It`s not the load that breaks you down, it`s the way you carry it.

It`s not the load that breaks you down, it`s the way you carry it.
It’s not the load that breaks you down, it’s the way you carry it.
Chapter 7: Molecular and BioTech products
James Dewey Watson
April 6 1928
Francis Crick
8 June 1916 - 28 July 2004
James Dewey Watson and Francis Crick are two scientist from USA and UK respectively. They won
the Nobel prize in 1962 for the discovery of the structure of DNA. The famous double helix structure
ZDVIRXQGXVLQJ[UD\GLIIUDFWLRQ$JUHDWGLVFRYHU\LQWKH¿HOGRIPLFURELRORJ\DQGJHQHWLFVLWHQDEOHG
greater study of the DNA. DNA is a nucleic acid which contains genetic information used in the
development and functioning of the cell which is basic building blocks of life.
6WXG\RIWKH'1$ZLOOKHOSXVJHWDEHWWHUXQGHUVWDQGLQJRIGLVHDVHVDQGKHOSXV¿QGDFXUH'1$
KROGVWKHJHQHWLFµFRGHV¶WRPDNH51$,QWXUQ51$LVQHHGHGLQ\RXUERG\EHFDXVHLWKROGVWKHFRGHV
for the amino acids that make proteins. A famous quote from Watson was “Science moves with the
VSLULWRIDQDGYHQWXUHFKDUDFWHUL]HGERWKE\\RXWKIXODUURJDQFHDQGE\WKHEHOLHIWKDWWKHWUXWKRQFH
IRXQGZRXOGEHVLPSOHDVZHOODVSUHWW\´
:HDW6FLFKHP7HFKZHKDYHHPLQHQWVFLHQWLVWVDQGUHVHDUFKVFKRODUVZRUNLQJIRUXVDQGZKRIROORZV
334
WKHIRRWVWHSVRI³:DWVRQDQG&ULFN´ZHDUHRQHRIWKHIHZFRPSDQLHVLQWKHZRUOGZKRKDVGHGLFDWHG
to the “ Genetic Engineering (Molecular Biology ) and Bio-Technology (Bio-Tech). We ScichemTech
DOZD\VNHHSRXUPRWWR³6HUYLQJWKH6FLHQFHDQG,QGXVWU\´SURJUHVVLQJ,QWKLV&KDSWHURXU5'KDV
developed few commonly used products which are used in the Bio-Science and Bio-Tech industries.
7KLVWLPHZHKDYHVRPH6DPSOHSUHSDUDWLRQHTXLSPHQWVDQGWHFKQLTXHV(OHFWURSKRUHVLVDQGUHODWHG
LQVWUXPHQWV6RPH*HQHPDQLSXODWLRQLQVWUXPHQWVOLNH*HQH*XQV(OHFWURSRUDWRUDQGWHFKQLTXHV
6DPSOHVWRUDJHVROXWLRQV5HIULJHUDWRUV'HHSIUHH]HUV)UHH]HGU\HUVDQG8OWUDORZIUHH]HUVDQG
Liquid nitrogen containers. We dedicate this complete chapter to Watson- crick and all the Scientists
who have contributed for the Molecular Biology / Bio-technology/Nano- Bio and related research.
ScichemTech Mol-Biol Team.
334 [email protected]
www.scichemtech.com
The talent should speak for itself
SCT-HAEMATO : DIGITAL DIFFERENTIAL CELL COUNTERS
SALIENT FEATURES:
Ɣ 6&7+$(0$72'LIIHUHQWLDO&HOO&RXQWHUVDUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFH
DQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH+DHPDWRORJLFDODSSOLFDWLRQV
with high level performance.
Ɣ 6&7+$(0$72KDVWKH6RIWWRXFKNH\VOHW\RXFRXQWIDVWHUDQGKDYHOHVVIDWLJXHWKDQ\RXKDYH
ever experienced with the mechanical counters.
Ɣ 6&7+$(0$72KDVDVHSDUDWHGLJLWGLVSOD\IRUHDFKFHOOW\SHSOXVDGLJLWGLVSOD\IRUWKHWRWDO
number of cells counted.
Ɣ 6&7+$(0$72KDVDQ$ODUPDFWXDWHVHYHU\FRXQWV
Ɣ 6&7+$(0$72KDVNH\VWRFRXQWWKHFHOOVZLWKEHWWHURSWLRQV
Ɣ 6&7+$(0$72KDVWKHWRWDOSHUFHQWDJHNH\ZKLFKHQDEOHVWKHXVHUWRVDYHWKH
time consuming calculations.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Keypad
Display
Key functions
Dimensions
Net Weight
SCT-107.001.01
SCT-HAEMATO
7ZHOYHFRXQWLQJNH\VSOXV727$/3(5&(17&217,&/($5NH\V
³6RIWWRXFK´NH\VZLWKDXGLEOHFOLFNWRDFNQRZOHGJHHQWU\
Separate 2-digit LED displays for each channel and every LED goes up to 99.
$GLJLWWRWDOFKDQQHOLVLQFUHDVHGE\RQHGLJLWZKHQHYHUWKHFRUUHVSRQGLQJ
counting key is depressed.
Available to count up to 999.
Each key enters a count into a separate channel and into the
727$/FKDQQHO
Counting keys
121727$/NH\(QWHUVDFRXQWLQWRDVHSDUDWHFKDQQHOEXWQRW
LQWRWKH727$/FKDQQHO
T 1% key
7RWDORWKHUZLVHFDOFXODWLQJSHUFHQWDJH
&217,NH\
You can get counts more than 100.
NH\
$GGLQJRUVXEWUDFWLQJWKHQXPEHUVFRXQWHGE\6,3NH\WRWRWDOL]H
&/($5NH\
Clears all channels
:['[+PP
1 kg
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
DESCRIPTION
SCT-107.001.01
6&7+$(0$72
6&7+$(0$72',))(5(17,$/&(//&2817(5LVVXSSOLHGFRPSOHWHZLWKWKHLQVWUXFWLRQPDQXDO
SCT-MICRO ENUMER : DIGITAL COLONY COUNTERS SOFTWARE DRIVEN
335
SALIENT FEATURES:
Ɣ 6&70,&52 (180(5 'LJLWDO &RORQ\ FRXQWHUV DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW WKH HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH0LFURELRORJLFDO
applications with high level performance.
Ɣ 6&70,&52(180(5KDVPDGHIRUUHOLDEOHDQGWUDFHDEOHFRXQWLQJRIEDFWHULDOFRORQLHVJURZLQJ
on any nutrient agar in petri-dishes with a wide range of diameter from 60~150mm.
Ɣ 6&70,&52(180(5KDVWKHSUHVVXUHVHQVRUGHVLJQHQDEOHVWKHFRXQWHUEHLQJXVHGE\DQ\
kind marking pen.
Ɣ 6&70,&52(180(5KDVDQLFHGLJLWDO´/('GLVSOD\ZLWKIRXUGLJLWVXSWRPDNHVWKH
user to see clearly and counts.
Ɣ 6&70,&52(180(5KDVDULQJVKDSHGLOOXPLQDWLRQODPSZLWKHOHFWURQLFEDOODVWUHVXOWVLQJODUH
free light without blinding or noise and makes operator working comfortable without eyestrain.
Ɣ 6&70,&52(180(5KDVDQ,QQRYDWLYH3&VRIWZDUHHPSRZHUVWKHXVHUUHFRUGLQJWUDFLQJRU
UHSRUWLQJGDWDRIVDPSOHQXPEHUGDWHXVHU¶VQDPHURZFRXQWGLOXWLRQIDFWRUWRWDOFRXQWGLOXWLRQ
IDFWRUWRWDOFRXQWHWF
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
[email protected]
www.scichemtech.com 335
Every man must scratch his head with his own nails.
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Readout
0DJQL¿FDWLRQ
3HWULGLVKVL]H
Zero reset
Count back
Illumination
3UHVVXUHVHQVLWLYLW\
2XWSXW
Dimension
Net Weight
Gross Weight
SCT-107.002.01
SCT-MICRO ENUMER
GLJLWaEULJKWUHG´/('GLVSOD\
a;
60~150 mm diameter
Yes
Yes
Glare-free ring-shaped lamp
Adjustable
56
:PP[+['PP
5.2 kg
6.4 kg
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.002.01
6&70,&52(180(5
DESCRIPTION
6&7',*,7$/&2/21<&2817(5LVVXSSOLHGFRPSOHWHZLWKWKHLQVWUXFWLRQPDQXDO
SCT-GRIND 1 : SEMI-AUTOMATED GLASS BATCH TISSUE GRINDERS / HOMOGENIZERS
SALIENT FEATURES:
Ɣ 6&7*5,1'6(0,$8720$7('',*,7$/*/$667,668(*5,1'(56+202*(1,=(56
DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWV
WKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7 *5,1' KDV WKH FRPELQDWLRQ RI ERWK WKH 3RWWHU(OYHKMHP JODVV WLVVXH JULQGHU ZLWK 37)(
SHVWOHZLWKWKHVWDLQOHVVVWHHOURGVRSHUDWHVZLWKWKHVHPLDXWRPDWHG2YHUKHDGVWLUUHUZKLFKLV
used as a grinder.
Ɣ 6&7 *5,1' KDV D 'LJLWDO 2YHU KHDG KRPRJHQL]HU SURYLGHV 530 DQG WKH WRUTXH IRU WKH
KRPRJHQL]LQJRUPL[LQJRIWKHVDPSOHV,WJLYHVGLJLWDOGLVSOD\RI530ZLWKWKHPD[LPXP
power of 120 watt.
Ɣ 6&7*5,1'RSHUDWHVZLWKORZVSHHGKLJKWRUTXHDQGOHVVQRLVHZKLFKHQDEOHVWKHXVHUWRJULQG
or quick homogenization of any soft plant or animal tissues.
Ɣ 6&7*5,1'KDVJODVVWXEHVZLWKDQGPOFDSDFLWLHVIRUYDULRXVDSSOLFDWLRQVLQ
ZKLFKPOFRPHVDVDVWDQGDUGZLWKWKHLQVWUXPHQW2WKHUVDUHRSWLRQDO
Ɣ 6&7 *5,1' KDV PDQ\ DSSOLFDWLRQV LQ WKH ELRORJLFDO ¿HOG KRZHYHU 6&7 UHFRPPHQGV IRU
extracting the mitochondria and the cytoplasm from the tissues. Also we recommend it for the soft
JULQGLQJRIDQ\WLVVXHVVXFKDVOLYHUDQGEUDLQWLVVXHV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
336
PRODUCT NO.
MODEL NO.
Motor Speed (rpm)
0D[LPXP3RZHU
+RPRJHQDWH7XEH6L]H
2SWLRQDOERWWOHVL]H
Net Weight
3DFNLQJVL]H
3RZHU6XSSO\
SCT-107.003.01
SCT-GRIND-1
50-2200 rpm adjustable.
120W
POPORQHHDFK
POPOPOPO
12 Kg
[[PP
99+]
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
SCT-GRIND-1
DESCRIPTION
6&7 (OHFWULF *ODVV +RPRJHQL]HU LV VXSSOLHG ZLWK PO PO JODVV WXEHV DQG WKH LQVWUXFWLRQ
manual
OPTIONAL ACCESSORIES:
PRODUCT NO.
6&7$$
6&7$%
6&7$&
6&7$'
6&7$(
DESCRIPTIONS
+RPRJHQDWH3UREH7LS
*ODVV*ULQGLQJ7XEHERWWOH0/
Glass Grinding Tube bottle 5ML
Glass Grinding Tube bottle 10ML
Glass Grinding Tube bottle 20ML
336 [email protected]
www.scichemtech.com
It’s sad when someone you know becomes someone you knew
SCT-GRIND 2 : HIGH SPEED HAND HELD HOMOGENIZERS
SALIENT FEATURES:
Ɣ 6&7*5,1'+,*+63(('%$7&+',*,7$/+$1'+(/'+202*(1,=(56DUHGHVLJQHGZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRU
the Biological applications with high level performance.
Ɣ 6&7*5,1'KDVDGLJLWDOGLVSOD\WRVKRZDQGVHHWKHVSHHG,WKDVWKHKLJKVSHHGEHWZHHQ
WRUSP
Ɣ 6&7*5,1'LVDKDQGKHOGW\SHZLWKWKHZLGHUDQJHFDSDFLW\RIPOXSWRPO
Ɣ 6&7*5,1'KDVDKLJKVSHHGURWRURSHUDWLQJDWFORVHFOHDUDQFHWRVWDWRUGUDZVPDWHULDOLQIURP
the bottom of the mixing vessel and subjects it to intense mixing and shearing action.
Ɣ 6&7*5,1' KDV D 7KH URWRU DFFHOHUDWHV WKH SURGXFW WRZDUGV WKH EODGHV SHULSKHU\ 7KHUH LW
is expelled through the stator openings into the body of the mix while undergoing an intensive
mechanical and hydraulic shearing action. Simultaneously new material is drawn in.
Ɣ 6&7*5,1''LJLWDO+LJK6SHHG+RPRJHQL]HUVDUHLGHDOIRUEDWFKKRPRJHQL]LQJRIFHOOWLVVXHV
HPXOVLI\LQJVXVSHQGHGVROLGVDQGDLUSROOXWLRQ¿OWHUH[WUDFWLRQDQGLVXVHGWRKRPRJHQL]HHPXOVLI\
DQGGLVSHUVHPDWHULDOLQSKDUPDFHXWLFDOFRVPHWLFVIRRGFKHPLFDOSHWURFKHPLFDOLQGXVWU\HWF
Ɣ 6&7*5,1'LVVXSSOLHGZLWKPPEODGHDVDVWDQGDUGDQGPPPPDVDQRSWLRQDOEODGHV
7KHXQLWLVSRUWDEOHOLJKWLQZHLJKWDURXQGNJRQO\
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Motor Speed (rpm)
Speed display
Speed mode
Capacity (ml)
Accessories
Total weight
3RZHU
Voltage
SCT-107.003.02
SCT-GRIND-2
USP
Digital display
Stepless speed
0.2 ml –120 ml
10 mm
1 kg
160 W
9+]
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
SCT-GRIND-2
DESCRIPTION
6&7+LJKVSHHGKRPRJHQL]HULVVXSSOLHGFRPSOHWHO\ZLWKWKHLQVWUXFWLRQPDQXDO
OPTIONAL ACCESSORIES:
PRODUCT NO.
6&7%$
6&7%%
DESCRIPTIONS
S.S. BLADE 6MM
S.S. BLADE 8MM
SCT-GRIND 3 : BENCH TOP DIGITAL HIGH SPEED BATCH HOMOGENIZERS
SALIENT FEATURES:
Ɣ 6&7*5,1'+,*+63(('%$7&++202*(1,=(56DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHKHDY\DQGODUJH
%LRORJLFDO,QGXVWULDOVDPSOHVDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
+LJKVSHHGPHFKDQLFDODQGK\GUDXOLFVKHDUIRUFHVDUHWKHUHDONH\WRWKHVXFFHVVRIWKLVPDFKLQH
5RWRU VWDWRU JHQHUDWHV D VKHDULQJ DFWLRQ ZKLFK LQVXUHV WKDW PDWHULDOV EHLQJ SURFHVVHG DUH
VXEMHFWHGWRWKRXVDQGVRIVKHDULQJDFWLRQVHDFKPLQXWH6KLHOGHGLQDVWDLQOHVVVWHHOVKDIW
the rotor acts as a centrifugal pump to recirculate the liquid and suspended solids through the
JHQHUDWRUZKHUHVKHDULPSDFWFROOLVLRQDQGFDYLWDWLRQSURYLGHUDSLGKRPRJHQL]DWLRQ
Ɣ 6&7*5,1'KDVDZLGHFDSDFLW\UDQJHIURPPOWLOOPOZKLFKHQDEOHVWKHXVHUZLWK
D ZLGH UDQJH RI VDPSOHV :H VXSSO\ VL]HV 66 EODGHV DQG PP DV DQ RSWLRQDO WRRO
enduser can select as per their requirement.
Ɣ 6&7*5,1'KDVDSRZHUIXOOEUXVKOHVVKLJKVSHHGPLQLDWXUHPRWRUZLWKZDWWSRZHUZKLFK
RSHUDWHVWKHXQLWIURPWLOO530ZLWKGLJLWDOGLVSOD\FRQWURO7KLVPDNHVWKHXQLWWR
KDQGOHTXLFNO\HYHQWRXJKHVWWLVVXHVDPSOHVHPXOVLRQVDQGGLVSHUVLRQV
Ɣ 6&7*5,1'KDVDWLPHUFRQWURIURPWRPLQXWHVYDULDEOHZLWKFRQWURO
Ɣ 6&7*5,1' KDV D JRRG RU WKH SODWIRUP WR NHHS WKH KRPRJHQL]LQJ YHVVHO WKH SODWIRUP LV
temperature controlled to keep the vessels and samples at the desired temperatures during
operation. Many of the biological samples needs this facility to get the samples without loss or
damage.
Ɣ 6&7*5,1'KDVDJUHDWSRZHUZKLFKPDNHVWKHXQLWWREHXVHGLQPDQ\DSSOLFDWLRQVOLNH'1$
51$DQG3URWHLQH[WUDFWLRQVDOOW\SHVRIELRORJLFDODQGELRFKHPLFDOUHVHDUFKDSSOLFDWLRQV$OVRLW
LVXVHGLQKRPRJHQL]LQJHPXOVLRQVVXVSHQVLRQV
Ɣ 6&7*5,1'LVVXSSOLHGZLWKWKHFRPSOHWHXQLWDQGPPEODGHPPPPDVDQRSWLRQDO
stainless steel cutting blades.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
[email protected]
337
www.scichemtech.com 337
The things i want to know are in books; my best friend is the man who’ll get me a book i ain’t read.
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
3URFHVV9ROXPH
Speed Range
Temperature
Total weight
3UR¿OHVL]H
Blade size (mm)
Net Weight (Kg)
3DFNLQJ6L]H
9ROWDJH3RZHU
SCT-107.003.03
SCT-GRIND-3
2ml to 1000ml
±USP7LPLQJ5DQJHPLQDGMXVWDEOH
-102C – 402C
6.0 Kg
[[PP
DQGPP2SWLRQDO
6 to 8 Kg
[[PP
99+]:
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
6&7*5,1'
DESCRIPTION
6&7*5,1'+LJK6SHHG+RPRJHQL]HUZLWKWKHVSHHGRIUSPDGMXVWDEOHZLWKWLPHULV
supplied completely with the instruction manual.
OPTIONAL ACCESSORIES:
PRODUCT NO.
6&7&$
6&7&%
6&7&&
DESCRIPTIONS
S.S. Blade 10 MM
S.S. Blade 14 MM
S.S. Blade 18 MM
SCT-GRIND 4 : DIGITAL PORTABLE ULTRASONIC HOMOGENIZERS
SALIENT FEATURES:
338
Ɣ 6&7*5,1' ',*,7$/ 3257$%/( 8/75$621,& +202*(1,=(56 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRU
WKH%LRORJLFDO$QDO\WLFDOVDPSOHVDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7*5,1'LVSRUWDEOHW\SHRIXOWUDVRQLFKRPRJHQL]HUZKLFKZRUNVRQWKHFDYLWDWLRQDO
EXEEOHSULQFLSOHZKLFKLVPRUHVXLWDEOHIRUWKHELRORJLFDOFHOOVDQGVDPSOHV
Ɣ 6&7*5,1' KDV D FOHDU GLJLWDO /(' GLVSOD\ ZKLFK HQDEOH WKH XVHU WR VHH WKH
temperature and the frequency details.
Ɣ 6&7*5,1' KDV ZDWW DV WKH PD[LPXP RXWSXW SRZHU DQG LW ZRUNV ZLWK PP
VRQLFDWRUWLSZKLFKJLYHVDXQLIRUPDQGHI¿FLHQWXOWUDVRQLFZDYHJHQHUDWLRQ,WKDVWKH
process volume from 10 to 1000 ml.
Ɣ 6&7*5,1'KDVWKHWLPHDQGSRZHUVHWWLQJDQGFRQWUROOLQJVHSDUDWHO\,WKDV
minutes as the total time and the unit operates in the normal controlled temperature.
Ɣ 6&7*5,1' KDV D ZLGH UDQJH RI DSSOLFDWLRQV OLNH GLVLQWHJUDWLQJ WKH FHOOV WLVVXHV
RI YDULRXV NLQGV RI DQLPDOV DQG SODQWV YLUXVHV EDFWHULD DQG DV ZHOO DV WR UHVKDSH
LQRUJDQLFVXEVWDQFHV,WFDQEHXVHGLQHPXOVL¿FDWLRQVHSDUDWLRQGLVUXSWLRQFROOHFWLRQ
cleaning and nano-material preparation dispersion acceleration of chemical reactions
etc.
Ɣ 6&7*5,1' ',*,7$/ 3257$%/( 8/75$621,& +202*(1,=(5 LV VXSSOLHG ZLWK PP
sonication tip as a standard option.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-GRIND-4
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.003.04
SCT-GRIND-4
3URFHVVLQJ9ROXPH
0D[2XWSXW3RZHU
Size
Control Type
10-100 ml
250W
95x210x280mm
Switchover by hand or automation
Shut circulation 0.199s adjustable
2SHQFLUFXODWLRQVDGMXVWDEOH
0.199 minutes adjustable
6 mm
9+]
3XOVH*HQHUDWRU
Total Time
Accompany Tip
Supply
ORDERING INFORMATIONS:
PRODUCT NO.
6&7
MODEL NO
DESCRIPTION
SCT-GRIND-4
6&7 *5,1' 3RUWDEOH 8OWUDVRQLF +RPRJHQL]HU :$FFRPSDQ\ ZLWK PP WLS VXSSOLHG
complete with instruction manual
338 [email protected]
www.scichemtech.com
Every one desires to live long, but no one would be old.
SCT GRIND : HIGH FREQUENCY ULTRASONIC HOMOGENIZERS
SALIENT FEATURES:
Ɣ 6&7 *5,1' %(1&+ 723 8/75$621,& +202*(1,=(56 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRU
WKH%LRORJLFDO$QDO\WLFDOVDPSOHVDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7 *5,1' ZRUNV ZLWK WKH FDYLWDWLRQDO SULQFLSOH DQG WKH PHWKRG WR GLVUXSW FHOOV
is ultrasonic disruption. The unit work by generating intense sonic pressure waves in a liquid
PHGLD ZKLFK FDXVHV VWUHDPLQJ LQ WKH OLTXLG DQG XQGHU WKH ULJKW FRQGLWLRQV UDSLG IRUPDWLRQ RI
PLFUREXEEOHV ZKLFK JURZ DQG FRDOHVFH XQWLO WKH\ UHDFK WKHLU UHVRQDQW VL]H YLEUDWH YLROHQWO\
and eventually collapse. This phenomenon is called cavitation. The implosion of the vapor phase
EXEEOHVJHQHUDWHVDVKRFNZDYHZLWKVXI¿FLHQWHQHUJ\WREUHDNFRYDOHQWERQGV6KHDUIURPWKH
imploding cavitation bubbles as well as from eddying induced by the vibrating sonic transducer
disrupt cell / tissue shapes.
SCT-GRIND
Ɣ 6&7*5,1'KDVSURFHVVLQJYROXPHVIURPWLOOPO
Ɣ 6&7*5,1'LVVXSSOLHGZLWKPPWLSVDVVWDQGDUGDQGWKHPPDVDQRSWLRQDORQH,WKDVWKH
SURFHVVLQJYROXPHIURPWRPODQGZRUNVZLWK.+]IUHTXHQF\DQGZDWWSRZHU
Ɣ 6&7*5,1'LVVXSSOLHGZLWKPPWLSVDVVWDQGDUGDQGWKHPPDVDQRSWLRQDORQH,WKDVWKH
SURFHVVLQJYROXPHIURPWRPODQGZRUNVZLWK.+]IUHTXHQF\DQGZDWWSRZHU
Ɣ 6&7*5,1'LVVXSSOLHGZLWKPPWLSVDVVWDQGDUGDQGWKHDQGPPDVDQRSWLRQDORQH,W
KDVWKHSURFHVVLQJYROXPHIURPWRPODQGZRUNVZLWK.+]IUHTXHQF\DQG
watt power.
Ɣ 6&7*5,1'LVVXSSOLHGZLWKPPWLSVDVVWDQGDUGDQGWKHPPDVDQRSWLRQDORQH,W
KDVWKHSURFHVVLQJYROXPHIURPWRPODQGZRUNVZLWK.+]IUHTXHQF\DQG
watt power.
Ɣ 6&7*5,1'DUHVXSSOLHGZLWKVRXQGUHGXFWLRQFKDPEHUZLWKDPRYLQJEDVHRUVKHOI
Ɣ 6&7*5,1'KDVPDQ\DSSOLFDWLRQVGXHWRLW¶VZLGHUDQJHRIIUHTXHQF\DQGSRZHU
RSWLRQV DSSOLFDWLRQV LQFOXGLQJ GLVUXSWLRQ RI FHOOV EDFWHULD VSRUHV HPXOVL¿FDWLRQ RI LPPLVFLEOH
OLTXLGV KRPRJHQL]DWLRQ XQLIRUP GLVSHUVLRQ RI SDUWLFOHV LQ OLTXLGV DFFHOHUDWLRQ RI UHDFWLRQV
GHSRO\PHUL]DWLRQ RI ODUJH PROHFXOHV DQG GHJDVVLQJ RI OLTXLGV ,W FDQ EH XVHG LQ HPXOVL¿FDWLRQ
VHSDUDWLRQGLVUXSWLRQFROOHFWLRQFOHDQLQJDQGQDQRPDWHULDOSUHSDUDWLRQGLVSHUVLRQDFFHOHUDWLRQRI
chemical reactions etc.
Control Unit
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PROUDCT NO.
MODEL NO.
)UHTXHQF\.+]
Accompany (F)
2SWLRQDO7LS)
3URFHVVLQJ9ROXPHPO
Duty Ratio (%)
3RZHU:
3RZHUVXSSO\FKDVVLVPP
Weight (Kg)
Mainframe Weight (Kg)
Dimensions (mm)
3RZHU6XSSO\9+]
SCT-107.003.05
SCT-107.003.06
SCT-107.003.07
SCT-107.003.08
SCT-GRIND-5
SCT-GRIND-6
SCT-GRIND-7
SCT-GRIND-8
±.+]
.+]
ɮ
)20
ɮ
)
)
10 – 100 ml
10-200 ml
50-1000 ml
50-1200 ml
1-99%
0.1-99.9%
150 W
250 W
1200 W
1800 W
400 ‘280’ 220 (mm)
40 ‘28’ 22 (cm)
7 kg
12.1 kg
NJ
NJ
9.5 kg
14.6 kg
15 kg
µ¶PP
9+]+]
339
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO
6&7
SCT-GRIND-5
6&7
SCT-GRIND-6
6&7
6&7&+23
6&7
6&7&+23
[email protected]
DESCRIPTION
6&7 *5,1' 8OWUDVRQLF +RPRJHQL]HU LQFOXGLQJ 6RXQG 5HGXFLQJ &KDPEHU :$FFRPSDQ\ ZLWK
ɮ&UXVKLQJ&DSDFLW\POVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
6&7 *5,1' 8OWUDVRQLF +RPRJHQL]HU LQFOXGLQJ 6RXQG 5HGXFLQJ &KDPEHU :$FFRPSDQ\ ZLWK
ɮ&UXVKLQJ&DSDFLW\POVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
6&7*5,1'8OWUDVRQLF+RPRJHQL]HU,QFOXGLQJ6RXQGReducing&KDPEHU:$FFRPSDQ\ZLWK
ɮ7HPSHUDWXUH&RQWUROOHG&UXVKLQJ&DSDFLW\POVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
6&7*5,1'8OWUDVRQLF+RPRJHQL]HU,QFOXGLQJ6RXQGReducing&KDPEHU:$FFRPSDQ\ZLWK
ɮ7HPSHUDWXUH&RQWUROOHG&UXVKLQJ&DSDFLW\POVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
www.scichemtech.com 339
I’ve failed over and over and over again in my life and that is why i succeed
SCT-GRIND 9 : HIGH PRESSURE HOMOGENIZERS
SALIENT FEATURES:
Ɣ 6&7 *5,1' +,*+ 35(6685( +202*(1,=(56 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW WKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH%LR3KDUPDFHXWLFDO
,QGXVWULDOKLJKOHYHOVDPSOHV%DFWHULDO0\FRORJLFDODSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7*5,1'KDVDSRZHUIXOK\GUDXOLFSUHVVXUHV\VWHPZKLFKH[WUXGHVEUHDNVDQGKRPRJHQL]HV
the large volume thick walled cells and samples.
Ɣ 6&7*5,1'KDVPPPD[LPXPSUHVVXUHVWURNHDQGPPVDVWKHSUHVVXUHSODWHVSHHG
Ɣ 6&7*5,1'KDVPPGLDPHWHUVWDLQOHVVVWHHOVDPSOHWXEHV,WFDQDFFRPRGDWHPOWLPH
Ɣ 6&7*5,1'KDVDGLDOSUHVVXUHJDXJHWRJHWWKHDFWXDODSSOLHGSUHVVXUH
Ɣ 6&7 *5,1' LV EHVW WR GLVUXSW PLFURELDO FHOOV :LWK WKH H[FHSWLRQ RI KLJKO\ ¿ODPHQWRXV
PLFURRUJDQLVPVWKHPHWKRGKDVEHHQIRXQGWREHJHQHUDOO\VXLWDEOHIRUDYDULHW\RIEDFWHULD\HDVW
and mycelia.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXfactured under ISO 9001 : 2008 Quality Standards.
SCT-GRIND-9
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Capacity
Voltage
Maximum operating pressure
3UHVVXUHGHYLFH
0D[3UHVVXUH6WURNH
Sample tube
3UHVVXUHSODWHVSUHDG
Dimensions
Largest volume of sample
SCT-107.003.09
SCT-GRIND-9
POWLPHVFRQWLQXRXVLQFUHDVHVDPSOHVIRUVFLHQWL¿FUHVHDUFK
9
0SD36,
+\GUDXOLF6\VWHP
170 mm
)25mm Stainless
6.8mm/s
555 ‘600’ 1170mm
50ml/times
ORDERING INFORMATIONS:
PRODUCT NO.
6&7
MODEL NO.
DESCRIPTION
SCT-GRIND-9
6&7 +LJK3UHVVXUH +RPRJHQL]HU 03D LV VXSSOLHG FRPSOHWHO\ ZLWK WKH LQVWUXFWLRQ
manual.
2WKHURSWLRQDODFFHVVRULHVXSRQUHTXHVW
SCT-GRIND 10 : HIGH THROUGHPUT STEEL-BALLS TISSUE GRINDER
SALIENT FEATURES:
340
Ɣ 6&7*5,1'+,*+7+528*+38767((/%$//67,668(*5,1'(56+202*(1,=(56DUH
GHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKH
VSHFL¿FDWLRQVIRUWKH%LRORJLFDOVDPSOHVDQGDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7*5,1'KDVWKHFDSDFLW\RIJULQGLQJPDQ\VDPSOHVDWDWLPHLQDTXLFNZD\XVLQJVWHHO
EDOOV LW KDV WKH IUHTXHQF\ RI WLPHV VHF SRZHU ZLWK ZDWW LW KDV WKH WLPHU XSWR minutes.
Ɣ 6&7*5,1'KDVWKHFDSDFLW\WRJULQG[SDLUVRIVDPSOHVLQPLQXWHV
Ɣ 6&7*5,1'KDVWKHFKRLFHLQGU\JULQGLQJZHWJULQGLQJPL[LQJDQGKRPRJHQL]LQJWUHDWPHQW
Ɣ 6&7*5,1'KDVWKHVSHFLDODSSOLFDWLRQVIRUJULQGLQJSODQWWLVVXHVDQLPDOWLVVXHVFHOOVEDFWHULD
DQG\HDVWHWFHYHQQXFOHLFDFLGH[WUDFWLRQLVSRVVLEOHXVLQJWKLVJULQGHU
Ɣ 6&7*5,1'KDVIRXUGLIIHUHQWVDPSOHVL]HVPO[SODFHVPO[SODFHVPO[
SODFHVDQGPO[SODFHV
Ɣ 6&7*5,1'LVVXSSOLHGZLWKVWHHOEDOOV*ULQGLQJEDOOVDUHXVHGZLWKGHHSZHOOSODWHVDQG
YLDO VHWV WR EHDG EHDW SODQW WLVVXHV VHHGV DQG DQLPDO WLVVXHV 7KHVH JULQGLQJ EDOOV DUH PDGH
of 4402C stainless steel which allows them to be retrieved with a magnet while making them
resistant to tarnishing. Grinding balls are treated to remove residual oils and contaminants prior to
packaging.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-GRIND-10
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Grinding Frequency
Digital Timer
3RZHU
Sample size
Dimensions (mm)
SCT-107.003.10
SCT-GRIND-10
aWLPHVSHUVHFRQG
1 - 99 minutes
:
POKROHVPOKROHVPOKROHVPOKROHV
/[:[+PP
340 [email protected]
www.scichemtech.com
The three great essentials to achieve anything worth while are: hard work, stick-to-itiveness, and common sense.
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
SCT-GRIND-10
DESCRIPTION
6&7+,*+7+528*+38767((/%$//67,668(*5,1'(5LVVXSSOLHGZLWKRI6WHHO
Balls and with the instruction manual.
OPTIONAL ACCESSORIES:
PRODUCT NO.
6&7'$
6&7'%
6&7'&
6&7''
DESCRIPTIONS
0.2 - 0.5 ml / 192 holes
1 ml / 72 holes
2 ml / 64 hole
5 ml / 48 holes.
2WKHURSWLRQDODFFHVVRULHVDQGDSSOLFDWLRQPRWHVXSRQUHTXHVW
SCT-CHOP : LABORATORY BLENDERS
SALIENT FEATURES:
Ɣ 6&7&+23%$6,&/$%25$725<%/(1'(56DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWK
high level performance.
Ɣ 6&7&+23DUHSRZHUIXODQGGXUDEOHIRUJULQGLQJEOHQGLQJFKRSSLQJDQGSURFHVVLQJ
Ɣ 6&7&+23KDVUDQJHIURPOLWHUWROLWHUV:LWKVWDLQOHVVVWHHORUJODVVFRQWDLQHUV
Ɣ 6&7&+23DUHVXLWDEOHIRUDOOW\SHVRIEDVLFODERUDWRU\DSSOLFDWLRQV
Ɣ 6&7&+23WKHVHODERUDWRU\EOHQGHUVDUHXVHGZLWKERWKZHWDQGGU\LQJUHGLHQWVDQGDUH
DYDLODEOHLQYDULRXVVL]HV//DQG/ZLWKYDU\LQJVSHHGVRQHVSHHGWZRVSHHGDQGYDULDEOH
speed)
Ɣ 6&7&+23±KDVSURYLGHVWZRKDQGOHVIRUVDIHUHDVLHUOLIWLQJSRXULQJDQGFDUU\LQJ
Ɣ 6&7&+23 KDV VHDOHG SUHFLVLRQ KLWHFK EDOO EHDULQJ V\VWHP H[WHQGV WKH OLIH RI RXU
blenders.
Ɣ 6&7&+23HQFDVHVLWVLQGXVWU\OHDGLQJ+3PRWRUIRUTXLHWRSHUDWLRQ
Ɣ 6&7&+23KDVGHHSHUZLGHUIXOOWUDFWLRQUXEEHUQRQVNLGIHHWNHHSWKHEOHQGHUVWDEOH
6&7&+23
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
SCT-PRODUCT No
SCT-MODEL
&$3$&,7<0/
SCT-107.004.01
SCT-CHOP-1
1000 ml
SCT-107.004.02
SCT-CHOP-2
1200 ml
63(('
2QHVSHHG
Two speed with 60 minutes
mechanical timer
&217$,1(57<3(
Stainless steel with handle
and two piece vinyl and
styrene lid .
+HDWUHVLVWDQWJODVVZLWK
handle and two piece vinyl
and styrene lid .
BASE
32:(56833/<9+]
+(,*+7PP
:(,*+7.J
Epoxy Coated Motor
+RXVLQJ
9+]
PP
.J
SCT-107.004.03
SCT-CHOP-3
1200 ml
9DULDEOHVSHHGIRUPL[LQJ
VWLUULQJEOHQGLQJDQG
homogenizing
Stainless steel with handle
and two piece vinyl and
styrene lid .
(SR[\&RDWHG0RWRU+RXVLQJ (SR[\&RDWHG0RWRU+RXVLQJ
9+]
410 mm
5.9 Kg
9+]
410 mm
5.9 Kg
SCT-107.004.04
SCT-CHOP-4
4000 ml
2II/R0HG+L
3XOVH
stainless steel with
stainless steel blades stainless steel clamp-on
lid with rubber gasket
and stopper
Die-cast gray epoxy
coating
9+]
665 mm
17.2 Kg
341
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.004.01
6&7&+23
SCT-107.004.02
6&7&+23
6&7
6&7&+23
SCT-107.004.04
6&7&+23
DESCRIPTION
6&7 /$%25$725< %/(1'(56 RQH VSHHG PO FDSDFLW\ VXSSOLHG FRPSOHWH ZLWK
instruction manual.
6&7 /$%25$725< %/(1'(56 WZR VSHHG PO FDSDFLW\ VXSSOLHG FRPSOHWH ZLWK
instruction manual.
6&7/$%25$725<%/(1'(56YDULDEOHVSHHGPOFDSDFLW\VXSSOLHGFRPSOHWHZLWK
instruction manual.
6&7 /$%25$725< %/(1'(56 2II/R0HG+L SXOVH VSHHG PO FDSDFLW\ VXSSOLHG
complete with instruction manual.
* Models/ Brands subjected to chance due to quality Impratement
[email protected]
www.scichemtech.com 341
Every production of an artist should be the expression of an adventure of his soul.
SCT-CHOP 5 : FOOD LABORATORY BLENDERS
SALIENT FEATURES:
Ɣ 6&7&+23 %$6,& /$%25$725< %/(1'(56 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW WKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWK
high level performance.
Ɣ 6&7&+23KDVDFOHDUGLJLWDO/&'GLVSOD\ZKLFKGLVSOD\VWKHWHPSHUDWXUHUDWWOLQJWLPHUDWWOLQJ
speed etc.
Ɣ 6&7&+23KDVDYROXPHRVPOFDSDFLW\LWKDVWKHUDWWOLQJVSDFLQJRIPPDGMXVWDEOH
it has the soft start mode to start the shaking softly. It has the rattling time of 0.1 till 99 minutes.
Ɣ 6&7&+23LVDFRPPRQO\XVHG/DEEOHQGHUIRUDOOWKHEDVLFIRRGVDPSOHVDQGXVHGLQWKHIRRG
ODEV,WKDVWKHUDWWOLQJVSHHGRIWLPHVVHFRQGLHWLPHVVHF
Ɣ 6&7&+23KDVVDPSOHVHFXULW\IXQFWLRQVZLWKDXWR±VWRSDQWLWUDSIHDWXUHV,WZLOOVWRSRUSDXVH
if the samples are not placed properly.
Ɣ 6&7&+23KDVDVWDLQOHVVVWHHOVODSER[9LEUDWLRQIUHHRSHUDWLRQV
Ɣ 6&7&+23FDQDFFHSWDOOW\SHVRIVWDQGDUGODEEOHQGHUEDJV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
6&7&+2
3
3DGGOH%OHQ
GHU
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.004.05
SCT-CHOP-5
Rating Time
0.1 – 99 minutes (to 0.1 minutes step) or 6 ~ 5940 seconds
±WLPHVVHFWRWLPHVVHFRQGVWHS
'LVSOD\DFWXDOUDWWOLQJQXPEHUVWKHV\VWHPDXWRPDWLFDOO\DGMXVWVWKHVODS
speed
0XOWLVWDJHSURJUDPPLQJFDQEHGHVLJQHGSDUDPHWULFJURXSVFDQEHVHW
according to one’s wishes.
More than 10groups of multi-stage programming parameters are stored.
PO
Stainless Steel
9$&+]
18.5 kg
:
[FP
LCD
0~5 mm adjustable
Gentle start
[[PP
To ensure sample security
With auto-stop anti-trap features.
5HPRYDEOHZLQGRZVDQGDGMXVWDEOHVODSERDUGWRXJKHQHGJODVVVHFXULW\
door.
Rattling Speed
3DUDPHWHUVWRUDJH
Effective Volume
Slap Box
Supply
Weight
0D[LPXP3RZHU
Sterile Bag
Display
Rattling Spacing
Soft-start mode
Dimensions
3DXVH)XQFWLRQ
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-106.004.05
6&7&+23
342
DESCRIPTION
6&7/DERUDWRU\SDGGOH%OHQGHUZLWK/&'GLVSOD\5DS6SHHGPOWLPHVVHFVSHHGVWHSOHVV
10 groups of multi-stage programming parameters can save supplied complete with instruction manual
SCT-CHOP 6 : FOOD & MICRO LABORATORY BLENDERS
SALIENT FEATURES:
Ɣ 6&7 &+23 ± %$6,& /$%25$725< %/(1'(56 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW WKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWK
high level performance.
Ɣ 6&7&+23±KDVDFOHDUGLJLWDO/&'GLVSOD\DQGDNH\ERDUGIRUVHWWLQJWKHSDUDPHWHUVDQGIRU
programming.
Ɣ 6&7&+23±KDVWLPHVVHFRQGDVWKHUDSVSHHG$QGWLPLQJDVVHFRQGVRULW
can work continuously.
Ɣ 6&7&+23±KDVDFDSDFLW\RIPOZLWKUSP
Ɣ 6&7&+23±KDVDZLGHUDQJHRIDSSOLFDWLRQVLQDOOIRRGODEVDQGLQWKHIRRGLQGXVWULHV,WLVXVHG
to blend many related samples.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
7KHKRPRJHQL]HUFDQEHZLGHO\XVHGLQWKHKRPRJHQL]DWLRQRIDQLPDOWLVVXHELRORJLFDOVDPSOH
IRRGVWXIIDQGFRVPHWLFVHVSHFLDOO\XVHGLQWKHSUHSDUDWLRQRIPLFURRUJDQLFWHVWVDPSOHIHDWXULQJ
VRIW KRPRJHQL]DWLRQ ZLWKRXW FRQWDPLQDWLRQ QR GDPDJH QR WHPSHUDWXUHULVH QR VWHULOL]LQJ
treatment to the sample and no need to wash the utensils. The most special feature of this device
LVWKDWLWLVLGHDOIRUKRPRJHQL]LQJWXPRUWLVVXHVOLYHUFDQFHULQWHVWLQHFDQFHUVWRPDFKFDQFHUDQG
EUHDVWFDQFHUQRWRQO\REWDLQLQJSOHQW\RIVLQJOHFHOOVîPLQXWHV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
342 [email protected]
www.scichemtech.com
Jealousy... Is a mental cancer.
TECHNICAL SPECIFICATIONS:
MODEL NO.
PRODUCT NO.
SCT-107.004.06
SCT-CHOP-6
VHFRUFRQWLQXRXVZRUNLQJ
6-9 times/sec
PO
500 – 1500 rpm
LCD
Keyboard setting
[PP
22.5 kg
[[PP
[[
:
9+=
Timing
Rap Speed
Capacity
Motor Speed
Attenuation
Display
Setting
Sterile homogenization bags
Net weight
Dimensions
3DFNLQJ6L]H
3RZHU
Supply
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.004.0.06
6&7&+23
DESCRIPTION
6&7/DERUDWRU\3DGGOH%OHQGHUV5DS6SHHGWLPHVVHFPO0LFUREH7LVVXH/&'
Display supplied complete with instruction manual
SCT CHOP : LABORATORY PADDLE BLENDERS
SALIENT FEATURES:
Ɣ 6&7&+23±%$6,&3$''/(/$%25$725<%/(1'(56DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHW
WKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQV
with high level performance.
Ɣ 6&7&+23±KDVDFOHDUGLJLWDO/&'GLVSOD\ZKLFKGLVSOD\VWKHWHPSHUDWXUHUDWWOLQJWLPHUDWWOLQJ
speed etc
Ɣ 6&7&+23±KDVDYROXPHRIPOFDSDFLW\LWKDVWKHUDWWOLQJVSDFLQJRIPPDGMXVWDEOH
it has the soft start mode to start the shaking softly. It has the rattling time of 0.1 till 99 minutes.
Ɣ 6&7&+23±LVDFRPPRQO\XVHG/DEEOHQGHUIRUDOOWKHEDVLFIRRGVDPSOHVDQGXVHGLQWKHIRRG
ODEV,WKDVWKHUDWWOLQJVSHHGRIWLPHVVHFRQGLHWLPHVVHF
Ɣ 6&7 &+23 ± KDV VDPSOH VHFXULW\ IXQFWLRQV ZLWK DXWR ±VWRS DQWLWUDS IHDWXUHV ,W ZLOO VWRS RU
pause if the samples are not placed properly.
Ɣ 6&7&+23±KDVDVWDLQOHVVVWHHOVODSER[9LEUDWLRQIUHHRSHUDWLRQV6WHULOHKRPRJHQL]HUDOVR
NQRZQDVWDSSLQJW\SHKRPRJHQL]HULVZLGHO\XVHGLQDQLPDOWLVVXHVXFKDVKRPRJHQL]DWLRQRI
ELRORJLFDOVDPSOHVLQIRRGPHGLFLQHVFRVPHWLFVFOLQLFDOPROHFXODUWR[LQVDQGEDFWHULDFDQEH
DSSOLHG¿HOGVRIGHWHFWLRQLQSDUWLFXODUVDPSOHVWREHWHVWHGIRUSUHSDUDWLRQRIPLFURRUJDQLVPV
Ɣ 6&7&+23±KDV7KHXQLWXVHVVWDLQOHVVVWHHOV\VWHPFDQHIIHFWLYHO\VHSDUDWHWKHVROLGVDPSOH
VXUIDFH DQG KRPRJHQHRXV PLFURRUJDQLVPV DUH LQFOXGHG LQ WKH VDPSOH WKH VDPSOH SDFNHG LQ
GLVSRVDEOH VWHULOH KRPRJHQL]DWLRQ EDJV GR QRW WRXFK WKH LQVWUXPHQW ZLWK KRPRJHQHRXV VRIW
VDPSOHQRSROOXWLRQQRGDPDJHQRKHDWLQJQRVWHULOL]DWLRQQRZDVKLQJXWHQVLOVVDWLVI\LQJIDVW
accurate and reproducible requirements. This product is also suitable for tumor tissue (such as
OLYHUFRORQFDQFHUJDVWULFFDQFHUEUHDVWFDQFHUKRPRJHQDWHFDQEHDODUJHQXPEHURIVLQJOH
FHOOVPLQXWHVXSWRîLIQHFHVVDU\FDQEHH[WHQGHGKRPRJHQHRXVWLPHRQWLVVXHFHOOV
VXFKDVOLYHUHWFWRDFKLHYHDVRIWEURNHQFDQDFFHSWDOOW\SHVRIVWDQGDUGODEEOHQGHUEDJV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
6&7&+2
3
3DGGOH%OHQGH
U
343
MODEL NO.
PRODUCT NO.
Time
SCT-107.004.07
SCT-CHOP-7
0.1 ~ 99 minutes (in 0.1 minutes step) that is 6 to 5940 seconds
1.0 ~ 12 times / sec (0.1 times / second step) shows the actual number
6HYHUDOVODS
RI VODS VODS WKH V\VWHP DXWRPDWLFDOO\ DGMXVWV WKH VSHHG PXOWLVWDJH
SURJUDPPLQJDQ\FRPELQDWLRQRISDUDPHWHUVVHW
3DUDPHWHUVDUHVWRUHG 99 Multi-programming parameter storage
Effective volume
aPO
Beat box
stainless steel
0D[LPXP3RZHU
:
Aseptic bag
[FP
Slap spacing
0 ~ 20mm adjustable
Soft-start mode
Soft start
to ensure sample security
With a pause function
With auto-stop anti-trap feature
&DQDGMXVWWKHORDGLQJZLQGRZDQGVODSSODWHGRXEOHVHFXULW\GRRUV
Temperature Display
Slap box with temperature display
6ODS ER[ EXLOWLQ OLJKW GLVLQIHFWLRQ GLVLQIHFWLRQ FDQ EH H[SHFWHG RQ WKH
Disinfection
working chamber (Single sterilization cycle 5min)
Dimensions
[[PP
Weight
18.5kg
3RZHU
9$&+=
[email protected]
www.scichemtech.com 343
The trees that are slow to grow bear the best fruit
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.004.07
MODEL NO
DESCRIPTION
6&7&+23
6&7 /DERUDWRU\ 3DGGOH %OHQGHUV )ODSW\SH 7HPSHUDWXUH 5DQJH$PELHQW 2& FDQ EH VHW
arbitrarily with disinfection function supplied complete with instruction manual
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.004.AA
SCT-107.004.AB
DESCRIPTIONS
),/7(5+202*(1286%$*
',6326$%/(67(5,/(78%(
3OHDVHQRWH$OORWKHU67,55(560,;(566+$.(56,1&8%$7256UHODWHG(TXLSPHQWV
are available in chapter-6
SCT MASS : LABORATORY SAMPLE CONCENTRATORS
SALIENT FEATURES:
Ɣ 6&70$66/$%25$725<6$03/(&21&(175$7256DUHGHVLJQHGZLWKFUHDWLYHQHVVWR
JHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQV
with high level performance.
Ɣ 6&70$66KDV/('W\SHGLJLWDOGLVSOD\WRVKRZWKHWHPSHUDWXUH
Ɣ 6&70$66KDVWKH1LWURJHQFRQVXPSWLRQUDWHRI/PLQ
Ɣ 6&70$66KDVPPDQGPPQHHGOHVZKLFKDUHPDGHIURPKLJKTXDOLW\VWDLQOHVV
VWHHOWKHVHFDQEHXVHGZLWKDQ\QRQFRUURVLYHVROYHQWV
Ɣ 6&70$66KDVWKHFDSDFLW\RIFRQFHQWUDWLQJWKHVDPSOHVLQIHZPLQXWHVWLPHWRVDYHWKH
WLPH7KH1LWURJHQJDVLVSDVVHGWKURXJKWKHVWDLQOHVVVWHHOQHHGOHVRYHUWKHVROYHQW¿OOHGRQWKH
VDPSOHV7KHFDUU\LQJ*DVLQFUHDVHVWDNHVWKHHYDSRUDWLQJIXPHVRIWKHVROYHQWWRJLYHDTXLFN
concentration to the samples.
Ɣ 6&70$66KDVPDQ\SDUWVWRRSHUDWHLWFRQVLVWVRIDEDVHDQGVWDQGDVVHPEO\VDPSOH
holder and gas distribution system. Test tubes are held in a block.The gas at 5 to 10 psig passes
through the distribution manifold. Depending on the test-tube size and solvent volume they can be
individually raised or lowered to the correct height.
Needles or glass pipettes blow gas onto the surface of the solution resulting in rapid evaporation of
the solvent.
Ɣ 6&70$66KDVPPQHHGOHVDQG0$66KDVPPQHHGOHVWRSDVVWKHJDV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
344
PRODUCT NO.
MODEL NO.
Temperature Control Range
Timer
Display
7HPS&RQWURO$FFXUDF\#aƒ&
7HPS&RQWURO$FFXUDF\#aƒ&
Display Accuracy
+HDWLQJ7LPHaƒ&
Standard Blocks
Nitrogen Consumption
Dimension (mm)
Needle Length
SCT-107.005.01
SCT-MASS-1
57ƒ&aƒ&
1min~99h59min
LED
“ƒ&
“ƒ&
ƒ&
”PLQ
1
0-10L/min
280 x 240 x 110
80mm
SCT-107.005.02
SCT-MASS-2
57ƒ&aƒ&
1min~99h59min
LED
“ƒ&
“ƒ&
ƒ&
”PLQ
2
0-10L/min
280 x 240 x 110
150mm
SCT-MASS
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.005.01
SCT-MASS-1
SCT-107.005.02
SCT-MASS-2
DESCRIPTION
6&76$03/(&21&(175$725LVVXSSOLHGZLWKVWDQGDUGVLQJOHEORFNZLWKWKHQHHGOHOHQJWKRI
mm is supplied completely with the instruction manual.
6&76$03/(&21&(175$725LVVXSSOLHGZLWKVWDQGDUGVLQJOHEORFNZLWKWKHQHHGOHOHQJWKRI
150 mm is supplied completely with the instruction manual.
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.005.AA
SCT-107.005.AB
SCT-107.005.AC
344 [email protected]
DESCRIPTION
80mm Needles
150mm Needles
Flow Control Valve
www.scichemtech.com
Every science begins as philosophy and ends as art.
BLOCK FOR SCT SAMPLE CONCENTRATION:
CODE
SCT-107.005.AD
SCT-107.005.AE
SCT-107.005.AF
SCT-107.005.AG
6&7$+
SCT-107.005.AI
SCT-107.005.AJ
SCT-107.005.AK
SCT-107.005.AL
SCT-107.005.AM
SCT-107.005.AN
6&7$2
6&7$3
6&7$4
SCT-107.005.AR
SCT-107.005.AS
SCT-107.005.AT
SCT-107.005.AU
SCT-107.005.AV
SCT-107.005.AW
DESCRIPTION
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
[ĭPP
49x0.5ml tubes
25x1.5ml tubes
25x2.0ml tubes
96x0.2ml tubes
96x0.2ml microplate
DIMENSIONS (MM)
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
96x96x49
78x114x26
[[
SCT FREEZE : LABORATORY FREEZE DRYERS
SALIENT FEATURES:
Ɣ 6&7)5((=(/$%25$725<)5((=('5<(56DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWK
high level performance.
Ɣ 6&7)5((=(KDV/&''LVSOD\GLVSOD\GU\LQJFXUYH
Ɣ 6&7)5((=(KDV//FDSDFLWLHV,WKDVDODUJHRSHQLQJWUDSQRFRLOLQVLGHZLWK
samples prefreeze function.
Ɣ 6&7)5((=( KDV 5HIULJHUDWLRQ FRPSUHVVRU ZLWK &)& IUHH UHIULJHUDQW WKH FRPSUHVVRU
operates in a low noise.
Ɣ 6&7)5((=(KDVWKH&ROGWUDSDQGFRQWUROSDQHOZHUHPDGHE\VWDLQOHVVVWHHOFRUURVLRQ
resistant and easy to clean.
Ɣ 6&7)5((=( KDV WKH WUDQVSDUHQW VWHHO VDPSOH KROGHU FRPPRQ VDPSOH SODWH VSDFLQJ
adjustable.
Ɣ 6&7)5((=(KDVD2SWLRQDOQLWURJHQLQÀDWLRQYDOYH
Ɣ 6&7)5((=( KDV D ZLGH YDULHW\ RI DSSOLFDWLRQV LQ IUHH]H GU\LQJ PDQ\ ELRORJLFDO DQG
SKDUPDFHXWLFDOVDPSOHIUHH]HGU\HULVDVHWRIPLQLW\SHWDEOHHTXLSPHQWZKLFKLVVXLWDEOHIRUWKH
freeze-dry test and smack production of lab samples.
6DPSOH7UD\WKHGLDPHWHURIPDWHULDOGU\WUD\LVPPWKUHHOD\HUVIRXUOD\HUVLQVWDOOWKHPDWHULDO
DERXWPOPDWHULDOWKLFNQHVVPPRUSODFHGERWWOHVWKHGLDPHWHURIPP
)UHH]HGU\WLPHDERXWKPDWHULDOWKLFNQHVVPP
3OHDVH QRWH WKDW WKHVH IUHH]H GU\HUV QHHG D VXLWDEOH 9DFXXP VRXUFH RU D YDFXXP 3XPS :H
recommend the user to visit our liquid handling or Vacuum pumps section and select the suitable
pump for your operations.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-FREEZE
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
No load temperature
No load freeze area
3ODWHORDGPDWHULDOV
Ability to capture water
Vacuum
Dimension
Material Tray
6SHFL¿FDWLRQV
Consuming wattage
Voltage
SCT-107.006.01
SCT-FREEZE-2
<-502C
0.09 - 0.18m2
0.7 - 2L
4Kg / 24h
3D
PP
)200mm four-layered 70mm
(common)
)200mm six-layered 50mm
(common)
)180mm three-layered
(with cover)
1000VA
9+]
345
SCT-107.006.02
SCT-FREEZE-4
<-602C
0.18 - 0.27m2
/
6Kg / 24h
3D
PP
ZE
SCT-FREE
)240mm four-layered (common)
)240mm six-layered 50mm
(common) optional
)200mm three-layered
(with cover)
9$
9+]
0XOWLPDQLIROG7)UDPH6WDQGDUGUXEEHUVHDOYDOYHVZKLFKFDQEHDWWDFKHGDPSRXOHWXEH
Special requirements can be customized.
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.006.01
SCT-107.006.02
MODEL NO
SCT-FREEZE-1
SCT-FREEZE-2
[email protected]
DESCRIPTION
6&7)5((=('5<,1*0$&+,1(/WUVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
6&7)5((=('5<,1*0$&+,1(/WUVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
www.scichemtech.com 345
Judge of a man by his questions rather than by his answers
OPTIONAL VACUUM PUMPS
SCT CRYOGEN : LABORATORY LIQUID NITROGEN CONTAINERS
SALIENT FEATURES:
Ɣ 6&7&5<2*(1DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHG
ZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHSUHVHUYLQJDQGVWRULQJWKHELRVDPSOHV
and related applications with high level performance.
SCT-CRYOGEN
Ɣ 6&7&5<2*(1 /LTXLG QLWURJHQ FRQWDLQHUV DUH FODVVL¿HG LQ WR W\SHV YL]
3257$%/(&217$,1(566725$*(&217$,1(56$1'7+(75$163257&217$,1(56
Ɣ 6&7/LTXLGQLWURJHQLVDFU\RSUHVHUYDWLYHRIPDQ\KXPDQPDWHULDOVVXFKDVEORRGDQGVHPHQ
(YHU\KRVSLWDOXVHVDOLTXLGQLWURJHQWDQNWRVWRUHWKHLUEORRGZRUNVHPHQHJJVDQGHYHQGRQRU
ERG\RUJDQV,QIDFWKRVSLWDOVPD\EHWKHODUJHVWFRQVXPHURIOLTXLGQLWURJHQWDQNV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-CRYOGEN
SCT-CRYOGEN
TECHNICAL SPECIFICATIONS:
PARAMETERS
PRODUCT
No
MODEL NO.
SCT107.007.01
CRYOGEN-1
SCT107.007.02
CRYOGEN-2
SCT107.007.03
CRYOGEN-3
&$3$&,7</1
SCT107.007.04
CRYOGEN-4
SCT107.007.05
CRYOGEN-5
SCT107.007.06
CRYOGEN-6
SCT107.007.07
CRYOGEN-7
51.5
LITERS
1.5
7.9
1.5
25.5
(037<:(,*+7
Kg
2.2
5.5
11.2
15.9
2.2
11.6
15
)8//:(,*+7
Kg
11.9
54.1
56.6
NECK DIA
MM
51
90
120
51
51
287(5',$
MM
175
460
460
175
400
460
727$/+(,*+7
MM
407
556
445
700
407
720
757
/266'8(72
(9$325$7,21
LITERS/DAY
0.097
0.097
0.25
67$7,&+2/',1*
TIME
DAYS
15
58
67
124
15
102
120
CANISTER
287(5',$
MM
17
68
72
26
-
-
CANISTER
+(,*+7
MM
120
120
120
280
120
-
-
180%(52)
CANISTERS
STRAW
&$3$&,7<
NUMBERS
5
6
9
11
1
-
-
0.5 ML
110
720
11000
60
-
-
0.25ML
250
1560
24000
-
-
ORDERING INFORMATIONS:
346
PRODUCT NO.
SCT-107.007.01
SCT-107.007.02
6&7
SCT-107.007.04
SCT-107.007.05
SCT-107.007.06
SCT-107.007.07
MODEL NO
6&7&5<2*(1
6&7&5<2*(1
6&7&5<2*(1
6&7&5<2*(1
6&7&5<2*(1
6&7&5<2*(1
6&7&5<2*(1
DESCRIPTION
6&7/,48,'1,752*(1&217$,1(5/&$3$&,7<,66833/,('&203/(7(/<
6&7/,48,'1,752*(1&217$,1(5/&$3$&,7<,66833/,('&203/(7(/<
6&7/,48,'1,752*(1&217$,1(5/&$3$&,7<,66833/,('&203/(7(/<
6&7/,48,'1,752*(1&217$,1(5/&$3$&,7<,66833/,('&203/(7(/<
6&7/,48,'1,752*(1&217$,1(5/75$163257&$3$&,7<,66833/,('&203/(7(/<
6&7/,48,'1,752*(1&217$,1(5/&$3$&,7<,66833/,('&203/(7(/<
6&7/,48,'1,752*(1&217$,1(5/&$3$&,7<,66833/,('&203/(7(/<
2SWLRQDODFFHVVRULHVFDQEHDGGHGKHUH
Scichemtech –USA Electrophoresis
ELECTROPHORESIS
(OHFWURSKRUHVLVLVDWHFKQLTXHXVHGWRVHSDUDWHELRORJLFDOPROHFXOHVVXFKDVQXFOHLFDFLGVFDUERK\GUDWHVDQGDPLQRDFLGVEDVHGRQWKHLUPRYHPHQW
GXHWRWKHLQÀXHQFHRIDGLUHFWHOHFWULFFXUUHQWLQDEXIIHUHGVROXWLRQ3RVLWLYHO\FKDUJHGPROHFXOHVPRYHWRZDUGWKHQHJDWLYHHOHFWURGHZKLOHQHJDWLYHO\
charged molecules move toward the positive electrode.
,QWKHODVWGHFDGHVWKHUROHRIHOHFWURSKRUHVLVLQWKHVHSDUDWLRQRIWKHELRPROHFXOHVOLNHQXFOHLFDFLGVDQGWKHSURWHLQVKDYHLQFUHDVHGUDSLGO\,Q
WXUQ PDQ\ FRPPHUFLDO FRPSDQLHV VWDUWHG SURGXFLQJ YDULRXV XQLWV WR SHUIRUP WKH (OHFWURSKRUHVLV :H DW 6FLFKHP7HFK DOVR VWDUWHG RXU QHZ OLQH RI
electrophoretic equipment. We focus with the basic line of electrophoretic equipments and related accessories. Apparatus for gel electrophoresis are
UHODWLYHO\VLPSOH(OHFWURSKRUHVLVFHOOVDUHHVVHQWLDOO\SODVWLFER[HVZLWKDQRGHDQGFDWKRGHEXIIHUFRPSDUWPHQWVHOHFWURGHVXVXDOO\SODWLQXPZLUHDQG
jacks for making electrical contact with the electrodes. Gels are held vertically between the electrode chambers during the run. Gel cassettes have open
tops and bottoms. The bottom is sealed with a gasket during gel formation and the top is open to receive monomer solution. The top and bottom ends
DUHRSHQDQGLQFRQWDFWZLWKEXIIHUIRUHOHFWURSKRUHVLV+LJKYROWDJHGLUHFWFXUUHQWVXSSOLHVSURYLGHHOHFWULFDOSRZHUIRUHOHFWURSKRUHVLV0LFURSLSHWWHV
WHVWWXEHVDQGKHDWLQJEORFNVDUHVDPSOHKDQGOLQJQHFHVVLWLHV0DQ\VXLWDEOHGHYLFHVDUHDYDLODEOHIURP6FLFKHP7HFK
2XUHTXLSPHQWVDUHGHVLJQHGWRFDWHUWKH(GXFDWLRQDODQGEDVLFUHVHDUFKUHODWHGDSSOLFDWLRQVDQGWKHFXVWRPHUV$OVRZHIRFXVPDLQO\RQWKHHTXLSPHQW
SDUWDQGLQFDVHLI\RXQHHGWKHUHODWHGFKHPLFDOVUHDJHQWVDQGEXIIHUVZHFDQVXSSO\XSRQUHTXHVW
2XU6&75'WHDPLVVXUHWKDWRXUFXVWRPHUVZLOOHQMR\WKHVLPSOLFLW\RIRXULQKRXVHGHVLJQHGXQLWV
346 [email protected]
www.scichemtech.com
The true entrepreneur is a doer, not a dreamer.
SCT NUCLEIC ACIDS ELECTROPHORESIS
,QWKHHDUO\GD\VRI'1$PDQLSXODWLRQ'1$IUDJPHQWVZHUHODERULRXVO\VHSDUDWHGE\JUDYLW\,QWKHVWKHSRZHUIXOWRRORI'1$JHOHOHFWURSKRUHVLV
was developed. This process uses electricity to separate DNA fragments by size as they migrate through a gel matrix.
(OHFWURSKRUHVLVPD\EHWKHPDLQWHFKQLTXHIRUPROHFXODUVHSDUDWLRQLQWRGD\¶VFHOOELRORJ\ODERUDWRU\%HFDXVHLWLVVXFKDSRZHUIXOWHFKQLTXHDQG\HW
UHDVRQDEO\HDV\DQGLQH[SHQVLYHLWKDVEHFRPHFRPPRQSODFH,QVSLWHRIWKHPDQ\SK\VLFDODUUDQJHPHQWVIRUWKHDSSDUDWXVDQGUHJDUGOHVVRIWKH
PHGLXPWKURXJKZKLFKPROHFXOHVDUHDOORZHGWRPLJUDWHDOOHOHFWURSKRUHWLFVHSDUDWLRQVGHSHQGXSRQWKHFKDUJHGLVWULEXWLRQRIWKHPROHFXOHVEHLQJ
separated.
(OHFWURSKRUHVLVFDQEHRQHGLPHQVLRQDOLHRQHSODQHRIVHSDUDWLRQRUWZRGLPHQVLRQDO2QHGLPHQVLRQDOHOHFWURSKRUHVLVLVXVHGIRUPRVWURXWLQH
SURWHLQDQGQXFOHLFDFLGVHSDUDWLRQV7ZRGLPHQVLRQDOVHSDUDWLRQRISURWHLQVLVXVHGIRU¿QJHUSULQWLQJDQGZKHQSURSHUO\FRQVWUXFWHGFDQEHH[WUHPHO\
DFFXUDWHLQUHVROYLQJDOORIWKHSURWHLQVSUHVHQWZLWKLQDFHOOJUHDWHUWKDQ
:HDW6FLFKHP7HFKGHYHORSHGWKH1XFOHLF$FLGV(OHFWURSKRUHVLV8QLWVDQGZLWKWKHVXLWDEOHDFFHVVRULHVIRURXU%LRFXVWRPHUV:HKDYHQDPHGWKLV
VHULHVRISURGXFWVDV'5%$/$VHULHV:DWULFN6HULHVLQRUGHUWRUHFRJQLVHDQGUHPHPEHUDOOWKHNQRZQDQGXQNQRZQVFLHQWLVWZKRKDYHFRQWULEXWHG
IRUWKH1XFOHLF$FLGVUHVHDUFK,QWKHIROORZLQJSDJHV¿QGVRPHRIUHODWHGSURGXFWV
SCT- DRBALA : NUCLEIC ACID ELECTROPHORESIS (800 ML)
SALIENT FEATURES:
Ɣ 6&7 '5%$/$18&/(,& $&,' (/(&7523+25(6,6 81,76 DUH GHVLJQHG ZLWK
FUHDWLYHQHVV WR JHW WKH HOHJDQFH DQG SURGXFHG ZLWK SURSHU TXDOLW\ DQG PHHWV WKH
VSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7(OHFWURSKRUHVLVWDQNV$FFRPPRGDWHVVWDQGDUGJHOVIRUERWKDQDO\WLFDODQGSUHSDUDWLYH
studies of nucleic acid.
Ɣ 'HVLJQHGIRUVHSDUDWLRQVRI'1$DQG51$UHVWULFWLRQIUDJPHQWVLQDJDURVHJHODVZHOODV
3&5ŠVFUHHQLQJDQG5)/3
Ɣ 0D[LPXPQXPEHURIVDPSOHVZLWKFRPEV
Ɣ *HOWUD\[FPKDVVSDFHVIRUFRPEVLQVHUWLRQ
Ɣ *HOWUD\[FPKDVVSDFHVIRUFRPEVLQVHUWLRQ
Ɣ &RPEVDQGWHHWKFRPSDWLEOHZLWKPXOWLFKDQQHOSLSHWWHV
Ɣ 3UHSDUDWLYHFRPEVDOVRDYDLODEOHDGMXVWDEOHIHHWDQGEXEEOHOHYHO5HGVWULSVIRUZHOOV
visualisation.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
MODEL NO.
PRODUCT NO.
Buffer Volume
(w x l x h)
SCT-107.008.01
SCT-DRBALA-1
800 ml Unit dimensions
28 x 16 x 9 cm
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.008.01
SCT-DRBALA-1
DESCRIPTION
6&718&/(,&$&,'(/(&7523+25(6,6LQFOXGHGUHPRYDEOH89WUDQVSDUHQWJHOWUD\[FPZ[O
UHPRYDEOHFDVWLQJJDWHVPPWKLFNQHVVWHHWKFRPEVDPSOHYROXPH—OVDIHW\OLGVHWRISRZHU
OHDGVEXIIHUFLUFXODWLRQDFFHVVRULHVXVHU¶VPDQXDO
OPTIONAL ACCESSORIES:
PRODUCT NO.
THICKNESS
TEETH
SAMPLE VOLUME*
SCT-107.008.AA
Comb 1.0 mm
10
—O
SCT-107.008.AB
Comb 2.0 mm
10
—O
SCT-107.008.AC
&RPEPP
10
—O
SCT-107.008.AD
Comb 1.0 mm
16
—O
SCT-107.008.AE
Comb 2.0 mm
16
—O
SCT-107.008.AF
&RPEPP
16
—O
SCT-107.008.AG
Comb 1.0 mm
18
—O
compatible with multichannel pipettes
6&7$+
3UHS&RPEPPVDPSOHPDUNHUV—O[—O
SCT-107.008.AI
3UHS&RPEPPVDPSOHVPDUNHUV—O[—O
SCT-107.008.AJ
3UHS&RPEPPVDPSOHPDUNHUV—O[—O
SCT-107.008.AK
U.V. transparent tray 10 x 14 cm (w x l) Supplied with 2 removable casting gates
SCT-107.008.AL
U.V. transparent tray 10 x 8 cm (w x l) Supplied with 2 removable casting gates
SCT-107.008.AM
Set of power leads
SCT-107.008.AN
Separate gel Casting base with adjustable feet and bubble
WELL WIDTH
6.0 mm
6.0 mm
6.0 mm
PP
PP
PP
PP
347
PP
PP
PP
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
:HUHFRPPHQGWKHIROORZLQJSRZHUVXSSOLHVIRUWKHDERYHXQLWV
352'(&712
MODEL NO.
9ROWDJH2XWSXWUDQJH5HVROXWLRQ
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
0D[LPXP3RZHU
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
[email protected]
SCT-107.011.10
SCT-EDISON-1
9YROWVWHSV
1 - 400 mA / 1 mA steps
100 W
1 volt - 1 mA
YROW—$:
stop - audible alarm - message
ƒ&ƒ&
17 x 24 x 7 cm
1.6 kg
SCT-EDISON 1
www.scichemtech.com 347
Everybody wants happiness nobody wants pain ; but you cant have a rainbow without a little rain.
SCT DRBALA : NUCLEIC ACID ELECTROPHORESIS (1200 ML)
SALIENT FEATURES:
Ɣ 6&7 '5%$/$ 18&/(,& $&,' (/(&7523+25(6,6 81,76 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRU
the applications with high level performance.
Ɣ $FFRPRGDWHVVWDQGDUGJHOVIRUERWKDQDO\WLFDODQGSUHSDUDWLYHVWXGLHVRIQXFOHLFDFLG'HVLJQHG
IRUVHSDUDWLRQVRI'1$DQG51$UHVWULFWLRQIUDJPHQWVLQDJDURVHJHODVZHOODV3&5ŠVFUHHQLQJ
DQG5)/3
Ɣ 6KRUWDQGORQJOHQJWKVHSDUDWLRQDFFRUGLQJWKHVHOHFWHG*HO7UD\
Ɣ *HOWUD\[FPKDVVSDFHVIRUFRPELQVHUWLRQ
Ɣ *HOWUD\[FPKDVVSDFHVIRUFRPEVLQVHUWLRQ
Ɣ *HOWUD\[FPKDVVSDFHVIRUFRPEVLQVHUWLRQ
Ɣ *HOWUD\[FPKDVVSDFHVIRUFRPEVLQVHUWLRQ
Ɣ &RQYHQWLRQDOFRPSDWLEOHZLWKPXOWLFKDQQHOSLSHWWHVDQGSUHSDUDWLYHFRPEV
Ɣ DGMXVWDEOHIHHWDQGEXEEOHOHYHO
Ɣ 5HGVWULSVIRUZHOOVYLVXDOL]DWLRQ
Ɣ 3RUWVIRUEXIIHUFLUFXODWLRQ
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-DR
BALA
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Buffer Volume
Unit dimensions
SCT-107.008.02
SCT-DRBALA-2
1200 ml
Z[O[K[[FP
SCT-107.008.02
SCT-DRBALA-3
1200ML
More accessories
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.008.02
SCT-DRBALA-2
6&7
6&7'5%$/$
DESCRIPTION
6&7'5%$/$,QFOXGHVUHPRYDEOH89WUDQVSDUHQWJHOWUD\[FPZ[OUHPRYDEOHFDVWLQJ
JDWHV PP WKLFNQHVV WHHWK FRPE VDPSOH YROXPH —O VDIHW\ OLG VHW RI SRZHU OHDGV EXIIHU
FLUFXODWLRQDFFHVVRULHVXVHU¶VPDQXDO
6&7'5%$/$ )XOO\ HTXLSSHG ZLWK FRPEV IRU UXQQLQJ VDPSOHV RQ D [ FP JHO ,QFOXGHV
UHPRYDEOH89WUDQVSDUHQWJHOWUD\[FPZ[OHTXLSSHGE\UHPRYDEOHFDVWLQJJDWHV[
PPWKLFNQHVVWHHWKFRPEFRPSDWLEOHZLWKPXOWLFKDQQHOSLSHWWHVVDPSOHYROXPH—OVDIHW\OLGVHW
RISRZHUOHDGVEXIIHUFLUFXODWLRQDFFHVVRULHVXVHU¶VPDQXDO
OPTIONAL ACCESSORIES:
348
PRODUCT NO.
THICKNESS
TEETH
SCT-107.008.BA
SCT-107.008.BB
SCT-107.008.BC
SCT-107.008.BD
SCT-107.008.BE
SCT-107.008.BF
SCT-107.008.BG
Comb 1.0 mm**
Comb 2.0 mm**
&RPEPP
Comb 1.0 mm
Comb 2.0 mm
&RPEPP
Comb 1.0 mm**
16
16
16
27
27
27
6&7%+
SCT-107.008.BI
SCT-107.008.BJ
SCT-107.008.BK
SCT-107.008.BL
SCT-107.008.BM
SCT-107.008.BN
6&7%2
6&7%3
SAMPLE
VOLUME*
—O
—O
—O
—O
—O
—O
—O
3UHS&RPEPPVDPSOHPDUNHU—O—O
3UHS&RPEPPVDPSOHPDUNHU—O—O
3UHS&RPEPPVDPSOHPDUNHU—O—O
U.V. transparent tray 15 x 20 cm (w x l) Supplied with 2 removable casting gates
U.V. transparent tray 15 x 17 cm (w x l) Supplied with 2 removable casting gates
U.V. transparent tray 15 x 12 cm (w x l) Supplied with 2 removable casting gates
U.V. transparent tray 15 x 8 cm (w x l) Supplied with 2 removable casting gates
Set of power leads
Separate gel Casting base with adjustable feet and bubble
WELL WIDTH
6.0 mm
6.0 mm
6.0 mm
4.0 mm
4.0 mm
4.0 mm
PP
PP
PP
PP
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
:HUHFRPPHQGWKHIROORZLQJSRZHUVXSSOLHVIRUWKHDERYHXQLWV
352'8&712
MODEL NO.
9ROWDJH2XWSXWUDQJH5HVROXWLRQ
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
0D[LPXP3RZHU
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
348 [email protected]
SCT-107.001.10
SCT-EDISON-1
9YROWVWHSV
1 - 400 mA / 1 mA steps
100 W
1 volt - 1 mA
YROW—$:
stop - audible alarm - message
ƒ&ƒ&
17 x 24 x 7 cm
1.6 kg
SCT-EDISON 1
www.scichemtech.com
Just because something doesn’t do what you planned it to do doesn’t mean it’s useless.
SCT-WATRICK : PORTABLE NUCLEIC ACID SEQUENCERS
SALIENT FEATURES:
Ɣ 6&7:$75,&.3257$%/(18&/(,&$&,'6(48(1&(56DUHGHVLJQHGZLWKFUHDWLYHQHVV
WRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH
applications with high level performance.
Ɣ 6&,&+(07(&+'1$VHTXHQFLQJXQLWLVGHVLJQHGZLWKFDELQHWVW\OHGRRUVDQGDVDIHW\OLG
to provide easy access for sample loading without compromising safety. All components are
shielded and the unit cannot operate until the doors are closed and the safety lid is in place.
$FRPELQDWLRQRIUXEEHUPRXQWHGSUHFLVLRQPDFKLQHGDOXPLQLXPKHDWWUDQVIHUSODWHVÀRDW
JODVV SODWHV DQG FODPSV HQVXUH H[FHOOHQW KHDW GLVWULEXWLRQ DQG VWUDLJKW VDPSOH PLJUDWLRQ
through the gel. A drainage port in the upper buffer tank facilitates emptying of the running
buffer. An optional fan kit provides adjustable thermostatic control of the gel and enables gels
WREHUXQDWKLJKHUVSHHGV:LWKWKHIDQNLWD[FPPPJHOFDQEHUXQDWƒ&
within 1 hour 45 minutes (including the pre-run).
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Gel dimensions
Max buffer volume
SCT-107.009.01
SCT-WATRICK-1
[FP
700 ml (W x L)
700 ml
[[FP:[/[+
48
upper
lower
Dimensions
Max. sample capacity
Combs available
No. of samples
Thickness
SCT-WATRICK
PP
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.009.01
MODEL NO.
DESCRIPTION
6&7'1$6HTXHQFLQJ*HO8QLW[FPZLWK,QWHJUDO$OXPLQLXP+HDW6LQN3ODWH,QFOXGHV[1RWFKHG
SCT-WATRICK-1 *ODVV3ODWH[3ODLQ*ODVV3ODWH[6HWRIPP0HOLQH[6SDFHUVRIPP0HOLQH[6DPSOH
Shark’s Tooth Comb.
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.008.CA
SCT-107.008.CB
SCT-107.008.CC
SCT-107.008.CD
SCT-107.008.CE
SCT-107.008.CF
DESCRIPTION
1RWFKHG*ODVV3ODWHSN
3ODLQ*ODVV3ODWHSN
PP6SDFHU6HW[FP:[/
PP6SDFHU6HW[FP:[/
Thermostatic Fan kit for sequencing units
7HPSHUDWXUHSUREHVXLWDEOHIRU3RZHUVXSSOLHV
349
COMBS FOR SEQUENCING UNITS SPECIFICATIONS & ORDERING INFORMATION
33 cm Wide Combs suitable for DNA Sequencing
SCT-107.008.DA
SCT-107.008.DB
SCT-107.008.DC
SCT-107.008.DD
SCT-107.008.DE
SCT-107.008.DF
0.25
0.25
0.25
40
60
80
40
60
80
4
2
2.5
4
2
2.5
2.5
1.1
2.5
1.1
5
2.5
2.5
7
4
5.6
4.5
2.8
5.6
4.5
2.8
7
5
7
7
5
33 cm Wide Shark’s Tooth Combs suitable for DNA Sequencing
SCT-107.008.EA
SCT-107.008.EB
SCT-107.008.EC
SCT-107.008.ED
SCT-107.008.EE
SCT-107.008.EF
0.25
0.25
0.25
[email protected]
48
60
96
48
60
96
0.25
0.25
0.25
0.25
0.25
0.25
www.scichemtech.com 349
The true secret of happiness lies in the taking a genuine interest in all the details of daily life.
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
PRODUCT NO.
MODEL NO.
2XWSXWYROWDJHUDQJH5HVROXWLRQ
2XWSXWFXUUHQWUDQJH5HVROXWLRQ
2XWSXWFXUUHQWUDQJHZLWK3URJ
2XWSXWSRZHUUDQJH5HVROXWLRQ
Temperature range / Resolution
Integrator range / Resolution
Timer range / Resolution
Minimum regulated value
Value display range / Resolution
Minimum non regulated value
0LQLPXPRXWSXWZLWKSURJUDP
Fault detection
Dimensions (w x d x h)
Weight
SCT-107.011.13
SCT-EDISON-4
9ROW9ROWVWHSV
—$P$P$VWHSV
P$P$
ZDWWVZDWWVWHSV
ƒ&LQƒ&VWHSV
9ROW+U9ROW+UVWHSV
1 - 9999 minutes / 1 minute steps
10 Volt - 1 mA - 1 watt
9ROW9ROW
P$P$
ZDWWVZDWW
ƒ&ƒ&
9ROW+U9ROW+UVWHSV
0 - 9999 minutes / 1 mn steps
9ROW—$:
10 Volt - 0 mA - 0 W
VWRSDXGLEOHDODUPDQGGLVSOD\HGPHVVDJHV
[[FP
4 kg
SCT-EDISON 4
PROTEIN GEL ELECTROPHORESIS:
6FLFKHP7HFK86$3URWHLQJHO(OHFWURSKRUHVLV$Q,QWUR
3URWHLQHOHFWURSKRUHVLVSURWHLQVDUHVHSDUDWHGRQWKHEDVLVRIFKDUJHDQGWKHFKDUJHRIDSURWHLQFDQEHHLWKHURUGHSHQGLQJXSRQWKHS+RI
WKHEXIIHU,QQRUPDORSHUDWLRQDFROXPQRIJHOLVSDUWLWLRQHGLQWRWKUHHVHFWLRQVNQRZQDVWKH6HSDUDWLQJRU5XQQLQJ*HOWKH6WDFNLQJ*HODQGWKH
Sample Gel. The sample gel may be eliminated and the sample introduced via a dense non-convective medium such as sucrose. Electrodes are
attached to the ends of the column and an electric current passed through the partitioned gels. If the electrodes are arranged in such a way that the
XSSHUEDWKLVFDWKRGHZKLOHWKHORZHUEDWKLVDQRGHDQGDQLRQVDUHDOORZHGWRÀRZWRZDUGWKHDQRGHWKHV\VWHPLVNQRZQDVDQDQLRQLF
V\VWHP)ORZLQWKHRSSRVLWHGLUHFWLRQZLWKFDWLRQVÀRZLQJWRWKHFDWKRGHLVDFDWLRQLFV\VWHP
$WRQHWLPHRUDQRWKHUGXULQJWKHFRXUVHRISURWHLQDQDO\VLVRUSXUL¿FDWLRQUHVHDUFKHUVDUHOLNHO\WRPDNHXVHRIJHOHOHFWURSKRUHVLV$OOODERUDWRULHV
working with proteins have some capability for carrying out gel electrophoresis and all researchers have at least rudimentary knowledge of the
technique.
*HOHOHFWURSKRUHVLVFDQSURYLGHLQIRUPDWLRQDERXWWKHPROHFXODUZHLJKWVDQGFKDUJHVRISURWHLQVWKHVXEXQLWVWUXFWXUHVRISURWHLQVDQGWKHSXULW\RI
a particular protein preparation. It is relatively simple to use and it is highly reproducible. The most common use of gel electrophoresis is the qualitative
DQDO\VLVRIFRPSOH[PL[WXUHVRISURWHLQV0LFURDQDO\WLFDOPHWKRGVDQGVHQVLWLYHOLQHDULPDJHDQDO\VLVV\VWHPVPDNHJHOHOHFWURSKRUHVLVSRSXODU
for quantitative and preparative purposes as well. The technique provides the highest resolution of all methods available for separating proteins.
3RO\SHSWLGHVGLIIHULQJLQPROHFXODUZHLJKWE\DVOLWWOHDVDIHZKXQGUHGVRIGDOWRQVDQGSURWHLQVGLIIHULQJE\OHVVWKDQS+XQLWLQWKHLULVRHOHFWULF
points are routinely resolved in gel.
:HDW6FLFKHPWHFKUHDOL]HGWKDW3URWHLQ(OHFWURSKRUHVLVPXVWEHLQFRUSRUDWHGDORQJZLWKWKH1XFOHLF$FLGV+HQFHZHKDYHLQWURGXFHG3UR-DPHV
'5.-/HQLQJK3URWHLQ(OHFWURSKRUHVLVDQGUHODWHGSURGXFWVHULHVVHULHVLQRUGHUWRUHPHPEHUDOOWKHNQRZQDQGXQNQRZQ6FLHQWLVWV3URI¶VZKR
KDYHFRQWULEXWHGWRWKH%LR&KHPLVWU\DQGWKHSURWHLQFKHPLVWU\,QWKHIROORZLQJSDJHV\RXZLOO¿QGRXU3URWHLQ(OHFWURSKRUHVLVUHODWHGSURGXFWV
SCT-PROTEIN GEL ELECTROPHORESIS PROJAMES 1 (300-400 ml)
SALIENT FEATURES:
350
2XU352-$0(6HOHFWURSKRUHVLVXQLWVDUHPDQXIDFWXUHGWRDKLJKVSHFL¿FDWLRQDQGGHVLJQ
to combine versatility with safety. The robust gel tanks are easy to use and are offering
PDQ\JHOVL]HVVWDQGDUGJHOV$OO352-$0(6JHOXQLWVDUHVXSSSOLHGZLWKÀRDWJODVVSODWHV
WRHQVXUHWKDWWKHJHOVDUHRIXQLIRUPWKLFNQHVVSURYLGLQJDQHYHQVDPSOHPLJUDWLRQDQG
minimum lane distortion. Gel can be cast in the inner running frame.
7KH352-$0(6/LVGHVLJQHGLQRUGHUWREHFRPSDWLEOHZLWKRXUSUHFDVWJHOVDQGZLWK
most pre-cast gels 10 x 10 cm. Cooling is a built-in equipment but not necessary for all
DSSOLFDWLRQV$OO352-$0(6PRGHOVKDYHDJHOFDVWLQJV\VWHPXVLQJWKHVODEJHOUXQQLQJ
module and a leak-free separate casting base equipped by two silicone seals and two
clamping cams. This system allows two gel to be cast at a time directly in the gel running
module.
SCT-PROJAMES 1
7KHQDIWHUJHOSRO\PHULVDWLRQWKHUXQQLQJPRGXOHLVUHPRYHGIURPWKHFDVWLQJEDVHDQG
directly placed in the outer buffer tank.
‡
‡
‡
‡
‡
‡
‡
‡
(DV\WRXVHFODPSLQJV\VWHP
6DIHW\OLGZLWKLQWHJUDOSRZHUOHDGV
/RQJOLIHSXUHSODWLQXPHOHFWURGHVDUHERWKSURWHFWHGDQGXVHUUHSODFHDEOH
*ROGSODWHGWHUPLQDOVIRUFRUURVLRQUHVLVWDQFH
/HDNIUHHEXIIHUVHDOV
)ORDWJODVVSODWHVHQVXUHXQLIRUPJHOWKLFNQHVVDQGVWUDLJKWVDPSOHPLJUDWLRQ
6XSSOLHGZLWKFDVWLQJEDVH
&RPSOHPHQWHGZLWKDIXOOUDQJHRIFRPEVDQGVSDFHUV
350 [email protected]
www.scichemtech.com
Everyone makes mistakes; if you cant forgive others , don’t expect others to forgive you
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Total Buffer Volume
Maximum number of samples
8QLWGLPHQVLRQV+[:['
SCT-107.010.01
SCT-PROJAMES-1
PO
2 x 15
14 x 17 x 12 cm
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.010.01
6&7352-$0(6
DESCRIPTION
6&7352-$0(6IXOO\HTXLSSHGIRU[PPJHO[FPDQGFDVWLQJEDVH,QFOXGHV
QRWFKHGJODVVSODWHVSODLQJODVVSODWHVFHUDPLFSODWHVEOLQGSODWHFRPEVZHOOVPP
VSDFHUVPPUHSODFHPHQWJDVNHWLQWHUQDOUXQQLQJPRGXOHZLWKLQWHUQDOFRROLQJFKDPEHU
VDIHW\OLGZLWKSRZHUFRUGVJHOFDVWLQJEDVHXVHU¶VPDQXDO
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.010.AA
SCT-107.010.AB
SCT-107.010.AC
SCT-107.010.AD
SCT-107.010.AE
SCT-107.010.AF
SCT-107.010.AG
6&7$+
SCT-107.010.AI
SCT-107.010.AJ
SCT-107.010.AK
SCT-107.010.AL
SCT-107.010.AM
SCT-107.010.AN
6&7$2
6&7$3
6&7$4
SCT-107.010.AR
SCT-107.010.AS
SCT-107.010.AT
SCT-107.010.AU
SCT-107.010.AV
DESCRIPTION
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPPPXOWLFKDQQHOSLSHWWH:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
6HWRI[PPVSDFHUV
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPPPXOWLFKDQQHOSLSHWWHFRPSDWLEOH:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
6HWRI[PPVSDFHUV
3ODLQJODVVSODWH[FPSLHFH
Notched glass plate 10x10 cm (1 piece)
Notched alumina plate 10x10 cm (1 piece)
Blocking plate for running one gel (Blind plate)
Water cooled removable Running module (already included in the package no. 400000)
Replacement clamps for running module no. 400010 (x 2)
Replacement gasket for running module no. 400010 (x 2)
Gel casting base (already included in the package no. 400000)
Replacement gasket for casting base (x 2)
*HOFDVWLQJEDVHDFU\OLFEORFNZLWKJDVNHWDQGFODPSVIRUFDVWLQJJHOVLQGHSHQGHQWO\
351
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
COMPACT, LIGHT WEIGHT AND POWERFUL UNIT
PRODUCT NO.
MODEL NO.
9ROWDJH2XWSXWUDQJH5HVROXWLRQ
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
0D[LPXP3RZHU
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
[email protected]
SCT-107.011.10
SCT-EDISON-1
9YROWVWHSV
1 - 400 mA / 1 mA steps
100 W
1 volt - 1 mA
YROW—$:
stop - audible alarm - message
ƒ&ƒ&
17 x 24 x 7 cm
1.6 kg
SCT-EDISON 1
www.scichemtech.com 351
Keep advertising and the advertising will keep you
SCT PROTEIN ELECTROPHORESIS PROJAMES-2 (1300ml)
SALIENT FEATURES:
Ɣ 6&7352-$0(6 3527(,1 (/(&7523+25(6,6 81,76 DUH GHVLJQHG ZLWK
FUHDWLYHQHVV WR JHW WKH HOHJDQFH DQG SURGXFHG ZLWK SURSHU TXDOLW\ DQG PHHWV WKH
VSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ *ODVVSODWHVL]HVFP:[FP/
Ɣ $FU\ODPLGHFDSDFLW\PO
Ɣ &XUUHQWFRQVWDQWP$JHO
Ɣ 0D[LPXPYROWDJH9ROW
Ɣ 5XQWLPHPLQXWHV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
MODEL NO.
PRODUCT NO.
Total Buffer Volume
Maximum number of samples
8QLWGLPHQVLRQV+[:['
Active gel sizes
Glass plate sizes
Acrylamide capacity
Current constant
Maximum voltage
Run time
SCT-107.010.02
SCT-PROJAMES-2
PO
50
[[FP
[FP:[+
20 cm W x 18-20 cm L
24-49 ml
15-75 mA/gel
1000 Volt
PLQXWHV
SCT-PROJAMES 2
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.010.02
6&7352-$0(6
DESCRIPTION
6&7352-$0(6IXOO\HTXLSSHGIRU[PPJHO[FPJHOFDVWLQJEDVH,QFOXGHV
QRWFKHGJODVVSODWHVSODLQJODVVSODWHVEOLQGSODWHFRPEVZHOOVPPFRPEV
ZHOOV PP VSDFHUV PP UHSODFHPHQW JDVNHW LQWHUQDO UXQQLQJ PRGXOH ZLWK LQWHUQDO
FRROLQJFKDPEHUVDIHW\OLGZLWKSRZHUFRUGVJHOFDVWLQJEDVHXVHU¶VPDQXDO
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.010.BA
SCT-107.010.BB
SCT-107.010.BC
SCT-107.010.BD
SCT-107.010.BE
SCT-107.010.BF
SCT-107.010.BG
6&7%+
SCT-107.010.BI
SCT-107.010.BJ
SCT-107.010.BK
SCT-107.010.BL
SCT-107.010.BM
SCT-107.010.BN
6&7%2
6&7%3
6&7%4
SCT-107.010.BR
352
DESCRIPTION
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
3UHSFRPEWHHWKPP:HOOYROXPH—O—O7HHWKZLGHPP
6HWRI[PPVSDFHUV
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
WHHWKFRPEPP:HOOYROXPH—O7HHWKZLGHPP
6HWRI[PPVSDFHUV
3ODLQJODVVSODWH[FPSLHFH
Notched glass plate 20 x 20 cm (1 piece)
Water cooled removable Running module (already included in the package no. 420000)
Replacement clamps for running (x 2)
Replacement gasket for running (x 2)
Gel casting base (already included in the package
Replacement gasket for casting base (x 2)
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
Recommended Power supply:
PRODUCT NO.
MODEL NO.
2XWSXWUDQJH5HVROXWLRQ
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
Timer range / Resolution
3RZHU
Displays
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
SCT-107.011.12
SCT-EDISON-3
1 - 600 volt / 1 volt steps
1 - 800 mA / 1 mA steps
0 - 9999 min. / 1 min. steps
ZDWWV
5 volt - 1mA
9—$:
stop - audible alarm - fault Led
ƒ&ƒ&
[[FP
4 kg.
APPLICATIONS
DNA/RNA Electrophoresis agarose gel
5)/3DQG'1$)UDJPHQWV
3&56FUHHQLQJ
3URWHLQ(OHFWURSKRUHVLV
2-D Electrophoresis
3UHSDUDWLYHJHO6'63DJH
Semi-dry Blotting
Western Blotting
SCT-EDISON-3
Recommended
Recommended
Recommended
Recommended
3RVVLEOH
Recommended
Recommended
Recommended
352 [email protected]
SCT-EDISON 3
www.scichemtech.com
The true sign of intelligence is not knowledge but imagination.
SCT DRKJ : MINI TRANSBLOTTERS FOR GELS (10 X 10 CM) (LIQUID BLOTTING).
SALIENT FEATURES:
Ɣ 6&7'5.-0,1,75$16%/277(56)25*(/6DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH1257+(51
6287+(51$1':(67(51DSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7'5.-8QLWVDUHXVHGIRUWKHJHOVZLWK[FPVL]H
Ɣ 6&7'5.-KDV:DWHUFRROHGEDVHZLWKVWLUULQJEDUZKLFKFDQEHSODFHGLQWKHXQLWXQGHUWKH
compression cassette. Then unit is placed on a stable magnetic stirrer.
Ɣ 6&7'5.-KDVDQRSHQVTXDUHJULGGHVLJQIRUWKHFDVVHWWHVSURYLGHVDPD[LPXPDUHDIRU
WKHWUDQVIHUDQGLVVWURQJHQRXJKWRPDLQWDLQD¿UPFRQWDFWEHWZHHQWKHJHODQGWKHWUDQVIHU
membrane.
SCT-D
RKJ-1
Ɣ 6&7'5.-KDVUHSODFHDEOHSODWLQXPHOHFWURGHV
Ɣ 6&7'5.-KDV6DIHW\OLGSURYLGHVFRPSOHWHSURWHFWLRQWRWKHXVHU
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.010.03
SCT-DRKJ-1
PO
[[FP
9 cm W x 9 cm L
KRXUV2YHUQLJKW
Buffer Volume
8QLWGLPHQVLRQV+[:['
Transfer Area
Run Time
ORDERING INFORMATIONS:
PRODUCT NO.
6&7
MODEL NO.
DESCRIPTION
SCT-DRKJ-1
SCT-DRKJ-1(OHFWUREORWWLQJXQLWIRUXSWRIRXU[FPJHOVLQFOXGHVFRPSUHVVLRQFDVVHWWHV
VPDOO¿EUHSDFNV
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.010.CA
SCT-107.010.CB
DESCRIPTION
Compression cassette
)LEUHSDGV[FP3.
353
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
Recommended Power supply:
PRODUCT NO.
MODEL NO.
9ROWDJH2XWSXWUDQJH5HVROXWLRQ
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
0D[LPXP3RZHU
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
[email protected]
SCT-107.011.11
SCT-EDISON-2
9YROWVWHSV
1 - 400 mA / 1 mA steps
100 W
1 volt - 1 mA
YROW—$:
stop - audible alarm - message
ƒ&ƒ&
17 x 24 x 7 cm
1.6 kg
SCT-EDISON 2
www.scichemtech.com 353
Everyone should be respected as an individual, but no one idolized.
SCT-DRKJ : TRANSBLOTTERS FOR GELS (20 X 20 CM) (LIQUID BLOTTING)
SALIENT FEATURES:
Ɣ 6&7'5.-75$16%/277(56)25*(/DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFH
DQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH1257+(516287+(51
AND WESTERN applications with high level performance.
Ɣ 6&7'5.-XQLWVDUHXVHGIRUWKHJHOZLWK[FPVL]HV
Ɣ 6&7'5.-KDV:DWHUFRROHGEDVHZLWKVWLUULQJEDUZKLFKFDQEHSODFHGLQWKHXQLWXQGHUWKH
compression cassette. Then unit is placed on a stable magnetic stirrer.
Ɣ 6&7 '5.- KDV DQ RSHQ VTXDUH JULG GHVLJQ IRU WKH FDVVHWWHV SURYLGHV D PD[LPXP DUHD IRU
WKH WUDQVIHU DQG LV VWURQJ HQRXJK WR PDLQWDLQ D ¿UP FRQWDFW EHWZHHQ WKH JHO DQG WKH WUDQVIHU
membrane.
SCT-D
RKJ-2
Ɣ 6&7'5.-KDV5HSODFHDEOHSODWLQXPHOHFWURGHV
Ɣ 6&7'5.-KDV6DIHW\OLGSURYLGHVFRPSOHWHSURWHFWLRQWRWKHXVHU
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
MODEL NO.
PRODUCT NO.
SCT-107.010.04
SCT-DRKJ-2
PO
[[FP
19 cm W x 19 cm L
KRXUV2YHUQLJKW
Buffer Volume
8QLWGLPHQVLRQV+[:['
Transfer Area
Run Time
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.010.04
SCT-DRKJ-2
DESCRIPTION
SCT SCT-DRKJ-2 (OHFWUREORWWLQJ XQLW IRU XS WR WZR [ FP JHO LQFOXGHV FRPSUHVVLRQ
FDVVHWWHVODUJH¿EUHSDFNV
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.010.DA
SCT-107.010.DB
DESCRIPTION
Compression cassette 20 x 20 cm with pads
)LEUHSDGV[FP3.
354
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
Recommended Power supply:
PRODUCT NO.
MODEL NO.
2XWSXWUDQJH5HVROXWLRQ
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
Timer range / Resolution
3RZHU
Displays
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
354 [email protected]
SCT-107.011.12
SCT-EDISON-3
1 - 600 volt / 1 volt steps
1 - 800 mA / 1 mA steps
0 - 9999 min. / 1 min. steps
ZDWWV
5 volt - 1mA
9—$:
stop - audible alarm - fault Led
ƒ&ƒ&
[[FP
4 kg.
SCT-EDISON 3
www.scichemtech.com
Keep updating and be the best version of yourself;
TANKS FOR BLOTTING
SCT DRKJ : THE SLIM- FAST BLOTTERS (LIQUID BLOTTING)
'HVLJQHGIRUDOOEORWWLQJV
3527(,16:(67(51ZLWKVWDQGDUGDOOR\DQRGHDQGFDWKRGH
'1$6287+(51ZLWKSODWLQL]HG7LWDQLXPDQRGH
51$1257+(51ZLWKSODWLQL]HG7LWDQLXPDQRGH
‡ :HVWHUQ%ORWVRIRUPPWKLFNJHOVDUHFOHDUHGRISURWHLQVXSWRN'LQVL]HLQ
minutes at 24Volts.
‡ :HVWHUQ%ORWVRIPPWKLFNJHOVLQPLQXWHVDW9ROWV
SALIENT FEATURES:
Ɣ 6&7 '5.- 7+( 6/,0 )$67 %/277(56 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW WKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH1257+(51
6287+(51$1':(67(51DSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7'5.-FDQSHUIRUPIDVWEORWWLQJIRU3527(,16:(67(51ZLWKVWDQGDUGDOOR\
anode and cathode.
Ɣ 6&7'5.-FDQSHUIRUPIDVWEORWWLQJIRU3527(,16:(67(51ZLWKVWDQGDUGDOOR\
DQRGHDQGFDWKRGHDQGIRU'1$6287+(51ZLWKSODWLQL]HG7LWDQLXPDQRGH
Ɣ 6&7'5.-FDQSHUIRUPIDVWEORWWLQJIRU'1$6287+(51ZLWKSODWLQL]HG7LWDQLXP
anode and for
51$1257+(51ZLWKSODWLQL]HG7LWDQLXPDQRGH
Ɣ 6&7'5.-7,//KDV/2:%8))(592/80($QGMXVWDIHZPLQXWHVIRUORDGLQJ+LJK
VXUIDFHDUHDDVVXUHVDKLJK¿HOGDWWKHJHO
Ɣ 6&7 '5.- 7,// KDV PDLQWHQDQFH IUHH SODWLQL]HG 7LWDQLXP HOHFWURGHV 1R EXEEOH
surrounding the electrodes and Standard alloy electrodes should be wiped occasionally.
Ɣ 6&7'5.-7,//KDVPRGHOVZLWKDOOR\HOHFWURGHVIRU:(67(51%ORW:HVWHUQ%ORWVRI
RUPPWKLFNJHODUHFOHDUHGRISURWHLQVXSWRN'LQVL]HLQPLQXWHVDW9ROWV
DQG:HVWHUQ%ORWVRIPPWKLFNJHOLQPLQXWHVDW9ROWV
Ɣ 6&7 '5.- 7,// KDV PRGHOV ZLWK SODWLQL]HG 7LWDQLXP DQRGH IRU 6287+(51 DQG
127+(51EORWWLQJ
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.010.05
SCT-107.010.06
SCT-107.010.07
SCT-107.010.08
SCT-107.010.09
SCT-107.010.10
SCT-107.010.11
SCT-107.010.12
6&7
SCT-107.010.14
SCT-107.010.15
SCT-107.010.16
MODEL NO.
6&7'5.-
SCT-DRKJ-4
SCT-DRKJ-5
SCT-DRKJ-6
SCT-DRKJ-7
SCT-DRKJ-8
SCT-DRKJ-9
SCT-DRKJ-10
SCT-DRKJ-11
SCT-DRKJ-12
6&7'5.-
SCT-DRKJ-14
DESCRIPTION
[FPXQLWZLWKDOOR\DQRGHIRU:HVWHUQ%ORWV%XIIHUPO
15 x 20 cm unit with alloy anode for Western Blots Buffer 800 ml
20 x 24 cm unit with alloy anode for Western Blots Buffer 1400 ml
[FPXQLWZLWKDOOR\DQRGHIRU:HVWHUQ%ORWV%XIIHUPO
[FPXQLWZLWK3ODWLQL]HG7LWDQLXPDQRGHIRU6RXWKHUQDQG:HVWHUQ%ORWV%XIIHUPO
[FPXQLWZLWK3ODWLQL]HG7LWDQLXPDQRGHIRU6RXWKHUQDQG:HVWHUQ%ORWV%XIIHUPO
[FPXQLWZLWK3ODWLQL]HG7LWDQLXPDQRGHIRU6RXWKHUQDQG:HVWHUQ%ORWV%XIIHUPO
[FPXQLWZLWK3ODWLQL]HG7LWDQLXPDQRGHIRU6RXWKHUQDQG:HVWHUQ%ORWV%XIIHUPO
[FP3ODWLQL]HG7LWDQLXPDQRGHIRUQXFOHLFDFLGEORWV
[FP3ODWLQL]HG7LWDQLXPDQRGHIRUQXFOHLFDFLGEORWV
[FP3ODWLQL]HG7LWDQLXPDQRGHIRUQXFOHLFDFLGEORWV
[FP3ODWLQL]HG7LWDQLXPDQRGHIRUQXFOHLFDFLGEORWV
2WKHURSWLRQDODFFHVVRULHVXSRQUHTXHVW
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
Recommended Power supply:
PRODUCT NO.
MODEL NO.
9ROWDJH2XWSXWUDQJH5HVROXWLRQ
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
0D[LPXP3RZHU
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
SCT-107.011.10
SCT-EDISON-1
9YROWVWHSV
1 - 400 mA / 1 mA steps
100 W
1 volt - 1 mA
YROW—$:
stop - audible alarm - message
ƒ&ƒ&
17 x 24 x 7 cm
1.6 kg
SCT-EDISON-2
9ROWDJH2XWSXWUDQJH5HVROXWLRQ
SCT-107.011.11
9YROWVWHSV
1 - 500 mA / 1 mA steps
0 - 999 min. / 1 min steps
100 W
1 volt - 1 mA
YROW—$:
stop - audible alarm - message
02C - 402C
17 x 24 x 7 cm
1.6 kg
&XUUHQW2XWSXWUDQJH5HVROXWLRQ
0D[LPXP3RZHU
Minimum regulated value
Minimum non regulated value
Fault detection
2SHUDWLQJWHPSHUDWXUH
Dimensions (w x d x h)
Weight
[email protected]
355
SCT-EDISON 1
SCT-EDISON 2
www.scichemtech.com 355
7KHWZRPRVWLPSRUWDQWGD\VLQ\RXUOLIHDUHWKHGD\\RXDUHERUQDQGWKHGD\\RXÀQGRXWZK\
SCT LENINGH : SEMI-DRY BLOTTERS FOR PROTEINS AND NUCLEIC ACIDS
SALIENT FEATURES:Ɣ 6&7/(1,1*+±6(0,'5<%/277(56)253527(,16$1'18&/(,&$&,'6DUH
GHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWV
WKHVSHFL¿FDWLRQVIRUWKH%/277,1*2)3527(,16$1'18&/(,&$&,'6DSSOLFDWLRQVZLWK
high level performance.
6&7/(1,1*+
Ɣ 0LQLDQG/DUJH6HPL'U\%ORWWHUVVL]HV[FP[FP
Ɣ 9HU\KLJKFRQGXFWLYLW\ZLWKFRUURVLRQIUHHHOHFWURGHV
Ɣ &DWKRGHLQVWDLQOHVVVWHHODQRGHLQSODWLQXPSODWHGWLWDQLXPIRUORQJOLIH
Ɣ 8SWRP$FPRIJHOSURYLGHVDYHU\IDVWWUDQVIHU
Ɣ 6WURQJ VLGH FODPS V\VWHP SURYLGHV DQ XQLIRUP SUHVVXUH EHWZHHQ WKH JHO DQG WKH WUDQVIHU
membrane.
RKJ-3
SCT-D
Solution 1: Semi-Dry BLOTTING
‡ 5HFRPPHQGHGIRU%/277,1*2)3527(,16$1'18&/(,&$&,'6
‡ ,GHDOIRUWUDQVIHUULQJDOO3URWHLQRYHUDOOOHVVWKDQNG
‡ 1RVLJQL¿FDQWYROXPHRIEXIIHUWRSUHSDUH
,GHDOIRUSURWHLQVOHVVWKDQ.')DVW:(67(51%/270LQL*HOVLQPLQXWHV'HVLJQHG
for extensive use.
+HDY\OLGZLWK6WDLQOHVV6WHHO&DWKRGH3ODWH
0LQLIRUPDWIRU[FPJHOV%DVHZLWK3ODWLQXPFRDWHG7LWDQLXP$QRGH3ODWH
+HDY\GXW\NQREV
Large gels up to 20 cm x 20 cm or four gels 10 x 10 cm.
TANKS FOR BLOTTING:
Membrane
Transfer Buffer
3RZHU6HWWLQJ
Running Time
PROTEIN
Nitrocellulose
—PRU—P
39')—PRU—P
7RZELQ%XIIHU%XIIHU
6\VWHP%MHUUXP
Schafer-Nielsen
Constant current
P$FP
gel surface area
10-14 Volts maximum
PLQXWHVWRKRXUV
Needs to be experimentally
determined (large molecules
need longer transfer time)
DNA/RNA
Nylon
;;7%(1$4
Constant current
P$FP
gel surface area
10-14 Volts max.
PLQXWHVWRKRXUV
generally in the lower
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.011.01
SCT-107.011.02
356
MODEL NO.
6&7/(1,1*+
6&7/(1,1*+
DESCRIPTION
0LQL/(1,1*+6HPL'U\%ORWWHUIRUJHOXSWR[FP /DUJH/(1,1*+6HPL'U\%ORWWHUIRUJHOXSWR[FP
SCT-LENINGH : ISO ELECTRIC FOCUSING (IEF) UNITS
SALIENT FEATURES:
Ɣ 6&7/(1,1*+,62(/(&75,&)2&86,1*81,76DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHW
WKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWWKHVSHFL¿FDWLRQVIRUWKHDOOWKHÀDW
bed electrophoresis techniques / applications with high level performance.
Ɣ 6&7/(1,1*+KDVDODUJH[PPFRROLQJSODWHDOORZVIRUWKHUXQQLQJRIYLUWXDOO\DOO
of the available pre-cast gels and self-cast gels.
Ɣ 6&7 /(1,1*+ KDV D UHPRYDEOH FRROLQJ SODWH KDV D VSHFLDOO\ GHVLJQHG FHUDPLF VXUIDFH
which provides homogeneous thermostatting over it’s entire surface. This provides even heat
GLVVLSDWLRQSDUWLFXODUO\LPSRUWDQWZKHQXVLQJXOWUDWKLQ,()JHOVDWKLJKYROWDJHV*HOFDQEH
HOHFWURSKRUHVHGDWWHPSHUDWXUHVDVORZDVƒ&
Ɣ 6&7/(1,1*+KDVVRPHPDUNLQJVRQWKHFHUDPLFSODWHVKRZWKHSRVLWLRQRIWKHHOHFWURGHV
ZKHQXVLQJWKHPRVWSRSXODUVL]HVRIFRPPHUFLDOO\DYDLODEOHSUHFDVWJHOV7KHPDUNLQJVDOVR
FRLQFLGHZLWKPDUNLQJVRQWKHHOHFWURGHVWDQGZKLFKDOORZVIRUWKHDOLJQPHQWRIWKHHOHFWURGHV
before lowering them onto the gel. The coded grid allows for the accurate measurement of
sample migration.
Ɣ 6&7 /(1,1*+ KDV VRPH SRVLWLRQV RI WKH HOHFWURGHV DUH DGMXVWHG E\ PRYLQJ WKHP LQ DQ
electrode frame. The electrode frame is also designed for easy electrode tensioning and
replacement.
Ɣ 6&7/(1,1*+QHHGVDUHIULJHUDWHGFLUFXODWRUIRUWKHFRROLQJSXUSRVHVZHDW6&7VWURQJO\
UHFRPPHQGWRXVHRXU6&7UHIULJHUDWHGFLUFXODWRUVIRUWKLVSXUSRVH3OVUHIHURXUFKDSWHU
6&7+<'523URGXFW1R6&7IRUPRUHGHWDLOV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
356 [email protected]
SC
T-L
E
NIN
GH
www.scichemtech.com
Everything has beauty, but not everyone sees it
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Running Buffer Volume (ml)
Cooling plate size (mm)
Unit dimensions (W x L x L) (mm)
SCT-107.011.03
SCT-LENINGH-3
600 ml per chamber
270 x 270 mm
[[PP
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
6&7/(1,1*+
DESCRIPTION
6&7 &RPSOHWH /(1*7+ ,() 8QLW FRPHV DORQJ ZLWK 5XQQLQJ 7DQN &RROLQJ 3ODWH *ODVV
Electrode Frame and Electrodes.
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.011.EA
SCT-107.011.EB
SCT-107.011.EC
SCT-107.011.ED
6&7
DESCRIPTION
&RROLQJ3ODWH
Glass Electrode Frame
Cathode Electrode
Anode Electrode
SCT-Immersion Bath Circulator (Refrigerated)
OPTIONAL POWER SUPPLY : (TO BE ORDERED SEPARATELY)
PRODUCT NO.
MODEL NO.
2XWSXWYROWDJHUDQJH5HVROXWLRQ
2XWSXWFXUUHQWUDQJH5HVROXWLRQ
2XWSXWFXUUHQWUDQJHZLWK3URJ
2XWSXWSRZHUUDQJH5HVROXWLRQ
Temperature range / Resolution
Integrator range / Resolution
Timer range / Resolution
Minimum regulated value
Value display range / Resolution
Minimum non regulated value
0LQLPXPRXWSXWZLWKSURJUDP
Fault detection
Dimensions (w x d x h)
Weight
SCT-107.011.12
SCT-EDISON-3
9ROW9ROWVWHSV
—$P$P$VWHSV
P$P$
ZDWWVZDWWVWHSV
ƒ&LQƒ&VWHSV
9ROW+U9ROW+UVWHSV
1 - 9999 minutes / 1 minute steps
10 Volt - 1 mA - 1 watt
9ROW9ROW
P$P$
ZDWWVZDWW
ƒ&ƒ&
9ROW+U9ROW+UVWHSV
0 - 9999 minutes / 1 mn steps
9ROW—$:
10 Volt - 0 mA - 0 W
VWRS DXGLEOH DODUP DQG GLVSOD\HG
messages
[[FP
4 kg
SCT-EDISON 4
SCT-EDISON SERIES POWER SUPPLY
PRODUCT NO.
MODEL NO.
Maximum Voltage (Volts)
Maximum Current (mA)
0D[LPXP3RZHU:
Constant Voltage and Current
Constant Voltage
&XUUHQWDQG3RZHU
Timer / Gel Saver
Integrator
3URJUDPPDEOH
7HPSHUDWXUHFRQWUROE\H[WHUQDO3UREH
Settings by tactile switches
56&RPSXWHUFRPSDWLELOLW\
SCT.107.011.10
EDISON-1
400
100
Ƈ
FILED OF APPLICATIONS
DNA/RNA electrophoresis agarose gel
5)/3DQG'1$)UDJPHQWV
3&56FUHHQLQJ
Nucleic acid sequencing
,VRHOHFWURIRFXVLQJ66&3'**(
3URWHLQ(OHFWURSKRUHVLV
3UHSDUDWLYHJHOV6'63DJH
Semidry Blotting
Western Blotting
[email protected]
SCT.107.011.11
EDISON-2
500
100
Ƈ
SCT.107.011.12
EDISON-3
600
800
Ƈ
ƇƇ
Ƈ
Ƈ
Ƈ
Ƈ
EDISON-1
Ƈ
Ƈ
Ƈ
EDISON-2
Ƈ
Ƈ
Ƈ
EDISON-3
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
Ɣ
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
SCT.107.011.13
EDISON-4
357
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
Ƈ
EDISON-4
Ɣ
Ɣ
Ɣ
Ƈ
Ƈ
Ɣ
www.scichemtech.com 357
Keep your eyes wide open before marriage, half shut afterwards
SCT-LENINGH : VACUUM HEATED GEL DRYERS
SALIENT FEATURES:
Ɣ 6&7/(1,1*+9$&880+($7('*(/'5<(56DUHGHVLJQHGZLWKFUHDWLYHQHVVWR
JHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH*HO
drying applications with high level performance.
Ɣ 6&7/(1,1*+KDVWZRVL]HVRIYDFXXPKHDWHGJHOGU\HU[PPDQG[
400 mm.
Ɣ 6&7/(1,1*+KDYHWZRWLPHUVRQHIRUWKHWHPSHUDWXUHDQGRQHIRUWKHYDFXXPSXPS
7KHGU\LQJWHPSHUDWXUHFDQEHVHWEHWZHHQDPELHQWDQGƒ&DQGUHJXODWHGWR“ƒ&DQGWKH
drying time set up to 5 hours in 1 minute steps.
Ɣ 6&7/(1,1*+KDVWKHRSWLRQDOYDFXXPSXPSZKLFKFDQDOVREHWLPHGWRDXWRPDWLFDOO\
VZLWFKRIIDQ\WLPHXSWRKRXUVLQPLQXWHVWHSV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-LE
NING
H-5
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
GEL DRYERS
Unit dimensions
+[:['
Weight
9$&8803803237,21$/$&&(6625<
Unit dimensions
Maximum Vacuum
0D[LPXP$LUÀRZ
Noise Level
Weight
SCT-107.011.04
SCT-LENINGH-4
SCT-107.011.05
SCT-LENINGH-5
110 x 570 x 400 mm
[[PP
14 Kg
14 Kg
[[FP
-440 mbar
70 litres/min
45 dBa at 1 metre
7 Kg
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
DESCRIPTION
SCT-107.011.04
6&7/(1,1*+
[FP&RPSOHWH6ODE*HO'U\HU6\VWHP,QFOXGHV6WDLQOHVVVWHHOVFUHHQ0\ODUVKHHW3RURXV
SRO\HWK\OHQHVKHHWFOHDUVLOLFRQHUXEEHURYHUOD\VKHHW
SCT-107.011.05
6&7/(1,1*+
[ FP 6ODE *HO 'U\HU 6\VWHP ,QFOXGHV 6WDLQOHVV VWHHO VFUHHQ 0\ODU VKHHW 3RURXV
SRO\HWK\OHQHVKHHWFOHDUVLOLFRQHUXEEHURYHUOD\VKHHW
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.011.BA
DESCRIPTION
9DFXXP3XPS
SCT-VIN-SERIES THERMAL CYCLERS & PCR (POLYMERASE CHAIN REACTION ) MACHINES
358
7KHUPDO&\FOHUVDUHRQHRIWKHLPSRUWDQWWRROVXVHGLQDOOWKHPROHFXODUELRORJLFDOJHQHWLF/DEV&XVWRPHUVQHHGVTXLFNUHOLDEOHUHVXOWV7KLQNLQJ
WKLVDVSHFW6FLFKHP7HFK¶V5'KDVFRODEUDWHGZLWKVRPHRIWKHOHDGLQJ3&57HFKQRORJLVWGHYHORSHG1HZ6&79LQVHULHV3HOWLHUEDVHG3&5
Machines.We have offered 2 models which can be useful for all type of customers like University –college students to Advanced Research Lab
FXVWRPHUV:HDUHVXUHRXU3&5PDFKLQHVZLOOJLYH\RXSUHFLVHDFFXUDWHTXLFNUHVXOWV
SCT –VIN-1 : PETIER BASED THERMAL CYCLER (PCR MACHINE)
SALIENT FEATURES:
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHLVGHVLJQHGLQDHUJRQRPLFZD\HOHJDQWFRPSDFW
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHKDVDWRXFKVFUHHQODUJH´ZLWKFRORXUJUDSKLF
display
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHKDV+LJK4XDOLW\'XUDEOHSUHPLXP3HOWLHUSDUWV
(QVXUHORQJOLIHDQG+LJK4XDOLW\
Ɣ 6&79,1 7KHUPDO &\FOHU 3&5 0DFKLQH KDV RSWLRQDO TXLFNO\ FKDQJHDEOH PRGXOHV IRU
*UDGLHQW3&50RGXOHZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOV
0XOWL3XUSRVH0RGXOH0RGXOH,Q6LWX$GDSWHU
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHKDV3HOWLHUEDVHGKHDWLQJFRROLQJDQGXQLIRUP
blocks which gives precise and better results.
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHKDVLQEXLOW3&5SURWRFROV86%GULYHQ
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHKDVXVHUIULHQGO\XQLTXHOLGRSHQLQJWHFKQRORJ\
358 [email protected]
www.scichemtech.com
The weak can never forgive. Forgiveness is the attribute of the strong.
Ɣ 6&79,1 7KHUPDO &\FOHU 3&5 0DFKLQH FDQ KDYH XSWR SURJUDPV VWHSV
SURJUDPPLQJDQGXSWR7\SLFDOF\FOHVQHVWLQJF\FOHV
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHKDV/RQJ7RXFKGRZQ3&5¶V
Ɣ 6&79,17KHUPDO&\FOHU3&50DFKLQHKDVDXVHUIULHQGO\ZLQGRZVEDVHGVRIWZDUHIRU
KDQGOLQJWKH3&5GDWD¶V
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
+HDWLQJDQG&RROLQJ7HFKQRORJ\
Display
Language
USB Flash Drive
Communications
Additional In-Situ Function
Temperature
Block Temperature Range
0D[+HDWLQJ5DWH
Max. Cooling Rate
Temperature Uniformity
Temperature Accuracy
Display Resolution
Mode of Temperature Control
Ramping Rate Adjustable
Gradient
Gradient Accuracy
Column Uniformity
Gradient Range
Temp. Differential Range
Gradient Capability
Programming
0D[1RRI3URJUDPV
Max. Step
Max. Cycle
Time Increment/Decrement
Temp. Increment/Decrement
$XWR3DXVH
Auto Restart
+ROGDWƒ&
Running Status Display
Real Time Display
Heat Lid
+HLJKWRI+HDW/LG
+HDW/LG7HPSHUDWXUH5DQJH
$XWR6KXW2II
Other Features & Optional modules
%ORFN2SWLRQDO
3RZHU6XSSO\5DQJH
3RZHU&RQVXPSWLRQ
Approvals
'LPHQVLRQ/î:î+
Net Weight
SCT-107.012.01
SCT-VIN-1
0RGHUQ*HQHUDWLRQ3HOWLHU%DVHG7HFKQRORJ\
*UDSKLFDO&RORU'LVSOD\´7RXFK6FUHHQ
English
8QOLPLWHG6WRUDJHRI3URWRFROVZLWK86%)ODVK'ULYH
2 USB2.0 and LAN
<HV$YDLODEOHIRU0RGXOH
ƒ&aƒ&
ƒ&V
ƒ&V
”“ƒ&DWƒ&
”“ƒ&ƒ&ƒ&
ƒ&
6LP7XEH%ORFN0RGH
Yes
”“ƒ&ƒ&ƒ&
”“ƒ&DWƒ&
ƒ&aƒ&
aƒ&
12 Column
0D[3URJUDPV2QERDUG8QOLPLWHG6WRUDJHRI3URWRFROV:LWK86%)ODVK'ULYH
6WHSV
7\SLFDO&\FOHV0D[QHVWLQJF\FOHV
a6HF/RQJ3&5$YDLODEOH
aƒ&7RXFKGRZQ3&5$YDLODEOH
Yes
Yes
Forever
Yes
<HV%DWWHU\%XIIHUHG
6WHSOHVVO\$GMXVWDEOH/LG$FFRPPRGDWHVDOONLQGVRI3&57XEHV6WULSVDQG3ODWHV
ƒ&aƒ&
Yes
359
Gradient Module
0RGXOHZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOV
0XOWL3XUSRVH0RGXOH0RGXOH,Q6LWX$GDSWHU
:LGH5DQJH3RZHU6XSSO\9a9+]
0D[:
,62&(
îîPP
NJV
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.012.01
SCT-VIN-1
[email protected]
DESCRIPTION
6&7±9,13(7,(5%$6('7+(50$/&<&/(53&50DFKLQH,VVXSSOLHGFRPSOHWH
with instruction manual.
www.scichemtech.com 359
Everything should be made as simple as possible, but not one bit simpler
SCT-VIN-2: AUTOMATIC ADVANCED THERMAL CYCLER (PCR MACHINE)
SALIENT FEATURES :
Ɣ 6&79,1$XWRPDWLF7KHUPDO&\FOHU3&50DFKLQHLVGHVLJQHGLQDHUJRQRPLFZD\HOHJDQW
FRPSDFW
Ɣ 6&79,1$XWRPDWLF7KHUPDO&\FOHU3&50DFKLQHKDV0RGHUQ3HOWLHUEDVHGWHFKQRORJ\
DQG+LJK4XDOLW\'XUDEOHSUHPLXP3HOWLHUSDUWV(QVXUHORQJOLIHDQG+LJK4XDOLW\
Ɣ 6&79,1$XWRPDWLF7KHUPDO&\FOHU3&50DFKLQHFDQKDYHXSWRSURJUDPV
VWHSVSURJUDPPLQJDQGXSWR7\SLFDOF\FOHVQHVWLQJF\FOHV
Ɣ 6&79,1$XWRPDWLF7KHUPDO&\FOHU3&50DFKLQHKDV/RQJ7RXFKGRZQ3&5¶V
Ɣ 6&79,1$XWRPDWLF 7KHUPDO &\FOHU 3&5 0DFKLQH$XWRPDWLFDOO\ &DOFXODWHV WKH 0HOWLQJ
DQG$QQHDOLQJ7HPSHUDWXUHWKURXJKLQSXW7ZR3ULPHU6HTXHQFHVDQGKROGVDWƒ&LIUHTXLUHG
for ever.
Ɣ 6&79,1$XWRPDWLF7KHUPDO&\FOHU3&50DFKLQHKDV'DWD3URWRFROVSURWHFWLRQXVLQJ
3DVVZRUG%DVHG$XWKHQWLFDWLRQSUHYHQWVIURP9LHZ&RS\DQG$OWHUDWLRQRI3URWRFROV
Ɣ 6&79,1$XWRPDWLF7KHUPDO&\FOHU3&50DFKLQHKDVXVHUIULHQGO\,QQRYDWLYH³723
23(1´7HFKQRORJ\5HDOL]HV2SHQDQG/LIWWKHOLGLQ2QH6WHS
Ɣ 6&79,1$XWRPDWLF7KHUPDO&\FOHU3&50DFKLQHKDV$XWRSDXVH$XWRUHVWDUWDXWR
Shut-off.
Ɣ 6&79,1 $XWRPDWLF 7KHUPDO &\FOHU 3&5 0DFKLQH KDV RSWLRQDO TXLFNO\ FKDQJHDEOH
PRGXOHVIRU*UDGLHQW3&50RGXOHZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOV
0XOWL3XUSRVH0RGXOH0RGXOH,Q6LWX$GDSWHU
Ɣ 6&79,1 $XWRPDWLF 7KHUPDO &\FOHU 3&5 0DFKLQH KDV *OREDO $GDSWDEOH VZLWFK SRZHU
YY,QFUHDVLQJVDIHW\5HOLDEOH3HUIRUPDQFH
Ɣ 6&79,1 $XWRPDWLF 7KHUPDO &\FOHU 3&5 0DFKLQH KDV D XVHU IULHQGO\ ZLQGRZV EDVHG
VRIWZDUHIRUKDQGOLQJWKH3&5GDWD¶V
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
360
PRODUCT NO.
MODEL NO.
Display
Communications
Temperature
Block Temperature Range
0D[+HDWLQJ&RROLQJ5DWH
Temperature Uniformity
Temperature Accuracy
Display Resolution
Mode of Temperature Control
Gradient
Gradient Accuracy
Column Uniformity
Gradient Range
Temp. Differential Range
Gradient Capability
Software
0D[1RRI3URJUDPV
Max. Step
Max. Cycle
Time Increment/Decrement
$XWR3DXVH$XWR5HVWDUW
Multi-User Log In
Tm Calculator
+ROGDWƒ&
3URJUDP:L]DUG
Running Report
+HDWLQJDQG&RROLQJ7HFKQRORJ\
360 [email protected]
SCT-107.012.02
SCT-VIN-2
7RXFK6FUHHQFRORXU*UDSKLFDO'LVSOD\RI3URWRFROVDQG5XQQLQJ6WDWXVZLWKODUJH´VFUHHQ
2 USB2.0 and LAN
ƒ&aƒ&
ƒ&V
”“ƒ&DWƒ&
”“ƒ&ƒ&ƒ&
ƒ&
6LP7XEH%ORFN0RGH
”“ƒ&ƒ&ƒ&
”“ƒ&DWƒ&
ƒ&aƒ&
aƒ&
12 Column
0D[3URJUDPV2QERDUG8QOLPLWHG6WRUDJHRI3URWRFROVZLWK86%)ODVK'ULYH
6WHSV
7\SLFDO&\FOHV0D[QHVWLQJF\FOHV
<HV$YDLODEOHIRU/RQJ3&57RXFKGRZQ3&5
Yes
3DVVZRUG%DVHG$XWKHQWLFDWLRQSUHYHQWVIURP9LHZ&RS\DQG$OWHUDWLRQRI3URWRFROV
$XWRPDWLFDOO\&DOFXODWHVWKH0HOWLQJDQG$QQHDOLQJ7HPSHUDWXUHWKURXJKLQSXW7ZR3ULPHU6HTXHQFHV
Forever
<HV&UHDWH3&53URWRFROVZLWK2QO\D)HZ&OLFNV
<HV3URYLGH2EMHFWLYHDQG3UHFLVHLQIRUPDWLRQIRUWKH:KROH([SHULPHQW
0RGHUQ*HQHUDWLRQ3HOWLHU%DVHG7HFKQRORJ\
www.scichemtech.com
Keep your fears to yourself, but share your courage with others
Heat Lid
+HLJKWRI+HDW/LG
2SHQ0HWKRG
+HDW/LG7HPSHUDWXUH5DQJH
$XWR6KXW2II
2WKHU)HDWXUHV2SWLRQDOEORFNV
%ORFN2SWLRQDO
6WHSOHVVO\$GMXVWDEOH/LG$FFRPPRGDWHVDOONLQGVRI3&57XEHV6WULSVDQG3ODWHV
,QQRYDWLYH³72323(1´7HFKQRORJ\5HDOL]HV2SHQDQG/LIWWKHOLGLQ2QH6WHS
ƒ&aƒ&
Yes
Gradient Module
0RGXOHZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOVîPOZHOOVîPO
0RGXOHZHOOV
0XOWLSXUSRVH0RGXOH0RGXOH,Q6LWX$GDSWHU
îîPP
NJV
'LPHQVLRQ/î:î+
Net Weight
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.012.02
MODEL NO.
DESCRIPTION
SCT-VIN-2
6&79,1 $XWRPDWLF $GYDQFHG 7KHUPDO &\FOHU 3&5 0DFKLQH LV VXSSOLHG FRPSOHWH ZLWK
instruction manual.
SCT-SPB-1 : DIGITAL HYBRIDIZATION OVENS
SALIENT FEATURES:
Ɣ 6&763% ',*,7$/ +<%5,',=$7,21 29(16 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW
WKH HOHJDQFH DQG SURGXFHG ZLWK SURSHU TXDOLW\ DQG PHHWV WKH VSHFL¿FDWLRQV IRU WKH '1$ 6287+(51%/277,1*DSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&763%KDVDFOHDUGLJLWDOGLVSOD\WRLQGLFDWHWKHFRUUHFWVSHHGDQGWKHWHPSHUDWXUHRIWKH
oven.
Ɣ 6&763% KDV D YDULDEOH VSHHG ZLWK WR 530 ZKLFK LV H[DFWO\ VXLWDEOH IRU DOO WKH
+\EULGL]DWLRQUHODWHGZRUNDQGLWKDVWKHSURSHUWHPSHUDWXUHUDQJHRIDPELHQWWLOO2&
with a greater 20 minutes temperature balance time.
Ɣ 6&763% KDV WKH DELOLW\ WR ZRUN FRQWLQXRXVO\ IRU KRXUV DQG HYHQ WKH URWDWRU URWDWHV
continuously.
Ɣ 6&763%FRYHUVPDMRULW\RIWKH6RXWKHUQEORWWLQJK\EULGL]DWLRQDSSOLFDWLRQV,WLVVXSSOLHG
ZLWKSFVRI[PPK\EULGL]DWLRQWXEHVLQFDVHLIWKHXVHUQHHGVWKHVSDUHWXEHV
please order separately.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-SPB1
HYBRIDIZATION
OVEN
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Temperature range
Temperature Accuracy
Temperature error
Display resolution
Temperature equilibrium time
Rotation speed
Continuous working time
Tube specification
Voltage
3RZHU
Net Weight
SCT-107.013.01
SCT-SPB-1
$PELHQW7HPS2C-1002C
0.52C
2C
0.12C
<20 min
UPLQDGMXVWDEOH
24 hour
)PP
9$&+]
<600VA
22Kg
361
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.013.01
SCT-SPB-1
DESCRIPTION
6&763%+<%5,',=$7,2129(1LVVXSSOLHGFRPSOHWHO\ZLWKRQHVHWRI[PPSFV
included with the instruction manual.
OPTIONAL ACCESSORIES:
PRODUCT NO.
6&7$$
DESCRIPTION
+\EULGL]DWLRQWXEHVERWWOHV[PP
[email protected]
www.scichemtech.com 361
The whole purpose of education is to turn mirrors into windows.
SCT SPB-2 : DENATURALIZATION AND HYBRIDIZATION SYSTEM
3RUJUDPPDEOHV\VWHPDQGDXWRPDWLFKXPLGLI\LQJWKDWDXWRPDWHVWKHVWHSVLQDVOLGHEDVHG),6+SURFHGXUHDQGSURYLGHVZDONDZD\FRQYHQLHQFH
IRUFOLQLFDODQGUHVHDUFKSHUVRQQHO7KHORZFRVWXQLWDFFHSWVDZLGHUDQJHRIVDPSOHW\SHVLVHDV\WRXVHDQGUHGXFHVKDQGVRQWLPHE\PRUH
WKDQZKLOHHQVXULQJRYHUDOOSUHFLVLRQDQGDFFXUDF\LQDOO),6+DVVD\V8SWRVOLGHVFDQHDVLO\EHDGGHGRUUHPRYHGZLWKRQHKDQG7ZRVLGH
heating of slides that allows achieving exact correspondence of the set and actual temperature and maintaining uniform temperature across all slide
positions.
SALIENT FEATURES:
Ɣ 6&763%',*,7$/6/,'('(1$785,=$7,21+<%5,',=$7,216<67(06DUHGHVLJQHG
ZLWK FUHDWLYHQHVV WR JHW WKH HOHJDQFH DQG SURGXFHG ZLWK SURSHU TXDOLW\ DQG PHHWV WKH
VSHFL¿FDWLRQVIRUWKH),6+UHODWHGDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&763%KDVGLJLWDOGLVSOD\ZLWKWRXFKVFUHHQDOORZVIRUHDV\WRUHDGDQGHDV\SURJUDPPLQJ
And 99 user programmable settings
Ɣ 6&763% KDV WKUHH RSHUDWLRQ PRGHV GHQDWXUDWLRQK\EULGL]DWLRQ K\EULGL]DWLRQ DQG ¿[HG
WHPSHUDWXUHLWFDQEHXVHGDVD¿[HGWHPSHUDWXUHVOLGHZDUPHU
Ɣ 6&763% HOLPLQDWHV PDQXDO VWHSV DQG UHGXFHV KDQGVRQ WLPH GXULQJ ),6+ SURFHGXUHV
Slides do not need to be fully loaded to maintain temperature accuracy. Slide guide keeps
VOLGHVLQSODFHDQGDOORZVIRURQHKDQGUHPRYDOLWKDVPRUHVWULQJHQWWHPSHUDWXUHFRQWURO
Ɣ 6&763%KDVUDSLGWHPSHUDWXUHUDPSXSDQGDFFXUDF\RI“ƒ&DQG6XSHULRUWHPSHUDWXUH
XQLIRUPLW\DFURVVDOOVOLGHSRVLWLRQVDOVRKDV7ZRVLGHKHDWLQJVOLGHWRWHPSHUDWXUHVLGHDOIRU
),6+SURFGXUHV
Ɣ 6&763%KDVDXWRPDWLFFRQWUROKXPLGLW\EXLOWLQKXPLGLW\VHQVRUFDQGHWHFWVWKHFKDPEHU
KXPLGLW\WKH&38V\VWHPFDQEHDXWRPDWLFDOO\KXPLGLI\DQGNHHSLGHDOKXPLGLW\DQGDODUPV
while the humidity shortage
Ɣ 6&763%KDVDSHUIHFWOLGVHDOVWLJKWO\ZLOOPDLQWDLQXQLIRUPWHPSHUDWXUHDQGHQVXUHKXPLGLW\
across all slide positions
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Temperature Control Range
Temperature Accuracy
Temperature Uniform
3URFHVVLQJ7LPHU
+HDWLQJ7LPHƒ&WRƒ&
&RROLQJ7LPHƒ&WRƒ&
7HPSHUDWXUH&RQWURO3URJUDPPDEOH
Capacity
2YHUDOO'LPHQVLRQV/[:[+
Net Weight
SCT-107.013.02
SCT-SPB-2
57ƒ&aƒ&
“ƒ&
“ƒ&
1min~99h59min
PLQ
5min
ƒ&aƒ&
12 slides
îîPP
6kg
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
6&763%
DESCRIPTION
6&763%),6+6OLGHV+\EULGL]DWLRQ6\VWHPLVVXSSOLHGFRPSOHWHO\ZLWKLQVWUXFWLRQPDQXDO
SCT-SPB-3 : DIGITAL CELL FUSION APPARATUS
SALIENT FEATURES:
362
Ɣ 6&7±63%',*,7$/&(//)86,21$33$5$786LVGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH&HOOIXVLRQ
embryo operations/ hybridoma generations /plant protoplast fusion applications with high level
performance.
Ɣ 6&7 ±63% KDV D PDMRU UROH LQ PDNLQJ WKH DQLPDO DQG SODQW FHOO IXVLRQV XVLQJ '& GLUHFW
pulses .These electric pulses are variable and changeable.
Ɣ 6&7±63%KDVFOHDUGLJLWDOGLVSOD\VWRVKRZWKHFHOOIXVLRQIXQFWLRQV
Ɣ 6&7±63%KDVWKHDELOLW\WRJLYHGLIIHUHQWW\SHVRIHOHFWULFDOSXOVHVZKLFKDUHEXQFK\HOHFWULF
YROWDJHEXQFK\HOHFWULFDOIUHTXHQF\VTXDUHZDYHIXVLRQSXOVHV,WPDNHVWKHIXVLRQVXVLQJ
micro slides and the special electrodes.
Ɣ 6&7±63%KDVWKHVSHFLDOW\SHRIHOHFWURGHVZKLFKUDQJHVIURPWKHOHQJWKRIPPWLOOPP
each electrode works properly till 1500 pulses.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
AC Under Parameters
Bunchy pulse voltage
Bunchy pulse frequency
DC Under Parameters
Square wave fusion pulse voltage
Square wave fusion pulse range
:LWKIXVLRQÀDWHOHFWURGH
Net Weight
3DFNLQJVL]H
362 [email protected]
SCT-107.013.03
SCT-SPB-3
3HDN3HDN9DOXH94V) Adjustable continuously.
.+]0+]DGMXVWDEOH
SCT-SPB 3
1-600V adjustable (electrode distance) 1.0 mm electric
YROWDJH¿HOGUHDFK9FP
1us-5ms selective 10 grades
3RODUGLVWDQFHPP
9.22 Kg.
[[PP
www.scichemtech.com
Excellence is a continuous process and not an accident
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
6&763%
DESCRIPTION
6&763%&(//)86,21$33$5$786LVVXSSOLHGFRPSOHWHO\ZLWKLQVWUXFWLRQPDQXDO
OPTIONAL ACCESSORIES:
PRODUCT NO.
6&7%$
6&7%%
6&7%&
6&7%'
6&7%(
6&7%)
6&7%*
6&7%+
6&7%,
6&7%-
DESCRIPTION
0LFURVOLGHV(OHFWURGH'LVWDQFHPPYROXPH—OYROWDJHUDQJH9'&
0LFURVOLGHV(OHFWURGH'LVWDQFHPPYROXPH—OYROWDJHUDQJH9'&
0LFURVOLGHV(OHFWURGH'LVWDQFHPPYROXPH—OYROWDJHUDQJH9'&
0LFURVOLGHV(OHFWURGH'LVWDQFHPPYROXPHPOYROWDJHUDQJH9'&
*HQHWURGHV(OHFWURGHOHQJWKPP3ROHWLSFRQ¿JXUDWLRQ0LFUR3ROHFRQ¿JXUDWLRQ6WUDLJKW(OHFWURGHVSDFLQJPP
3ROHWLSGLDPHWHUPP9ROWDJH'&9
*HQHWURGHV(OHFWURGHOHQJWKPP3ROHWLSFRQ¿JXUDWLRQ0LFUR3ROHFRQ¿JXUDWLRQ6WUDLJKW(OHFWURGHVSDFLQJPP
3ROHWLSGLDPHWHUPP9ROWDJH'&9
*HQHWURGHV(OHFWURGHOHQJWKPP3ROHWLSFRQ¿JXUDWLRQ0LFUR3ROHFRQ¿JXUDWLRQ6WUDLJKW(OHFWURGHVSDFLQJPP
3ROHWLSGLDPHWHUPP9ROWDJH'&9
*HQHWURGHV(OHFWURGHOHQJWKPP3ROHWLSFRQ¿JXUDWLRQ0LFUR3ROHFRQ¿JXUDWLRQ/VKDSH(OHFWURGHVSDFLQJPP
3ROHWLSGLDPHWHUPP9ROWDJH'&9
*HQHWURGHV(OHFWURGHOHQJWKPP3ROHWLSFRQ¿JXUDWLRQ%OXQW3ROHFRQ¿JXUDWLRQ/VKDSH(OHFWURGHVSDFLQJPP
3ROHWLSGLDPHWHUPP9ROWDJH'&9
*HQHWURGHV(OHFWURGHOHQJWKPP3ROHWLSFRQ¿JXUDWLRQ%OXQW3ROHFRQ¿JXUDWLRQ/VKDSH(OHFWURGHVSDFLQJPP
3ROHWLSGLDPHWHUPP9ROWDJH'&9
SCT-SPB-4 : DIGITAL UV CROSS LINKERS / FIXERS
SALIENT FEATURES:
Ɣ 6&763% ',*,7$/ 89 8/75$ 9,2/(7 &5266 /,1.(56 ),;(56 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQV
for the applications with high level performance.
Ɣ 6&763%KDVDGLJLWDOGLVSOD\ZLWKWLPHDQGWKHH[SRVXUHGHWDLOV
Ɣ 6&763%LVDPXOWLIXQFWLRQDWLQVWUXPHQWRI89UDGLDWLRQV\VWHPDQGPDLQO\XVHGLQ¿[LQJ
'1$RQPHPEUDQH,WFDQDOVREHXVHGWRFXW'1$LQDJDURVHJHOWRVHOHFW5HF$PXWDWLRQ
SDUWO\GLJHVWWK\PLQHGLPPHUE\UHVWULFWLRQHQGRQXFOHDVHVWRHOLPLQDWHWKH3&5FRQWDPLQDWLRQ
E\ PHDQV RI 89 VWHULOL]DWLRQ$QG LW LV DOVR XVHG LQ WKH ¿HOGV VXFK DV 89 VWHULOL]DWLRQ DQG
disposal of polymer.
Ɣ 6&763%KDVWKHDELOLW\WR¿[WKHQXFOHRWLGHVRQWKHPHPEUDQHLW¶VRQO\DPDWWHURIVHYHUDO
RG
VHFRQGVRIUDGLDWLRQDWQPE\WKH89)L[HU+RZHYHUDFFRUGLQJWRWKHWUDGLWLRQDOPHWKRG
the membrane has to be baked for 2 hours at 802C by using a vacuum oven.
Ɣ 6&763%XVHV89:DYHOHQJWKQPQPQPSURYLGHG
([SRVXUHWLPHDQGPHDVXULQJUDQJHPLQXWHVSRZHU:
89VRXUFHZOLJKWWXEH[LQIRUPDWLRQORVVOHVVXQGHUWXUQLQJRII
(QHUJ\VHWVDQGVDYHH[SRVXUHVGLVSOD\
SCT-SPB
4
UV-Fixer
UV-Radiation
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
363
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
UV wavelength
Exposure time and measuring range
UV source
Energy sets and save
Time setting and save
UV exposure Manual set energy
UV exposure Manual set time
External dimension
Exposure room dimension
SCT-107.013.04
SCT-SPB-4
QPQPQPSURYLGHG
PLQXWHVSRZHU:
:OLJKWWXEHî,QIRUPDWLRQORVVOHVVXQGHUWXUQLQJRII
9 exposures display on liquid crystal screen
9 exposures Touchable keyboard
UV shaded window
Wide stainless steel UV
PPîPPîPP
PPîPPîPP
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
DESCRIPTION
6&7
6&763%
6&763%',*,7$/89&5266/,1.(56),;(56LVVXSSOLHGFRPSOHWHO\ZLWKLQVWUXFWLRQPDQXDO
[email protected]
www.scichemtech.com 363
Kind words can be short and easy to speak, but their echoes are truly endless.
SCT-ANN 1 : DIGITAL PORTABLE ELECTROPORATORS (IN VIVO).
SALIENT FEATURES:
Ɣ 6&7$11 ',*,7$/ 3257$%/( (/(&752325$7256 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR
JHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKH&(//
75$16)(&7,21$1'(/(&752325$7,21DSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7$11KDVGLJLWDOGLVSOD\LQGLFDWHVWKHYROWDJHEHLQJXVHGGXULQJWKHHOHFWURSRUDWLRQ,W
KDVDSXOVHYROWDJHRI'9&VWHSOHVVYDULDEOH
Ɣ 6&7$11 LV D VLPSOH SRUWDEOH XQLW KDV D ZLGH DSSOLFDWLRQ RI LQ YDULRXV '1$ WUDQVIHU WR
cells.
Ɣ 6&7$11KDVWKHDSSOLFDWLRQRISXOVHGHOHFWULF¿HOGVRIFHOOVE\XVLQJORZYROWDJHFDQHQKDQFH
cell-membrane permeability and thus facilitate polynucleotide uptake into cells. Resulting in a
distinct improvement of DNA vaccines and gene therapy.
Ɣ 6&7$11LVDIDQWDVWLFWRROIRUWKHUHVHDUFKHUVZKRXVHVWKHHOHFWURSRUDWLRQWHFKQLTXH,WLV
simple and user friendly with high reliability.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-ANN 1
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
3XOVHYROWDJH
3XOVHZLGWK
Waveform
Numbers of discharge
2XWSXWHOHFWURGH
Input voltage
Input power frequency
SCT-107.014.01
SCT-ANN-1
a9'&VWHSOHVVDGMXVWDEOH
P6ZKHQ3RZHUDW+]
P6ZKHQSRZHUDW+]WRWDO
VKLIWV7KHUHDUHWRWDOVKLIWVSOXVUHSHWLWLRXVVKLIWV
6TXDUHZDYHGXW\UDWLR
1~9 pulses/discharge
Changeable
110V in USA or West Europe (Set by wiring inside the instrument. No set switch outside.)
+]RU+]
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.016.02
MODEL NO.
SCT-Ann-1
DESCRIPTION
6&7$QQ',*,7$/3257$%/((/(&752325$7256,19,92LVVXSSOLHGFRPSOHWHO\ZLWK
instruction manual.
SCT-ANN 2 : DIGITAL BENCH TOP ELECTROPORATORS
SALIENT FEATURES:
364
Ɣ 6&7 $11 ',*,7$/ %(1&+ 723 (/(&752325$7256 DUH GHVLJQHG ZLWK FUHDWLYHQHVV
WR JHW WKH HOHJDQFH DQG SURGXFHG ZLWK SURSHU TXDOLW\ DQG PHHWV WKH VSHFL¿FDWLRQV IRU WKH
applications with high level performance.
(OHFWURSRUDWLRQ LV D SURFHVV E\ ZKLFK D KLJK YROWDJH LV DSSOLHG DFURVV DQ HOHFWULFDO ¿HOG WR
disrupt a cell membrane and introduce a foreign substance into the cell. Electroporation is a
YHUVDWLOHDQGHI¿FLHQWPHWKRGRI'1$WUDQVIHFWLRQEHFDXVHLWKDVEHHQVKRZQWRZRUNIRUVXFK
a wide variety of cell types.
Ɣ 6&7$11KDVGLJLWDOGLVSOD\RIWKHWHVWSDUDPHWHUV,WKDV9ORZLQSXWYROWDJHDQG
400 –2500 V high output voltage.
Ɣ 6&7$11LVPLFURSURFHVVRUFRQWUROOHGLQVWUXPHQWIRUWKHSUHFLVHFRQWURORYHUWKHUHVLVWDQFH
WKHFDSDFLWDQFHZKLFKVHWVDLGHDOHQYLURQPHQWIRUWKH*HQH(OHFWURSRUDWLRQDQGWKHVDIHU
operations.
Ɣ 6&7$11LVZLGHO\DSSOLFDEOHWRWKHHOHFWURSHUIRUDWLRQRIPLFURRUJDQLVPFHOOVRIDQLPDOV
and plants and is also used for cell hybrid and mixing as well gene electroporation
Ɣ 6&7$11KDVDQH[FHOOHQWWUDQVIHFWLRQUDWHDQGHI¿FLHQF\
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-ANN 2
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
+LJKYROWDJHPRGH
Low voltage mode
+9FDSDFLWDQFH
LV capacitance
SCT-107.014.02
SCT-ANN-2
400-2500V
100-450V
—)
—)
—)UHVROXWLRQ
JUDGHV
Microprocessor
Decaying or truncated exponential waveform with RC time
constant
îîFP
10.5kg
îîPP
Resistance
2SHUDWLRQ
DC waveform
2XWHUGLPHQVLRQ
Net weight
3DFNLQJ'LPHQVLRQ
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.016.01
MODEL NO.
SCT-Ann-2
364 [email protected]
DESCRIPTION
6&7$QQ',*,7$/%(1&+723(/(&752325$7256LVVXSSOLHGFRPSOHWHO\ZLWKLQVWUXFWLRQ
manual.
www.scichemtech.com
The world is the great gymnasium where we come to make ourselves strong.
SCT-DRRUX 1 : HAND HELD GENE GUNS
SALIENT FEATURES:
Ɣ 6&7'558;+$1'+(/',16,78*(1(*816DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQV
with high level performance.
Ɣ 6&7'558;LVDFRQYHQLHQWKDQGKHOGGHYLFHVZKLFKFDQGLUHFWJHQHWUDQVIHUUDQJLQVLWX
7KHDGMXVWDEOHSUHVVRIKHOLXPGULYHVWKHPHWDOSRZGHUSDUWLFOHVSUHSDFNHGZLWK'1$51$
or some other substance in the interior of a small nylon tube into the inside of cells. Compared
ZLWKRWKHUJHQHGHOLYHU\V\VWHPVLWKDVEHLQJDVDIHFRQYHQLHQWHI¿FLHQWRIWKHDGYDQWDJHV,W
can be commonly used by cells of different kinds. The help of a small amount of DNA and some
RWKHUFHOOVPXOWLPDWHULDOPLFURFDUULHUVLPSRUWFDQMRLQWO\EHFDUULHGRXW,WLVDEOHWRWUDQVSRUW
large pieces of DNA and make the target gene have many cells transferred and eligible for
transformation both outside and inside. It makes the operation of transgenic work become
PRUHÀH[LEOHVLPSOH
Ɣ 6&7'558;LV3RUWDEOH/LJKWZHLJKWXVHUIULHQGO\DQGVDIH
Ɣ 6&7'558;LVDVSHFLDOJDVYDOYHDQGKRVHVSOXVVDPSOHGHYLFHVFXWWLQJPDFKLQH
Ɣ 6&7'558;KDVDQRSWLRQDOVSHFLDOO\PDGHQ\ORQWXEH)HHWEDJPHWDO0LFURFDUULHUV
(powder).
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-DR-RUX
1
SCT-GENE GUN
TECHNICAL SPECIFICATIONS:
MODEL NO.
PRODUCT NO.
Experimental conditions
Target Region
3UHVVXUHUDQJH
7DUJHW7\SH$QLPDOV3ODQWV
Carrier Gas
Metal Micro-carriers
Voltage
SCT-107.015.01
SCT-DR.RUX-1
,QVLWX,QYLWURLQ9,92IURPWKHERG\
2cm2
03D
7DUJHWW\SH$QLPDOVDQ\RUJDQL]DWLRQVNLQRUJDQVH[SRVXUHWRJHQHJXQFHOOVH[SODQWDQGRUJDQFXOWXUH
)LHOGDQGJUHHQKRXVHXVHSODQWFHOOFXOWXUHDQGH[SODQW\HDVWEDFWHULDRWKHUPLFUREHV
+HOLXP
)—PFRPPRQ)—P
9V (capable of firing 1000 times).
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.015.01
6&7'558;
DESCRIPTION
6&7'558;3RUWDEOH*HQH*XQVXSSOLHGZLWKVSHFLDOJDVZDOODQGKRVHVSOXVVDPSOHGHYLFHVFXWWLQJ
machine.
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.015.AA
SCT-107.015.AB
SCT-107.015.AC
DESCRIPTION
Specially made nylon tube 50 Feet/bag
Metal Micro carriers
3RZGHU—PRU—P
SCT-DRRUX 2 : BENCH TOP HIGH PRESSURE GENE GUNS
SALIENT FEATURES:
365
Ɣ 6&7 '558; %(1&+ 723 +,*+ 35(6685( ,16,78 *(1( *816 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQV
for the applications with high level performance.
Ɣ 6&7 '558; *HQH JXQ WHFKQRORJ\ SDUWLFOH ERPEDUGPHQW LV D DOOQHZ JHQHGHOLYHU\
WHFKQRORJ\DOVRDSK\VLFDOPHWKRGLQZKLFKWKHJHQHWLFPDWHULDORURWKHUVXEVWDQFHVDWWDFKHG
WR D KLJKVSHHG PLFURERPE DUH VKRW GLUHFWO\ LQWR WKH FHOOV VR LW LV D ODWH JHQHWUDQVIHUUHG
technology internationally.
Ɣ 6&7'558;SQHXPDWLF*DVJHQHJXQFDQPDNHDZLGHUDQJHRIFHOOW\SHVLQVWDQWO\VWDEOH
DQGKLJKO\HI¿FLHQWWUDQVIRUPDWLRQ7KHJHQHJXQKDVDVSHFLDOUXSWXUHZKLFKJHQHUDWHVDJDV
VKRFNZDUH7KHGHJUHHRI+HOLXPSUHVVXUHWKDWGULYHVWKHFDUULHU¿OPLVGHWHUPLQHGE\WKH
GLIIHUHQWUXSWXUH¿OPVXVHGLQWKHSURFHVV:LWKLQDSURSHUDWPRVSKHULFSUHVVXUHWKHGLIIHUHQW
UXSWXUH¿OPVSHQHWUDWHWKH'1$FRDWHGPLFURFDUULHUVLQWRWKHWDUJHWFHOOVDWWKHERWWRPRIWKH
bombardment chamber.
Ɣ 6&7 '558; JHQH JXQ LV DSSOLFDEOH LQ JHQHWUDQVIRUPDWLRQ RI SODQWV DQG DQLPDOV FHOO
FXOWXUHV HPEU\RV EDFWHULD DQG VPDOO DQLPDOV OW KDV KDYH IDVW VLPSOH VDIH DQG HI¿FLHQW
features.
Ɣ 6&7'558;KDVDXQLTXHFLUFXODUERPEDUGPHQWWUDQVIRUPDWLRQURRPUHPRYDEOHIRUHDV\
FOHDQVLQJ DQG GLVLQIHFWLRQ ORZ FRVW 6WDQGDUG &RQ¿JXUDWLRQ KRVW YDFXXP SXPSV EUHDNDJH
¿OPFDUULHU¿OPVWDLQOHVVVWHHOQHWWXQJVWHQSRZGHU
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
[email protected]
www.scichemtech.com 365
Excellence is not a skill. It is an attitude.
TECHNICAL SPECIFICATIONS:
MODEL NO.
PRODUCT NO.
3UHVVXUHUDQJH
Max. target area
The diameter of the largest target
Voltage
Gas source
Metal Micro Carriers
SCT-107.015.02
SCT-DR.RUX-2
0SD
40cm2
ĭPP
220V
+HOLXPRUQLWURJHQ
ĭμPFRPPRQĭμm
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.015.02
6&7'558;
DESCRIPTION
6&7'558;+LJK3UHVVXUH*DV*HQH*XQVXSSOLHGZLWKYDFXXPSXPSVEUHDNDJH¿OPFDUULHU
¿OPVWDLQOHVVVWHHOQHWWXQJVWHQSRZGHU
2WKHURSWLRQDODFFHVVRULHVDQGWKHDSSOLFDWLRQQRWHVXSRQUHTXHVW
SCT-MOLINC : ID INCUBATORS
SALIENT FEATURES:
Ɣ 6&7 02/,1& ',*,7$/ ,' &$5' ,1&8%$7256 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW WKH
HOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQV
with high level performance.
Ɣ 6&702/,1&,QFXEDWRULVIRUJHOFDUGVLQUDFNVDWƒ&
Ɣ 6&702/,1&KDVLQGHSHQGHQWLQFXEDWLRQ]RQHVZLWKDFDSDFLW\IRUJHOFDUGV
Ɣ 6&702/,1&KDV'LJLWDOLQWHUIDFHVFUHHQIRUFRQWURODQGYLVXDOL]DWLRQRIUHPDLQLQJLQFXEDWLRQ
time and real temperature for each one.
Ɣ 6&702/,1&KDV)L[HGSUHVHWWHPSHUDWXUHWLPHRIPLQXWHVZKLFKFDQEHDGMXVWE\WKH
user.
Ɣ 6&702/,1&KDVDXGLEOHSURJUDPPDEOHDODUPWRQRWLI\HQGRILQFXEDWLRQSHULRG
Ɣ 6&702/,1&KDVDPLQXWHVYDULDEOHWLPHU
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-MOLINC
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Capacity
Temperature
Timer
3RZHU
Dimensions
SCT-107.016.01
SCT-MOLINC-1
24 Gel cards
2C
15min (Variable)
$&9RU$&9+]:
'[:[+ [[PP
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.016.01
MODEL NO.
6&702/,1&
DESCRIPTION
6&702/,1&,',1&8%$7256LVVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
366
SCT-MOLCEN : ID CENTRIFUGES
SALIENT FEATURES:
Ɣ 6&702/&(1',*,7$/,'&(175,)8*(6DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFH
DQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJK
level performance.
Ɣ 6&702/&(1LVDVLPXOWDQHRXVFHQWULIXJHRIXSWRJHOFDUGV
Ɣ 6&702/&(1KDVDUHPRYDEOHDQGH[FKDQJHDEOHVSLQQLQJKHDG
Ɣ 6&7 02/&(1 KDV 3UHGH¿QHG FHQWULIXJH SDUDPHWHUV IRU RSWLPXP JHO FDUGV SURFHVVLQJ
DFFHOHUDWLRQVSHHGEUDNLQJDQGWLPH
Ɣ 6&702/&(1KDVGLJLWDOLQWHUIDFHYLVRUFRQWURODQGYLVXDOL]DWLRQRIFHQWULIXJHVSHHGDQGWLPH
remaining for processing.
Ɣ 6&702/&(13URJUDPPDEOHDXGLEOHDODUPVIRUHQGRIFHQWULIXJDOWLPHSHULRGV
Ɣ 6&702/&(1RSHUDWHVDW530DQGLWKDVWRPLQXWHVWLPHU
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
366 [email protected]
SCT-MOLCEN
www.scichemtech.com
Kind words can be short and easy to speak, but their echos are truly endless
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Capacity
Speed
Max.speed
Timer
3RZHU
Dimensions
SCT-107.016.02
SCT-MOLCEN-1
24 Gel cards
Two stages (It can be variable according to user need)
1500rpm
0~99min
$&9+]:
'[:[+ [[PP
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.016.02
MODEL NO.
6&702/&(1
DESCRIPTION
6&702/&(1,'&(175,)8*(6LVVXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
SCT-ANTIBODY : SEMI AUTOMATED DIGITAL MICROPLATE / ELISA READERS
SALIENT FEATURES:
Ɣ 6&7 $17,%2'< 6(0,$8720$7(' ',*,7$/ 0,&523/$7( (/,6$ 5($'(56 DUH
GHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWV
WKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 6&7$17,%2'<KDVDQHDV\:LQGRZVRSHUDWLRQV\VWHPZLWKWRXFKVFUHHQRUPRXVHODUJH
/&'GLVSOD\FKDQQHORSWLFDO¿EHUV\VWHPHQDEOHVVHFV¶UHDGLQJIRUWKHZKROHSODWH
%LFKURPDWLFPHDVXUHPHQWFDOFXODWLRQPRGHVLQFOXGLQJ$%6&XWRII&XUYH/LQHDU
Log and Exponential regression
/DUJHPHPRU\XSWRWHVWSURWRFROVDQGFDQEHVWRUHG
Ɣ 6&7 $17,%2'< KDV D DXWR VHOIFKHFN ZKHQ SRZHU RQ :LWK ODPS VOHHSLQJ DQG ZDNHXS
function Random positive and negative control setting
Ɣ 6&7$17,%2'< KDV D 0XOWLDVVD\ HQDEOHV XS WR GLIIHUHQW DVVD\V RQ RQH SODWH VKDNLQJ
function
Ɣ 6&7$17,%2'<KDVWKHIROORZLQJRSWLRQDOIHDWXUHVWRXSJUDGHODWHU,QWHUQDOSULQWHUH[WHUQDO
SULQWHU RSWLRQDO 3RZHUIXO 4& IXQFWLRQ *UXEV :HVWJXDUG 0XOWLUXOH /HYH\ -HQQLQJV SORW
(optional)
(DV\VRIWZDUHXSJUDGHE\6'FDUGVXSSRUW86%PRXVHDQGNH\ERDUG
Multiform result output including patient comprehensive report
$ELOLW\WRFRPPXQLFDWHZLWK3&IRUGDWDPDQDJHPHQWRSWLRQDO
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Absorbance Range
Resolution
Accuracy
Type of Microplate
SCT-107.017.01
SCT ANTIBODY
0.000-4.000Abs
$EVGLVSOD\$EVFDOFXODWLRQ
±0.1% or ±0.005 Abs
Standard with 96-well or other kind of microplate and strip
QPPRUH¿OWHUVRSWLRQDOIURPQPDYDLODEOH
Wavelength
on special order)
Measurement range
0.000-2.500Abs
2SWLF6\VWHP
FKDQQHORSWLF¿EHUV\VWHP
Light Source
+DORJHQODPS
Wavelengths
QPPRUH¿OWHUVRSWLRQDO
Wavelength Accuracy
± 1nm
Band width
<8nm
$%6 $%6 &XW2II 6LQJOH 6WDQGDUG &XUYH 0XOWL3HUFHQW 3HUFHQW
Calculation Method
/RJ/LQHDU([SRQHQWLDO3RZHU3/5HJUHVVLRQ
Reading Speed
5 seconds for 96 well plate (single wavelength)
6KDNLQJ3ODWH
Shaking time and speed adjustable
2SHUDWLRQ
3&RSHUDWLRQELGLUHFWLRQDOFRPPXQLFDWLRQV
Memory
0RUHWKDQSURJUDPVXSWRWHVWUHVXOWV
Interface
5686%6'FDUGLQWHUIDFH
Display
´/&'ZLWKWRXFKVFUHHQIXQFWLRQ
Input
Touch panel or mouse
2XWSXW
,QWHUQDOSULQWHU([WHUQDOSULQWHURSWLRQDO
3RZHUVXSSO\
$&99“+]
Net Weight
9KG
'LPHQVLRQV/î:î+PP îî
367
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.017.01
6&7$17,%2'<
[email protected]
DESCRIPTION
6&7$QWLERG\0,&523/$7(5($'(56833/,('&203/(7(:,7+,16758&7,21$1'5($'<
7286(
www.scichemtech.com 367
The only real failure in life is the failure to try.
SCT-ANTIGEN : SEMI AUTOMATED DIGITAL MICROPLATE / ELISA WASHERS
SALIENT FEATURES:
Ɣ 6&7$17,*(16(0,$8720$7('',*,7$/0,&523/$7((/,6$:$6+(56DUHGHVLJQHGZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRU
the applications with high level performance.
Ɣ 6&7$17,*(1KDVDQHDV\:LQGRZVRSHUDWLRQV\VWHPODUJH/&'GLVSOD\
:DVKHVÀDW8DQG9ERWWRPVWULSVDQGSODWHVZD\RUZD\PDQLIROGDXWRPDWLFDQGPDQXDO
SRVLWLRQLQJ/DUJHPHPRU\XSWRZDVKSURWRFROVFDQEHSURJUDPPHG
Ɣ 6&7$17,*(1KDVDDXWRPDWLFPRQLWRULQJIRUYDFXXPDQGSUHVVXUHDXWRPDWLFULQVHF\FOH:DVKLQJ
SUHVVXUHYROXPHDQGWLPHDGMXVWDEOH/LTXLGOHYHOGHWHFWLRQDQGDOHUWIXQFWLRQ
Ɣ )RU6&7$17,*(11RVSHFLDODLUWLJKWERWWOHUHTXLUHGIRUZDVKERWWOHDQGHDV\PDLQWHQDQFH
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL INFORMATIONS:
PRODUCT NO.
MODEL NO.
3ODWH0RGH
'LVSHQVH3UHFLVLRQ
Residual Volume
Washing Volume
SCT-107.017.02
SCT-ANTIGEN
96-/48-well plate or strip
CV<2.0%
—O
a—/IRUZD\PDQLIROG
a—/IRUZD\PDQLIROG
Maximum 99 cycles
1 to 12 strips programmable
0~24hours
0~24hours
5’’ LCD
FKDQQHOERWWOHVIRUZDVKIRUZDWHUULQVHDQGIRUZDVWH
2 Liters each bottle
50 washing protocols
56
$&9“a+=
8 KG
îî
Washing Cycle
Strip Washing
Soaking Time
Shaking Time
Display
Wash Channels
Bottles Capacity
Memory
Interface
3RZHU6XSSO\
Net Weight
'LPHQVLRQ/î:î+PP
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.017.02
SCT-ANTIGEN
DESCRIPTION
SCT ANTIGEN0,&523/$7(:$6+(5&203/(7(:,7+,16758&7,21$1'5($'<
7286(
2WKHURSWLRQDODFFHVVRULHVDQGDSSOLFDWLRQQRWHVXSRQUHTXHVW
SCT-FLAKE : SEMI-AUTOMATED LAB ICE FLAKE MACHINES
SALIENT FEATURES:
368
Ɣ 6&7 )/$.( 6(0,$8720$7(' /$% )/$.( ,&( 0$&+,1(6 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQV
for the applications with high level performance.
Ɣ 6&7 )/$.( KDV D KLJK TXDOLW\ VWDLQOHVV VWHHO FKDPEHU ZLWK DQWLFRUURVLYH GXUDEOH
construction.
Ɣ 6&7)/$.(KDVDJRRGTXDOLW\&)&IUHHQRLVHOHVV&RPSUHVVRUZKLFKZRUNVFRQVWDQWO\
JLYHDFRQWLQXRXVSURGXFWLRQRIÀDNHLFH
Ɣ 6&7 )/$.( KDV D PLFURSURFHVVRU FRQWUROOHG RSHUDWLRQ WR DFKLHYH PD[LPXP RXWSXW
LQ WKH ÀDNH LFH SURGXFWLRQ ZLWK WKH VDPH W\SH RI ÀDNHV ,W PDNHV HQYLURQPHQWDO IULHQGO\
operations.
Ɣ 6&7 )/$.( KDV GLIIHUHQW SURGXFWLRQ FDSDFLWLHV DQG .JGD\ RI LFH
ÀDNHV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-FLAKE
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.018.01
SCT-107.018.02
6&7
SCT-107.018.04
SCT-FLAKE-1
SCT-FLAKE-2
6&7)/$.(
SCT-FLAKE-4
368 [email protected]
Ice volume
(kg/24h)
20
40
70
100
Ice weight
(kg)
10
15
25
25
Dimension
(L W Hmm)
Packing size
(L W Hmm)
457*621*770
Net weight
(kg)
40
57
58
www.scichemtech.com
Expect problems and eat them for breakfast.
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.018.01
SCT-FLAKE-1
SCT-107.018.02
SCT-FLAKE-2
6&7
6&7)/$.(
SCT-107.018.04
SCT-FLAKE-4
6&7)/$.(
manual.
6&7)/$.(
manual.
6&7)/$.(
manual.
6&7)/$.(
manual.
DESCRIPTION
6(0,$8720$7(' /$% ,&( )/$.( 0$&+,1(6 LV VXSSOLHG FRPSOHWH ZLWK LQVWUXFWLRQ
6(0,$8720$7(' /$% ,&( )/$.( 0$&+,1(6 LV VXSSOLHG FRPSOHWH ZLWK LQVWUXFWLRQ
6(0,$8720$7(' /$% ,&( )/$.( 0$&+,1(6 LV VXSSOLHG FRPSOHWH ZLWK LQVWUXFWLRQ
6(0,$8720$7(' /$% ,&( )/$.( 0$&+,1(6 LV VXSSOLHG FRPSOHWH ZLWK LQVWUXFWLRQ
2WKHURSWLRQDODFFHVVRULHVDQGRWKHUVXSRQUHTXHVWFDSDFLWLHV
SCT – RINSE : AUTOMATIC LABORATORY GLASS WASHING MACHINES
SALIENT FEATURES:
Ɣ 6&7 5,16( $8720$7,& /$%25$725< */$66 :$6+,1* 0$&+,1(6 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQV
for the applications with high level performance.
SCT-RINSE
Ɣ 6&75,16(KDVOLWHUVFDSDFLW\
Ɣ 6&75,16(LVDFOHDQLQJDQGGLVLQIHFWLRQPDFKLQHDGRSWVFRPSXWHUFRQWUROOHGWHFKQRORJ\WR
FRQWUROWKHZDWHUWHPSHUDWXUHSUHVVXUHDQGÀXVKLQJWLPHRIWKHKLJKSUHVVXUHDQGG\QDPLF
spray.
Ɣ 6&75,16(FDQEHXVHGIRUVXUIDFHDQGLQWUDFDYLW\FOHDQLQJDQGGLVLQIHFWLRQZRUNZLWKWKH
RWKHU GHWHUJHQW RU GLVLQIHFWDQW IRU GHQWDO HTXLSPHQW VXUJLFDO LQVWUXPHQW ODE FRQWDLQHUV HWF
DQGKDVEHHQZLGHO\XVHGLQGHQWDOFOLQLFVKRVSLWDOVXSSO\FHQWUHRSHUDWLQJURRPDQGYDULRXV
biological and toxicological laboratories.
Ɣ 6&75,16(LVVXSSOLHGZLWKVWDQGDUGUDFNIRUKROGLQJODEJODVVZDUHV
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Flow direction
Rated external water pressure
Water pressure
Automatic cleaning program
Vacuum Composite Filter
Maximum power
Drying mode
Stainless steel chamber
'LPHQVLRQ/î:î+
Chamber volume
Experimental vessel cleaning rack
:DWHU¿OWHUV3RULVLW\
Working noise
Net weight
SCT-107.018.05
SCT-RINSE
Three dimensional dynamic comprehensive
in consecutive spray rinse
0.041.00Mpa
a0SD
VWURQJVWDQGDUGHFRQRP\
ULQVHIDVWXOWUDIDVWSUHZDVKVHYHQNLQGVRISURFHGXUHV
0LQLPXP¿OWUDWLRQ XP
”:
high-temperature hot-dry
+HDWUHVLVWLQJFRUURVLRQUHVLVWLQJHDV\WRFOHDQ
îîPP
about 160L
Cleaning 18 Beakers and 20 burettes each time
PK
”G%
NJ
369
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.018.05
SCT-RINSE
[email protected]
DESCRIPTION
6&7$8720$7,&/$%25$725<*/$66:$6+,1*0$&+,1(6LVVXSSOLHGFRPSOHWH
with instruction manual.
www.scichemtech.com 369
Kites rise highest against the wind, not with it.
SCT-REFRIGERATORS/ (0 to 15
2
C)
SALIENT FEATURES:
Ɣ 6&732/$5/$%25$725<0(',&$/3+$50$&(87,&$/5()5,*(5$7256DUH
GHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWV
WKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 3UHFLVH 7HPSHUDWXUH &RQWURO 6\VWHP 0LFURSURFHVVRU 3,' FRQWUROOHU HQVXUHV WKH PRVW
accurate temperature control and maintains cooled temperature during defrost cycle by unique
designated technology
3&62)7:$5(6<67(0
56&LQWHUIDFHWR/,6+,6UHTXLUHPHQWZLWKPRQLWRULQJVRIWZDUHLVVXSSOLHG
Ɣ 6(/)',$*1267,&$1'$/$506<67(0
+LJK/RZZRUNLQJURRPWHPSHUDWXUH$ODUP
- Electric power failure Alarm
- Status of door opening warning Alarm
- Low battery for controller warning Alarm
2SHUDWLQJWHPSHUDWXUHFKHFNLQKLJKDQGORZ
3DVVZRUGORFNLQJV\VWHPIRUVHWWHPSHUDWXUH
Ɣ 121&)&+&)&5()5,*(5$7,216<67(0
&)&+&)&IUHH +HUPHWLFDOO\ VHDOHG FRPSUHVVRU DQG 1DWXUDO 5HIULJHUDQW JDV DUH XVHG IRU
compliance with the New Environmental Regulation
Ɣ ,424'2&80(17$7,219$/,'$7,21LVSURYLGHGRQUHTXHVWDVRSWLRQDORUGHU
+,*+'(16,7< 32/<85(7+$1( )2$0 ,168/$7,21 ZLWK PP WKLFNQHVV ,QVXODWLRQ
provides excellent low temperature and maintains cool temperature for a long time in case of
power failure
Ɣ 9$&8806($/('3$,5*/$66'225
:LWKHPEHGGHGLQYLVLEOHKHDWLQJ¿OPSUHYHQWVYLHZLQJZLQGRZIURPPRLVWXUHFRQGHQVDWLRQ
Ɣ $8720$7,&'()5267$1''(+80,',)<6<67(0
8QLTXHDLUÀRZFLUFXODWLRQDQGGHIURVWV\VWHPSURYLGHVKLJKSUHFLVLRQWHPSHUDWXUHXQLIRUPLW\
and stability
USER FRIENDLY DESIGN
Ɣ %XLOWLQ)OXRUHVFHQWODPSZLWK212))VZLWFKDQGFLUFXODWLRQIDQVWRSVZKLOHGRRULVRSHQLQJ
Ɣ Door key Lock device and password lock for safety
+HLJKWDGMXVWDEOHHSR[\SRZGHUFRDWHGVKHOI
Ɣ 0$*1(7,&3$&.,1*:,7+$'-867$%/(7(16,21'225
Magnetic packing with adjustable enforced tension door prevent cold temperature from any air
leakage
Ɣ 37457'6(1625
3URYLGHVWKHH[DFWWHPSHUDWXUHFRQWUROIRUSURGXFWVLQWKHFKDPEHU2SWLRQ6HQVRULQOLTXLG
ERWWOH:+2&RPSOLDQFH2SWLRQDO&KDUW5HFRUGHU
Ɣ&RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-POLAR 1
Lab Refrigerator
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.019.01
SCT-POLAR-1
295L
ó+3
:
SCT-107.019.02
SCT-107.019.03
SCT-POLAR-2
SCT-POLAR-3
612L
1125L
ó+3
ò+3
:
:
Stable temperature during defrost cycle
(DFK
6 Each
12 Each
0LFURSURFHVVRU'LJLWDO3,'&RQWUROOHUZLWKEDWWHU\EDFNXSV\VWHP
',*,7/(''LVSOD\/('6LJQDO/DPS
22C - 102C / 02C to 152C
6HW$FFXUDF\2&8QLIRUPLW\2C at 42C
6HW+LJKOLPLW/RZ/LPLW7HPSHUDWXUH$XGLEOHDQG9LVLEOHDODUP
6WDLQOHVVVWHHO
(SR[\3RZGHU&RDWHG(*,6WHHO
9DFXXP6HDOHG3DLU*ODVV6ZLQJ'RRU,QYLVLEOH+HDW)LOP(PEHGGHG
.H\ORFNHU$GMXVWDEOHWHQVLRQVSULQJ0DJQHWLF3DFNLQJGRRU
Turbo Fan with automatic stop/run during door open
+LJK/RZ7HPS3URWHFWRU(/&%7KHUPDO3URWHFWRU
9+]RU9+=
560x 660x 800
620 x 700x 1410
1140x700x1410
[[
740x805x1985
1260 x 805 x1998
Capacity
Refrigerator Non CFC
'HIURVW+HDWHU
Drawer Shelf
Controller
Display
Temperature Range
370
Temperature Alarm
Material Interior
Exterior
Door
Air Circulation
Safety
Electric Supply
Dimensions Inner
:;';+PP2XWHU
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
DESCRIPTION
SCT-107.019.01
6&732/$5
SCT-32/$5/$%25$725<0(',&$/3+$50$&<5()5,*(5$7256 Supplied complete with Battery Back
up system
SCT-107.019.02
6&732/$5
SCT-32/$5/$%25$725<0(',&$/3+$50$&<5()5,*(5$7256 Supplied complete with Battery Back
up system
6&7
6&732/$5
SCT-32/$5/$%25$725<0(',&$/3+$50$&<5()5,*(5$7256 Supplied complete with Battery Back
up system
OPTIONAL ACCESSORIES:
SCT-107.019.AA
SCT-107.019.AB
SCT-107.027.AC
370 [email protected]
7 days Chart Recorder
STS Drawer Shelf
Digital Recorder
www.scichemtech.com
There are many good seeds in you. Therefore you must avoid every bad soil in the world
SCT- BLOOD BANK REFRIGERATORS 4 C
2
Ɣ 6&732/$5DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWK
SURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
3UHFLVH 7HPSHUDWXUH &RQWURO 6\VWHP 0LFURSURFHVVRU 3,' FRQWUROOHU HQVXUHV WKH PRVW
accurate temperature control and maintains cooled temperature during defrost cycle by unique
designated technology.
Ɣ 3&62)7:$5(6<67(0
56&LQWHUIDFHWR/,6+,6UHTXLUHPHQWZLWKPRQLWRULQJVRIWZDUHLVVXSSOLHG
6(/)',$*1267,&$1'$/$506<67(0
Ɣ +LJK/RZZRUNLQJURRPWHPSHUDWXUH$ODUP
Electric power failure Alarm.
Status of door opening warning Alarm.
Low battery for controller warning Alarm.
Ɣ 2SHUDWLQJWHPSHUDWXUHFKHFNLQKLJKDQGORZ
Ɣ 3DVVZRUGORFNLQJV\VWHPIRUVHWWHPSHUDWXUH
Ɣ 121&)&+&)&5()5,*(5$7,216<67(0
&)&+&)&IUHH +HUPHWLFDOO\ VHDOHG FRPSUHVVRU DQG 1DWXUDO 5HIULJHUDQW JDV DUH XVHG IRU
compliance with the New Environmental Regulation.
Ɣ ,424'2&80(17$7,219$/,'$7,21LVSURYLGHGRQUHTXHVWDVRSWLRQDORUGHU
+,*+'(16,7<32/<85(7+$1()2$0,168/$7,21
With 60mm thickness Insulation provides excellent low temperature and maintains cool
temperature for a long time in case of power failure.
Ɣ 9$&8806($/('3$,5*/$66'225
:LWKHPEHGGHGLQYLVLEOHKHDWLQJ¿OPSUHYHQWVYLHZLQJZLQGRZIURPPRLVWXUHFRQGHQVDWLRQ
Ɣ Automatic Defrost and Dehumidify System.
Ɣ 8QLTXHDLUÀRZFLUFXODWLRQDQGGHIURVWV\VWHPSURYLGHVKLJKSUHFLVLRQWHPSHUDWXUHXQLIRUPLW\
and stability.
USER FRIENDLY DESIGN
Ɣ %XLOWLQ)OXRUHVFHQWODPSZLWK212))VZLWFKDQGFLUFXODWLRQIDQVWRSVZKLOHGRRULVRSHQLQJ
Door key Lock device and password lock for safety.
+HLJKWDGMXVWDEOHHSR[\SRZGHUFRDWHGVKHOI
Ɣ Magnetic packing with adjustable tension Door Magnetic packing with adjustable enforced
tension door prevent cold temperature from any air leakage.
Ɣ 37457'6(1625
3URYLGHVWKHH[DFWWHPSHUDWXUHFRQWUROIRUSURGXFWVLQWKHFKDPEHU2SWLRQ6HQVRULQOLTXLG
bottle).:+2&RPSOLDQFH2SWLRQDO&KDUW5HFRUGHU
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-POLAR 11
Blood Bank Refrigerator
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Capacity
500ml Bags Capacity Approx.
Compressor Non Cfc
'HIURVW+HDWHU
Drawer Shelf
Controller
Display
Temperature Range
Temperature Alarm
Material Interior
Exterior
Door
Air Circulation
Safety
Electric Supply
Dimensions Inner
:;';+PP2XWHU
SCT-107.020.01
SCT-POLAR-11
295L
150 Each
ó+3
:
SCT-107.020.02
SCT-107.020.03
SCT-POLAR-12
SCT-POLAR-13
612L
1125
(DFK
550 Each
ó+3
ò+3
:
:
Stable temperature during defrost cycle
(DFK
6 Each
12 Each
0LFURSURFHVVRU'LJLWDO3,'&RQWUROOHUZLWKEDWWHU\EDFNXSV\VWHP
',*,7/(''LVSOD\/('6LJQDO/DPS
42C
6HW$FFXUDF\2&8QLIRUPLW\2C at 42C
6HW+LJKOLPLW/RZ/LPLW7HPSHUDWXUH$XGLEOHDQG9LVLEOHDODUP
6WDLQOHVVVWHHO
(SR[\3RZGHU&RDWHG(*,6WHHO
9DFXXP6HDOHG3DLU*ODVV6ZLQJ'RRU,QYLVLEOH+HDW)LOP(PEHGGHG
.H\ORFNHU$GMXVWDEOHWHQVLRQVSULQJ0DJQHWLF3DFNLQJGRRU
Turbo Fan with automatic stop / run during door open
+LJK/RZ7HPS3URWHFWRU(/&%7KHUPDO3URWHFWRU
9+]RUY+=
560x 660x 800
620 x 700x 1410
1140x700x1410
[[
740x805x1985
1260 x 805 x1998
371
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.020.01
6&732/$5
SCT-107.020.02
6&732/$5
6&7
6&732/$5
[email protected]
DESCRIPTION
SCT 32/$5%/22'%$1.5()5,*(5$72566XSSOLHGFRPSOHWHZLWKGD\VFKDUWUHFRUGHU676'UDZHU
6KHOI%DWWHU\%DFNXSV\VWHP
SCT 32/$5%/22'%$1.5()5,*(5$72566XSSOLHGFRPSOHWHZLWKGD\VFKDUWUHFRUGHU676'UDZHU
6KHOI%DWWHU\%DFNXSV\VWHP
SCT 32/$5%/22'%$1.5()5,*(5$72566XSSOLHGFRPSOHWHZLWKGD\VFKDUWUHFRUGHU676'UDZHU
6KHOI%DWWHU\%DFNXSV\VWHP
www.scichemtech.com 371
Expect the best. Prepare the worst. Capitalize on what comes
SCT-COMBINED : REFRIGERATORS / FREEZERS
SALIENT FEATURES:
Ɣ 6&7 32/$5 6&7 FRPELQHG UHIULJHUDWRUV DQG IUHH]HUVDUH GHVLJQHG ZLWK FUHDWLYHQHVV WR
JHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWK
high level performance.
3UHFLVH 7HPSHUDWXUH &RQWURO 6\VWHP 0LFURSURFHVVRU 3,' FRQWUROOHU HQVXUHV WKH PRVW DFFXUDWH
temperature.
Ɣ&21752/DQGPDLQWDLQVFRROHGWHPSHUDWXUHGXULQJGHIURVWF\FOHE\XQLTXHGHVLJQDWHGWHFKQRORJ\
Ɣ$8',%/($1'9,6,%/($/$506<67(0
+LJKORZWHPSHUDWXUHDODUPV\VWHPSURYLGHVVDIHW\DQGVHFXULW\VWRUDJH
Ɣ121&)&+&)&5()5,*(5$7,216<67(0&)&+&)&IUHH+HUPHWLFDOO\VHDOHGFRPSUHVVRU
and Natural Refrigerant gas are used for compliance with the New Environmental Regulation.
Ɣ0$*1(7,&3$&.,1*:,7+$'-867$%/(7(16,21'225
Magnetic packing with adjustable enforced tension door prevent cold temperature from any air leakage.
0(7$/62/,''225:,7+$,57,*+7*$6.(7
3URWHFWVVDPSOHVDQGUHDJHQWVIURPVXQOLJKW
Ɣ+,*+'(16,7<32/<85(7+$1()2$0,168/$7,21
With 60mm thickness Insulation provides excellent low temperature and maintains cool temperature for
a long time in case of power failure.
Ɣ$8720$7,&'()5267$1''(+80,',)<6<67(0
8QLTXHDLUÀRZFLUFXODWLRQDQGGHIURVWV\VWHPSURYLGHVKLJKSUHFLVLRQWHPSHUDWXUHXQLIRUPLW\VWDELOLW\
Ɣ%XLOWLQ)OXRUHVFHQWODPSZLWK212))VZLWFKDQGFLUFXODWLRQIDQVWRSVZKLOHGRRULVRSHQLQJ
Door key Lock device and password lock for safety.
+HLJKWDGMXVWDEOHHSR[\SRZGHUFRDWHGVKHOI
Ɣ3&62)7:$5(6<67(056&LQWHUIDFHWR/,6+,6UHTXLUHPHQWFDQEHRUGHUHGDVRSWLRQ
Ɣ7:2,121(&20%,1$7,215HIULJHUDWRUDQG)UHH]HUFRPELQHGZLWKRQHFDELQHW:+2&RPSOLDQFH
2SWLRQDO&KDUW5HFRUGHU
Ɣ&RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-POLAR 1
Lab Refrigerator - Freezer
TECHNICAL INFORMATIONS:
PRODUCT NO.
MODEL NO.
&$3$&,7<
&2035(6625
'()5267+($7(5
372
(32;<32:'(5&2$7(':,5(6+(/)
&21752//(5
',63/$<
Temperature Range
Set Accuracy
Uniformity
Material Interior
Exterior
Door
Air Circulation
Safety
Electric Supply
Dimensions Inner
:;';+PP2XWHU
SCT-107.021.01
SCT-POLAR-21
600 l /[
ó+3
:
SCT-107.021.02
SCT-107.021.03
SCT-POLAR-22
SCT-POLAR-23
1110 l (277Lx4)
1110 l (555Lx2)
ò+3
ò+3
:
:
Stable temperature during defrost cycle
6each
($&+
($&+
0,&52352&(6625'LJLWDO3,'&RQWUROOHU
',*,7/(''LVSOD\/('6LJQDO/DPS
Refrigerator 22F722c / Freezer 102FWR2c
0.12c
5HIULJHUDWRU2c at 42F)UHH]HU2c
6WDLQOHVVVWHHO
(SR[\3RZGHU&RDWHG(*,6WHHO
7:262/,''225
7:262/,''225
)28562/,''225
Turbo Fan with automatic stop / run during door open
+LJK/RZ7HPS3URWHFWRU(/&%7KHUPDO3URWHFWRU
9+]RUY+=
;;
;;
;;
;;
;;
;;
ORDERING INFORMATIONS:
PART NO.
SCT-107.021.01
SCT-107.021.02
6&7
MODEL NO.
DESCRIPTION
6&732/$5/$%25$725<5()5,*(5$7256&80)5((=(56LVVXSSOLHGFRPSOHWHZLWK
instruction manual.
6&732/$5/$%25$725<5()5,*(5$7256&80)5((=(56LVVXSSOLHGFRPSOHWHZLWK
6&732/$5
instruction manual.
6&732/$5/$%25$725<5()5,*(5$7256&80)5((=(56LVVXSSOLHGFRPSOHWHZLWK
6&732/$5
instruction manual.
6&732/$5
OPTIONAL ACCESSORIES:
PRODUCT NO.
SCT-107.021.AA
SCT-107.021.AB
SCT-107.021.AC
SCT-107.021.AD
SCT-107.021.AE
DESCRIPTION
7 Days Chart Recorder
Digital Recorder
56,QWHUIDFH*UDSKLF0RQLWRULQJIRU7HPSHUDWXUHRQUHDOWLPH
Battery back up system
STS Drawer Shelf
372 [email protected]
www.scichemtech.com
Knowing others is wisdom, knowing yourself is enlightenment.
SCT- DEEP FREEZERS (-10 TO -35OC)
SALIENT FEATURES:
Ɣ 6&732/$5DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWK
SURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ 8QLTXHUHIULJHUDWLRQWHFKQRORJ\FIFKFIFQDWXUDOHQYLURQPHQWDOO\IULHQGO\UHIULJHUDQW
Ɣ (I¿FLHQWHYDSRUDWRUUDSLGFRROLQJWRoC.
Ɣ &DYLW\RIKLJKTXDOLW\VWDLQOHVVVWHHOURXQGHGGHVLJQLVHDV\WRFOHDQ
Ɣ 0HFKDQLFDOGHVLJQFDELQHWSHUIHFWVHDORQDQGRII
Ɣ 0LFURFRPSXWHUGLJLWDO3,'FRQWUROOHUZLWKDXGLRYLVXDODODUPV\VWHP
Ɣ %XLOWLQWHVWKROHVXVHGIRUDGGLWLRQDOGDWDPRQLWRULQJDQGDSSOLFDWLRQ
Ɣ FRPSOHWHO\VHDOHGRIIORZWHPSHUDWXUHUHIULJHUDWLRQ
Ɣ 7KUHHWLPHVDVWLJKWWKHUPRSODVWLFUXEEHUWKHUPRSODVWLFHODVWRPHUJDVNHWVWRUHGXFHHQHUJ\
loss.
Ɣ ,QGHSHQGHQWGRRU+'3(PDWHULDOSURWHFWLRQRIDLUFRQGLWLRQLQJ
Ɣ $XQLTXHKHDWHGGRRUIUDPHGHVLJQHGWRUHGXFHWKHGRRUIUDPHIUHH]HVFRQYHQLHQWUHRSHQ
the door. Advanced latch system to facilitate open and tightly closed.
Ɣ &)&)5((+&)&FRROLQJV\VWHP
1DWXUDO HQYLURQPHQWDOO\ IULHQGO\ UHIULJHUDQW DQG +HUPHWLF &RPSUHVVRU FRPSO\ ZLWK QHZ
environmental protection regulations.
durable and user-friendly design box structure.
Ɣ +HDY\GXW\FDVWRUVZLWKPRXQWLQJEUDFNHWIRUHDV\PRELOLW\
Ɣ PPKLJKGHQVLW\SRO\XUHWKDQHIRDPLQVXODWLRQOD\HUWRPDLQWDLQORZWHPSHUDWXUH
- Electric and refrigeration easy-to-open access door.
+HLJKWDGMXVWDEOHVKHOYHVVWDLQOHVVVWHHORUHSR[\SRZGHUFRDWHGZLUH
Ɣ 7KHDXWRPDWLFYROWDJHUHJXODWRUDQGHQHUJ\VDYLQJFLUFXLWU\
(I¿FLHQW DQG GXUDEOH HOHFWULFDO FRPSRQHQWV WR SURYLGH ORQJ OLIH DQG PLQLPXP SRZHU ORDG WR
consume the lowest energy.
Ɣ 0DWFKLQJOLTXLGQLWURJHQFDUERQGLR[LGHEDFNXSV\VWHP
We recommend to use our Liquid Nitrogen containers for storing Liquid nitrogen.
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-POLAR 31
Bio-Medical Lab - Freezer
TECHNICAL SPECIFICATIONS:
PRODUCT No
MODLE NO.
Refrigeration type
Capacity
Size mm
Internal
:['[+([WHUQDO
Compressor
Controller
Temperature
Insulation insulation layer
Material
Internal
External
Safety devices
3RZHUVXSSO\
SCT-107.022.01
POLAR-31
SCT-107.022.02
SCT-107.022.03
SCT-107.022.04
POLAR-32
POLAR-33
POLAR-34
Single-stage refrigeration systems / Vertical
/
492 L
615 L
/
îî
îî
îî
îî
îî
îî
îî
îî
+3
+3
+3
+3
7KHGLJLWDO3,'PLFURSURFHVVRUFRQWUROZLWKEDWWHU\EDFNXSV\VWHP
-102&WR2C
+LJKGHQVLW\PPWKLFNSRO\XUHWKDQHIRDPLQVXODWLRQWKHUPDOLQVXODWLRQOD\HU
VWDLQOHVVVWHHO
Epoxy powder coated galvanized steel
+LJKDQGORZWHPSHUDWXUHSURWHFWLRQHDUWKOHDNDJHFLUFXLWEUHDNHUWKHUPDOSURWHFWLRQ
9+]
373
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.022.01
MODEL NO.
6&732/$5
SCT-107.022.02
6&732/$5
6&7
6&732/$5
SCT-107.022.04
6&732/$5
DESCRIPTION
6&732/$5 '((3 )5((=(5 72 & / LV VXSSOLHG FRPSOHWHO\ ZLWK WKH XVHU
manual
6&732/$5 '((3 )5((=(5 72 & / LV VXSSOLHG FRPSOHWHO\ ZLWK WKH XVHU
manual
6&732/$5 '((3 )5((=(5 72 & / LV VXSSOLHG FRPSOHWHO\ ZLWK WKH XVHU
manual
6&732/$5'((3 )5((=(5 72 & / LV VXSSOLHG FRPSOHWHO\ ZLWK WKH XVHU
manual
3/6127(5$&.6&5<2%2;(6$5(127,1&/8'(',17+(67$1'$5'6833/<72%(25'(5('6(3$5$7(/<
2WKHU+RUL]RQWDOPRGHOVXSRQUHTXHVW
[email protected]
www.scichemtech.com 373
There are moments in business and in life when you have to say, failure is not an option.
SCT : ULTRA LOW FREEZERS (-85OC) VERTICAL
SALIENT FEATURES:
Ɣ 6&7 32/$5 DUH GHVLJQHG ZLWK FUHDWLYHQHVV WR JHW WKH HOHJDQFH DQG
SURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHO
performance.
Up Right Type -852C Deep Freezer Non-CFC high-density polyurethane Insulation thickness
145mm.
Ƈ 7KH8QLTXH5HIULJHUDWLRQWHFKQRORJ\ZLWK1RQ&)&+&)&QDWXUDOUHIULJHUDQW
Ƈ )DVW&RROLQJGRZQWR2C perfect contacted evaporator system.
Ƈ +LJKTXDOLW\VWDLQOHVVVWHHOLQQHUFKDPEHUZLWKURXQGHGFRUQHUVIRUHDV\FOHDQ
Ƈ 0HFKDQLFDOGHVLJQHGFDELQHWZLWKSHUIHFWGRRUVHDODQGFORVXUH
Ƈ 0LFURSURFHVVRU3,'GLJLWDOFRQWUROOHUZLWK$XGLEOH9LVLEOH$ODUPV\VWHP
Ƈ %XLOWLQDFFHVVSRUWIRUH[WHUQDOGDWDPRQLWRULQJDQGVXSSO\
Ɣ &RPSOHWHVHDOLQJDQGFORVXUHPHFKDQLVPIRUXOWUDORZWHPSHUDWXUH
- Triple air tight Santoprene sealing gaskets made from Thermoplastics Elastomer.
7KHLQGLYLGXDOLQQHUGRRUVPDGHIURPFROGIUHH+23(PDWHULDO
- Mechanically heated door frame seal keeps ice formation-free.
- Advanced door latch system for perfect closing and easy opening.
Ɣ 1RQ&)&+&)&5HIULJHUDWLRQ6\VWHP
Natural refrigerant and hermetically sealed compressor are used for compliance with the New
Environmental.
3URWHFWLRQ5HJXODWLRQ
Ɣ +HDY\GXW\ DQG XVHU IULHQGO\ GHVLJQHG FKDPEHU VWUXFWXUH +HDY\GXW\ FDVWHU ZLWK EXLOWLQ
adjustable stands for easy movement.
PP+LJKGHQVLW\SRO\XUHWKDQHIRDPHGLQVXODWLRQPDLQWDLQFRROWHPSHUDWXUH(DV\RSHQLQJ
access door for electric and refrigeration compartments.
Ɣ +HLJKWDGMXVWDEOHVKHOILVVWDLQOHVVVWHHORUHSR[\SRZGHUFRDWHGZLUH
Ɣ $XWRPDWLF YROWDJH UHJXODWLRQ DQG (QHUJ\ VDYLQJ HOHFWULF FLUFXLW V\VWHP (I¿FLHQW DQG GXUDEOH
HOHFWULFSDUWVDQGFRPSRQHQWVSURYLGHVORQJOLIHF\FOHDQGPLQLPL]HHOHFWULFORDGOHDGLQJWR
consumption of low energy and to protection.
Ɣ 2SWLRQDO/1&EDFNXS6\VWHP:KR&RPSOLDQFH
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-POLAR 44
SCT Ultra Low Deep Freezer -85OC
SCT-POLAR 42
O
SCT Ultra Low Deep Freezer -85 C
TECHNICAL SPECIFICATIONS:
374
PRODUCT NO.
MODEL NO.
5()5,*(5$7,217<3(
&$3$&,7<
5()5,*(5$725121&)&
&21752//(5
SCT-107.023.01
SCT-POLAR-41
SCT-107.023.02
SCT-107.023.03
SCT-107.023.04
SCT-POLAR-42
SCT-POLAR-43
SCT-POLAR-44
Cascade Refrigeration System / Upright Type
/
492 L
615 L
/
+3;
+3;
+3;
+3;
0,&52352&(6625'LJLWDO3,'&RQWUROOHUZLWKEDWWHU\EDFNXSV\VWHP
Temperature
Insulation
Material Interior
Exterior
Door
Safety
Electric Supply
Dimensions Inner
:;';+PP2XWHU
-402&722C
PP+LJK'HQVLW\3RO\XUHWKDQH)RDPHG,QVXODWLRQ
6WDLQOHVVVWHHO
(SR[\3RZGHU&RDWHG(*,6WHHO
9DFXXP6HDOHG3DLU*ODVV6ZLQJ'RRU,QYLVLEOH+HDW)LOP(PEHGGHG
+LJK/RZ7HPS3URWHFWRU(/&%7KHUPDO3URWHFWRU
Y+=
600x650x955
600x650x1275
750x 655x 1275
750x775x1275
895x845x 1660
895x845x1985
1045x845x1985
1045x 965x1985
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&7
6&732/$5
6&7
6&732/$5
6&7
6&732/$5
6&7
6&732/$5
DESCRIPTION
6&732/$58/75$/2:'((3)5((=(56o&835,*+7LVVXSSOLHGFRPSOHWHZLWK
days chart recorder676'UDZHU6KHOI%DWWHU\%DFNXSV\VWHP
6&732/$58/75$/2:'((3)5((=(56o&835,*+7LVVXSSOLHGFRPSOHWHZLWK
days chart recorder676'UDZHU6KHOI%DWWHU\%DFNXSV\VWHP
6&732/$58/75$/2:'((3)5((=(56o&835,*+7LVVXSSOLHGFRPSOHWHZLWK
days chart recorder676'UDZHU6KHOI%DWWHU\%DFNXSV\VWHP
6&732/$58/75$/2:'((3)5((=(56o&835,*+7LVVXSSOLHGFRPSOHWHZLWK
days chart recorder676'UDZHU6KHOI%DWWHU\%DFNXSV\VWHP
OPTIONAL ACCESSORIES:
6&7$$
7 days Chart Recorder
6&7$%
(OHFWURPDJQHWLFGRRU3DVVZRUGORFNLQJV\VWHP
6&7$&
C02 / LN2 Backup System
*Racks and other storage boxes and vials upon request
374 [email protected]
www.scichemtech.com
Experience enables you to recognize a mistake when you make it again.
SCT - ULTRA LOW FREEZERS (-85OC) HORIZONTAL
SALIENT FEATURES:
Ɣ 6&7 32/$5 +RUL]RQWDO XOWUD ORZ GHHS IUHH]HUV & DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQV
for the applications with high level performance.
Chest Type -852C Deep Freezer Non-CFC high-density polyurethane Insulation thickness
145mm.
Ƈ 7KH8QLTXH5HIULJHUDWLRQWHFKQRORJ\ZLWK1RQ&)&+&)&QDWXUDOUHIULJHUDQW
SCT-POLAR 54
Ƈ )DVW&RROLQJGRZQWR2C perfect contacted evaporator system.
Ƈ +LJKTXDOLW\VWDLQOHVVVWHHOLQQHUFKDPEHUZLWKURXQGHGFRUQHUVIRUHDV\FOHDQ
Ƈ 0HFKDQLFDOGHVLJQHGFDELQHWZLWKSHUIHFWGRRUVHDODQGFORVXUH
Ƈ 0LFURSURFHVVRU3,'GLJLWDOFRQWUROOHUZLWK$XGLEOH9LVLEOH$ODUPV\VWHP
Ƈ %XLOWLQDFFHVVSRUWIRUH[WHUQDOGDWDPRQLWRULQJDQGVXSSO\
Ɣ &RPSOHWHVHDOLQJDQGFORVXUHPHFKDQLVPIRUXOWUDORZWHPSHUDWXUH
- Triple air tight Santoprene sealing gaskets made from Thermoplastics Elastomer.
7KHLQGLYLGXDOLQQHUGRRUVPDGHIURPFROGIUHH+23(PDWHULDO
- Mechanically heated door frame seal keeps ice formation-free.
- Advanced door latch system for perfect closing and easy opening.
Ɣ 1RQ&)&+&)&5HIULJHUDWLRQ6\VWHP
Natural refrigerant and hermetically sealed compressor are used for compliance with the New
(QYLURQPHQWDO3URWHFWLRQ5HJXODWLRQ
Ɣ +HDY\GXW\ DQG XVHU IULHQGO\ GHVLJQHG FKDPEHU VWUXFWXUH +HDY\GXW\ FDVWHU ZLWK EXLOWLQ
DGMXVWDEOH VWDQGV IRU HDV\ PRYHPHQW PP +LJK GHQVLW\ SRO\XUHWKDQH IRDPHG LQVXODWLRQ
maintain cool temperature Easy opening access door for electric and refrigeration compartments
Ɣ +HLJKWDGMXVWDEOHVKHOILVVWDLQOHVVVWHHORUHSR[\SRZGHUFRDWHGZLUH
Ɣ $XWRPDWLF YROWDJH UHJXODWLRQ DQG (QHUJ\ VDYLQJ HOHFWULF FLUFXLW V\VWHP (I¿FLHQW DQG GXUDEOH
HOHFWULFSDUWVDQGFRPSRQHQWVSURYLGHVORQJOLIHF\FOHDQGPLQLPL]HHOHFWULFORDGOHDGLQJWR
consumption of low energy and to protection
Ɣ 2SWLRQDO/1&EDFNXS6\VWHP:+2&RPSOLDQFH
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT Ultra Low Chest Freezer -85OC
SCT-POLAR 51
SCT Ultra Low Chest Freezer -85OC
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Refrigeration Type
Capacity
Refrigerator Non CFC
Controller
Temperature
Material Interior
Exterior
Safety
Electric Supply
Dimensions Inner
:;';+PP2XWHU
SCT-107.024.01
SCT-POLAR-51
SCT-107.024.02
SCT-107.024.03
SCT-107.024.04
SCT-POLAR-52
SCT-POLAR-53
SCT-POLAR-54
Cascade Refrigeration System / Chest Type
210 L
/
456 L
550 L
+3;
+3;
+3;
+3;
0,&52352&(6625'LJLWDO3,'&RQWUROOHUZLWKEDWWHU\EDFNXSV\VWHP
-402&722C
6WDLQOHVVVWHHO
(SR[\3RZGHU&RDWHG(*,6WHHO
+LJK/RZ7HPS3URWHFWRU(/&%7KHUPDO3URWHFWRU
Y+=
600x690x500
600x690x800
;x690
1400x600x690
890x900x1010
1088x889x1010
2040x;
;;
375
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.024.01
6&732/$5
SCT-107.024.02
6&732/$5
6&7
6&732/$5
SCT-107.024.04
6&732/$5
DESCRIPTION
SCT-32/$58/75$/2:'((3)5((=(562&&+(67is supplied with complete instruction
manual.
SCT-32/$58/75$/2:'((3)5((=(562&&+(67is supplied with complete instruction
manual.
SCT-32/$58/75$/2:'((3)5((=(562&&+(67is supplied with complete instruction
manual.
SCT-32/$58/75$/2:'((3)5((=(562&&+(67is supplied with complete instruction
manual.
OPTIONAL ACCESSORIES:
PRODUCT NO.
DESCRIPTION
SCT-107.024.AA
7 days Chart Recorder
SCT-107.024.AB
(OHFWURPDJQHWLFGRRU3DVVZRUGORFNLQJV\VWHP
SCT-107.024.AC
C02 / LN2 Backup System
[email protected]
www.scichemtech.com 375
Knowledge is power
SCT-CRYO-STORE : MOVABLE COLD STORAGE CHAMBERS (-0 to 15 OC )
SALIENT FEATURES:
Ɣ 6&7 &5<2 6725( 029$%/( &2/' 6725$*( &+$0%(56 DUH GHVLJQHG ZLWK
FUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQV
for the applications with high level performance.
Ɣ 6&7&5<26725(KDVGLJLWDO0LFURSURFHVVRUEDVHG3,'FRQWUROOHUVZLWKEDWWHU\EDFN
up. Due to these controllers the samples will be stored in a properly controlled environment.
Ɣ 6&7&5<26725(RSHUDWHVDQGPDLQWDLQVEHWZHHQ2C to 102&ZLWK2&DFFXUDF\
ZKLFK DGRSWV DQ XQLTXH DLU ÀRZ PHFKDQLVP SURYLGHV SUHFLVH DQG XQLIRUP WHPSHUDWXUH
throughout the cold chambers and optional (0 to 15C) available
Ɣ 6&7&5<26725(HTXLSSHGZLWKIXOO\DXWRPDWLFGHIURVWDQGDXWRHYDSRUDWRUV\VWHPV
Ɣ 6&7&5<26725(KDVJODVVGRRUVDQGDKHDWLQJ¿OPLVHPEHGGHGRQWKHVHGRRUVIRU
DSURSHUH[WUDLQVXODWLRQUHTXLUHGPDQ\VHQVLWLYHDQGYDOXDEOHVDPSOHVUHDJHQWV
Ɣ 6&7&5<26725(KDVFRPSOHWHTXDOLW\VWDLQOHVVVWHHOLQWHULRUVDQGWKHH[WHULRUZLWK
epoxy powder coated steel.
Ɣ 6&7&5<26725(DYDLODEOHLQWZRGLIIHUHQWFDSDFLWLHV/LWHUVWKHVHPRYDEOH
FROGVWRUHVDUHVXLWDEOHIRUVWRULQJEXONFRQWDLQHUVH[SHULPHQWDOLQVWUXPHQWVHWF
Ɣ 6&7&5<26725(IRUWKHVHPRGHOVZHFDQSURYLGH,424YDOLGDWLRQLQIRUPDWLRQV
PDQXDOZKLFKLVPDQGDWRU\IRUDOOWKH3KDUPDFHXWLFDOLQGXVWULHVFRPSOLDQFHV,WLVDQ2SWLRQDO
pls contact SCT for price / cost details).
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
SCT-CRYO STORE 2
SCT Movable Cold Chamber
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
&$3$&,7<
&2035(6625
$,5&,5&8/$7,21)$1
6+(/9(6
Temperature Range
Accuracy
Uniformity
Material Interior
Exterior
'()5267
(9$3$5$725
SAFETY
Electric Supply
'LPHQVLRQV,QQHU:;';+PP
2XWHU:;';+PP
SCT-107.025.01
SCT-107.025.02
SCT-CRYO-STORE-1
SCT-CRYO-STORE-2
682 L
1050 L
+3;
+3;
:)$1;($&+
:)$1;($&+
($&+
($&+
02&722C / 0 to 152C
2C
2C at 42C
Stainless steel
Epoxy powder coated EGI STEEL
Auto Function Defrost System
Auto Function Defrost System
+LJK/RZ7HPS3URWHFWRU(/&%
110V+=259+]
650 x 700 x 1500
1500 x 840 x 1950
[[
[[
ORDERING INFORMATIONS:
PRODUCT NO.
SCT-107.025.01
SCT-107.025.02
MODEL NO.
6&7&5<26725(
6&7&5<26725(
DESCRIPTION
6&7029$%/(&2/'6725$*(&+$0%(56VXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
6&7029$%/(&2/'6725$*(&+$0%(56VXSSOLHGFRPSOHWHZLWKLQVWUXFWLRQPDQXDO
SCT –VAPOR : LAB FUME HOODS / CABINETS
376
SALIENT FEATURES:
Ɣ 6&79$325/$%25$725<±*(1(5$/385326()80(+22'6&$%,1(76DUH
designed with creativeness to get the elegance and produced with proper quality and meets
WKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ $,5 /($. &$%,1(7 6758&785( ZLWK KLJK FOHDQ VWDLQOHVV VWHHO LQWHULRU ZRUN VWDWLRQ DQG
epoxy powder coated steel exterior for long durability
Ɣ 7(03(5(' 6$)(7< */$66 6/,',1* '225 IRU PDLQWDLQ KLJK TXDOLW\ FOHDQOLQHVV DQG IRU
clear view
Ɣ /2:12,6(/(9(/$1'9,%5$7,21)5((
G%KLJKHI¿FLHQF\6LURFFRIDQEORZHU
Ɣ 0,&52352&(6625',*,7$/&21752//(5
Air velocity and alarm system temperature monitor at working zone
,1)/2:$,59(/2&,7<&21752/
,QÀRZYHORFLW\PV
Ɣ 7(03(5$785(021,725,1*6<67(0
digital temperature display at working zone
Customized structure available as optional order
Material Selection Guide
Work Top
Ɣ 6\QWKHWLFFHUDPLFZRUNWRSDVVWDQGDUG
Ɣ 6WDLQOHVVVWHHOWRSRUDVRSWLRQDO
Ɣ (SR[\UHVLQWRS+HDY\GXW\DVRSWLRQDO
Ɣ 7UHVSDSKHQROLFZRUNWRSDVRSWLRQDO
Sink
Ɣ 33RU39&5RXQGW\SH
Ɣ 33RU6WDLQOHVVVWHHO5HFWDQJXODU7\SH
Ɣ Exterior Structure
376 [email protected]
www.scichemtech.com
There are no regrets in life.
Ɣ
Ɣ
Ɣ
Ɣ
Ɣ Epoxy powder coated EGI
+DLUOLQHGVWDLQOHVVVWHHORUDVRSWLRQDO
Interior Structure
Ɣ+DLUOLQHGVWDLQOHVVVWHHODVVWDQGDUG
Ɣ+DLUOLQHGVWDLQOHVVVWHHORUDVRSWLRQDO
Ɣ Trespa phenolic resin as optional
Ɣ Epoxy powder coated EGI for economic models
Exterior Color Selection for 2 tone
ƔMain color maroon/brown
Ɣ Front panel dark blue / red purple / all light grey
Ɣ. Base Stand dark blue / red purple with light grey
Ɣentrifugal Sirocco Fan
Ɣ(*VWHHOIDQZLWKHSR[\SRZGHUFRDWHG3RO\SURS\OHQHIDQRUDQWLDFLG
Sash Glass
Ɣ7HPSHUHGVDIHW\JODVVWPP
Ɣ7HPSHUHGVDIHW\JODVVZLWKODPLQDWHGWPP
&RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Air Volume (Approx.)
Built-in Fan
Controller
Face Air Velocity
Air Speed Control Range
Noise Level
Light with safety cover
Interior
Exterior
Material
Sash Door
Utility Device
Electric Supply
Dimensions
:['[+PP
Inner
2XWHU
SCT-107.026.01
SCT-107.026.02
SCT-107.026.03
SCT-VAPOR-1
SCT-VAPOR-2
SCT-VAPOR-3
&0+:
&0+
&0+
260 W
400W
$LUYHORFLW\DQGPRQLWRULQJDXWRPDWLFDLUYHORFLW\FRQWURO
/RZDLUYHORFLW\YLVXDODXGLEOHDODUP&ORFNDQGWLPHDXWRVWRSIRUGRRUH[FHVVRSHQ
0.5 m/sec at Factory set
PVHF
56 - 60dBA
Incandescent lamp x 1 EA
6WDLQOHVVVWHHO+DLUOLQHG
Epoxy powder coated Electro Galvanized steel
Tempered safety glass sliding door with stainless steel frame
:DWHUIDXFHW$LUFRFN*DVFRFN
3RUWV3RZHU5HFHSWDFOH29RU9[($
9+]RU9+]
1050 x 650 x 750
[[
1650 x 650 x 750
1200 x 750 x 2250
1500 x 750 x 2250
1800 x 750 x 2250
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
6&79$325
SCT-107.026.01
6&79$325
SCT-107.026.02
6&79$325
6&7
DESCRIPTION
6&79$325/$%)80(+22'6&$%,1(76PPLVVXSSOLHGFRPSOHWHZLWK
instruction manual.
6&79$325/$%)80(+22'6&$%,1(76PPLVVXSSOLHGFRPSOHWHZLWK
instruction manual.
6&79$325/$%)80(+22'6&$%,1(76PPLVVXSSOLHGFRPSOHWHZLWK
instruction manual.
3OHDVHUHIHUFKDSWHUIRUFKHPLFDOVVROYHQWVVWRUDJHFDELQHWV
SCT HEPA : LAMINAR FLOW CABINETS / BENCHES (VERTICAL)
SALIENT FEATURES:
Ɣ 6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(69(57,&$/7<3(DUHGHVLJQHG
ZLWK FUHDWLYHQHVV WR JHW WKH HOHJDQFH DQG SURGXFHG ZLWK SURSHU TXDOLW\ DQG PHHWV WKH
VSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ ,62,62&ODVV&ODVV6WDQGDUGV&RPSOLDQFH
Ɣ +(3$¿OWHUUHPRYHVRIPPSDUWLFOHV
(DV\WR5HSODFH)L,WHUIURPWKH%DFN3DQHOZLWKPDLQWHQDQFHIUHHGHVLJQDQGVWUXFWXUH
/DPLQDU$LUÀRZDQG8QLIRUPDLUYHORFLW\SURYLGHKLJKFOHDQ¿OWHUDLUIRUKLJKSHUIRUPDQFH
Built-In Lamps and Utilities
Ɣ 89DQGÀXRUHVFHQWODPSDLUDQGJDVFRFNSRZHUFRQVHQWDUHEXLOWDVVWDQGDUG
2QH3LHFH&DELQHW6WUXFWXUH
QRUHTXLUHGVHSDUDWHVWDQGHDV\WRPRYHIUHHIURPWKHORDGLQJ
Ɣ $LU/HDN3URRI&DELQHW6WUXFWXUHZLWKKLJKFOHDQVWDLQOHVVVWHHOLQWHULRUZRUNVWDWLRQDQGHSR[\
powder coated steel exterior for long durability
Ɣ 7HPSHUHG 6DIHW\ *ODVV 6OLGLQJ 'RRU IRU PDLQWDLQ KLJK TXDOLW\ FOHDQOLQHVV DQG IRU SURWHFWLRQ
from UV exposure
Ɣ /RZ1RLVH/HYHODQG9LEUDWLRQIUHH
G%KLJKHI¿FLHQF\IDQEORZHU
Ɣ 0LFURSURFHVVRU'LJLWDO&RQWUROOHUZLWK/&'EDFNOLJKWGLVSOD\
Ƈ )LOWHU5HSODFHPHQW:DUQLQJ6LJQDOE\3UHVVXUHJDXJH&RQWUROOHUGLVSOD\
Ƈ %XLOWLQ0HVKJXDUGIRU+(3$)LOWHUSURWHFWLRQ
Ƈ 2QHWRXFKRSHQIURQWSDQHOIRUHDV\PDLQWHQDQFH
Ƈ 896WHULOL]DWLRQZLWKRQRIIZRUNLQJWLPHU
Ƈ 2SWLRQ8/3$)LOWHURIXPSDUWLFOHUHPRYH
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
[email protected]
377
SCT LAMINAR
FLOW CABINET
- VERTICAL
SCT-HEPA 3
www.scichemtech.com 377
Experience is one thing you can’t get for nothing.
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
SCT-107.027.01
MODEL NO.
Air Volume
Controller
+(3$)LOWHU
3UH¿OWHU
$LUÀRZYHORFLW\
Noise Level Light
Interior
Exterior
Material
Door
Utility Device
Electric Supply
Dimension
:['[+PP
Inner
2XWHU
SCT-107.027.02
SCT-107.027.03
SCT-107.027.04
SCT-HEPA-1
SCT-HEPA-2
SCT-HEPA-3
SCT-HEPA-4
Vertical Air Flow Type
980 m2/h
PK
1700 m2/h
PK
VWDJHYHORFLW\FRQWURO7RWDOXVLQJWLPHU89)//DPSRQRII
&ODVVSXULW\P3DUWLFOH5HPRYDO
aP3DUWLFOH5HPRYDO
aPVHF
56 ~ 60 dBA
6WDLQOHVV6WHHO
(SR[\3RZGHU&RDWHG(OHFWUR*DOYDQL]HG6WHHO
Tempered Safety Glass Sliding Door
$LUFRFN*DV&RFN9&RQVHQW
Y+]RU9+]
890x550x650
1190x550x650
1490x550x650
1790x550x650
1050x800x1880
[[
1650x800x1880
1950x800x1880
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.027.01
6&7+(3$
SCT-107.027.02
6&7+(3$
6&7
6&7+(3$
SCT-107.027.04
6&7+(3$
DESCRIPTION
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(69(57,&$/PPZLGWKVXSSOLHG
complete with instruction manual.
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(69(57,&$/PPZLGWKVXSSOLHG
complete with instruction manual.
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(69(57,&$/PPZLGWKVXSSOLHG
complete with instruction manual.
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(69(57,&$/PPZLGWKVXSSOLHG
complete with instruction manual.
SCT HEPA : LAMINAR FLOW CABINETS / BENCHES (HORIZONTAL)
SALIENT FEATURES:
378
Ɣ 6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(6+25,=217$/7<3(DUH
GHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWKSURSHUTXDOLW\DQGPHHWV
WKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ ,62,62&ODVV&ODVV6WDQGDUGV&RPSOLDQFH
Ɣ +(3$¿OWHUUHPRYHVRIPPSDUWLFOHV
(DV\WR5HSODFH)L,WHUIURPWKH%DFN3DQHO
with maintenance free design and structure
Ɣ /DPLQDU$LUÀRZDQG8QLIRUPDLUYHORFLW\SURYLGHKLJKFOHDQ¿OWHUDLUIRUKLJKSHUIRUPDQFH
Built-In Lamps and Utilities
Ɣ 89DQGÀXRUHVFHQWODPSDLUDQGJDVFRFNSRZHUFRQVHQWDUHEXLOWDVVWDQGDUG
2QH3LHFH&DELQHW6WUXFWXUH
QRUHTXLUHGVHSDUDWHVWDQGHDV\WRPRYHIUHHIURPWKHORDGLQJ
Ɣ $LU/HDN3URRI&DELQHW6WUXFWXUHZLWKKLJKFOHDQVWDLQOHVVVWHHOLQWHULRUZRUNVWDWLRQDQGHSR[\
powder coated steel exterior for long durability
Ɣ 7HPSHUHG 6DIHW\ *ODVV 6OLGLQJ 'RRU IRU PDLQWDLQ KLJK TXDOLW\ FOHDQOLQHVV DQG IRU SURWHFWLRQ
from UV exposure
Ɣ /RZ1RLVH/HYHODQG9LEUDWLRQIUHH
G%KLJKHI¿FLHQF\IDQEORZHU
Ɣ 0LFURSURFHVVRU'LJLWDO&RQWUROOHUZLWK/&'EDFNOLJKWGLVSOD\
Ƈ )LOWHU5HSODFHPHQW:DUQLQJ6LJQDOE\3UHVVXUHJDXJH&RQWUROOHUGLVSOD\
Ƈ %XLOWLQ0HVKJXDUGIRU+(3$)LOWHUSURWHFWLRQ
Ƈ 2QHWRXFKRSHQIURQWSDQHOIRUHDV\PDLQWHQDQFH
Ƈ 896WHULOL]DWLRQZLWKRQRIIZRUNLQJWLPHU
Ƈ 2SWLRQ8/3$)LOWHURIPPSDUWLFOHUHPRYH
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
378 [email protected]
SCT LAMINAR
FLOW CABINET
- HORIZONTAL
SCT-HEPA 12
www.scichemtech.com
Knowledge will bring you the opportunity to make a difference.
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Air Volume
Controller
+(3$)LOWHU
3UH¿OWHU
$LUÀRZYHORFLW\
Noise Level Light
Material
Door
Utility Device
Electric Supply
Dimension
:['[+PP
Interior
Exterior
Inner
2XWHU
SCT-107.027.11
SCT-107.027.12
SCT-107.027.13
SCT-HEPA-11
SCT-HEPA-12
SCT-HEPA-13
+RUL]RQWDO$LU)ORZ7\SH
980 m2/h
PK
1700 m2/h
VWDJHYHORFLW\FRQWURO7RWDOXVLQJWLPHU89)//DPSRQRII
&ODVVSXULW\P3DUWLFOH5HPRYDO
aP3DUWLFOH5HPRYDO
aPVHF
56 ~ 60 dBA
6WDLQOHVV6WHHO
(SR[\3RZGHU&RDWHG(OHFWUR*DOYDQL]HG6WHHO
Tempered Safety Glass Sliding Door
$LUFRFN*DV&RFN9&RQVHQW
Y+]RU9+]
890x550x650
1190x550x650
1490x550x650
1050x800x1880
[[
1650x800x1880
SCT-107.027.14
SCT-HEPA-14
PK
1790x550x650
1950x800x1880
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.027.11
6&7+(3$
SCT-107.027.12
6&7+(3$
6&7
6&7+(3$
SCT-107.027.14
6&7+(3$
DESCRIPTION
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(6+25,=217$/ZLGWKLVVXSSOLHG
complete with instruction manual.
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(6+25,=217$/ZLGWKLVVXSSOLHG
complete with instruction manual.
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(6+25,=217$/ZLGWKLVVXSSOLHG
complete with instruction manual.
6&7+(3$/$0,1$5)/2:&$%,1(76%(1&+(6+25,=217$/ZLGWKLVVXSSOLHG
complete with instruction manual.
SCT PROTECT : BIO-HAZARD SAFETY CABINETS –CLASS II TYPE A2
SALIENT FEATURES:
Ɣ 6&73527(&7DUHGHVLJQHGZLWKFUHDWLYHQHVVWRJHWWKHHOHJDQFHDQGSURGXFHGZLWK
SURSHUTXDOLW\DQGPHHWVWKHVSHFL¿FDWLRQVIRUWKHDSSOLFDWLRQVZLWKKLJKOHYHOSHUIRUPDQFH
Ɣ ,62,62&ODVV&ODVV6WDQGDUGV&RPSOLDQFH
Ɣ +(3$¿OWHUUHPRYHVRIXPPLFURPHWHUSDUWLFOHV
(DV\WR5HSODFH)L,WHUIURPWKH%DFN3DQHOZLWKPDLQWHQDQFHIUHHGHVLJQDQGVWUXFWXUH
Ɣ /DPLQDU$LUÀRZDQG8QLIRUPDLUYHORFLW\SURYLGHKLJKFOHDQ¿OWHUDLUIRUKLJKSHUIRUPDQFH
Built-In Lamps and Utilities
Ɣ 89DQGÀXRUHVFHQWODPSDLUDQGJDVFRFNSRZHUFRQVHQWDUHEXLOWDVVWDQGDUG
$LU/HDN3URRI&DELQHW6WUXFWXUHZLWKKLJKFOHDQVWDLQOHVVVWHHOLQWHULRUZRUNVWDWLRQDQGHSR[\
powder coated steel exterior for long durability
Ɣ 7HPSHUHG 6DIHW\ *ODVV 6OLGLQJ 'RRU IRU PDLQWDLQ KLJK TXDOLW\ FOHDQOLQHVV DQG IRU SURWHFWLRQ
from UV exposure
Ɣ /RZ1RLVH/HYHODQG9LEUDWLRQIUHH
G%KLJKHI¿FLHQF\IDQEORZHU
Ɣ 0LFURSURFHVVRU'LJLWDO&RQWUROOHUZLWK/&'EDFNOLJKWGLVSOD\
$LU9HORFLW\&RQWURO$ODUP6\VWHP
Ɣ 7HPSHUDWXUHPRQLWRUDLUZRUNLQJ]RQH
Ɣ (DV\WRUHSODFH+(3$)LOWHULQIURQWSDQHO
%XLOWLQ0HVKJXDUGIRU+(3$)LOWHUSURGXFWLRQ
Ɣ 5HPRYDEOH:RUNLQJ7UD\HDV\WRFOHDQDQGGLVLQIHFWLRQIRUZRUNLQJ]RQH
2QHWRXFKRSHQIURQWSDQHORUHDV\PDLQWHQDQFH
Ɣ 0D[LPXP'RRU2SHQLQJDODUPWRSURWHFWDLUÀRZSHUIRUPDQFHDQGVDIHW\
UV Sterilization with on/off working timer
Ɣ &RQIRUPVWRWKHLQWHUQDWLRQDOVWDQGDUGV&(VDIHW\VWDQGDUGV
Ɣ 0DQXIDFWXUHGXQGHU,624XDOLW\6WDQGDUGV
[email protected]
SCT-PROTECT
3
SCT BIO-HAZARD SAFETY
CLASS 2 TYPE A2
CABINET
379
www.scichemtech.com 379
There are no secrets to success. It is the result of preparation, hard work, and learning from failure.
TECHNICAL SPECIFICATIONS:
PRODUCT NO.
MODEL NO.
Air Volume (Approx.)
Microprocessor
Digitla LCD
Control
+(3$)LOWHU
Air Flow Velocity
SCT-107.028.01
SCT-PROTECT-1
Door
Utility Device
Elelctric Supply
Dimension
:['[+PP
SCT-107.028.03
SCT-PROTECT-3
SCT-107.028.04
SCT-PROTECT-4
980 m2/h
P2/h
1700 m2/h
P2/h
$LU9HORFLW\DQG7HPSHUDWXUHPRQLWRULQJ$XWRPDWLF$LU9HORFLW\FRQWURO
/RZ$LU9HORFLW\YLVXDODXGLEOH$ODUP)LOWHUXVLQJFKDQJHWLPH$ODUP
&ORFNDQG7LPHU$XWRVWRSIRUGRRUH[FHVVRSHQ
&ODVVSXULW\P3DUWLFOH5HPRYDO
aPVHF
> 0.5 m/sec
56 ~ 60 dBA
Down Flow
In Flow
Noise Level
Light
Material
SCT-107.028.02
SCT-PROTECT-2
89:[($)/:[($
Interior
Exterior
[[
1050x800x1880
Inner
2XWHU
89:[($)/:[($
6WDLQOHVV6WHHO
(SR[\3RZGHU&RDWHG(OHFWUR*DOYDQL]HG6WHHO
Tempered Safety Glass Sliding Door
$LU&RFN*DV&RFN9&RQVHQW
9+]RU9+]
[[
[[
[[
[[
1650x800x1880
1950x800x1880
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
SCT-107.028.01
6&73527(&7
SCT-107.028.02
6&73527(&7
6&7
6&73527(&7
SCT-107.028.04
6&73527(&7
DESCRIPTION
6&73527(&7%,2+$=$5'6$)(7<&$%,1(76±&/$66,,7<3($PPZLGWKLV
supplied complete with instruction manual.
6&73527(&7%,2+$=$5'6$)(7<&$%,1(76±&/$66,,7<3($PPZLGWKLV
supplied complete with instruction manual.
6&73527(&7%,2+$=$5'6$)(7<&$%,1(76±&/$66,,7<3($PPZLGWKLV
supplied complete with instruction manual.
6&73527(&7%,2+$=$5'6$)(7<&$%,1(76±&/$66,,7<3($PPZLGWKLV
supplied complete with instruction manual.
2WKHU7\SHDQGPRGHOVXSRQUHTXHVW
SCT CLEAN-WALK AUTOMATIC SHOE COVER MACHINE
SALIENT FEATURES:
380
Ɣ 6&7&/($1:$/.$XWRPDWLFVKRHFRYHUPDFKLQHLVSOHDVDQWO\GHVLJQHGZLWKDJUHDWORRN
Ɣ 6&7&/($1:$/.$XWRPDWLFVKRHFRYHUPDFKLQHLVPDGHIRUFOHDQZDONIDFLOLWLHVZKHUHDOO
you need dust free walk.
Ɣ 6&7&/($1:$/.$XWRPDWLFVKRHFRYHUPDFKLQHFDQDFFRPGDWHGLIIHUHQWVL]HVRIVKRHV
Ɣ 6&7&/($1:$/.$XWRPDWLFVKRHFRYHUPDFKLQHVHDOVFRYHUVWKHVKRHVDXWRPDWLFDOO\QR
QHHGWRSXWDQ\EXWWRQV1RQHHGWREHQGZRUNVZLWKXVHUIULHQGO\SULQFLSOH
Ɣ 6&7&/($1:$/.$XWRPDWLFVKRHFRYHUPDFKLQHFRYHURQO\WKHORZHUSDUWRIWKHVKRHVDQG
give a nice look while wearing the shoe cover.
Ɣ 6&7&/($1:$/.$XWRPDWLFVKRHFRYHUPDFKLQHLVDSRUWDEOHPDFKLQHFDQEHVKLIWHGHDVLO\
any where.
Ɣ 6&7 &/($1:$/. $XWRPDWLF VKRH FRYHU PDFKLQH LV VXLWDEOH IRU DQ\ FOHDQ GXVW IUHH
HQYLURQPHQWHVSHFLDOO\+LJKVHQVLWLYH/DEV
Ɣ 6&7 &/($1:$/.$XWRPDWLF VKRH FRYHU PDFKLQH PDNH WKH VKRH FRYHU RU VHDOV LQ seconds.
Ɣ 6&7&/($1:$/.$XWRPDWLFVKRHFRYHUPDFKLQHKDVYHU\ORQJ/LIHWLPHV
7(&+1,&$/63(&,),&$7,216
PRODUCT NO.
MODEL NO.
Loading Capacity of shoe cover
Life Time
Material
3UHKHDWLQJ7LPH
Film-delivering Time
Film Shaping Time
2SHUDWLQJ9ROWDJH
0D[LPXP3RZHU
6WDQGE\3RZHU
Dimension of Machine
380 [email protected]
SCT-107.030.30
SCT-CLEAN WALK
1000pcs / Batch/roll
WLPHV
$%62XWHU&DVH
§V
V
V
“9
:
75W
[[FP
www.scichemtech.com
Experience is the teacher of all things.
Dimension of Carton
Net Weight
Gross Weight
87 x 50 x 40 cm
24kg
27kg
ORDERING INFORMATIONS:
PRODUCT NO.
MODEL NO.
DESCRIPTION
6&7
SCT-CLEAN WALK
SCT-CLEAN WALK Automatic Foot / Shoe sealing Machine is supplied with one roll
RI39&7KHUPRVKULQNDEOH)LOP5ROOD3URSHUXVHUPDQXDO
CONSUMABLES: (To be ordered Separately)
PRODUCT NO.
6&7$$
DESCRIPTION
6&77KHUPRVKULQNDEOH39&),/052//;;&0
NOTES :
381
We at ScichemTech would like to thank our customers for sparing your valuable time in reading and using our Chapter 7, We hope
we have listed most of the products you would be using or looking for.
We assure you that, our R&D will be thinking ahead always and working to bring you something useful and unique, we will be
NHHSGLVFRYHULQJDQGPDNLQJWKHSURGXFWV,QFDVHVKRXOG\RXUHTXLUHDQ\DGGLWLRQDOLQIRUPDWLRQVRUFODUL¿FDWLRQVSOHDVHFRQWDFW
us anytime us at [email protected], we are sure you will enjoy our next chapter SCT-TEST & MEASUREMENT, PROCESS
PRODUCTS.
0DQXIDFWXUHUKDVWKHULJKWVWRFKDQJHRUPRGLI\WKHVSHFL¿FDWLRQVZLWKRXWSULRUQRWLFHIRUTXDOLW\LPSURYHPHQW
[email protected]
www.scichemtech.com 381
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement