian of the infant to be attentive and ensure that the infant does not approach the machine. 13 • Immediately stop such violent acts as hitting and kicking the product. Such violent acts can cause parts damage or cause the cabinet to fall over, resulting in injury. 3 PRECAUTIONS REGARDING PRODUCT OPERATION • Items such as large finger rings can cause injury to the fingers while playing. Instruct players to remove all accessories that could cause an accident before playing. • Take care to ensure that two persons do not attempt to play a game by grasping a single steering wheel. Failure to heed this precaution may result in a minor or a major collision. ([SODLQWKDWWKH027,216723EXWWRQFDQEHSUHVVHGWRVWRSSOD\ZKHQHYHUWKH player feels ill. • Explain that the attendant will stop the game if he or she judges that a situation is dangerous. • Take care to ensure that other customers do not touch operating devices during a game. Failure to heed this precaution may result in an accident or cause trouble between customers. • There are steps and level differences on each ride, so instruct players to be careful when getting on or off the ride. • Do not allow players to extend their hands or feet out from the ride during play. Otherwise there could be bruises, sprains or other accidental injuries. • Instruct the player to adjust the seat in the front-rear direction to match his or her body size. If a player plays a game in an unreasonable posture, he or she may sustain an injury or incur discomfort. 14 • The load limit on one ride of the machine is 300 kg. If you allow a person or persons weighing more than the load limit to get on a ride and operate it, the ride may break down or wear considerably. • After the end of a game, check to ensure that the player has not forgotten or dropped any belongings. 3 PRECAUTIONS REGARDING PRODUCT OPERATION • If a player carries hand luggage or other items onto a ride, objects may fall off or roll over, for example, when the ride moves, resulting in injury or damage. Also, instruct players not to take breakable items, etc., onto the ride. 15 4 PART DESCRIPTIONS 4 PART DESCRIPTIONS FIG. 4a Overall Diagram FIG. 4b 16 Name (quantity) × Depth × Height (mm) Mass (kg) 5($5&$%,1(7 W 1,400 × D 1,850 × H 1,170 363 )5217&$%,1(7 W 1,620 × D 880 × H 1,250 177 '/3%$6( W 1,510 × D 850 × H 920 152 PROJECTOR (2) W 1,510 × D 570 × H 1,400 110 REAR LAMP (2) W 1,310 × D 360 × H 210 23 6,'(67(3/ W 332 × D 1,990 × H 62 18 6,'(67(35 W 332 × D 1,990 × H 62 18 %,//%2$5' W 1,510 × D × H 360 32 630 4 PART DESCRIPTIONS Width 17 5 ACCESSORIES &RQ¿UPWKDWWKHDFFHVVRULHVOLVWHGLQWKHWDEOHEHORZDUHSUHVHQWZKHQVHWWLQJXSWKHSURGXFW Accessories marked "Spare" in the note column are consumable items but included as spares. ,IWKHUHDUHDQLQVXI¿FLHQWQXPEHURIJDPHSOD\PDQXDOVUHTXHVWWKHSRLQWRISXUFKDVHRUWKHRI¿FHLQGLFDWHGLQWKLV manual to supply additional manuals. 5 TABLE 5a ACCESSORIES '(6&5,37,21 2:1(5¶60$18$/ Part No. (Qty.): 420-7004-02 (1) Note: This manual Figures: Parts not labeled with part numbers are as yet XQUHJLVWHUHGRUFDQQRWEHUHJLVWHUHG%HVXUHWR handle all parts with care, as some parts are not available for purchase separately. 6(59,&(0$18$/ 420-7005-01 (1) ([SODQDWLRQRIVRIWZDUH KEY MASTER 220-5793-2-A001 (2) For opening/closing the doors The key master is shipped with the manual packed together with the accessories. KEY (2 each) PARTS CATALOG 420-7006-02 (1) Parts list /,1'%(5*+6(59,&(0$18$/ 420-6921-01 (1) ([SODQDWLRQRIEXLOWLQJDPHERDUG Each key is used for opening and closing the coin chute door of a seat. The key for each seat is different. The keys are placed inside the coin chute doors for shipping. PROJECTOR REMOTE CONTROLLER 200-6023 (2) For making adjustments. (See Chapter 8.) 92/80( 220-5753/220-5484 (2) Spare. (See Chapters 9 and 11.) 0,&526:,7&+ 509-5704 (2) Spare. (See Chapter 10.) 18 TAMPERPROOF SCREW WRENCH 540-0007-01 (1) Tool. (See Chapter 10.) GREASE 090-0289 (1) For greasing up. (See Chapter 13.) *5($6(*81 090-0083 (1) For greasing up. (See Chapter 13.) ACCESSORIES 6(59,&(0$18$/'93(1* 420-6923-01 (1) 5 $66<:,5('9' 605-0094 (1) For software installation. (See Chapter 17.) '9''5,9( 610-0719-01-91 (1) For software installation. (See Chapter 17.) 19 7KHSDUWVVKRZQLQ7$%/(EDUHQRWXVHGIRUQRUPDOPDLQWHQDQFH7KH\DUHXVHGWRUHLQVWDOOVRIWZDUHWKDWZDV inadvertently uninstalled. TABLE 5b 5 '9'62)7:$5(.,7 (1) Software media. (See Chapter 17.) ACCESSORIES NOTE: When you order the DVD-ROM disc only, specify the part number 610-0726-0015 (DVD SOFT ORA). 20 6 ASSEMBLY AND INSTALLATION • Perform assembly work by following the procedure herein stated. Failure to comply with the instructions can cause electric shock. • When assembling, be sure to use plural persons. Depending on the assembly work, there are some cases in which working by one person alone can cause personal injury or parts damage. • Adhere strictly to all of the work procedures stipulated in this document. If two or more workers are working at the same time, exercise special caution. If VHTXHQFHVDUHFDUULHGRXWHUURQHRXVO\DFFLGHQWVFDQUHVXOW7KHUHPLJKWDOVR be cases in which the assembly cannot be completed. • Pay special attention to the surroundings when a multiple number of workers are working at the same time. There is always the danger that a worker might be injured. In assembly and installation of this product, there are procedures in which a stepladder is used, procedures in which heavy objects are attached, and procedures involving connection of a rated power supply of 15 amperes. Carelessness in doing work could lead to grave injuries and even fatalities. 6 ASSEMBLY AND INSTALLATION • Perform assembling as per this manual. Since this is a complex machine, LQFRUUHFW DVVHPEOLQJFDQFDXVHDQHOHFWULFVKRFNPDFKLQHGDPDJH DQGRU LPSURSHUIXQFWLRQLQJDVSHUVSHFLÀHGSHUIRUPDQFH • Ensure that connectors are accurately connected. Incomplete connections can cause electric shock. • This work should be carried out by the site maintenance personnel or other TXDOLÀHGSURIHVVLRQDOV:RUNSHUIRUPHGE\QRQWHFKQLFDOSHUVRQQHOFDQFDXVH a severe accident such as electric shock. Failing to comply with this instruction can cause a severe accident such as electric shock to the player during RSHUDWLRQ ,I QR RQH ZLWK SURSHU WHFKQRORJLFDO H[SHUWLVH LV DYDLODEOH UHTXHVW VHUYLFHIURPWKHRIÀFHLQGLFDWHGLQWKLVGRFXPHQWRUWKHSRLQWRISXUFKDVHVRDV to ensure safety. • Be careful not to damage the wires. Damaged wires may cause electric shock RUVKRUWFLUFXLWRUSUHVHQWDULVNRIÀUH • Do not leave power cable or earth lines exposed over passageways. Exposure could lead to damage, electric shock or short circuit. Wherever wiring has been laid out on a floor surface, use a wiring protection cover. (Wiring diameter: Power cable, approx. Ø18) 3HUVRQV ZKR FRQQHFW LQGRRU SRZHU VXSSOLHV PXVW EH TXDOLILHG HOHFWULFLDQV 'RQRWDOORZDQ\RQHZLWKRXWSURSHUTXDOLÀFDWLRQVWRPDNHVXFKFRQQHFWLRQV Otherwise there could be electric shock. 21 6 • Provide power cables for connecting the indoor power supply to the product. Two cables are needed for the cabinets. The rating of each power cable must EHDWOHDVWDPSHUHV7KHFDEOHVPXVWFRQIRUPWRWKLVUHTXLUHPHQWDQGDOVR EHRIVXIÀFLHQWOHQJWKWRHQDEOHWKHLQGRRUSRZHUVXSSO\WREHFRQQHFWHGWRWKH SURGXFWZLWKRXWGLIÀFXOW\8VHRIDFDEOHWKDWGRHVQRWPHHWWKHUHTXLUHPHQWV FDQUHVXOWLQDÀUHRUHOHFWULFVKRFN ASSEMBLY AND INSTALLATION • For the sake of safety and workability, use 3 core coaxial cabtire cables for the power cables. • Provide an earth wire for connecting the indoor earth terminal to the product earth terminal. Unless grounding is secure, there could be electric shock, damage to parts, or faulty operation. • When inserting or removing a connector, always hold it by its main part. If you hold it by anything else while doing so, the connections between wire and connector terminal fixtures could be damaged; and there could be a short FLUFXLWRUÀUH 0DNHVXUHWKDWDOOWKHDGMXVWHUVDUHUHVWLQJRQWKHÁRRU7KHFDELQHWPD\PRYH and cause an accident if the adjusters are not laid out properly. • Whenever any fasteners (e.g. screws, nuts) have been lost, always use replacement fasteners with proper dimensions as specified in this document. ,IIDVWHQHUVRIDQ\RWKHUGLPHQVLRQVDUHXVHGLWFRXOGFDXVHGDPDJHDQGRU separation of parts that result in secondary accidents. • In order to perform the work of assembling this product reliably and safely, provide a number of stepladders. If there is only one step ladder, it will be GLIÀFXOWWRFDUU\RXWWKHZRUN • Exercise due caution when using stepladders while working. If anyone stumbles or falls, it could cause a serious accident. In locations where the ceiling is low, a head injury could occur. • Be careful when aligning, attaching or mounting parts so that your head, hands, ÀQJHUVHWFGRQRWJHWFDXJKWLQDQ\WKLQJ,IWZRRUPRUHZRUNHUVDUHZRUNLQJ at the same time, exercise special caution. Failure to be cautious could result in accidental bone fractures or amputation. Check the surroundings carefully before proceeding. • When connecting wires inside the cabinet, there may be instances in which the LQGRRUOLJKWLQJGRHVQRWUHDFKWKDWORFDWLRQ+DYHDÁDVKOLJKWRURWKHUDX[LOLDU\ OLJKWLQJHTXLSPHQWRQKDQG,IZLUHVDUHFRQQHFWHGFDUHOHVVO\WKHUHFRXOGEH DQDFFLGHQWDOVKRUWFLUFXLWÀUHHWF • After installing the step, be careful. If you trip over the step and fall over, you may seriously injure yourself. • When tightening bolts and screws, ensure that other parts are suspended properly and bolts and screws are fastened tightly. Be sure to take accident prevention measures such as having another worker support parts. If a part drops or topples over during this work, a serious accident may result. 22 • When removing or attaching the door or parts, be careful that your hands or ÀQJHUVGRQRWJHWFDXJKWLQDQ\WKLQJ 6XSSRUWDQGKROGSDUWVLQSODFHVHFXUHO\DQGIDVWHQWKHPZLWKVFUHZVDQGRU bolts. Use two workers, one to support the part and another to fasten it in place. If a part is not supported securely, it might fall down, resulting in an accident. • When installing a wire protection cover over a floor, use a material shaped so that no one passing by will stumble over it. Using a material that could be stumbled over might lead to an accidental fall. • Be careful in handling plastic parts. Be sure not to tighten screws or nuts too tightly. If such parts are exposed to excessive loads or impact, they might become damaged, resulting in fragments or cracks that could cause accidental injury. 6 ASSEMBLY AND INSTALLATION • Wear appropriate work clothing so that work can be performed safely. Use gloves and safety shoes to prevent accidents or injuries. • There are parts of similar shape, so carefully check the shape of each part. • Confirm the direction of installation for a part before proceeding. Make sure you understand the part’s orientation in terms of up or down, left or right, front or rear, etc. • Be careful in handling the projector screens. They can easily be damaged, and if they are damaged, it might not be possible to service or repair them. 23 6 ASSEMBLY AND INSTALLATION 1 Removing the shipping brackets 2 Assembling the projector and the DLP base 3 Assembling the billboard 4 Joining the DLP projectors 5 ,QVWDOOLQJWKH'/3SURMHFWRU 6 Assembling the cockpit 7 Joining the cockpit and DLP projector 8 ,QVWDOOLQJWKHFRFNSLW 9 Attaching the step and rear lamp 10 Connecting the power cable 11 Attaching the play instructions stickers 12 Turning on the power 13 Checking assembly This product consists of two cabinets. The cabinet consists of a projector, DLP base, cockpit (front cabinet and rear cabinet), rear lamp and billboard assembled together. 2IWKHFRPSRQHQWSDUWVRIWKHFDELQHWVWKHSURMHFWRUVDQGELOOERDUGVDUHFRPPRQWRHDFKRWKHU7KHH[WHUQDOERG\ cover, internal wiring, etc, are different. The sequence in which the two cabinets are arranged is fastened. The sequence is 1P and 2P seen facing the projector screens when the cabinets are assembled. This sequence cannot be changed. ,I\RXDVVHPEOHWKHFDELQHWVZLWKWKHFRPSRQHQWSDUWVVHWRXWLQFRUUHFWO\RUZLWKWKHFDELQHWVLQWKHZURQJVHTXHQFH WKHPDFKLQHPD\IDLOWRRSHUDWHQRUPDOO\%HIRUHDVVHPEO\FDUHIXOO\YHULI\WKDWDOOSDUWVDUHWREHVHWLQWKHULJKW place. The number sticker of each DLP base is on the rear of that DLP base. 24 The body color of each cabinet and the rear lamp nameplate are shown below. 1P: Red 2P: Yellow F50 Dino246GTS 6 ASSEMBLY AND INSTALLATION FIG. 6a Component parts of cabinet FIG. 6b No. indication on DLP base 25 Tools necessary for work - Philips screwdrivers (for M4, M5, and M8) - Short Philips screwdriver or ratchet handle with Philips screwdriver tip (for M4) 6 ASSEMBLY AND INSTALLATION 6RFNHWZUHQFKHVRUKH[DJRQVFUHZGULYHUVPHDVXULQJGLVWDQFHVRIPPPPDQGPPWRRSSRVLWHVLGHIRU 00DQG0KH[DJRQEROWVDQGQXWV - Spanner with measuring distance of 24mm to opposite side 24 mm - Master key (accessory) - Flashlight or other supplementary lighting - Stepladder (height must be 1.5 meters min.) - Scissors 26 1 REMOVING THE SHIPPING BRACKETS Store the shipping brackets and fastening bolts carefully, because they are used to prevent the product from becoming damaged while moving the product. 5HPRYHWKHIRXUKH[DJRQEROWVIURPHDFKVKLSSLQJEUDFNHWDQGUHPRYHWKHVKLSSLQJEUDFNHW7KHEUDFNHWXVHVÀDW washers with bolts that have spring washers attached. ASSEMBLY AND INSTALLATION There are red-painted shipping brackets at the bellows at the rear part of the rear cabinets. 6 FIG. 6-1a FIG. 6-1b SHIPPING BRACKET 27 2 6 ASSEMBLING THE PROJECTOR AND THE DLP BASE • Be sure to have at least four persons lift the projector. Do not perform this work using three or fewer persons. Failure to heed this warning may result in an accident or injury to a worker. ASSEMBLY AND INSTALLATION %H FDUHIXO QRW WR JHW \RXU KDQGV RU ILQJHUV FDXJKW +ROG WKH SURMHFWRU E\ WKH handles on the side, and also at the bottom part at the rear face. Failure to follow this precaution may result in broken bones or amputation. • In addition to the workers who carry the projector, have another worker support WKH'/3EDVH7KLVZLOOSUHYHQWWKHEDVHIURPPRYLQJDQGFDXVLQJDQDFFLGHQW 2QFH WKH SURMHFWRU KDV EHHQ PRXQWHG RQ WKH '/3 EDVH SURPSWO\ IDVWHQ LW LQ place. If it is left in an unfastened condition, an unforeseen accident may occur. The screen of the projector is easily damaged, so try not to touch it during the above work. 0RXQWWKHSURMHFWRURQWKH'/3EDVH(PSOR\DWRWDORIDWOHDVW¿YHZRUNHUVIRXUIRUFDUU\LQJWKHSURMHFWRUDQGRQH for supporting the DLP base. The DLP base has notches to enable the casters on the projector to pass into the DLP base. Mount the projector from the side of the DLP base that has the notches. 1 Have at least four persons lift the projector, and place it on the DLP base. FIG. 6-2a 28 2 Align the projector and the DLP base so that their sides are in the same plane, and then push them together so that there is no opening between them. %HFDUHIXOQRWWRJHW\RXUKDQGVRU¿QJHUVFDXJKW 3 Remove the two fastening screws from the DLP front door. 6 4 ASSEMBLY AND INSTALLATION FIG. 6-2b 8QORFNWKH'/3IURQWGRRUXVLQJWKHPDVWHUNH\DQGWKHQUHPRYHWKHGRRU FIG. 6-2c 29 5 $WWDFKHDFKRIWKHWZRIURQWKROGHUV8VKDSHGUHFWDQJXODUVKHHWPHWDOSDUWVZLWKWZRKH[DJRQEROWVWRWKH LQVLGHRIWKH'/3IURQWGRRU7KHKROGHUVXVHÀDWZDVKHUVZLWKEROWVWKDWKDYHVSULQJZDVKHUVDWWDFKHG When attaching the front holder, join the projector to the DLP base. 6 ASSEMBLY AND INSTALLATION FIG. 6-2d FRONT HOLDER FIG. 6-2e 6 Attach joint A (L-shaped sheet metal part) to the rear corner of the projector. Fasten each joint A with four KH[DJRQEROWV-RLQW$XVHÀDWZDVKHUVZLWKEROWVWKDWKDYHVSULQJZDVKHUVDWWDFKHG FIG. 6-2f JOINT A 30 FIG. 6-2g 7 Attach two caster lids on the back of the DLP base, and fasten each of them with four screws. The screws KDYHÀDWZDVKHUVDQGVSULQJZDVKHUVDWWDFKHG SCREW (4), black M4x16, w/flat & spring washers 6 8 9 10 FIG. 6-2i 8VLQJDVFUHZIDVWHQWKHURXQGWHUPLQDODWWKHWLSRIWKHHDUWKZLUHDOUHDG\FRQQHFWHGLQVLGHWKH'/3EDVH %HVXUHWRXVHDÀDWZDVKHUDQGVSULQJZDVKHUZLWKWKHVFUHZ ASSEMBLY AND INSTALLATION FIG. 6-2h CASTER LID Connect the three wiring connectors inside the DLP base to the projector connectors. There are fastening VFUHZVRQERWKVLGHVRIWKHPHWDO'68%FRQQHFWRU6HFXUHWKHFRQQHFWRUVZLWKWKHVFUHZVDIWHUWKH\DUH connected. Fasten the wiring of the connected connector using the cord clamp inside the DLP base. FIG. 6-2j 11 Attach the DLP front door, lock it and fasten it with the two truss screws. 31 3 6 ASSEMBLING THE BILLBOARD ASSEMBLY AND INSTALLATION 3HUIRUPWKLVZRUNZLWKWKHWRROVDQGQXPEHURIZRUNHUVVSHFLÀHGLQWKLVPDQXDO Proceeding without the necessary tools or number of workers could cause an accident. Two or more workers should lift up the billboard, in cooperation with one other worker who assists while standing on a stepladder. 1 Remove the three screws then remove the service door. TRUSS SCREW (3), black M4×8 FIG. 6-3a 2 Lift up the billboard with two or more workers. From the rear of the DLP, place the billboard down on the hook on the upper part of the DLP. FIG. 6-3b 32 FIG. 6-3c 3 Slide the billboard forward. Hitch the billboard onto the bracket of the DLP. 6 ASSEMBLY AND INSTALLATION FIG. 6-3d 4 )DVWHQWKHELOOERDUGZLWKWZRKH[DJRQEROWV FIG. 6-3e 5 8QGRWKHFRUGFODPSWRDFFHVVWKHFRQQHFWRU FIG. 6-3f 33 6 Connect this connector to the connector on the panel on the upper part of the DLP. 6 ASSEMBLY AND INSTALLATION FIG. 6-3g 7 Fasten the wire with the cord clamp. FIG. 6-3h 8 Reattach the service door with three screws. FIG. 6-3i 34 4 JOINING THE DLP PROJECTORS Arrange the two DLP projectors consisting of the projectors mounted on their DLP bases alongside each other, and join them together. Attach the following parts between the two projectors. The parts to be attached between the two projectors are uniform. Note, however, that the wiring connections differ according to the particular projectors. 6 ASSEMBLY AND INSTALLATION JOINT UPPER (Total 1) JOINT HOLDER (Total 4) JOINT MIDDLE (Total 1) LAN JOINT (Total 1) JOINT LOWER COVER (Total 1) JOINT LOWER (Total 1) 35 6 ASSEMBLY AND INSTALLATION JOINT WIRE COVER (Total 2) DLP SIDE PLATE (Total 1) 36 1 Place the two DLP projectors alongside each other. The sequence is 1P and 2P going from the left seen facing the projector screens. Check the sequence by observing the number stickers at the back of the DLP EDVHV6HH),*E Remove the DLP projector lids on the sides where the 1P and 2P projectors will be joined together. 6 2 ,QVHUWWKHUHFWDQJXODUSLSHRIWKHMRLQWORZHULQWRWKHUHFWDQJXODUKROHVDWWKHERWWRPRIWKHVLGHRIWKH'/3 base. The side rectangular holes for the joint lower are towards the back of the DLP base (rear of screen). Assemble the joint lower so that the rectangular holes in the DLP base still have remaining space (in the shape of a rectangular hole) above the joint lower. Attach a lid over the rectangular holes in the right side of the 2P DLP base. FIG. 6-4b 3 ASSEMBLY AND INSTALLATION FIG. 6-4a FIG. 6-4c Move the DLP projector so that the side of the DLP base and the side of the joint lower are firmly connected. 7DNHFDUHQRWWRFDWFK\RXUKDQGVRU¿QJHUV 'RQRWIDVWHQWKHMRLQWORZHUZLWKWKHEROWVDWWKLVVWDJH,I\RXLQVHUWWKHEROWVRIWKHMRLQWORZHUEHIRUH DWWDFKLQJWKHRWKHUSDUWVLWZLOOEHGLI¿FXOWWRWKHQDWWDFKWKHRWKHUSDUWV 37 4 7HPSRUDULO\IDVWHQWKHWZRMRLQWKROGHUVWRWKHVLGHRIWKHSURMHFWRUXVLQJWZRKH[DJRQEROWVIRUHDFK7KH MRLQWKROGHUVXVHÀDWZDVKHUVZLWKEROWVWKDWKDYHVSULQJZDVKHUVDWWDFKHG The mounting face is the side that faces the adjacent DLP projector. Do not attach joint holders on the left side of 1P or the right side of 2P. 6 ASSEMBLY AND INSTALLATION FIG. 6-4d FIG. 6-4e ,QVHUWWKHMRLQWSDUWLQWRWKHRSHQLQJEHWZHHQ the joint holder and the projector side. Fasten DKH[DJRQEROWORRVHO\VRWKHRSHQLQJLVNHSW intact. FIG. 6-4f 5 Attach the joint upper in such a way that the sheet metal on the side of the joint upper is inserted into the opening of the upper joint holder. The face that has a notch for passing the temporarily fastened bolts of the joint holder is the side of the joint upper. Also, the face with the rectangular holes is the screen side. Do not tighten the temporarily fastened bolts at this stage. FIG. 6-4g 38 6 Attach the joint middle in such a way that the sheet metal on the side of the joint middle is inserted into the opening of the lower joint holder. The face that has a notch for passing the temporarily fastened bolts of the joint holder is the side of the joint middle. Also, the face with the rectangular holes is the screen side. Do not tighten the temporarily fastened bolts at this stage. 6 ASSEMBLY AND INSTALLATION FIG. 6-4h 7 )DVWHQWKHMRLQWORZHUWRWKH'/3EDVH7LJKWHQWKUHHKH[DJRQEROWVRQRQHVLGHRIHDFKVLGH7KHMRLQWORZHU XVHVÀDWZDVKHUVZLWKEROWVWKDWKDYHVSULQJZDVKHUVDWWDFKHG FIG. 6-4i 39 8 Tighten all of the temporarily fastened bolts of the joint holder. 6 ASSEMBLY AND INSTALLATION FIG. 6-4j 9 FIG. 6-4k Attach the DLP side plate (wooden board). Attach the upper and lower sheet metal parts so that they are suspended from the rectangular holes in the joint upper and joint middle. Hoist the central sheet metal part and attach it. FIG. 6-4l 40 FIG. 6-4m 10 )DVWHQWKH'/3VLGHSODWHXVLQJVL[KH[DJRQEROWV8VHWKUHH bolts each for the joint upper and middle, respectively. The MRLQWXSSHUDQGPLGGOHXVHÀDWZDVKHUVZLWKEROWVWKDWKDYH spring washers attached. 6 11 ASSEMBLY AND INSTALLATION FIG. 6-4n Remove the 2 screws fastening the DLP back door at the back of the DLP base. The screws have spring ZDVKHUVDQGÀDWZDVKHUVDWWDFKHG FIG. 6-4o 41 12 8QORFNWKH'/3EDFNGRRUZLWKWKHPDVWHU key, and remove the door. Remove the doors of all two DLP bases. 6 ASSEMBLY AND INSTALLATION FIG. 6-4p 13 Connect the LAN cables between the DLP bases. Draw out the LAN cables from the rectangular holes at the sides of the 1P and 2P. Connect their connectors inside the joint lower. Also, at this time, draw out the earth wire from the 2P together with the LAN cable. FIG. 6-4q Also, use LAN joints to connect the LAN cables. FIG. 6-4r 42 14 At the bottom of the joint lower in the area that is left unpainted, there is a provisionally fastened screw for securing the earth wire. Temporarily remove the earth wire fastening screw, and then use it to secure the round WHUPLQDOWKDWIDVWHQVWKHHDUWKZLUH%HVXUH WRXVHDVSULQJZDVKHUDQGDÀDWZDVKHUZLWK the screw. 6 15 Attach the joint lower cover on the joint lower. Take care not to damage the wiring. ASSEMBLY AND INSTALLATION FIG. 6-4s FIG. 6-4t 16 Fasten the joint lower cover using two screws. Each screw has a flat washer and spring washer attached. FIG. 6-4u 43 17 Attach the joint wire cover by the left and right rectangular holes of the joint lower cover, and fasten each ZLWKVHYHQVFUHZV7KHVFUHZVKDYHDÀDWZDVKHUDQGVSULQJZDVKHUDWWDFKHG%HFDUHIXOQRWWRGDPDJHWKH wiring. 6 ASSEMBLY AND INSTALLATION FIG. 6-4v 18 Provisionally tighten the center plate on both sides with two screws. FIG. 6-4w 19 Pass the keyhole slots of the bracket plate holder through the provisionally fastened screws. Push forward until the center hole becomes visible. FIG. 6-4x 44 20 Tighten the screw for the center hole. 6 21 Tighten the remaining screws on the both sides of the bracket plate holder. ASSEMBLY AND INSTALLATION FIG. 6-4y FIG. 6-4z 45 5 INSTALLING THE DLP PROJECTOR • Carefully check the surrounding area while moving the projector. If you get caught between the product and the wall, a serious accident may occur. 6 ASSEMBLY AND INSTALLATION %HVXUHWRJURXQGWKHDGMXVWHUVDQGVHFXUHWKHSURGXFWÀUPO\WRWKHLQVWDOODWLRQ location. If the projector moves either during assembly work or during operation after the completion of assembly, a serious accident may occur. 6HFXUHDGHTXDWHVSDFHDWWKHEDFNRIWKHSURGXFWWRHQDEOHZRUNHUVWRSDVV E\WKHSURGXFWZLWKRXWSUREOHP$FRQÀQHGVSDFHPD\UHVXOWLQDQDFFLGHQW during work. It will also prevent work from being carried out accurately and reliably. *UDVSWKHKDQGOHVDWWKHVLGHRIWKHSURMHFWRURUWKHVLGHRIWKH'/3EDVHRUKROG at the bottom, and then either push or pull to move and change direction. Do not push or hold the sheet metal part because this may result in injury. • When the adjusters are grounded and secured to the installation location, the projector cannot be moved easily. Carefully check the distance between nearby walls and other installed items when grounding the adjusters. ,IWKHÁRRUZKHUHWKHSURMHFWRULVWREHPRYHGLVPDGHRIFDUSHWRUGHFRUDWLYH sheeting, there is a risk of wear or staining. (DFK'/3EDVHKDVIRXUFDVWHUVDQGIRXUDGMXVWHUV6HH),*G0RYHWRWKHLQVWDOODWLRQSRVLWLRQGLUHFWO\JURXQG WKHDGMXVWHUVSURYLGHDQRSHQLQJRIDERXWPPEHWZHHQWKHÀRRUVXUIDFHDQGWKHFDVWHUVDQGSHUIRUPDGMXVWPHQWV so the machine is level to the ground. The subsequent assembly work includes placing a ladder at the back of the product and the connecting of power cables. %HVXUHWRVHFXUHHQRXJKVSDFHDWWKHEDFNRIWKHSURGXFWWRHQDEOHZRUNHUVWRSDVVE\WKHSURGXFWHDVLO\ 46 1 Move the two joined DLP projectors to the installation position. Grasp the handles at the side of the projector or the side of the DLP base, or hold at the bottom, and then either push or pull to move and change direction. 6 ASSEMBLY AND INSTALLATION FIG. 6-5a 2 After moving the DLP projectors to the installation position, check the passageway for customers to ensure that it has a width of at least 1.2 m, and that there is a clearance of at least 1 m behind the product. FIG. 6-5b 47 3 Ground all of the adjusters at the bottom of the DLP base. 6 ASSEMBLY AND INSTALLATION FIG. 6-5c Ground adjusters 4 Adjust the height of the adjusters. Provide a clearance of about 5 mm between the casters and the floor surface. After adjustment, tighten the nuts of the adjusters in the upward direction so as to secure the height. FIG. 6-54d Bottom view of two DLP bases joined together FIG. 6-5e Adjustment of adjusters 48 6 ASSEMBLING THE COCKPIT $VVHPEOHWKHWZRFDELQHWV¶FRFNSLWV-RLQWKHIURQWFDELQHWVDQGUHDUFDELQHWVWRJHWKHUDQGFRQQHFWWKHZLULQJ%H sure that the color of the front cabinet parts matches the body color of the rear cabinet. 6 1 ASSEMBLY AND INSTALLATION FIG. 6-6a Match the color of the front cabinet and rear cabinet 5HPRYHWKHOHIWDQGULJKWÀRRUVHFWLRQVRIWKH rear cabinet. Remove three truss screws for HDFK7KHOHIWDQGULJKWÀRRUVDUHLGHQWLFDO FIG. 6-6b 2 Join the front cabinet and rear cabinet together by inserting the two rectangular SLSHVRIWKHIURQWFDELQHWLQWRWKH8VKDSHG rectangular hole on the underside of the rear FDELQHW%HFDUHIXOQRWWRJHW\RXUKDQGVRU ¿QJHUVFDXJKW FIG. 6-6c 49 3 Fasten the front cabinet and rear cabinet WRJHWKHUZLWKHLJKWKH[DJRQEROWV8VHIRXU EROWVLQVLGHHDFKRIWKHOHIWDQGULJKWÀRRUV Check to ensure that all eight bolts can be tightened properly before tightening them IXOO\7KHVHEROWVXVHÀDWDQGVSULQJZDVKHUV 6 ASSEMBLY AND INSTALLATION FIG. 6-6d 4 Remove the two truss screws fastening the motor driver door on the right side of the front cabinet. FIG. 6-6e 5 8QORFNXVLQJWKHPDVWHUNH\DQGUHPRYHWKHPRWRUGULYHUGRRU FIG. 6-6f 50 6 Pass the rear cabinet wiring into the interior of the front cabinet, and connect the two connectors. 6 7 ,QVLGHWKHOHIWVLGHÀRRUSXOOWKHIURQWFDELQHWZLULQJWRWKHUHDUFDELQHWDQGFRQQHFWWKHFRQQHFWRU FIG. 6-6i 8 FIG.6-6h ASSEMBLY AND INSTALLATION FIG. 6-6g FIG. 6-6j Pass the motor driver wiring (the black covered wiring with the L and R tags) and the earth wire to the front cabinet. FIG. 6-6k 51 9 Pull the motor driver wiring and the earth wire through to the front of the front cabinet. 6 ASSEMBLY AND INSTALLATION FIG. 6-6l 10 The two parts with the white casing at the front of the front cabinet is the motor driver. Connect the wiring connector with the L tag to the near side of the motor driver, and the wiring connector with the R tag to the far side of the motor driver. FIG. 6-6n 11 52 FIG. 6-6m FIG. 6-6o Reattach the left and right floors to their original positions, and fasten three truss screws for each. FIG. 6-6p 7 JOINING THE COCKPIT AND DLP PROJECTOR Join each DLP projector and cockpit. The order of the cockpits is already determined. 1P is the red body and 2P is yellow. 1 Place the two cockpits in front of the DLP projectors. The sequence of body color is red and yellow going from the left seen facing the projector screens. 6 ASSEMBLY AND INSTALLATION FIG. 6-7a 2 $WWDFKWKHMRLQWEUDFNHWVVRWKDWWKH\H[WHQGRXWWRWKHOHIWDQGULJKWUHVSHFWLYHO\7HPSRUDULO\IDVWHQHDFK ZLWKWKHWZRKH[DJRQEROWVWKDWZHUHUHPRYHG FIG. 6-7b 53 3 Place the cockpit near the DLP projector. As the wiring is not long, keep the distance between them at around 10 cm. 6 ASSEMBLY AND INSTALLATION The connector panels are to the front left and right of the '/3 SURMHFWRU %HVLGHV WKH FRQQHFWRU SDQHO FRQQHFWRUV there is an earth wire inside the rectangular hole on the left VLGH,QVLGHWKHUHFWDQJXODUKROHRQWKHULJKWVLGHWKHUHLVD wire for the yellow connector. FIG. 6-7d LEFT SIDE CONNECTOR PANEL 4 FIG. 6-7e RIGHT SIDE CONNECTOR PANEL Remove one screw from the near side motor driver terminal. The screw uses flat and VSULQJZDVKHUV%HFDUHIXOQRWWRPLVSODFH these washers. FIG. 6-7f 54 FIG. 6-7c 5 Fasten the round terminal of the earth wire pulled from the DLP projector to the motor driver terminal with the removed screw. Make sure to always use flat and spring washers with the screw. 6 6 Connect the four cockpit wiring connectors to the connector panel on the left side of the DLP base. ASSEMBLY AND INSTALLATION FIG. 6-7g FIG. 6-7h 7 Pull out the wiring for the yellow connector from the inside of the right side rectangular hole. Connect with the yellow connector of the cockpit side wiring. FIG. 6-7i 55 8 Connect the eight cockpit wiring connectors to the connector panel on the DLP base right side. 6 ASSEMBLY AND INSTALLATION FIG. 6-7j 9 10 &RPSOHWHO\DOLJQWKHFRFNSLWZLWKWKHIURQWVLGHRIWKH'/3SURMHFWRU%HFDUHIXOQRWWRFDWFKWKHZLULQJ 3DVVWZRKH[DJRQEROWVLQWRWKH'/3SURMHFWRUVLGHEROWKROHVRIHDFKRIWKHMRLQWEUDFNHWV(QVXUHWKDWDOO IRXUEROWVFDQEHIXOO\WLJKWHQHGEHIRUHWHPSRUDULO\IDVWHQLQJWKHP7KHMRLQWEUDFNHWVXVHÀDWZDVKHUVZLWK bolts that have spring washers attached. HEXAGON BOLT (total 4), black M8x20, w/spring washer, flat washer used FIG. 6-7k 11 Attach the motor driver door, lock it, and secure with two truss screws. FIG. 6-7l 56 8 INSTALLING THE COCKPIT • Carefully check the surrounding area while moving the product. If caught between the product and a nearby wall, a serious injury could result. • Make sure that there is enough space behind the product for workers to pass by. During work, an accident may result if this space is too narrow. Also, it may EHFRPHWRRGLIÀFXOWWRSHUIRUPWKHZRUNDFFXUDWHO\DQGUHOLDEO\ (DFKFRFNSLWKDVHLJKWFDVWHUVDQGVL[DGMXVWHUV6HH),*E'LUHFWO\JURXQGWKHDGMXVWHUVSURYLGHDFOHDUDQFH RIDERXWPPEHWZHHQWKHÀRRUVXUIDFHDQGWKHFDVWHUVDQGSHUIRUPDGMXVWPHQWVVRWKHPDFKLQHLVOHYHOWRWKH ground. 1 Ground all the adjusters on the underside of the cockpit. 6 ASSEMBLY AND INSTALLATION • Always ground the adjusters, and secure the product to the installation site. If this is not done, a serious accident may result as the product may move during assembly work, or during operation after assembly is completed. FIG. 6-8a Ground adjusters 2 Adjust the height of the adjusters. Provide a clearance of about 5 mm between the casters and the floor surface. After adjustment, tighten the nuts of the adjusters in an upward direction so as to secure the height. FIG. 6-8b 57 6 ASSEMBLY AND INSTALLATION 58 FIG. 6-8c Adjust the adjusters 3 Fully tighten the four fastening bolts for each of the cockpit joint brackets temporarily fastened to the DLP projector side. 9 ATTACHING THE STEP AND REAR LAMP There are two kinds of metal board parts used for the step. These are step side L for use on the left side of the cockpit, and step side R for use on the right side of the cockpit. First, assemble the step to be attached between the cockpits. When attaching the step, the rear lamp is also attached at the same time to the cockpit base rear part. Each rear lamp is different. Match each rear lamp with the correct cockpit body color before attaching. 6 ASSEMBLY AND INSTALLATION STEP HOLDER L (Total 2) STEP HOLDER R (Total 2) STEP LID L, R (2 each) JOINT BRACKET (Total 2) CUSHIONING (1) STEP SIDE L, R (2 each) REAR LAMP (Total 2) 59 1 Prepare step L and step R. Assemble the step to be attached between the cockpits. Attach cushioning to step L. 6 ASSEMBLY AND INSTALLATION FIG. 6-9a Cut away any surplus cushioning with a scissors. FIG. 6-9b 2 Place step L and step R side by side as shown in the picture. FIG. 6-9c 60 3 Link step L and step R with the joint bracket and four screws. Link the opposite side in the same way. 6 4 3URYLVLRQDOO\IDVWHQVWHSKROGHU/DQGVWHSKROGHU5WRWKHOLQNHGVWHSZLWKIRXUKH[DJRQEROWV STEP HOLDER R ASSEMBLY AND INSTALLATION FIG. 6-9d STEP HOLDER L HEXAGON BOLT (2 ea.), black M8×20, w/spring washer and flat washer used FIG. 6-9e 5 ,QVHUWWKHOLQNHGVWHSEHWZHHQWKHFRFNSLWV 6HFXUH WR WKH FRFNSLWV ZLWK WZR KH[DJRQ bolts each. At this time, fully tighten the bolts that were provisionally fastening the VWHSKROGHUV8VHÀDWZDVKHUVZLWKEROWVWKDW have spring washers attached. FIG. 6-9f 61 6 Secure the step side L and R in the same ZD\%RWKVWHSVLGH/DQG5XVHÀDWZDVKHUV with bolts that have spring washers attached. 6 ASSEMBLY AND INSTALLATION FIG. 6-9g 7 Remove the rear lamp lids on both sides. Remove two truss screws from each. The left and right lids are identical parts. FIG. 6-9h 8 $OLJQDUHDUODPSZLWKHDFKFRFNSLWUHDUSDUW$WWKDWWLPHSXOORXWWKHÀXRUHVFHQWOLJKWZLULQJDQGWKHHDUWK ZLUHIURPWKHKROHLQWKHOHIWUHDUDUHDRIWKHFRFNSLWDQGGUDZWKHPLQWRWKHLQVLGHRIWKHUHDUODPS%H careful not to catch the wiring. Pay attention to the nameplate design in the center of the rear lamp. The photo below showing “F50” is for the 1P rear lamp. FIG. 6-9i 62 9 6HFXUHWKHUHDUODPSZLWKWZRKH[DJRQEROWV The bolt hole for fastening the rear lamp is visible from the hole that appears after the lids are removed. The rear lamp uses flat washers with bolts that have spring washers attached. 6 10 Connect the connector to the inside of the lid on the rear lamp left side and connect the earth wire to the rear lamp. ASSEMBLY AND INSTALLATION FIG. 6-9j FIG. 6-9k 63 11 Reattach the removed lids at their original positions. Secure each with two truss screws. 6 ASSEMBLY AND INSTALLATION FIG. 6-9l 12 Attach the step lid L and R. The slanted side is for the rear ODPSVLGH8VHQLQHWUXVVVFUHZVIRUHDFKVWHSOLG7KHWUXVV VFUHZVXVHÀDWZDVKHUV FIG. 6-9m 64 10 CONNECTING THE POWER CABLE 8VHWKHSRZHUVXSSO\HTXLSSHGZLWKDQHDUWKOHDNDJHEUHDNHU 8VHRISRZHU VXSSO\ZLWKRXWVXFKDEUHDNHUFRXOGUHVXOWLQÀUHLIWKHUHLVDFXUUHQWOHDNDJH • Do not expose the power cable or earth wire. If these are exposed, customers could stumble over them, for instance, and easily damage them. Additionally, if these lines are damaged, there could be a risk of electrical shock or short circuit. Set these lines at locations where they will not interfere with customer WUDIÀFRUDWWDFKFRYHUVWRWKHP • For safety reasons, be sure to first connect the power cable to the product. If WKHSRZHUFDEOHLVÀUVWFRQQHFWHGWRWKHSRZHUVRXUFHDQDFFLGHQWVXFKDVDQ electric shock or short circuit may occur. 6 ASSEMBLY AND INSTALLATION +DYH DYDLODEOH D VHFXUHO\ JURXQGHG LQGRRU HDUWK WHUPLQDO :LWKRXW SURSHU grounding, customers could be electrocuted and product operations might not always be stable. Connect the power supply cables (2 cockpits) to the receptacle (not included) correctly and secure the connection. POWER CABLE FIG. 6-10a L RECEPTACLE Hubbell:HBL23 23(for single h pase) N EARTH 6,1*/(3+$6( +XEEHOO+%/ FIG. 6-10b FIG. 6-10c Power Cable Plug 65 11 ATTACHING THE PLAY INSTRUCTIONS STICKERS 6 ASSEMBLY AND INSTALLATION FIG. 6-11a PLAY INSTRUCTIONS STICKERS $WWDFKDSOD\LQVWUXFWLRQVVWLFNHURQWRSRIHDFKFRFNSLWFRLQFKXWHWRZHU%RWKSOD\LQVWUXFWLRQVVWLFNHUVDUH identical. Place the sticker on top of the tower in a visible direction facing the players. Fasten with two screws. The screws KDYHÀDWDQGVSULQJZDVKHUVDWWDFKHG FIG. 6-11b 66 12 TURNING ON THE POWER • Turn on the power only after checking that there are no foreign objects or abnormalities near the ride’s moving parts or the steering wheel. If any parts are damaged or deformed due to the presence of a foreign object when the ride or steering wheel moves during the initialization operation, an accident may occur. • Turn on the power, only after reinspecting the assembly work. If the power is engaged directly after the installation and assembly work is completed, a fatal accident may occur if the adjusters are not grounded properly, screws are not fastened, or tools or spare screws have been left on or in the product. 6 ASSEMBLY AND INSTALLATION • Turn on the power only after carefully checking the surrounding area. The initialization operation begins automatically when the power is engaged. If a person is near the product and the ride (car body) or steering wheel moves, that SHUVRQPD\FROOLGHZLWKWKHSURGXFWDQGDQDFFLGHQWVXFKDVDIDOORUÀQJHUV being caught may occur. It will take about five minutes for the Customer Welcome Screen to appear after the power is engaged and the initialization operation is completed. Do not touch the ride or steering wheel until the Customer Welcome Screen appears. The product cannot be operated properly if the initialization operation is not completed properly. If there is any abnormality when the ride or steering wheel moves, make sure to reengage the power and conduct the initialization operation properly. Take great care when working on this product. This product has a ride the same size as an actual automobile. A serious accident could occur if proper care is not taken. Follow the steps below, and then turn on the power. After beginning operation, always be mindful that customers may leave belongings behind or tamper with the product. Carefully inspect all areas of the product before engaging power. 1 Reinspect the assembly work, paying special attention to the points below. Finally, check that there are no persons near the ride. Has the shipping bracket been removed? +DYHDOOWKHDGMXVWHUVEHHQSURSHUO\JURXQGHGDQGDUHQRFDVWHUVFRQWDFWLQJWKHÀRRUVXUIDFH" Have all power cable terminal blocks been fastened correctly? Has the cover been attached to the terminal block? Have all fastening bolts and screws been tightened? Have any foreign objects been placed near the ride, or have any tools or spare screws, etc. been left on or in the product? Have any foreign objects been placed near the steering wheel? 67 2 Turn the power switches for each cabinet on the left side of the DLP base on. Following the order below, output locations will activate. D 7KHÀXRUHVFHQWOLJKWVRIWKHUHDUODPSDQGWKHELOOERDUGZLOOJORZ E 7KH/,1'%(5*+ORJRLVGLVSOD\HGRQWKHSURMHFWRUVFUHHQ c) The steering wheel L initializes. After aligning itself in a center position, it turns completely to the left, and then returns to the center position. d) The steering wheel R initializes. After aligning itself in a center position, it turns completely to the left, and then returns to the center position. e) The actuator initializes. After moving from its lowest point to its highest point, the actuator stops at its home position. f) A network check is performed. The projector screen display changes to a network check display. J ,IWKHQHWZRUNFKHFNLVFRPSOHWHGSURSHUO\WKH&XVWRPHU:HOFRPH6FUHHQDSSHDUVDQGVRXQGLVRXWSXW at the same time. 6 ASSEMBLY AND INSTALLATION 3 &KHFNWKDWWKH&XVWRPHU:HOFRPH6FUHHQDSSHDUVRQDOOWKHVFUHHQV,IWKHQHWZRUNFKHFNFRQWLQXHVIRU¿YH minutes or more, there is most likely a fault in the network play connection or settings. ,IDIWHUWKHLQLWLDOL]DWLRQRSHUDWLRQHQGVWKHVWHHULQJZKHHOLVQRWDWLWVFHQWHUSRVLWLRQIDFLQJVWUDLJKW DKHDGRUWKHULGHVWRSVDWDWLOWHGSRVLWLRQIRUH[DPSOHUHHQJDJHWKHSRZHUDQGFRQGXFWWKHLQLWLDOL]DWLRQ operation again. ,IWKHSUREOHPLVQRWFRUUHFWHGDIWHUUHSHDWLQJWKHLQLWLDOL]DWLRQWKHUHLVPRVWOLNHO\DIDXOWLQWKHYROXPH settings. Enter Test Mode, and check the settings. (See service manual.) For this product, the following data and settings are still saved even if the power is turned off. Coin numbers represented in fractions (number of coins deposited that are not enough for one credit) and bonus adder count data are not saved. 68 - Number of credits - Ranking data 7HVW0RGHVHWWLQJVFRLQFUHGLWVHWWLQJVGLI¿FXOW\OHYHOHWF 13 CHECKING ASSEMBLY 8VH7HVW0RGHWRFRQ¿UPWKDWDVVHPEO\KDVEHHQSURSHUO\GRQHDQGWKDWWKH/,1'%(5*+FRQQHFWLQJERDUGVDQG input/output devices are normal. Perform the following tests in Test Mode. )RUWHVWVWRUHIHUWRWKH/,1'%(5*+VHUYLFHPDQXDO)RUWHVWVWRVHHVHUYLFHPDQXDO>*DPH7HVW Mode]. (1) Information Display Screen :KHQ³6<67(0,1)250$7,21´³6725$*(,1)250$7,21´RU³-967(67´KDVEHHQVHOHFWHGRQWKH 6\VWHP7HVW0RGH0HQXV\VWHPLQIRUPDWLRQJDPHLQIRUPDWLRQDQGLQIRUPDWLRQRQ-96,2ERDUGFRQQHFWHGWR /,1'%(5*+DUHGLVSOD\HG ,IHDFKFDWHJRU\RILQIRUPDWLRQLVGLVSOD\HGZLWKRXWDQRPDOLHVWKH/,1'%(5*+LVQRUPDO 6 ASSEMBLY AND INSTALLATION 7KHUHLVD/,1'%(5*+LQVWDOOHGLQHDFKRIWKHWZRFDELQHWVRIWKLVSURGXFW$OZD\V enter the Test Mode of all two cabinets when checking settings or making inspections. When using Test Mode for a particular cabinet, only that cabinet can be checked. (2) JVS Input Test Screen :KHQ³,13877(67´KDVEHHQVHOHFWHGRQWKH-96WHVWVFUHHQGDWDLQSXWWRWKH-96,2ERDUGLVGLVSOD\HG2QWKH product, this is the screen for testing the coin switch. ,QVHUWDFRLQ,IWKHGLVSOD\WRWKHVLGHRIWKHVZLWFKFKDQJHVWKHVZLWFKDQGZLULQJFRQQHFWLRQVDUHQRUPDO (3) Monitor Test Screen :KHQ³021,7257(67´KDVEHHQVHOHFWHGRQWKH6\VWHP7HVW0RGH0HQXWKHVFUHHQIRUFKHFNLQJPRQLWRU adjustment status appears. Monitor adjustment is completed when the product is shipped from the factory, but you should observe the test screen to determine whether further adjustment is necessary. Refer to Chapter 8 and adjust the monitor if necessary. (4) Speaker Test Screen When “SPEAKER TEST” has been selected on the System Test Mode Menu, the screen for checking speaker sound output appears. 7RFRQ¿UPWKDWDXGLRRXWSXWLVQRUPDOKDYHWHVWVRXQGRXWSXWIURPWKHJDPHXQLW¶VVSHDNHU 69 (5) Input Test :KHQ³,13877(67´KDVEHHQVHOHFWHGRQWKH*DPH7HVW0RGH0HQXWKHVFUHHQIRUWHVWLQJLQSXWGHYLFHVDSSHDUV 7HVWWKHLQSXWGHYLFHVE\SUHVVLQJHDFKVZLWFK,IWKHGLVSOD\RQWKHVLGHRIHDFKLQSXWGHYLFHFKDQJHVWR³21´DQG numerical values change smoothly in accordance with each operation, the input device and its wiring connections are normal. INPUT TEST 6 ASSEMBLY AND INSTALLATION STEERING (1P) STEERING (2P) GAS (1P) GAS (2P) BRAKE (1P) BRAKE (2P) GEAR POSITION START VIEW CHANGE SERVICE TEST MOTION STOP **H **H **H **H **H **H N OFF OFF OFF OFF OFF PRESS TEST AND SERVICE TO EXIT FIG. 6-13a INPUT TEST Screen (6) Output Test :KHQ³2873877(67´KDVEHHQVHOHFWHGRQWKHJDPHWHVWPRGHPHQXWKHVFUHHQIRUWHVWLQJODPSVDQGRWKHU output devices appears. ,IHDFKRXWSXWGHYLFHRSHUDWHVSURSHUO\WKHRXWSXWGHYLFHDQGLWVZLULQJFRQQHFWLRQVDUHQRUPDO OUTPUT TEST START BUTTON VIEW CHANGE BUTTON TAIL LAMP DRIVER LAMP L DRIVER LAMP R -> EXIT OFF OFF OFF OFF OFF SELECT WITH SERVICE AND PRESS TEST FIG. 6-13b OUTPUT TEST Screen 70 :KHQ³$&78$725&21752/%2$5'7(67´KDVEHHQVHOHFWHGWKHVFUHHQIRUWHVWLQJULGHPHFKDQLVPVDSSHDUV ,IZKHQWKHFRQWUROVDUHPDQLSXODWHGWKHULGHPRYHVSURSHUO\DQGLWVWRSVDWLWVOLPLWSRVLWLRQVWKHPHFKDQLVPVDQG wiring connections are normal. ACTUATOR CONTROL BOARD TEST SELECT WITH SERVICE AND PRESS TEST 6 ASSEMBLY AND INSTALLATION L CW LIMIT SWITCH OFF L CCW LIMIT SWITCH OFF R CW LIMIT SWITCH OFF R CCW LIMIT SWITCH OFF L ACTUATOR ***mm R ACTUATOR ***mm INITIALIZE L ACT CW MOVE L ACT CCW MOVE R ACT CW MOVE R ACT CCW MOVE LR ACT CW MOVE LR ACT CCW MOVE L ACT CW R ACT CCW MOVE L ACT CCW R ACT CW MOVE ACTUATOR MOVE SPEED LOW (MID /HIGH) -> EXIT FIG. 6-13c ACTUATOR CONTROL BOARD TEST Screen (7) Calibration Setting %HJLQDJDPHDQGFKHFNWRVHHLIWKHUHLVDQ\LUUHJXODULW\LQWKHFRQWUROVIRUWKHLQSXWGHYLFHVRULQWKHPRYHPHQW of the ride. These are adjusted before the product is shipped, but, due to vibration, etc. during transit, there may be a need to adjust these settings again. ,IWKHFRQWUROVFDQQRWEHRSHUDWHGVDWLVIDFWRULO\VHOHFW³&$/,%5$7,21´RQWKH*DPH7HVW0RGH0HQX6FUHHQDQG FKHFNDQGDGMXVWWKHYROXPH¿JXUHV CALIBRATION SETTING MENU INPUT STEERING VALUE *** CENTER OF STEER *** SETTING HANDLE SETTING CONTENTS RIGHT LEFT -> EXIT LEFT CENTER OF STEER SELECT WITH SERVICE AND PRESS TEST FIG. 6-13d CALIBRATION SETTING MENU Screen Also, be sure to conduct the above inspections regularly once a month. 71 (8) Game Assignments At shipping, the settings for this product are such that coin-operated network play can be conducted on all two cabinets. Check this setting by entering the Game Setting Screen. After turning on the power and allowing for the initialization operation to end, check the settings and connection IRUQHWZRUNSOD\,IWKHVHWWLQJVDQGFRQQHFWLRQDUHQRUPDOWKH&XVWRPHU:HOFRPH6FUHHQZLOODSSHDURQDOOWZR screens. ,IDOOWZRFDELQHWVFDQFRQGXFWVLPXOWDQHRXVQHWZRUNSOD\SURSHUO\WKHVHWWLQJVDUHQRUPDO 6 ASSEMBLY AND INSTALLATION GAME ASSIGNMENTS MENU DIFFICULTY CABINET ADVERTISE SOUND SPEED METER QUICK START 15 COURSE MODE DRIVER CHANGE MODE TIELE TYPE LINK ID TOTAL MACHINE GROUP VS CAR SELECT CABINET CAR TYPE 23(5$7,2102'( -> EXIT NORMAL DX ON KILO OFF OFF FREE AMERICA 1 1 1 FIXED F50 &2,1 SELECT WITH SERVICE AND PRESS TEST FIG. 6-13e GAME ASSIGNMENTS MENU Screen [Settings at the time of shipping] *DPH6HWWLQJ6FUHHQ,WHPV 1P 2P DX DX /,1.,' 1 2 727$/0$&+,1( 2 2 *5283 1 1 ),;(' ),;(' F50 ',12 &2,1 &2,1 &$%,1(7 96&$56(/(&7 &$%,1(7&$57<3( 23(5$7,217<3( NOTES: *: This setting must be the same for all two cabinets. #: This setting is different for each cabinet. 72 7 PRECAUTIONS WHEN MOVING THE MACHINE • Even when the product is to be moved within the same building, store or facility, contact the point of purchase or the office indicated in these instructions if there will be level differences or narrow or low level entrances while moving. 2UUHTXHVWWKDWPRYLQJEHGRQHIRU\RX1HYHUGLVDVVHPEOHWKHSURGXFWLQDQ\ ZD\QRWFRYHUHGLQWKHVHLQVWUXFWLRQV2WKHUZLVHWKHUHFRXOGEHDÀUHHOHFWULF VKRFNDQGRUVKRUWFLUFXLW • Always disconnect the power cable before moving the product. If it is moved ZLWKWKHSRZHUFDEOHFRQQHFWHGWKHFDEOHFRXOGEHGDPDJHGFDXVLQJÀUHRU electric shock. $TXDOLÀHGHOHFWULFLDQLVUHTXLUHGIRUPRYLQJSURGXFWSDUWVZLWKLQDVWRUHDQG for changing indoor wiring. Do not have work performed by anyone who is not TXDOLÀHG2WKHUZLVHWKHUHFRXOGEHHOHFWULFVKRFN 7 PRECAUTIONS WHEN MOVING THE MACHINE • As used in these instructions, the term “moving” refers to moving of the product within the same building, store or facility. These instructions do not cover moving between different buildings, areas, stores or facilities, since diverse factors are involved, not only packaging but also loading onto transport vehicles, and securing the product in place during transport. To transport the product to a different building or store, contact the vendor where the product was purchased RUWKHRIÀFHLQGLFDWHGLQWKHVHLQVWUXFWLRQV2UUHTXHVWWKDWPRYLQJEHGRQHIRU you. This product is made up of parts that are of large size and heavy weight. Unless work is entrusted to someone with expertise in packaging and transport of such parts, a serious accident might occur. +DYH ZRUN SHUIRUPHG E\ VLWH PDLQWHQDQFH SHUVRQQHO RU RWKHU TXDOLILHG individuals. Do not allow people without proper knowledge and technical expertise to work on the product. Otherwise there could be an electric shock or other serious accident. Also, customers could be injured while operating the product. 1HYHUPRYHWKHSURGXFWDIWHULWKDVEHHQDVVHPEOHG$OZD\VVHSDUDWHWKHWZR FDELQHWV·FRFNSLWXQLWVIURPWKH'/3VZLWKWKHSURMHFWRUUHPDLQLQJRQWKH'/3 base). Moving the product while it is assembled may cause abnormalities in the joints and fastenings, and can result in accidents such as electric shock, short FLUFXLWDQGÀUH %HFDXVHLWLVVWUXFWXUDOO\GLIÀFXOWIRUH[WHULRUOLJKWLQJWRHQWHUWKHFDELQHWKDYH auxiliary lighting available. Working within a dark environment can lead to accidents. • For instructions on separation and disassembly of the cabinet, please refer to Chapter 6 of this manual. Failure to follow the instructions given by this manual leaves a high risk of accidents such as electric shock occurring. • Proceed with checks and tasks as indicated in these instructions. If instructions DUHQRWIROORZHGRULIWDVNVDQGRUFKHFNVDUHQHJOHFWHGDQHOHFWULFVKRFNRU other very serious accident, even fatal accident, can occur. Also, customers could be injured while operating the product. 73 • Be careful not to damage wiring. Before separating parts that have wiring connections, disconnect the wiring connections, unravel wire bundles and undo fastenings. Only after that, remove fasteners (screws, nuts, etc.). If wiring EHFRPHVGDPDJHGWKHUHFRXOGEHDQHOHFWULFVKRFNVKRUWFLUFXLWRUÀUH 7 PRECAUTIONS WHEN MOVING THE MACHINE • When inserting or removing a connector, always hold it by its main part. If you hold it by anything else while doing so, the connections between wire and connector terminal fixtures could be damaged; and there could be a short FLUFXLWRUÀUH7KHUHFRXOGDOVREHSRRUFRQQHFWLYLW\ • Do not move unit with the adjusters in contact with the floor. Otherwise parts might be damaged or deformed and there might be accidents. • Whenever any fasteners (e.g. screws, nuts) have been lost, always use replacement fasteners with proper dimensions as specified in this manual. If IDVWHQHUV RI DQ\ RWKHU GLPHQVLRQV DUH XVHG LW FRXOG FDXVH GDPDJH DQGRU separation of parts that result in secondary accidents. • Check surroundings carefully while moving the unit. If you should get caught between the unit and a wall, for instance, there could be a serious accident. 'RQRWSODFHWKHFRFNSLWRU'/3RQLQFOLQHVRUXQHYHQVXUIDFHV7KLVFRXOGUHVXOW in the unit falling over. +DYHRQKDQGDQXPEHURIZRUNHUVDSSURSULDWHIRUHDFKWDVNWKDWQHHGVWREH done. Make calculations by approximating that one worker can lift roughly 15 kg of weight. If an insufficient number of workers try to lift a heavy object, it could result in a worker stumbling and the object being dropped, crushing someone or something underneath. Workers could also injure their backs, etc. • When lifting a heavy object, be sure to carefully consider the area where it will be lifted. If possible, lift the object by its handles or base. If weak fasteners or fragile parts are gripped, they could be damaged under the weight of the object, and this could result in a worker stumbling and the object being dropped, causing personal injury. 1HYHUGLVDVVHPEOHWKHXQLWLQZD\VRWKHUWKDQWKRVHGHVFULEHGLQWKLVPDQXDO 'RLQJVRFDQFDXVHDFFLGHQWVVXFKDVHOHFWULFVKRFNVVKRUWFLUFXLWVDQGÀUHV 'RQRWDWWHPSWWRWLOWWKHXQLWWRÀWLWWKURXJKQDUURZGRRUZD\V0RYLQJWKHXQLW while it is tilted can result in an accident. It can also cause deformations and damage to parts, as well as deviations of fastening positions, which could result in accidents during operation. 74 'R QRW SXVK SODVWLF SDUWV RU WKH ULGH·V )53 SDUWV 'R QRW VXSSRUW WKH XQLW E\ FDUU\LQJSODVWLFSDUWVRU)53SDUWV3DUWVFDQEHGDPDJHGDQGIUDJPHQWVFDQ cause injury. • Do not lean separated or disassembled parts against a wall or other surface indiscriminately. The parts could be deformed. Accidents could also occur should the parts fall over. • Do not hold or push controls such as the steering wheels or Gear Shifters. Deformations could lead to player injury. ,IWKHXQLWLVPRYHGRYHUÁRRUVXUIDFHVZKHUHWKHUHLVFDUSHWGHFRUDWLYHSDQHO etc., there might be friction or soiling. 0RYHPHQWE\FDVWHUVFDQGDPDJHWKHÁRRUGHSHQGLQJRQWKHÁRRUPDWHULDO +DYHDPDWRUWKLQSODWHDYDLODEOHIRUPRYLQJFDVWHUV,IUXJVIRULQVWDQFHKDYH been laid out, remove them before moving. 7 PRECAUTIONS WHEN MOVING THE MACHINE • Do not stack parts that have been separated or disassembled indiscriminately. The surface of the parts could be damaged or deformed. Significant deformations can result in improper operation and breakdowns. • Be careful not to damage the surfaces of parts. Support and push strong parts made of metal. • Do not apply rope directly to the product’s surface. Use protective material at locations where rope is applied. 7KHVWUHQJWKRIWKLVSURGXFW¶VMRLQWVZHUHQRWGHVLJQHGVXFKWKDWWKHSURGXFWFDQEHPRYHGZKLOHDVVHPEOHG Attempting to push on the cockpit, etc. to move the unit while assembled can result in damage, deformation, and misalignment of the joints. Abnormalities in the joints can result in improper operation or breakdown in internal mechanisms. 75 7 PRECAUTIONS WHEN MOVING THE MACHINE 76 FIG. 7a FIG. 7b 7 PRECAUTIONS WHEN MOVING THE MACHINE FIG. 7c 77 8 PROJECTOR The projector is adjusted prior to leaving the factory. Avoid any unnecessary adjustment. 8 PROJECTOR • If the adjustment method in this manual does not resolve the problem contact the customer service number in this manual or your supplier. • “Snow” on the screen and changes in brightness for a short period are due to the high pressure mercury lamp in the projector. This is not a defect and does not need repairs. • There is no way of knowing when the lamp is going to cease to function. Once it ceases to function, the projector will be unable to display anything and the SURGXFWFDQQRWEHXVHG+DYHDVSDUHODPSUHDG\DWDOOWLPHV • Do not stick tape, stickers or anything else onto the screen. Any kind of adhesive may damage the surface of the screen. The projector can save adjustments. :KHQWKHWHVWVFUHHQVKRZVGLVWRUWLRQVXVHWKHUHPRWHFRQWUROOHUWRDGMXVWWKHSURMHFWRU¶VVHWWLQJV 7KHSURMHFWRU¶VKLJKSUHVVXUHPHUFXU\ODPSKDVDQDYHUDJHOLIHVSDQRIURXJKO\KRXUVVXUYLYDOUDWHEXW the actual lifespan may vary depending on its usage. 7KHODPSLVDUHSODFHDEOHSURGXFW,IWKHVFUHHQEHFRPHVGDUNRUJRHVRXWRFFDVLRQDOO\UHSODFHWKHODPSDVTXLFNO\ as possible. Replace the lamp following the instructions in the instruction manual provided with the projector. Also, be sure to reset the timer setting. 78 8-1 CLEANING THE SCREEN Since the projector screen is susceptible to damage, pay careful attention to its handling. When cleaning, refrain from using water or volatile chemicals. PROJECTOR When the screen surface becomes dirty with dust, etc., clean it by using a soft cloth such as gauze. When water, and volatile chemicals such as benzene, thinner, etc., spill on the screen surface, it may be subject to damage, therefore, do not use them. Also, since the surfaces are susceptible to damage, refrain from rubbing them with a hard material or using a duster. ,IWKHVFUHHQLVHVSHFLDOO\GLUW\FDOOLQDSURIHVVLRQDOFOHDQHU 8 FIG. 8-1 Cleaning the screen 79 8-2 PROJECTOR ADJUSTMENT 8 • When making adjustments, make sure that the remote controller’s emitter is pointed toward the projector screen. PROJECTOR • The projector unit itself does not have any controls on it. *1 Do not needlessly enter Service or Special Modes. Any control errors made in these modes may alter settings and prevent display. This manual does not contain an explanation of Service Mode. *2 The projector does not have a VIDEO input. The VIDEO setting cannot be used. 8VHWKHDFFRPSDQ\LQJUHPRWHFRQWUROOHUWRSHUIRUPDOOSURMHFWRUDGMXVWPHQWV 7KHUHPRWHFRQWUROOHUFDQQRWWXUQWKHSURMHFWRURUWKHHQWLUHJDPHV\VWHP¶VSRZHU21RU2)) FIG. 8-2a 80 $'-867$GMXVW0RGH 3UHVVWKLVEXWWRQWRHQWHU$GMXVW0RGH,WDOVRIXQFWLRQVDVWKH (;,7EXWWRQ (2) :%VZLWFKZKLWHEDODQFH 6HOHFW:KLWH%DODQFH0RGH (3) :5,7,1*PHPRU\ Store adjustment data. (4) 5*%FRORUVHOHFW 8VHWRVHOHFWDFRORUZKHQDGMXVWLQJFRORUEDODQFH (5) CONTRAST: Adjust the contrast of the projected image. (6) %5,*+7 Adjust the black level (brightness) of the projected image. (7) TP (test pattern): Display an internal test pattern. (8) PHASE (phase adjust): Adjust the sampling phase. (9) CLOCK (clock adjust): Adjust the sampling clock. (10) 326,GLVSOD\SRVLWLRQ Adjust the display position of the projected image. (11) &$3785(DGMXVWLPDJHFDSWXUH Adjust timing of image capture. (12) 9,'(2LQSXW Select video input. (13) 5*%LQSXW 6HOHFW5*%LQSXW (14) '9,LQSXW 6HOHFW'9,LQSXW (15) 6(59,&( Enter Service Mode. (16) &872))DGMXVWFXWRII Adjust the white balance of dark areas. 8 PROJECTOR (1) (17) $'-867DGMXVWXSGRZQDQGOHIWULJKW Adjusted selected category. (18) 63(&,$/ Enter Special Mode. (19) '5,9(DGMXVWGULYH Adjust the white balance of light areas. Control and Adjustment The projector is precisely adjusted in the factory prior to sale. Avoid unnecessary DGMXVWPHQWDWDOOFRVWV1HHGOHVVO\DOWHULQJDGMXVWPHQWGDWDPD\PDNHDQ\ODWHU repairs harder to perform. 81 [Controls] %HIRUHSHUIRUPLQJDQ\DGMXVWPHQWV\RXPXVW¿UVWSUHVVWKH$'-867EXWWRQDQGHQWHU$GMXVW0RGH ,I\RXZLVKWRH[LWZLWKRXWPDNLQJDQ\DGMXVWPHQWVSUHVVWKH$'-867EXWWRQWZLFHWRUHWXUQWR1RUPDO0RGH :KHQ\RXKDYH¿QLVKHGPDNLQJDGMXVWPHQWVSUHVVWKH:5,7,1*EXWWRQWRUHFRUGWKHDGMXVWHGGDWD ,I\RXZLVKWRH[LWZLWKRXWVDYLQJWKHDGMXVWHGGDWDUHWXUQWR1RUPDO0RGHZLWKRXWSUHVVLQJWKH:5,7,1*EXWWRQ DQGWKHQWXUQWKHSRZHURIIIRUDUHDVRQDEOHSHULRGRIWLPH3UHVVWKH$'-867EXWWRQWKUHHWLPHVWRUHWXUQWR1RUPDO Mode. 8 PROJECTOR 82 1 3UHVVWKH$'-867EXWWRQ The projector will enter Adjust Mode and wait for an adjustment category button to be pressed. 2 Press an adjustment category button. The projector will enter the selected Adjustment Mode. 3 8VHWKH$'-867> ] [ ] [ ] [ ] buttons to make adjustments. Adjust the values of the displayed adjustment data to suit your needs. 4 3UHVVWKH:5,7,1*EXWWRQUHFRUGDQG¿QLVK 7KHPHVVDJH³:5,7,1*´ZLOOEHGLVSOD\HGDQG the adjusted data recorded. After about 3 seconds the projector will return to Normal Mode. 8VHWKHIROORZLQJ³$GMXVWLQJ&RQWUDVW´H[SODQDWLRQDVDQH[DPSOHRIWKHPDLQDGMXVWPHQWSURFHVV Adjusting Contrast • If you wish to carry on and make further adjustments to a different menu repeat 2~3. • If you do not record adjustment data then all adjustments will be lost when the power if turned off, and when it is turned back on the projector will be returned to the state prior to adjustment. 8 PROJECTOR • To abort adjustment without recording any changes press the ADJUST button WZLFHLQVRPHLQVWDQFHVWKUHHWLPHVWRUHWXUQWR1RUPDO0RGH Adjusting the contrast will alter the tones of the displayed image. 1 3UHVVWKH$'-867EXWWRQ The projector will enter Adjust Mode and wait for an adjustment category button to be pressed. 2 Press the CONTRAST button. The projector will enter the Contrast Adjust Mode. 3 8VHWKH$'-867> ] [ ] buttons to make adjustments. The values of the adjustment data will change. Continue to PDNHDGMXVWPHQWVXQWLOWKHVFUHHQ¶VFRQWUDFWVXLWV\RXUQHHGV 4 3UHVVWKH:5,7,1*EXWWRQUHFRUGDQG¿QLVK 7KH PHVVDJH ³:5,7,1*´ ZLOO EH GLVSOD\HG DQG WKH adjusted data recorded. 83 8-3 CHANGING THE LAMP UNIT • To prevent electric shock and fire hazards, only perform this operation after turning off the power switch. 8 PROJECTOR 1HYHUSXWDQ\WKLQJPHWDORUÁDPPDEOHLQWRWKHLQWHULRURIWKH'/38VLQJLWZLWK VXFKDQREMHFWLQVLGHPD\OHDGWRDQHOHFWULFVKRFNRUÀUH • Make sure that the lamp is firmly in place. If the lamp is loose then it is a fire hazard, and it also might not come on. • The lamp becomes very hot during use and remains so for a while afterward. Attempting to change the lamp before it has sufficiently cooled may lead to burns and other injuries. ,IWKHODPSVKDWWHUVIUDJPHQWVRIJODVVZLOOUHPDLQLQVLGHWKHODPS1HYHUVKDNH DVKDWWHUHGODPSRUKROGSODFHRQHKLJKHUWKDQH\HOHYHO'RLQJVRFRXOGOHDG to a serious accident. • When opening the door or lamp cover to change the lamp, do not touch or remove any parts that are unrelated to the lamp changing process. Doing so PD\OHDGWRLQMXU\DQGFRXOGDOVRKDUPWKHHIÀFLHQWZRUNLQJRIWKHSURGXFW %HFDUHIXOQRWWRJHWÀQJHUVRUKDQGVFDXJKWZKHQUHPRYLQJRUDWWDFKLQJGRRUV or other parts. • Do not remove any screws other than those specified below. Doing so could KDUPWKHHIÀFLHQWZRUNLQJRIWKHSURGXFW • There are electric and electronic parts such as circuit boards contained in the '/3EDVH%HVXUHWRDYRLGGURSSLQJUHPRYHGSDUWVRUWRROVLQVLGHWKHEDVH Always perform the lamp changing operation with the power turned off. Once you have inserted the new lamp only turn the SRZHUEDFNRQRQFHWKHODPSH[FKDQJHFRYHULVEDFN in place. Then enter Special Mode and reset the lamp timer on the Lamp Timer Screen. Lamp Unit Parts Number/Name 200-6020/ASSY LAMP DLP PJTN DSPL 84 1 2 7XUQWKHSRZHURIIIRUWKHFDELQHWZKRVHSURMHFWRU¶VODPSZLOOEHFKDQJHG Remove the DLP front door. Remove the two truss screws that fasten the door. 8 PROJECTOR FIG. 8-3a 3 8QORFNXVLQJWKHPDVWHUNH\DQGUHPRYHWKH DLP front door. FIG. 8-3b 4 Remove the front beam from the top of the '/3IURQWGRRUDWWDFKPHQW¿[WXUH5HPRYH WZRWUXVVVFUHZVDQGWZRÀDWKHDGVFUHZV FIG. 8-3c 85 5 5HPRYH WKH IURQW EHDP %H FDUHIXO QRW WR drop it inside the DLP base. 8 PROJECTOR FIG. 8-3d There is a lamp replacement cover in the front of the projector. FIG. 8-3e 6 Remove four screws, and remove the lamp replacement cover. FIG. 8-3f 86 FIG. 8-3g On the inside of the removed lamp replacement cover are replacement instructions. 8 PROJECTOR FIG. 8-3h 7 8VHDÀDWKHDGVFUHZGULYHUWRIXOO\ORRVHQWKH three lamp unit fastening screws. The design is such that the screws will not be lost even if they are loosened. FIG. 8-3i 8 Grip the handle, and remove the lamp unit by pulling directly towards yourself. FIG. 8-3j 9 $WWDFKWKHQHZODPSXQLW,QVHUWLWXQWLOLWLVDOOWKHZD\LQVLGH 87 8 PROJECTOR 88 10 11 12 13 Tighten the three lamp unit fastening screws. Attach the lamp replacement cover, and fasten its four screws. Attach the front beam. Attach the DLP front door, and lock it. Fasten the two truss screws. Special Mode: Lamp Timer Display and Reset After changing the lamp you must perform the lamp reset operation (step 4 below) to reset the lamp timer. 1 3UHVVWKH$'-867EXWWRQ The projector will enter Adjust Mode and wait for an adjustment category button to be pressed. 2 3UHVVWKH63(&,$/EXWWRQ The projector will enter Special Mode and await further selections. 3 3UHVVWKH:5,7,1*EXWWRQ The amount of time the current lamp has been used for will be displayed. PROJECTOR Displays the amount of time the lamp has been used for. 8 89 4 8 PROJECTOR 90 +ROGGRZQWKH3EXWWRQIRUDSSUR[LPDWHO\VHFRQGV :LOOUHVHWWKHWLPHUUHFRUGLWDQGH[LW Once this message appears release the P button. The used time will change to “00000” and the reset is complete. 9 STEERING WHEEL MECHANISM • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. • Do not touch any parts that are not specified in these directions. Touching XQVSHFLÀHGORFDWLRQVPD\OHDGWRHOHFWULFVKRFNRUFDXVHVKRUWFLUFXLWV • This work should be performed by site maintenance personnel or other skilled professionals. Work performed by non-technical personnel can cause a severe accident such as an electric shock. • To prevent accidents while working or while operating the product after it has been installed, be sure not to conduct any procedures other than those given in this manual. There are cases in which procedures not covered in this PDQXDOUHTXLUHVSHFLDOWRROVDQGVNLOOV,IDSURFHGXUHQRWJLYHQLQWKLVPDQXDOLV UHTXLUHGUHTXHVWVHUYLFHIURPWKHRIÀFHJLYHQLQWKLVPDQXDORUIURPWKHSRLQWRI purchase. 9 STEERING WHEEL MECHANISM • Be careful not to damage the wires. Damaged wires may cause an electric VKRFNVKRUWFLUFXLWRUSUHVHQWDULVNRIÀUH • Exercise due caution in performing soldering procedures. If the soldering iron is KDQGOHGFDUHOHVVO\WKHUHFRXOGEHÀUHVRUEXUQV • Proceed very carefully when heating the thermal contraction tube. Careless RSHUDWLRQVFDQUHVXOWLQÀUHVRUEXUQV • The motor parts may be hot immediately after a game has been completed, so allow some time to pass before beginning work on the parts. • Stand back from the cabinet when restoring power after maintenance has been completed. The ride and steering wheel will automatically undergo initialization operation when power is restored. Failure to move away from the product could result in an accident such as a collision or fall. • Be careful when handling the parts of the steering wheel mechanism. Avoid damaging, deforming, or losing them. The loss of even one part will adversely affect the operation of the steering wheel, and may cause player injury. It could also result in fatal breakdown or faulty operations. • Be careful not to get fingers caught when removing or attaching doors or DGMXVWLQJWKH95EUDFNHW • The handle mechanism has mechanical parts such as gears and timing belts. 3HUIRUPLQJ PDLQWHQDQFH DOVR UHTXLUHV D SHUVRQ WR EHQG RYHU WKH VLGH RI WKH cockpit. Careless work methods can result in injuries such as back and shoulder LQMXULHVRUÀQJHUVEHLQJFDXJKW 91 When the operability of the steering wheel is poor, or when there is no effect from adjusting the volume in Test Mode, most likely either the volume gears are misaligned or the volume has broken down. Following the procedures described below, adjust the alignment of the gears, or replace the volume. This product is designed such that the volume will not be damaged when the steering wheel is turned completely WRWKHOHIWRUULJKWEHFDXVHLWZLOOEHZLWKLQWKHUDQJHRIWKHYROXPH¶VD[LVRIUHYROXWLRQ)DVWHQWKHYROXPHVR the gears are aligned appropriately when the steering wheel is in the center position (i.e. straight ahead) with the YROXPHD[LVLQWKHLOOXVWUDWHGGLUHFWLRQ 9 STEERING WHEEL MECHANISM 9-1 VOLUME ADJUSTMENT AND REPLACEMENT Adjustment Method 1 Turn off the power switch of the cabinet that requires maintenance. FIG. 9-1a 2 92 Remove the hood door on the same side as the steering wheel mechanism which requires adjustment. Remove four truss screws. Facing the projector screen, the left side is steering wheel L, and the right side is steering wheel R. ,QWKHLOOXVWUDWLRQVEHORZZRUNRQVWHHULQJZKHHO/LVGHSLFWHG FIG. 9-1b 3 Remove hood door L (R). On the top of the door, there is a handle near the side. When reattaching the hood door after work has completed, be aware of the direction in which it is to be attached. 9 4 5 6 7 8 Loosen the two screws that fasten the VR bracket, and undo the gear alignment. Only loosen the two screws. $OLJQWKHJHDUVVRWKDWWKHYROXPHD[LVLVDVGHSLFWHGEHORZZLWKWKHVWHHULQJZKHHOLQFHQWHUSRVLWLRQLH straight ahead). STEERING WHEEL MECHANISM FIG. 9-1c Tighten the two VR bracket fastening screws. &RQ¿UPWKDWWKHJHDUVURWDWHVPRRWKO\E\RSHUDWLQJWKHVWHHULQJZKHHO On the Calibration Screen in the Game Test Mode, set the volume values. (See service manual.) FIG. 9-1d STEERING WHEEL MECHANISM VOLUME 9 &RQ¿UPWKDWWKH¿JXUHVFKDQJHVPRRWKO\E\RSHUDWLQJWKHVWHHULQJZKHHO 93 Replacement Method When replacing the volume, prepare the new volume and three thermal contraction tubes (PART No. 310-5029-F20). 8VHWKHZLULQJWREHVROGHUHGWRWKHYROXPHDVLV For replacement, the following tools are required. 9 STEERING WHEEL MECHANISM - Philips screwdriver for M4 screws - Allen wrench measuring a distance of 1.5 mm to opposite side - Adjustable spanner measuring a distance of 11 mm to 12 mm to opposite side - Nippers - Cutter - Soldering iron ,QGXVWULDOGU\HU - Solder 1 8QSOXJWKHZLULQJFRQQHFWRUVIURPWKHYROXPH8QGRWKHFRUGFODPSWKDWIDVWHQVWKHZLULQJ FIG. 9-1e 2 3 4 5 6 7 8 94 Remove the two screws that fasten the VR bracket, and remove the VR bracket together with the volume. 7KHVFUHZVKDYHÀDWDQGVSULQJZDVKHUVDWWDFKHG /RRVHQWKHWZRKH[DJRQVRFNHWVFUHZVIURPWKHJHDUKROGHUDQGSXOORXWWKHJHDUKROGHUIURPWKHYROXPH D[LV Remove the nut that fastens the VR bracket, and remove the volume from the VR bracket. :LWK QLSSHUV RU D FXWWHU UHPRYH WKH WKHUPDO FRQWUDFWLRQ WXEH WKDW FRYHUV WKH VROGHU ZHOG SDUW 8VH D soldering iron to melt the solder weld, and remove the wiring from the volume. Run each wire of the wiring through a thermal contraction tube. 6ROGHUHDFKZLUHWRWKHWHUPLQDOVRIWKHQHZYROXPH%HVXUHWRYHULI\WKHZLUHIRUVROGHULQJDQGLWVWHUPLQDO using the wiring diagram. Cover the solder weld part with thermal contraction tubing, and heat with the industrial dryer, adhering the thermal contraction tubing to the solder weld part. Attach the VR bracket and gear holder to the volume. $OLJQWKHJHDUVVRWKDWWKHYROXPHD[LV¶V'FXWVXUIDFHLVOHYHOZLWKWKHWRSVLGHZKLOHWKHVWHHULQJZKHHOLV LQFHQWHUSRVLWLRQLHVWUDLJKWDKHDG)DVWHQWKH95EUDFNHWZLWKWZRVFUHZV6HH),*G &RQ¿UPWKDWWKHJHDUVURWDWHVPRRWKO\E\RSHUDWLQJWKHVWHHULQJZKHHO Connect the connectors. Fasten the wiring with a cord clamp so that it does not get caught in the gears or other parts. Turn on the power. Take proper precautions since the initialization operation will begin. 2QWKH&DOLEUDWLRQ6FUHHQLQWKH*DPH7HVW0RGHVHWWKHYROXPH¿JXUHV6HHVHUYLFHPDQXDO 9 STEERING WHEEL MECHANISM 9 10 11 12 13 14 FIG. 9-1f 95 9-2 GREASING 9 • Be sure to use the designated grease. Using undesignated grease can cause parts damage. STEERING WHEEL MECHANISM 'RQRWDSSO\JUHDVHWRORFDWLRQVRWKHUWKDQDVVSHFLÀHG'RLQJVRPD\FUHDWH a risk of operational problems and deterioration of parts. • The designated periods for greasing serve only as a guide. Whenever there are VTXHDNVRURWKHUDQRPDOLHVDSSO\JUHDVHDWGHVLJQDWHGORFDWLRQV Grease the parts listed below once every three months. 8VH*5($6(0$7(3$571RDVVSUD\JUHDVH FIG. 9-2 96 10 GEAR SHIFTER ,IWKHUHLVDQDEQRUPDOLW\LQWKH*HDU6KLIWHU¶VVZLWFKLQSXWDVVHHQRQWKH7HVW6FUHHQUHSODFHWKHVZLWFK$OVR PHFKDQLFDOVOLGLQJSDUWVVKRXOGEHJUHDVHGRQFHHYHU\WKUHHPRQWKV%RWKRIWKHDERYHRSHUDWLRQVUHTXLUHUHPRYDO of the Gear Shifter unit. 10 • Be careful not to damage the wires. Damaged wires may cause an electric VKRFNVKRUWFLUFXLWRUSUHVHQWDULVNRIÀUH GEAR SHIFTER • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. 10-1 GEAR SHIFTER REMOVAL 1 2 Turn off the power switch. Remove the four tamperproof screws, and lift up the Gear Shifter unit. TAMPERPROOF SCREW (4), black M5x12 FIG. 10-1a 3 8QSOXJWKHFRQQHFWRUVDQGUHPRYHWKH*HDU6KLIWHUXQLW FIG. 10-1b 97 10 4 7RDWWDFKGRWKHUHYHUVHSURFHGXUH'RWKHDERYHVWHSVLQWKHRSSRVLWHRUGHU%HVXUHWRDWWDFKVRWKDWWKH “DOWN” display is upwards. 5 $IWHUDWWDFKLQJYHULI\SURSHURSHUDWLRQXVLQJWKH,QSXW7HVWLQ7HVW0RGH (See service manual.) 10-2 SWITCH REPLACEMENT GEAR SHIFTER 1 2 3 8QGRWKHZLULQJFRQQHFWRUVIURPWKHVZLWFKWREHUHSODFHG Remove two tapping screws, and replace the microswitch. 9HULI\WKDWWKHLQGLFDWRUVFKDQJHLQUHVSRQVHWRWKHPDQLSXODWLRQRIWKH*HDU6KLIWHURQWKH,QSXW7HVW6FUHHQ in Test Mode. (See service manual.) FIG. 10-2 10-3 GREASING 2QFHHYHU\WKUHHPRQWKVDSSO\JUHDVHWRWKHGHVLJQDWHGSRLQWVSHFL¿HG6HH),* 8VH12../8%(5/RU*5($6(0$7(3$571RDVVSUD\JUHDVH 98 11 ACCELERATOR & BRAKE • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. • Do not touch any parts that are not specified in these directions. Touching XQVSHFLÀHGORFDWLRQVPD\OHDGWRHOHFWULFVKRFNRUFDXVHVKRUWFLUFXLWV • This work should be performed by site maintenance personnel or other skilled professionals. Work performed by non-technical personnel can cause a severe accident such as an electric shock. • For the replacement of parts whose replacement methods are not listed in this PDQXDOZRUNVKRXOGEHGRQHRQO\DIWHUFRQÀUPLQJWKHSURFHGXUHDQGSRLQWVRI FDXWLRQIURPWKHSRLQWRISXUFKDVHRURIÀFHOLVWHGLQWKLVPDQXDO8VLQJLPSURSHU replacement parts or making improper adjustments can cause overloading and inadvertent contact between parts, which can result in electric shocks, short FLUFXLWVRUÀUHV 11 ACCELERATOR & BRAKE • Be careful not to damage the wires. Damaged wires may cause an electric VKRFNVKRUWFLUFXLWRUSUHVHQWDULVNRIÀUH After replacing or adjusting the volume, always set the volume’s movement values at the Volume Settings Screen in Test Mode. (See service manual.) When the accelerator and brake pedal do not operate properly, either the volume attachment position must be adjusted, or the volume must be replaced. Also, the gear alignment position and spring should be greased once every three months. 11-1 VOLUME ADJUSTMENT AND REPLACEMENT A Philips screwdriver for M4 and M5 screws is required for the following procedures. To view the volume values, use Test Mode. (See service manual.) %HFDXVHWKLVSURFHGXUHLQYROYHVKDQGOLQJPDFKLQHU\ZLWKWKHSRZHUVWLOOFRQQHFWHGQHYHUWRXFKSODFHVRWKHUWKDQ those designated. Failure to observe this precaution could result in electric shocks and short circuits. 99 Adjustment Method 1 Remove two truss screws, and remove the front cover of the accelerator and brake. 11 ACCELERATOR & BRAKE FIG. 11-1a 2 Loosen the screw that secures the potentiobase, and adjust the volume values by moving the base. FIG. 11-1b 3 4 5 100 Fasten the potentiobase. On the Calibration Screen in the Game Test Mode, set the volume values. (See service manual.) &RQ¿UPWKDWWKHYDOXHVFKDQJHVPRRWKO\E\RSHUDWLQJWKHSHGDO Replacement Method 5HPRYHWZRVFUHZVDQGUHPRYHWKHSRWHQWLRFRYHU),*F 11 8QGRWKHFRQQHFWRURIWKHYROXPHWREHUHSODFHG 5HPRYHWKHVFUHZWKDWIDVWHQVWKHSRWHQWLREDVH),*E :LWKWKHYROXPHVWLOODWWDFKHGUHPRYHWKHSRWHQWLREDVH),*F Remove the base and the gears, and replace the volume. ACCELERATOR & BRAKE 1 2 3 4 5 6 7 Turn off the power. After replacement, set the volume as described in the “Adjustment Method” section above. (See service manual.) TRUSS SCREW (2) M4x8 POTENTIOCOVER POTENTIOBASE FIG. 11-1c 8 $IWHUDGMXVWLQJWKHVHWWLQJVFRQ¿UPWKDWWKHYDOXHVFKDQJHVPRRWKO\E\RSHUDWLQJWKHSHGDO 101 11-2 GREASING 11 ACCELERATOR & BRAKE Be sure to use the designated grease. Using undesignated grease can cause parts damage. Grease the spring and gear alignment area once every three months. 8VH*5($6(0$7(3$571RDVVSUD\JUHDVH FIG. 11-2 102 12 COIN SELECTOR Handling the Coin Jam ,IWKHFRLQLVQRWUHMHFWHGZKHQWKH5(-(&7EXWWRQLVSUHVVHGRSHQWKHFRLQFKXWHGRRUDQGRSHQWKHVHOHFWRUJDWH After removing the jammed coin, put a normal coin in and check to see that the selector correctly functions. 12 5HPRYH DQG FOHDQ VPHDUV E\ XVLQJ D VRIW FORWK GLSSHG LQ ZDWHU RU GLOXWHG FKHPLFDOGHWHUJHQWDQGWKHQVTXHH]HGGU\ COIN SELECTOR Cleaning the Coin Selector 1HYHUDSSO\PDFKLQHRLOHWFWRWKHFRLQVHOHFWRU1HYHUDSSO\PDFKLQHRLOHWF to the coin selector. • After cleaning the coin selector, insert a regular coin during normal working status and ensure that the selector correctly functions. The coin selector should be cleaned once every 3 months. When cleaning, follow the procedure below: 1 2 3 Turn the power for the machine OFF. Open the coin chute door. Remove the coin selector from the coin chute door. Open the gate and dust off by using a soft brush (made of wool, etc.). FIG. 12a 4 Remove and clean smears by using a soft cloth dipped in water or diluted chemical detergent and then squeezed dry. 103 5 Remove the cradle. When removing the retaining ring (E ring), be very careful so as not to bend the rotary shaft. 12 COIN SELECTOR FIG. 12b 6 7 Remove any stains from the rotary shaft and shaft receiving portions by wiping with a soft cloth, etc. After wiping off as per previous step, further apply a dry cloth, etc. to dry the coin selector completely. Coin Insertion Test Once every month, when performing the Coin SW Test, simultaneously check the following: Does the coin meter count satisfactorily? 'RHVWKHFRLQGURSLQWRWKHFDVKER[FRUUHFWO\" ,VWKHFRLQUHMHFWHGZKHQLQVHUWHGZKLOHNHHSLQJWKH5(-(&7EXWWRQSUHVVHGGRZQ" FIG. 12c 104 13 GREASING THE RIDE MECHANISMS • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. • Do not touch any parts that are not specified in these directions. Touching XQVSHFLÀHGORFDWLRQVPD\OHDGWRHOHFWULFVKRFNRUFDXVHVKRUWFLUFXLWV • This work should be performed by site maintenance personnel or other skilled professionals. Work performed by non-technical personnel can cause a severe accident such as an electric shock. • To prevent accidents while working or while operating the product after it has been installed, be sure not to conduct any procedures other than those given in this manual. There are cases in which procedures not covered in this PDQXDOUHTXLUHVSHFLDOWRROVDQGVNLOOV,IDSURFHGXUHQRWJLYHQLQWKLVPDQXDOLV UHTXLUHGUHTXHVWVHUYLFHIURPWKHRIÀFHJLYHQLQWKLVPDQXDORUIURPWKHSRLQWRI purchase. 13 GREASING THE RIDE MECHANISMS • Be careful not to damage the wires. Damaged wires may cause an electric VKRFNVKRUWFLUFXLWRUSUHVHQWDULVNRIÀUH • Stand back from the cabinet when restoring power after maintenance has been completed. The ride and steering wheel will automatically undergo initialization operation when power is restored. Failure to observe this precaution could result in a collision or fall. • Do not carelessly touch the ride mechanism. Doing so could result in broken bones or amputation. When using grease, adhere to all warnings described on the grease’s packaging. Careless use of grease can present health risks to workers. - Grease may cause inflammation upon contact with skin. Use gloves for protection, and be careful not to let the grease come in contact with bare skin. If grease gets into contact with skin, wash thoroughly with soap and water. - There is a risk of cutting your hands when opening the container of grease. Use gloves for protection. - The handling of grease is governed by laws and ordinances. Use grease in accordance with the laws and ordinances administered by the area where the facility is located. Unlawful usage can result in environmental pollution. If you are unsure of the laws and ordinances associated with handling grease, consult with the point of purchase of this product. 105 8VHRQO\WKHVSHFLÀHGJUHDVH8VLQJDQ\RWKHUNLQGRIJUHDVHFDQUHVXOWLQIDXOW\ operations and damage to parts. 13 • To prevent dirt or water from mixing with grease, tightly seal the grease after usage. GREASING THE RIDE MECHANISMS • Store the grease in a dark area, out of direct sunlight. • The designated periods for greasing serve only as a guide. Whenever there are VTXHDNVRURWKHUDQRPDOLHVDSSO\JUHDVHDWGHVLJQDWHGORFDWLRQV • Be sure to use the special grease included with the product. The same grease is applied before shipping. Use of different grease creates chemical changes, and can result in faulty operations or operational failures. • Order more grease from the point of purchase if you run out of the included special grease. • Control the grease gun’s lever so it is completely open and completely closed. Without implementing the full range of motion, the grease cannot be applied. 'RQRWDSSO\JUHDVHWRORFDWLRQVRWKHUWKDQDVVSHFLÀHG'RLQJVRPD\FUHDWH a risk of operational problems and deterioration of parts. 8VHRQO\WKHVSHFLÀHGDPRXQWRIJUHDVHZKHQDSSO\LQJJUHDVHZLWKWKHJUHDVH JXQ$SSO\LQJPRUHWKDQWKHVSHFLÀHGDPRXQWRIZLOOKDYHQRHIIHFW • If you turn the power off when the actuators that move the ride are stretched, they will make noise when shrinking. This is not a malfunction. 7KHFRFNSLW¶VULGHPHFKDQLVPKDVWZRDFWXDWRUVDQGDJXLGHLQWKHPLGGOH Grease the mechanisms at the following frequencies listed below. - Actuator: - Guide: Once per two months Once per year 13-1 GREASING THE ACTUATOR Equip the included grease gun with the H-shaped nozzle, and apply the special grease to the upper and lower nipples of the actuator. 1 2 106 Turn off the power switch on the DLP base side of the ride that needs greasing. Attach the H-shaped nozzle on the grease JXQPDLQSDUWDQG¿UPO\IDVWHQLW FIG. 13-1a 3 8QVFUHZ WKH JUHDVH WXEH RI WKH LQFOXGHG grease gun, and remove it from the main part. 13 4 Remove the cap of the included grease cartridge. GREASING THE RIDE MECHANISMS FIG. 13-1b FIG. 13-1c 5 Screw the grease cartridge onto the grease gun. FIG. 13-1d 107 6 Reattach the grease tube to its original position on the grease gun main part. 13 GREASING THE RIDE MECHANISMS FIG. 13-1e 7 Remove the two upper lids at the rear of the seat. Remove eight truss screws for each. After removing the upper lids, you will see the upper nipple of the actuator. FIG. 13-1f 8 FIG. 13-1g ,QVHUW WKH +VKDSHG QR]]OH¶V WLS LQWR WKH nipple, and apply grease. Apply grease by fully opening and closing WKHJUHDVHJXQ¶VOHYHUUHSHDWHGO\'RWKUHHWR four repetitions. FIG. 13-1h 108 9 Remove the rear holder that fastens the top part on the rear side of the bellows. Remove IRXUVFUHZV7KHVFUHZVKDYHÀDWDQGVSULQJ washers attached. 13 10 Remove the rear holder. GREASING THE RIDE MECHANISMS FIG. 13-1i FIG. 13-1j 11 Remove the side holders that fasten the upper part on the left and right side of the bellows. 5HPRYH¿YHVFUHZVIURPHDFK7KHVFUHZV KDYHÀDWDQGVSULQJZDVKHUVDWWDFKHG FIG. 13-1k 109 12 Remove the side holders from each side. 13 GREASING THE RIDE MECHANISMS FIG. 13-1l 13 Push down on the bellows to assure there is an opening. You will see the lower nipple of the actuator. FIG. 13-1m 14 FIG. 13-1n ,QVHUW WKH +VKDSHG QR]]OH¶V WLS LQWR WKH nipple, and apply grease. Apply grease by fully opening and closing WKHJUHDVHJXQ¶VOHYHUUHSHDWHGO\'RRQHWR two repetitions. FIG. 13-1o 110 13-2 GREASING THE GUIDE • Use at least two people to remove the ride body (car body). Trying to remove the body alone can result in an accident. The ride body itself could also be damaged. - Assure the availability of space to place the removed ride body. - Do not stand up the ride body because it could become deformed. 3ODFHLWRQDVRIWÁRRUFRYHULQJVXFKDVDEODQNHW 7RJUHDVHWKHXQLYHUVDOMRLQWVRIWKHORZHUDQGXSSHUDFWXDWRUVDQGJXLGHRIWKHULGH¶VFHQWUDOPHFKDQLVPVWKHULGH body will be removed. Since the ride body is a large part, one worker cannot remove it alone. Two or more workers must remove the ride body. 8VHWKHLQFOXGHGJUHDVHJXQDQGVSHFLDOJUHDVHIRUJUHDVLQJWKHXQLYHUVDOMRLQWV8VHWKHJUHDVHOLVWHGEHORZIRU greasing the guide. GREASING THE RIDE MECHANISMS • In order not to damage the ride body, take appropriate measures. If damaged, chipped pieces and fragments could cause injury, and maintenance and repair FRXOGEHGLIÀFXOWWRFRQGXFW 13 Sumico Lubricant Sumitec 305 3RO\DOSKDROH¿Q3$2V\QWKHWLFRLOJUHDVHH[WUDOXEULFDWLRQW\SH 7KLVJUHDVHLVDQRUJDQLFPRO\EGHQXPFRPSRXQGZLWKZHLJKWVXSSRUWIRUSODVWLFOXEULFDWLRQ,I\RXDUHXQDEOHWR REWDLQDQHTXLYDOHQWSURGXFWFRQWDFWWKHRI¿FHOLVWHGLQWKLVPDQXDORUWKHSRLQWRISXUFKDVH 1 2 3 After turning off the power switch on the rear side of the control tower, turn off the power switch on side of the DLP base of the ride to be greased. Remove the two side holders and rear holders that fasten the top part of the bellows. (See 13-1.) Remove the lower cover on the lower side at the rear of the seat. Remove ten truss screws. The screws use ÀDWZDVKHUV FIG. 13-2a 111 4 5 Remove the two upper lids from the rear of the seat. (See 13-1.) 5HPRYHWKHKH[DJRQEROWVEHWZHHQWKHULGHERG\VLGHSDQHOV and the left and right seats. There are three bolts on each VLGHWRWDOLQJVL[EROWVIRUUHPRYDO7KHVLGHSDQHOVXVHÀDW washers with bolts that have spring washers attached. 13 GREASING THE RIDE MECHANISMS FIG. 13-2b 6 Remove the wiring connector inside the upper lid. Facing the projector screen, this connector is only on the right side. FIG. 13-2c 7 5HPRYHWKHKH[DJRQEROWVLQVLGHWKHXSSHU lid on the left and right sides, totaling two bolts for removal. The bolts use flat and spring washers. FIG. 13-2d 112 8 Employ at least two people to vertically lift and remove the ride body. To avoid damage, carry the body to a separate area. 13 GREASING THE RIDE MECHANISMS FIG. 13-2e 9 Grease the guide part. Apply grease to sliding parts. FIG. 13-2f 10 Attach the H-shaped nozzle on the included grease gun, and install the special grease cartridge. (See 13-1.) 113 11 Grease the universal joints of the upper and low parts of the two actuators. ,QVHUWWKHWLSRIWKH+VKDSHGQR]]OHRIWKH grease gun into the nipple of the universal joint, and apply grease. Apply grease by fully opening and closing WKHJUHDVHJXQ¶VOHYHUUHSHDWHGO\'RRQHWR two repetitions. 13 GREASING THE RIDE MECHANISMS FIG. 13-2g FIG. 13-2h 114 FIG. 13-2i 14 FLUORESCENT LIGHT REPLACEMENT • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. 8VHODPSVRIWKHVSHFLÀHGUDWLQJV8VLQJODPSVZLWKGLIIHUHQWUDWLQJVPD\FDXVH ÀUHVRUGDPDJH • Watch your step while working. There is a step leading to the ride inside the FDELQHW<RXFRXOGVWXPEOHDQGIDOO 6XFKWKLQJVDVGHWHULRUDWHGLQVXODWLRQLQOLJKWLQJÀ[WXUHVFDQFDXVHDVKRUWFLUFXLW DQGRU VPRNH 0DNH VXUH WKHUH DUH QR DEQRUPDOLWLHV )RU H[DPSOH FKHFN LI you can smell anything burning, if any sockets have been discolored and if the ODPSKDVWREHUHSODFHGIUHTXHQWO\ 14 FLUORESCENT LIGHT REPLACEMENT • There is danger that hot lamps can cause burns. Exercise due caution when replacing lamps. • To safely and reliably perform this work, be sure to use a stable stepladder. Use of an unstable stepladder can result in a worker falling over or falling down. • Be careful when handling parts made of plastic or glass. For example, be careful not to tighten screws excessively. If such parts are damaged, injuries could be caused by fragments, cracks, etc. Rear Lamp Fluorescent Light 1 2 7XUQRIIWKHSRZHUVZLWFKRIWKHFDELQHWZKRVHUHDUODPSÀXRUHVFHQWOLJKWZLOOEHUHSODFHG Remove the eight truss screws that fasten the rear lamp cover. FIG. 14a 115 3 Remove the rear lamp cover. 14 FLUORESCENT LIGHT REPLACEMENT FIG. 14b 4 5HSODFHWKHÀXRUHVFHQWOLJKWDQGJORZODPS FIG. 14c 5 116 Attach the rear lamp cover. Billboard Fluorescent Light 1 Remove the three screws then remove the service door. 14 FLUORESCENT LIGHT REPLACEMENT FIG. 14d FIG. 14e 2 5HSODFHWKHÀXRUHVFHQWOLJKWDQGJORZODPS FIG. 14f 117 3 Reattach the service door. 14 FLUORESCENT LIGHT REPLACEMENT 118 FIG. 14g 15 PERIODIC INSPECTION 1HYHU XVH D ZDWHU MHW HWF WR FOHDQ LQVLGH DQG RXWVLGH WKH FDELQHW ,I WKH machine gets wet for any reason, do not use it until it has completely dried. 3HULRGLFDOO\DURXQGRQFHD\HDUJHWLQWRXFKZLWKWKHRIÀFHKHUHLQVWDWHGRU the distributor, etc. where the product was purchased from, regarding internal cleaning. Using the product with accumulated dust in the interior can cause a ÀUHRUDFFLGHQW1RWHWKDWSURIHVVLRQDOFOHDQLQJZLOOUHTXLUHDIHH 7KHUHLVWKHGDQJHURIDFFLGHQWVLQYROYLQJHOHFWULFDOVKRUWVFLUFXLWVRUÀUHFDXVHG by factors such as the deterioration of insulation in electrical and electronic HTXLSPHQWRYHUWLPH&KHFNWKDWWKHUHDUHQRDEQRUPDOLWLHVVXFKDVRGRUVIURP burning. 15 PERIODIC INSPECTION • Be sure to check once a year to see whether power cords are damaged, the plug is securely inserted, dust has accumulated between the socket outlet and WKHSRZHUSOXJHWF8VLQJWKHSURGXFWZLWKDFFXPXODWHGGXVWFDQFDXVHÀUH and electric shock. • For all normal maintenance procedures, always turn off the power before beginning. Starting the procedures with the power still on can result in electric shocks or short circuits. • When restoring power after maintenance is completed or going into or coming out of the Test Mode, be sure to verify that there are no people near the product. When the power is restored or when coming out of Test Mode, the product will automatically undergo initialization operation. If someone is near the product, there could be a minor or major collision. • In the event that parts related to the ride mechanisms (actuators, limit switches, etc.) are damaged or break down, or when parts replacement or repairs are QHHGHGUHTXHVWZRUNEHGRQHE\WKHSRLQWRISXUFKDVHRUWKHRIÀFHOLVWHGLQ WKLVPDQXDO6XFKSURFHGXUHVUHTXLUHVSHFLDOL]HGNQRZOHGJHWHFKQLTXHVDQG tools. Improperly performed procedures can result in accidents. 119 The items listed below require periodic checks and maintenance to guarantee the performance of this machine and to ensure safe operation. Regularly clean all points of direct player contact such as the steering wheel, gear shifter, and seat. Make regular inspections to ensure there is no damage to the surfaces and there are no foreign objects on the parts. TABLE 15 PERIODIC INSPECTION TABLE ,7(06 15 '(6&5,37,21 REFERENCE PERIODIC INSPECTION Area surrounding installed product &KHFNVSDFHIRUHYDFXDWLRQDQGH[KDXVW Daily 2 &$%,1(7 &RQ¿UPWKDWDGMXVWHUVFRQWDFWÀRRU Daily 3 ,QVSHFWEHOORZV Daily 3 Steering wheel, gear shifter surface inspection Daily 3 Seat inspection, removal of foreign objects Daily 3 Trial run Daily 3 &RQ¿UPRSHUDWLRQRI027,216723 button Daily 3 DLP PROJECTOR Screen cleaning Weekly 8-1 &RQ¿UPVHWWLQJV Monthly 6 13 , 8-2 Replace lamp 67((5,1*:+((/ 0(&+$1,60 *($56+,)7(5 Volume inspection ACCELERATOR & %5$.( 8-3 Service Manual 3 Gear alignment inspection Every 3 months Service Manual 3 Greasing Every 3 months 9-2 Switch inspection Volume inspection Greasing &2,16(/(&725 8SRQPHVVDJH display Monthly Greasing 120 3(5,2' Monthly Every 3 months Monthly Every 3 months Service Manual 3 10-3 Service Manual 3 11-2 Coin switch inspection Monthly 12 Coin insertion test Monthly 12 Selector cleaning Every 3 months 12 6($75$,/ Greasing Every 3 months 1H[WSDJH $&78$725 Greasing Every 2 months 13 *8,'( Greasing 1 year 13 )/825(6&(17 /,*+76/$036 /LJKWLQJ¿[WXUHLQVSHFWLRQ As appropriate As above (/(&7521,& (/(&75,&$/3$576 ,QVSHFWLRQ As appropriate As above *$0(%2$5' All tests Monthly Service Manual 3 &RQ¿UPVHWWLQJV Monthly Service Manual 3 32:(5&$%/(6 ($57+:,5(6 ,QVSHFWLRQ&OHDQLQJ 1 year As above &$%,1(7,17(5,25 Cleaning 1 year As above &$%,1(7 685)$&(6 Cleaning As appropriate 1H[WSDJH Cleaning the Cabinet Surfaces When the cabinet surfaces become dirty, remove stains with a soft cloth soaked in water or diluted (with water) FKHPLFDOGHWHUJHQWDQGWKHQZUXQJGU\7RDYRLGGDPDJLQJWKH¿QLVKGRQRWXVHVXFKVROYHQWVVXFKDVWKLQQHU benzene, etc. (other than ethyl alcohol) or abrasives (bleaching agent and chemical dust-cloth). Seat (Greasing to Seat Rail Portion) Move the seat to the rearmost position and apply grease to the SRUWLRQVKRZQLQWKH¿JXUHRQFHHYHU\PRQWKVE\XVLQJ12. ./8%(5/RU*5($6(0$7(6(*$3$571R After greasing, move the seat a few times forward and backward so as to allow the grease to be applied all over uniformly. 15 PERIODIC INSPECTION Some general-purpose household, kitchen, and furniture cleaning products may contain strong solvents that degrade SODVWLFSDUWVFRDWLQJVDQGSULQW%HIRUHXVLQJDQ\FOHDQLQJSURGXFWUHDGWKHSURGXFW¶VFDXWLRQDU\QRWHVFDUHIXOO\ DQGWHVWWKHSURGXFW¿UVWRQDVPDOODUHDWKDWLVQRWKLJKO\YLVLEOH %HVXUHWRZLSHJUHDVHZKLFKDWWDFKHVWRWKHVXUIDFHVRIWKH 3527(&758%%(5RQWKHVHDWUDLORUDQ\H[FHVVJUHDVH FIG. 15 121 16 TROUBLESHOOTING 16 TROUBLESHOOTING • Should an error message appear, have the facility’s maintenance or technical staff deal with the issue. Work by those without the necessary specialized knowledge and technical expertise can result in electric shocks, short circuits, and fires. If such maintenance or technical staff is not available, or if the problem is with the ride mechanisms, immediately turn off the product’s power DQGFRQWDFWWKHRIÀFHOLVWHGLQWKLVPDQXDORUWKHSRLQWRISXUFKDVH • In the event that problems arise beyond those covered in this manual, or if the procedures listed in this document do not solve the problem, do not attempt to solve the problem with careless measures. Immediately turn off the product’ s power and contact the office listed in this manual or the point of purchase. Improper procedures can result in unforeseen accidents. There is also a risk of fatal damage. • When restoring power after the problem has been resolved or going into or coming out of Test Mode procedures, be sure to verify that there are no people near the product. When the power is restored or when coming out of Test Mode, the product will automatically undergo initialization operation. If someone is near the product, there could be a minor or major collision. • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. • Be careful not to damage the wires. Damaged wires may cause an electric VKRFNVKRUWFLUFXLWRUSUHVHQWDULVNRIÀUH • Once the reason that the breaker or circuit protector activated has been removed, restore the breaker or circuit protector to its original condition. If the product is used while the reason for activation has not yet been removed, heat DQGRUÀUHFRXOGEHJHQHUDWHG • In the event that parts related to the ride mechanism actuator are damaged RU EUHDN GRZQ RU ZKHQ SDUWV UHSODFHPHQW RU UHSDLUV DUH QHHGHG UHTXHVW ZRUNEHGRQHE\WKHSRLQWRISXUFKDVHRUWKHRIÀFHOLVWHGLQWKLVPDQXDO6XFK SURFHGXUHVUHTXLUHVSHFLDOL]HGNQRZOHGJHWHFKQLTXHVDQGWRROV,PSURSHUO\ performed procedures can result in accidents. %HFDXVHWKLVSURGXFWKDVSDUWVVXFKDVWKHULGHPHFKDQLVPVLWKDVVRPHXQLTXHHUURUPHVVDJHV When an error message appears, refer to the supplemental service manual. ,IWURXEOHDULVHV¿UVWLQVSHFWWKHFRQQHFWLRQVRIWKHZLULQJFRQQHFWRUV 122 TABLE 16 352%/(06 The steering wheels do not initialize. &$86( The wiring is not connected correctly. &2817(50($685(6 Check the connections of the wiring from the steering wheel motor to the steering wheel driver board. Check the wiring from the game board to the steering wheel drive switchboard. The ride does not initialize. The wiring is not connected correctly. Check the connections of the wiring from the game board to the actuator control board. Check the connections of the wiring from the DFWXDWRUFRQWUROERDUGWRWKHVHUYRDPSOL¿HU Check the connections of the wiring from the VHUYRDPSOL¿HUWRWKHDFWXDWRUPRWRU Sound does not output from speakers. The wiring is not connected correctly. Check the connections of the wiring from the game board to the speaker. The volume is not appropriate. Check the volume inside the coin tower. The wiring is not connected correctly. Check the connections of the wiring of the projector. The projector lamp has burned out. 5HSODFHWKHSURMHFWRU¶VODPSXQLW6HH The steering wheel volume has broken down. 8VH7HVW0RGHWRFKHFNWKHFKDQJHVLQWKH steering wheel values, and replace the volume if there are problems. (See 9-1.) The steering wheel center position is misaligned. $GMXVWWKHVWHHULQJZKHHO¶VFHQWHULQJXVLQJ Test Mode. The steering wheel does not respond or is weak. The Test Mode setting value. 8VH7HVW0RGHWRDGMXVWWKHPRWRUSRZHU value to an appropriate level. The accelerator or brake does not perform appropriately. The volume has broken down. 8VH7HVW0RGHWRFKHFNWKHFKDQJHVLQWKH various values, and replace the volume if there are problems. (See Section 11.) The projector does not display an image. The steering wheel does not perform appropriately. The button has broken down, or the The START button or 9,(:&+$1*(EXWWRQV ,2ERDUGKDVEURNHQGRZQ do not operate properly, or the lamps do not glow. The ride does not move. TROUBLESHOOTING &KHFNWKHZLULQJIURPWKH,2ERDUGWRWKH steering wheel unit volume. 16 8VH7HVW0RGHWRFKHFNLQSXWDQGRXWSXWDQG replace the parts if there are problems. An error has arisen in the servo Turn the power of the cockpit with the DPSOL¿HUEHFDXVHRIDSUREOHPVXFK problem to off, wait about 30 seconds, then switch the power to on again. as overloading. 123 352%/(06 Abnormal sounds come from the rear part of the ride. &2817(50($685(6 The actuator is over its limits because of improper adjustment with the limit switch. The actuator or limit switch requires adjustment. &RQWDFWWKHRI¿FHOLVWHGLQWKLVPDQXDORUWKH point of purchase. The actuator has not been properly maintained. Turn the power off, remove the FRP, and grease the actuator. (See Section 13.) 7KHÀXRUHVFHQWOLJKWV of the rear lamp or the billboard do not glow. The wiring is not connected correctly. &KHFNWKHÀXRUHVFHQWOLJKWSRZHUFRQQHFWLRQV 7KHÀXRUHVFHQWOLJKWRUJORZODPS has burned out. 5HSODFHWKHÀRUHVFHQWOLJKWRUJORZODPS (See Section 14.) Network play does not work. Test Mode settings are not correct. Check the game assignment items in Test Mode. (See recommended settings for OutRun 2 SP DX.) The hub does not have power. Check the connections of the wiring to the hub inside the DLP base. The network cable is not connected correctly. Check the connections of the wiring inside the joints between the DLP bases. 16 TROUBLESHOOTING 124 &$86( 17 GAME BOARD • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. • +DYHDX[LOLDU\OLJKWLQJPDGHDYDLODEOH7KHFDELQHWVWUXFWXUHPDNHVLWGLIÀFXOWIRU H[WHUQDOOLJKWLQJWRUHDFKLQVLGHWKHFDELQHWDQGÁRRUERDUGVDUHUHPRYHG:RUNLQJ in an environment without proper illumination can result in accidents. It can also cause damage to parts or wiring, resulting in an electric shock or short circuit. 17 GAME BOARD • +DYHZRUNSHUWDLQLQJWRHOHFWULFFLUFXLWU\VXFKDVZLWKWKHJDPHERDUGGRQHE\WKH VLWHPDLQWHQDQFHSHUVRQQHORURWKHUTXDOLÀHGSURIHVVLRQDOV2WKHUZLVHWKHUHFRXOG be an electric shock or other serious accident. If no one with proper knowledge and VNLOOVLVDYDLODEOHUHTXHVWZRUNIURPWKHSRLQWRISXUFKDVHRUWKHRIÀFHLQGLFDWHGLQ these instructions. • Be careful not to damage the wires. Damaged wires may cause an electric shock, VKRUWFLUFXLWRUSUHVHQWDULVNRIÀUH • Do not expose the game board, etc. for any reason. Doing so may cause electric shock or malfunctioning. • 1RFRQQHFWRUVRWKHUWKDQWKRVHFRQQHFWHGRQWKHJDPHERDUGZKHQÀUVWGHOLYHUHG can be used by this product. Do not connect any other wires to any of the unused connectors. This may lead to the generation of heat, smoke or burn outs. • When replacing or repairing the game board and then returning it to the cabinet, be sure to reconnect all the connectors correctly. Improper connection may cause HOHFWULFVKRFNVKRUWFLUFXLWRUÀUH • When connecting the connectors, be sure to attach them correctly. There is only one correct way in which they must be connected. Attempting to connect them incorrectly may cause damage to the pins on the connectors, and cause electric VKRFNVKRUWFLUFXLWRUÀUH • In this product, setting changes are made using the Test Mode. The game board need not be operated. Use the game board, etc. as is with the same setting made at the time of shipment so as not to cause electric shock and malfunctioning. • The chip parts on IC boards can be damaged by electrostatic discharge from the human body. Before handling an IC board, always neutralize any static charge in the body by touching a grounded metal surface. %HFDUHIXOQRWWRJHWÀQJHUVFDXJKWZKHQUHPRYLQJGRRUVRURWKHUSDUWV • Be careful of the steps and joint lowers which cause level differences. Tripping over these could result in sprains or other accidents. :RUNLVGRQHE\VTXDWWLQJGRZQEHWZHHQFDELQHWV+LWWLQJWKHFDELQHWZLWK\RXU body, or remaining in uncomfortable positions for long periods of time can result in neck, shoulder, and back injuries, etc. 125 • When exchanging the game board, place and post the damaged board in the new board’s special packaging. If you do not have the packaging or it is GDPDJHG RUGHU RQH XVLQJ WKH IROORZLQJ SURGXFW QXPEHUQDPH &$5721%2;/%*! 17 GAME BOARD • When sending a board for repairs, do not dismantle the board in any way prior WRVHQGLQJLWDZD\,WPD\QRWEHSRVVLEOHWRPHHW\RXUUHTXHVWLIDQ\SDUWVDUH missing. • Send a game board in for repair with the key chip still inserted. /,1'%(5*+XQLWVWKDWDUHVHQWDVUHSODFHPHQWVDOUHDG\KDYHVRIWZDUHLQVWDOOHG RQWKHPEXWVHWWLQJVVXFKDVVHDWQXPEHUVDUHUHTXLUHG$IWHUUHSODFLQJWKHXQLW and turning on the power, since network play settings do not match, network check will continue to display. Enter Test Mode, and adjust the settings for the cabinet on the Game Setting Screen, etc. (See Service Manual.) 17-1 REMOVING THE LINDBERGH 7KH/,1'%(5*+LVLQVLGHWKH'/3EDVHRIHDFKFDELQHWRQWKHULJKWVLGHZKHQIDFLQJWKHVFUHHQ7KH/,1'%(5*+LV RQWRSRIWKH0$,1(/(&EDVHZRRGHQSDQHO7KH/,1'%(5*+LVUHPRYHGIURPWKH'/3EDVHDORQJZLWKLWVEDVH 1 2 6ZLWFKRIIWKHSRZHURIWKHFDELQHWZKLFKKDVD/,1'%(5*+WREHUHPRYHG Remove the two screws that secure the main board door on the right side of the DLP base. The screws have flat and spring washers attached. FIG. 17-1a 126 3 8QORFNLWXVLQJWKHPDVWHUNH\DQGUHPRYH the main board door. The orange-colored sheet metal case inside the door is the /,1'%(5*+ 17 4 5 GAME BOARD FIG. 17-1b Remove the following connectors connected WR WKH /,1'%(5*+ +ROG WKH FRQQHFWRU DQGSXOOVWUDLJKWRXWWRUHPRYH%HFDUHIXO not to pull the connector in a non-straight direction. 7KH'68%FRQQHFWRUDQG/$1FDEOHKDVD lock and fastening screws. After loosening the fastening screw, remove the connector as you unlock the lock. '68%&211(&725 /$1&$%/( -96,2&$%/( 6281'&$%/(&211(&725 FIG. 17-1c Remove the two connectors (YL6P, YL8P) on the left VLGHRIWKH/,1'%(5*+ 7KHVHDUHWKH0$,1(/(& connectors. FIG. 17-1d 127 6 Remove the DLP back door on the rear side of the DLP base. Remove two screws. The VFUHZVKDYHÀDWDQGVSULQJZDVKHUVDWWDFKHG 17 GAME BOARD FIG. 17-1e 7 8QORFNZLWKWKHPDVWHUNH\DQGUHPRYHWKH DLP back door. FIG. 17-1f 8 Remove the connector (YL3P). This is also FRQQHFWHGWR0$,1(/(& FIG. 17-1g 128 9 Remove the two thumbscrews that fasten the base (wooden panel). The thumbscrews use ÀDWDQGVSULQJZDVKHUV 17 10 GAME BOARD FIG. 17-1h While being careful that the wiring does not JHWFDXJKWSXOORXWWKH/,1'%(5*+DORQJ with its base. FIG. 17-1i 11 12 13 3ODFHWKHEDVHLQDÀDWORFDWLRQ :KHQUHSODFLQJWKH/,1'%(5*+UHPRYHDOOFRQQHFWRUVFRQQHFWHGWR/,1'%(5*+ Remove the four screws fastening the base. The screws have flat and spring washers attached. Send the unit in for repair with the key chip at the side of the connector still attached. FIG. 17-1j 129 17-2 COMPOSITION OF THE GAME BOARD 17 • The game board becomes the game board for this product once the key chip is inserted. GAME BOARD • The DIP SW (dip switches) on the board must be set as specified below. If set incorrectly for this product, an error will be displayed and the game will not run. ASSY CASE LBG L 1GB ORA USA (844-0008D-01) FIG. 17-2a DIP SW Setting 8VHWKLVSURGXFWZLWKWKH',36:VHWWLQJVVKRZQLQWKH¿JXUHEHORZ FIG. 17-2b 130 17-3 SOFTWARE INSTALLATION • When working with the product, be sure to turn the power off. Working with the power on may cause an electric shock or short circuit. • Be careful not to damage DVD wire, for example, by letting it get caught in VRPHWKLQJ2WKHUZLVHWKHUHFRXOGEHDVKRUWFLUFXLWRUÀUH 17 GAME BOARD • The ride will go through initialization operation and software installation simultaneously. Verify that there are no people near the product, and then begin installation. The car-sized ride will move. There is a step in the area of the ride. Even the slightest contact could cause a fall. • The following explanation assumes that the unit has been assembled properly as instructed. If there are operations or abnormalities other than as mentioned below, cut off the power supply immediately. If power is left on, there could be DQHOHFWULFVKRFNRUÀUH 'RQRWORRNGLUHFWO\LQWRWKH'9''5,9(LQWHULRU,I\RXORRNGLUHFWO\DWWKHODVHU EHDPLQVLGHWKH'9''5,9(\RXUYLVLRQFRXOGEHLPSDLUHG • Because power is engaged while software has not been installed in the game ERDUG/,1'%(5*+´(UURUµLVGLVSOD\HGEXWWKLVLVQRWDPDOIXQFWLRQ +RZHYHU LI DQ\ RWKHU HUURU LV GLVSOD\HG RU LI WKH VFUHHQ UHPDLQV FRPSOHWHO\ blank, it could be that there was an error in assembly, a wire connection is IDXOW\RUWKH/,1'%(5*+KDVEURNHQGRZQ • After turning on the power, wait for “Error 22” to be displayed. If you perform VRPH RSHUDWLRQ EHIRUHKDQG WKHUH FRXOG EH SUREOHPV PDOIXQFWLRQ DQGRU damage to parts. $IWHU´(UURUµKDVEHHQGLVSOD\HGVHWWKH'9'GLVFLQWKH'9''5,9(UHVHWWKH power. Then, installation is executed. • For about 30 seconds after the power has been engaged, the tray will not come RXWHYHQLIWKHVZLWFKLVSUHVVHGEHFDXVHWKH'9''5,9(LVLQLWLDOL]LQJ 7KH'9''5,9(WUD\FDQEHPDGHWRFRPHRXWDQGRUJREDFNLQRQO\ZKLOHWKH power is on. The tray does not move if the power has been disconnected. • After software has been installed, be sure to store the DVD software kit, DVD '5,9(DQG'9'ZLUHDWDVHFXUHORFDWLRQ • If for some reason installation cannot be completed, an error message will be displayed. Take corrective action as indicated in the service manual. • After software installation, the seat numbers, etc. must be set. After turning on the power and installing the software, network play will not be set. Enter Test Mode, and adjust the settings for the cabinet on the Game Setting Screen, etc. (See service manual.) 131 ,IVRIWZDUHLVDFFLGHQWDOO\XQLQVWDOOHGIROORZWKHSURFHGXUHVEHORZWRLQVWDOOVRIWZDUHWRWKH/,1'%(5*+ Also, if the software version is updated, follow the same procedures to install the updated software. 5HDG\WKHLQFOXGHG'9'VRIWZDUHNLW'9''5,9(DQG'9'ZLUH6HH&KDSWHU ,IWKHYHUVLRQLVXSGDWHGGHWDLOVDERXWWKHFKDQJHVFDQEHIRXQGLQWKHPDQXDOLQFOXGHGZLWKWKH'9'VRIWZDUHNLW that contains the updated software. 17 GAME BOARD Software Installation Preparation 1 2 6ZLWFKRIIWKHSRZHURIWKHFDELQHWZKLFKKDVWKH/,1'%(5*+WKDWZLOOXQGHUJRVRIWZDUHLQVWDOODWLRQ Remove the two screws that fasten the main board door on the right side of the DLP base. The screws have flat and spring washers attached. FIG. 17-3a 3 8QORFNZLWKWKHPDVWHUNH\DQGUHPRYHWKH main board door. FIG. 17-3b 132 4 &RQQHFW WKH WZR FRQQHFWRUV RQ WKH VLGH RI WKH '9' ZLUH WKDW KDV D ³/,1'%(5*+´ WDJ RQ LW WR WKH /,1'%(5*+ 2QWKH/,1'%(5*+WKHUHLVDER[VKDSHGSDUWZLWKIRXU86%FRQQHFWRUVOLQHGXSQH[WWRRQHDQRWKHU 7KH'9'ZLUHFDQEHFRQQHFWHGWRDQ\RIWKHVH86%FRQQHFWRUV 17 GAME BOARD FIG. 17-3c 5 With the DVD wire running through the notch on the top part of the main board door, FORVHWKHPDLQERDUGGRRU%HFDUHIXOQRWWR get the DVD wire caught. Pass the DVD wire through the notch on the main board door. FIG. 17-3d 6 Connect the two connectors on the side of the DVD wire that has a “DVD” tag on it to the '9''5,9( FIG. 17-3e 133 7 :LWKWKH'9''5,9(FDVHOLGLQIURQWRI you, place it on the joint lower. 3ODFHWKH'9'LQVLGHWKH'9''5,9(DQG LQVWDOOWKHVRIWZDUH3ODFHLWLQDÀDWSODFH 17 GAME BOARD 134 FIG. 17-3f INSTALLING THE SOFTWARE Handling the DVD DRIVE 17 [Do not use or store in these locations] $Q\ZKHUHZKLFKPD\YLEUDWHRUVKRFNWKHHTXLSPHQW - In direct sunlight - In damp or dusty places - In places with a sharp change in temperature - Close to anything that gives off heat (a heater, etc.) &ORVHWRDQ\WKLQJZLWKDVWURQJPDJQHWLFÀHOGPDJQHWVPRQLWRUVSHDNHUV radio, etc.) - Anywhere that is likely to get wet (kitchen, etc.) - Anywhere with a slope or incline $Q\ZKHUHZLWKFRUURVLYHJDVLQWKHDLUFKORULQHK\GURJHQVXOÀGHDPPRQLD sulfur dioxide, etc.) - Anywhere with strong static electricity [Do not use in these locations] - Close to anything that is highly retentive of heat (carpet, sponge, cardboard, etc.) $Q\ZKHUHWKDWEORFNVWKH'9''5,9(DLUYHQW GAME BOARD 'RQRWXVHRUVWRUHWKH'9''5,9(RU'9'ZLUHLQDQ\RIWKHIROORZLQJORFDWLRQV as this may result in serious damage. 7KH'9''5,9(LVDGHOLFDWHSLHFHRIHTXLSPHQW$YRLGWKHIROORZLQJ - Dropping or shaking it violently. *HWWLQJZDWHURURWKHUOLTXLGVRQLWRUSODFLQJVPDOOLWHPVRQWRSRILW - Placing large or heavy items on top of it. 'ULQNLQJRUVPRNLQJFORVHWRWKH'9''5,9( 'R QRW WXUQ RII WKH SRZHU WR WKH '9' '5,9( ZKHQ LWV DFFHVV ODPS LV RQ RU ÁDVKLQJDVWKLVFRXOGFDXVHGDPDJHWRWKHGHYLFH 'RQRWDOORZDQ\IRUHLJQPDWHULDOVVXFKDVOLTXLGVPHWDOVRUVPRNHLQVLGHWKH '9''5,9( 8VHDVRIWGU\FORWKWRZLSHRIIDQ\GLUWRUPDUNVRQWKH'9''5,9( - If you need to use a cleaning agent, always use a “neutral” agent diluted in water. 1HYHUXVHSURGXFWVRUFOHDQLQJDJHQWVFRQWDLQLQJEHQ]HQHDOFRKROWKLQQHUV etc. 'R QRW WRXFK WKH OHQV LQVLGH WKH '9' '5,9( 'RLQJ VR PD\ SUHYHQW LW IURP reading accurately • The chip components on IC boards can be damaged by electrostatic discharge from the human body. Before handling an IC board, always neutralize any static charge in the body by touching a grounded metal surface. 135 Handling the DVD-ROM Disc 'RQRWXVHD'9'520ZLWKDGDPDJHGIURQW7KLVPD\FDXVHDPDOIXQFWLRQ 17 GAME BOARD ,QVHUWWKH'9'520LQWRWKH'9''5,9(ZLWKWKHODEHOIDFLQJXSZDUGV • Do not get fingerprints or dust particles on the disc. Contaminated discs may ORZHUDXGLRDQGYLGHRTXDOLW\DQGPD\UHVXOWLQUHDGPDOIXQFWLRQV • When cleaning the disc, do not use volatile chemicals (benzene, thinner, etc.), cleaning sprays, or antistatic agents. • Do not use a cracked, warped, or damaged disc. Do not attach papers or seals onto the disc to avoid scratching it. Do not use a disc with signs of peeled seals, WDSHHWF,IVXFKDGLVFLVSODFHGLQWKH'9'520'5,9(PDOIXQFWLRQVVXFKDV the inability to remove the disc from the drive, may result. • When cleaning a heavily contaminated disc, use a clean cloth that has been VRDNHGLQZDWHUDQGVTXHH]HG$IWHUZLSLQJUHPRYHDQ\UHPDLQLQJPRLVWXUH with a clean, dry cloth. +RZWR+ROGD'LVF :KHQKDQGOLQJDGLVFEHFDUHIXOQRWWRFRQWDPLQDWHLWZLWK\RXUÀQJHUSULQWV 136 With both hands: With one hand: 3XW \RXU WKXPEV DQG IRUHÀQJHUV RQ RSSRVLWHVLGHVRIWKHGLVF When handling a disc, be careful not to FRQWDPLQDWHLWZLWK\RXUÀQJHUSULQWV 1 2 3 Turn on the power. 7KH/,1'%(5*+VWDUWXSVFUHHQZLOOEHGLVSOD\HG:DLWDWOHDVWDPLQXWHEHIRUHSURFHHGLQJ$QHUURUZLOO show. &RQ¿UPWKDWLWLVDQ³(UURU´,ILWLVDQ³(UURU´FRQWLQXHZLWKWKHIROORZLQJSURFHGXUHV,ILWLVQRWDQ ³(UURU´UHIHUWRWKH/,1'%(5*+VHUYLFHPDQXDOIRULQVWUXFWLRQV Remove 1 resin-head screw, and then remove '9''5,9(FDVHOLG 17 GAME BOARD 4 %HIRUHWXUQLQJRQWKHSRZHUGRDQLQVSHFWLRQWRHQVXUHWKDWWKHUHDUHQRSHRSOHLQWKHDUHDQHDUWKHULGHDQG that there are no tools, etc. left on or in the ride. FIG. 17-3g 5 3UHVV WKH '9' '5,9( VZLWFK7KH '9' '5,9(WUD\FRPHVRXW6HWWKH'9'IURP the DVD software kit into the tray. Always have the DVD label side facing upward. FIG. 17-3h 6 7 8 3UHVVWKH'9''5,9(VZLWFKDQGWKHWUD\UHWXUQVWRLWVRULJLQDOSRVLWLRQ After verifying that there are no people in the area of the ride, reset the power. After temporarily turning the power off, once again restore power after at least a minute has passed. 6RIWZDUHLQVWDOOVDXWRPDWLFDOO\IURPWKH'9'WRWKH/,1'%(5*+,QVRPHFDVHVLWPD\WDNHDVORQJDV PLQXWHVIRUWKHVRIWZDUHWRLQVWDOOWRWKH/,1'%(5*+ 137 17 GAME BOARD 138 9 Once installation completes, initialization operation will begin automatically. The steering wheel and ride will move. Standby until the ride stops at a level position. Touching the ride unnecessarily could result in accidents, errors, or trouble. 10 8SRQFRPSOHWLRQRIWKHLQLWLDOL]DWLRQRSHUDWLRQWKH&XVWRPHU:HOFRPH6FUHHQZLOOEHGLVSOD\HG When installing the software, the settings for network play are cleared, so use Test Mode in order to set up network play. 11 12 13 14 15 16 17 18 19 20 21 22 Open the coin chute door of the cabinet whose software was installed, and use the switch unit to put the cabinet into Test Mode. Adjust the settings as appropriate using the Coin Setting Screen and Game Setting Screen, etc. ([LW7HVW0RGH When the Customer Welcome Screen displays, setup has been completed. 3UHVVWKH'9''5,9(¶VVZLWFKWRRSHQWKHWUD\DQGUHPRYHWKH'9' 3UHVVWKH'9''5,9(¶VVZLWFKWRFORVHWKHWUD\7KHWUD\ZLOOQRWPRYHLIWKHSRZHULVWXUQHGRII Turn off the power. 5HPRYHWKH'9'ZLUHIURPWKH'9''5,9( $WWDFKWKHFDVHOLGWRWKH'9''5,9(DQGIDVWHQLWZLWKDUHVLQKHDGVFUHZ 5HPRYHWKHPDLQERDUGGRRUDIWHUXQORFNLQJLW%HFDUHIXOQRWWRGDPDJHWKH'9'ZLUH 5HPRYHWKH'9'ZLUHIURPWKH/,1'%(5*+ Attach the main board door, lock it, and fasten it with two screws. 6WRUHWKH'9''5,9('9'ZLUHDQG'9'VRIWZDUHNLWLQDORFDWLRQIUHHRIGXVWDQGFLJDUHWWHVPRNH 18 DESIGN-RELATED PARTS For the warning display stickers, refer to Section 1. CENTER PLATE ORA-0026 BILLBOARD PLATE ORA-1211 BILLBOARD PLATE ORA-1211 18 DESIGN-RELATED PARTS ACRYL PLATE YELLOW UL ORA-5004-02UL STEP SHEET SIDE L ORA-5203 STEP SHEET SIDE L ORA-5203 (Opposite Side) STEP SHEET SIDE R ORA-5303 (Opposite Side) STEP SHEET SIDE R ORA-5303 STICKER STRIPES ACRYL PLATE RED UL ORA-5007 ORA-5004-01UL FIG. 18a STICKER SUB INSTR ENG ORA-0023-01 METER PLATE ORA-3130 STICKER PLAY INSTR LL ENG ORA-3117-D STICKER PLAY INSTR LR ENG ORA-3117-E STICKER PLAY INSTR RR ENG ORA-3118-E STICKER CONSOLE ORA-3511-B FIG. 18b STICKER PLAY INSTR RL ENG ORA-3118-D STICKER MOTION STOP SW ORA-3353 139 7KH YDULRXV VWLFNHUV WKDW DUH SODFHG RQ HDFK ULGH )53 FDU ERG\ FDQQRW EH ordered individually. We appreciate your understanding that an entire set of stickers must be purchased at the same time. 18 DESIGN-RELATED PARTS FIG. 18c FRP STICKERS FIG. 18d FRP STICKERS 140 19 WIRE COLOR CODE TABLE 141 19 WIRE COLOR CODE TABLE The DC power wire color for this product is different from previous SEGA titles. :RUNLQJIURPWKHSUHYLRXVZLUHFRORUVZLOOFUHDWHDKLJKULVNRIÀUH 19 WIRE COLOR CODE TABLE The color codes for the wires used in the diagrams in the following chapter are as follows. Wires other than those of any of the above 5 single colors will be displayed by 2 alphanumeric characters. &2'( :,5(&2/25 10 RED %/8( 30 YELLOW 40 GREEN :+,7( 70 ORANGE %/$&. 90 GRAY $ 3,1. % 6.<%/8( & %52:1 ' 3853/( ( /,*+7*5((1 ,IWKHULJKWKDQGVLGHQXPHUDORIWKHFRGHLVWKHQWKHZLUHZLOOEHRIDVLQJOHFRORUVKRZQE\WKHOHIWKDQGVLGH numeral (see the above). Note 1:If the right-hand side numeral is not 0, that particular wire has a spiral color code. The lefthand side character shows the base color and the right-hand side one, the spiral color. ([DPSOH!«««:+,7(5(' 5(' :+,7( Note 2:The character following the wire color code indicates the size of the wire. 142 8 $:* K : AWG18 L : AWG20 None : AWG22 20 WIRING DIAGRAM (D-1/10) CABINET 20 WIRING DIAGRAM 143 (D-2/10) CABINET 20 WIRING DIAGRAM 144 (D-3/10) CABINET 20 WIRING DIAGRAM 145 (D-4/10) CABINET 20 WIRING DIAGRAM 146 (D-5/10) CABINET 20 WIRING DIAGRAM 147 (D-6/10) CABINET 20 WIRING DIAGRAM 148 (D-7/10) CABINET 20 WIRING DIAGRAM （灰：Gray　白：White　桃：Pink　赤：Red　橙：Orange　黒：Black) 149 (D-8/10) CABINET 20 WIRING DIAGRAM 150 (D-9/10) CABINET 20 WIRING DIAGRAM 151 (D-10/10) CABINET 20 WIRING DIAGRAM 152 BILLBOARD 20 WIRING DIAGRAM 153

SEGA OutRun 2 Special Tours DX arcade game OWNER'S MANUAL

Assistant Bot

Key Features

Frequently Answers and Questions

What is the minimum height requirement for playing?

What is the maximum weight limit for one ride?

What should I do if a player feels ill?

How do I adjust the projector?

Related manuals

SEGA OutRun 2 Special Tours DX arcade game OWNER'S MANUAL

Assistant Bot

Key Features

Frequently Answers and Questions

What is the minimum height requirement for playing?

What is the maximum weight limit for one ride?

What should I do if a player feels ill?

How do I adjust the projector?

Related manuals

Sega

Human Alliance

Sega

Golden Gun

Sega

Ghost Squad Evolution

Sega

OutRun 2 Special Tours SDX

TSURUMI PUMP

Submersible Portable Dewatering Pump

NAMCO BANDAI

Deadstorm Pirates

TSURUMI PUMP

LB-480

Kenmore

Elite 796.3140

Kenmore

796.3142

TSURUMI PUMP

KTD Series

Kenmore Elite

31553

NAMCO BANDAI

Deadstorm Pirates Special Edition