Cable MAC

Cable MAC
iii
About This Guide
This guide is a service manual for the InfoRanger SCM-120R and SCM-120U. The size, the shape and color of
the SCM-120R and SCM-120U are same and both of them have one Ethernet port. Different from SCM-120R,
SCM-120U has one USB port besides Ethernet port. This guide explains first the common features of SCM120R and SCM-120U and then the specific features of each with marking ‘Only for SCM-120R’ or ‘Only for
SCM-120U ’.
This guide consists of following :
Chapter 1 Introduction to InfoRanger describes the features and specification of InfoRanger and shows RF signal
information.
Chapter 2 Prior to Installation explains how to configure PC before installing the InfoRanger and the necessary
items to install InfoRanger.
Chapter 3 Installing and Provisioning InfoRanger explains how to install the InfoRanger and connect cables.
Chapter 4 Using InfoRanger describes the function of each connector and the way of using LED.
Chapter 5 Using Diagnostic Program explains how to use diagnostic program to diagnose the memory, Ethernet,
Cookie parameters, Upstream and Downstream status of InfoRanger.
Chapter 6 Using Management Commands explains the management commands used to test and debug the
InfoRanger.
Chapter 7 Structure of InfoRanger explains the cable interface, microprocessor, memory, Ethernet interface and
other miscellaneous part which constitutes the InfoRanger.
Chapter 8 Network Component describes the network component to support the DOCSIS-compatible Cable
modem.
Chapter 9 Network Layer Properties describes the cable layer such as Protocol Stack, Ethernet Driver, Cable
driver, Bridging.
Chapter 10 Web-based Management System explains how to check the current status of InfoRanger and change
the configuration through the website.
Appendix A Troubleshooting shows how to solve the InfoRanger problems occurred in the field or service line.
Appendix B Testing InfoRanger explains breifly how to test the InfoRanger in the field.
Appendix C Part List lists the numbers and description of each part which constitutes the InfoRanger.
Appendix D Servicing Diagram shows the overall diagrams and exploded view of InfoRanger.
iv
Table of Contents
Chapter 1
Introduction to InfoRanger
Features of the InfoRanger .................................................................................................................
Examples of Network Connection .......................................................................................................
Product Specifications ........................................................................................................................
RF Specifications ................................................................................................................................
1-1
1-2
1-3
1-4
Chapter 2 Prior to Installation .......................................................................... 2-1~2-6
Subscribing to Cable Internet Service .................................................................................................. 2-1
Environment Preparation for Installation .............................................................................................. 2-2
Preparing Necessary Items ................................................................................................................. 2-3
Configuring TCP/IP Protocol ............................................................................................................... 2-5
Installing TCP/IP Protocol on IBM Compatible PC ...................................................................................... 2-5
Installing TCP/IP Protocol on Macintosh PC ................................................................................................. 2-6
Chapter 3 Installing and Provisioning InfoRanger ............................................. 3-1~3-16
Installing InfoRanger........................................................................................................................... 3-1
Locating in a place ............................................................................................................................. 3-1
Connecting the Coaxial Cable ............................................................................................................ 3-3
Connecting PCs ................................................................................................................................. 3-4
Single PC Connection .......................................................................................................................................... 3-4
Multiple PCs Connection.................................................................................................................................... 3-6
Connecting the Power Adapter ............................................................................................................ 3-8
Inspecting Cable Connection .............................................................................................................. 3-9
Provisioning InfoRanger .................................................................................................................... 3-11
Procedure of Provisioning InfoRanger ........................................................................................................... 3-11
Power on and Initialization Sequence............................................................................................................. 3-11
Scan and Synchronize With Downstream Channel ...................................................................................... 3-12
Obtain Upstream Parameters........................................................................................................................... 3-12
Ranging ............................................................................................................................................................... 3-12
Establish IP Connectivity.................................................................................................................................. 3-13
Transfer Operational Parameters..................................................................................................................... 3-13
Registration......................................................................................................................................................... 3-14
Enable Ethernet Interface.................................................................................................................................. 3-14
Baseline Privacy Initialization.......................................................................................................................... 3-14
Chapter 4 Using InfoRanger .............................................................................. 4-1~4-4
Front View.......................................................................................................................................... 4-1
Rear View .......................................................................................................................................... 4-3
Chapter 5 Using Diagnostics Program ............................................................... 5-1~5-18
Equipment Preparation ...................................................................................................................... 5-1
Functional Test .................................................................................................................................. 5-2
Set Up ................................................................................................................................................................... 5-2
Starting Diagnostic Program ............................................................................................................................. 5-4
Memory Test Menu ............................................................................................................................................. 5-5
Ethernet Test Menu ........................................................................................................................................... 5-11
Miscellaneous Test Menu ................................................................................................................................. 5-13
Cookie Menu ...................................................................................................................................................... 5-13
Cable Downstream Test Menu......................................................................................................................... 5-14
Cable Upstream Test Menu .............................................................................................................................. 5-16
v
Chapter 6 Using Management Commands ........................................................... 6-1~6-9
List of Management Commands ......................................................................................................... 6-1
MacAddr ............................................................................................................................................................... 6-1
CmacMcast............................................................................................................................................................ 6-2
UsbMcast............................................................................................................................................................... 6-2
SnmpStat ............................................................................................................................................................... 6-2
ShowBpi ................................................................................................................................................................ 6-3
IfShow.................................................................................................................................................................... 6-4
UniShowPCMAC................................................................................................................................................. 6-5
Sdf .......................................................................................................................................................................... 6-5
cdf , cmSetDsFrequency...................................................................................................................................... 6-5
showUcd ............................................................................................................................................................... 6-6
upStat..................................................................................................................................................................... 6-8
dmdStat .................................................................................................................................................................. 6-8
reboot..................................................................................................................................................................... 6-9
Chapter 7 Structure of the InfoRanger ............................................................. 7-1~7-16
Introduction ....................................................................................................................................... 7-1
Cable Interface .................................................................................................................................. 7-2
Introduction .......................................................................................................................................................... 7-2
Downstream ......................................................................................................................................................... 7-3
Upstream........................................................................................................................................... 7-5
Microprocessor and Momory Interface ................................................................................................. 7-6
Microprocessor (CN9414) ................................................................................................................................... 7-6
Flash Memory (AMD29DL323D, Intel28F320)............................................................................................... 7-12
SDRAM (K4S641632D) ...................................................................................................................................... 7-14
User Interface .................................................................................................................................. 7-15
Ethernet Tranceiver (LXT 972) ......................................................................................................................... 7-15
Ethernet Line Interface ...................................................................................................................................... 7-16
Others ............................................................................................................................................. 7-16
Power................................................................................................................................................................... 7-16
Display ................................................................................................................................................................ 7-16
Switch .................................................................................................................................................................. 7-16
Connectors .......................................................................................................................................................... 7-16
Chapter 8 Network Component
Provisioning Model ............................................................................................................................
Cable Modem Configuration File .......................................................................................................
DHCP Server Configuration ...............................................................................................................
TFTP Server .......................................................................................................................................
Web Server .......................................................................................................................................
CMTS Configuration ..........................................................................................................................
8-1
8-3
8-4
8-4
8-4
8-5
Chapter 9 Network Layer Properties ................................................................. 9-1~9-6
Protocol Stack ...................................................................................................................................
Cable Driver .....................................................................................................................................
Ethernet Driver ..................................................................................................................................
USB Driver (InfoRanger SCM-120U) ....................................................................................................
Bridging ............................................................................................................................................
TCP and UDP/IP ................................................................................................................................
DHCP ...............................................................................................................................................
TFTP .................................................................................................................................................
SNMP ...............................................................................................................................................
9-1
9-2
9-2
9-2
9-2
9-4
9-5
9-5
9-5
vi
Chapter 10
Web-based Management System ............................................... 10-1~10-10
Check IP Address ............................................................................................................................ 10-1
Windows 98 SE (Second Edition) ................................................................................................................... 10-1
Windows 2000 .................................................................................................................................................... 10-2
Connecting the website .....................................................................................................................10-3
Information Lists............................................................................................................................... 10-4
Cable Modem General Information ................................................................................................................ 10-4
Headend Infomatino ......................................................................................................................................... 10-5
RF Signal Information ...................................................................................................................................... 10-6
Upstream Information....................................................................................................................................... 10-7
Changing the Downstream Frequency ........................................................................................................... 10-8
Selecting Regions ............................................................................................................................................... 10-9
Appendix A Troubleshooting ......................................................................... A-1~A-22
Troubleshooting in Physical Layer ....................................................................................................... A-1
Instruments Needed .......................................................................................................................................... A-1
Location of Test Points ...................................................................................................................................... A-2
On-site Check ..................................................................................................................................................... A-3
Power Check ....................................................................................................................................................... A-4
Oscillator Check ................................................................................................................................................. A-5
Display Check .................................................................................................................................................... A-6
Down Stream Chcek .......................................................................................................................................... A-7
Up Stream Check ............................................................................................................................................. A-13
Ping Test ............................................................................................................................................................ A-17
Troubleshooting in Network Layer ..................................................................................................... A-20
Appendix B
Testing InfoRanger .......................................................................B-1~B-10
Purpose of the Plan ........................................................................................................................... B-1
Feature Set ........................................................................................................................................ B-1
Typical Hardware Setup ..................................................................................................................... B-1
InfoRanger Test Topology ................................................................................................................... B-2
Typical Suggested Tests ...................................................................................................................... B-3
Test Environment and Setup Overview ................................................................................................. B-3
Setting Up the Test Environment .......................................................................................................... B-3
Understanding the Test Environment ................................................................................................... B-4
Setting Up the Headend ..................................................................................................................... B-4
About the Up Converter, Diplexer, and Attenuators .............................................................................. B-5
Setting Up the Support Services .......................................................................................................... B-6
Setting Up the TFTP Server ............................................................................................................................... B-6
Setting Up the DHCP Server ............................................................................................................................. B-7
Setting Up the TOD Server ................................................................................................................................ B-7
Configuring the Client PCs ................................................................................................................. B-8
Setting Up InfoRanger for the First Time ............................................................................................. B-8
To Begin the Debugging Process ......................................................................................................... B-9
Basic Information ................................................................................................................................................ B-9
InfoRanger Resets ............................................................................................................................................... B-9
Gathering Debug Information ............................................................................................................ B-9
Begin by Describing the Problem ..................................................................................................................... B-9
Tracing the Module Status ................................................................................................................. B-10
Appendix C Part List ...................................................................................... C-1~C-16
InfoRanger SCM-120R Part List .......................................................................................................... C-1
InfoRanger SCM-120U Part List ......................................................................................................... C-9
vii
Appendix D Servicing Diagrams ....................................................................... D-1~D-3
Block Diagram ................................................................................................................................. D-1
Exploded View................................................................................................................................... D-2
InfoRanger SCM-120R........................................................................................................................................ D-2
InfoRanger SCM-120U ....................................................................................................................................... D-3
&KDSWHU ,QWURGXFWLRQWR,QIR5DQJHU
7KH6$0681*,QIR5DQJHULVDQH[WHUQDOFDEOHPRGHPZKLFKHQDEOHVIDVWGDWDFRPPXQLFDWLRQVXVLQJD
FDEOHQHWZRUN
:LWKWKH6$0681*,QIR5DQJHU\RXFDQUHFHLYHGDWDXSWR0ESVDQGVHQGGDWDXSWR0ESV
&RPSDUHGZLWKFRQYHQWLRQDOWHOHSKRQHOLQHVWKLVUHPDUNDEOHVSHHGLVWLPHVIDVWHUWKDQ.ESVPRGHP
6$0681*,QIR5DQJHULVVSHFLDOO\GHVLJQHGIRUWKHXVHUVZKRZDQWWRWUDQVPLWGDWDDWKLJKVSHHGZLWK
ORZHUFRVW:LWK6$0681*,QIR5DQJHU\RXFDQHQMR\WKHIDVWHVWFRPPXQLFDWLRQVSHHG
,QIR5DQJHUVSHHGFDQEHFKDQJHGE\WKHIROORZLQJIDFWRUV
O 8VHU·VFRPSXWHUVSHFLILFDWLRQV
O 1XPEHURISURJUDPVWKDWLVUXQQLQJRQWKHXVHU·VFRPSXWHU
O 1HWZRUNWUDIILFZKHQXVHULVFRQQHFWHG
O 0D[LPXP%DQGZLGWKSURYLGHGE\\RXUVHUYLFHSURYLGHUWRWKHXVHUV
)HDWXUHVRI,QIR5DQJHU
+LJKVSHHG
7KH,QIR5DQJHUOHWV\RXFRQQHFWWRWKH,QWHUQHWWUDQVPLWHPDLOVDQGGRZQORDGGDWDXSWRWLPHVIDVWHU
WKDQD.ESVPRGHP
7ZRZD\GDWDFRPPXQLFDWLRQ
7KH,QIR5DQJHUSURYLGHVWZRZD\GDWDWUDQVPLVVLRQ:LWKWKH,QIR5DQJHU\RXFDQGRZQORDGGDWDXSWR
0ESVDQGVLPXOWDQHRXVO\XSORDGGDWDXSWR0ESV
([FHOOHQWFRPSDWLELOLW\'2&6,6FRPSOLDQW,QIR5DQJHU
,QFRPSOLDQFHZLWK'2&6,6'DWD2YHU&DEOH6HUYLFH,QWHUIDFH6SHFLILFDWLRQWKH,QIR5DQJHUFDQUHFHLYH
VHUYLFHVIURPDQ\FDEOHRSHUDWRUVDQGFDQEHXVHGZLWKRWKHU'2&6,6FRPSOLDQW&076&DEOH0RGHP
7HUPLQDWLRQ6\VWHP
4XLFNDQGHDV\LQVWDOODWLRQSURFHVV
:LWKWKH,QIR5DQJHUWKH,3DGGUHVVLVVHWDXWRPDWLFDOO\7KHRQO\WKLQJ\RXQHHGWRGRLVWRVHWXSDFFRUGLQJ
WRLQVWDOODWLRQJXLGH
&RPSDFWDQGFRQYHQLHQWGHVLJQ
7KH,QIR5DQJHULVGHVLJQHGIRUHDV\WRXVHDQGLWILWVZHOOLQDQ\KRPHDQGRIILFHHQYLURQPHQW
6XSSRUW86%SRUW2QO\IRU,QIR5DQJHU6&08
7KH,QIR5DQJHU6&08VXSSRUWV86%SRUWVRWKDW\RXFDQVDYHWURXEOHWRRSHQWKHFDVHRI3&DQGLQVWDOO
QHWZRUNLQWHUIDFHFDUG,WLVDIDVWELGLUHFWLRQDOLVRFKURQDOORZFRVWG\QDPLFDOO\DWWDFKDEOHVHULDOLQWHUIDFH
WKDWLVFRQVLVWHQWZLWKWKHUHTXLUHPHQWVRIWKH3&SODWIRUP,WVXSSRUWVXSWRSK\VLFDOGHYLFHVDQGLWV
WUDQVIHUUDWHDVVXUHVXSWR0EV
&KDSWHU
,QWURGXFWLRQWR,QIR5DQJHU
([DPSOHVRI1HWZRUN&RQQHFWLRQ
7KLVGLDJUDPVKRZVDQH[DPSOHRIXVLQJWKH(WKHUQHWSRUWRI,QIR5DQJHU6&087KHQHWZRUN
FRQILJXUDWLRQXVLQJ,QIR5DQJHU6&05LVLGHQWLFDOWRLW,QFDVHRI,QIR5DQJHU6&08\RX
FDQHYHQFRQILJXUHWKHQHWZRUNXVLQJWKH86%SRUWLQVWHDGRI(WKHUQHWSRUW
{ŒVSHFLILFDWLRQDQGWKHVKDSHRIWKHSRZHUDGDSWHUFRQWDLQHGLQWKHSDFNDJHLVGLIIHUHQW
DFFRUGLQJWRWKHUHJLRQVZKHUHWKH,QIR5DQJHULVSXUFKDVHG
,I\RXVXEVFULEHWRERWK&$79DQGWKH,QWHUQHW6HUYLFHV
&DEOH79VHUYLFHSURYLGHU
3RZHUDGDSWHU
&DEOHRXWOHW
DC 12V
&DEOHVSOLWWHU
3&
Reset
Ethern
et
USB
(WKHUQHWFDEOH
Cable
,QIR5DQJHU6&08
&RD[LDOFDEOH
7HOHYLVLRQ
,I\RXRQO\VXEVFULEHWRD&DEOH,QWHUQHW6HUYLFH
&DEOH79VHUYLFHSURYLGHU
3RZHUDGDSWHU
3&
DC 12V
Reset
Ethern
et
&DEOHRXWOHW
&RD[LDOFDEOH
(WKHUQHWFDEOH
USB
Cable
,QIR5DQJHU6&08
3URGXFW6SHFLILFDWLRQV
Item
,QWHUIDFH
7HPSHUDWXUH
)UHTXHQF\
0RGXODWLRQ
'DWDUDWH
&KDQQHOVSDFLQJ
EDQGZLGWK
)(&
6\PEROUDWH
(WKHUQHW
0ESV5-SRUWPIW
86%IRU6&08
0ESV86%SRUWPIW
2SHUDWLQJ
WR×G)WRG)
6WRUDJH
WR×G)WRG)
'RZQVWUHDP
WR0+]
8SVWUHDP
WR0+]
'RZQVWUHDP
4$0 4$0
8SVWUHDP
4$0 436.
'RZQVWUHDP
4$00ESV4$00ESV
8SVWUHDP
436.0ESV4$00ESV
'RZQVWUHDP
0+]
8SVWUHDP
.+].+].+]0+]0+]
'RZQVWUHDP
567UHOOLV
8SVWUHDP
563URJUDPPDEOH
'RZQVWUHDP
4$0 0VSV
4$0 0VSV
8SVWUHDP
.....VSV
'RZQVWUHDP
4$0 ELWV
4$0 ELWV
8SVWUHDP
436.
4$0
'RZQVWUHDP
WRG%P9
8SVWUHDP
436.
4$0
%LWVSHUV\PERO
/HYHOUDQJH
Specification
ELWV
ELWV
WRG%P9
WRG%P9
&DUULHUWRQRLVHUDWLR
4$0 !G%#%(5
4$0 !G%#%(5
6HFXULW\
'(6GHFU\SWLRQHQFU\SWLRQ
3K\VLFDOGLPHQVLRQ
6L]H
:['[+PP:['[+
:HLJKW
NJOE,QIR5DQJHU$GDSWHU
$&
(XURSH$VLD $&9+]
86$
$&9+]
'&
(XURSH$VLD 9$
86$
9$
3RZHUVXSSO\
5HJXODWRU\$JHQF\$SSURYDO
)&&8/&8/&(
&KDSWHU
,QWURGXFWLRQWR,QIR5DQJHU
5)6SHFLILFDWLRQV
7KH,QIR5DQJHUXVHVWKH&RQH[DQWFKLSWRIROORZ0&16VSHFLILFDWLRQ635),,
'RZQVWUHDP
O 0V\PEROUDWH
O 6XSSRUWVDQG4$0
O 'LJLWDOGHPRGXODWRU1\TXLVWILOWHUVWUDFNLQJORRSVDQGWDSDGDSWLYHGHFLVLRQIHHGEDFNHTXDOL]HU
O 'LJLWDOGHURWDWRUIRUZLGHEDQGFDUULHUSKDVHWUDFNLQJ
O VWDWH7UHOOLVGHFRGHU
O 5HHG6RORPRQQN W O 3URJUDPPDEOHFRQYROXWLRQDOGHLQWHUOHDYHU,- O ELWFRQYHUWHUVXLWDEOHWR4$0DSSOLFDWLRQV
8SVWUHDP
O 0&16,((('$9,&'9%FRPSOLDQW
O 3URJUDPPDEOHPRGXODWLRQ436.4$0
O 9DULDEOHV\PEROUDWHVXSWR0V\PEROUDWH
O 4$0/LQNPRGXODWRUZLWK VTURRW1\TXLVWILOWHUV
O 'LJLWDOO\WXQDEOH,)FHQWHUIUHTXHQF\XSWR0+]
O ELW'$&0+]PD[LPXPVDPSOHUDWH
O 3URJUDPPDEOHWUDQVPLWWHUSUHHTXDOL]HU
O 3URJUDPPDEOH56HQFRGHU*)7 WR
O 3URJUDPPDEOHODVW56FRGHZRUGIL[HGOHQJWKVKRUWHQHG
O 3URJUDPPDEOHELWUDQGRPL]HUSRO\QRPLDOVSHHGW\SH
O 3URJUDPPDEOHUDQGRPL]HUORFDWLRQEHIRUHDIWHU56HQFRGHU
O 3URJUDPPDEOHHQFRGLQJ'LIIHUHQWLDO1RQ'LIIHUHQWLDO
&KDSWHU 3ULRUWR,QVWDOODWLRQ
7KLVFKDSWHUH[SODLQVZKDW\RXVKRXOGGREHIRUHLQVWDOOLQJWKH,QIR5DQJHU
6XEVFULELQJWR&DEOH,QWHUQHW6HUYLFH
7KHFDEOHPRGHPUHFHLYHVGDWDWKURXJKDFDEOH79QHWZRUN7KHUHIRUHLWLVQHFHVVDU\WRVXEVFULEH,QWHUQHW
VHUYLFHWRXVH\RXUFDEOHPRGHP,I\RXDUHDOUHDG\VXEVFULELQJWRFDEOH79SOHDVHPDNHVXUHWKDW\RXDUH
DOVRVXEVFULELQJWRFDEOH,QWHUQHWVHUYLFHFDEOH79SURYLGHU,I\RXGRQRWKDYH,QWHUQHWVHUYLFHSOHDVH
FRQWDFW\RXUFDEOH79SURYLGHUDQGDVNWKHIROORZLQJVHUYLFHV
y :KHWKHUWKH\VXSSRUWWZRZD\FDEOHPRGHPDFFHVVVHUYLFHRUQRW
9 7KH,QIR5DQJHUHQDEOHVWZRZD\GDWDWUDQVPLVVLRQ,I\RXZDQWWRXVHDOOIHDWXUHVRIWKH,QIR5DQJHU
\RXQHHGWRVXEVFULEHWR\RXUFDEOH79SURYLGHUZKLFKSURYLGHVWZRZD\FDEOHPRGHPDFFHVVVHUYLFH
y :KHWKHUWKH\SURYLGHWKH,QWHUQHWVHUYLFHRUQRW
9 ,I\RXZDQWWRVHQGRUUHFHLYHHPDLOVDFFHVVWR:::DQGRUXVHRWKHU,QWHUQHWVHUYLFHVWKURXJKWKH
FDEOHPRGHP\RXQHHGWRKDYHFDEOH,QWHUQHWVHUYLFH2QFH\RXDUHDQ,QWHUQHWVHUYLFHVXEVFULEHULQ
\RXUFDEOH79SURYLGHULWZLOOSURYLGH\RXZLWKDQ,QWHUQHWDFFRXQWZKLFK\RXFDQFRQQHFWWRYLD
\RXUFDEOHPRGHP3OHDVHQRWHWKDW\RXU,QWHUQHWDFFRXQWVKRXOGEHHVWDEOLVKHGEHIRUHWKHLQVWDOODWLRQ
RIFDEOHPRGHP
&KDSWHU
3ULRUWR,QVWDOODWLRQ
(QYLURQPHQW3UHSDUDWLRQIRU,QVWDOODWLRQ
<RXVKRXOGLQVWDOOWKH,QIR5DQJHULQDSODFHZLWKWKHIROORZLQJWHPSHUDWXUHKXPLGLW\DQGVWDEOHHOHFWULF
SRZHU
y 2SHUDWLRQWHPSHUDWXUH WR×G)WRG)
6WRUDJHWHPSHUDWXUH
WR×G)WRG)
y 2SHUDWLRQKXPLGLW\
EHORZ×G)QRQFRQGHQVLQJ
3UHVHUYDWLRQKXPLGLW\ EHORZ×G)QRQFRQGHQVLQJ
y 3RZHU&RQVXPSWLRQ
:DWW
y ,QSXWYROWDJH
(XURSH$VLD9$&86$9
y 5DWHGIUHTXHQF\
(XURSH$VLD86$+]
:KLOHWKH,QIR5DQJHULVRSHUDWLQJNHHSWKHIOXFWXDWLRQUDQJHRILQSXWYROWDJHZLWKLQRI
UHJXODWHGYROWDJH,QDGGLWLRQJURXQGWKHHOHFWULFRXWOHWZKLFKLVFRQQHFWHGWRLQSXWWHUPLQDO
‹
$YRLGVWDWLFHOHFWULFLW\DQGHOHFWULFQRLVH«
8VHSUHYHQWLYHHTXLSPHQWLIWKH,QIR5DQJHULVLQVWDOOHGLQDSODFHZKHUH
KLJKVWDWLFHOHFWULFLW\RUHOHFWULFQRLVHLVSUHVHQW
‹
&OHDQDQGZHOOYHQWLODWHGSODFH«
,QVWDOOWKH,QIR5DQJHULQDYHQWLODWHGSODFHZKHUHWKHDSSURSULDWH
WHPSHUDWXUHDQGDLUIORZLVSUHVHQW$VGXVWFDQFDXVHDVHULRXVIDLOXUHRI
RSHUDWLRQLQVWDOOWKH,QIR5DQJHUDWDFOHDQSODFH
‹
$YRLGWKHGLUHFWVXQOLJKW
'LUHFWVXQOLJKWFDQLQFUHDVHWHPSHUDWXUHRIWKH,QIR5DQJHUDQGWKLVFDQ
FDXVHGDPDJHWRRSHUDWLRQDOSDUWVDQGOHDGWRRSHUDWLRQIDLOXUH7KHUHIRUH
6DPVXQJUHFRPPHQGVNHHSLQJWKH,QIR5DQJHUDZD\IURPGLUHFWVXQOLJKW
3UHSDULQJ1HFHVVDU\,WHPV
7KHIROORZLQJLWHPVVKRXOGEHSUHSDUHGLQRUGHUWRXVHWKH,QIR5DQJHU
,QFOXGHG,WHPV,QIR5DQJHU6&05
y ,QIR5DQJHU6&05
y $SRZHUDGDSWHU
y $VWDQGKROGHU
y $5-(WKHUQHWFDEOHP)W
y 7KLVPDQXDO
,QIR5DQJHU6&05
5-(WKHUQHWFDEOH
3RZHUDGDSWHU
K
7KLVPDQXDO
6WDQGKROGHU
)LJXUH ,QFOXGHGLWHPVLQWKH,QIR5DQJHUSDFNDJH
7KHVSHFLILFDWLRQDQGWKHVKDSHRIWKHSRZHUDGDSWHUFRQWDLQHGLQWKHSDFNDJHDUHGLIIHUHQW
DFFRUGLQJWRWKHUHJLRQVZKHUHWKHFDEOHPRGHPLVSXUFKDVHG
1RW,QFOXGHG,WHPV
7KHIROORZLQJLWHPVDUHQRWLQFOXGHGLQWKH,QIR5DQJHUSDFNDJH7KHVHQHHGWREHSUHSDUHGVHSDUDWHO\
y $Q,%0FRPSDWLEOH3&ZKLFK7&3,3LVLQVWDOOHGRQDQGUXQV:LQGRZVRUODWHURUD0DFLQWRVK
ZKLFK7&3,3LVLQVWDOOHGRQDQGUXQV6\VWHPRUODWHU
y $WZRZD\FRD[LDOFDEOH
y $FURVVRYHUFDEOHIRUFRQQHFWLQJKXE
y $1HWZRUN,QWHUIDFH&DUG1,&
&KDSWHU
3ULRUWR,QVWDOODWLRQ
,QFOXGHG,WHPV,QIR5DQJHU6&08
y ,QIR5DQJHU6&08
y $SRZHUDGDSWHU
y $VWDQGKROGHU
y $5-(WKHUQHWFDEOHP)W
y $86%FDEOHP)W
y 7KLVPDQXDO
y 86%'ULYHU)ORSS\'LVNHWWHIRU86%SRUWXVHGIRUERWK:LQGRZV6(6HFRQG(GLWLRQDQG:LQGRZV
HQYLURQPHQW
RC
V
SN
D
PC
,QIR5DQJHU6&08
TM
3RZHUDGDSWHU
5-(WKHUQHWFDEOH
K
86%FDEOH
7KLVPDQXDO
86%'ULYHUGLVNHWWH
6WDQGKROGHU
)LJXUH ,QFOXGHGLWHPVLQWKH,QIR5DQJHUSDFNDJH
7KH6SHFLILFDWLRQDQGWKHVKDSHRIWKHSRZHUDGDSWHUFRQWDLQHGLQWKHSDFNDJHDUHGLIIHUHQW
DFFRUGLQJWRWKHUHJLRQVZKHUH,QIR5DQJHULVSXUFKDVHG
1RW,QFOXGHG,WHPV
7KHIROORZLQJLWHPVDUHQRWLQFOXGHGLQWKH,QIR5DQJHUSDFNDJH7KHVHQHHGWREHSUHSDUHGVHSDUDWHO\
y $Q,%0FRPSDWLEOH3&ZKLFK7&3,3LVLQVWDOOHGRQDQGUXQV:LQGRZVRUODWHURUD0DFLQWRVK
ZKLFK7&3,3LVLQVWDOOHGRQDQGUXQV6\VWHPRUODWHU
y $WZRZD\FRD[LDOFDEOH
y $FURVVRYHUFDEOHIRUFRQQHFWLQJKXE
y $1HWZRUN,QWHUIDFH&DUG1,&
&RQILJXULQJ7&3,33URWRFRO
2QFH\RXKDYHVHWXSWKH,%0FRPSDWLEOH3&UXQQLQJRQ:LQGRZVRUODWHURUWKH0DFLQWRVKUXQQLQJRQ
6\VWHPRUODWHU\RXQHHGWRLQVWDOO7&3,3SURWRFRODQGQHWZRUNLQWHUIDFHFDUGRQO\ZKHQXVLQJ
(WKHUQHWSRUWRI,QIR5DQJHU
<RXGRQRWQHHGWRLQVWDOO7&3,3SURWRFROZKHQXVLQJ86%SRUWRI,QIR5DQJHU6&08EHFDXVH7&3,3
SURWRFROLVLQVWDOOHGDXWRPDWLFDOO\ZKLOH86%GULYHULVLQVWDOOHG6NLSWKLVVHFWLRQDQGJRWRWKHQH[WFKDSWHU
ZKHQXVLQJ86%SRUW
5HIHUULQJWRWKHPDQXDOWKDWSURYLGHGZLWK\RXUQHWZRUNLQWHUIDFHFDUGSOHDVHLQVWDOOWKHQHWZRUNLQWHUIDFH
FDUGRQ\RXUFRPSXWHUDQGLQVWDOOWKHQHWZRUNLQWHUIDFHFDUGGULYHU7KHQLQVWDOO7&3,3SURWRFRODV
IROORZV,I\RXDOUHDG\LQVWDOOHG7&3,3SURWRFROVNLSWKLVVHFWLRQDQGJRWRWKHQH[WFKDSWHU
7KH7&3,3SURWRFROLVLQVWDOOHGDXWRPDWLFDOO\GXULQJ:LQGRZVLQVWDOODWLRQ*HQHUDOO\LWLV
QRWQHFHVVDU\WRLQVWDOO7&3,3SURWRFROLQ:LQGRZVHQYLURQPHQWXQOHVV\RXUHPRYHG
7&3,3SURWRFRORQSXUSRVH
,QVWDOOLQJ7&3,33URWRFRORQ,%0&RPSDWLEOH3&
7KLVLQVWDOODWLRQLVDQH[DPSOHRIDQ,%0FRPSDWLEOH3&UXQQLQJRQ:LQGRZV6(6HFRQG
(GLWLRQ,QVWDOODWLRQRI7&3,3SURWRFROPD\YDU\GHSHQGLQJRQWKHGLIIHUHQWRSHUDWLQJ
V\VWHPDQGRUDQHWZRUNLQWHUIDFHFDUGXVHGDQGRU&DEOH6HUYLFH3URYLGHUEXWWKHRYHUDOO
SURFHVVLVJHQHUDOO\VLPLODU&RQWDFWWKH&DEOH6HUYLFH3URYLGHUWRLQVWDOO7&3,3SURWRFRO
DFFXDWHO\
)RU:LQGRZV6(
&OLFNWKH>[email protected]Î&RQWURO3DQHO
,Q&RQWURO3DQHO!ZLQGRZGRXEOHFOLFN1HWZRUNLFRQ
:KHQ1HWZRUN!ZLQGRZDSSHDUVFOLFN>$GG«@EXWWRQ
:KHQ6HOHFW1HWZRUN&RPSRQHQW!ZLQGRZDSSHDUVFOLFN3URWRFRODQGWKHQFOLFN>$GG«@EXWWRQ
:KHQ6HOHFW1HWZRUN3URWRFRO!ZLQGRZDSSHDUVFOLFN0LFURVRIWIURPWKH¶0DQXIDFWXUH·OLVWDQGWKHQ
FOLFN7&3,3IURPWKH¶1HWZRUN3URWRFROV·OLVW&OLFN>[email protected],QVHUW:LQGRZV6(&'LQWR&'520
GULYHDQGGHVLJQDWHLWVORFDWLRQLQFDVHDSRSXSZLQGRZUHTXHVWLQJWRLQVHUW:LQGRZV6(&'DSSHDUV
2WKHUZLVH\RXGRQRWQHHGWR
,Q1HWZRUN!:LQGRZFOLFN7&3,3IURP¶7KHIROORZLQJQHWZRUNFRPSRQHQWVDUHLQVWDOOHG·OLVWDQGFOLFN
>[email protected]
:KHQ7&3,33URSHUWLHV!ZLQGRZDSSHDUVFOLFN,3$GGUHVV!WDE2QWKH,3$GGUHVV!WDEVHOHFW
2EWDLQDQ,3DGGUHVVDXWRPDWLFDOO\DQGWKHQFOLFN>[email protected]
:KHQWKHV\VWHPUHERRWSURPSWPHVVDJHDSSHDUVFOLFN><([email protected]
&KDSWHU
3ULRUWR,QVWDOODWLRQ
)RU:LQGRZV
&OLFNWKH>[email protected]Î&RQWURO3DQHO
,Q&RQWURO3DQHO!ZLQGRZGRXEOHFOLFN1HWZRUNDQG'LDO8S&RQQHFWLRQVLFRQ
:KHQ1HWZRUNDQG'LDO8S&RQQHFWLRQ!ZLQGRZDSSHDUVVHOHFW/RFDO$UHD&RQQHFWLRQLFRQDQGSUHVV
WKHULJKWEXWWRQRIWKHPRXVH
:KHQ/RFDO$UHD&RQQHFWLRQ3URSHUWLHV!ZLQGRZDSSHDUV&OLFN>,[email protected]
:KHQ6HOHFW1HWZRUN&RPSRQHQW7\SH!ZLQGRZDSSHDUVVHOHFW3URWRFRODQGWKHQFOLFN>$GG«@EXWWRQ
:KHQ6HOHFW1HWZRUN3URWRFRO!ZLQGRZDSSHDUVVHOHFW,QWHUQHW3URWRFRO7&3,3DQGFOLFN>[email protected]
7&3,3SURWRFROLVLQVWDOOHG:KLOH7&3,3LVLQVWDOOHGLQVHUW:LQGRZV&'LQWR&'520GULYH
DQGGHVLJQDWHLWVORFDWLRQLQFDVHDSRSXSZLQGRZUHTXHVWLQJWRLQVHUW:LQGRZV&'DSSHDUV
2WKHUZLVH\RXGRQRWQHHGWR
6HOHFWWKHQHZO\LQVWDOOHG,QWHUQHW3URWRFRO7&3,3LQ6HOHFW1HWZRUN3URWRFRO!ZLQGRZFOLFN>[email protected]
EXWWRQ
:KHQ,QWHUQHW3URWRFRO7&3,33URSHUWLHV!ZLQGRZDSSHDUVVHOHFW2EWDLQDQ,3DGGUHVVDXWRPDWLFDOO\
DQG2EWDLQ'166HUYHUDGGUHVVDXWRPDWLFDOO\WKHQFOLFN>[email protected]
:KHQWKHV\VWHPUHERRWSURPSWPHVVDJHDSSHDUVFOLFN><[email protected]\WRUHERRWWKH
V\VWHP
,QVWDOOLQJ7&3,33URWRFRORQ0DFLQWRVK3&
7KLVLQVWDOODWLRQLVDQH[DPSOHRID0DFLQWRVKUXQQLQJRQ6\VWHP,QVWDOODWLRQPHWKRGRI
7&3,3SURWRFROPD\YDU\GHSHQGLQJRQWKHGLIIHUHQWRSHUDWLQJV\VWHPDQGRUDQHWZRUNLQWHUIDFH
FDUGXVHGDQGRUWKH&DEOH6HUYLFH3URYLGHUEXWWKHRYHUDOOSURFHVVLVJHQHUDOO\VLPLODU&RQWDFW
WKH&DEOH6HUYLFH3URYLGHUWRLQVWDOO7&3,3SURWRFRODFFXDWHO\
&OLFNWKH$SSOHLFRQDQGVHOHFWWKH7&3,3LFRQLQWKH&RQWURO3DQHOV
,Q7&3,3!ZLQGRZWKHUHDUHWZRPHQXV$SSOH7DONDQG(WKHUQHWLQWKH&RQQHFW9LDOLVW6HOHFW
(WKHUQHWLQWKHOLVW
7KH6HWXSER[LVFKDQJHG7KHUHDUHPHQXVLQWKH&RQILJXUHOLVW6HOHFW8VLQJ'+&36HUYHULQWKHOLVW
&OLFNLQJWKLVPHQXEULQJVWKH,3DGGUHVVURXWHUDGGUHVVWREHVHWDXWRPDWLFDOO\E\,QIR5DQJHU
&ORVHWKHZLQGRZWRILQLVKWKH7&3,3LQVWDOODWLRQ:KHQ6DYHFKDQJHVWRWKHFXUUHQWFRQILJXUDWLRQ"!
PHVVDJHDSSHDUVFOLFN>[email protected]
,IDPHVVDJHDSSHDUVWRUHVWDUWWKHV\VWHPUHERRWWKHV\VWHP2WKHUZLVH\RXGRQRWQHHGWR
&KDSWHU,QVWDOOLQJDQG3URYLVLRQLQJ,QIR5DQJHU
,QVWDOOLQJ,QIR5DQJHU
7KLVFKDSWHUH[SODLQVKRZWRLQVWDOOWKH,QIR5DQJHUDQGKRZWRFRQQHFWWKHFDEOHVWRWKH,QIR5DQJHU7KH
IROORZLQJGHVFULEHVWKHSURFHVV
3XWWKH,QIR5DQJHUWKHDSSURSULDWHSODFH
&RQQHFWWKHFRD[LDOFDEOH
&RQQHFWWR3&6LQJOH3&0XOWL3&V
&RQQHFWWKHSRZHUDGDSWHU
'RQRWFRQQHFWWKH,QIR5DQJHU·VSRZHUDGDSWHUEHIRUHFRQQHFWLQJDQ\FDEOHVWRLW,WFDQ
FDXVHVHULRXVGDPDJHWRWKHHTXLSPHQW
/RFDWLQJLQDSODFH
7KHORFDWLQJPHWKRGLVDSSLFDEOHWRERWK,QIR5DQJHU6&05DQG6&08
/RFDWH,QIR5DQJHULQDIODWVXUIDFHDZD\IURPGLUHFWVXQOLJKW,WLVDOVRQHFHVVDU\WRSXW,QIR5DQJHULQD
SODFHFORVHWRWKHFDEOHRXWOHWRUFDEOHVSOLWWHUIRUHDVLHUFRQQHFWLRQRIFDEOHV<RXFDQHLWKHUVWDQG
,QIR5DQJHUE\IL[LQJWKHVXSSOLHGVWDQGKROGHULQWRLWRUSXWLWLQDSODFHZLWKLWVVLGHZKHUH\RXFDQILQG
DSURWUXVLRQDWWKHERWWRP%XWLWLVVWURQJO\UHFRPPHQGHGWKDW\RXVWDQGLWXSWRLPSURYHYHQWLODWLRQ
7RVWDQGWKH,QIR5DQJHUIL[WKHVWDQGKROGHULQWRLWDVIROORZLQJ
7KHUHLVDVPDOOSURWUXVLRQDWWKHORZHUULJKWSDUWRQWKHIURQWVLGHRQZKLFK6$0681*ORJRLV
SULQWHGRIWKH,QIR5DQJHU$OVRWKHUHLVDQRWKHURQHDWWKHORZHUOHIWSDUWRQWKHEDFNVLGHRIWKH
,QIR5DQJHU)LUVWIL[WKHSURWUXVLRQRQWKHEDFNVLGHRIWKH,QIR5DQJHULQWRWKHQDUURZJURRYHRIWKH
VWDQGKROGHU
)L[WKHQDUURZJURRYHVLQWRWKH
SURWUXVLRQRQWKHEDFNVLGHILUVW
3URWUXVLRQRQWKHEDFN
)LJXUH )L[LQJWKHSURWUXVLRQRQWKHIURQWWRWKHJURRYHRIWKHVWDQGKROGHU
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
1H[WDGMXVWWKHPLGGOHRIWKHVWDQGKROGHUWRWKHKROORZSDUWXQGHUWKH,QIR5DQJHU7KHQSUHVVWKH
PLGGOHRIWKHVWDQGKROGHU
3UHVVWKHPLGGOHRIWKHVWDQGKROGHU
)LJXUH 3UHVVWKHVWDQGKROHUWRWKH,QIR5DQJHU
7KH,QIR5DQJHUZLWKVWDQGKROGHULVGHVFULEHGEHORZ
DC 12
V
Reset
Ethern
et
USB
Cable
)LJXUH ,QIR5DQJHU6&08ZLWKVWDQGKROGHU
%HVXUHWRIL[WKHVWDQGKROGHULQWRWKH,QIR5DQJHUZLWKWKHSURSHUDWWHQWLRQ)DLOXUHWRIL[WKH
VWDQGKROGHULQWRWKH,QIR5DQJHUDFFXUDWHO\DVLVGHVFULEHGLQWKLVFKDSWHUFDQEUHDNWKHVWDQG
KROGHU
&RQQHFWLQJWKH&RD[LDO&DEOH
7KHFRQQHFWLQJPHWKRGLVDSSOLFDEOHWRERWK,QIR5DQJHU6&05DQG6&08
&RQQHFWRQHHQGRIWKHFRD[LDOFDEOHWRWKH&DEOHFRQQHFWRURIWKH,QIR5DQJHUDQGFRQQHFWWKHRWKHUHQGRI
WKHFRD[LDOFDEOHWRWKHFDEOHRXWOHWRUFDEOHVSOLWWHU6OLGHWKHSLQLQWKHFHQWHURIWKHFRD[LDOFDEOHLQWRWKH
KROHLQWKH&DEOHFRQQHFWRUFDUHIXOO\ZLWKRXWEHQGLQJDQGWXUQWKHFRQQHFWRUFORFNZLVHXQWLOWKHFDEOHLV
ILUPO\DWWDFKHG
Cable
DC 12
V
Reset
Ethern
et
USB
Cable
)LJXUH &RQQHFWLQJWKHFRD[LDOFDEOHWRWKH&DEOHFRQQHFWRURI,QIR5DQJHU6&08
7KHFRD[LDOFDEOHLVQRWSURYLGHGZLWKWKH,QIR5DQJHUE\GHIDXOW
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
&RQQHFWLQJ3&V
<RXFDQFRQQHFWWKH,QIR5DQJHUWRDVLQJOH3&RUWRJURXSRI3&VWKURXJKDKXERUDVZLWFK<RXPXVWXVH
5-(WKHUQHWFDEOHVWUDLJKWWKURXJKFDEOHRU86%FDEOHZKLFKDUHSURYLGHGZLWKWKH,QIR5DQJHUWR
FRQQHFWWKH,QIR5DQJHUWR3&7RFRQQHFWDGGLWLRQDO3&VWRWKH,QIR5DQJHU\RXPXVWSUHSDUHWKH
DGGLWLRQDO6WUDLJKWWKURXJK(WKHUQHWFDEOHVDKXEDQGD&URVVRYHU(WKHUQHWFDEOH
<RXFDQXVHERWK(WKHUQHWSRUWDQG86%SRUWDWDWLPHZLWKRXWDQ\NLQGRIVSHFLILFRSHUDWLRQZKHQXVLQJ
,QIR5DQJHU6&08
8VH(WKHUQHWSRUWDQGSUHSDUH1HWZRUN,QWHUIDFH&DUGDQGD+XEWRFRQQHFWWKH,QIR5DQJHUWR
PXOWLSOH3&V<RXFDQFRQQHFWWKH86%SRUWRI,QIR5DQJHU6&08WRRQO\RQH3&DWDWLPH
2UXVHERWK(WKHUQHWSRUWDQG86%SRUWVLPXOWDQHRXVO\
,WLVSRVVLEOHWRFRQQHFWWKH,QIR5DQJHU6&08DQG6&05WRPXOWLSOH3&VE\XVLQJ86%
SRUWDQG(WKHUQHWSRUWDWWKHVDPHWLPHEXWWKHDPRXQWRI3&VLVGHSHQGHQWRQWKH&DEOH
6HUYLFH3URYLGHU&RQWDFW\RXU&DEOH6HUYLFH3URYLGHUIRUIXUWKHULQIRUPDWLRQ
6LQJOH3&&RQQHFWLRQ
8VLQJ(WKHUQHWSRUW
)LUVWWXUQRIIWKH3&ZKLFK\RXFRQQHFWWRWKH,QIR5DQJHU&RQQHFWWKH(WKHUQHWSRUWRIWKH,QIR5DQJHUWR
WKHSRUWRIWKHQHWZRUNLQWHUIDFHFDUGRQWKH3&XVLQJWKH5-QHWZRUNFDEOHSURYLGHGZLWKWKH
,QIR5DQJHU
1HWZRUN,QWHUIDFH&DUG
Reset
Ethern
et
USB
DC 12V
Reset
Ethern
et
USB
VWUDLJKWWKURXJK&DEOH
Cable
)LJXUH &RQQHFWLQJWKH5-(WKHUQHWFDEOHWRWKH3&DQGWKH(WKHUQHWSRUWRI,QIR5DQJHU6&08
8VLQJ86%SRUW2QO\IRU,QIR5DQJHU6&08
8VH,%0FRPSDWLEOH3&UXQQLQJ:LQGRZV6(6HFRQG(GLWLRQRUODWHUYHUVLRQVXFKDV
:LQGRZV0H0LOOHQLXP(GLWLRQDQG:LQGRZVLQFDVHRIXVLQJ86%SRUW
7RXVH86%SRUWWKHUHVKRXOGEHD86%SRUWLQWKH3&VXSSRVHGWREHFRQQHFWHGWR,QIR5DQJHU0DNHVXUH
LIWKHUHLVD86%SRUWLQWKH3&PRVWRIDOO
&RQQHFWWKH86%SRUWRI3&DQGWKH86%SRUWRI,QIR5DQJHUXVLQJ86%FDEOHZKLFKLVSURYLGHGZLWK
,QIR5DQJHU,WLVQRWQHFHVVDU\WRWXUQRIIWKH3&WRFRQQHFWWKH3&WR,QIR5DQJHU
Reset
Ether
net
86%3RUW
USB
DC 12V
Reset
Ethern
et
USB
Cable
)LJXUH &RQQHFWLQJWKH86%FDEOHWRWKH3&DQGWKH86%SRUWRI,QIR5DQJHU6&08
,QVWDOOWKHGULYHUIRU86%SRUW
7KHILQDOVWHSIRUXVLQJ86%SRUWLVWRLQVWDOOWKHGULYHUIRU86%SRUWXVLQJ86%GULYHUGLVNHWWHSURYLGHG
ZLWK,QIR5DQJHU'RWKHIROORZLQJVWHSVWRLQVWDOO86%GULYHU
<RXFDQGRZQORDGDPDQXDOGHVFULELQJPRUHLQGHWDLOKRZWRLQVWDOO86%GULYHUIRU,QIR5DQJHU
6&08LQZZZVDPVXQJQHWZRUNFRP
8)RU:LQGRZV6(
:KHQ\RXFRQQHFWWKH,QIR5DQJHUDQG3&WKH$GG1HZ+DUGZDUH:L]DUG!ZLQGRZDSSHDUV&OLFN
>1H[[email protected][WVWHS
6HOHFW6HDUFKIRUWKHSURSHUGULYHUIRU\RXUGHYLFH5HFRPPHQGHGLQWKHIROORZLQJZLQGRZDQGFOLFN>1H[[email protected]
WRJRRQWRWKHQH[WVWHS
6HOHFW)ORSS\'LVN'ULYHDVDORFDWLRQRIDQHZGULYHUDQGLQVHUWWKH86%GULYHUGLVNHWWHSURYLGHGZLWK
,QIR5DQJHULQWRIORSS\GLVNGULYH&OLFN>1H[[email protected]
6HOHFW8VHDQXSGDWHG'ULYHU5HFRPPHQGHG6DPVXQJ&DEOH0RGHP86%'ULYHULQWKHIROORZLQJZLQGRZ
FOLFN>1H[[email protected][WVWHS
$ZLQGRZDSSHDUVUHSRUWLQJLWKDVIRXQGWKHDSSURSULDWHGULYHULQWKHIORSS\GLVNDVIROORZLQJ&OLFN
>1H[[email protected][WVWHS
&OLFN>1H[[email protected]\WRLQVWDOO6DPVXQJ&DEOH0RGHP86%
'ULYHU,QVHUW:LQGRZV6(&'LQWR&'520GULYHGXULQJLQVWDOODWLRQZKHQDPHVVDJHDSSHDUV
UHTXHVWLQJWRLQVHUW:LQGRZV6(&'LQWR&'520GULYH&OLFN>1H[[email protected]&'520LVUHDG\
&OLFN>)[email protected]\VWHP
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
8)RU:LQGRZV
:KHQ\RXFRQQHFWWKH,QIR5DQJHUDQG3&WKH)RXQG1HZ+DUGZDUH:L]DUG!ZLQGRZDSSHDUV
&OLFN>1H[[email protected][WVWHS
6HOHFW6HDUFKIRUDVXLWDEOHGULYHUIRUP\'HYLFH5HFRPPHQGHGLQWKHIROORZLQJZLQGRZDQGFOLFN>1H[[email protected]
JRRQWRWKHQH[WVWHS
6HOHFW)ORSS\'LVN'ULYHDVDORFDWLRQRIDQHZGULYHUDQGLQVHUWWKH86%GULYHUGLVNHWWHSURYLGHGZLWK
,QIR5DQJHULQWRIORSS\GLVNGULYH&OLFN>1H[[email protected]
,QWKLVVWHSDZLQGRZDSSHDUVUHSRUWLQJLWKDVIRXQGWKHVXLWDEOHGULYHULQWKHIORSS\GLVN&OLFN>1H[[email protected]
WRJRRQWRWKHQH[WVWHS
:KHQDQZLQGRZDODUPLQJ0LFURVRIW'LJLWDO6LJQDWXUHLVQRWLQFOXGHGLQWKHVRIWZDUHMXVWFOLFN><[email protected]
SURFHHGLQVWDOODWLRQ
&OLFN>1H[[email protected]\WRLQVWDOOWKHGULYHU
,QVHUW:LQGRZV&'LQWR&'520GULYHGXULQJLQVWDOODWLRQZKHQDPHVVDJHDSSHDUVUHTXHVWLQJ
WRLQVHUW:LQGRZV&'LQWR&'520GULYH&OLFN>1H[[email protected]&'520LVUHDG\)LOHVDUHFRSLHG
IURP:LQGRZV&'
,IQRPHVVDJHDSSHDUVVNLSWKLVVWHS
&OLFN>)[email protected],WLVQRWQHFHVVDU\WRUHVWDUWWKHV\VWHPLQWKH:LQGRZV
HQYLURQPHQW
8QLQVWDOOWKHGULYHUIRU86%SRUW
,IQHFHVVDU\GRWKHIROORZLQJVWHSVWRXQLQVWDOO86%GULYHU
<RXFDQGRZQORDGDPDQXDOGHVFULELQJPRUHLQGHWDLOKRZWRXQLQVWDOO86%GULYHUIRU
,QIR5DQJHU6&08LQZZZVDPVXQJQHWZRUNFRP
8)RU:LQGRZV6(
&OLFNWKH>[email protected]Î&RQWURO3DQHO
,Q&RQWURO3DQHO!ZLQGRZGRXEOHFOLFN1HWZRUNLFRQ<RXFDQFKHFNWKH6DPVXQJ&DEOH0RGHP86%
'ULYHULWHPLQWKHFRQILJXUDWLRQOLVW
6HOHFWWKH6DPVXQJ&DEOH0RGHP86%'ULYHUDQGFOLFN>[email protected]%GULYHULVUHPRYHG7KHQUHERRW
WKHV\VWHP:KHQWKHV\VWHPLVUHVWDUWHGWKHIROORZLQJLWHPVUHTXLUHGGHOHWLQJWRFRPSOHWHO\XQLQVWDOO
WKHGULYHU
D )LOHQDPHG&?:LQGRZV?6\VWHP1HW6HF&PV\V
E )LOHQDPHG&?:LQGRZV?,1)?2WKHU6DPVXQJ1HW6HF&PLQI
$IWHUGHOHWLQJWKHWZRILOHVUHERRWWKHV\VWHPRQHPRUHWLPH
8)RU:LQGRZV
&OLFNWKH>[email protected]Î&RQWURO3DQHO
,Q&RQWURO3DQHO!ZLQGRZGRXEOHFOLFN$GG5HPRYH+DUGZDUHLFRQWRODXQFK$GG5HPRYH
+DUGZDUH:L]DUG!ZLQGRZ&OLFN>1H[[email protected]
,QWKHQH[WZLQGRZVHOHFW8QLQVWDOO8QSOXJDGHYLFHDQGFOLFN>1H[[email protected][WVWHS
,QWKHQH[WZLQGRZVHOHFW8QLQVWDOODGHYLFHLQRUGHUWRORDGWKHLWHPOLVWWRXQLQVWDOO,I6DPVXQJ&DEOH
0RGHP86%'ULYHUGRHVQRWH[LVWLQWKHOLVWFKHFNWKH6KRZKLGGHQGHYLFHXQGHUWKHOLVWER[WREULQJXSDOO
WKHGHYLFHV6HOHFW6DPVXQJ&DEOH0RGHP86%'ULYHUDQGFOLFN>1H[[email protected][WVWHS
,QWKHQH[WZLQGRZVHOHFW<HV,ZDQWWRXQLQVWDOOGHYLFHDQGFOLFN>1H[[email protected]%'ULYHULVXQLQVWDOOHG
&OLFN>)[email protected]$GG5HPRYH+DUGZDUH:L]DUG!
1RZODXQFK5HJLVWU\(GLWRU)URP>[email protected]\SHUHJHGLWRQWKHFRPPDQGOLQH
'HOHWHWKHIROORZLQJ+.(<B/2&$/B0$&+,1(?6<67(0?&XUUHQW&RQWURO6HW?(QXP?86%?9LGB(3LGB
([LWWKH5HJLVWU\(GLWRUDQGODXQFKWKH:LQGRZV([SORUHU)LQGDQGGHOHWHRQHRHP;LQI; «ILOH
XQGHU&?:,117?,1)ZKLFKFRQWDLQVDQRWH¶6DPVXQJ6&08(86%&$%/(02'(0·DWWKHEHJLQQLQJ
0RUHRYHU\RXQHHGWRDQRHP;SQI; «ILOHFRUUHVSRQGWRWKHGHOHWHGRHP;LQIILOHIRU
H[DPSOHLI\RXGHOHWHGRHPLQIILOHGHOHWHRHPSQIILOHDVZHOO
)LQDOO\GHOHWH1HW6HF&PV\VXQGHU&?:,117?6\VWHP?'ULYHUV
86%XQLQVWDOODWLRQSURFHVVLVILQLVKHG5HERRWWKHV\VWHP
7KHDWWULEXWHRI&?:,117?,1)IROGHUDQGLQIILOHVDUHKLGGHQVRWKDWWKH\PD\LQYLVLEOHLQWKH
:LQGRZV([SORUHU,QWKLVFDVHFOLFN7RROVÎ)ROGHU2SWLRQRIWKH:LQGRZV([SORUHUDQGVHOHFW
9LHZWDE,QWKHFRQILJXUDWLRQOLVWRSHQWKH +LGGHQ)LOHDQG)ROGHUVIROGHUDQGFKHFNWKH6KRZ
KLGGHQILOHDQGIROGHUV1RZWKDWWKHDWWULEXWHRI,1)IROGHUDQGLQIILOHVDUHFKDQJHG\RXFDQ
VHHWKHPLQWKH:LQGRZV([SORUHU
0XOWLSOH3&V&RQQHFWLRQ
7KHDPRXQWRI3&VLVGHSHQGHQWRQWKH&DEOH6HUYLFH3URYLGHU&RQWDFW\RXU&DEOH6HUYLFH
3URYLGHUIRUIXUWKHULQIRUPDWLRQ
,I\RXZDQWWRFRQQHFWPRUHWKDQRQH3&WRWKH,QIR5DQJHU\RXQHHGWRSUHSDUHWKHIROORZLQJDGGLWLRQDO
LWHPV
O $Q(WKHUQHWKXERUVZLWFKRI0ESVWUDQVPLVVLRQVSHHG
O 7ZLVWHGSDLUFDWHJRU\FURVVRYHUFDEOH
O 7ZLVWHGSDLUFDWHJRU\VWUDLJKWWKURXJKFDEOHVHTXDOWRWKHQXPEHURI3&V
7KHVSHFLILFDWLRQVRIWZLVWHGSDLUFDWHJRU\FURVVRYHUFDEOHVDQGVWUDLJKWWKURXJKFDEOHV
DUHGHVFULEHGDW$SSHQGL['LQGHWDLO
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
<RXFDQFRQQHFWWKH,QIR5DQJHUWRILIWHHQ3&VVLPXOWDQHRXVO\E\XVLQJ(WKHUQHWSRUW
,IWKHXVHUQHHGVPRUHWKDQRQHVWUDLJKWWKURXJKFDEOHWRFRQQHFWPXOWLSOH3&VWR,QIR5DQJHU
KHVKHVKRXOGSUHSDUHWKHQHFHVVDU\FDEOHVE\KLPVHOIKHUVHOIEHFDXVHRQO\RQHVWUDLJKW
WKURXJKFDEOHLVVXSSOLHGZLWK,QIR5DQJHUE\GHIDXOW
$IWHUSUHSDULQJDOOWKHWKLQJVWRFRQQHFWDGGLWLRQDO3&VGRWKHIROORZLQJV
7XUQRIIDOOWKH3&V\RXZDQWWRFRQQHFWWRWKH,QIR5DQJHU
&RQQHFWRQHHQGRIWZLVWHGSDLUFDWHJRU\FURVVRYHUFDEOHWRWKH(WKHUQHWSRUWRIWKH,QIR5DQJHU
7KHQFRQQHFWWKHRWKHUHQGRIFDEOHWRWKHSRUWRIKXE
&RQQHFWRQHHQGRIWZLVWHGSDLUFDWHJRU\VWUDLJKWWKURXJKFDEOHWRWKHSRUWRIQHWZRUNLQWHUIDFH
FDUGLQVWDOOHGRQ3&7KHQFRQQHFWWKHRWKHUHQGRIFDEOHWRWKHSRUWRIKXE
,QIR5DQJHU
DC 12V
Reset
Ethern
et
USB
2
Cable
(WKHUQHWKXE
FURVVRYHUFDEOH
3
VWUDLJKWWKURXJKFDEOH
3
VWUDLJKWWKURXJKFDEOH
3
VWUDLJKWWKURXJKFDEOH
FURVVRYHU
VWUDLJKWWKURXJK
)LJXUH &RQQHFWLQJWKH,QIR5DQJHU6&08WRPXOWLSOH3&VWKURXJKDQ(WKHUQHWKXE
&RQQHFWLQJWKH3RZHU$GDSWHU
7KHFRQQHFWLQJPHWKRGLVDSSLFDEOHWRERWK,QIR5DQJHU6&05DQG6&08
'RQRWFRQQHFWWKH,QIR5DQJHU·VSRZHUDGDSWHUEHIRUHFRQQHFWLQJDQ\FDEOHVWRLW,WFDQFDXVH
VHULRXVGDPDJHWRWKHHTXLSPHQW
%HVXUHWRFRQQHFWWKHSRZHUDGDSWHUWRWKH,QIR5DQJHURQO\DIWHUFRQQHFWLQJRWKHUFDEOHV
&RQQHFWRQHHQGRIWKHSRZHUDGDSWHUWR'&9MDFNRIWKH,QIR5DQJHUDQGWKHRWKHUHQGWRDZDOORXWOHW
DVIROORZV
DC 12
V
Reset
DC 12V
Reset
Ethern
et
USB
Cable
)LJXUH &RQQHFWLQJWKHSRZHUDGDSWHUWRWKH,QIR5DQJHU6&08
8VHRQO\WKHSRZHUDGDSWHUVXSSOLHGZLWKWKH,QIR5DQJHU8VLQJRWKHUW\SHRISRZHUDGDSWHU
FDQFDXVHFULWLFDOGDPDJHWRWKH,QIR5DQJHU
7KH6SHFLILFDWLRQDQGWKHVKDSHRIWKHSRZHUDGDSWHUFRQWDLQHGLQWKHSDFNDJHDUHGLIIHUHQW
DFFRUGLQJWRWKHUHJLRQVZKHUH,QIR5DQJHULVSXUFKDVHG
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
,QVSHFWLQJ&DEOH&RQQHFWLRQ
7KHIROORZLQJGLDJUDPVKRZVWKHFRUUHFWFDEOHFRQQHFWLRQV
7KLVGLVJUDPVKRZVDQH[DPSOHRIXVLQJWKH(WKHUQHWSRUWRI,QIR5DQJHU6&087KH
QHWZRUNFRQILJXUDWLRQXVLQJ,QIR5DQJHU6&05LVLGHQWLFDOWRLW,QFDVHRI,QIR5DQJHU6&0
8\RXFRQHYHQFRIQLJXUHWKHQHWZRUNXVLQJWKH86%SRUWLQVWHDGRI(WKHUQHWSRUW
Single PC Connection
&DEOH79VHUYLFHSURYLGHU
Internet
3RZHUDGDSWHU
DC 12V
Reset
Ethern
et
3&
(WKHUQHWFDEOH
VWUDLJKWWKURXJK
USB
Cable
,QIR5DQJHU6&08
&RD[LDOFDEOH
&DEOHRXWOHW
)LJXUH± &DEOHFRQQHFWLRQLQFDVHRIDVLQJDO3&FRQQHFWLRQ
7KHDERYHGLDJUDPLVVKRZLQJWKHFDVHRIFRQQHFWLQJWKH3&WR(WKHUQHWSRUWRI,QIR5DQJHU7KH
FDVHRIFRQQHFWLQJWKH3&WR86%SRUWRI,QIR5DQJHULVLGHQWLFDO
7KH6SHFLILFDWLRQDQGWKHVKDSHRIWKHSRZHUDGDSWHUFRQWDLQHGLQWKHSDFNDJHDUHGLIIHUHQW
DFFRUGLQJWRWKHUHJLRQVZKHUH,QIR5DQJHULVSXUFKDVHG
Multiple PCs Connection
&DEOH79VHUYLFHSURYLGHU
3RZHUDGDSWHU
&DEOHRXWOHW
DC 12V
Reset
Ethern
et
&RD[LDOFDEOH
USB
Cable
,QIR5DQJHU6&08
FURVVRYHUFDEOH
(WKHUQHWKXE
VWUDLJKWWKURXJKFDEOH
VWUDLJKWWKURXJKFDEOH
VWUDLJKWWKURXJKFDEOH
3&
3&
3&
)LJXUH &DEOHFRQQHFWLRQLQFDVHRIPXOWLSOH3&VFRQQHFWLRQ
7KH6SHFLILFDWLRQDQGWKHVKDSHRIWKHSRZHUDGDSWHUFRQWDLQHGLQWKHSDFNDJHDUHGLIIHUHQW
DFFRUGLQJWRWKHUHJLRQVZKHUH,QIR5DQJHULVSXUFKDVHG
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
3URYLVLRQLQJ,QIR5DQJHU
3URFHGXUHRI3URYLVLRQLQJ,QIR5DQJHU
7KH,QIR5DQJHULQLWLDOL]DWLRQSURFHVVLVDVIROORZV
3RZHURQDQG,QLWLDOL]DWLRQ6HTXHQFH
6FDQQLQJDQG6\QFKURQL]HZLWK'RZQVWUHDP&KDQQHO
2EWDLQ8SVWUHDP3DUDPHWHUV
5DQJLQJ
(VWDEOLVK,3&RQQHFWLYLW\
7UDQVIHU2SHUDWLRQDO3DUDPHWHUV
5HJLVWUDWLRQ
(QDEOH(WKHUQHW,QWHUIDFH
%DVHOLQH3ULYDF\,QLWLDOL]DWLRQ
3RZHURQDQG,QLWLDOL]DWLRQ6HTXHQFH
2QFHDV\VWHPLPDJHLVORDGHGE\WKHERRWIXQFWLRQWKHLQLWLDOL]DWLRQIXQFWLRQSHUIRUPVSODWIRUPDQG
9[:RUNVLQLWLDOL]DWLRQIXQFWLRQVLQFOXGLQJEXWQRWOLPLWHGWR
O &RS\GDWDVHJPHQWRILPDJHWR'5$0
O ,QLWLDOL]HV\VWHPFORFN
O ,QLWLDOL]HYDULRXVSK\VLFDOGHYLFHVHJFDEOH&1/;7
O ,QLWLDOL]HLQWHUUXSWKDQGOHUVXSSRUW
O ,QLWLDOL]H9[:RUNVNHUQHOIXQFWLRQVHJPHPRU\DQGOLVWPDQDJHPHQW
O ,QLWLDOL]HVFKHGXOHU
O ,QLWLDOL]HYDULRXVSURFHVVHV
O ,QLWLDOL]H5[DQG7[EXIIHUVDQGEXIIHUGHVFULSWRUULQJVIRUFDEOH(WKHUQHWDQG86%LQWHUIDFHV
O 6WDUWVFKHGXOHU
8SRQFRPSOHWLRQRISODWIRUPDQGRSHUDWLQJHQYLURQPHQWLQLWLDOL]DWLRQLQLWLDOL]DWLRQFRQWLQXHVDWDV\VWHP
OHYHODVSHU0&16VSHFLILFDWLRQ>635),@DQGLVSHUIRUPHGODUJHO\E\WKH&DEOH0$&&RQWUROIXQFWLRQ
DQGWKH&DEOH0$&KDUGZDUHEXWDOVRLQFOXGHVSDUWLFLSDWLRQE\WKH'+&3IXQFWLRQDQGSRVVLEO\WKH
7)73IXQFWLRQ
6FDQDQG6\QFKURQL]H:LWK'RZQVWUHDP&KDQQHO
7KHILUVWVWHSLQWKH,QIR5DQJHULQLWLDOL]DWLRQLVWKHDFTXLVLWLRQRIDGRZQVWUHDPFKDQQHO,IWKH,QIR5DQJHU
KDVSUHYLRXVO\DFTXLUHGDGRZQVWUHDPFKDQQHOWKLVLQIRUPDWLRQPXVWEHVWRUHGLQQRQYRODWLOHPHPRU\
GHYLFHDQGWKH,QIR5DQJHUPXVWILUVWDWWHPSWWRUHDFTXLUHLWVSUHYLRXVO\XVHGFKDQQHO,IDFTXLVLWLRQRI
WKHSUHYLRXVO\XVHGFKDQQHOIDLOVRULIWKHUHLVQRSUHYLRXVRSHUDWLRQDOGDWDLQQRQYRODWLOHPHPRU\GHYLFH
WKH,QIR5DQJHUFRQWLQXDOO\VFDQWKHFKDQQHOVLQWKHGRZQVWUHDPIUHTXHQF\UDQJHXQWLOLWILQGVDYDOLG
GRZQVWUHDPVLJQDO
$GRZQVWUHDPFKDQQHOLVFRQVLGHUHGWREHYDOLGZKHQWKH,QIR5DQJHUKDVDFKLHYHG
O V\QFKURQL]DWLRQRI4$0V\PEROWLPLQJ3+<
O V\QFKURQL]DWLRQRI03(*VWUHDP3+<
O UHFRJQLWLRQRI6<1&0$&PHVVDJHV0$&
,QWKHHYHQWWKDWPRUHWKDQRQHGRZQVWUHDPVLJQDOLVSUHVHQWLQWKHV\VWHPWKH,QIR5DQJHUPXVWRSHUDWH
XVLQJWKHILUVWYDOLGGRZQVWUHDPVLJQDOWKDWLWHQFRXQWHUVZKHQVFDQQLQJ,IQHFHVVDU\WKH,QIR5DQJHULV
LQVWUXFWHGWRFKDQJHWRDGLIIHUHQWGRZQVWUHDPFKDQQHOYLDWKHRSWLRQDOSDUDPHWHUVILOH
2EWDLQ8SVWUHDP3DUDPHWHUV
$IWHUDFTXLULQJDGRZQVWUHDPFKDQQHOWKH,QIR5DQJHUZDLWVIRUDQ8SVWUHDP&KDQQHO'HVFULSWRU8&'
PHVVDJH7KLVW\SHRIPHVVDJHLVWUDQVPLWWHGSHULRGLFDOO\IURPWKH&076DQGLVDGGUHVVHGWRWKH0$&
EURDGFDVWDGGUHVV7KHUHLVDVHSDUDWH8&'WUDQVPLWWHGIRUHDFKDYDLODEOHXSVWUHDPFKDQQHO
7KH,QIR5DQJHUGHWHUPLQHVLIDSDUWLFXODUXSVWUHDPFKDQQHOLVVXLWDEOHEDVHGRQSDUDPHWHUVLQFOXGHGLQ
WKH8&'PHVVDJHHJPRGXODWLRQ 436.RU4$02QFHDVXLWDEOHXSVWUHDPFKDQQHOLVIRXQGWKH
,QIR5DQJHUH[WUDFWVWKHFKDQQHOSDUDPHWHUVIURPWKH8&'ZDLWVIRUWKHQH[W6<1&PHVVDJHDQGH[WUDFWV
WKHXSVWUHDPPLQLVORWWLPHVWDPS7KH,QIR5DQJHUWKHQZDLWVIRUDEDQGZLGWKDOORFDWLRQPHVVDJH0$3
IRUWKHVHOHFWHGXSVWUHDPFKDQQHOEHIRUHLWFDQSURFHHGZLWKWKHQH[WLQLWLDOL]DWLRQSURFHVV7KH
,QIR5DQJHUPD\EHLQVWUXFWHGWRFKDQJHWRDGLIIHUHQWXSVWUHDPFKDQQHOYLDWKHRSWLRQDOSDUDPHWHUVILOH
5DQJLQJ
7KHQH[WVWHSLQ,QIR5DQJHULQLWLDOL]DWLRQLVWKHUDQJLQJSURFHVVZKHUHWKH,QIR5DQJHUDFTXLUHVDWLPLQJ
RIIVHWVXFKWKDWLWVWUDQVPLVVLRQVDUHDOLJQHGFRUUHFWO\RQXSVWUHDPPLQLVORWERXQGDULHV7KLVUHODWHVWR
WKHGLVWDQFHRIWKH,QIR5DQJHUIURPWKH&076:KHQD0$3LVUHFHLYHGIRUWKHSDUWLFXODUXSVWUHDP
FKDQQHOWKDWWKH,QIR5DQJHUKDVVHOHFWHGIRUWUDQVPLVVLRQVLWVHQGVD5DQJLQJ5HTXHVW51*5(4
PHVVDJHLQWKHEURDGFDVW,QLWLDO0DLQWHQDQFHWLPHVORWVGHILQHGLQWKH0$37KH6,'XVHGDWWKLVWLPHLV
WKHRQHUHVHUYHGIRUQRQLQLWLDOL]HG,QIR5DQJHU7KH&076UHVSRQGVZLWKD5DQJLQJ5HVSRQVH51*563
PHVVDJHDGGUHVVHGVSHFLILFDOO\WRWKH,QIR5DQJHUE\PHDQVRIWKH,QIR5DQJHU0$&DGGUHVV7KHUHVSRQVH
FRQWDLQVLQIRUPDWLRQRQ5)SRZHUOHYHODGMXVWPHQWDQGWLPLQJRIIVHWFRUUHFWLRQVDVZHOODVDWHPSRUDU\
6,'WKDWWKH,QIR5DQJHUXVHVIRUWKHUHPDLQGHURIWKHLQLWLDOL]DWLRQSURFHVV7KH,QIR5DQJHUWKHQZDLWVIRU
D0$3PHVVDJHGHVFULELQJXQLFDVW6WDWLRQ0DLQWHQDQFHPLQLVORWVVSHFLILFWRWKHWHPSRUDU\6,'
$QRWKHU51*5(4PHVVDJHLVWUDQVPLWWHGLQWKRVHPLQLVORWVFRQWDLQLQJSRZHUOHYHODQGWLPLQJRIIVHW
FRUUHFWLRQV7KH&076UHVSRQGVZLWKDQRWKHU51*563PHVVDJHWRWKH,QIR5DQJHUZLWKDQ\DGGLWLRQDO
ILQHWXQLQJLQIRUPDWLRQUHTXLUHG,IWKLV51*563GRHVQRWFRQWDLQD5DQJLQJ6XFFHVVIXOQRWLILFDWLRQWKH
SURFHGXUHVWDUWVZLWKWKHXQLFDVW6WDWLRQ0DLQWHQDQFH51*5(4LHSURFHGXUHGRHVQRWUHSHDWIURPILUVW
51*5(4
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
5DQJLQJSDUDPHWHUHJWUDQVPLWSRZHUDGMXVWPHQWVKDYHWKHIROORZLQJUHVWULFWLRQV
O $OOSDUDPHWHUVPXVWEHZLWKLQDSSURYHGUDQJHDWDOOWLPHV
O 3RZHUDGMXVWPHQWPXVWVWDUWIURPWKHPLQLPXPYDOXHXQOHVVDYDOLGSRZHULVDYDLODEOHIURPQRQ
YRODWLOHVWRUDJHLQZKLFKFDVHWKLVYDOXHPXVWEHXVHGDVDVWDUWLQJYDOXH
O 3RZHUDGMXVWPHQWPXVWEHFDSDEOHRIEHLQJUHGXFHGRULQFUHDVHGLQUHVSRQVHWRD51*563PHVVDJH
O ,ISRZHULVDGMXVWHGWRPD[LPXPYDOXHLWPXVWZUDSEDFNWRPLQLPXPYDOXH
(VWDEOLVK,3&RQQHFWLYLW\
$WWKLVSRLQWWKH'+&3IXQFWLRQDWWHPSWVWRREWDLQDQ,3DGGUHVVIRUWKH,QIR5DQJHU,QDGGLWLRQWRDQ,3
DGGUHVVDQGRWKHU,3OD\HULQIRUPDWLRQWKH'+&3UHVSRQVHPXVWFRQWDLQWKHQDPHRIDILOHZKLFK
FRQWDLQVIXUWKHUFRQILJXUDWLRQSDUDPHWHUV
7KHIROORZLQJDUHUHTXLUHGLQWKH'+&3UHVSRQVH
O ,3DGGUHVVWREHXVHGE\WKH,QIR5DQJHU
O 6XEQHWPDVNWREHXVHGE\,QIR5DQJHU
O +DUGZDUHW\SHVKRXOGEHVHWWR(WKHUQHW
O *DWHZD\DGGUHVVLI'+&3VHUYHULVRQDGLIIHUHQWQHWZRUN
O 1DPHRIWKH,QIR5DQJHUFRQILJXUDWLRQILOHWREHREWDLQHGIURP7)73VHUYHUE\WKH,QIR5DQJHU
O 7LPHRIIVHWRIWKH,QIR5DQJHUIURP8QLYHUVDO&RRUGLQDWHG7LPHXVHGE\WKH,QIR5DQJHUWRFDOFXODWH
ORFDOWLPH
O $OLVWRI>5)&@WLPHVHUYHUVIURPZKLFKWKHFXUUHQWWLPHPD\EHREWDLQHG
O ,3DGGUHVVRIVHFXULW\VHUYHULIVHFXULW\LVUHTXLUHG
7UDQVIHU2SHUDWLRQDO3DUDPHWHUV
$IWHUWKH,3FRQQHFWLRQKDVEHHQFRPSOHWHGWKH,QIR5DQJHUPXVWGRZQORDGWKH,QIR5DQJHUFRQILJXUDWLRQ
ILOH7KLVLVDELQDU\ILOHLQWKHVDPHIRUPDWGHILQHGIRU'+&3YHQGRUH[WHQVLRQGDWDLQ5)&DQG
FRQWDLQVPDQGDWRU\DQGYHQGRUVSHFLILFRSWLRQV
3DUDPHWHUVLQFOXGH
O 'RZQVWUHDPIUHTXHQF\RSWLRQ
O 8SVWUHDPFKDQQHO,'RSWLRQ
O $XWKHQWLFDWLRQVWULQJRSWLRQDVSHU0&16VHFXULW\VSHFLILFDWLRQPD\QRORQJHUEHPDQGDWRU\
O 1HWZRUNDFFHVVRSWLRQ
O 4XDOLW\RIVHUYLFHRSWLRQ
O 0RGHPFDSDELOLWLHVRSWLRQ
O 9HQGRU,'RSWLRQ
O 7)73GRZQORDGVHUYHU
O 6RIWZDUHXSJUDGHILOHQDPH
5HJLVWUDWLRQ
2QFHWKH,QIR5DQJHUKDVREWDLQHGLWVRSWLRQDOSDUDPHWHUVLWFRQYH\VWKHVHSDUDPHWHUVWRWKH&076LQD
5HJLVWUDWLRQ5HTXHVW5(*5(4PHVVDJHWRZKLFKWKH&076UHSOLHVZLWKD5HJLVWUDWLRQ5HVSRQVH5(*
563PHVVDJHFRQWDLQLQJDSHUPDQHQW6,'
(QDEOH(WKHUQHW,QWHUIDFH
'XULQJWKHSUHYLRXVVWHSVWKH,QIR5DQJHUKROGVWKH(WKHUQHWLQDGLVDEOHGVWDWH2QFHWKHUHJLVWUDWLRQ
SURFHGXUHLVFRPSOHWHGDQGWKHQHWZRUNDFFHVVRSWLRQLQGLFDWHVWKDWWKH,QIR5DQJHUFDQDFFHVVWKH
QHWZRUNWKH(WKHUQHWLQWHUIDFHLVHQDEOHG7KHV\VWHPLVQRZLQLWLDOL]HGDQGGDWDWUDIILFPD\IORZLQERWK
WKHXSVWUHDPDQGGRZQVWUHDPGLUHFWLRQV
7KH6\VWHP,QLWLDOL]DWLRQIXQFWLRQDOXQLWFRPPXQLFDWHVZLWKWKHIROORZLQJIXQFWLRQDOXQLWV
O &DEOH0$&&RQWURO%DVHOLQH3ULYDF\
9 WRLQLWLDWHUDQJLQJUHJLVWUDWLRQSURFHGXUHV
O '+&3
9 WRLQLWLDWH'+&3SURFHGXUHRQFHXSVWUHDPDQGGRZQVWUHDPFKDQQHOVDUHDFTXLUHG
O 7)73
9 WRLQLWLDWHGRZQORDGRIRSWLRQDOSDUDPHWHUVILOH
%DVHOLQH3ULYDF\,QLWLDOL]DWLRQ
7KHEDVHOLQHSULYDF\IXQFWLRQDOXQLWH[FKDQJHVVHFXULW\PHVVDJHZLWKWKH&076WRVXSSRUWDVHFXULW\
V\VWHPWKDWLVSURSRVHGE\0&16%DVHOLQHSULYDF\LVGHVFULEHGLQWKH0&16%DVHOLQH3ULYDF\
6SHFLILFDWLRQ
7KH0&16EDVHOLQHSULYDF\SURWRFROXVHVVLQJOH'(6HQFU\SWLRQRQGDWDSD\ORDGVRQO\&DEOH0$&
PDQDJHPHQWPHVVDJHVDUHQRWHQFU\SWHG
7KHHQFU\SWLRQLVSHUIRUPHGXVLQJ'(6NH\VRQDSHUVHVVLRQEDVLV$VHUYLFHLVXQLTXHO\LGHQWLILHGE\D
6HUYLFH,GHQWLILHU6,'&DEOH0$&PDQDJHPHQWPHVVDJHVDUHQRWHQFU\SWHGQRUDUHDQ\FDEOH0$&
KHDGHUV(QFU\SWLRQNH\H[FKDQJHEHWZHHQ&076DQGWKH,QIR5DQJHULVDFFRPSOLVKHGXVLQJWKHSXEOLF
SULYDWH56$NH\H[FKDQJHPHFKDQLVP(QFU\SWLRQNH\VDUHELWVLQOHQJWKRURSWLRQDOO\ELWVLIH[SRUW
UHVWULFWLRQVDSSO\
(DFKVHVVLRQKDVWZRFRUUHVSRQGLQJVHPLVWDWLF'(6HQFU\SWLRQNH\VUHIHUUHGWRDVWKHRGGDQGHYHQNH\V
6LQFHWKHFXUUHQW0&160$&KHDGHUIRUGDWDGRHVQRWFRQWDLQD6,'ILHOGWKHH[WHQGHGKHDGHURSWLRQLV
UHTXLUHGWRVXSSRUWWKHSHUVHVVLRQFRQFHSWIRUHQFU\SWLRQLQERWKWKHGRZQVWUHDPDQGXSVWUHDP7KH
EDVHOLQHSULYDF\SURWRFROGHILQHVQHZH[WHQGHGKHDGHUW\SHVIRUWKLVSXUSRVH7KHVHFXULW\H[WHQGHG
KHDGHUFRQWDLQVSURWRFROYHUVLRQLQIRUPDWLRQWKH6,'DQGVWDWXVELWVLQGLFDWLQJZKHWKHUHQFU\SWLRQLV
HQDEOHGRUGLVDEOHGDQGZKLFKRIRGGRUHYHQNH\VKRXOGEHXVHGWRGHFRGHDJLYHQGDWD
7KH,QIR5DQJHUVXSSRUWVWKHDELOLW\WRYHULI\LWVYHUVLRQRIVRIWZDUHDJDLQVWWKHFXUUHQWO\VSHFLILHG
´FRUUHFWµYHUVLRQIRUWKHQHWZRUNGXULQJWKH,QIR5DQJHULQLWLDOL]DWLRQVHTXHQFHDQGWRGRZQORDGDQHZ
VRIWZDUHLPDJHLIQHFHVVDU\7KH7)73FRQILJXUDWLRQILOHSURYLGHVLQIRUPDWLRQDERXWWKHFXUUHQWVRIWZDUH
YHUVLRQ,IWKHYHUVLRQGRHVQRWPDWFKWKHFXUUHQWFRQILJXUDWLRQWKH,QIR5DQJHUDXWRPDWLFDOO\GRZQORDGV
WKHQHZVRIWZDUHYHUVLRQXVLQJWKHLQIRUPDWLRQSURYLGHGLQWKH7)73RSWLRQILOH7KHLQLWLDOL]DWLRQ
VHTXHQFHWDNHVDERXWVHFRQGVRUOHVV
&KDSWHU
,QVWDOOLQJWKH,QIR5DQJHU
7KH,QIR5DQJHULVFDSDEOHRIUHFRYHULQJDVRIWZDUHGRZQORDGWKDWIDLOVIRUDQ\UHDVRQHJQHWZRUNHUURUV
RUSRZHUIDLOXUHIURPIDLOLQJRYHUWRWKHODVWRSHUDWLRQDOFRS\RIV\VWHPVRIWZDUH7KHXQLWVWRUHVWZR
YHUVLRQVRIRSHUDWLRQDOVRIWZDUHSHUPLWWLQJDUHVWDUWZLWKWKHSUHYLRXVSURWHFWHGIDOOEDFNYHUVLRQRI
VRIWZDUHLQWKHHYHQWDVRIWZDUHGRZQORDGIDLOV7KHV\VWHPFRQILJXUDWLRQLVVWRUHGLQ195$0DQG
RSWLRQDOSDUDPHWHUVDUHREWDLQHGDVVSHFLILHGXQGHU0&16IURPD'+&37)73VHUYHU
7KH,QIR5DQJHUKDVDUHVHWVZLWFKWKDWUHLQLWLDOL]HVDXWKHQWLFDWHVDQGDXWKRUL]HVWKHPRGHPZLWKWKH
QHWZRUN7KLVVZLWFKSHUIRUPVWKHIXQFWLRQRISRZHUF\FOLQJWKH,QIR5DQJHU:KHQWKHVZLWFKLVSUHVVHG
WKHV\VWHPUHORDGVRIV\VWHPVRIWZDUHFRQILJXUDWLRQSDUDPHWHUVDQGVXEVHTXHQWDXWKHQWLFDWHVDQG
DXWKRUL]HZLWKWKHQHWZRUN
&KDSWHU 8VLQJ,QIR5DQJHU
7KLVFKDSWHUH[SODLQVIHDWXUHVRIWKH/('VDQGWKHFRQQHFWRUVRIWKH,QIR5DQJHU
)URQW9LHZ
7KHUHDUH/('LQGLFDWRUVRQWKHIURQWVLGHRIWKH,QIR5DQJHU
/('
5&9
61'
3&/('
)LJXUH )URQWYLHZRIWKH,QIR5DQJHU6&05DQG6&08
:KHQ\RXFRQQHFWWKHSRZHUDGDSWHUWRWKH,QIR5DQJHUDJUHHQOLJKWLVRQ
/('ILUVWDQGWKH,QIR5DQJHUSURFHVVHV6HOIGLDJQRVLVÎ,QLWLDOL]DWLRQIRUUHFHLYLQJÎ
,QLWLDOL]DWLRQIRUVHQGLQJÎ5HJLVWHULQJPRGHPDQG$XWKHQWLILFDWLQJVHUYLFHV:KLOHWKHVH
SURFHVVHVDUHUXQQLQJWKH5&9/('DQG61'/('EOLQNV:KHQWKLVSURFHVVLVFRPSOHWHDQGWKH
,QIR5DQJHURSHUDWHVQRUPDOO\WKH /('5&9/('DQG61'/('OLJKWDQGUHPDLQJUHHQDQG
3&/('VWDUWVEOLQNLQJ$IWHU\RXFRQQHFWWKH(WKHUQHWFDEOHWRWKH(WKHUQHWSRUWRI,QIR5DQJHU
WKH3&/('DOVRWXUQVRQVWHDG\JUHHQ
7KHVLPSOHPHDQLQJRIHDFK/('LVDVIROORZV
LED
Green
,QGLFDWHVWKDWWKHSRZHULVSURYLGHGWR,QIR5DQJHUQRUPDOO\
5&9
,QGLFDWHV,QIR5DQJHULVORFNHGLQLWLDOL]DWLRQSURFHVV5HFHLYLQJ'DWD
61'
,QGLFDWHV,QIR5DQJHULVORFNHGLQLWLDOL]DWLRQSURFHVV6HQGLQJ'DWD
3&
,QGLFDWHV(WKHUQHWOLQNVWDWXVLVILQH
&KDSWHU
8VLQJ,QIR5DQJHU
/('32:(5/('
9 :KHQWKHSRZHULVSURYLGHGWRWKH,QIR5DQJHU·VWKHJUHHQOLJKWWXUQVRQLQ /('7KH /('LV
WXUQHGRIIZKHQWKHSRZHULVQRWSURYLGHGWRWKH,QIR5DQJHU
Color
*UHHQ
Description
21
3RZHULVSURYLGHG
2))
1R3RZHU
5&9/('5(&(,9(/('
9 7KHJUHHQ5&9/('EOLQNVGXULQJPRGHPLQLWLDOL]DWLRQZKLFKPHDQVVFDQQLQJDGRZQVWUHDP
UHFHLYLQJFKDQQHO:KHQWKHVFDQQLQJLVFRPSOHWHWKHJUHHQ5&9/('UHPDLQVFRQWLQXRXVO\OLWDV
ORQJDVWKHPRGHPLVORFNHGRQWKHFKDQQHO7KH5&9/('LVWXUQHGRIIZKHQWKHPRGHPVWRSV
ZRUNLQJ7KHJUHHQ5&9/('EOLQNVIDVWO\WRLQGLFDWHWKHPRGHPLVUHFHLYLQJGDWDWKURXJKWKHFDEOH
QHWZRUN
Color
Description
21
*UHHQ
&KDQQHO/RFNHG
%OLQNLQJ
/RZVSHHG &KDQQHOVFDQQLQJ
)DVWVSHHG 5HFHLYLQJGDWD
61'/('6(1'/('
9 7KHJUHHQ61'/('EOLQNVGXULQJLQLWLDOL]DWLRQFKDQQHOUDQJLQJIRUWUDQVPLWWLQJGDWDXSVWUHDP
:KHQUDQJLQJLVFRPSOHWHWKHJUHHQ61'/('WXUQVJUHHQDQGUHPDLQVFRQWLQXRXVO\OLW7KH61'
/('LVWXUQHGRIIZKHQWKHPRGHPVWRSVZRUNLQJ7KHJUHHQ61'/('EOLQNLQJIDVWO\ZKHQWKH
PRGHPLVVHQGLQJGDWD
Color
Description
21
*UHHQ
5DQJLQJ/RFNHG
%OLQNLQJ
/RZ6SHHG &KDQQHOUDQJLQJ
)DVW6SHHG 6HQGLQJ'DWD
3&/('
9 7KH3&/('OLJKWVJUHHQDQGEOLQNVZKHQWKH,QIR5DQJHUFRPHVRQOLQHDQGWXUQVRQZKHQWKH(WKHUQHWOLQN
EHWZHHQWKH3&DQG,QIR5DQJHULVQRUPDO7KH3&/('WXUQVRIIZKHQWKH(WKHUQHWOLQNJRHVRIIOLQH
Color
*UHHQ
Description
%OLQNLQJ
2QOLQH
21
/LQN2.
2))
2IIOLQH
Misc.
(WKHUQHW86%/LQN
,IWKH61'/('5&9/('DQGWKH3&/('DUHRIIZKLOH\RXDUHXVLQJWKH,QIR5DQJHUFKHFNWR
VHHLIWKHFDEOHDQGWKH(WKHUQHWFDEOH86%FDEOHRQO\IRU,QIR5DQJHU6&08DUHQRW
FRQQHFWHGWRWKH&$%/(FRQQHFWRUDQG(WKHUQHWSRUW86%SRUWSURSHUO\
5HDU9LHZ
DC 12
V
'&,QSXW7HUPLQDO
5HVHW6ZLWFK
Reset
DC 12
V
Ether
net
(WKHUQHW3RUW
Reset
Ethern
et
86%3RUW
USB
USB
Cable
Cable
&DEOH&RQQHFWRU
)LJXUH 5HDU9LHZRIWKH,QIR5DQJHU6&08
&$%/(&RQQHFWRU
9 7KLVLVXVHGWRFRQQHFWWKHFRD[LDOFDEOHWRWKHFDEOHRXWOHWRUWKHFDEOHVSOLWWHU
5HVHW6ZLWFK
9 7KLVLVXVHGWRLQLWLDOL]HWKHPRGHP
(WKHUQHW3RUW
9 7KH,QIR5DQJHUVXSSRUWVXSWR0ESVWRGRZQORDGGDWDDQGDOVRXSWR0ESVWRXSORDGGDWDZLWK
WKLV(WKHUQHWSRUW7KLVSRUWLVFRQQHFWHGWRWKHQHWZRUNLQWHUIDFHFDUGLQVWDOOHGRQ3&RUDKXERUD
VZLWFKLILWLVFRQQHFWHGWRPXOWLSOH3&VXVLQJWKH(WKHUQHWFDEOH
86%3RUW2QO\IRU,QIR5DQJHU6&08
9 7KLVLVD86%SRUWZLWKVXSSRUWVXSWR0ESV7KLVSRUWLVFRQQHFWHGWRWKH86%SRUWRI3&
'&,QSXW7HUPLQDO
9 7KLVLVDQLQSXWWHUPLQDOZKLFKSURYLGHV'&9WRWKH,QIR5DQJHUWKURXJKWKHSRZHUDGDSWHU
&KDSWHU
8VLQJ,QIR5DQJHU
7KLVSDJHLVOHIWEODQNLQWHQWLRQDOO\
&KDSWHU 8VLQJ'LDJQRVWLFV3URJUDP
(TXLSPHQW3UHSDUDWLRQ
O 3&
O 7)736HUYHU3&RU:RUNVWDWLRQ
,PDJHILOH
%RRWURPILOH
O 56&FDEOHFRQQHFWRUIHPDOHWRPDOH'%
IRUFRQQHFWLQJD3&DQGWKH,QIR5DQJHU
O &RQVROHMLJERDUGSURYLGHGE\6DPVXQJ
O &RQVROHFDEOHSURYLGHGE\6DPVXQJ
IRUFRQQHFWLQJDFRQVROHMLJERDUGFRQQHFWRUDQGWKH,QIR5DQJHU
O (WKHUQHWFDEOHVWUDLJKWWKURXJKFURVVRYHU
FURVVRYHUFDEOHIRUFRQQHFWLQJDKXEDQGWKH,QIR5DQJHU
VWUDLJKWWKURXJKFDEOHIRUFRQQHFWLQJD7)736HUYHUDQGWKH,QIR5DQJHU
3&
7)736HUYHU
6WUDLJKWWKURXJK&DEOH
56&&DEOH
&URVVRYHU&DEOH
&RQVROH-LJ%RDUG
&RQVROH&DEOH
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
)XQFWLRQDO7HVW
6HW8S
&RQQHFWLQJ(TXLSPHQWV
2QFH\RXKDYHDOOHTXLSPHQWUHDG\FRQQHFWWKHPDFFRUGLQJWRWKHIROORZLQJLQVWUXFWLRQV
PC
RC
SND
V
TM
)LUVWJHWULGRIWKHVWDQGKROGHUXQGHUWKH,QIR5DQJHUWRGLVFRYHUDVPDOOEODFNUXEEHUFDS7DNHRXWWKH
UXEEHUFDSWRH[SRVHWKHSRUW3.HHSWKHUXEEHUFDSLQDVDIHSODFHEHFDXVH\RXQHHGLWDIWHUWKH
WHVW
PC
RCV
SND
TM
3OXJRQHHQGRIWKHFRQVROHFDEOHLQWRWKH3SLQFRQQHFWRUXQGHUWKH,QIR5DQJHUDQGWKHRWKHUWR
WKHSSLQFRQQHFWRURIWKHFRQVROHMLJERDUG
&RQQHFWWKH56&FDEOHWRWKHVHULDOFRQQHFWRU3RQWKHFRQVROHMLJERDUGDQGWRWKHVHULDOFRQQHFWRU
&20RU&20RIWKH3&
6HULDOFRQQHFWRU
PC
RCV
SND
TM
56FDEOH
6HWXS+\SHU7HUPLQDORI3&ZLWK
O %SV
O 'DWDELW
O 6WRSELW
O 3DULW\
1RQH
O )ORZFRQWURO 1RQH
&RQQHFWWKHSRZHUDGDSWHUWRWKH'&9FRQQHFWRURQWKH,QIR5DQJHU
56&&DEOH)HPDOHWRPDOH
Connector A
Connector B
SLQ
SLQ
SLQ
SLQ
SLQ
SLQ
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
6WDUWLQJ'LDJQRVWLF3URJUDP
$IWHUFRQQHFWLQJDOOWKHHTXLSPHQWUXQWKHGLDJQRVWLFSURJUDPE\GRLQJWKHIROORZLQJ
7KHIROORZLQJPHVVDJHVKRXOGDSSHDUPRPHQWDULO\RQWKH+\SHU7HUPLQDO3UHVVWKH>([email protected]\LQWKLV
VFUHHQ
'LDJQRVWLF6:IRU6&06HULHV9HU
6$0681*(/(&7521,&6
,QIRUPDWLRQ&RPPXQLFDWLRQ%XVLQHVV
1HWZRUN'LYLVLRQ%17JURXS
3UHVVDNH\WRVWDUWKDUGZDUHGLDJQRVWLFV
!!3UHVVWKH(QWHUNH\
7KHQWKHIROORZLQJPDLQPHQXRIWKHGLDJQRVWLFSURJUDPDSSHDUV
67$57
D 0HPRU\7HVW
E (WKHUQHW7HVW
F 0LVFHOODQHRXV7HVW
G &RRNLH
H &DEOH'RZQVWUHDP7HVW
I &DEOH8SVWUHDP7HVW
(6& ([LW
,QWURGXFWLRQWR'LDJQRVWLF3URJUDP0HQX
7KHPDLQPHQXRIWKH,QIR5DQJHUGLDJQRVWLFSURJUDPFRQVLVWVRIVL[GLIIHUHQWIXQFWLRQDOPHQXJURXSV(DFK
JURXSFRQWDLQVVXEPHQXVZKRVHIXQFWLRQVFDQEHVXPPDUL]HGDVIROORZV
O 0HPRU\7HVW'LDJQRVHWKHPHPRU\RQERDUG
O (WKHUQHW7HVW'LDJQRVHWKH(WKHUQHW
O 0LVFHOODQHRXV7HVW%OLQNWKH/('RIWKH,QIR5DQJHU
O &RRNLH'LVSOD\FRRNLHFRQWHQWDQGUHFRQILJXUH
O &DEOH'RZQVWUHDP7HVW7HVWWKHGRZQVWUHDPVWDWXV
O &DEOH8SVWUHDP7HVW7HVWWKHXSVWUHDPVWDWXV
8VLQJ'LDJQRVWLF3URJUDP
7KH,QIR5DQJHUGLDJQRVWLFSURJUDPLVDPHQXW\SHSURJUDPZKHUH\RXSUHVVWKHNH\FRUUHVSRQGLQJWRHDFK
PHQX7KHIROORZLQJLQVWUXFWLRQVDUHWKHEDVLFVRIXVLQJWKHPHQXW\SHGLDJQRVWLFSURJUDP
([HFXWLQJ0HQX
7RH[HFXWHDPHQXRUVXEPHQXHQWHUWKHOHWWHULQIURQWRIWKDWPHQXRQWKHNH\ERDUG
)RUH[DPSOHWRYLHZVXEPHQXVXQGHUWKH0HPRU\7HVWPHQXIURPWKHPDLQPHQXVFUHHQ\RXVKRXOG
HQWHU¶D·
5HWXUQLQJWR3DUHQW0HQX
7RUHWXUQWRDSDUHQWPHQXIURPDVXEPHQXSUHVV¶(VF·3UHVVLQJ¶(VF·RQWKHPDLQPHQXH[LWVWKH
GLDJQRVWLFSURJUDP
0HPRU\7HVW0HQX
7KH0HPRU\7HVWPHQXFRQVLVWVRIPHQXVWRGLDJQRVHPHPRU\RIWKH,QIR5DQJHU/HWXVILQGRXWKRZWR
XVHHDFKPHQX(QWHU¶D·IURPWKH67$57!PHQXWRVWDUW0HPRU\7(67
0HPRU\7(670(18
D )ODVK0HPRU\7HVW
E 6'5$00HPRU\7HVW
(6& ([LW
)ODVK0HPRU\7HVW
6WDUWWKH¶)ODVK0HPRU\7HVW·PHQXE\HQWHULQJ¶D·IURPWKH0HPRU\7(670(08!7KHQWKH)ODVK
7(6768%0(08!DSSHDUVLQWKHVFUHHQ
'HYLFHBLGLV&
,17(/)ZDVGHWHFWHG
)ODVK,'LV&
)ODVK7(6768%0(18
D
E
F
G
H
(6&
(UDVH)ODVK
:ULWH)ODVK
)ODVK,''HWHFW
'LVSOD\)ODVK
&RS\IURP)ODVKWR)ODVK
([LW
/HWXVYLHZWKHHDFKRIWKHVXEPHQX
'RQRWWHVWUHODWHGWR)ODVKPHPRU\ZRUNLQJLQWKH)LHOG7KHWDVNUHVXOWVLQHUDVLQJWKH
5XQQLQJ,PDJHVWRUHGLQWKH)ODVKPHPRU\<RXKDYHWRWDNHWKHWURXEOHWRGRZQORDGWKH
5XQQLQJ,PDJHIURPWKH7)73VHUYHULIWKH\DUHHUDVHG
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
(UDVH)ODVK
5XQWKH¶)ODVK(UDVH·PHQXE\HQWHULQJ¶D·IURPWKH)ODVK7(6768%0(18!PHQX7KLVIXQFWLRQ
HUDVHVDOOWKHGDWDVWRUHGLQWKH)ODVKPHPRU\
:KLOHWKH¶)ODVK(UDVH·LVUXQQLQJWKHSURFHVVLQJVWDWXVLVGLVSOD\HGLQWKHVFUHHQDVEHORZ7KH)ODVK
7(6768%0(18!UHDSSHDUVZKHQWKHWDVNLVFRPSOHWHG,IWKHH[HFXWLRQIDLOVWKHDGGUHVVDQGGDWD
ZKHUHWKHHUURURFFXUVDSSHDULQWKHVFUHHQ
6666666666 666((((((( (((((((((( (((((((((( (((((((((( (((((((((( (((6
3$66
)ODVK7(6768%0(18
D
E
F
G
H
(6&
(UDVH)ODVK
:ULWH)ODVK
)ODVK,''HWHFW
G'LVSOD\)ODVK
&RS\IURP)ODVKWR)ODVK
([LW
:ULWH)ODVK
5XQWKH¶:ULWH(UDVH·PHQXE\HQWHULQJ¶E·IURPWKH)ODVK7(6768%0(18!7KLVIXQFWLRQHUDVHVDOO
WKHGDWDVWRUHGLQWKH)ODVKPHPRU\DQGZULWHVWKHQHZGDWD
)ODVK:ULWLQJWDVNWDNHVWLPHEHFDXVHLWH[FXWHVHUDVLQJDQGZULWLQJFRQVHFXWLYHO\
:KLOHWKH¶:ULWH(UDVH·LVUXQQLQJWKHSURFHVVLQJVWDWXVLVGLVSOD\HGLQWKHVFUHHQDVEHORZ7KH)ODVK
7(6768%0(18!UHDSSHDUVZKHQWKHWDVNLVFRPSOHWHG,IWKHH[HFXWLRQIDLOVWKHDGGUHVVDQGGDWD
ZKHUHWKHHUURURFFXUVDSSHDULQWKHVFUHHQ
6666666666 666::::::: :::::::::: :::::::::: :::::::::: :::::::::: :::6
3$66
)ODVK7(6768%0(18
D
E
F
G
H
(6&
(UDVH)ODVK
:ULWH)ODVK
)ODVK,''HWHFW
'LVSOD\)ODVK
&RS\IURP)ODVKWR)ODVK
([LW
)ODVK,''HWHFW
5XQWKH¶)ODVK,''HWHFW·PHQXE\HQWHULQJ¶F·IURPWKH)ODVK7(6768%0(18!7KLVIXQFWLRQ
GLVSOD\VWKH,'RI)ODVKPHPRU\RQERDUG7KH)ODVK7(6768%0(18!UHDSSHDUVZKHQWKHWDVNLV
FRPSOHWHG
7KHVFUHHQEHORZVKRZVDQH[DPSOHWKDWD)ODVKPHPRU\RI,')LVGHWHFWHG
'HYLFHBLGLV&
,17(/)ZDVGHWHFWHG
)ODVK7(6768%0(18
D
E
F
G
H
(6&
(UDVH)ODVK
:ULWH)ODVK
)ODVK,''HWHFW
'LVSOD\)ODVK
&RS\IURP)ODVKWR)ODVK
([LW
'LVSOD\)ODVK
5XQWKH¶'LVSOD\)ODVK·PHQXE\HQWHULQJ¶G·IURPWKH)ODVK7(6768%0(18!PHQX7KLVIXQFWLRQ
VKRZVWKHGDWDVWRUHGLQWKH)ODVKPHPRU\
,QSXWWKH6WDUW$GGUHVV2IIVHWDQGOHQJWKRIWKHPHPRU\LQWKHILUVWSURPSWDVWKHH[DPSOHEHORZ,IWKH
6WDUW$GGUHVV2IIVHWLV[DVWKHH[DPSOHGDWDLVGLVSOD\HGIURPWKHUHDOVWDUWDGGUHVVRIWKHPHPRU\
[
>[email protected]>/[email protected][[
,QWKLVH[DPSOH\RXFDQVHHWKHGDWDVWRUHGLQWKHPHPRU\VWDUWLQJWKHDGGUHVV[[ORQJLQ
OHQJWK7KH)ODVK7(6768%0(18!UHDSSHDUVZKHQWKHWDVNLVFRPSOHWHG
>[email protected]>/[email protected][[
6XFFHVV
$
%
&
'
(
)
$
))
))
))
))
))
))
))
))
'
))
))
))
))
&
&
))
))
))
))
$
))
))
))
))
&
))
))
))
))
(
))
))
))
))
(
(
)
))
))
))
))
)'
)
))
))
))
))
))
))
))
))
'
))
))
))
))
))
'
))
))
))
))
$
))
))
))
))
))
))
))
))
))
($
&
))
))
))
))
))
))
))
))
))
))
))
))
))
))
))
))
&
))
))
))
))
))
))
))
))
))
))
))
&
))
))
))
))
))
)
))
))
))
))
))
))
&
))
))
))
))
))
'
))
))
))
))
))
'
))
))
))
))
))
))
$
))
))
))
))
))
))
))
))
))
))
(
))
))
))
))
))
(
))
))
))
))
))
)
))
))
))
))
))
)
))
))
))
))
))
'
(
))
))
))
))
))
(
))
))
))
))
))
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
6'5$00HPRU\7HVW
6WDUWWKH¶6'5$00HPRU\7(67·E\HQWHULQJ¶E·IURPWKH0HPRU\7(670(08!7KHQWKH6'5$0
7(6768%0(08!DSSHDUVLQWKHVFUHHQ
6'5$07(6768%0(18
D
E
F
(6&
7HVW6'5$0
5HDG6'5$0
:ULWH6'5$0
([LW
/HWXVYLHZWKHHDFKRIWKHVXEPHQX
7HVW6'5$0
5XQWKH¶7HVW6'5$0·PHQXE\HQWHULQJ¶D·IURPWKH6'5$07(6768%0(18!PHQX7KLVIXQFWLRQ
H[HFXWHVWKH6'5$0WHVW7KH6'5$07(6768%0(18!UHDSSHDUVZKHQWKHWHVWLVFRPSOHWHG
3333333333
3$66
3333333333
3$66
3333333333
3$66
3333333333
3$66
3333336666
6666666666
66
3333336666
6666666666
66
3333336666
6666666666
66
3333336666
6666666666
66
6'5$07(6768%0(18
D
E
F
(6&
7HVW6'5$0
5HDG6'5$0
:ULWH6'5$0
([LW
5HDG6'5$0
5XQWKH¶5HDG6'5$0·PHQXE\HQWHULQJ¶E·IURPWKH6'5$07(6768%0(18!PHQX7KLVIXQFWLRQ
VKRZVWKHGDWDVWRUHGLQWKH6'5$0
,QSXWWKHVWDUWDGGUHVVRIIVHWDQGOHQJWKRIWKHPHPRU\LQWKHILUVWSURPSWDVWKHH[DPSOHEHORZ,IWKH
6WDUW$GGUHVV2IIVHWLV[DVWKHH[DPSOHGDWDLVGLVSOD\HGIURPWKHUHDOVWDUWDGGUHVVRIWKHPHPRU\
[
>[email protected]>/[email protected][[
,QWKLVH[DPSOH\RXFDQVHHWKHGDWDVWRUHGLQWKHPHPRU\VWDUWLQJWKHDGGUHVV[[ORQJLQ
OHQJWK7KH6'5$07(6768%0(18!UHDSSHDUVZKHQWKHWDVNLVFRPSOHWHG
>[email protected]>/[email protected][[
$
%
&
'
(
)
6'5$07(6768%0(18
D
E
F
(6&
7HVW6'5$0
5HDG6'5$0
:ULWH6'5$0
([LW
:ULWH6'5$0
5XQWKH¶:ULWH6'5$0·PHQXE\HQWHULQJ¶F·IURPWKH6'5$07(6768%0(18!PHQX7KLVIXQFWLRQ
HUDVHVDOOWKHGDWDVWRUHGLQWKH6'5$0PHPRU\DQGZULWHVWKHQHZGDWD
,QSXWWKHVWDUWDGGUHVVRIIVHWYDOXHWRZULWHDQGOHQJWKRIWKHPHPRU\LQWKHILUVWSURPSWDVWKHH[DPSOH
EHORZ,IWKH6WDUW$GGUHVV2IIVHWLV[DVWKHH[DPSOHGDWDLVGLVSOD\HGIURPWKHUHDOVWDUWDGGUHVVRI
WKHPHPRU\[
>[email protected]>[email protected]>/[email protected][[$$[
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
,QWKLVH[DPSOH\RXFDQVHHWKHGDWDVWRUHGLQWKHPHPRU\VWDUWLQJWKHDGGUHVV[[ORQJLQ
OHQJWK:KHQWKHWHVWLVFRPSOHWHGDPHVVDJH¶:ULWLQJLVILQLVKHG·DSSHDUVDQGWKH6'5$07(6768%
0(18!UHDSSHDUVVXFFHVVLYHO\
>[email protected]>[email protected]>/[email protected][[$$[
:ULWLQJLVILQLVKHG
6'5$07(6768%0(18
D
E
F
(6&
7HVW6'5$0
5HDG6'5$0
:ULWH6'5$0
([LW
7RFKHFNWRVHHLIWKHZULWLQJSURFHVVLVGRQHVXFFHVVIXOO\HQWHU¶E·IURPWKH6'5$07(6768%
0(18!WRUXQ¶5HDG6'5$0·7KHVFUHHQEHORZLVDQH[DPSOHWRUXQ¶5HDG6'5$0·
>[email protected]>/[email protected][[
S0HPRU\PDOORFIDLOHGLQ)/$6+6<6
###PDOORFVXFFHVV
$$
$$
$$
6'5$07(6768%0(18
D 7HVW6'5$0
E 5HDG6'5$0
F :ULWH6'5$0
(6& ([LW
$$
$$
$$
$$
$$
$$
$$
$$ $$
$$ $$
$$ $$
(WKHUQHW7HVW0HQX
7KH(WKHUQHW7(670(18FRQVLVWVRIPHQXVWRGLDJQRVH(WKHUQHWSRUWRIWKH,QIR5DQJHU(QWHU¶E·IURP
WKH67$57!PHQXWRVWDUW¶(WKHUQHW7(670(18·/HWXVILQGRXWKRZWRXVHPHQX¶F··G··H··I·EHFDXVH
WKH\DUHXVHGPRUHIUHTXHQWO\
(WKHUQHW7(670(18
D
E
F
G
H
I
J
K
(6&
7[7HVW
5[7HVW
,QWHUQDO/RRSEDFN7HVWDW&38
,QWHUQDO/RRSEDFN7HVWDW0,,(3K\
([WHUQDO/RRSEDFN7HVWDW&DEOH
0,,(3K\UHJLVWHUUHDG
5HDG'DWD
5HDG&OXVWHU
([LW
,QWHUQDO/RRSEDFN7HVWDW&38
(QWHULQJ¶F·IURPWKH(WKHUQHW7(670(18!PHQXSHUIRUPVWKH¶,QWHUQDO/RRSEDFNWHVWDW&38·7KLV
IXQFWLRQWHVWVWKH/RRSEDFNDW&38DQGKDVQRWKLQJWRGRZLWKWKHH[WHUQDOSDWWHUQRI&38
,IWKHWHVWZDVVXFFHVVIXOWKHIROORZLQJPHVVDJHZLOOEHGLVSOD\HGDQGWKH(WKHUQHW7(670(18!
UHDSSHDUV
(0$&U[GBKZFDOORFVXFFHVV
(WKHUQHW/RRS%DFN7(673$66
(WKHUQHW7(670(18
D
E
F
G
H
I
J
K
(6&
7[7HVW
5[7HVW
,QWHUQDO/RRSEDFN7HVWDW&38
,QWHUQDO/RRSEDFN7HVWDW0,,(3K\
([WHUQDO/RRSEDFN7HVWDW&DEOH
0,,(3K\UHJLVWHUUHDG
5HDG'DWD
5HDG&OXVWHU
([LW
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
,QWHUQDO/RRSEDFN7HVWDW0,,(3K\
(QWHULQJ¶G·IURPWKH(WKHUQHW7(670(18!PHQXSHUIRUPVWKH¶,QWHUQDO/RRSEDFNWHVWDW0,,(3K\·
7KLVIXQFWLRQWHVWVWKH/RRSEDFNDWWKH(WKHUQHWFKLSDQGFKHFNVWKHVWDWXVEHWZHHQWKH&38DQG
(WKHUQHWFKLS
,IWKHWHVWZDVQRWVXFFHVVIXOWKHIROORZLQJ¶)$,/·PHVVDJHZLOOEHGLVSOD\HG,IWKHWHVWZDVVXFFHVVIXO
WKHIROORZLQJPHVVDJHZLOOEHGLVSOD\HGDQGWKH(WKHUQHW7(670(18!UHDSSHDUV
(0$&U[GBKZFDOORFVXFFHVV
(WKHUQHW0,,/RRS%DFN7(673$66
(WKHUQHW7(670(18
D
E
F
G
H
I
J
K
(6&
7[7HVW
5[7HVW
,QWHUQDO/RRSEDFN7HVWDW&38
,QWHUQDO/RRSEDFN7HVWDW0,,(3K\
([WHUQDO/RRSEDFN7HVWDW&DEOH
0,,(3K\UHJLVWHUUHDG
5HDG'DWD
5HDG&OXVWHU
([LW
([WHUQDO/RRSEDFN7HVWDW&DEOH
(QWHULQJ¶H·IURPWKH(WKHUQHW7(670(18!PHQXSHUIRUPVWKH¶([WHUQDO/RRSEDFNWHVWDW&DEOH·7KLV
IXQFWLRQWHVWVWKH/RRSEDFNDWWKH,QIR5DQJHUFRQQHFWRUDQGFKHFNVWKHVWDWXVEHWZHHQWKH&38DQGWKH
,QIR5DQJHUFRQQHFWRU
,IWKHWHVWZDVQRWVXFFHVVIXOWKHIROORZLQJ¶)$,/·PHVVDJHZLOOEHGLVSOD\HG,IWKHWHVWZDVVXFFHVVIXO
WKHIROORZLQJPHVVDJHZLOOEHGLVSOD\HGDQGWKH(WKHUQHW7(670(18!UHDSSHDUV
(0$&U[GBKZFDOORFVXFFHVV
(WKHUQHW(;7/RRS%DFN7(673$66
(WKHUQHW7(670(18
D
E
F
G
H
I
J
K
(6&
7[7HVW
5[7HVW
,QWHUQDO/RRSEDFN7HVWDW&38
,QWHUQDO/RRSEDFN7HVWDW0,,(3K\
([WHUQDO/RRSEDFN7HVWDW&DEOH
0,,(3K\UHJLVWHUUHDG
5HDG'DWD
5HDG&OXVWHU
([LW
0,,(3K\UHJLVWHUUHDG
(QWHULQJ¶I·IURPWKH(WKHUQHW7(670(18!PHQXSHUIRUPVWKH0,,(3K\UHJLVWHUUHDG7KLVIXQFWLRQ
UHDGVWKHUHJLVWHUGDWDLQWKH(WKHUQHWFKLS/;7DQGVKRZVWKHUHJLVWHUGDWD
,IWKHWHVWZDVVXFFHVVIXOWKHIROORZLQJPHVVDJHZLOOEHGLVSOD\HG
))))
)))
&
(
))))
)
(
))))
)))
)))
))))
))))
0LVFHOODQHRXV7HVW0HQX
(QWHU¶F·RQWKH67$57!PHQXDQGWKHQDJDLQHQWHU¶D·WRVHHWKHIRXU/('VRIWKH,QIR5DQJHUEOLQN
&RRNLH0HQX
(QWHU
G
RQWKH67$57!PHQXWRGLVSOD\WKH¶&RRNLHIXQFWLRQ·PHQXVKRZLQJWKHLQIRUPDWLRQRQWKH
FXUUHQWFRRNLH
7RFKDQJHWKHYDOXHVHQWHUWKHDOSKDEHWOHWWHULQIURQWRIHDFKPHQXRQWKHNH\ERDUG$IWHUSURJUDPPLQJ
SUHVV¶6·WRVDYHWKHQHZYDOXHV
FRRNLHIXQFWLRQ
$
%RRW9HUVLRQ1XPEHU
%
&
'
(
)
*
+
,
-
.
/
0
1
2
6
(6&
[))))))))
(0$&$GGUHVV
&0$&$GGUHVV
86%$GGUHVV
)'$(
)'$)
)'$
&06HULDO1XPEHU
+:9HUVLRQ0DMRU
+:9HUVLRQ0LQRU
Q
7XQHUW\SH
&3(7\SH
3URGXFWIRU
7(0,&[
(7+2QO\
$0(5,&$
6'3B9+)/RZ
6'3B9+)+LJK
6'3B8+)
XV8SK\2IIVHW
XV8SK\*DLQ
[&
[&
[&
[
[
6DYH1HZ&RRNLHWR)ODVK
5HUXHQWRSUHYLRXVPHQX
127&+$1*('
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
&DEOH'RZQVWUHDP7HVW0HQX
(QWHU¶H·IURPWKH67$57!PHQXWRVWDUW¶'RZQVWUHDP0DLQ0HQX·
'RZQVWUHDP0DLQ0HQX
D
E
F
(6&
5[6157HVW
5HDG'RZQVWUHDP5HJLVWHU
615
([LW
/HWXVILQGRXWKRZWRXVHHDFKPHQX
5[6157HVW
6WDUWWKH¶5[6157HVW·PHQXE\HQWHULQJ
D
RQWKH'RZQVWUHDP0DLQ0HQX!
:KHQWKHIROORZLQJPHVVDJHDSSHDUVHQWHUWKH'RZQVWUHDP)UHTXHQF\DQGSUHVV>([email protected]\
,QSXW)UHTXHQF\
7KH'RZQVWUHDP)UHTXHQF\LVVHWLQ8SFRQYHUWRUWKURXJKWKH+HDGHQG
1H[WFKRRVHD6\PERO5DWHEHWZHHQDQGDQGSUHVV>([email protected]
,QSXW6\PERO5DWH
,IWKH+HDGHQG'RZQVWUHDPLVVHWWR4$0VHOHFWDVD6\PERO5DWH,ILWLVVHWWR
4$0VHOHFWDVD6\PERO5DWH
:KHQWKHIUHTXHQF\DQGWKH6\PERO5DWHDUHQRUPDOWKHUHVXOWLVGLVSOD\HGDVLQWKHIROORZLQJ7KH
VFUHHQEHORZVKRZVDQH[DPSOHWKDWWKH'RZQVWUHDP)UHTXHQF\LVDQGWKH6\PERO5DWHLV
<RXFDQDOVRFKHFNWKH615YDOXH(612
'(02'/2&.('
75(//,6/2&.('
)(&/2&.('
03(*/2&.('
(612 'RZQVWUHDP0DLQ0HQX
D
E
F
(6&
5[6157HVW
5HDG'RZQVWUHDP5HJLVWHU
615
([LW
5HDG'RZQVWUHDP5HJLVWHU
5XQWKH¶5HDG'RZQVWUHDP5HJLVWHU·PHQXE\HQWHULQJ
E
RQWKH'RZQVWUHDP0DLQ0HQX!7KHGDWDLQ
WKHGRZQVWUHDPUHJLVWHULVGLVSOD\HG
$
$
%
%
&
&
'
'
(
(
&
(
%
&
)%
)
()
&
))
&
(
$
&
)
'
%
$
))
('
)
$
)
)
%
)
%
&
(
))
'
'
&
)(
))
'RZQVWUHDPPDLQ0HQX
D5[6157HVW
E5HDG'RZQVWUHDP5HJLVWHU
F615
(6&H[LW
615
5XQWKH¶615·PHQXE\HQWHULQJ
F
RQWKH'RZQVWUHDP0DLQ0HQX!<RXFDQFKHFNWKH615YDOXHZKLFK
LVVHWDFFRUGLQJWKH'RZQVWUHDP)UHTXHQF\DQGWKH6\PERO5DWHFRQILJXUHGLQ5[6157HVW
615 G%
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
&DEOH8SVWUHDP7HVW0HQX
(QWHU¶I·IURPWKH67$57!PHQXWRVWDUW¶8SVWUHDP0DLQ0HQX·
8SVWUHDP0DLQ0HQX
D 7[6LJQDO
E 5HDGXSVWUHDP5HJLVWHU
F 7[/HYHO&KDQJH
G 7[6\PERO&KDQJH
(6& ([LW
/HWXVILQGRXWKRZWRXVHHDFKPHQX
7[6LJQDO
6WDUWWKH¶7[6LJQDO·PHQXE\HQWHULQJ
D
RQWKH8SVWUHDP0DLQ0HQX!
:KHQWKHIROORZLQJPHVVDJHDSSHDUVHQWHUWKHXSVWUHDPIUHTXHQF\DQGSUHVV>([email protected]
VKRZVDQH[DPSOHWRHQWHUIUHTXHQF\
,QSXW)UHTXHQF\
,QSXWWKH8SVWUHDP)UHTXHQF\LQ+]IURP0+]WR0+]
6HFRQGFKRRVHD0RGXODWLRQ0RGHEHWZHHQ436.DQG4$0DQGSUHVV>([email protected]
EHORZVKRZVDQH[DPSOHWRFKRRVHPRGH
436.4$0
,QSXWPRGXODWLRQPRGH
436.PRGHLVVHOHFWHG
1H[WVHOHFWD6\PERO5DWHDPRQJDQGSUHVV>([email protected]
H[DPSOHWRFKRRVH
6\PERO5DWH
,QSXW6\PERO5DWH
6\PUDWHLVVHOHFWHG
)LQDOO\HQWHUDQ2XWSXW/HYHODQGSUHVV>([email protected][DPSOHWRHQWHUOHYHO
G%P9G%P9
,QSXWOHYHO
RXWSXWOHYHOLVG%P9
:KHQDOOWKHSDUDPHWHUVDUHHQWHUHGWKHUHVXOWLVGLVSOD\HGDVLQWKHIROORZLQJ
)UHTXHQF\²+]
2XWSXW3ZU/YO G%PYG%P9
0HDVXUHWKH,QIR5DQJHUVLJQDOSRZHUDQGFKHFNWRVHHLIWKHYDOXHLVQRUPDO
5HDG8SVWUHDP5HJLVWHU
5XQWKH¶5HDG8SVWUHDP5HJLVWHU·PHQXE\HQWHULQJ
E
RQWKH8SVWUHDP0DLQ0HQX!7KHGDWDLQWKH
XSVWUHDPUHJLVWHULVGLVSOD\HG
)
&
)&
%
)
&
8SVWUHDP0DLQ0HQX
D
E
F
G
(6&
7[6LJQDO
5HDGXSVWUHDP5HJLVWHU
7[/HYHO&KDQJH
7[6\PERO&KDQJH
([LW
7[/HYHO&KDQJH
5XQWKH¶7[/HYHO&KDQJH·PHQXE\HQWHULQJ
F
RQWKH8SVWUHDP0DLQ0HQX!<RXFDQFKDQJHWKHYDOXH
RI2XWSXW/HYHOHQWHUHGLQWKH¶7[6LJQDO·PHQX
6\PERO5DWH
,QSXW6\PERO5DWH
6\PUDWHLVVHOHFWHG
8SVWUHDP0DLQ0HQX
D
E
F
G
(6&
7[6LJQDO
5HDGXSVWUHDP5HJLVWHU
7[/HYHO&KDQJH
7[6\PERO&KDQJH
([LW
&KDSWHU
8VLQJ'LDJQRVWLFV3URJUDP
7[6\PERO&KDQJH
5XQWKH¶7[6\PERO&KDQJH·PHQXE\HQWHULQJ
G
RQWKH8SVWUHDP0DLQ0HQX!<RXFDQFKDQJHWKHYDOXH
RI6\PERO5DWHHQWHUHGLQWKH¶7[6LJQDO·PHQX
6\PERO5DWH
,QSXW6\PERO5DWH
6\PUDWHLVVHOHFWHG
8SVWUHDP0DLQ0HQX
D
E
F
G
(6&
7[6LJQDO
5HDGXSVWUHDP5HJLVWHU
7[/HYHO&KDQJH
7[6\PERO&KDQJH
([LW
&KDSWHU 8VLQJ0DQDJHPHQW&RPPDQGV
7KLVFKDSWHUGHVFULEHVWKHPDQDJHPHQWFRPPDQGVWKDWFDQEHXVHGWRWHVWDQGGHEXJWKH,QIR5DQJHU7KH
PDQDJHPHQWFRPPDQGVDUHQRWUHTXLUHGIRUEDVLF,QIR5DQJHURSHUDWLRQ
/LVWRI0DQDJHPHQW&RPPDQGV
7KHPDMRUPDQDJHPHQWFRPPDQGVDUHOLVWHGDVIROORZLQJ
Command
Description
See Page
PDF$GGU
'LVSOD\VWKH0$&DGGUHVV
FPDF0FDVW
'LVSOD\VWKHFRQWHQWVRIWKHKDVKILOWHUWDEOHDQGWKHFDEOH0$&PXOWLFDVW
XVE0FDVW
'LVSOD\VWKHFRQWHQWVRIWKH86%PXOWLFDVWWDEOH
VQPS6WDW
'LVSOD\VWKHVWDWLVWLFDOGDWDRI3&0$&6103
VKRZ%SL
'LVSOD\VWKH%3,3DUDPHWHUV
LI6KRZ
'LVSOD\VWKHLQIRUPDWLRQRIV\VWHPLQWHUIDFH
XQL6KRZ3&0$&
'LVSOD\VWKHXQLFDVWDGGUHVVWDEOHGDWDRI3&0$&
VGIFGI
FP6HW'V)UHTXHQF\
6HWWKHGRZQVWUHDPIUHTXHQF\
VKRZ8FG
'LVSOD\VWKH8&'LQIRUPDWLRQEHLQJXVHGSUHVHQWO\
XS6WDW
'LVSOD\VWKHXSVWUHDPFKDQQHOV
GPG6WDW
'LVSOD\VWKHSK\VLFDOVWDWXVRIGRZQVWUHDP
UHERRW
5HERRWWKHFDEOHPRGHP
pdfDggu
Synopsis
ERROPDF$GGU
Syntax
PDF$GGU
Description
7KLVFRPPDQGGLVSOD\VWKH0$&DGGUHVVEHLQJSUHVHQWO\XVHG
Parameter
1$
Return Value
Example
Æ PDF$GGU
0$&$GGUHVVIEGI
YDOXH [
&KDSWHU
8VLQJ0DQDJHPHQW&RPPDQGV
fpdfPfdvw
Synopsis
ERROFPDF0FDVW
Syntax
FPDF0FDVW
Description
7KLVFRPPDQGVKRZVWKHLQIRUPDWLRQRIWKHFDEOH0$&PXOWLFDVWWDEOHDQGKDVKILOWHU
WDEOH
Parameter
1$
Return Value
Example
ÆFPDF0FDVW
QXPEHURIHQWULHV
0XOWLFDVW7DEOH
+DVK7DEOH
IIIIIIII
IIIIIIII
IIIIIIII
IIIIIIII
IIIIIIII
IIIIIIII
IIIIIIII
IIIIIIII
YDOXH [
xvePfdvw
Synopsis
ERROXVE0FDVW
Syntax
XVE0FDVW
Description
7KLVFRPPDQGVKRZVWKHDGGUHVVHVRI86%PXOWLFDVWWDEOHDQGWKH86%0$&
Parameter
1$
Return Value
Example
ÆXVE0FDVW
QXPEHURIHQWULHV
0XOWLFDVW7DEOH
0$&$GGUHVVH
YDOXH [
vqpsVwdw
Synopsis
ERROVQPS6WDW
Syntax
VQPS6WDW
Description
7KLVFRPPDQGVKRZVWKHXSVWUHDPFKDQQHOLQIRUPDWLRQ
Parameter
1$
Return Value
Example
ÆVQPS6WDW
8SVWUHDP&KDQQHO,QIR
&KDQQHO,'
&KDQQHO)UHTXHQF\
&KDQQHO:LGWK
&KDQQHO0RG3URILOH
&KDQQHO6ORW6L]H
&KDQQHO7[7LPLQJ2IIVHW
&KDQQHO5QJ%DFNRII6WDUW
&KDQQHO5QJ%DFNRII(QG
&KDQQHO7[%DFNRII6WDUW
&KDQQHO7[%DFNRII(QG
0$&(QWU\*HW
75QJ5HVS7LPHRXW
&06WDWXV
/RVW6\QFV
,QYDOLG0DSV
&06HUYLFHV
6HUYLFH,'
4RV3URILOH
7[6ORW,PPHG
7[6ORWV'HG
7[5HWULHV
7[([FHHGHGV
5T5HWULHV
5T([FHHGHGV
YDOXH [
vkrzEsl
Synopsis
YRLGVKRZ%SL
Syntax
VKRZ%SL
Description
7KLVFRPPDQGVKRZVWKH%3,3DUDPHWHULQIRUPDWLRQ
Parameter
1$
Return Value
1$
Example
!VKRZ%SL
56$0RGXOXV.H\VL]H %3,2SHUDWLQJ0RGH %3,0RGH
8SVWUHDP(QFU\SWLRQ0RGH (QFU\SWHG
$XWK:DLW7LPHRXW
5H$XWK:DLW7LPHRXW
$XWKRUL]DWLRQ*UDFHWLPH
2SHUDWLRQDO:DLW7LPHRXW
5HNH\:DLW7LPHRXW
0D[LPXP&ORFN2IIVHW
$XWKRUL]H5HMHFW:DLW7LPHRXW
6$0DS:DLW7LPHRXW
6$0DS0D[5HWULHV
$FWLYH7(.6OLVW[
YDOXH [G &KDSWHU
8VLQJ0DQDJHPHQW&RPPDQGV
liVkrz
Synopsis
YRLGLI6KRZ
Syntax
LI6KRZ
Description
7KLVFRPPDQGVKRZVWKHV\VWHPLQWHUIDFHLQIRUPDWLRQ
Parameter
1$
Return Value
1$
Example
ÆLI6KRZ
PDFXQLWQXPEHU
)ODJV[83%52$'&$6708/7,&$67$535811,1*
7\SH(7+(51(7B&60$&'
,QWHUQHWDGGUHVV
%URDGFDVWDGGUHVV
1HWPDVN[II6XEQHWPDVN[IIIIII
(WKHUQHWDGGUHVVLVIEGI
0HWULFLV
0D[LPXP7UDQVIHU8QLWVL]HLV
SDFNHWVUHFHLYHGSDFNHWVVHQW
PXOWLFDVWSDFNHWVUHFHLYHG
PXOWLFDVWSDFNHWVVHQW
LQSXWHUURUVRXWSXWHUURUV
FROOLVLRQVGURSSHG
ORXQLWQXPEHU
)ODJV[83/223%$&.08/7,&$67$535811,1*
7\SH62)7:$5(B/223%$&.
,QWHUQHWDGGUHVV
1HWPDVN[II6XEQHWPDVN[II
0HWULFLV
0D[LPXP7UDQVIHU8QLWVL]HLV
SDFNHWVUHFHLYHGSDFNHWVVHQW
PXOWLFDVWSDFNHWVUHFHLYHG
PXOWLFDVWSDFNHWVVHQW
LQSXWHUURUVRXWSXWHUURUV
FROOLVLRQVGURSSHG
PDFXQLWQXPEHU
)ODJV[83%52$'&$6708/7,&$67$535811,1*
7\SH(7+(51(7B&60$&'
,QWHUQHWDGGUHVV
%URDGFDVWDGGUHVV
1HWPDVN[IIIIII6XEQHWPDVN[IIIIII
(WKHUQHWDGGUHVVLVIEGD
0HWULFLV
0D[LPXP7UDQVIHU8QLWVL]HLV
SDFNHWVUHFHLYHGSDFNHWVVHQW
PXOWLFDVWSDFNHWVUHFHLYHG
PXOWLFDVWSDFNHWVVHQW
LQSXWHUURUVRXWSXWHUURUV
FROOLVLRQVGURSSHG
PDFXQLWQXPEHU
)ODJV[83%52$'&$6708/7,&$67$535811,1*
7\SH(7+(51(7B&60$&'
,QWHUQHWDGGUHVV
%URDGFDVWDGGUHVV
1HWPDVN[IIIIII6XEQHWPDVN[IIIIII
xqlVkrzSFPDF
Synopsis
YRLGXQL6KRZ3&0$&
Syntax
XQL6KRZ3&0$&
Description
7KLVFRPPDQGVKRZVWKHXQLFDVWDGUHVVWDEOHGDWDRI3&0$&
Parameter
1$
Return Value
1$
Example
ÆXQL6KRZ3&0$&
(QWU\1XPEHU>([email protected]$&$GGUHVV
$GGU>@IEGI
$GGU>@GEE
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
$GGU>@
YDOXH [
vgi
Synopsis
YRLGVGI8,17I
Syntax
VGI I
Description
6HWWKHGRZQVWUHDPIUHTXHQF\
Parameter
ILVDQHZGRZQVWUHDPIUHTXHQF\
Return Value
1$
Example
ÆVGI
fgi#/#fpVhwGvIuhtxhqf|
Synopsis
YRLGFGI8,17IRUYRLGFP6HW'V)UHTXHQF\8,17I
Syntax
FGIIRUFP6HW'V)UHTXHQF\I
Description
6HWWKH'RZQVWUHDPIUHTXHQF\DQGGRHVQRWUHVHWWKH,QIR5DQJHU
Parameter
ILVDQHZGRZQVWUHDPIUHTXHQF\
Return Value
1$
Example
FGI
FP6HW'V)UHTXHQF\
&KDSWHU
8VLQJ0DQDJHPHQW&RPPDQGV
vkrzXfg
Synopsis
YRLGVKRZ8FG
Syntax
VKRZ8FG
Description
7KLVFRPPDQGVKRZVWKHLQIRUPDWLRQRI&08&'VHQWIURP&076
Parameter
1$
Return Value
1$
Example
ÆVKRZ8FG
$YDLODEOH8&,'V
&XUUHQW8SVWUHDP&KDQQHO3DUDPHWHUV
,'
'RZQVWUHDP,'
3RZHU
GEPY
)UHTXHQF\
+]
&KDQJH&RXQW
5HTXHVW6L]H
PLQLVORWV
0LQL6ORW6L]H([SRQHQW
6\PERO5DWH
NV\PVHF
3UHDPEOH/HQ
ELWV
3UHDPEOH3DWWHUQ
EEFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFI
FIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFI
FIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFI
FIFIFIFIFFHIFFHI
,8&W\SH5(48(679$/,'
0RGXODWLRQ
436.
'LIIHUHQWLDO(QFRGLQJ
2))
$FWLYH3UHDPEOH/HQJWK
ELWV
3UHDPEOH2IIVHW9DOXH
ELW
)(&7
2))
)(&&RGHZRUG/HQ
12786('
6FUDPEOHU6HHG
0D[%XUVW6L]H
PLQLVORWV
0D[%XUVW6L]H
E\WHV
0D[*XDUG7LPH6L]H
6\PEROWLPHV
/DVW&RGHZRUG/HQJWK
),;('
6FUDPEOHU
21
%\WHVPLQLVORW
,8&W\SH5(4'$7$0XOWLFDVW9$/,'
0RGXODWLRQ
81.12:1
'LIIHUHQWLDO(QFRGLQJ
81.12:1
$FWLYH3UHDPEOH/HQJWK
ELWV
3UHDPEOH2IIVHW9DOXH
ELW
)(&7
E\WHV
)(&&RGHZRUG/HQ
E\WHV
6FUDPEOHU6HHG
0D[%XUVW6L]H
PLQLVORWV
0D[%XUVW6L]H
E\WHV
0D[*XDUG7LPH6L]H
6\PEROWLPHV
/DVW&RGHZRUG/HQJWK
81.12:1
6FUDPEOHU
81.12:1
%\WHVPLQLVORW
,8&W\SH,1,7,$/0$,17(1$1&(9$/,'
0RGXODWLRQ
436.
'LIIHUHQWLDO(QFRGLQJ
2))
$FWLYH3UHDPEOH/HQJWK
ELWV
3UHDPEOH2IIVHW9DOXH
ELW
)(&7
E\WHV
)(&&RGHZRUG/HQ
E\WHV
6FUDPEOHU6HHG
0D[%XUVW6L]H
PLQLVORWV
0D[%XUVW6L]H
E\WHV
0D[*XDUG7LPH6L]H
6\PEROWLPHV
/DVW&RGHZRUG/HQJWK
),;('
6FUDPEOHU
21
%\WHVPLQLVORW
,8&W\SH67$7,210$,17(1$1&(9$/,'
0RGXODWLRQ
436.
'LIIHUHQWLDO(QFRGLQJ
2))
$FWLYH3UHDPEOH/HQJWK
ELWV
3UHDPEOH2IIVHW9DOXH
ELW
)(&7
E\WHV
)(&&RGHZRUG/HQ
E\WHV
6FUDPEOHU6HHG
0D[%XUVW6L]H
PLQLVORWV
0D[%XUVW6L]H
E\WHV
0D[*XDUG7LPH6L]H
6\PEROWLPHV
/DVW&RGHZRUG/HQJWK
),;('
6FUDPEOHU
21
%\WHVPLQLVORW
,8&W\SH6+257'$7$*5$179$/,'
0RGXODWLRQ
4$0
'LIIHUHQWLDO(QFRGLQJ
2))
$FWLYH3UHDPEOH/HQJWK
ELWV
3UHDPEOH2IIVHW9DOXH
ELW
)(&7
E\WHV
)(&&RGHZRUG/HQ
E\WHV
6FUDPEOHU6HHG
0D[%XUVW6L]H
PLQLVORWV
0D[%XUVW6L]H
E\WHV
0D[*XDUG7LPH6L]H
6\PEROWLPHV
/DVW&RGHZRUG/HQJWK
6+257(1('
6FUDPEOHU
21
%\WHVPLQLVORW
,8&W\SH/21*'$7$*5$179$/,'
0RGXODWLRQ
4$0
'LIIHUHQWLDO(QFRGLQJ
2))
$FWLYH3UHDPEOH/HQJWK
ELWV
3UHDPEOH2IIVHW9DOXH
ELW
)(&7
E\WHV
)(&&RGHZRUG/HQ
E\WHV
6FUDPEOHU6HHG
0D[%XUVW6L]H
PLQLVORWV
0D[%XUVW6L]H
E\WHV
0D[*XDUG7LPH6L]H
6\PEROWLPHV
/DVW&RGHZRUG/HQJWK
6+257(1('
6FUDPEOHU
21
%\WHVPLQLVORW
YDOXH [I
&KDSWHU
8VLQJ0DQDJHPHQW&RPPDQGV
xsVwdw
Synopsis
YRLGXS6WDW
Syntax
XS6WDW
Description
7KLVFRPPDQGVKRZVWKHXSVWUHDPFKDQQHOLQIRUPDWLRQ
Parameter
1$
Return Value
1$
Example
ÆXS6WDW
$YDLODEOH8&,'V
&XUUHQW8SVWUHDP&KDQQHO3DUDPHWHUV
,'
'RZQVWUHDP,'
3RZHU
GEPY
)UHTXHQF\
+]
&KDQJH&RXQW
5HTXHVW6L]H
PLQLVORWV
0LQL6ORW6L]H([SRQHQW
6\PERO5DWH
NV\PVHF
3UHDPEOH/HQ
ELWV
3UHDPEOH3DWWHUQ
EEFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFI
FIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFI
FIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFIFI
FIFIFIFIFFHIFFHI
YDOXH [
gpgVwdw
Synopsis
YRLGGPG6WDW
Syntax
GPG6WDW
Description
Wklv#frppdqg#vkrzv#wkh#sk|vlfdo#vwdwxv#ri#grzqvwuhdp
Parameter
1$
Return Value
1$
Example
ÆGPG6WDW
)UHTXHQF\
4$00RGH
,QWHUOHDYH'HSWK
6SHF,QYHUVLRQ
(V1R
562XW2I6\QF&RXQW
YDOXH [
1R
uherrw
Synopsis
YRLGUHERRW
Syntax
UHERRW
Description
Wklv#frppdqg#uherrwv#wkh#fdeoh#prghp
Parameter
1$
Return Value
1$
Example
ÆUHERRW
&KDSWHU
8VLQJ0DQDJHPHQW&RPPDQGV
7KLVSDJHLVOHIWEODQNLQWHQWLRQDOO\
7-1
Chapter 7 Structure of the InfoRanger
Introduction
InfoRanger is a user terminal within Cable Modem System that consists of ISP (Internet Service Provider),
Internet network, Headend, HFC network, InfoRanger, and PC, which receives ISP-provided Internet service
through Headend into PC to display (figure 7-1). InfoRanger also send signals to Headend (upstream), so a
two-way communication takes place between Headend and InfoRanger.
Internet Network
PC
PC
InfoRanger
InfoRanger
Headend
ISP
Figure 7-1
HFC net
InfoRanger
InfoRanger
PC
PC
Cable Modem System
While the existing phone line modem uses baseband phone line (Up to 30 KHz), InfoRanger, by using
broadband HFC network (Up to 1 GHz), realizes high data transmission rate ( Up to 40 Mbps for download,
up to 5 Mbps for upload).
InfoRanger consists of cable interface, microprocessor memory, Ethernet interface and circuits. This chapter
explains the signal streams sent to each part and the roles of each element.
7-2
Chapter 7
Structure of the InfoRanger
Cable Interface
Introduction
First, let’s have a brief look at the signal methods of downstream (receiving signal) and upstream (sending
signal).
Downstream (Receiving Signal)
1. RF signal: The Input downstream signal into InfoRanger is QAM converted (64-QAM/256-QAM) RF signal
whose Center Frequency is between 90 and 858MHz and its bandwidth 6 MHz.
2. IF signal: This RF signal is inputted through F-connector of tuner, then down converted in the tuner to be
IF signal whose center frequency of 43.75MHz and bandwidth of 6 MHz.
3. Secondary amplification: After going through SAW (Surface Acoustic Wave) filter, the converted IF signal
is authorized for uPC2798 with the built- in Down Converter/AGC Amp to be amplified to become
center frequency of 43.75MHz and bandwidth of 6 MHz.
4. Authorized as CN9414 IC: The amplified secondary IF signal, after going through DS filter, is inputted to
CN9414 IC with the built-in 64/256 QAM receiver.
Upstream (Sending Signal)
1. Data Occurrence: Upstream digital data occurred in the microprocessor inside the CN9414 is converted to
QPSK/16-QAM analog signal with center frequency of 5 ~42 MHz and bandwidth of 200K ~3.2 MHz.
2. Signal Conversion: The converted signal, after going through BPF in 5 M ~ 42 MHz, is inputted as
programmable power amp MAX3510.
3. Output for Cable: First the input signal is output with appropriate power level in MAX3510. Second, it
goes through BPF. Finally, it is output for the cable through the F-connector of the tuner.
The following displays briefly the signal streams in the cable interface part.
Downstream
90~858 MHz
RF
TRNER
SAW
AGC/
Down conv
LPF
RF AGC
frequency control
MPU/MAC/PHY/CN9414
MEMORY
DIPLEXER
10base-T
Ethernet
Transceiver
Power control
BPF
5~42 MHz
Amplifier
RJ45 IF
BPF
(Anti-aliasing filter)
Upstream
Figure 7-2 Cable Interface Part Block Diagram
7-3
Downstream
Tuner (4737PY5)
IF Signal Conversion
In order to convert input RF signal with center frequency of fc (90<fc<860MHz) into IF signal with center
frequency of43.75MHz, I2C Bus Line (Data, Clock) is put into SDA (#10), SCL (#9) terminals in the tuner
from RF_SDA (#C5), RF_SCL (#A5) terminals of CN9414, respectively. CN9414 has the tuning frequency
information.
The following is the timing diagram of I2C Bus interface.
Figure 7-3 Tuner Control Signal Timing diagram
Also, control signal on tuner AGC comes out of AGC_RF (#D3) of CN9414 to be converted into a 3.6V DC
value in a circuit composed of R124, C147, R422, C407 and U404. Then, the converted signal is put into AGC
(#5) of the tuner. Here, the control signal is a PWM (Pulse Width Modulation) signal and the larger the Duty
Cycle, the bigger the DC value that the control signal is converted into.
DC-DC Converter
Composed of U802 (TK11819), L807, L808, C821, C822, C823, C824 and R809, DC-DC converter generates
33V DC for the tuner from 5V power. The voltage is put into 33V (#7) terminal of the tuner.
Down converter/AGC Amp (uPC2798)
IF signal input
IF signal that is put out through IF_OUT (#12, #13) terminals of the tuner, after going through SAW filter
(X6964M100) and built-in R414, R415, C411, C412 and R401 for Impedance Matching, is authorized for
AGC_IN1, AGC_IN2 (#1, #2) terminals in Down-Converter/AGC Amp (uPC2798).
Here, the IF signal is sent in Differential Mode along the two lines in order to reduce the effect of the
Common Mode Noise in each line.
IF Signal Amplification
Input IF signal is amplified through AGC Amp within uPC2798. Then, the control signal that comes out of
AGC_IF(#C2) terminal in CN9414 goes through LPF composed of R123, C162, R402, C413, R403, and R404 to
be filtered as DC value and finally be put into VAGC (#3) terminal in uPC2798 for controlling the degree of
amplification.
IF Signal Output
The secondary IF signal identical to the first IF signal is filtered through LPF composed of C418, R407, C419,
L403, L404, L405, C421, C422, C423, and L407, and again goes through the amplifier within the IC before it is
put out through OUT1, OUT2 (#12, #11) terminals of uPC2798. The output secondary IF signal is put into
+IF_OUT, -IF_OUT (#H1, #G1) terminals of CN9414 through R412, R413, C429, C431 and C430.
7-4
Chapter 7
Structure of the InfoRanger
DC-DC Converter
DC-DC converter, composed of U403, C434, and C435, generates 9V DC for AGC amplification inside
uPC2798 from 12V power. The generated power is put into VCC2(#13) terminal of uPC2798.
100MHz Clock
100 MHz(120MHz) clock needed in CN9414 is generated in Crystal (Y101), C102, C103, C104 and L101, and
then put into XTI,XTO (#J1,#K1) terminals.
Dual AGC Operatrions
As shown in the Fig. 2 (Downstream Block Picture), the downstream circuit composed of tuner (4737PY5),
SAW filter (X6964M), down converter/AGC Amp (uPC2798), Cable MAC/PHY (CN9414) is in dual AGC
loop.
Measuring AGC Control Voltage (AGC (#5), uPC2798 VAGC (#3) of the tuner) according to input signal
level reveals that the tuner AGC works as critical control signal for stronger input signals while uPC2798
AGC works as major control signal for weaker ones. Therefore, for the entire input signal level, a linear AGC
control is in the works through Dual AGC Operations.
64-QAM
256-QAM
Input Signal Level
(dBmV)
Tuner AGC Input
Voltage (Volt)
uPC2798 AGC
Input Voltage (Volt)
Tuner AGC Input
Voltage (Volt)
uPC2798 AGC
Input Voltage (Volt)
+20
1.52
1.18
1.53
1.18
+15
1.65
1.18
1.72
1.18
+10
2.06
1.18
2.08
1.18
+5
2.53
1.18
2.55
1.18
0
2.71
1.18
2.71
1.18
-5
2.94
1.18
2.93
1.18
-10
3.65
1.19
3.61
1.18
-15
3.65
1.32
3.65
1.31
-20
3.65
1.40
3.65
1.39
Table 7-1 AGC Control Voltage Chnges according to Input Signal Level
7-5
Upstream
As shown in Figure 7-2, upstream is composed of Cable MAC/PHY (CN9414), OP Amp Driver (MAX3510)
and other peripheral circuits.
BPF(Anti-alias Filter)
The output Analog converted upstream signal through +TX_IN, -TX_IN (#T1, #R1) terminals of CN9414,
goes in the Differential Mode. It goes through BPF that passes signals in 5~42MHz only.
Composed of C807, L803, C808, R804, R805, R806, R807, C804, C805, L801, L802, L804 and L805, BPF filters
out the Harmonics and the signal noise from CN9414.
Power Amp (MAX3510)
The three signals (TXASEL, TX_SDA,TX_SCL) for controlling upstream power is transmitted from CN9414
IC to MAX3510 IC. How the three signals are combined determines the level satisfying DOCSIS SPEC
between 8dBmV and 58dBmV.
1. Input : Upstream signal comes out of CN9414 to go through the first BPF is put into +VIN (#5), -VIN (#6)
terminals of MAX3510.
2. Output : Input signal goes through PGA (Programmable-Gain Amplifier) inside the ARA05050 and is
put out of +VOUT (#16), -VOUT (#15) terminals. Output signal from +VOUT, -VOUT terminals
is processed impedance matching as 300ohm and becomes Single-ended signal with impedance
matching of 75ohm as it goes through the transformer (T801) with voltage ratio of 2 to 1.
Cable MAC/PHY (CN9414)
CN9414 is an integrated IC of four features: 64/256 QAM receiver with downstream PHY function,
QPSK/16 QAM Transmitter with upstream PHY function, Cable MAC and microprocessor.
64/256 QAM Receiver
Downstream signal in Differential Mode that is put into +IF_OUT, -IF_OUT (#H1, #G1) terminals of CN9414
first goes through the following steps.
1. amplified by PGA(Programmable Gain Amplifier)
2. converted to digital by 10-Bit A/D converter
3. demodulated as digital data after going through QAM Demodulator
First, digital signal processes such as phase recovery and adaptive equalizer are done on the demodulated
digital data. Then, as it goes through FEC (Forward Error Correction) such as Trellis, Decoding,
Deinterleaving, and Reed-Solomon decoding, it is converted into the original Serial digital data with errors
corrected. The corrected data is finally sent to cable MAC.
16 QAM/QPSK Transmitter
Upstream data that has been through Cable MAC of CN9414 is sent to the upstream transmitter part.
The transmitted data will in for channel coding such as Randomizing, Reed-Solomon encoding to recover
the errors generated during the transmission. And then, it is converted into digital QAM data by the
processes such as Pre-Equalizing, Pulse Shaping, Interpolation, and QAM modulation.
The modulated data is converted into analog data by D/A converter inside the CN9414 to be put out
through +TX_IN, -TX_IN (#T1, #R1) terminals in the Differential Mode.
Cable MAC
This is where MAC algorithm is realized to enable multiple users to communicate in the cable network.
This extracts MAC frame from downstream data to store in SRAM and transmits it to the transmitter part of
an authorized time slot after the upstream data stored in SRAM is made as MAC frame.
7-6
Chapter 7
Structure of the InfoRanger
Microprocessor and Momory Interface
Microprocessor and memory interface part consists of a memory device, Ethernet and a microprocessor
(CN9414) that controls the entire operation by Operation Code. See the following diagram.
Power
+5.0Va
+5.0V
+3.3V
+3.3Va
+2.5v
SDRAM
1x16bitx4bank
Flash
2Mx16bit
ETX
Tx Control
Ethernet
Tranceiver
LXT972
Ethernet
ERX
RF part
Tuner
RF Control
CPU
CN9414
USB
AGC
RS 232
Figure 7-4 SCM120R Board Block Diagram (CN9414 solution)
Microprocessor(CN9414)
Configuration
There are two 32 Bit RISC processors in CN9414. As shown in Figure 7-5, the processor consists of memory
related modules and peripheral modules.
The following is a brief description of critical modules to the circuit and their function.
- The Two 32-bit RISC microprocessors operating in100MHz, 120MHz internal clock, respectively.
(35.84MHz for external clock)
- SRAM internal memory
- Timer, Clock pulse generator (Watchdog timer, Interrupt)
- Host interface for external memory access (Address decoding, Wait state generation)
- SDRAM Interface (RAS, CAS signals)
- DMA Controller
- Ethernet PHY
- Cable MAC
- Cable PHY
- Serial Interface (UART)
7-7
Figure 7-5 CN9414 Block Diagram
Interrupt
ARM has two interrupts FIQ and IRQ. FIQ interrupt has a higher priority over IRQ interrupt. In the circuit,
there is no interrupt generated by external hardware.
Apart from FIQ and IRQ, there are two additional internal interrupts as follows.
- Software watchdog and other timers (internal interrupt)
- UART (internal interrupt)
7-8
Chapter 7
Structure of the InfoRanger
Host Interface
ARM, with built-in host interface, manages external memory access. CN9414 has a direct access to eight flash
memories and other memory devices using host interface controller. The memories used through the host
interface of InfoRanger are flash ones.
Flash memories are allocated for CS0 (HCS0) and the interface can be set as either 8 bit or 16bit. The interface
range is determined by HSEL Pin (W10) in CPU. For InfoRanger that its HSEL pin is set as "Low", the
interface is 16bit. CN9414 is connectable for up to 4Mbyte.
Though rarely the case currently, InfoRanger can use PROM, NVRAM or peripheral elements in
proper parts.
The following table shows the source and Chip Select Signal available for CN9414.
AREA
ADDRESS
DEVICE
DATA WIDTH
USE
0
0x0040_0000
0x007F_FFFF
Flash memory($Mbyte)
16bit
/HCS[0]
1
0x0020_0000
0x0023_FFFF
256Kbyte
space
/HCS[1]
2
0x0024_0000
0x0027_FFFF
256Kbyte
space
/HCS[2]
3
0x0028_0000
0x0028_FFFF
64Kbyte
space
/HCS[3]
4
0x0029_0000
0x0029_FFFF
64Kbyte
space
/HCS[4]
5
0x002A_0000
0x002A_FFFF
64Kbyte
space
/HCS[5]
6
0x002B_0000
0x002B_FFFF
64Kbyte
space
/HCS[6]
7
0x002C_0000
0x002C_FFFF
64Kbyte
space
/HCS[7]
8
0x002D_0000
0x002F_FFFF
192Kbyte
Table 7-2
Reserved for ASB Registers
Memory Map
SDRAM Controller
There is an XMAC (eXpansion Memory Acess Controller) inside ARM, which works as SDRM for up to
8Mbyte SDARM and 16bit interface. Here, SDRAM is driven as 100MHz.
The available SDRAM configuration is following:
Total
Memory
Memory
Configuration
# SDRAMs
SDRAM
Configuration
SDRAM
Capacity
SDRAM #
Banks
SDRAM #
Rows
SDRAM #
Cols
2MB
1M x 16
1
1M x 16
16Mb
2
2K
256
4MB
2M x 16
2
2M x 8
16Mb
2
2K
512
8MB
4M x 16
1
4M x 16
64Mb
4
4K
256
Table 7-3 SDARM Configuration
7-9
Internal Memory and Memory MAP
There are Internal memory (SRAM) and Register inside ARM, and their address allocation is as follows.
AREA
1
2
ADDRESS
0x0000 0000
0x0000 001F
0x0000 0020
0x000F FFFF
0x0010 0000
0x0010 001F
0x0010 0020
0x0011 FFFF
DEVICE
DATA
WIDTH
32
USE
Read Only Memory
Descriptions
ARM #1 Vector table
ROM/FLASH
32
ROM/FLASH
32
ARM #2 Vector table
(Internal)
32
ARM #2 Instruction
Memory (Internal)
24K*32 SRAM(AIM)
3
0x0014 0000
0x0014 FFFF
16K*32 SRAM(ADM)
32
ARM #2 Data
Memory (Internal)
4
0x0018 0000
0x0018 7FFF
8K*32 SRAM
32
ASB SRAM(Internal)
0x0020 0000
0x0023 FFFF
EPROM(256Kbyte)
space
/HCS[1]
0x0024 0000
0x0027 FFFF
EPROM(256Kbyte)
space
/HCS[2]
0x0028 0000
0x0028 FFFF
64Kbyte
space
/HCS[3]
0x0029 0000
0x0029 FFFF
64Kbyte
space
/HCS[4]
0x002A 0000
0x002A FFFF
64Kbyte
space
/HCS[5]
0x002B 0000
0x002B FFFF
64Kbyte
space
/HCS[6]
0x002C 0000
0x002C FFFF
64Kbyte
space
/HCS[7]
0x002D 0000
0x002F FFFF
192Kbyte
64
5
6
Reserved for ASB
Registers
0x0030 0000
0x0030 0070
32bit
Reserved for internal
DMA Controller Registers
0x0031 0000
0x0031 0023
32bit
Reserved for internal
Cable MAC Registers
0x0032 0000
0x0032 0023
64, 32, 16
Reserved for internal
Ethernet MAC Registers
0x0033 0000
0x0033 0023
64, 32, 16
Reserved for internal
USB Registers
0x0034 0000
0x0034 0028
8.32bit
Reserved for internal
DES#1
0x0036 0000
0x0036 0007
32bit
0x0035 0010
0x0037 000c
0x0038 0000
0x0038 0028
Reserved as Cable PHY
Register Interface
Reserved for internal
Miscellaneous Registers
8.32bit
Host Mast-mode
Peripherals I/F
Reserved for internal
DES#2
APB Bridge
dword access only
7-10
Chapter 7
Structure of the InfoRanger
AREA
ADDRESS
DEVICE
7
0x0040_0000
0x007F_FFFF
8
0x0080 0000
0x00FF FFFF
DATA
WIDTH
USE
16bit
/HCS[0]
Host Master mode
Flash Interface
SDRAM
External DRAM
Interface
Descriptions
Table 7-4 Memory MAP
Clock Pulse Generator
InfoRanger requires Clock Sources, which are set as follows.
y CPU : 35.8MHz or 46.8MHz crystal (for CN9414)- determined by the pin A10 in CPU.
- H : 46.8MHz
- L : 35.8MHz
y Ethernet tranceiver : 25 MHz (from CPU (all pins) Ethernet tranceiver (pin 1))
y SDRAM (KM416S4030CT-F8) : 100 MHz (from CPU (pin M18) SDRAM (pin 38))
y USB : 60MHz
y Upstream : 143.36MHz
y Downstream : 45.84MHz
Clock
Reference
Source
FCLK
XFCK
Typ
Freq(MHz)
PLL
Frequency
Oper
Output
frequency
45.84MHz
120MHz
Fout=Fx*M.N
Programmable
45.84MHz
60MHz
Fout/2
45.84MHz
100MHz
Fout=Fx*M.N
45.84MHz
50MHz
Fout/2
APB Bus Clock
Cable Upstream
D/A Clk
Crystal
UCLK
XBCK
Reference
Freq(MHz)
BCLK
PCLK
Crystal
Description
ARM940T fast
clock in
USB timing
reference
Programmable
ASB Bus Clock
CUCK
Crystal
45.84MHz
143.36MHz
Fout=4*Fs
CDUK
Crystal
45.84MHz
35.84MHz
N/A
Cable
Downstream
Clock
EPCLK
BCLK
100MHz
25MHz
N/A
Ethernet Phy
Clock
Table 7-5 Clock Sources
PLL
CPU has three built-in PLLs. One is used for the analog part while other two are for digital.
- Analog PLL :
when PLL is used for analog, four-fold frequency of the input (crystal) frequency is in use.
- Digital PLL :
the two remaining PLLs used for digital are adjusted as program through the internal register.
The InfoRanger part is used as 120MHz and 100MHz.
7-11
CPU Pin E1
CPU Pin E1 (PLLtst) is used to determine at hardware level whether to bypass PLL part in CPU. When the
pin is in ‘H’, PLL part is bypassed and then pin TBUCK (pin M1) is used to drive the analog part.
The function can be controlled at software level using a software bit, BYPASS_PLL. When controlling at
software, set PLLtst and TBUCK as 'L'.
CPU Pin B10
When CPU pin B10 (XPB) is in ‘H’, PLL is bypassed, so XFCK(pin C10) and XBCK are used as input.
When the pin is in ‘L’, XFCK (pin C10), XBCK are used as output.
CPU Pin A11
CPU pin A11(XBCK) is used as system clock input in PLL mode while it is used as Ethernet mast clock out
put in normal mode.
Cable Media Access Controller Interface
CN9414 has Cable MAC, Cable PHY and others. Cable PHY is divided into downstream and upstream.
y Downstream: Downstream sends signal that is modulated and encoded in Headend equipment. The
modulated signal is sent to cable MAC after it is demodulated and decoded in the user cable modem.
y Upstream: Upstream modulates and encodes signal to send to cable Headend equipment.
Downstream part is composed of as follows.
y A/D Converter
y Demodulator
y Forward Error correction
- Trellis Decoder
- Differential Decoder
- FEC Frame Synchronizer
- Derandomizer
- Deinterleaver
- Reed-Solomon Decoder Error Detection
- MPEG Transport Packet Synchronizer
y Clock smoother
Upstream part is composed of as follows.
y Modulator
- Preamble
- Reed-Solomon Encoder
- Scrambler, Bit-to-symbol Mapper
- Differential Encoder
- FIR and interpolation filters, Barrel shifter, and Quadrature Modulator
y Amplifier Control Supporter
7-12
Chapter 7
Structure of the InfoRanger
Ethernet MAC
Since Conexant CPU CN9414 has built-in EMAC (Ethernet Media Access controller), it sends and receives
data by externally connecting to MII (Media Independent Interface).
EMAC makes both 10/100M MII-compatible Ethernet device mode and 7-wire HomeLan device mode
programmable.
PIN
Ethernet Mode
HomeLAN Mode
ETXCK
Tx clock
Tx clock
ETXEN
Tx enable
Tx enable
ETXD[0,1,2,3]
bit 0 of 4 bit parallel Tx data
Serial Tx data
ECOL
Collision
Collision
ECRS
Carrial
Carrial
ERXCK
Rx clock
Rx clock
ERXD[0,1,2,3]
bit 0 of 4 bit parallel Rx data
Serial Rx data
Table 7-6
Media Independent Interface Signal
Flash Memory(AMD29DL323D, Intel28F320)
InfoRanger uses one flash memory with 4Mbyte capacity. The memory consists of 16Bit data bus (HAD0 ~
HAD15) and 21 Bit address bus (HC1~HC7, HAD16 ~ HAD29).
The size of flash memory must be no larger than 4Mbyte in CN9414.
Memory Part
4MByte flash memory largely consists of three parts.
1. First 1Mbyte : Bootrom Image
2. The next 1Mbyte : Working Image 1
3. The final 1Mbyte : Working Image2
Memory Access
Read Access Time of Flash Memory is 100ns. Access time is defined by setting HST_WST (0x002D004) register
inside the microprocessor. Holding Time is set in the register HST_XFER_CNTL (0x002D008).
7-13
Reading and Writing
Flash memory access is selected by HC [0] (pin Y17), HC [8] (pin V12) and HC [9] (pin Y11) of the
microprocessor and address. The addresses allocated for flash memory are from 0x400000 to 0x7FFFFF.
You can both read and write on Flash memory. The major control signals for the memory are HC [0] pin
Y17), HC [8] (pin V12), and HC [9] (pin Y11). These signals all operate as Active Low.
1. When writing, Chip Enable signal (HC [0]) and Write enable (HC [9]) operate as Active “Low”.
2. When reading, Chip Enable signal (HC [0]) and Output enable (HC [9]) operate as Active “Low”
The following pictures Figure 7-6 and Figure 7-7 show Flash Read and Write Timing, respectively.
Figure 7-6 Flash Memory Read Timing
Figure 7-7
Flash Memory Write Timing
7-14
Chapter 7
Structure of the InfoRanger
SDRAM(K4S641632D)
DRAM
SDRAM is in use for InfoRanger. The memory consists of 16 Bit Data bus (D0 ~ D15) and 12 Bit Address bus
(A0 ~ A11). The access time for DRAM is 80ns. Control signal for DRAM consists of RAS (#18), CAS (#17),
WE (#16) and CS (#19).
SDRAM
SDRAM memory access is driven by RAS signal generated in MRAS (#G18) of microprocessor and CAS
signal generated in MCAS (#H19).
SDRAM memory address consists of 11 Bit (row) and 8 Bit (column). When RAS is Low addresses in the
rows are valid and when CAS is Low addresses in columns are valid. The final address is determined by the
combination of row and the column addresses.
Reading and Wrinting
- When reading, the equipment is selected by Chip Select (Low) signal generated in microprocessor _MCS
(G19) terminal while the data is read by the addresses composed of RAS and CAS, and the signal (High)
generated in microprocessor _MWE (#L18) terminal.
- When writing, the equipment is selected by Chip Select (Low) signal generated in microprocessor _MCS
(G19) terminal while the data is written by the addresses composed of RAS and CAS, and the signal (High)
generated in microprocessor _MWE (#L18) terminal.
The compressed image stored in flash memory is decompressed in SDRAM when the power is provided.
The image consists of operation code, Configuration Parameter and Data Buffer.
7-15
User Interface
Ethernet Tranceiver (LXT 972)
Sending and Receicing Signals
y Sending signal : Ethernet tranceiver interfaces the CPU and Ethernet line. When sending signal, it
Menchester encodes digital data to convert into analog data for output.
y Receiving signal : When receiving signal, it demodulates analog data into digital signal and Menchester
decodes to send to the processor.
Register
Ethernet tranceiver has 32 internal registers. When the power is provided, these registers are set as default
value and can be also set by users through CPU.
Register setting data is transmitted by MDIO (#42) while the clock is sent by MDC (#43).
Clock and Loopback
LXT972 supports 10/100Mbps Full-duplex and operates as 3.3V. Power consumption is about300mW.
1) External clock requirements
External clock sources (25 MHz for100 Mbps, 2.5MHz for 10Mbps) or crystal
2) MDIO clock requirements
MII management channel (MDIO) uses external clock of up to 8MHz.
3) Loopback
- operational loopback
; 10Mbps half duplex support (register 16 , 8bit = 0)
- test loopback
; 100TX, 10TX support (register 0, 14bit = 1
register 0, 8bit = 1
register 0, 12bit = 0)
The following is a brief block diagram of Ethernet tranceiver and CPU.
7-16
Chapter 7
Structure of the InfoRanger
Ethernet Line Interface
Ethernet Line interface part is composed of a transformer and several passive elements.
Others
Power
InfoRanger uses 12 V DC power adapter and the power is provided through power jack (P501).
The power voltage in use for board is 5Va, 5V, 3,3Va, 3.3V, and 2.5V. Internally DC-DC converter is used for
each voltage.
Display
InfoRanger has four LEDs (LED601, LED602, LED603, LED604) each of which is controlled by CPU GPIO
port. The content for each is POWER_LED, RECEIVE_OK_LED, SEND_OK_LED, and PC_LED.
Switch
Reset Switch
InfoRanger has MAX708S, a Voltage Monitoring Supervisor. When power is authorized, MAX708S _MR (#1)
terminal maintains 3.3V. However if you press and release S101, a circuit connected to Ground from
+3.3_VCC through R219 is set and _MR terminal generates pulse that drops to 0V and surges back to 3.3V.
MAX708S detects the pulse and sends Falling Pulse to microprocessor _HRST (#W4).
Pulse drop and surge as hardware reset signal reboots InfoRanger.
Connectors
F-connector( withinTU401)
Downstream and upstream signals are sent and received through this cable port. .
Ethernet connector (P301)
During communicating with PC, the connector Ethernet sends and receives Ethernet packets.
Power Jack (P501)
The 12V DC power is input through this connector from power adapter.
JTAG Port(U601)
JTAG port is used for loading data into flash memory through Multi-ICE.
RS-232C Port (P602)
RS-232C port is used for communication, when InfoRanger is being debugged in connection with Console.
Here, RS-232C cable is required as well as Console Jig board that changes the signal level between the
InfoRanger and Console. (3.3V Volt ↔ +10/-10 Volt)
&KDSWHU 1HWZRUN&RPSRQHQW
7KLVWHFKQLFDOQRWHGHVFULEHVWKHQHWZRUNFRPSRQHQWVUHTXLUHGWRVXSSRUW'2&6,6FRPSOLDQWFDEOHPRGHPV
7KHSURYLVLRQLQJPRGHOLVDVGHVFULEHGLQ´2SHUDWLRQV6XSSRUW6\VWHP,QWHUIDFH6SHFLILFDWLRQ266,µ6RPH
WHUPLQRORJ\KDVEHHQPRGLILHGLQWKHLQWHUHVWRIEUHYLW\EXWWKHHVVHQWLDOPRGHOLVWKHVDPH
7KH'2&6,6VHULHVRIVSHFLILFDWLRQVGHILQHVDQ,3RQO\QHWZRUNVHUYLFHXVLQJDQ+)&FDEOHSODQWDVWKH
SULPDU\LQWHUIDFHIRUUHVLGHQWLDO,QWHUQHWDFFHVVWKURXJKSHUVRQDOFRPSXWHUV2WKHUSURWRFROVVXFKDV
1(7%(8,DQG$SSOH7DONDUHVXSSRUWHGLIHQFDSVXODWHGLQ7&3,3RUEULGJHGWKURXJK,3WXQQHOV
$OWKRXJKWHOHSKRQ\UHWXUQPRGHPVDUHVXSSRUWHGRQO\WZRZD\PRGHPVDUHGHVFULEHGLQWKLVGRFXPHQW
3URYLVLRQLQJ0RGHO
,WLVXVHIXOWRVSOLWWKHSURYLVLRQLQJPRGHOLQWRQHWZRUNVLGHFRPSRQHQWVDQGSODQWVLGHFRPSRQHQWV7KH
QHWZRUNVLGHFRPSRQHQWVFRQVLVWRIHOHPHQWPDQDJHPHQWOD\HUVDQGKLJKHUOHYHO266·VVXSSRUWEDVLF
EXVLQHVVSURFHVVHVVXFKDVELOOLQJ,3DGGUHVVDOORFDWLRQDQGQHWZRUNPRQLWRULQJ7KHVHFRPSRQHQWVDUHQRW
GHVFULEHGLQWKLVGRFXPHQW
7KHSODQWVLGHFRPSRQHQWVFRQVLVWPLQLPDOO\RI
O ,QIR5DQJHU
O +)&3ODQWDQG5)7HUPLQDWLRQ(TXLSPHQW
O &DEOH0RGHP7HUPLQDWLRQ6\VWHP&076
O 6ZLWFK
O '+&37)736HUYHU
O 5RXWHU
WAN
I/F
Router
Switch
DHCP
TFTP
Server
HFC Plant
CMTS
CM
PC
7KHFDEOHPRGHPVPD\EHDQ\'2&6,6FRPSOLDQWFDEOHPRGHPVUXQQLQJRQD+)&SODQWZKLFK
KDVSDVVHGERWKDQDORJFHUWLILFDWLRQDQGGLJLWDOFHUWLILFDWLRQ,QWKH8QLWHG6WDWHVDQDORJFHUWLILFDWLRQLVDQ
DQQXDOPHDVXUHPHQWSURFHGXUHPDQGDWHGE\WKH)HGHUDO&RPPXQLFDWLRQV&RPPLVVLRQ)&&$VVXPLQJ
WKDWWKHSODQWDOVRSDVVHVD\HWWREHGHILQHGGLJLWDOFHUWLILFDWLRQSURFHVVLWFDQEHDVVXPHGWKDW&076
,QIR5DQJHUOLQNKDVPHDVXUDEOHUHOLDELOLW\
:KLOHWKH,QIR5DQJHULVFXUUHQWO\GHILQHGDVDEULGJHGHYLFHWKH&076PD\EHHLWKHUDEULGJHRUDURXWHU,I
WKH&076LVDURXWHUWKHQVRPHPXOWLSOHVHUYLFHRSHUDWRUV062VPD\FKRRVHWRVLPSOLI\WKHKXE
HTXLSPHQWVFKHPHWRHOLPLQDWHWKHH[WUDURXWHUDQGVZLWFK
&KDSWHU
1HWZRUN&RPSRQHQW
,QWKLVFRQILJXUDWLRQWKH&076LVFRQILJXUHGDVDSUR[\IRUZDUGLQJ'+&3UHTXHVWVIURPWKH,QIR5DQJHUWR
WKH'+&3VHUYHU
WAN
I/F
Switch
DHCP
TFTP
Server
HFC Plant
CM
PC
,QDGGLWLRQLQDUHDVZKHUH'2&6,6PRGHPVKDYHORZSHQHWUDWLRQWKH'+&37)73VHUYHUPD\EHORFDWHG
VRPHZKHUHRQWKHZLGHDUHDQHWZRUN:$17KHSXUSRVHRIWKH'+&37)73VHUYHULVVWRUHDQGSURYLGH
WKHFDEOHPRGHP·VRQOLQHFRQILJXUDWLRQ$QRXWOLQHRIWKH,QIR5DQJHU·VLQLWLDOL]DWLRQSURFHGXUHLVDVIROORZV
'+&33URWRFROREWDLQVERRWSDUDPHWHUVLQFOXGHV,3DGGUHVVVXEQHWPDVNVHUYHUV72'DQG7)73
DGGUHVVHVDQGFRQILJXUDWLRQILOHQDPH
7LPH3URWRFROREWDLQVORFDOWLPHIURPDQ5)&WLPHVHUYHUVSHFLILHGLQWKH'+&3YHQGRURSWLRQDUHD
7)73SURWRFROGRZQORDGVFRQILJXUDWLRQILOHVSHFLILHGE\'+&3
'HFRGHDQGDXWKHQWLFDWHWKHFRQILJXUDWLRQILOH
2SWLRQDO7)73SURWRFROGRZQORDGVQHZVRIWZDUHLPDJHVSHFLILHGE\WKHFRQILJXUDWLRQILOHRQO\LI
UXQQLQJLPDJHLVROGHU
6HQG5(*5(4OLQNPHVVDJHWR&0767KHPHVVDJHXVHVWKHFODVVRIVHUYLFHSURILOHIRXQGLQWKH
FRQILJXUDWLRQILOH
5HFHLYH5(*563OLQNPHVVDJHIURP&076FRQWDLQLQJPRGHP·VVHUYLFH,'V6,'V
1HJRWLDWHOLQNHQFU\SWLRQIRUHDFKEDVHOLQHSULYDF\HQDEOHG6,',QFOXGHVPXOWLFDVW6,'VZLWK,63VSHFLILF
FRQWHQW
&DEOH0RGHP&RQILJXUDWLRQ)LOH
'2&6,6FDEOHPRGHPVSHUIRUPDQDXWRPDWLFUHJLVWUDWLRQSURFHVVWRHVWDEOLVKDOLQNZLWKWKHQHWZRUN$V
SDUWRIWKLVSURFHVV'+&3LVXVHGWRJUDQWWKHFDEOHPRGHPDQ,3DGGUHVVEXWDOVRWRWHOOWKHFDEOHPRGHP
WKH,3DGGUHVVRID7)73VHUYHUIURPZKLFKLW0867GRZQORDGDFRQILJXUDWLRQILOH7KHFRQILJXUDWLRQILOH
IRUPDWLVGHILQHGLQ'2&6,65),VSHFLILFDWLRQ
$QH[DPSOHFODVVRIVHUYLFHLV
&ODVV,'
0D[LPXP'RZQVWUHDP5DWH
0D[LPXP8SVWUHDP5DWH
8SVWUHDP&KDQQHO3ULRULW\
*XDUDQWHHG0LQLPXP8SVWUHDP5DWH
0D[LPXP8SVWUHDP7UDQVPLW%XUVW
&ODVVRI6HUYLFH3ULYDF\(QDEOH
7KHUHVXOWLQJILOHLQKH[LV
))
)
%)%))$)&'$)
&'&()&%'(
&(''&'))
&KDSWHU
1HWZRUN&RPSRQHQW
'+&36HUYHU&RQILJXUDWLRQ
,QDGGLWLRQWRWKHVWDQGDUG,3DGGUHVVILHOGVWKH'+&3VHUYHUVKRXOGEHFRQILJXUHGWRSURYLGHWKHIROORZLQJ
ILHOGVVSHFLILHGE\5),VSHFLILFDWLRQ
7KHQDPHRIWKH,QIR5DQJHUFRQILJXUDWLRQILOHLVVSHFLILHGLQWKHE\WHVERRWILOHQDPHILHOGQRWE\DQ\
SDUDPHWHULQWKHYHQGRURSWLRQVDUHD+HUHLVDQH[DPSOHFRQILJIRU,6&'+&3YHUVLRQ
VXEQHWQHWPDVN^
UDQJH
GHIDXOWOHDVHWLPH
PD[OHDVHWLPH
RSWLRQVXEQHWPDVN
RSWLRQURXWHUV
RSWLRQWLPHVHUYHUV
RSWLRQWLPHRIIVHW
RSWLRQRSWLRQH
`
JURXS^
ILOHQDPH´WIWSERRWEURQ]HFPµ
KRVWFP^KDUGZDUHHWKHUQHWHHEEEG`
`
7KHVHFXULW\VHUYHU,3DGGUHVVRSWLRQPD\QHHGWREHFRQILJXUHGDVDFXVWRPRSWLRQ1RWPDQ\'+&3
FXUUHQWO\VXSSRUWWKLVRSWLRQ,QWKHDERYHH[DPSOHWKH,3DGGUHVVLVVSHFLILHGLQKH[DGHFLPDO7KH'+&3
VHUYHUVKRXOGEHDFFHVVLEOHE\&076YLDDQLQWHUIDFHRWKHUWKDQWKHFDEOHLQWHUIDFHEHLQJVHUYHG
,QDGGLWLRQWRVHUYLQJFDEOHPRGHPVWKH'+&3VHUYHUPXVWEHIOH[LEOHHQRXJKWRDOVRVHUYHKRVW3&V
EHKLQGWKHPRGHPV,3DGGUHVVHVVKRXOGEHVHJUHJDWHGLQWRJURXSV2QHJURXSIRU3&VWKHRWKHUIRU
PRGHPV0RGHPV,3DGGUHVVDVVLJQPHQWVKRXOGEHNH\HGRQ0$&DGGUHVV7KLVSURYLGHVDGPLQLVWUDWLYH
FRQWURORIWKHVHUYLFHFODVVDVVLJQPHQWIRUHDFKVXEVFULEHU*HQHUDOO\VWDWLF,3DVVLJQPHQWLVXVHGWRDOORZ
6103EDVHGQHWZRUNPDQDJHPHQW
+RVW,3DGGUHVVDVVLJQPHQWPD\EHG\QDPLFRUVWDWLFEDVHGRQ,63VHUYLFHSDUDPHWHUV&XUUHQWO\PRGHP
DQGKRVW,3DGGUHVVHVDUHPHPEHUVRIWKHVDPHVXEQHW7KLVUHVWULFWLRQZLOOQRWDSSO\LQWKHIXWXUH&076
VRIWZDUHUHOHDVHV
7)736HUYHU
&XUUHQWO\DVWDQGDUG7)73VHUYHUVKRXOGEHDFFHVVLEOHE\&076YLDDQLQWHUIDFHRWKHUWKHFDEOHLQWHUIDFH
EHLQJVHUYHG7KHFDEOHPRGHPFRQILJXUDWLRQILOHVPXVWEHNHSWLQWKHILOHQDPHSDWKVSHFLILHGE\WKH'+&3
VHUYHU0XOWLSOHFRQILJXUDWLRQILOHVVSHFLI\LQJGLIIHUHQWFODVVHVRIVHUYLFHPD\EHXVHGWRVHUYHDFRPPXQLW\
RIPRGHPV,WLVQRWQHFHVVDU\WRVWRUHRQHILOHSHUPRGHP
:HE6HUYHU
,IWKH7)73VHUYHUKRVWDOVRVXSSRUWVD:(%VHUYHUWKHQWKHFRQILJXUDWLRQILOHHGLWRUPD\EHLQVWDOOHG7KLV
DOORZVFRQILJXUDWLRQILOHVWREHHGLWHGXVLQJD-DYDDSSOHW3OHDVHVHHDQDFFRPSDQ\LQJGRFXPHQWIRU
LQVWDOODWLRQLQVWUXFWLRQV
&076&RQILJXUDWLRQ
6SHFLILFDOO\D&LVFR·VKHDGHQGV\VWHPWKHX%5IXQFWLRQVDVDURXWHUW\SH&0767KHUHIRUH,3
DGGUHVVHVPXVWEHGHILQHGIRUHDFKUXQQLQJLQWHUIDFH7KHFDEOHLQWHUIDFHPXVWKDYHDVWDWLFDOO\DVVLJQHG,3
DGGUHVVZKLFKLVDPHPEHURIWKHVXEQHWIRUWKHPRGHPVDQGKRVWVUHDFKHGRYHUWKH5)LQWHUIDFH
,QDGGLWLRQWKH´LSKHOSHUDGGUHVVµFRPPDQGVKRXOGEHVHWWRWKH,3DGGUHVVRIWKH'+&3VHUYHU0XOWLSOH
'+&3VHUYHUVPD\EHVSHFLILHG&XUUHQWO\ERWKPRGHPVDQG3&VVKRXOGEHVHUYHGE\WKHVDPHVHUYHU,I
PXOWLSOH'+&3VHUYHUVDUHXVHGWKH\PXVWEHDEOHWRFRRUGLQDWHDVVLJQLQJ,3DGGUHVVHVLQWKHVDPHVXEQHW
&KDSWHU
1HWZRUN&RPSRQHQW
7KLVSDJHLVOHIWEODQNLQWHQWLRQDOO\
&KDSWHU 1HWZRUN/D\HU3URSHUWLHV
3URWRFRO6WDFN
7KHPDLQIXQFWLRQRIWKH,QIR5DQJHULVWRDFWDVDQGFRPSOLDQWWUDQVSDUHQWEULGJH7UDQVSDUHQW
EULGJLQJUHIHUVWRWKHIDFWWKDWWKHRSHUDWLRQDQGSUHVHQFHRIWKHVHGHYLFHVLQDQ,3QHWZRUNLVWUDQVSDUHQWRU
LQYLVLEOHWRWKHQHWZRUN,3OD\HU%ULGJHVSHUIRUPRSHUDWLRQVEDVHGRQ(WKHUQHW0$&DGGUHVVHV7KH
SURWRFROVWDFNSURYLGHVGFRPSOLDQWWUDQVSDUHQWEULGJLQJDQGFRQIRUPVWR0&16VSHFLILFDWLRQV7KH
SURWRFROVWDFNGRHVQRWSHUIRUPVRXUFHURXWHEULGJLQJ
7KH,QIR5DQJHUPXVWDOVRIXQFWLRQDVDQ//&KRVWDQGDVDQ,3KRVW7KDWLVLQDGGLWLRQWRSHUIRUPLQJ
EULGJLQJIXQFWLRQVWKH,QIR5DQJHUPXVWDOVRDFWDVDWHUPLQDWLRQSRLQWIRU(WKHUQHW0$&IUDPHV
DQGRU,3SDFNHWVDQGWKHUHIRUHPXVWKDYHERWKDXQLTXH(WKHUQHW0$&DGGUHVVIRULWV&DEOH
LQWHUIDFHDQGDQ,3DGGUHVV
7KHWDEOHEHORZVKRZVWKHSURWRFROVWDFNFRPSRQHQWV
SNMP
TFTP
DHCP
Security Mgmt
8'3
,3,&03$53
(WKHUQHW//&
/LQN6HFXULW\
&DEOH0$&
&DEOH3+<
(WKHUQHW//&
G7UDQVSDUHQW%ULGJLQJ
(WKHUQHW0$&
%DVH7
7KH,QIR5DQJHU6103DJHQWVXSSRUWVWKHGRWG%DVHDQGGRWG7S0,%JURXSVGHVFULEHGLQ5)&
%ULGJH0,%
Features
Description
&DEOH0$&&RQWURO
%DVHOLQH3ULYDF\
(VWDEOLVKHVFRPPXQLFDWLRQDQGEDVHOLQHVHFXULW\ZLWKWKH&076HVWDEOLVKHV,3
FRQQHFWLYLW\ZLWKWKHDVVLVWDQFHRIWKH'+&3DQG7)73FOLHQWVDQGPDQDJHV&DEOH
0$&FRQWUROPHVVDJHVUHFHLYHGYLD6103
&DEOH'ULYHU
3URYLGHVWKHLQWHUIDFHWRWKH&DEOH0$&KDUGZDUH
(WKHUQHW'ULYHU
3URYLGHVWKHLQWHUIDFHWRWKH(WKHUQHW0$&KDUGZDUH
%ULGJLQJ6&05
3URYLGHVGFRPSOLDQW7UDQVSDUHQW%ULGJLQJEHWZHHQWKH(WKHUQHWDQG&DEOH
GULYHUV
86%'ULYHU6&08
3URYLGHVWKHLQWHUIDFHWRWKH86%0$&KDUGZDUH
%ULGJLQJ6&08
3URYLGHVGFRPSOLDQW7UDQVSDUHQW%ULGJLQJEHWZHHQWKH&DEOHGULYHUDQG
(WKHUQHW86%
'+&3&OLHQW
$FTXLUHVFRQILJXUDWLRQGDWDYLDWKH'\QDPLF+RVW&RQILJXUDWLRQ3URWRFROIURPD
'+&3VHUYHUDWWKHKHDGHQGWRHVWDEOLVK,3FRQQHFWLYLW\DQGWRLGHQWLI\ORFDWLRQRI
,QIR5DQJHUFRQILJXUDWLRQILOH7KH'+&3VHUYHU´OHDVHVµFRQILJXUDWLRQGDWDWRWKH
FOLHQWIRUDGXUDWLRQHVWDEOLVKHGE\WKH'+&3VHUYHUDGPLQLVWUDWRU
7)73&OLHQW
$FTXLUHVD,QIR5DQJHUFRQILJXUDWLRQGDWDILOHYLDWKH7ULYLDO)LOH7UDQVIHU3URWRFRO
7KH&DEOH0DF&RQWURO%DVHOLQH3ULYDF\IXQFWLRQDOXQLWSURYLGHVWKH7)73VHUYHU
DQGILOHQDPHVSHFLILHGLQWKHFRQILJXUDWLRQGDWDDFTXLUHGE\WKH'+&3FOLHQW
&KDSWHU
1HWZRUN/D\HU3URSHUWLHV
Features
6103$JHQW
Description
3URYLGHVUHPRWHDFFHVVWRWKH,QIR5DQJHU·V&DEOH0DF'ULYHUDQG&DEOH0$&
&RQWURO7&38'3,3DQGEULGJLQJSDUDPHWHUVYLDWKH6LPSOH1HWZRUN
0DQDJHPHQW3URWRFRO
)URPKRVWVHTXLSSHGZLWK6103FOLHQWVRIWZDUHDWWKH+HDGHQGQHWZRUN
DGPLQLVWUDWRUVFDQ´JHWµRU´VHWµWKHSDUDPHWHUVGHILQHGWKHIROORZLQJ
0DQDJHPHQW,QIRUPDWLRQ%DVHV0,%VVXSSRUWHGE\WKH,QIR5DQJHU
y 0,%,,GHILQHGLQ5)&
y &DEOH0,%GHILQHGLQWKH,QWHUQHWGUDIW
y %ULGJH0,%GHILQHGLQ5)&
&DEOH'ULYHU
7KH&DEOH'ULYHUSURYLGHVWKHLQWHUIDFHWRWKHFDEOH0$&KDUGZDUH
(WKHUQHW'ULYHU
7KH(WKHUQHWGULYHUSURYLGHVWKHLQWHUIDFHWRWKH(WKHUQHW0$&KDUGZDUH
86%'ULYHU,QIR5DQJHU6&08
7KH86%GULYHUSURYLGHVWKHLQWHUIDFHWRWKH86%0$&KDUGZDUH
%ULGJLQJ
G7UDQVSDUHQW%ULGJLQJLVVXSSRUWHG7KHRSWLRQDO6SDQQLQJ7UHH3URWRFROLVQRWVXSSRUWHGE\WKLV
YHUVLRQRIWKH,QIR5DQJHU7KH,QIR5DQJHUPXVWLQFOXGHWKHDELOLW\WRILOWHUDQGGLVUHJDUGG%3'8V
7KLVLVWKHGHIDXOWPRGHRIRSHUDWLRQLQWKLVUHOHDVH$Q\%3'8VUHFHLYHGRQWKH/$1LQWHUIDFHRURQWKH
FDEOHLQWHUIDFHDUHLJQRUHG
7KH,QIR5DQJHUEULGJHVWKHIROORZLQJ(WKHUQHW0$&IUDPHVUHFHLYHGDWLWVFDEOHLQWHUIDFHWRWKH/$1
LQWHUIDFH
8QLFDVWIUDPHVFRQWDLQLQJ,3SDFNHWVZLWKGHVWLQDWLRQ0$&DGGUHVVRIDKRVWGHYLFHRQWKH,QIR5DQJHU/$1
LQWHUIDFH,IWKHGHVWLQDWLRQ0$&DGGUHVVLVWKDWRIWKH,QIR5DQJHULWVHOIWKHIUDPHLVSURFHVVHGE\KLJKHU
OD\HUVRIWZDUHRQWKH,QIR5DQJHU
1RWHWKDWEULGJLQJRIIUDPHVWRWKH/$1LQWHUIDFHRQO\IRUGHYLFHVNQRZQLHOHDUQHGWREHRQWKDW
LQWHUIDFHLVDGHYLDWLRQIURPGEULGJLQJZKLFKVSHFLILHVWKDWIUDPHVZLWKXQNQRZQLHQRW\HWOHDUQHG
GHVWLQDWLRQ0$&DGGUHVVDUHWREHWUDQVPLWWHGWRDOOLQWHUIDFHVVDYHIRUWKHLQWHUIDFHRQZKLFKWKH\ZHUH
UHFHLYHG
6LQFH>635),@GRHVQRWLQFOXGH,QIR5DQJHUVSHFLILF&DEOH0$&DGGUHVVLQJIRUIUDPHVHQFDSVXODWLQJ,3
SDFNHWVGDWD3'8VWKH,QIR5DQJHUPXVWWDNHRQHRIWZRDSSURDFKHVIRUUHFHLYLQJVXFKIUDPHV
7KH,QIR5DQJHUZLOORQO\UHFHLYHGDWDIURPWKHFDEOHLQWHUIDFHZLWKGHVWLQDWLRQ0$&DGGUHVVHVRIKRVWV
NQRZQE\WKH,QIR5DQJHUWREHRQLWV/$1LQWHUIDFHRUGHVWLQDWLRQ0$&DGGUHVVRIWKH,QIR5DQJHULWVHOI
7KLVLVWKHSUHIHUUHGPHWKRGIRUWKH,QIR5DQJHUDQGSURFHHGVDVIROORZV
y 2QVWDUWXS,QIR5DQJHUSURJUDPVWKHFDEOH0$&KDUGZDUHWRLQLWLDOO\UHFHLYHRQO\IUDPHVZLWK
GHVWLQDWLRQ0$&DGGUHVVRIWKH,QIR5DQJHULWVHOI
y $IWHUV\VWHPLQLWLDOL]DWLRQ,QIR5DQJHUOHDUQVRI/$1WRSRORJ\DVSHUG$V0$&DGGUHVVHVRI
KRVWVRQ/$1VLGHDUHOHDUQHGWKH,QIR5DQJHUSURJUDPVWKHFDEOH0$&KDUGZDUHWRUHFHLYHIUDPHV
FRQWDLQLQJWKRVH0$&DGGUHVVHV7KRVHDGGUHVVHVDUHDOVRVWRUHGLQDQDGGUHVVFDFKHVRWKDWWKH
,QIR5DQJHUFDQLJQRUHORFDOWUDIILFEHWZHHQKRVWVRQWKH/$1VLGH
7KH,QIR5DQJHUWKHUHIRUHUHFHLYHVQRGDWDRWKHUWKDQWKDWGHVWLQHGIRUWKH,QIR5DQJHULWVHOIXQWLOLWKDV
OHDUQHGRIWKHH[LVWHQFHRIRQHRUPRUHKRVWVRQLWV/$1LQWHUIDFH7KHUHIRUH$OOXQLFDVWIUDPHVFRQWDLQLQJ
,3SDFNHWVUHFHLYHGE\WKH,QIR5DQJHURQLWVFDEOHLQWHUIDFHDQGQRWLQWHQGHGIRUWKH,QIR5DQJHULWVHOIDUH
EULGJHGWRWKH/$1LQWHUIDFH
y %URDGFDVWIUDPHVFRQWDLQLQJ,3SDFNHWV
y 0XOWLFDVWIUDPHVFRQWDLQLQJ,3SDFNHWV
6RPHPXOWLFDVWFRQVLGHUDWLRQV
y 7KH,QIR5DQJHUFRXOGVQRRSLQ,&03SDFNHWVWRGHWHUPLQHZKLFKPXOWLFDVWJURXSVDUHMRLQHGE\KRVWV
RQLWV/$1LQWHUIDFHDQGWKHQSURJUDPWKHFDEOH0$&KDUGZDUHWRUHFHLYHRQO\PXOWLFDVWIUDPHV
FRUUHVSRQGLQJWRWKRVHJURXSV
y 7KH,QIR5DQJHUFRXOGWDNHQRLQYROYHPHQWDQGVLPSO\UHFHLYHDQGEULGJHDOOPXOWLFDVWIUDPHVWRWKH
/$1LQWHUIDFH7KLVZLOOQRWVXSSRUWWKHEDVHOLQHSULYDF\HQFU\SWLRQRIPXOWLFDVWVHVVLRQV
$OORWKHU0$&IUDPHVUHFHLYHGDWWKH&DEOHLQWHUIDFHDUHLJQRUHG
7KH,QIR5DQJHUEULGJHVWKHIROORZLQJ(WKHUQHW0$&IUDPHVUHFHLYHGDWLWV/$1LQWHUIDFHWRWKH
KHDGHQG
8QLFDVWIUDPHVFRQWDLQLQJ,3SDFNHWVXQOHVV
7KHGHVWLQDWLRQ0$&DGGUHVVLVWKDWRIDKRVWGHYLFHRQWKH,QIR5DQJHU/$1LQWHUIDFH7KH,QIR5DQJHU
GLVFRYHUVZKLFKGHYLFHVDUHRQLWV/$1LQWHUIDFHWKURXJK7UDQVSDUHQW%ULGJHOHDUQLQJ,QWKLVFDVHWKHIUDPH
LVGURSSHG
7KHGHVWLQDWLRQ0$&DGGUHVVLVWKDWRIWKH,QIR5DQJHULWVHOI,QWKLVFDVHWKHIUDPHLVSURFHVVHGE\KLJKHU
OD\HUVRIWZDUHRQWKH,QIR5DQJHU
7KHIDFWWKDWWKH,QIR5DQJHUKDVRQO\WKUHHLQWHUIDFHVDOORZVIRUDQRWKHUPRGLILFDWLRQWRGWKHUHLVQR
QHHGIRUWKH,QIR5DQJHUWROHDUQRIWKHQHWZRUNWRSRORJ\RQWKHFDEOHVLGH/HDUQLQJWKHFDEOHVLGHWRSRORJ\
DQGPDLQWDLQLQJDSRWHQWLDOO\ODUJHFDFKHRI0$&DGGUHVVHVRIGHYLFHVOHDUQHGWREHRQWKHFDEOHVLGHLVD
SRLQWOHVVH[HUFLVH,IVXFKDFDFKHZHUHPDLQWDLQHGWKHVWHSVIRUEULGJLQJDIUDPHUHFHLYHGDWWKH/$1
LQWHUIDFHZRXOGEHDVIROORZV
y ,IGHVWLQDWLRQ0$&DGGUHVVLVWKDWRI,QIR5DQJHUSDVVWKHIUDPHWRKLJKHUOD\HUVRIWZDUH
y ,IGHVWLQDWLRQ0$&DGGUHVVH[LVWVLQFDEOHVLGHDGGUHVVFDFKHIRUZDUGIUDPHWRFDEOHLQWHUIDFHIRUZDUG
IUDPHWRFDEOHLQWHUIDFHE\XQNQRZQGHVWLQDWLRQDGGUHVVUXOH
&OHDUO\WKHQHWUHVXOWRIKDYLQJDFDEOHVLGHDGGUHVVFDFKHRUQRWLVLGHQWLFDO
y %URDGFDVWIUDPHVFRQWDLQLQJ,3SDFNHWV
y 0XOWLFDVWIUDPHVFRQWDLQLQJ,3SDFNHWV
$OORWKHU0$&IUDPHVUHFHLYHGDWWKH/$1LQWHUIDFHDUHLJQRUHG
&KDSWHU
1HWZRUN/D\HU3URSHUWLHV
7KH%ULGJLQJIXQFWLRQDOXQLWFRPPXQLFDWHVZLWKWKHIROORZLQJIXQFWLRQDOXQLWV
y &DEOH'ULYHU
IRU7[DQG5[RIGDWDIUDPHV
y (WKHUQHW'ULYHU
IRU7[DQG5[RIGDWDIUDPHV
y 8'3,3
IRU5[RIGDWDIUDPHVGHVWLQHGIRU,QIR5DQJHU
7[RIGDWDIUDPHVRULJLQDWLQJDW,QIR5DQJHU
y 86%'ULYHU6&08
IRU7[DQG5[RIGDWDIUDPHV
7&3DQG8'3,3
7KLVIXQFWLRQDOXQLWSURYLGHVVWDQGDUG,37&3DQG8'3OD\HUV7KH61037)73DQG'+&3IXQFWLRQDO
XQLWVUHTXLUHRQO\WKH8'3DQG,3OD\HUV$53DQG,&03DUHJHQHUDOO\FRQVLGHUHGWREHSDUWRIWKH,3
SURWRFRO
'RZQVWUHDP&076Æ,QIR5DQJHU$53UHTXHVWVDUHKDQGOHGLQWKHIROORZLQJZD\
y $53UHTXHVWVIRU,QIR5DQJHUSK\VLFDODGGUHVVDUHDQVZHUHGZLWKFDEOHLQWHUIDFH0$&DGGUHVV
y $OORWKHU$53UHTXHVWVDUHEULGJHGWR(WKHUQHWLQWHUIDFH,QFDVHRIXVLQJWKH86%SRUWRI,QIR5DQJHU
6&08WKHUHTXHVWVDUHEULGJHGWR86%LQWHUIDFH
8SVWUHDP+RVWÆ,QIR5DQJHU$53UHTXHVWVDUHKDQGOHGLQWKHIROORZLQJZD\
y $53UHTXHVWVIRU,QIR5DQJHUSK\VLFDODGGUHVVDUHDQVZHUHGZLWK(WKHUQHWLQWHUIDFH0$&DGGUHVV
,QFDVHRIXVLQJWKH86%SRUWRI,QIR5DQJHU6&08WKHUHTXHVWVDUHDQVZHUHGZLWK86%LQWHUIDFH
0$&DGGUHVV
y $OORWKHU$53UHTXHVWVDUHEULGJHGWRWKHFDEOHLQWHUIDFH
'RZQVWUHDP&076Æ,QIR5DQJHU,&03PHVVDJHVDUHKDQGOHGLQWKHIROORZLQJZD\
y (FKR5HTXHVWVSLQJDGGUHVVHGWR,QIR5DQJHUDUHDQVZHUHGRQFDEOHLQWHUIDFHZLWK(FKR5HSO\
y (FKR5HTXHVWVDGGUHVVHGWRRWKHUWKDQ,QIR5DQJHUDUHEULGJHGWR(WKHUQHWLQWHUIDFH,QFDVHRIXVLQJWKH
86%SRUWRI,QIR5DQJHU6&08WKHHFKRUHTXHVWVDUHEULGJHGWR86%LQWHUIDFH
y 2WKHU,&03UHTXHVWVDGGUHVVHGWR,QIR5DQJHU7%'
y 2WKHU,&03UHTXHVWVDGGUHVVHGWRRWKHUWKDQ,QIR5DQJHUDUHEULGJHGWR(WKHUQHWLQWHUIDFH
8SVWUHDP+RVWÆ,QIR5DQJHU,&03PHVVDJHVDUHKDQGOHGLQWKHIROORZLQJZD\
y (FKR5HTXHVWVSLQJDGGUHVVHGWR,QIR5DQJHUDUHDQVZHUHGRQ(WKHUQHWLQWHUIDFHZLWK(FKR5HSO\,Q
FDVHRIXVLQJWKH86%SRUWRI,QIR5DQJHU6&08WKHHFKRUHTXHVWVDUHDQVZHUHGZLWK86%LQWHUIDFH
ZLWK(FKR5HSO\
y (FKR5HTXHVWVDGGUHVVHGWRRWKHUWKDQ,QIR5DQJHUDUHEULGJHGWRFDEOHLQWHUIDFH
y 2WKHU,&03UHTXHVWVDGGUHVVHGWR,QIR5DQJHU7%'
y 2WKHU,&03UHTXHVWVDGGUHVVHGWRRWKHUWKDQ,QIR5DQJHUDUHEULGJHGWRFDEOHLQWHUIDFH
'+&3
7KH'+&3IXQFWLRQDOXQLWLVUHVSRQVLEOHIRULPSOHPHQWLQJWKH'\QDPLF+RVW&RQILJXUDWLRQ3URWRFROZKLFK
LVXVHGE\WKH,QIR5DQJHUWRREWDLQLWV,3DGGUHVVDWV\VWHPLQLWLDOL]DWLRQ
7KH,QIR5DQJHU'+&3FOLHQWKDQGOHVWKHILUVWVWDJHRIFRQILJXUDWLRQDFTXLULQJSDUDPHWHUVIRUEDVLF,3
FRQILJXUDWLRQVXFKDV,3DGGUHVVDQGVXEQHWPDVNDQGWKHORFDWLRQRID,QIR5DQJHUFRQILJXUDWLRQILOHWKDWLW
FDQGRZQORDGYLD7ULYLDO)LOH7UDQVIHU3URWRFRO7)73
7)73
7KH7)73IXQFWLRQDOXQLWLVUHVSRQVLEOHIRULPSOHPHQWLQJWKH7ULYLDO)LOH7UDQVIHU3URWRFROZKLFKLVXVHGE\
WKH,QIR5DQJHUIRUWKHIROORZLQJ
y 7RGRZQORDGDQRSWLRQDOSDUDPHWHUVILOHDWV\VWHPLQLWLDOL]DWLRQ
y 7RGRZQORDGDQHZVRIWZDUHLPDJHLQUHVSRQVHWRDQ6103FRPPDQG
6103
7KH,QIR5DQJHUVRIWZDUHVXSSRUWV6103YDVGHILQHGLQ5)&6103YDQG0,%,,DVGHILQHGLQ5)&
5)&5)&DQGVRRQDOWKRXJKQRWDOO0,%REMHFWVZLOOEHVXSSRUWHGLQWKLVUHOHDVH
7KH,QIR5DQJHUVRIWZDUHDOVRVXSSRUWVWKHGRWG%DVHDQGGRWG7SWUDQVSDUHQWEULGJLQJ0,%JURXSVRIWKH
%ULGJH0,%GHILQHGLQ5)&7KH,QIR5DQJHUVRIWZDUHDOVRVXSSRUWVWKH0,%GHILQHGLQ5)&DQG
WKH,QWHUQHWGUDIWGUDIWLHWILSFGQPFQVESLPLEW[WDSURSRVHGDOWHUQDWLYHWRWKH0&16FDEOH0,%
GHILQHGLQ2SHUDWLRQV6XSSRUW6\VWHP,QWHUIDFH6SHFLILFDWLRQIRUFDEOHV\VWHPVSHFLILFPDQDJHPHQWREMHFWV
&KDSWHU
1HWZRUN/D\HU3URSHUWLHV
7KLVSDJHLVOHIWEODQNLQWHQWLRQDOO\
$
$SSHQGL[$ 7URXEOHVKRRWLQJ
7URXEOHVKRRWLQJLQ3K\VLFDO/D\HU
,QWKLVVHFWLRQRYHUDOOWURXEOHVKRRWLQJPHWKRGLQSK\VLFDOOD\HULVSURYLGHGZKLFKFDQEHXWLOL]HGZKHQ
WKHUHRFFXUWURXEOHZLWK,QIR5DQJHURQWKHVLWHRURQWKHVHUYLFHOLQH)LUVWVHFWLRQVKRZVVLPSOHWUHDWPHQWV
ZKLFKFDQEHWDNHQRQWKHVLWHZLWKRXWRSHQLQJFDVHV5HPDLQLQJVHFWLRQVGHVFULEHWHFKQLFDOWURXEOHVKRRWLQJ
PHWKRGVZKLFKDUHSRVVLEOHZLWKDLGRIVHYHUDOLQVWUXPHQWVLQWKHODE,QWKLVSURFHVVUHIHUHQFHWR¶&KDSWHU
8VLQJWKH'LDJQRVWLFV3URJUDP·LVKLJKO\UHFRPPHQGHG
,QVWUXPHQWV1HHGHG
7KHIROORZLQJLQVWUXPHQWVDUHUHTXLUHGIRUWURXEOHVKRRWLQJWKH,QIR5DQJHU
Item
Model No.
Maker
&$79$QDO\]HU
+3&
+3
4$00RGXODWRU
%&0
%URDGFRP
8S&RQYHUWHU
&8
*,
6WHS$WWHQXDWRU
966$
9LHZVRQLFV
3RZHU6SOLWWHU
$Q\G%3RZHU6SOLWWHU
'LJLWDO9ROW0HWHU
$Q\'LJLWDO9ROW0HWHU
2VFLOORVFRSH
$Q\RVFLOORVFRSHZLWK0+]
3&
$Q\3&ZLWK26KLJKHUWKDQ:LQGRZVDQG+\SHU7HUPLQDO
&RQVROH-LJ%RDUG
3URYLGHGIRUVHUYLFHSXUSRVH
'&3RZHU6XSSO\
$Q\'&3RZHU6XSSO\
6HUYHU
$Q\3&ZLWK:LQGRZV17
&076
$Q\'2&6,6FRPSOLDQW&076
)L[HG$WWHQXDWRU
$Q\)L[HG$WWHQXDWRUZLWKG%[
'LSOH[HU)LOWHU
965('3
6DPVXQJ
9LHZVRQLFV
$
$SSHQGL[$
7URXEOHVKRRWLQJ
/RFDWLRQRI7HVW3RLQWV
/RFDWLRQVWHVWSRLQWVRQWKH3&%WRSYLHZDUHVKRZQIRUTXLFNLGHQWLILFDWLRQLQWKHIROORZLQJILJXUH7KH\
DUHPDUNHGDV+[[
$
2QVLWH&KHFN
3XUSRVH
7RSURYLGHTXLFNUHPHG\PDLQO\E\FKHFNLQJFRQQHFWLRQVDQGWRLGHQWLI\V\PSWRPVIRUIXUWKHUFKHFNLQJ
7KHFDVHVVKDOOQRWEHRSHQLQWKLVSURFHVV7KHSURFHVVGHVFULEHGLQEROGER[VKDOOEHGRQHLQWKHODE
5HTXLUHG,QVWUXPHQW
3RUWDEOH&$79$QDO\]HURSWLRQDO
76)ORZ&KDUW
6WDUW
$
8QSOXJSRZHUDGDSWHUDQG
SOXJLWEDFNLQWRWKHPRGHP
1RIURQWSDQHO
/('"
1R
<HV
&KHFN$&SRZHURXWOHW
1RIURQWSDQHO
/('"
1R
<HV
*RWR$
3RZHU&KHFN
*RWR$
2VFLOODWRU&KHFN
*RWR$
'LVSOD\&KHFN
$
$
$SSHQGL[$
7URXEOHVKRRWLQJ
3RZHU&KHFN
3XUSRVH
7RFKHFN'&SRZHUYROWDJHV9999DQG9
5HTXLUHG,QVWUXPHQW
'90RURVFLOORVFRSH
76)ORZ&KDUW
6WDUW
%
9ROWDJHDW3
12
LV9"
&KHFNSRZHUDGDSWHU
%
&KHFN8/&'
%
&KHFN8/&'
%
&KHFN8
%
<(6
9ROWDJHDW8
12
LV9"
<(6
9ROWDJHDW8
12
LV9"
<(6
9ROWDJHDW8
12
LV9"
<(6
9ROWDJHDW8
8LV9"
12
&KHFN88
%
$
2VFLOODWRU&KHFN
3XUSRVH
7RFKHFNRVFLOODWRUZDYHIRUPV0+]
5HTXLUHG,QVWUXPHQW
2VFLOORVFRSH
76)ORZ&KDUW
6WDUW
<(6
9ROWDJHDW<
LV!9SSDQG
0+]"
<(6
2.
12
&KHFN<
&
$
$SSHQGL[$
7URXEOHVKRRWLQJ
'LVSOD\&KHFN
3XUSRVH
7RFKHFNIURQWDQGEDFNSDQHOGLVSOD\/('V
5HTXLUHG,QVWUXPHQW
'90
76)ORZ&KDUW
6WDUW
'
1RIURQWSDQHO
'LVSOD\/('"
<HV
1R
&KHFN8
1R
1RIURQWSDQHO
'LVSOD\/('"
<HV
&KHFN/('/('
/('/('
2.
'
$
'RZQ6WUHDP&KHFN
3XUSRVH
7RFKHFNVWUHDPDQDORJVLJQDOIORZ,WLVSRLQWWRFKHFNLIWKH$*&FLUFXLWLQWKHGRZQVWUHDPEORFNZRUNV
5HTXLUHG,QVWUXPHQWV
4$00RGXODWRU8S&RQYHUWHU6WHS$WWHQXDWRU3RZHU6SOLWWHU&$79$QDO\]HU3&&RQVROH-LJERDUG
&RQVROHFDEOH56&FDEOH'&3RZHU6XSSO\2VFLORVFRSH'LJLWDO9ROW0HWHU
,QVWUXPHQWV&RQQHFWLRQ
&$79$QDO\]HU
83&RQY
6WHS$WWHQ
3RZHU6SOLWWHU
6&056&08
3
&$%/(
6FRSH
'90
4$00RG
&RQVROH-LJ
ERDUG
'&3RZHU
3&
'HWDLOHG6HWWQJV
4$00RGXODWRUVHWWLQJ%&0
U &DVHRI4$0
4$0B
',*&3+5
35%6B0
$XWRB6\QF
&+
1$
6\P5DWH 0VSV
,
,)
6
1RUP
L
M
&20
$
$SSHQGL[$
7URXEOHVKRRWLQJ
V &DVHRI4$0&KRRVHWKLVFDVHWRWKHIROORZLQJGHVFULSWLRQVRIWKHFXUUHQWVHFWLRQ
4$0B
',*&3+5
35%6B0
&+
1$
6\P5DWH 0VSV
,
,)
$XWRB6\QF
6
1RUP
L
M
8S&RQYHUWHU6HWWLQJ&8
y $
y 5(01$
y 2370(18
,'/(2))
%$.8312
/
+-/
5(),17
7(67/('
7(67,1
5(9
&8
3*0$2))
$8;$2))
02'8',*
,0*,,,,,,,,,
,$*&2))
02'()54
5)21
5),,,,,,,,,
,137,)
6$0681*
&1975$
%
&$79$QDO\]HU+3&DQG6WHS$WWHQXDWRU6HWWLQJ
y &HQWHU)UHTXHQF\
0+]
y )UHTXHQF\6SDQ
0+]
y 5HVROXWLRQ%DQGZLGWK .+]
y 9LGHR%DQGZLGWK
.+]
y 3UHVV',63/$</LQH(QWHU
y $GMXVWVWHSDWWHQXDWRUVRWKDW',63/$</LQHUHDGVG%P9RQWKHVLJQDOVSHFWUXP
$
3&6HWWLQJ
y *HWULGRIWKHEODFNUXEEHUFDSXQGHUWKH,QIR5DQJHUWRH[SRVH3SRUW&RQQHFWWKH3SRUWDQGWKH
&20SRUWRIWKH3&WKURXJKWKH&RQVROH-LJERDUGZKLFKLVSURYLGHGIRUWKHSXUSRVHRIVHUYLFH5HIHU
WR¶&KDSWHU8VLQJWKH'LDJQRVWLF3URJUDP·DERXWWKLVPHWKRG
y $FWLYDWHD+\SHUWHUPLQDODQGFRQILJXUHWKH&20SRUWDVIROORZV
%36
'DWD%LW
3DULW\
12
6WRS%LW
)ORZ&RQWURO 12
,QIR5DQJHU6HWWLQJ
7KHIROORZLQJPHVVDJHVKRXOGDSSHDUPRPHQWDULO\RQWKH+\SHU7HUPLQDO3UHVVWKH>([email protected]\LQWKLV
VFUHHQ
'LDJQRVWLF6:IRU6&06HULHV9HU
6$0681*(/(&7521,&6
,QIRUPDWLRQ&RPPXQLFDWLRQ%XVLQHVV
1HWZRUN'LYLVLRQ%17JURXS
3UHVVDNH\WRVWDUWKDUGZDUHGLDJQRVWLFV
!!3UHVVWKH(QWHUNH\
7KHQWKHIROORZLQJPDLQPHQXRIWKHGLDJQRVWLFSURJUDPDSSHDUV
67$57
D0HPRU\7HVW
E(WKHUQHW7HVW
F0LVFHOODQHRXV7HVW
G&RRNLH
H&DEOH'RZQVWUHDP7HVW
I&DEOH8SVWUHDP7HVW
(6&([LW
(QWHU¶H·IURPWKH67$57!PHQXWRVWDUW¶'RZQVWUHDP0DLQ0HQX·
'RZQVWUHDP0DLQ0HQX
D5[6157HVW
E5HDG'RZQVWUHDP5HJLVWHU
F615
(6&([LW
$SSHQGL[$
$
7URXEOHVKRRWLQJ
:KHQWKHIROORZLQJPHVVDJHDSSHDUVHQWHUWKH0+]DVD'RZQVWUHDP)UHTXHQF\DQG
SUHVV>([email protected]\
,QSXW)UHTXHQF\
1H[WFKRRVHIRU6\PERO5DWHDQGSUHVV>([email protected]
,QSXW6\PERO5DWH
:KHQWKHIUHTXHQF\DQGWKH6\PERO5DWHDUHQRUPDOWKHUHVXOWLVGLVSOD\HGDVLQWKHIROORZLQJ<RXFDQ
DOVRFKHFNWKH615YDOXH(612
'(02'/2&.('
75(//,6/2&.('
)(&/2&.('
03(*/2&.('
(612 'RZQVWUHDP0DLQ0HQX
D5[6157HVW
E5HDG'RZQVWUHDP5HJLVWHU
F615
(6&([LW
5HIHUWR'RZQVWUHDPWHVWLQWKH¶&KDSWHU8VLQJWKH'LDJQRVWLF3URJUDP·
$
76)ORZ&KDUW
6WDUW
(
3HUIRUPIGLDJQRVWLFVLQ$
615!G%4$0
LVLQ/RFN)(&LV
LQ/RFN"
<(6
2.
12
9ROWDJHDW8
LV9"
12
<(6
'LJLWDO'DWD%XUVWV
DSSHDUDW78
ZKHQLQSXWWLQJ
6\PERO5DWH"
&KHFN8
(
12
&KHFNWKHDVVRFLDWHGSDWKVWR
8DQG78
<(6
(
5HPRYH5DQG5DQG
DSSO\9GFWR78DQG
9GFWR8
9ROWHJHVDW5
5DUH9SS
"
<(6
12
&KHFN78
(
$
$SSHQGL[$
7URXEOHVKRRWLQJ
9ROWHJHVDW+
+DUH9SS
"
12
&KHFN8DQG
<(6
3XOVHDSSHDUVDW
SLQ&$*&B,)
RI8"
DVVRFLDWHGSDVVLYHHOHPHQWV
(
12
<(6
&KHFN8
(
5HSODFH8
(
5HPRYH'&SRZHU6XSSO\DQG
UHVWRUH5DQG5
&KHFNDVVRFLDWHGSDWKVIURP
SLQ&'RIWR
3LQ$*&B,)RI8DQG
SLQ$*&B5)RI78
3HUIRUPIGLDJQRVWLFVLQ$
615!G%4$0
LVLQ/RFN
)(&LVLQ/RFN"
<(6
2.
12
$
8S6WUHDP&KHFN
3XUSRVH
7RFKHFNXSVWUHDPDQDORJVLJQDOIORZ
5HTXLUHG,QVWUXPHQWV
&$79$QDO\]HU3&&RQVROH-LJ%RDUG&RQVROHFDEOH56&FDEOH2VFLOORVFRSH'LJLWDO9ROW0HWHU
,QVWUXPHQWV&RQQHFWLRQ
6&056&08
6FRSH
3
3RZHU6SOLWWHU
&DEOH
&RQVROH-LJERDUG
'90
3&
'HWDLOHG6HWWQJV
&$79$QDO\]HU+3&
y 6WDUW)UHTXHQF\0+]
y 6WRS)UHTXHQF\0+]
y 5HVROXWLRQ%DQGZLGWK.+]
y 9LGHR%DQGZLGWK.+]
3&6HWWLQJ
y 5HIHUWR$SDJH
3&VHWWLQJ
,QIR5DQJHU6HWWLQJ
$IWHUVHWWLQJWKHHTXLSPHQWGHVFULEHGLQ$SDJHWKHIROORZLQJPHVVDJHVKRXOGDSSHDUPRPHQWDULO\RQ
WKH+\SHU7HUPLQDO3UHVVWKH>([email protected]\LQWKLVVFUHHQ
'LDJQRVWLF6:IRU6&06HULHV9HU
6$0681*(/(&7521,&6
,QIRUPDWLRQ&RPPXQLFDWLRQ%XVLQHVV
1HWZRUN'LYLVLRQ%17JURXS
3UHVVDNH\WRVWDUWKDUGZDUHGLDJQRVWLFV
!!3UHVVWKH(QWHUNH\
$
$SSHQGL[$
7URXEOHVKRRWLQJ
7KHQWKHIROORZLQJPDLQPHQXRIWKHGLDJQRVWLFSURJUDPDSSHDUV
67$57
D0HPRU\7HVW
E(WKHUQHW7HVW
F0LVFHOODQHRXV7HVW
G&RRNLH
H&DEOH'RZQVWUHDP7HVW
I&DEOH8SVWUHDP7HVW
(6&([LW
6WDUWWKH¶7[6LJQDO·PHQXE\HQWHULQJ
D
RQWKH8SVWUHDP0DLQ0HQX!
:KHQWKHIROORZLQJPHVVDJHDSSHDUVHQWHUWKHXSVWUHDPIUHTXHQF\DQGSUHVV>([email protected]
VKRZVDQH[DPSOHWRHQWHUIUHTXHQF\
,QSXW)UHTXHQF\
6HFRQGFKRRVHIRUWKH0RGXODWLRQ0RGHDQGSUHVV>([email protected]
436.4$0
,QSXWPRGXODWLRQPRGH
436.PRGHLVVHOHFWHG
1H[WVHOHFWIRU6\PERO5DWHDQGSUHVV>([email protected]
6\PERO5DWH
,QSXW6\PERO5DWH
6\PUDWHLVVHOHFWHG
)LQDOO\HQWHUG%P9IRU2XWSXW/HYHODQGSUHVV>([email protected]
G%P9G%P9
,QSXWOHYHO
RXWSXWOHYHOLVG%P9
:KHQDOOWKHSDUDPHWHUVDUHHQWHUHGWKHUHVXOWLVGLVSOD\HGDVLQWKHIROORZLQJ
)UHTXHQF\²+]
2XWSXW3ZU/YO G%PY
0HDVXUHWKH,QIR5DQJHUVLJQDOSRZHUDQGFKHFNWRVHHLIWKHYDOXHLVQRUPDO
5HIHUWR8SVWUHDPWHVWLQWKH¶&KDSWHU8VLQJWKH'LDJQRVWLF3URJUDP·
$
76)ORZ&KDUW
6WDUW
)
3HUIRUPJGLDJQRVWLFVLQ$
0DLQOREHSHDNLV
!G%P9"
<(6
2.
12
9ROWDJHDW8
57!9SS
DQG0+]"
12
<(6
9ROWDJHDW8
57DUHP
9SS"
<(6
)
&KHFN8
)
12
<(6
9ROWDJHDW&
&LVP9"
&KHFN<
12
&KHFN////
$
$SSHQGL[$
7URXEOHVKRRWLQJ
9ROWDJHDWSLQ
RI7LV
9SS"
12
3XOVHDWSLQ
$%&*DLQ
FRQWUROSRUWV
&7[(QDEOH
RIDUHKLJK"
,VFRPLQJRXW"
<(6
&KHFN8
<(6
12
&KHFNDVVRFLDWHGSDWKV
IURP8WR8
)
9ROWDJHDWSLQ
RI7LV
9SS"
<(6
&KHFN78
&KHFN7
)
$
3LQJ7HVW
3XUSRVH
7RFKHFNWKHFRQQHFWLYLW\EHWZHHQWKHFDEOHPRGHPDQGWKH+HDGHQGRU&076
5HTXLUHG,QVWUXPHQWV
6HUYHU&0768S&RQYHUWHU6WHS$WWHQXDWRU)L[HG$WWHQXDWRUG%['LSOH[HU&$79$QDO\]HU3&
&RQVROJ-LJERDUG&RQVROJFDEOH56&FDEOH
,QVWUXPHQWV&RQQHFWLRQ
8S&RQY
6WHS$WWHQ
+LJK
6&056&08
3
'LSOH[HU
/RZ
)L[HG$WWHQ
&076
&$%/(
8S6WUHDP
&DEOH,QWHUIDFH
(WKHUQHW,QWHUIDFH
&RQVROH-LJ
ERDUG
3&
(WKHUQHW
3&
&20
'+&37)7372'
6HUYHU3&
'HWDLOHG6HWWLQJV
&0766HWWLQJ
y $Q\'2&6,6FRPSOLDQW&076FDQEHXWLOL]HGKHUH5HIHUWRWKHUHODWHGPDQXDOVRIWKHFRUUHVSRQGLQJ
&076IRUGHWDLOHGLQIRUPDWLRQRQLWVVHWXS
6HUYHU6HWWLQJ
y ,QWKH)LJXUHDERYHDOOWKHVHUYHUV'+&37)7372'VHUYHUVDUHLQVWDOOHGLQDVLQJOHVHUYHUZLWK
:LQGRZV17DQGWKH6HUYHU,3DGGUHVVLVVHWDWIRUWKHSXUSRVHRIH[SHULPHQW
y '+&36HUYHU
([HFXWHWKHEXLOWLQ'+&3VHUYHU
$IWHUFOLFNLQJ'20$,1DQGWKHQ0$.(PHQXVVHWXSWKH,3DGGUHVVSRROZKLFKZLOOEHDOORFDWHG
WRWKHFDEOHPRGHPVFRQQHFWHGWRWKH&0767KHDOORFDWHG,3DGGUHVVHVVKRXOGKDYHDFRPPRQ
VXEQHWZLWKWKH&DEOH,QWHUIDFH,3KHUH[[[
$IWHUFOLFNLQJ'+&3237,21DQGWKHQ*/2%$/PHQXVVHWXS5287(57,0(6(59(57,0(
2))6(7%227),/(1$0(E\DVVLJQLQJ&DEOH,QWHUIDFH,3$GGUHVVRI&076KHUH7)73
VHUYHU,3DGGUHVVKHUHWLPHRIIVHWEHWZHHQ72'VHUYHUDQGFDEOHPRGHPVKHUH
FRQILJXUDWLRQILOHQDPHKHUHVDPVXQJFQIWRWKHPUHVSHFWLYHO\
$
$SSHQGL[$
7URXEOHVKRRWLQJ
y 7)736HUYHU
,IWKH7)73VHUYHULVQRWLQVWDOOHGLQWKHVHUYHUGRZQORDGD7)73VHUYHUIURPWKH,QWHUQHWKHUH
7)736HUYHU3UR9IURPKWWSZZZZDOXVRIWFRXN
$IWHUH[HFXWLQJ7)73VHUYHUVHWXSRXWERXQGGLUHFWRU\WRZKHUHV\VWHPLPDJHVDQGFRQILJXUDWLRQ
ILOHVDUHORFDWHG
y 72'6HUYHU
,IWKH72'VHUYHULVQRWLQVWDOOHGLQWKHVHUYHUGRZQORDGD72'VHUYHUIURPWKH,QWHUQHWKHUH
7LPH6\QF9IURPKWWSZZZQRZDUHDFFFRDW
$IWHUH[HFXWLQJ7LPH6\QFVHWXS1HZ61731HZ7LPH1HZ8QL7LPH1HZ1HW5HPRWH72'E\
DVVLJQLQJWKHVHUYHU,3DGGUHVVKHUHWRWKHPUHVSHFWLYHO\
6WHS$WWHQXDWRU6HWWLQJ
y $GMXVWVWHSDWWHQXDWRUVRWKDWWKHLQSXWVLJQDOOHYHOLVDERXWG%P9
3&6HWWLQJ
y *HWULGRIWKHEODFNUXEEHUFDSXQGHUWKH ,QIR5DQJHUWRH[SRVHSRUW&RQQHFWWKH3SRUWDQGWKH
&20SRUWRIWKH3&WKURXJKWKH&RQVROH-LJERDUGZKLFKLVSURYLGHGIRUWKHSXUSRVHRIVHUYLFH5HIHU
WRWKH&KDSWHURIWKLVPDQXDODERXWWKLVPHWKRG
y $FWLYDWHD+\SHUWHUPLQDODQGFRQILJXUHWKH&20SRUWDVIROORZV
%36
'DWD%LW
3DULW\
12
6WRS%LW
)ORZ&RQWURO 12
,QIR5DQJHU6HWWLQJ
y $IWHUUHVHWWLQJ,QIR5DQJHUHQWHUWKHDXWRERRWLQJPRGHE\OHDYLQJWKHFRXQWGRZQWRUHDFK
$
76)ORZ&KDUW
6WDUW
,
5HVHWWKHPRGHPDQGZDLWIRU
DZKLOHXQWLOWKHFRXQWZRUQ
UHDFKHVDQGWKHPRGHP
HQWHUVDXWRERRWLQJPRGH
$IWHUEOLQNLQJ*UHHQ5&9
/('21"'LDJQRVWLFVKRZV
VXFFHVVIXOGRZQVWUHDP
IUHTXHQF\GHWHFWLRQ
12
*RWR$'RZQVWUHDP&KHFN
,
*RWR$8SVWUHDP7)7372'
'+&36HUYHU&076&KHFN
,
7)7372''+&36HUYHU
&076&KHFN
,
<(6
$IWHUEOLQNLQJ*UHHQ
61'/('21"'LDJQRVWLF
VKRZVDOOFRQILJXUDWLRQRI
&076DUHGRQH
12
<(6
3HUIRUP3LQJ7HVWWR6HUYHUE\
W\SLQJLQSLQJ
3LQJWHVW2."
<(6
2.
12
$
$SSHQGL[$
7URXEOHVKRRWLQJ
7URXEOHVKRRWLQJLQ1HWZRUN/D\HU
y%ROGIDFHIRQW
y&RQWHQWVLQ &RPPDQGWREHW\SHG
&RPPHQWVWRKHOSXQGHUVWDQGLQJ
1RUPDOVWDWH
Æ 7KH,QIR5DQJHUZRUNVZHOOZLWKRXWDQ\SUREOHP
&RPSDQ\6$0681*
3URGXFW([WHUQDO(WKHUQHW&DEOH0RGHP
3DUW5HY
7DUJHW1DPHY[7DUJHW
8VHUWDUJHW
0$&&RGH9HUVLRQ
XO8VE7UDFH/HYHOFKDQJLQJIURPWR
XO8VE7UDFH/HYHOFKDQJLQJIURPWR
86%BORDGFRPSOHWH
$WWDFKHG7&3,3LQWHUIDFHWRPDFXQLW
$WWDFKLQJQHWZRUNLQWHUIDFHORGRQH
/YO2(02(0'HVFULSWRUY)RXQG
/YO%DFNJURXQG7LPHU6HW
/YO2(0(0$&VHWWRIEGEE
/YO2(0&0$&VHWWRIEGEF
/YO2(086%VHWWRIEGEG
/YO2(0,QLWLDOL]DWLRQFRPSOHWH
/YO%3,,QIRUPDWLRQDO$)606WDWH&KDQJHGWR6WDUW6WDWH
1)6FOLHQWVXSSRUWQRWLQFOXGHG
XVU1HW,QLW'RQH
/YO6FDQQLQJFKDQQHO+]/DVW*RRG
/YO(WKHUQHW,QWHUIDFHLVGRZQ
/YO86%,QWHUIDFHLVGRZQ
/YO0$&,QWHUIDFHLVXS
/YO'RZQVWUHDP,QWHUIDFHLVXS
/YO(WKHUQHW,QWHUIDFHLVXS
/YO86%,QWHUIDFHLVXS
/YO$FTXLUHG'6)UHT0RG4$0
/YO)RXQG8&','
V
/YO8SVWUHDP,QWHUIDFHLVXS
/YO6WDUWLQJ'+&3
/YO'+&3VXFFHVVIXO&0,3
/YO6WDUWLQJ72'DW
/YO72'6XFFHVVIXO:(''(&
/YO6WDUWLQJ7IWS&RQILJ)LOH*HW
VDPFQI
DW
/YO&RQILJ)LOH*HW6XFFHVVIXO
/YO8QUHFRJQL]HGW\SH
/YO3HUIRUPLQJFKHFNIRUERRWVWDWHEDVHG6:8SJUDGH
FRPSDUH)LOH5HVXOW /YO6WDUWLQJ5HJLVWUDWLRQZLWKWHPS6LG
/YO5HJ5VS2.6XFFHVVIXO
/YO6HUYLFH&ODVV,G6,'
/YO0D[&3(VHWWRE\FRQILJILOH
/YO6QPS&ROG6WDUW6XFFHVVIXO
/YO3HUIRUPLQJFKHFNIRUSRVWFRQILJILOHEDVHG6:8SJUDGH
FRPSDUH)LOH5HVXOW /YO&02SHUDWLRQDO
$
1R'+&3VHUYHU
Æ ,QIR5DQJHUKDVSUREOHPZLWK'+&3RU72'DQGHWF
&RPSDQ\6$0681*
3URGXFW([WHUQDO(WKHUQHW&DEOH0RGHP
3DUW5HY
7DUJHW1DPHY[7DUJHW
8VHUWDUJHW
0$&&RGH9HUVLRQ
XO8VE7UDFH/HYHOFKDQJLQJIURPWR
XO8VE7UDFH/HYHOFKDQJLQJIURPWR
86%BORDGFRPSOHWH
$WWDFKHG7&3,3LQWHUIDFHWRPDFXQLW
$WWDFKLQJQHWZRUNLQWHUIDFHORGRQH
!/YO2(02(0'HVFULSWRUY)RXQG
/YO%DFNJURXQG7LPHU6HW
/YO2(0(0$&VHWWRIEGEE
/YO2(0&0$&VHWWRIEGEF
/YO2(086%VHWWRIEGEG
/YO2(0,QLWLDOL]DWLRQFRPSOHWH
/YO%3,,QIRUPDWLRQDO$)606WDWH&KDQJHGWR6WDUW6WDWH
1)6FOLHQWVXSSRUWQRWLQFOXGHG
XVU1HW,QLW'RQH
/YO6FDQQLQJFKDQQHO+]/DVW*RRG
/YO(WKHUQHW,QWHUIDFHLVGRZQ
/YO86%,QWHUIDFHLVGRZQ
/YO0$&,QWHUIDFHLVXS
/YO'RZQVWUHDP,QWHUIDFHLVXS
/YO$FTXLUHG'6)UHT0RG4$0
/YO)RXQG8&','
V
/YO8SVWUHDP,QWHUIDFHLVXS
/YO6WDUWLQJ'+&3
/YO'KFSVHQGLQJ',6&29(5
GKGKFSF%LQGIDLOHG2.
GKFS&IJ4XHU\GKFS3DUDPV*HWIDLOHGHUUQR [D
/YO'KFSGKFS&IJ*HW)DLOHG
/YO2(0V\VWHPUHVWDUW
<RXUFRQILJXUDWLRQILOHIRU&DEOHPRGHPVKRXOGEHORFDWHGLQ\RXU7)73VHUYHU
&RQILJXUDWLRQILOHPD\KDYHIROORZLQJLWHPV
'RZQVWUHDP)UHTXHQF\
8SVWUHDPFKDQQHO,'
&ODVVRIVHUYLFHJURXS
PDQGDWRU\ILHOG
FODVV,'PD[LPXPGRZQVWUHDPUDWH
ELWSHUVHFRQG
PD[LPXPXSVWUHDPUDWH
ELWSHUVHFRQG
XSVWUHDPFKDQQHOSULRULW\
VKRXOGEHZLWKWKHKLJKHVWSULRULW\
*XDUDQWHHGPLQLPXPXSVWUHDPUDWH
ELWSHUVHFRQG
0D[LPXPXSVWUHDPWUDQVPLWEXUVW
6RIWZDUHXSJUDGHILOHQDPH
&3((WKHUQHW0$&DGGUHVV
'2&6,65),VSHFLILFDWLRQDOVRKDVDGGLWLRQDOLQIRUPDWLRQRQFRQILJXULQJILOHIRU&076
,I\RXZDQWWRVHWWR\RXUGRZQVWUHDPIUHTXHQF\
!VGI0+]
$
$SSHQGL[$
7URXEOHVKRRWLQJ
7KLVSDJHLVOHIWEODQNLQWHQWLRQDOO\
%
$SSHQGL[% 7HVWLQJ,QIR5DQJHU
3XUSRVHRIWKH3ODQ
7KHSXUSRVHRIWKLVSODQLVWRRXWOLQHWKHYDULRXVDUHDVRILQIRUPDWLRQWKDWLVLPSRUWDQWIRUWKHVXFFHVVRI
3DUWQHUV)LHOG7ULDOV
)HDWXUH6HW
7KHIROORZLQJVDUHWKHFXUUHQWIHDWXUHVIRU)LHOG7ULDO
O 6103$JHQWIRU)LOWHU,3WDEOH)LOWHU//&WDEOH'HY)LOWHUJURXS
O /('GULYHU
O 1HZFRRNLH
O 4$0436.
O (WKHUQHWGLDJQRVWLFV
O '+&3
O 0,%YDOXHV
O )ODVK
O %RRWILOHV
O 72'(QWULHV
O &RQILJXUDWLRQILOHVXVLQJ7)73
O 9[:RUNVVWLQIODVK
O QP$FFHVVWDEOHILOWHULQJ
O )ODVKILOHV\VWHP
O %DVHOLQH3ULYDF\56$HQFU\SWLRQ
O 3ULYDF\0,%
%
$SSHQGL[%
7HVWLQJ,QIR5DQJHU
7\SLFDO+DUGZDUH6HWXS
7KHIROORZLQJLVDVXJJHVWHGOLVWRIKDUGZDUH
O 2QHFDEOHURXWHU+HDGHQG
O 7ZR,QIR5DQJHUOLQHFDUGV
O 2QH&8XSVWUHDPFRQYHUWHU
O $WWHQXDWRUV
O 2QHGLSOH[HUILOWHU
O 2QHVSOLWWHU
O 7ZRVXEVFULEHUXQLWV,QIR5DQJHU
O )RXU,%0FRPSDWLEOH3&V
O )RXU%$6(7(WKHUQHW1,&V
O 7ZRWULVHJPHQWKXEV
O 2QHURXWHUWREHXVHGDVD&RPVHUYHU
O 2QHPDVWHUFRQVROH
O 2QHPLFURZHE6HUYHU
O 2QH6RODULV81,;ZRUNVWDWLRQ
O 2QH06:LQGRZV176HUYHU
O 2QHUDFN
,QIR5DQJHU7HVW7RSRORJ\
)LJXUH% ,QIR5DQJHU7HVW7RSRORJ\
%
7\SLFDO6XJJHVWHG7HVWV
O )73WHVWLQJ
O ,QWHUQHWDFFHVV
O 7)73VHUYHUFRQILJXUDWLRQ
O X%5WHVWLQJURXWLQJSURWRFRO
O )HDWXUHVHWFRQWHQW
O 6HFXULW\
O 6WDELOLW\
O 0,%
O ,PDJHXSJUDGH
O 3OXJDQGSOD\
7HVW(QYLURQPHQWDQG6HWXS2YHUYLHZ
7KLVVHFWLRQGHVFULEHVWKHWHVWHQYLURQPHQWDQGVWHSVWKDWWHVWVWDIIXVHVWRH[HUFLVH,QIR5DQJHU%\
FRPSDULQJWKHWHVWHQYLURQPHQWWR\RXURZQ\RXFDQOHDUQKRZWRFRQILJXUH\RXURZQHQYLURQPHQW
7KLVGRFXPHQWSURYLGHVFKHFNOLVWVRIHQYLURQPHQWYDULDEOHVWKDWZLOOEHXQLTXHWR\RXUHQYLURQPHQWDQG
WKDW\RXZLOOQHHGWRVHWXS\RXUHQYLURQPHQW,WFRQWDLQVWKHIROORZLQJVHFWLRQV
O ¶6HWWLQJ8SWKH7HVW(QYLURQPHQW·VHFWLRQGHVFULEHVKRZWRFRQILJXUHWKHVHUYHUVDQGURXWHUVLQ\RXU
WHVWHQYLURQPHQWWRDFFRPPRGDWH&05'EDVHG,QIR5DQJHU
O ¶6HWWLQJXSWKH,QIR5DQJHUIRUWKHILUVWWLPH·VHFWLRQGHVFULEHVZKDW\RXPXVWGRWRHDFK,QIR5DQJHU
WKDW\RXZDQWWRWHVWLQWKHWHVWHQYLURQPHQW
6HWWLQJ8SWKH7HVW(QYLURQPHQW
7KLVVHFWLRQGHVFULEHVKRZWRFRQILJXUHWKHVHUYHUVDQGURXWHUVWRDFFRPPRGDWHWKH,QIR5DQJHULQ\RXUWHVW
HQYLURQPHQW,WFRQWDLQVWKHIROORZLQJVHFWLRQV
O 8QGHUVWDQGLQJWKHWHVWHQYLURQPHQW
O 6HWWLQJXSWKH&076
O 6HWWLQJXSWKHVXSSRUWVHUYLFHV
7KLVGRFXPHQWGRHVQRWGHVFULEHFRQILJXUDWLRQRIWKHVHFXULW\VHUYHUVQHHGHGWRVXSSRUW%DVHOLQH
3ULYDF\
%
$SSHQGL[%
7HVWLQJ,QIR5DQJHU
8QGHUVWDQGLQJWKH7HVW(QYLURQPHQW
7KLVVHFWLRQGHVFULEHVWKHWHVWQHWZRUNDQGLGHQWLILHVYDULDEOHVWKDWZLOOEHGLIIHUHQWLQ\RXURZQWHVW
QHWZRUN7KHJRDORIWKHWHVWHQYLURQPHQWLVWRDSSUR[LPDWHWKHHQYLURQPHQWLQZKLFK062VZLOOGHSOR\
,QIR5DQJHUIRUWHVWSXUSRVHV7KHPDLQGLIIHUHQFHVEHWZHHQWKHWHVWHQYLURQPHQWDQGWKH062HQYLURQPHQW
DUH
O 7KH,QIR5DQJHULQWKHWHVWHQYLURQPHQWPD\KDYHDFFHVVWRQHWZRUNVHUYHUVIRULQLWLDOFRQILJXUDWLRQ
EHIRUHWKH\FDQEHWHVWHG)RULQIRUPDWLRQDERXWLQLWLDOFRQILJXUDWLRQVHHWKHVHFWLRQ¶6HWWLQJXSWKH
,QIR5DQJHUIRUWKHILUVWWLPH·VHFWLRQ
O 7KH,QIR5DQJHULQWKHWHVWHQYLURQPHQWPD\EHHTXLSSHGZLWKVHULDOSRUWVIRUWHVWLQJYLDDWHUPLQDO
FRQQHFWHGGLUHFWO\WRWKHVHULDOSRUWRUYLDDFRPPXQLFDWLRQVHUYHU7KH,QIR5DQJHUPD\QRWLQFOXGH
VHULDOSRUWVZKHQGHSOR\HGE\062VDQGWKHGLDJQRVWLFVVRIWZDUHPD\QRWEHLQFOXGHGLQWKHVRIWZDUH
LPDJHVLQVWDOOHGLQWKH,QIR5DQJHU
7KHWHVWHQYLURQPHQWGRHVQRWUHSUHVHQWWKHGHYHORSPHQWV\VWHPVXVHGWRFUHDWHV\VWHPLPDJHV
IRUWKH,QIR5DQJHU)LJXUH%SUHVHQWVWKHWHVWHQYLURQPHQWXVHGE\6DPVXQJ·VWHVWVWDII7KLVWHVW
HQYLURQPHQWXVHV,3DGGUHVVHVUHVHUYHGE\WKH,QWHUQHW$VVLJQHG1XPEHUV$XWKRULW\,$1$IRU
SULYDWHLQWHUQHWV
)RUGHWDLOVRQWKHUHVHUYHG,3DGGUHVVHVVHH5)&<RXFDQXVHWKHVH,3DGGUHVVHVIRUWHVW
SXUSRVHVRULIFRQQHFWLYLW\ZLWKWKH,QWHUQHWLVUHTXLUHG\RXFDQXVH\RXURZQ,3DGGUHVV
6HWWLQJ8SWKH+HDGHQG
0DNHVXUHWKH&076OLQHFDUGLVHTXLSSHGZLWKWKHODWHVWVXSSRUWHGVRIWZDUHLPDJHDQGWKDWWKHLPDJHV
ORDGHGLQWRWKH,QIR5DQJHUDQG\RXU7)73VHUYHUDUHFRPSDWLEOHZLWKLW)RUGHWDLOVRQORDGLQJVRIWZDUH
LPDJHVLQWR\RXU&LVFRX%5VHHWKH&LVFRX%5GRFXPHQWDWLRQ,QWKHWHVWHQYLURQPHQWVKRZQLQ)LJXUH%
WKHX%5FRQILJXUDWLRQILOHFRQWDLQVWKHIROORZLQJFRQILJXUDWLRQHQWULHVIRUWKH&DEOHLQWHUIDFH
LQWHUIDFH&DEOH
LSDGGUHVV
LSKHOSHUDGGUHVV
QRLSUHGLUHFWV
QRLSSUR[\DUS
LSSLPGHQVHPRGH
QRLSURXWHFDFKH
QRLSPURXWHFDFKH
QRNHHSDOLYH
VKXWGRZQ
FDEOHLQVHUWLRQLQWHUYDO
FDEOHGRZQVWUHDPDQQH[%
FDEOHGRZQVWUHDPPRGXODWLRQTDP
FDEOHGRZQVWUHDPLQWHUOHDYHGHSWK
FDEOHXSVWUHDPIUHTXHQF\
FDEOHXSVWUHDPSRZHUOHYHO
FDEOHXSVWUHDPPRGXODWLRQSURILOH
QRFDEOHXSVWUHDPVKXWGRZQ
)RURWKHUFDEOHLQWHUIDFHFRQILJXUDWLRQVHH\RXUX%5GRFXPHQWDWLRQ
%
$ERXWWKH8S&RQYHUWHU'LSOH[HUDQG$WWHQXDWRUV
7RHQVXUHWKDWWKHXSVWUHDPDQGGRZQVWUHDPIUHTXHQFLHVDWWKHKHDGHQGPDWFKWKHIUHTXHQFLHVDWWKH
,QIR5DQJHUWKHWHVWHQYLURQPHQWLQFOXGHVDQXSFRQYHUWHU
7KHH[DPSOHWHVWHQYLURQPHQWVHH)LJXUH%HPSOR\VD*HQHUDO,QVWUXPHQW&8XSFRQYHUWHUZKLFKKDV
WZRGRZQVWUHDPFKDQQHOV$DQG%2QH&8WKHUHIRUHVXSSRUWVWZROLQHFDUGVHDFKWUDQVPLWWLQJRQWZR
GLIIHUHQWFKDQQHOV
7KHGRZQVWUHDPIUHTXHQF\LVVHOHFWHGEDVHGRQWKHFKDQQHOVHOHFWHGRQWKHXSFRQYHUWHU)RUH[DPSOH
&KDQQHO-HUROGFKDQQHOQXPEHULQWKH(,$FROXPQ0+](,$FKDQQHOIRUWKH+3DQDO\]HU
7KH&8VKRXOGEHVHWRQ67'DQG',*7KHKHDGHQGXVXDOO\JHQHUDWHVGRZQVWUHDPVLJQDOSRZHURIXSWR
GEPYDW0+]7KH8S&RQYHUWHUJHQHUDWHVD0+]VLJQDOWRWKHQHWZRUN*HQHUDOO\WKHSURSHU
LQSXWWRWKH,QIR5DQJHULVPDLQWDLQHGDURXQGGEPY,IWKHLQSXWIDOOVEHORZGEPYDYHU\UDUH
RFFXUDQFHLQVWDOODPSOLI\LQJHOHPHQWVWRERRVWLW$WWHQXDWRUVDUHIDVWHQHGWRWKHKLJKHQGRIWKHGLSOH[HU
ILOWHUZKLFKIHHGVWKHGRZQVWUHDPFKDQQHO7KH,QIR5DQJHUXSVWUHDPRXWSXWLVW\SLFDOO\PXFKOHVVWKDQ
GEPY7KH'2&6,6VSHFLILFDWLRQVUHTXLUHDWWHQXDWLRQWRDFFRPPRGDWHOHVVWKDQGEPYDW0+]7KH
XSVWUHDPVLJQDOLQSXWSRZHUWRWKHKHDGHQGVKRXOGEHFORVHWRGEPY
$OOFRPSRQHQWVFRQWULEXWHWRWKHRYHUDOOVLJQDODWWHQXDWLRQLQDGGLWLRQWRWKHDWWHQXDWRUV)URPD
,QIR5DQJHU·VSHUVSHFWLYHWKHGLSOH[HUILOWHULVDVLJQDOVHSDUDWRURIKLJK0+]DQGORZ0+]
IUHTXHQFLHV6SOLWWHUVDOVRFRQWULEXWHWRVLJQDODWWHQXDWLRQ7DEOH%OLVWVWKHDPRXQWRIDWWHQXDWLRQ
FRQWULEXWHGE\FRPPRQVSOLWWHUV'LSOH[HUVW\SLFDOO\FRQWULEXWHG%RIDWWHQXDWLRQDQGFRD[ZLUHFRQWULEXWHV
DWWHQXDWLRQWKDWYDULHVZLWKVLJQDOIUHTXHQF\
Splitter Type
Attenuation
ZD\
G%SHUSRUW
ZD\
G%RQSRUWG%RQWKHWKLUGRUG%RQDOOWKUHHSRUWV
ZD\
G%SHUSRUW
ZD\
G%RUG%SRUW
ZD\
G%SHUSRUW
7DEOH% 6SOLWWHU$WWHQXDWLRQOLVW
%
$SSHQGL[%
7HVWLQJ,QIR5DQJHU
6HWWLQJ8SWKH6XSSRUW6HUYLFHV
7KLVVHFWLRQGHVFULEHVKRZVXSSRUWVHUYLFHVDUHFRQILJXUHGWRDFFRPPRGDWH,QIR5DQJHULQWKHWHVW
HQYLURQPHQW,WFRQWDLQVWKHIROORZLQJVHFWLRQV
O 6HWWLQJXSWKH7)73VHUYHU
O 6HWWLQJXSWKH'+&3VHUYHU
O 6HWWLQJXSWKH72'VHUYHU
6HWWLQJ8SWKH7)736HUYHU
7KH7)73VHUYHU6LQ)LJXUH%QHHGVWRSURYLGHV\VWHPLPDJHVDQGFRQILJXUDWLRQILOHVUHTXLUHGE\
'2&6,6FRPSOLDQWFDEOHPRGHPV&0DQG&0,QWKHWHVWH[DPSOHWKHFXUUHQW,QIR5DQJHUV\VWHPLPDJH
Y[ZRUNVVWDQGFRQILJXUDWLRQILOHWHVWFQIDUHLQVWDOOHGRQWKH7)73VHUYHU,3DGGUHVVDQ17
VHUYHUUXQQLQJ'+&3VHUYHU
,I\RXZDQWWRGRZQORDGDQHZV\VWHPLPDJHWRWKH,QIR5DQJHUIURPWKH7)73VHUYHU\RXPXVW
HLWKHUXVHDQ6103PDQDJHPHQWV\VWHPWRLQLWLDWHWKHGRZQORDGRUFKDQJHWKHV\VWHPLPDJHILOH
QDPHDQGLQFOXGHWKHQHZILOHQDPHLQWKH,QIR5DQJHUFRQILJXUDWLRQILOHVRWKDW,QIR5DQJHUZLOO
NQRZWKDWDQHZV\VWHPLPDJHLVDYDLODEOH)RUJHQHUDOLQIRUPDWLRQDERXW'2&6,6FRPSOLDQW
FRQILJXUDWLRQILOHUHIHUWR$SSHQGL[&LQWKH'2&6,6VSHFLILFDWLRQ
)RUVHFXULW\SXUSRVHVXVHWKH7)73VHUYHUFRQILJXUDWLRQSDUDPHWHU5(675,&7$&&(66RUWKH
HTXLYDOHQWWRUHVWULFW7)73DFFHVVWRVSHFLILFGLUHFWRULHV,I5(675,&7$&&(66LVQRWFRQILJXUHGDOO
´ZRUOGUHDGDEOHµILOHVDUHDFFHVVLEOHWR7)73FOLHQWV2QWKH&''07)73VHUYHUWKH5(675,&7
$&&(66SDUDPHWHULVHQDEOHGE\GHIDXOW
%
6HWWLQJ8SWKH'+&36HUYHU
7KH'+&3VHUYHU6QHHGVWRSURYLGH,3FRQILJXUDWLRQGDWDIRU,QIR5DQJHU&0DQG&07KHIROORZLQJ
WDEOHOLVWVWKHFRQILJXUDWLRQSDUDPHWHUVWKDWWKH'+&3VHUYHUPXVWVXSSO\IRU&0DQG&0<RXPD\DOVR
FRQILJXUHWKH'+&3VHUYHUWRSURYLGHQHWZRUNFRQILJXUDWLRQSDUDPHWHUVIRUKRVWV3&VFRQQHFWHGWR
HDFK,QIR5DQJHU·V/$1LQWHUIDFH,QWKHWHVWH[DPSOHD:LQGRZV17VHUYHU,3DGGUHVV
ZLWK'+&3VHUYHUSOD\VWKHUROHRIWKH'+&3VHUYHU)RUHDFK,QIR5DQJHUWKHUHLVDFRUUHVSRQGLQJ´VWDWLFµ
'+&3HQWU\WKDWPDSVWKH,3FRQILJXUDWLRQSDUDPHWHUVWRWKH,QIR5DQJHU·V0$&DGGUHVV´6WDWLFµOHDVHV
FDQQRWEHDVVLJQHGWRDQ\GHYLFHRWKHUWKDQWKHRQHZLWKWKHVSHFLILHG0$&DGGUHVVHYHQLIWKHOHDVH
H[SLUHV
7RDVVLJQWKHVWDWLF,3DGGUHVVWRDVSHFLILF,QIR5DQJHUWKH0$&DGGUHVVHVRI&0DQG&0
PXVWEHNQRZQ7KHSUHGHWHUPLQHG0$&DGGUHVVHVDUHSURJUDPPHGLQWRHDFK,QIR5DQJHU·V
´FRRNLHµ
)RUPRUHGHWDLOVRQ'+&3VHHWKHIROORZLQJ5)&V
O5)&'\QDPLF+RVW&RQILJXUDWLRQ3URWRFRO
O5)&'+&32SWLRQVDQG%22739HQGRU([WHQVLRQV
3DUDPHWHU
&0
&0
0$&$GGUHVV
HHDEFDH
HHDEGDH
,3$GGUHVV
6XEQHW0DVN
'HIDXOW5RXWH
7LPH6HUYHU
7LPH2IIVHW
367
367
7)73VHUYHU
&RQILJILOH
WHVWFQI
WHVWFQI
7)73GLUHFWRU\
PXOWLQHWWIWS
PXOWLQHWWIWS
6HWWLQJ8SWKH72'6HUYHU
7KH72'VHUYHU6QHHGVWRSURYLGHWLPHVHUYLFHWR,QIR5DQJHU&0DQG&07LPHVWDPSVDUHUHTXLUHG
LQWHUQDOO\IRUUHJXODU&0IXQFWLRQVVXFKDV'+&3OHDVHUHQHZDOWLPHVDQGORJJLQJ&0HYHQWV,QWKHWHVW
H[DPSOH6LVD8QL[VHUYHU,3DGGUHVV:LQGRZV17V\VWHPVPD\UHTXLUHDGGLWLRQDO
VRIWZDUHVXFKDVWKH5&&7LPHVHUYHU$VLGHIURPPDNLQJVXUHWKH72'VHUYHULVUXQQLQJQRXQLTXH
FRQILJXUDWLRQLVUHTXLUHG)RUPRUHGHWDLOVRQ72'VHUYLFHVHH5)&
%
$SSHQGL[%
7HVWLQJ,QIR5DQJHU
&RQILJXULQJWKH&OLHQW3&V
,QWKHWHVWHQYLURQPHQWWKH3&FOLHQWVZKLFKUHSUHVHQWUHVLGHQWLDOKRVWV´EHKLQGµ,QIR5DQJHUFDQEH
FRQILJXUHGPDQXDOO\DVZHOODVDXWRPDWLFDOO\ZLWKSUHGHWHUPLQHG,3FRQQHFWLYLW\SDUDPHWHUV,3DGGUHVV
VXEQHWPDVN'16VHUYHUOLVWGHIDXOWJDWHZD\V7KHIROORZLQJWDEOHOLVWVWKHSDUDPHWHUVPDQXDOO\
FRQILJXUHGLQWKHIRXUFOLHQW3&V
$OOFOLHQW3&VVSHFLI\WKH,3DGGUHVVRIWKH&076FDEOHLQWHUIDFHDVWKHGHIDXOW
URXWHU,QWKHWHVWHQYLURQPHQWDOOIRXUFOLHQWVXVHWKH6,3DGGUHVVDV'16
VHUYHUVD:LQGRZV17VHUYHUUXQQLQJ'+&3VHUYHU
3DUDPHWHU
3&
3&
3&
3&
,3$GGUHVV
6XEQHW0DVN
'HIDXOW5RXWH
'166HUYHU
6HWWLQJ8S,QIR5DQJHUIRUWKH)LUVW7LPH
7KLVVHFWLRQGHVFULEHVZKDW\RXPXVWGRWRHDFK,QIR5DQJHUWKDW\RXZDQWWRWHVWLQWKHWHVWHQYLURQPHQW
%HIRUH\RXLQVWDOO,QIR5DQJHULQWKHWHVWHQYLURQPHQWFRQILJXUHWKH,QIR5DQJHUZLWKWKHIROORZLQJ
O 3URJUDPPHGFRRNLH0$&DGGUHVVVHULDOQXPEHU
O %RRW0RQLWRULPDJHDQGV\VWHPLPDJHLQ)ODVKEDQN
2QWHVW,QIR5DQJHUHTXLSSHGZLWKVHULDOLQWHUIDFHDQGGLDJQRVWLFVVRIWZDUHXVHWKH,QIR5DQJHUKDUGZDUH
GLDJQRVWLFXWLOLW\WRSURJUDPWKHFRRNLHDQGFRS\LPDJHVLQWR)ODVKPHPRU\,QPDQXIDFWXULQJHQYLURQPHQW
WKHLPDJHVPD\EHZULWWHQWR)ODVKPHPRU\EHIRUHLQVWDOODWLRQLQWKH,QIR5DQJHU
7RLQLWLDOO\GRZQORDGLPDJHVLQWR)ODVKPHPRU\,QIR5DQJHUPXVWDFFHVVWRWKH7)73VHUYHUYLD
WKHLU(WKHUQHWLQWHUIDFHV
%
7R%HJLQWKH'HEXJJLQJ3URFHVV
$OOUHSRUWHGSUREOHPVPXVWFRQWDLQEDVLFLQIRUPDWLRQDERXWWKHHQYLURQPHQW7KHLQIRUPDWLRQUHTXHVWHGLQ
WKH´%DVLF,QIRUPDWLRQµVHFWLRQEHORZLVWKHFRPPDQGVXVHGDWPRGHPFRQVROHDQG5(48,5('ZKHQ
UHSRUWLQJDQ\SUREOHPV,VVXHWKHFRPPDQGVDQGFDSWXUHWKHRXWSXWWRIRUZDUGWR6DPVXQJVXSSRUW
%DVLF,QIRUPDWLRQ
O ,VVXHWKHFRPPDQGYHUVLRQFRPPDQGDWWKH,QIR5DQJHUFRQVROHSURPSWWRGLVSOD\WKH26YHUVLRQ
LQIRUPDWLRQ
O ,VVXHWKHFRPPDQGLI6KRZFRPPDQGDWWKH,QIR5DQJHUFRQVROHSURPSWWRGLVSOD\WKHGHWDLOHG
LQIRUPDWLRQRIWKHLQWHUIDFHUHJLVWHU
O ,VVXHWKHFRPPDQGQHW+HOSFRPPDQGWRVKRZWKHQHWZRUNFRPPDQGV
O ,VVXHWKHFRPPDQGXS6WDWWRGLVSOD\WKHXSVWUHDPLQIRUPDWLRQ
O ,VVXHWKHFRPPDQGGPG6WDWWRGLVSOD\WKHGRZQVWUHDPLQIRUPDWLRQ
O ,VVXHWKHFRPPDQGKHOS6WDWWRSULQWRXWWKHFRPPDQGVUHODWHGWRWKHVWDWLVWLFV
,QIR5DQJHU5HVHWV
7RUHFRQILJXUHWKH,QIR5DQJHUUXQUHERRWRUSUHVV&WUO[
*DWKHULQJ'HEXJ,QIRUPDWLRQ
7KLVVHFWLRQGHVFULEHVFRPPDQGVWKDWFDQEHXVHGWRJDWKHUPRUHLQIRUPDWLRQZKHQDSUREOHPRFFXUV
3URYLGLQJDVPXFKLQIRUPDWLRQDVSRVVLEOHZKHQILUVWUHSRUWLQJWKHSUREOHPZLOOIDFLOLWDWHDTXLFNSUREOHP
UHVROXWLRQ1RWDOOFRPPDQGVZLOODSSO\WRDOOVLWXDWLRQV:KHQLQGRXEWSURYLGHRXWSXWIURP$//WKH
GHEXJJLQJFRPPDQGVOLVWHGLQWKLVVHFWLRQ6DPVXQJVXSSRUWPD\UHTXHVWPRUHVSHFLILFLQIRUPDWLRQDVWKH
GLDJQRVLVRIWKHSUREOHPSURJUHVVHV
%HJLQE\'HVFULELQJWKH3UREOHP
O 'HVFULEHZKDWDFWXDOO\RFFXUV'HVFULEHWKHH[SHFWHGEHKDYLRU
O 3URYLGHDQ(;$&7GHVFULSWLRQRIWKHVWHSVQHHGHGWRUHSURGXFHWKHSUREOHP
O 3URYLGHDQ\HUURUPHVVDJHVWKDWDUHJHQHUDWHG
O 8VHWKHORJJLQJIDFLOLWLHVGHVFULEHGEHORZWRFDSWXUHPRUHLQIRUPDWLRQLIDSSOLFDEOH
O 3URYLGHDORJRIWKHVWHSVXVHGWRUHSURGXFHWKHSUREOHPDORQJZLWKDQ\PHVVDJHVRUHUURUVLISRVVLEOH
%
$SSHQGL[%
7HVWLQJ,QIR5DQJHU
7UDFLQJWKH0RGXOH6WDWXV
vhwWudfh#{/|#LVDFRPPDQGWRREVHUYHWKHRSHUDWLQJVWDWXVRIHDFKPRGXOHRI,QIR5DQJHU7KHILUVW
SDUDPHWHUVSHFLILHVHDFKPRGXOHDQGWKHVHFRQGSDUDPHWHUGHEXJOHYHOVSHFLILHVKRZPXFKLQGHWDLOWR
WUDFHWKHPRGXOH7KHKLJKHUWKHGHEXJOHYHOLVWKHPRUHVSHFLILFDOO\\RXFDQWUDFHWKHPRGXOH
([DPSOHVHW7UDFH7UDFHDPHVVDJHZLWKDOHYHOZKLFKRFFXUUHGLQPRGXOHRI,QIR5DQJHU
Module
Number
Debug level
%63
&0$&
(0$&
)/$6+
*3,2
,&
61$5)
&006*
'0'
),5
2(0$3,
5(.(<
781(5
83+<
2(0%5*
3&3,3(
86%
$//
,WLVWUXHWKDWWKHKLJKHUWKHGHEXJOHYHOLV\RXFDQWUDFHWKHPRGXOHPRUHVSHFLILFDOO\7RUDLVH
WKHGHEXJOHYHOH[FHVVLYHO\KRZHYHUPD\GURSRIILQSHUIRUPDQFHRIWKHLQIR5DQJHUDQGHYHQ
FDXVHUHFRQILJXUHRIWKHLQIR5DQJHU 7RVWRSWUDFLQJVHWWKHGHEXJOHYHO)RUH[DPSOHWRVWRSWUDFLQJDFFRUGLQJWR>[email protected]
>[email protected]
&
$SSHQGL[& 3DUW/LVW
,QIR5DQJHU6&053DUW/LVW
Level
Part No
Quantity
Description
Specification
6&05$0;$5
*/$
3%$0$,1
6&05$0;$567$86$6&05$0;
$5'$7$%8/./$<(5)25'2*8%;
0
',2'(5(&7,),(5
0%569$&$6($73
',2'(5(&7,),(5
0%569$&$6($73
/('
&+,3*51[PPQP
/('
&+,3*51[PPQP
/('
&+,3*51[PPQP
/('
&+,3*51[PPQP
,&'5$0
60[[%LW762330,/Q69
3/$67,&WR&P$&02673
,&)/$6+0(025<
)0[%LW762330,/Q69
3/$67,&WR&X$&02673
,&23$03
62330,/'8$/9P9
,&35($03
462330,/G%3/$67,&9
P$WR&X$
,&1(*$),;('5(*
0'3$.33/$67,&
,&326,),;('5(*
/7230,/3/$67,&9
72&$73
,&326,),;('5(*
723003/$67,&
,&326,),;('5(*
'3$.3/$67,&9
,&32:(5
683(59,625
6233/$67,&
,&326,),;('5(*
7233/$67,&
,&'&'&
&219(57(5
7.0627/30,/3/$
,&6:,7&+92/5(* 7233/$67,&WR&$73
,&02'(0
&1%*$30,/3/$67,&9
WR&75
,&75$16&(,9(5
/;7/&4)330,/3/$67,&9
WR&75
,&(7&/,1($5
83&*5662330,/3/$6
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
&
Level
Part No
Quantity
Description
Specification
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
X)9<973
&&(5$0,&&+,3
X)9<973
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&
Level
Part No
Quantity
Description
Specification
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)S)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)S)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q).9;573
&$/
X)9/=73[PP
&$/
X)9/=73[PP
&$/
X)9/=73[
&$/
X)9/=73[
&$/
X)9/=73[
&$/60'
X)9*373[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&
Level
Part No
Quantity
Description
Specification
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
75$1660'38/6(
X+[[PP73
75$160$7&+,1*
RKP33[[PP73
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
P+[[PP
,1'8&72560'
X+[[PP
&5<67$/60'
0+]SSP$$1S)RKP73
),/7(56$:$9
0+]6,3367G%',*,7
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
&25()(55,7(%($'
$%2+0;;000$73)(55,7(
2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(
2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(
2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(
2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(
2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(
2+0
6:,7&+7$&7
9P$JI[[PP6367
&211(&725+($'(5
%2;3500$1*/(61
&211(&725+($'(5
12:$//35PP675$,*+7
-$&.'&32:(5
3PP$*%/.12
-$&.02'8/$5
3&67$1'$5'<$1*/(67$1'$5'1%/
.$8)
685*($%625%(5
9$
685*($%625%(5
9$
*/$
&%)+$51(66
6&055281'8/(
*/$
781(5
3<;6&052+0)
&211%.980+='%92/7$
*/$
3&%0$,1
6&05)5/7[PP3&%
*/$
$'$37256&05
6&05:9$&9'&$+]
*/$
0$18$/86(566&05
6&056(&(1*86$02-2:/
9(5$
&
,QIR5DQJHU6&083DUW/LVW
Level
Part No
Quantity
Description
Specification
6&08$0
;$5
*/
$%
3%$0$,1
6&08$06&08$0'$7$)25
'2*8%%20/$<(5;006&05$
',2'(5(&7,),(5
0%569$&$6($73
',2'(5(&7,),(5
0%569$&$6($73
/('
&+,3*51[PPQP
/('
&+,3*51[PPQP
/('
&+,3*51[PPQP
/('
&+,3*51[PPQP
,&&026/2*,&
/9;$1'*$7(62330,
,&75$16,(17
68335(6625
$P:3766230,/73
,&'5$0
60[[%LW762330,/Q69
3/$67,&WR&P$&02673
,&)/$6+0(025<
)0[%LW762330,/Q69
3/$67,&WR&X$&02673
,&23$03
62330,/'8$/9P9
,&35($03
462330,/G%
3/$67,&9P$WR&X$
,&1(*$),;('5(*
0'3$.33/$67,&
,&326,),;('5(*
/7230,/3/$67,&9
72&$73
,&326,),;('5(*
723003/$67,&
,&326,),;('5(*
'3$.3/$67,&9
,&32:(5683(59,625 6233/$67,&
,&326,),;('5(*
,&'&'&&219(57(5 7.0627/30,/3/$
,&6:,7&+92/5(*
7233/$67,&WR&$73
,&02'(0
&1%*$30,/3/$67,&9
WR&75
,&75$16&(,9(5
/;7/&4)330,/3/$67,&9
WR&75
,&(7&/,1($5
83&*5662330,/3/$6
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
7233/$67,&
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
&
Level
Part No
Quantity
Description
Specification
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
5&+,3
.RKP:'$73
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
5&+,3
RKP:'$73
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
X)9<973
&&(5$0,&&+,3
X)9<973
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&
Level
Part No
Quantity
Description
Specification
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)S)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)S)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)91373
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&&(5$0,&&+,3
Q)9;573
&
Level
Part No
Quantity
Description
Specification
&&(5$0,&&+,3
Q).9;573
&$/
X)9/=73[PP
&$/
X)9/=73[PP
&$/
X)9/=73[
&$/
X)9/=73[
&$/
X)9/=73[
&$/60'
X)9*373[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9:773[[
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
&$/60'
X)9*373[[PP
75$1660'38/6(
X+[[PP73
75$160$7&+,1*
RKP33[[PP73
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
Q+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
&
$SSHQGL[&
3DUW/LVW
Level
Part No
Quantity
Description
Specification
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
X+[[PP
,1'8&72560'
P+[[PP
,1'8&72560'
X+[[PP
&5<67$/60'
0+]SSP$$1S)RKP73
),/7(56$:$9
0+]6,3367G%',*,7
&25()(55,7(%($'
&+,32+0;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
&25()(55,7(%($'
$%2+0;;000$73)(55,7(2+0
6:,7&+7$&7
9P$JI[[PP6367
&211(&725+($'(5 %2;3500$1*/(61
&211(&725+($'(5 12:$//35PP675$,*+7
-$&.'&32:(5
3PP$*%/.12
-$&.86%
3&PP$8,95
-$&.02'8/$5
3&67$1'$5'<$1*/(67$1'$5'1%/.$8)
685*($%625%(5
9$
685*($%625%(5
9$
*/
$
&%)/,1(&25'
3&'$86&08
3&PP:+786%8/
*/
$
&%)+$51(66
6&055281'8/(
*/
$
781(5
3<;6&052+0)&211
%.980+='%92/7$
*/
$
3&%0$,1
6&05)5/7[PP3&%
*/
$
$'$37256&05
6&05:9$&9'&$+]
*/
$
0$18$/86(56
6&08
6&086(&(1*86$02-2:/9(5$
'
$SSHQGL[' 6HUYLFLQJ'LDJUDPV
%ORFN'LDJUDP
P501
DC 12V
U501
Regulator
MC7805BD2T
U505
Regulator
MC78M05CDT
U504
Regulator
EZ1086CM-3.3
U502
Regulator
LM2596S-3.3
5Va
5V
3.3Va
3.3V
2.5V
T301
TRANS
H1102
U701
Transient
Suppressor
SN75240
U802
DC-DC Converter
TK11819
M401
SAW Tilter
X 6964M
3.3V
Ethernet Controller
LXT972LC
U301
T801
Trans
458PT-1087
UP STREAM
U205
MAX708
3.3V
43.75MHz
5Va, 33Ve
TU401
Tuner
4737~PY5(SCM-120R(U)A)
TECC1040(SCM-120R(U)B)
U503
Regulator
LM2596SX-ADJ
93MHz~855MHz
0K]a0K]
REAR
S201
RESET
P301
RJ-45
ETHERNET
JACK
P701
RJ-45
USB JACK
CABLE
Diplexer
Filter
(in Tuner)
5~42MHz
3.3Ve
TX_EN
U101
MAC
BPF
LPF
IF_AGC
2.5V, 3.3V, 3.3Va
CN9414
RF_AGC
43.75MHz
Y101
35.84MHz
Power Control
U801
Power Amp
MAX3510EEP
5V
25.0MHz
ETXD0-3
4
4
ERXD0-3
TUNER_AGC
Freq_Control
U402
5Va, 9V
AGC Amp
UPC2798
DOWN STREAM
5~42MHz
7
HC0-9
100MHz
A0-25
D0-15
14 HAD16-29
16
26
2
U201
5V
SDRAM
(1M x 16Bit x 4Bank)
KM416S1020CT-G8
3.3V
U202
Flash (2M x 16Bit)
28F320C3
(or AMD)
4
P602
RS232C Jig Port
P601
MULTI ICE JTAG
MAIN BOARD
LED601
LED603
LED605
LED607
FRONT
'
$SSHQGL['
6HUYLFLQJ'LDJUDPV
([SORGHG9LHZ
,QIR5DQJHU6&05
14
9
2-1
2
8
12
8
6
4
7
5
13
11
3
1-1
1
10
NO
DESCRIPTION
MATERIAL
Q’TY
REMARKS
*/$
67$1'
3RO\FDYRQDWH$%68/9
$66·<0$,1%2$5'6&05
3%$
6&5(:03+/
602&
6&5(:0)+/
602&
/$%(/%$5&2'(
7(7521
*/$
/$%(/5$7,1*6&05
7(7521
*/$
:$6+(53/$,1
623
187+(;
602&
&211(&725&$3
6,/,&21
*/$
5($53$:(/6&05
$/W
*/$
/(',1',&$725
3&
*/$
5,*+76+,(/'&29(5
6(&&W
*/$
58%%(5)227
158%%(5
*/$
/()7&29(5
3RO\FDYRQDWH$%68/9
*/$
58%%(5)227
158%%(5
*/$
5,*+7&29(5
+3,68/9
*/$
'
,QIR5DQJHU6&08
15
9
2-1
2
8
12
6
4
8
7
13
5
14
11
3
1-1
1
10
NO
DESCRIPTION
MATERIAL
Q’TY
REMARKS
*/$
67$1'
3RO\FDYRQDWH$%68/9
$66·<0$,1%2$5'6&08
3%$
&211(&72586%%86+,1*
+3,68/9
*/$
6&5(:03+/
602&
6&5(:0)+/
602&
/$%(/%$5&2'(
7(7521
*/$
/$%(/5$7,1*6&08
7(7521
*/$
:$6+(53/$,1
623
187+(;
602&
&211(&725&$3
6,/,&21
*/$
5($53$:(/6&08
$/W
*/$
/(',1',&$725
3&
*/$
5,*+76+,(/'&29(5
6(&&W
*/$
58%%(5)227
158%%(5
*/$
/()7&29(5
3RO\FDYRQDWH$%68/9
*/$
58%%(5)227
158%%(5
*/$
5,*+7&29(5
+3,68/9
*/$
7HFKQLFDO6XSSRUW
6$0681*RIIHUVWKHKLJKHVWOHYHORIFXVWRPHUVHUYLFHLQWKHLQGXVWU\)ULHQGO\DQGNQRZOHGJHDEOH
FXVWRPHUVHUYLFHLVDYDLODEOHDVIROORZVWKURXJKRXUZHEVLWHRU\RXUVHUYLFHSURYLGHU
O
*HQHUDOLQIRUPDWLRQDERXWWKHSURGXFW
O
6XSSRUWZKHQSUREOHPVDULVH
O
)$4V
1RUWK$PHULFD
6DPVXQJ7HOHFRPPXQLFDWLRQ$PHULFD,QF
(DVW3ODQR3DUNZD\6XLWH
3ODQR7;
3KRQH +(/3
)D[
85/ ZZZVDPVXQJWHOHFRPFRP
2WKHUV
+HDGTXDUWHUV
)O6DPVXQJ0DLQ%OGJ
*D7DHS\XQJ5R&KXQJ.X6HRXO.RUHD
3KRQH )D[
85/ ZZZVDPVXQJQHWZRUNFRP
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement