CHAPTER 6 Electrophoresis and Immunoblotting INTRODUCTION T he development of powerful new technologies is a major driving force of scientific progress. A good example of this is the role that electrophoretic techniques have played in the evolution of modern cell biology. Electrophoresis and related applications have contributed greatly to the understanding of the molecular bases of cell structure and function. The combination of high resolution, ease of use, speed, low cost, and versatility of electrophoretic techniques is unmatched by any other method used to separate proteins. It is for this reason that electrophoresis is an indispensable tool in any cell biology laboratory and that papers describing basic techniques of protein electrophoresis (e.g., Laemmli, 1970, and O’Farrell, 1975, to name just a couple) are among the most cited articles in this field. Laemmli’s technique of discontinuous gel electrophoresis in the presence of SDS, for example, continues to be widely used and referenced almost 30 years after publication. Thus, no book of techniques in cell biology would be complete without a detailed description of electrophoretic techniques. Chapter 6 begins with UNIT 6.1, which is a collection of state-of-the-art protocols for analyzing proteins by one-dimensional electrophoresis under denaturing conditions on polyacrylamide gels. Sodium dodecyl sulfate (SDS), in combination with a reducing agent and heat, is most often used as a denaturant. This type of electrophoresis is thus referred to as SDS-polyacylamide gel electrophoresis (SDS-PAGE). Denaturation of the proteins prior to electrophoresis allows for enhanced resolution and discrimination of proteins on the basis of molecular size rather than charge or shape. Utilization of a discontinuous system (i.e., the apposition of “stacking” and “separating” gels) results in concentration of dilute samples and enhanced band sharpness. UNIT 6.1 presents an overview of electricity and electrophoresis, followed by detailed protocols for SDS-PAGE using either Laemmli’s buffers and gel system or modifications of this system (i.e., use of Tris-tricine buffers, higher concentrations of buffers, gradient gels, single-concentration gels, and minigels). The unit also explains how to calculate the apparent molecular weights of proteins from SDS-PAGE data. The next unit in the chapter, UNIT 6.2, describes protocols for immunoblotting (also referred to as western blotting). In this technique, proteins separated by any of the electrophoretic techniques described in UNIT 6.1 are electrophoretically transferred (“electroblotted”) onto a membrane. The membrane, which thus becomes a replica of the polyacrylamide gel, is subsequently probed with antibodies to specific proteins. The primary antibodies can be revealed by an additional incubation with 125I-labeled secondary antibodies or protein A, followed by autoradiography (UNIT 6.3). In recent years, however, the use of radioiodinated antibodies has been progressively replaced by nonradioactive detection with antibodies coupled to enzymes such as alkaline phosphatase or horseradish peroxidase (see UNIT 16.5). The enzymes act on substrates which are converted to colored, luminescent, or fluorescent products. Nonradioactive methods are just as sensitive as radioactive methods, with the added advantage that they do not require the special precautions associated with the use of radioactivity. Nonradioactive detection is nowadays the method of choice for visualizing immunoblotted proteins. A disadvantage of nonradioactive methods is that they have a narrower linear range of detection, which can be a problem in experiments that require accurate quantitation of protein levels. Electrophoresis and Immunoblotting Contributed by Juan S. Bonifacino Current Protocols in Cell Biology (2002) 6.0.1-6.0.3 Copyright © 2002 by John Wiley & Sons, Inc. 6.0.1 Supplement 15 Radiolabeled proteins separated by electrophoresis or proteins detected by immunoblotting with radioiodinated antibodies or protein A can be visualized by autoradiography, as described in UNIT 6.3. In this technique, ionizing radiation emanating from the radionuclides impresses a photographic film. The technique can be made more sensitive by the use of intensifying screens or scintillating compounds, which emit light upon radiation absorption, which then impresses the film. The unit contains several protocols for autoradiographic detection of various radionuclides, including methods for enhancing the signal with intensifying screens or by fluorography. Also included in UNIT 6.3 are discussions of the quantification of film images by densitometry and the direct detection and quantification of radioactive samples in gels by phosphor imaging. The resolution of electrophoretic techniques can be enormously enhanced by combining two different electrophoretic procedures performed successively in perpendicular directions (i.e., two-dimensional gel electrophoresis). The most common type of two-dimensional gel electrophoresis is based on separation of proteins by isoelectric focusing on a tube gel (first dimension) followed by SDS-PAGE on a slab gel (second dimension). The two processes separate proteins on the basis of charge and size, respectively, allowing resolution of up to several thousand proteins on a single two-dimensional gel. UNIT 6.4 describes several methods for separating proteins by two-dimensional isoelectric focusing/SDS-PAGE. In addition, this unit presents a protocol for two-dimensional nonreducing/reducing electrophoresis in which proteins are separated by SDS-PAGE under nonreducing conditions in the first dimension and under reducing conditions in the second dimension. This type of two-dimensional gel electrophoresis allows analysis of intersubunit disulfide bonds in multiprotein complexes and, in some cases, of intrasubunit disulfide bonds. Both types of two-dimensional gel electrophoresis can be used for either analytical or preparative purposes. Another useful method for electrophoretic separation of cellular proteins is one-dimensional electrophoresis under nondenaturing conditions. Two protocols describing variations of this method are included in UNIT 6.5. What distinguishes this method from those described in UNIT 6.1 and UNIT 6.4 is that protein samples are not exposed to denaturing agents (i.e., SDS or urea) either prior to or during electrophoresis. Thus, proteins migrate according to their native properties, such as size, shape, and charge. This allows analysis of the oligomeric state of proteins, conformational changes, charge heterogeneity, and post-translational modifications that affect conformation or charge while having minimal effects on the molecular weights of the proteins. In many cases, this method preserves the intrinsic function of the proteins, which allows their detection with specific activity or binding assays. The first protocol describes continuous electrophoresis on nondenaturing polyacrylamide gels. This system involves electrophoresis on a single separating gel and uses the same buffer in the chambers and the gel. The second protocol, discontinuous electrophoresis on nondenaturing polyacrylamide gels, is a variation of SDS-PAGE in which SDS and reducing agents are omitted from all the solutions. Determination of the migration of proteins on parallel gels made up of different concentrations of acrylamide and bisacrylamide allows calculation of their molecular weights using Ferguson plots. Proteins separated by electrophoresis can be visualized by direct staining of the gels. Four procedures for staining proteins in gels based on different principles are presented in UNIT 6.6. These procedures involve staining with Coomassie blue, silver, SYPRO ruby or zinc ions. The unit describes the basic protocols and provides guidelines for the selection of a specific protocol. Introduction The separation of proteins by polyacrylamide gel electrophoresis is limited to proteins with molecular weights less than ∼300,000. The electrophoretic separation of larger proteins or multiprotein complexes requires the use of other matrix materials. A suitable material is agarose, which is most commonly used for the separation of DNA. UNIT 6.7 presents protocols for the electrophoretic separation of proteins on agarose gels. In 6.0.2 Supplement 15 Current Protocols in Cell Biology addition to permitting the separation of very large proteins, these protocols allow the analysis of multimerization or aggregation. Although these processes can also be analyzed by sedimentation on sucrose gradients (UNIT 6.3) or gel filtration (UNIT 6.4), agarose gel electrophoresis is more convenient for analysis of large numbers of samples. LITERATURE CITED Laemmli, U.K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227:680-685. O’Farrell, P.H. 1975. High resolution two-dimensional polyacrylamide gel electrophoresis of proteins. J. Biol. Chem. 250:4007-4021. Juan S. Bonifacino Electrophoresis and Immunoblotting 6.0.3 Current Protocols in Cell Biology Supplement 15 One-Dimensional SDS Gel Electrophoresis of Proteins UNIT 6.1 Sean R. Gallagher1 1 UVP, Inc., Upland, California ABSTRACT Electrophoresis is used to separate complex mixtures of proteins (e.g., from cells, subcellular fractions, column fractions, or immunoprecipitates), to investigate subunit compositions, and to verify homogeneity of protein samples. It can also serve to purify proteins for use in further applications. In polyacrylamide gel electrophoresis, proteins migrate in response to an electrical field through pores in a polyacrylamide gel matrix; pore size decreases with increasing acrylamide concentration. The combination of pore size and protein charge, size, and shape determines the migration rate of the protein. In this unit, the standard Laemmli method is described for discontinuous gel electrophoresis under denaturing conditions, that is, in the presence of sodium dodecyl sulfate (SDS). Both full-size and minigel formats are detailed. Several modifications are provided for specific applications. For separation of peptides and small proteins, the standard buffers are replaced with either a Tris-tricine buffer system or a modified Tris buffer in the absence of urea. Continuous SDS-PAGE is a simplified method in which the same buffer is used for both the gel and the electrode solutions and the stacking gel is omitted. Other protocols cover the preparation and use of ultrathin gels and gradient gels, and the simultaneous C 2007 by John preparation of multiple gels. Curr. Protoc. Cell Biol. 37:6.1.1-6.1.38. Wiley & Sons, Inc. Keywords: protein r electrophoresis r separation r polyacrylamide r SDS-PAGE INTRODUCTION Electrophoresis is used to separate complex mixtures of proteins (e.g., from cells, subcellular fractions, column fractions, or immunoprecipitates), to investigate subunit compositions, and to verify homogeneity of protein samples. It can also serve to purify proteins for use in further applications. In polyacrylamide gel electrophoresis (PAGE), proteins migrate in response to an electrical field through pores in the gel matrix; pore size decreases with higher acrylamide concentrations. The combination of gel pore size and protein charge, size, and shape determines the migration rate of the protein. The standard Laemmli method (see Basic Protocol 1) is used for discontinuous gel electrophoresis under denaturing conditions, that is, in the presence of sodium dodecyl sulfate (SDS). The standard method for full-size gels (e.g., 14 × 14 cm) can be adapted for the minigel format (e.g., 7.3 × 8.3 cm; see Basic Protocol 2). Minigels provide rapid separation but give lower resolution. Several alternate protocols are provided for specific applications. The first two alternate protocols cover electrophoresis of peptides and small proteins, separations that require modification of standard buffers: either a Tris-tricine buffer system (see Alternate Protocol 1) or a modified Tris buffer in the absence of urea (see Alternate Protocol 2). Continuous SDS-PAGE is a simplified method in which the same buffer is used for both gel and electrode solutions and the stacking gel is omitted (see Alternate Protocol 3). Other protocols cover the preparation and electrophoresis of various types of gels: Electrophoresis and Immunoblotting Current Protocols in Cell Biology 6.1.1-6.1.38, December 2007 Published online December 2007 in Wiley Interscience (www.interscience.wiley.com). DOI: 10.1002/0471143030.cb0601s37 C 2007 John Wiley & Sons, Inc. Copyright 6.1.1 Supplement 37 ultrathin gels (see Alternate Protocol 4), multiple single-concentration gels (see Support Protocol 1), gradient gels (see Alternate Protocol 5), multiple gradient gels (see Support Protocol 2), and multiple gradient minigels (see Support Protocol 3). Proteins separated on gels can be subsequently analyzed by immunoblotting (UNIT 6.2), autoradiography or phosphor imaging (UNIT 6.3), or staining with protein dyes (UNIT 6.6). Protein size is determined by comparing the mobility of the protein band to the mobility of the dye front (see Support Protocol 4). CAUTION: Before any protocols are used, it is extremely important to read the following section about electricity and electrophoresis. ELECTRICITY AND ELECTROPHORESIS Many researchers are poorly informed concerning the electrical parameters of running a gel. It is important to note that the voltages and currents used during electrophoresis are dangerous and potentially lethal. Thus, safety should be an overriding concern. A working knowledge of electricity is an asset in determining what conditions to use and in troubleshooting the electrophoretic separation, if necessary. For example, an unusually high or low voltage for a given current (milliampere) might indicate an improperly made buffer or an electrical leak in the chamber. Safety Considerations 1. Never remove or insert high-voltage leads unless the power supply voltage is turned down to zero and the power supply is turned off. Always grasp high-voltage leads one at a time with one hand only. Never insert or remove high-voltage leads with both hands. This can shunt potentially lethal electricity through the chest and heart should electrical contact be made between a hand and a bare wire. On older or homemade instruments, the banana plugs may not be shielded and can still be connected to the power supply at the same time they make contact with a hand. With commercial modern power supplies, this is less of an issue. However, with age and use, wires may become exposed through cracks in the insulation or poor connections. Carefully inspect all cables and connections and replace frayed or exposed wires immediately. 2. Always start with the power supply turned off. Have the power supply controls turned all the way down to zero. Then hook up the gel apparatus: generally, connect the red high-voltage lead to the red outlet and the black high-voltage lead to the black outlet. Turn the power supply on with the controls set at zero and the high-voltage leads connected. Then turn up the voltage, current, or power to the desired level. Reverse the process when the power supply is turned off: i.e., to disconnect the gel, turn the power supply down to zero, wait for the meters to read zero, turn off the power supply, and then disconnect the gel apparatus one lead at a time. CAUTION: If the gel is first disconnected and then the power supply turned off, a considerable amount of electrical charge is stored internally. The charge will stay in the power supply over a long time. This will discharge through the outlets even though the power supply is turned off and can deliver an electrical shock. One-Dimensional SDS-PAGE Ohm’s Law and Electrophoresis Understanding how a gel apparatus is connected to the power supply requires a basic understanding of Ohm’s law: voltage = current × resistance, or V = IR. A gel can be viewed as a resistor and the power supply as the voltage and current source. Most power supplies deliver constant current or constant voltage. Some will also deliver constant power: power = voltage × current, or VI = I2 R. The discussion below focuses on constant current because this is the most common mode in vertical SDS-PAGE. 6.1.2 Supplement 37 Current Protocols in Cell Biology Most modern commercial equipment is color-coded so that the red or positive terminal of the power supply can simply be connected to the red lead of the gel apparatus, which goes to the lower buffer chamber. The black lead is connected to the black or negative terminal and goes to the upper buffer chamber. This configuration is designed to work with vertical slab gel electrophoreses in which negatively charged proteins or nucleic acids move to the positive electrode in the lower buffer chamber (an anionic system). When a single gel is attached to a power supply, the negative charges flow from the negative cathode (black) terminal into the upper buffer chamber, through the gel, and into the lower buffer chamber. The lower buffer chamber is connected to the positive anode (red) terminal to complete the circuit. Thus, negatively charged molecules, such as SDS-coated proteins and nucleic acids, move from the negative cathode attached to the upper buffer chamber toward the positive anode attached to the lower chamber. SDS-PAGE is an anionic system because of the negatively charged SDS. Occasionally, proteins are separated in cationic systems. In these gels, the proteins are positively charged because of the very low pH of the gel buffers (e.g., acetic acid/urea gels for histone separations) or the presence of a cationic detergent (e.g., cetyltrimethylammonium bromide, CTAB). Proteins move toward the negative electrode (cathode) in cationic gel systems, and the polarity is reversed compared to SDS-PAGE: the red lead from the lower buffer chamber is attached to the black outlet of the power supply, and the black lead from the upper buffer chamber is attached to the red outlet of the power supply. Most SDS-PAGE separations are performed under constant current (consult instructions from the manufacturer to set the power supply for constant current operation). The resistance of the gel will increase during SDS-PAGE in the standard Laemmli system. If the current is constant, then the voltage will increase during the run as the resistance goes up. Power supplies usually have more than one pair of outlets. The pairs are connected in parallel with one another internally. If more than one gel is connected directly to the outlets of a power supply, then these gels are connected in parallel (Fig. 6.1.1). In a parallel circuit, the voltage is the same across each gel. In other words, if the power supply reads 100 V, then each gel has 100 V across its electrodes. The total current, however, is the sum of the individual currents going through each gel. Therefore, under constant current it is necessary to increase the current for each additional gel that is connected to the power supply. Two identical gels require double the current to achieve the same starting voltages and electrophoresis separation times. Figure 6.1.1 Series and parallel connections of gel tanks to power supply. Electrophoresis and Immunoblotting 6.1.3 Current Protocols in Cell Biology Supplement 37 Multiple gel apparatuses can also be connected to one pair of outlets on a power supply. This is useful with older power supplies that have a limited number of outlets. When connecting several gel units to one outlet, make certain the connections between the units are shielded and protected from moisture. The gels can be connected in parallel or in series (Fig. 6.1.1). When gels are connected through the same outlet in parallel, the principle of additive currents is the same as for gels connected through different outlets in parallel. In the case of two or more gels running off the same outlet in series, the current is the same for every gel. If 10 mA is displayed by the power supply meter, for example, each gel in series will experience 10 mA. The voltage, however, is additive for each gel. If one gel at a constant 10 mA produces 100 V, then two identical gels in series will produce 200 V (100 V each) and so on. Thus, the voltage can limit the number of units connected in series on low-voltage power supplies. Gel thickness affects the above relationships. A 1.5-mm gel can be thought of as two 0.75-mm-thick gels run in parallel. Because currents are additive in parallel circuits, a 0.75-mm gel will require half the current of the 1.5-mm gel to achieve the same starting voltage and separation time. If gel thickness is doubled, then the current must also be doubled. There are limits to the amount of current that can be applied. Thicker gels require more current, generating more heat that must be dissipated. Unless temperature control is available in the gel unit, a thick gel should be run more slowly than a thin gel. NOTE: Milli-Q-purified water or equivalent should be used throughout the protocols. BASIC PROTOCOL 1 DENATURING (SDS) DISCONTINUOUS GEL ELECTROPHORESIS: LAEMMLI GEL METHOD One-dimensional gel electrophoresis under denaturing conditions (i.e., in the presence of 0.1% SDS) separates proteins based on molecular size as they move through a polyacrylamide gel matrix toward the anode. The polyacrylamide gel is cast as a separating gel (sometimes called resolving or running gel) topped by a stacking gel and secured in an electrophoresis apparatus. After sample proteins are solubilized by boiling in the presence of SDS, an aliquot of the protein solution is applied to a gel lane, and the individual proteins are separated electrophoretically. The stacking gel, through a combination of low porosity and a lower buffer concentration and pH, concentrates proteins into a thin stack before they enter the resolving gel. 2-Mercaptoethanol (2-ME) or dithiothreitol (DTT) is added during solubilization to reduce disulfide bonds. This protocol is designed for a vertical slab gel with a maximum size of 0.75 mm × 14 cm × 14 cm. For thicker gels or minigels (see Basic Protocol 2 and Support Protocol 3), the volumes of stacking and separating gels and the operating current must be adjusted. Additional protocols describe the preparation of ultrathin gels (see Alternate Protocol 4) and gradient gels (see Alternate Protocol 5), as well as the use of gel casters to make multiple gels, both single-concentration gels (see Support Protocol 1) and gradient gels (see Support Protocol 2). Materials One-Dimensional SDS-PAGE Separating and stacking gel solutions (Table 6.1.1) H2 O-saturated isobutyl alcohol 1× Tris·Cl/SDS, pH 8.8 (dilute 4× Tris·Cl/SDS, pH 8.8; Table 6.1.1) Protein sample, on ice 2× and 1× SDS sample buffer (see recipe) Protein molecular weight standards (Tables 6.1.2 and 6.1.3) 6× SDS sample buffer (see recipe; optional) 1× SDS electrophoresis buffer (see recipe) 6.1.4 Supplement 37 Current Protocols in Cell Biology Electrophoresis apparatus: e.g., Protean II 16-cm cell (Bio-Rad) or SE 600/400 16-cm unit (Hoefer) with clamps, glass plates, casting stand, and buffer chambers 0.75-mm spacers 0.45-µm filters (used in stock solution preparation) 25-ml Erlenmeyer side-arm flasks Vacuum pump with cold trap 0.75-mm Teflon comb with 1, 3, 5, 10, 15, or 20 teeth Screw-top microcentrifuge tubes (recommended) 25- or 100-µl syringe with flat-tipped needle Constant-current power supply (see Electricity and Electrophoresis above) Pour the separating gel 1. Assemble the glass-plate sandwich of the electrophoresis apparatus according to manufacturer’s instructions using two clean glass plates and two 0.75-mm spacers. If needed, clean the glass plates in liquid Alconox or RBS-35 (Pierce). These aqueousbased solutions are compatible with silver and Coomassie blue staining procedures. 2. Lock the sandwich to the casting stand. 3. Prepare the separating gel solution as directed in Table 6.1.1, degassing using a rubber-stoppered 25-ml Erlenmeyer side-arm flask connected with vacuum tubing to a vacuum pump with a cold trap. After adding the specified amount of 10% ammonium persulfate and TEMED to the degassed solution, stir gently to mix. The desired percentage of acrylamide in the separating gel depends on the molecular size of the protein being separated. Generally, use 5% gels for SDS-denatured proteins of 60 to 200 kDa, 10% gels for SDS-denatured proteins of 16 to 70 kDa, and 15% gels for SDS-denatured proteins of 12 to 45 kDa (Table 6.1.1). The stacking gel is the same regardless of the separating gel used. 4. Using a Pasteur pipet, apply the separating gel solution to the sandwich along an edge of one of the spacers until the height of the solution between the glass plates is ∼11 cm. Use the solution immediately; otherwise it will polymerize in the flask. Sample volumes <10 µl do not require a stacking gel. In this case, cast the resolving gel as usual, but extend the resolving gel into the comb (step 10) to form the wells. The proteins are then separated under the same conditions as used when a stacking gel is present. Although this protocol works well with single-concentration gels, a gradient gel is recommended for maximum resolution (see Alternate Protocol 5). 5. Using another Pasteur pipet, slowly cover the top of the gel with a layer (∼1 cm thick) of H2 O-saturated isobutyl alcohol, by gently layering the isobutyl alcohol against the edge of one and then the other of the spacers. Be careful not to disturb the gel surface. The overlay provides a barrier to oxygen, which inhibits polymerization, and allows a flat interface to form during gel formation. The H2 O-saturated isobutyl alcohol is prepared by shaking isobutyl alcohol and H2 O in a separatory funnel. The aqueous (lower) phase is removed. This procedure is repeated several times. The final upper phase is H2 O-saturated isobutyl alcohol. 6. Allow the gel to polymerize 30 to 60 min at room temperature. A sharp optical discontinuity at the overlay/gel interface will be visible on polymerization. Failure to form a firm gel usually indicates a problem with the ammonium persulfate, TEMED, or both. Ammonium persulfate solution should be made fresh before use. Ammonium persulfate should “crackle” when added to the water. If not, fresh ammonium persulfate should be purchased. Purchase TEMED in small bottles so, if necessary, a new previously unopened source can be tried. Current Protocols in Cell Biology Electrophoresis and Immunoblotting 6.1.5 Supplement 37 Table 6.1.1 Recipes for Polyacrylamide Separating and Stacking Gelsa SEPARATING GEL Final acrylamide concentration in separating gel (%)c Stock solutionb 5 6 7 7.5 8 9 10 12 30% (w/v) acrylamide/ 2.50 0.8% (w/v) bisacrylamide 3.00 3.50 3.75 4.00 4.50 5.00 6.00 6.50 7.50 4× Tris·Cl/SDS, pH 8.8 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 H2 O 8.75 8.25 7.75 7.50 7.25 6.75 6.25 5.25 4.75 3.75 10% (w/v) ammonium 0.05 persulfated 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 TEMEDe 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 13 15 Preparation of separating gel In a 25-ml side-arm flask, mix 30% acrylamide/0.8% bisacrylamide solution, 4× Tris·Cl/SDS, pH 8.8 (see reagents, below), and H2 O. Degas under vacuum ∼5 min. Add 10% ammonium persulfate and TEMED. Swirl gently to mix. Use immediately. STACKING GEL (3.9% w/v acrylamide) In a 25-ml side-arm flask, mix 0.65 ml of 30% acrylamide/0.8% bisacrylamide, 1.25 ml of 4× Tris·Cl/SDS, pH 6.8 (see reagents, below), and 3.05 ml H2 O. Degas under vacuum 10 to 15 min. Add 25 µl of 10% ammonium persulfate and 5 µl TEMED. Swirl gently to mix. Use immediately. REAGENTS USED IN GELS 30% (w/v) acrylamide/0.8% (w/v) bisacrylamide Mix 30.0 g acrylamide and 0.8 g N,N -methylenebisacrylamide with H2 O in a total volume of 100 ml. Filter the solution through a 0.45-µm filter and store at 4◦ C in the dark. The 2× crystallized grades of acrylamide and bisacrylamide are recommended. Discard after 30 days, as acrylamide gradually hydrolyzes to acrylic acid and ammonia. CAUTION: Acrylamide monomer is neurotoxic. A mask should be worn when weighing acrylamide powder. Gloves should be worn while handling the solution, and the solution should not be pipetted by mouth. 4× Tris·Cl/SDS, pH 6.8 (0.5 M Tris·Cl containing 0.4% w/v SDS) Dissolve 6.05 g Tris base in 40 ml H2 O. Adjust to pH 6.8 with 1 N HCl. Add H2 O to 100 ml total volume. Filter the solution through a 0.45-µm filter, add 0.4 g SDS, and store at 4◦ C up to 1 month. 4× Tris·Cl/SDS, pH 8.8 (1.5 M Tris·Cl containing 0.4% w/v SDS) Dissolve 91 g Tris base in 300 ml H2 O. Adjust to pH 8.8 with 1 N HCl. Add H2 O to 500 ml total volume. Filter the solution through a 0.45-µm filter, add 2 g SDS, and store at 4◦ C up to 1 month. a The recipes produce 15 ml of separating gel and 5 ml of stacking gel, which are adequate for a gel of dimensions One-Dimensional SDS-PAGE 0.75 mm × 14 cm × 14 cm. The recipes are based on the SDS (denaturing) discontinuous buffer system of Laemmli (1970). b All reagents and solutions used in the protocol must be prepared with Milli-Q-purified water or equivalent. c Volumes are in milliliters. The desired percentage of acrylamide in the separating gel depends on the molecular size of the protein being separated. See annotation to step 3, Basic Protocol 1. d Best to prepare fresh. Failure to form a firm gel usually indicates a problem with the ammonium persulfate, TEMED, or both. e TEMED, N,N,N,N-tetramethylethylenediamine. 6.1.6 Supplement 37 Current Protocols in Cell Biology Table 6.1.2 Molecular Weights of Protein Standards for Polyacrylamide Gel Electrophoresisa Protein Molecular weight (Da) Cytochrome c 11,700 α-Lactalbumin 14,200 Lysozyme (hen egg white) 14,300 Myoglobin (sperm whale) 16,800 β-Lactoglobulin 18,400 Trypsin inhibitor (soybean) 20,100 Trypsinogen, PMSF treated 24,000 Carbonic anhydrase (bovine erythrocytes) 29,000 Glyceraldehyde-3-phosphate dehydrogenase (rabbit muscle) 36,000 Lactate dehydrogenase (porcine heart) 36,000 Aldolase 40,000 Ovalbumin 45,000 Catalase 57,000 Bovine serum albumin 66,000 Phosphorylase b (rabbit muscle) 97,400 β-Galactosidase 116,000 RNA polymerase, E. coli 160,000 Myosin, heavy chain (rabbit muscle) 205,000 a Protein standards are commercially available as prepared mixtures (see Table 6.1.3). Pour the stacking gel 7. Pour off the layer of H2 O-saturated isobutyl alcohol and rinse with 1× Tris·Cl/SDS, pH 8.8. Residual isobutyl alcohol can reduce resolution of the protein bands; therefore, it must be completely removed. The isobutyl alcohol overlay should not be left on the gel longer than 2 hr. 8. Prepare the stacking gel solution as directed in Table 6.1.1. Use the solution immediately to keep it from polymerizing in the flask. 9. Using a Pasteur pipet, allow the stacking gel solution to trickle slowly into the center of the sandwich along an edge of one of the spacers until the height of the solution in the sandwich is ∼1 cm from the top of the plates. Be careful not to introduce air bubbles into the stacking gel. 10. Insert a 0.75-mm Teflon comb into the layer of stacking gel solution. If necessary, add additional stacking gel to fill the spaces in the comb completely. Again, be careful not to trap air bubbles in the tooth edges of the comb; they will cause small circular depressions in the well after polymerization that will lead to distortion in the protein bands during separation. 11. Allow the stacking gel solution to polymerize 30 to 45 min at room temperature. A sharp optical discontinuity will be visible around the wells on polymerization. Again, failure to form a firm gel usually indicates a problem with the ammonium persulfate, TEMED, or both. Electrophoresis and Immunoblotting 6.1.7 Current Protocols in Cell Biology Supplement 37 Table 6.1.3 Protein Standard Mixtures Available from Selected Suppliers Applicationsa 1-D 2-Db Bio-Rad X X CalBiochem X Cell Signaling Technology X X Favorgen X X GE Healthcare X X X Invitrogen X X X NEB X Norgen Biotek X X Novagen X X PerkinElmer X Pierce X Promega X Qiagen X R & D Systems X Roche Applied Science X Sigma-Aldrich X Upstate X X USB X X Im Prec Fluor Gly Phos X Bio Tag IEF X X X X X X X Nat X X X X X X X X X X X X X X X X X X X X X X X X X X X X X a Abbreviations: 1-D, one-dimensional gels; 2-D, two-dimensional gels; Im, immunoblotting; Pre, prestained; Fluor, fluorescent; Gly, glycoprotein; Phos, phosphoprotein; Bio, biotinylated; Tag, tagged; IEF, isoelectic focusing; Nat, native. b 2-D standards are useful as independently characterized internal controls or reference standards for 2-D SDS-PAGE. Many investigators simply use an internally characterized test sample as a reference set. c Prestained standards, while not as sharply delineated as unstained standards, can be used to monitor progress of the separation since the bands are visible through the gel cassette during electrophoresis. They are also useful for marking the position of a band after electroblotting to a nitrocellulose or PVDF membrane prior to immunoassay or analysis by mass spectrometry. Prepare the sample and load the gel 12. Dilute a portion of the protein sample to be analyzed 1:1 (v/v) with 2× SDS sample buffer and heat 3 to 5 min at 100◦ C in a sealed screw-cap microcentrifuge tube. If the sample is a precipitated protein pellet, dissolve the protein in 50 to 100 µl of 1× SDS sample buffer and boil 3 to 5 min at 100◦ C. Dissolve protein molecular weight standards in 1× SDS sample buffer according to supplier’s instructions; use these standards as a control (Tables 6.1.2 and 6.1.3). For dilute protein solutions, consider using 5:1 protein solution/6× SDS sample buffer to increase the amount of protein loaded. Proteins can also be concentrated by precipitation in acetone, ethanol, or trichloroacetic acid (TCA), but losses will occur. For a 0.8-cm-wide well, 25 to 50 µg total protein in <20 µl is recommended for a complex mixture when staining with Coomassie blue, and 1 to 10 µg total protein is needed for samples containing one or a few proteins. If silver staining is used, 10- to 100-fold less protein can be applied (0.01 to 5 µg in <20 µl depending on sample complexity). One-Dimensional SDS-PAGE To achieve the highest resolution possible, the following precautions are recommended. Prior to adding the sample buffer, keep samples at 0◦ C. Add the SDS sample buffer (room temperature) directly to the 0◦ C sample (still on ice) in a screw-top microcentrifuge tube. 6.1.8 Supplement 37 Current Protocols in Cell Biology Cap the tube to prevent evaporation, vortex, and transfer directly to a 100◦ C water bath for 3 to 5 min. Let immunoprecipitates dissolve for 1 hr at 56◦ C in 1× SDS sample buffer prior to boiling. DO NOT leave the sample in SDS sample buffer at room temperature without first heating to 100◦ C to inactivate proteases (see Critical Parameters and Troubleshooting). Endogenous proteases are very active in SDS sample buffer and will cause severe degradation of the sample proteins after even a few minutes at room temperature. To test for possible proteases, mix the sample with SDS sample buffer without heating and leave at room temperature for 1 to 3 hr. A loss of high-molecular-weight bands and a general smearing of the banding pattern indicate a protease problem. Once heated, the samples can sit at room temperature for the time it takes to load samples. 13. Carefully remove the Teflon comb without tearing the edges of the polyacrylamide wells. After the comb is removed, rinse wells with 1× SDS electrophoresis buffer. The rinse removes unpolymerized monomer; otherwise, the monomer will continue to polymerize after the comb is removed, creating uneven wells that will interfere with sample loading and subsequent separation. 14. Using a Pasteur pipet, fill the wells with 1× SDS electrophoresis buffer. If well walls are not upright, they can be manipulated with a flat-tipped needle attached to a syringe. 15. Attach gel sandwich to upper buffer chamber following manufacturer’s instructions. 16. Fill lower buffer chamber with the recommended amount of 1× SDS electrophoresis buffer. 17. Place sandwich attached to upper buffer chamber into lower buffer chamber. 18. Partially fill the upper buffer chamber with 1× SDS electrophoresis buffer so that the sample wells of the stacking gel are filled with buffer. Monitor the upper buffer chamber for leaks and, if necessary, reassemble the unit. A slow leak in the upper buffer chamber may cause arcing around the upper electrode and damage the upper buffer chamber. 19. Using a 25- or 100-µl syringe with a flat-tipped needle, load the protein sample(s) into one or more wells by carefully applying the sample as a thin layer at the bottom of the wells. Load control wells with molecular weight standards. Add an equal volume of 1× SDS sample buffer to any empty wells to prevent spreading of adjoining lanes. Disposable loading tips can be used with automatic pipettors to simplify loading. Preparing the samples at approximately the same concentration and loading an equal volume to each well will ensure that all lanes are the same width and that the proteins run evenly. If unequal volumes of sample buffer are added to wells, the lane with the larger volume will spread during electrophoresis and constrict the adjacent lanes, causing distortions. The samples will layer on the bottom of the wells because the glycerol added to the sample buffer gives the solution a greater density than the electrophoresis buffer. To keep bands tight, hold the tip of the needle near the bottom of the well and load the samples slowly. The bromphenol blue in the sample buffer makes sample application easy to follow visually. 20. Fill the remainder of the upper buffer chamber with additional 1× SDS electrophoresis buffer so that the upper platinum electrode is completely covered. Do this slowly so that samples are not swept into adjacent wells. Electrophoresis and Immunoblotting 6.1.9 Current Protocols in Cell Biology Supplement 37 Run the gel 21. Connect the power supply to the cell and run at 10 mA of constant current for a slab gel 0.75 mm thick, until the bromphenol blue tracking dye enters the separating gel. Then increase the current to 15 mA. For a standard 16-cm gel sandwich, 4 mA per 0.75-mm-thick gel will run ∼15 hr (i.e., overnight); 15 mA per 0.75-mm gel will take 4 to 5 hr. To run two gels or a 1.5-mm-thick gel, simply double the current. When running a 1.5-mm gel at 30 mA, the temperature must be controlled (10◦ to 20◦ C) with a circulating constant-temperature water bath to prevent “smiling” (curvature in the migratory band). Temperatures <5◦ C should not be used because SDS in the running buffer will precipitate. If the level of buffer in the upper chamber decreases, a leak has occurred. 22. After the bromphenol blue tracking dye has reached the bottom of the separating gel, disconnect the power supply. Refer to Safety Considerations under Electricity and Electrophoresis. Disassemble the gel 23. Discard electrophoresis buffer and remove the upper buffer chamber with the attached gel sandwich. 24. Orient the gel so that the order of the sample wells is known, remove the sandwich from the upper buffer chamber, and lay the sandwich on a sheet of absorbent paper or paper towels. 25. Carefully slide one of the spacers halfway from the edge of the sandwich along its entire length. Use the exposed spacer as a lever to pry open the glass plate, exposing the gel. 26. Carefully remove the gel from the lower plate. Cut a small triangle off one corner of the gel so the lane orientation is not lost during staining and drying. Proceed with protein detection. Gradient gels are most easily picked up without tearing from the high-concentration end of the gel using gloved fingers. Single-concentration gels <10% can be picked up and placed in fixative, but are more easily removed if first immersed in fixative while left on the plate, allowing the gel to float off. The gel can be stained with Coomassie blue or silver (UNIT 6.6), or proteins can be electroeluted, electroblotted onto a polyvinylidene difluoride (PVDF) membrane for subsequent staining or sequence analysis, or transferred to a membrane for immunoblotting (UNIT 6.2). If the proteins are radiolabeled, they can be detected by autoradiography (UNIT 6.3). ALTERNATE PROTOCOL 1 ELECTROPHORESIS IN TRIS-TRICINE BUFFER SYSTEMS Separation of peptides and proteins under 10 to 15 kDa is not possible in the traditional Laemmli discontinuous gel system (see Basic Protocol 1). This is due to the comigration of SDS and smaller proteins, obscuring the resolution. Two approaches to obtain the separation of small proteins and peptides in the range of 5 to 20 kDa are presented: the following Tris-tricine method and a system using increased buffer concentrations (see Alternate Protocol 2). The Tris-tricine system uses a modified buffer to separate the SDS and peptides, thus improving resolution. Several precast gels are available for use with the tricine formulations (Table 6.1.4). One-Dimensional SDS-PAGE 6.1.10 Supplement 37 Current Protocols in Cell Biology Table 6.1.4 Precast Gels Available from Selected Suppliers Format Bio-Rad Large Mini 2-Da X X X X X X X X Cambrex Jule Application X Invitrogen Instrument Compatibility Native Peptide SDS Bio-Rad Cambrex Hoefer Invitrogen X X X X X X X X X X X X X X X X X X X X X X X X X X a Two-dimensional analysis. Table 6.1.5 Recipes for Tricine Peptide Separating and Stacking Gelsa SEPARATING AND STACKING GELS Stock solutionb Separating gel Stacking gel 30% (w/v) acrylamide/0.8% (w/v) bisacrylamide 9.80 ml 1.62 ml Tris·Cl/SDS, pH 8.45 10.00 ml 3.10 ml H2 O 7.03 ml 7.78 ml 4.00 g (3.17 ml) — 10% (w/v) ammonium persulfate 50 µl 25 µl TEMED 10 µl 5 µl Glycerol c Prepare separating and stacking gel solutions separately. In a 50-ml side-arm flask, mix 30% acrylamide/0.8% bisacrylamide solution (Table 6.1.1), Tris·Cl/SDS, pH 8.45 (see reagents, below), and H2 O. Add glycerol to separating gel only. Degas under vacuum 10 to 15 min. Add 10% ammonium persulfate and TEMED. Swirl gently to mix; use immediately. ADDITIONAL REAGENTS USED IN GELS Tris·Cl/SDS, pH 8.45 (3.0 M Tris·Cl containing 0.3% w/v SDS) Dissolve 182 g Tris base in 300 ml H2 O. Adjust to pH 8.45 with 1 N HCl. Add H2 O to 500 ml total volume. Filter the solution through a 0.45-µm filter, add 1.5 g SDS, and store at 4◦ C up to 1 month. a The recipes produce 30 ml of separating gel and 12.5 ml of stacking gel, which are adequate for two gels of dimensions 0.75 mm × 14 cm × 14 cm. The recipes are based on the Tris-tricine buffer system of Schagger and von Jagow (1987). b All reagents and solutions used in the protocol must be prepared with Milli-Q-purified water or equivalent. c Best to prepare fresh. Failure to form a firm gel usually indicates a problem with the persulfate, TEMED, or both. Additional Materials (also see Basic Protocol 1) Separating and stacking gel solutions (Table 6.1.5) 2× tricine sample buffer (see recipe) Peptide molecular weight standards (Table 6.1.6) Cathode buffer (see recipe) Anode buffer (see recipe) Coomassie blue G-250 staining solution (see recipe) 10% (v/v) acetic acid 50-ml Erlenmeyer side-arm flasks Electrophoresis and Immunoblotting 6.1.11 Current Protocols in Cell Biology Supplement 37 Table 6.1.6 Molecular Weights of Peptide Standards for Polyacrylamide Gel Electrophoresisa Peptide Molecular weight (Da) Myoglobin (polypeptide backbone) 16,950 Myoglobin 1-131 14,440 Myoglobin 56-153 10,600 Myoglobin 56-131 8,160 Myoglobin 1-55 6,210 Glucagon 3,480 Myoglobin 132-153 2,510 a Peptide standards are commercially available from Sigma-Aldrich. See Sigma- Aldrich Technical Bulletin MWSDS70-L for molecular weight markers for proteins. 1. Prepare and pour the separating and stacking gels (see Basic Protocol 1, steps 1 to 11) using the recipes in Table 6.1.5. 2. Prepare the sample (see Basic Protocol 1, step 12), but substitute 2× tricine sample buffer for the 2× SDS sample buffer, and heat the sample at 40◦ C for 30 to 60 min to improve solubilization prior to loading. Use peptide molecular weight standards (Table 6.1.6). If proteolytic activity is a problem (see Basic Protocol 1, step 12), heating samples to 100◦ C for 3 to 5 min may be required. 3. Set up the electrophoresis apparatus and load the gel (see Basic Protocol 1, steps 13 to 20), but use cathode buffer or water to rinse the wells, use cathode buffer in the upper buffer chamber, and use anode buffer in the lower buffer chamber. The cathode buffer contains the tricine. 4. Connect the power supply to the cell and run 1 hr at 30 V (constant voltage) followed by 4 to 5 hr at 150 V (constant voltage). Use a heat exchanger to keep the electrophoresis chamber at room temperature. 5. After the tracking dye has reached the bottom of the separating gel, disconnect the power supply. Refer to Safety Considerations under Electricity and Electrophoresis. Coomassie blue G-250 is used as a tracking dye instead of bromphenol blue because it moves ahead of the smallest peptides. 6. Disassemble the gel (see Basic Protocol 1, steps 23 to 26). Stain proteins in the gel for 1 to 2 hr in Coomassie blue G-250 staining solution. Follow by destaining with 10% acetic acid, changing the solution every 30 min until background is clear (3 to 5 changes). For higher sensitivity, use silver staining as a recommended alternative. Prolonged staining and destaining will result in the loss of resolution of the smaller proteins (<10 kDa). Proteins diffuse within the gel and out of the gel, resulting in a loss of staining intensity and resolution. ALTERNATE PROTOCOL 2 One-Dimensional SDS-PAGE NONUREA PEPTIDE SEPARATIONS WITH TRIS BUFFERS A simple modification of the traditional Laemmli buffer system presented in Basic Protocol 1, in which the increased concentration of buffers provides better separation between the stacked peptides and the SDS micelles, permits reasonable separation of peptides as small as 5 kDa. 6.1.12 Supplement 37 Current Protocols in Cell Biology Additional Materials (also see Basic Protocol 1) Separating and stacking gel solutions (Table 6.1.7) 2× Tris·Cl/SDS, pH 8.8 (dilute 4× Tris·Cl/SDS, pH 8.8; Table 6.1.1) 2× SDS electrophoresis buffer (see recipe) 1. Prepare and pour the separating and stacking gels (see Basic Protocol 1, steps 1 to 11), using the modified recipes in Table 6.1.7. After removing the isobutyl alcohol overlay from the separating gel, rinse with 2× Tris·Cl/SDS, pH 8.8, rather than 1× Tris·Cl/SDS. 2. Prepare the sample and load the gel (see Basic Protocol 1, steps 12 to 20), but substitute 2× SDS electrophoresis buffer for the 1× SDS electrophoresis buffer. Table 6.1.6 lists the standards for small protein separations. Table 6.1.7 Recipes for Modified Laemmli Peptide Separating and Stacking Gelsa SEPARATING AND STACKING GELS Stock solutionb Separating gel Stacking gel 30% (w/v) acrylamide/0.8% (w/v) bisacrylamide 10.00 ml 0.65 ml 8× Tris·Cl, pH 8.8 3.75 ml — 4× Tris·Cl, pH 6.8 — 1.25 ml 0.15 ml 50 µl 1.00 ml 3.00 ml 10% (w/v) ammonium persulfate 50 µl 25 µl TEMED 10 µl 5 µl c 10% (w/v) SDS H2 O c Prepare separating and stacking gel solutions separately. In a 25-ml side-arm flask, mix 30% acrylamide/0.8% bisacrylamide solution (see Table 6.1.1), 8× Tris·Cl, pH 8.8, or 4× Tris·Cl, pH 6.8 (see reagents below), 10% SDS, and H2 O. Degas under vacuum 10 to 15 min. Add 10% ammonium persulfate and TEMED. Swirl gently to mix. Use immediately. ADDITIONAL REAGENTS USED IN GELS 4× Tris·Cl, pH 6.8 (0.5 M Tris·Cl) Dissolve 6.05 g Tris base in 40 ml H2 O. Adjust to pH 6.8 with 1 N HCl. Add H2 O to 100 ml total volume. Filter the solution through a 0.45-µm filter and store up to 1 month at 4◦ C. 8× Tris·Cl, pH 8.8 (3.0 M Tris·Cl) Dissolve 182 g Tris base in 300 ml H2 O. Adjust to pH 8.8 with 1 N HCl. Add H2 O to 500 ml total volume. Filter the solution through a 0.45-µm filter and store up to 1 month at 4◦ C. a The recipes produce 15 ml of separating gel and 5 ml of stacking gel, which are adequate for one gel of dimensions 0.75 mm × 14 cm × 14 cm. The recipes are based on the modified Laemmli peptide separation system of Okajima et al. (1993). b All reagents and solutions used in the protocol must be prepared with Milli-Q-purified water or equivalent. c Best to prepare fresh. Failure to form a firm gel usually indicates a problem with the ammonium persulfate, TEMED, or both. Electrophoresis and Immunoblotting 6.1.13 Current Protocols in Cell Biology Supplement 37 3. Run the gel (see Basic Protocol 1, steps 21 and 22). Note that the separations will take ∼25% longer than those using Basic Protocol 1. The increased buffer concentrations lead to faster transit through the stacking gel but lower mobility in the resolving gel. 4. Disassemble the gel (see Basic Protocol 1, steps 23 to 26). Proteins in the gel may now be stained. ALTERNATE PROTOCOL 3 CONTINUOUS SDS-PAGE With continuous SDS-PAGE, the same buffer is used for both the gel and electrode solutions. Although continuous gels lack the resolution of the discontinuous systems, they are extremely versatile, less prone to mobility artifacts, and much easier to prepare. The stacking gel is omitted. Additional Materials (also see Basic Protocol 1) Separating gel solution (Table 6.1.8) 2× and 1× phosphate/SDS sample buffer (see recipe) 1× phosphate/SDS electrophoresis buffer (see recipe) Table 6.1.8 Recipes for Separating Gels for Continuous SDS-PAGEa SEPARATING GEL Final acrylamide concentration in the separating gel (%)c Stock solutionb 5 30% (w/v) acrylamide/0.8% (w/v) bisacrylamide 2.5 4× phosphate/SDS, pH 7.2 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 H2 O 8.75 8.25 7.75 7.25 6.75 6.25 5.75 5.25 4.75 4.25 3.75 10% (w/v) ammonium persulfated 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 TEMED 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 6 7 8 9 10 11 12 13 14 15 3.00 3.50 4.00 4.50 5.00 5.50 6.00 6.50 7.00 7.50 Preparation of separating gel In a 25-ml side-arm flask, mix 30% acrylamide/0.8% bisacrylamide solution (see Table 6.1.1), 4× phosphate/SDS, pH 7.2, and H2 O. Degas under vacuum about 5 min. Add 10% ammonium persulfate and TEMED. Swirl gently to mix. Use immediately. ADDITIONAL REAGENTS USED IN GELS 4× phosphate/SDS, pH 7.2 (0.4 M sodium phosphate/0.4% w/v SDS) Mix 46.8 g NaH2 PO4 ·H2 O, 231.6 g Na2 HPO4 ·7H2 O, and 12 g SDS in 3 liters H2 O. Store at 4◦ C for up to 3 months. a The recipes produce 15 ml of separating gel, which is adequate for one gel of dimensions 0.75 mm × 14 cm × 14 cm. The recipes are based on the original continuous phosphate buffer system of Weber et al. (1972). b All reagents and solutions used in the protocol must be prepared with Milli-Q-purified water or equivalent. c Volumes are in milliliters. The desired percentage of acrylamide in the separating gel depends on the molecular size One-Dimensional SDS-PAGE of the protein being separated. See Basic Protocol 1, annotation to step 3. d Best to prepare fresh. Failure to form a firm gel usually indicates a problem with the ammonium persulfate, TEMED, or both. 6.1.14 Supplement 37 Current Protocols in Cell Biology 1. Prepare and pour a single separating gel (see Basic Protocol 1, steps 1 to 4), except use the recipe in Table 6.1.8 and fill the gel sandwich to the top. Omit the stacking gel. Insert the comb (see Basic Protocol 1, step 10) and allow the gel to polymerize 30 to 60 min at room temperature. 2. Mix the protein sample 1:1 with 2× phosphate/SDS sample buffer and heat to 100◦ C for 2 min. For large sample volumes or samples suspended in high-ionic-strength buffers (>50 mM), dialyze against 1× sample buffer prior to electrophoresis. Note that the precautions about proteases (see Basic Protocol 1, step 12) apply here. 3. Assemble the electrophoresis apparatus and load the sample (see Basic Protocol 1, steps 13 to 20) using the phosphate/SDS electrophoresis buffer. Load empty wells with 1× phosphate/SDS sample buffer. 4. Connect the power supply and start the run with 15 mA per 0.75-mm-thick gel until the tracking dye has entered the gel. Continue electrophoresis at 30 mA for 3 hr (5% gel), 5 hr (10% gel), 8 hr (15% gel), or until the dye reaches the bottom of the gel. Use temperature control if available to maintain the gel at 15◦ to 20◦ C. SDS will precipitate below 15◦ C in this system. 5. Disassemble the gel (see Basic Protocol 1, steps 23 to 26). See Safety Considerations in introduction. Proteins in the gel may now be stained. CASTING AND RUNNING ULTRATHIN GELS Ultrathin gels provide superb resolution but are difficult to handle. In this application, gels are cast on GelBond, a Mylar support material. Silver staining is recommended for the best resolution. Combs and spacers for gels <0.5 mm thick are not readily available for most protein electrophoresis units. However, by adapting combs and spacers used for DNA sequencing, casting gels from 0.2 to 0.5 mm thick is straightforward. ALTERNATE PROTOCOL 4 Additional Materials (also see Basic Protocol 1) 95% (v/v) ethanol GelBond (Lonza) cut to a size slightly smaller than the gel plate dimensions Glue stick Ink roller (available from art supply stores) Combs and spacers (0.19 to 0.5 mm; sequencing gel spacers and combs can be cut to fit) 1. Wash gel plates with water-based laboratory detergent followed by successive rinses with hot tap water, deionized water, and finally 95% ethanol. Allow to air dry. Gel plates must be extremely clean for casting thin gels. Gloves are needed throughout these procedures to prevent contamination by proteins on the surface of skin. 2. Apply a streak of adhesive from a glue stick to the bottom edge of the glass plate. Quickly position the GelBond with the hydrophobic side down (a drop of water will bead up on the hydrophobic surface). Apply pressure with Kimwipe tissue to attach the GelBond firmly to the plate. Finally, pull the top portion of the GelBond back, place a few drops of water underneath, and roll flat with an ink roller. Make sure the GelBond does not extend beyond the edges of the upper and lower sealing surface of the plate. This will cause it to buckle on sealing. Reposition the GelBond if needed to prevent it from extending beyond the glass plate. Material may also be trimmed to fit flush with the plate edge. Electrophoresis and Immunoblotting 6.1.15 Current Protocols in Cell Biology Supplement 37 3. Assemble the gel cassette according to the manufacturer’s instructions (also see Basic Protocol 1, steps 1 and 2). Just prior to assembly, blow air over the surface of both the GelBond and the opposing glass surface to remove any particulate material (e.g., dust). Sequencing gel spacers can be easily adapted. First, cut the spacers slightly longer than the length of the gel plate. Position a spacer along each edge of the glass plate and assemble the gel sandwich, clamping in place. With a razor blade, trim the excess spacer at top and bottom to get a reusable spacer exactly the size of the plate. 4. Prepare and pour the separating and stacking gels (see Basic Protocol 1, steps 3 to 9). In place of the Teflon comb, insert a square well sequencing comb cut to fit within the gel sandwich. Allow the stacking gel to polymerize 30 to 45 min at room temperature. Less solution is needed for ultrathin gels. For example, a 0.5-mm-thick gel requires 33% less gel solution than a 0.75-mm gel. 5. Prepare the sample and load the gel (see Basic Protocol 1, steps 12 to 20). When preparing protein samples for ultrathin gels, 3 to 4 µl at 5 µg protein/µl is required for Coomassie blue R-250 staining, whereas 10-fold less is needed for silver staining. 6. Run the gel (see Basic Protocol 1, steps 21 and 22), except conduct the electrophoresis at 7 mA/gel (0.25-mm-thick gels) or 14 mA/gel (0.5-mm-thick gels) for 4 to 5 hr. 7. When the separation is complete, disassemble the unit and remove the gel (see Basic Protocol 1, steps 23 to 26) with the GelBond still attached. With a gloved hand, wash away the adhesive material from the back of the GelBond under a stream of water before proceeding to protein detection. Either Coomassie blue or silver staining may be used, but silver staining produces particularly fine resolution with thin GelBond-backed gels. Compared to staining thicker (>0.75 mm) gels, thin (<0.75 mm) gels stain and destain more quickly. Although the optimum staining times must be empirically determined, all steps in Coomassie blue and silver staining procedures are generally reduced by half. SUPPORT PROTOCOL 1 CASTING MULTIPLE SINGLE-CONCENTRATION GELS Casting multiple gels at one time has several advantages. All the gels are identical, so sample separation is not affected by gel-to-gel variation. Furthermore, casting ten gels is only slightly more difficult than casting two gels. Once cast, gels can be stored for several days in a refrigerator. Additional Materials (also see Basic Protocol 1) Separating and stacking gels for single-concentration gels (Table 6.1.9) Multiple gel caster (Bio-Rad, Hoefer) 100-ml disposable syringe and flat-tipped needle Extra plates and spacers 14 × 14–cm acrylic blocks or polycarbonate sheets 250- and 500-ml side-arm flasks (used in gel preparation) Long razor blade or plastic wedge (Wonder Wedge, Hoefer) Resealable plastic bags Pour the separating gel 1. Assemble the multiple gel caster according to the manufacturer’s instructions. One-Dimensional SDS-PAGE With the Hoefer unit, make sure to insert the large triangular space filler plug in the base of the caster. The plug is removed when casting gradient gels (see Support Protocol 2). 6.1.16 Supplement 37 Current Protocols in Cell Biology Table 6.1.9 Recipes for Multiple Single-Concentration Polyacrylamide Gelsa SEPARATING GEL Final acrylamide concentration in the separating gel (%)c Stock solutionb 5 6 7 8 9 10 11 12 13 14 15 30% (w/v) acrylamide/ 0.8% (w/v) bisacrylamide 52 62 72 83 93 103 114 124 134 145 155 4× Tris·Cl/SDS, pH 8.8 78 78 78 78 78 78 78 78 78 78 78 H2 O 181 171 160 150 140 129 119 109 98 88 78 10% (w/v) ammonium persulfated 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.0 TEMED 0.21 0.21 0.21 0.21 0.21 0.21 0.21 0.21 0.21 0.21 0.21 Preparation of separating gel In a 500-ml side-arm flask, mix 30% acrylamide/0.8% bisacrylamide solution (see Table 6.1.1), 4× Tris·Cl/SDS, pH 8.8 (Table 6.1.1), and H2 O. Degas under vacuum ∼5 min. Add 10% ammonium persulfate and TEMED. Swirl gently to mix. Use immediately. STACKING GEL In a 250-ml side-arm flask, mix 13.0 ml 30% acrylamide/0.8% bisacrylamide solution, 25 ml 4× Tris·Cl/SDS, pH 6.8 (Table 6.1.1), and 61 ml H2 O. Degas under vacuum ∼5 min. Add 0.25 ml 10% ammonium persulfate and 50 µl TEMED. Swirl gently to mix. Use immediately. a The recipes produce about 300 ml of separating gel and 100 ml of stacking gel, which are adequate for ten gels of dimensions 1.5 mm × 14 cm × 14 cm, with extra solution should there be a leak or spill while casting the gels. For thinner spacers or fewer gels, calculate volumes using the equation in the annotation to step 4. The recipes are based on the SDS (denaturing) discontinuous buffer system of Laemmli (1970). b All reagents and solutions used in the protocol must be prepared with Milli-Q-purified water or equivalent. c Volumes in table body are in milliliters. The desired percentage of acrylamide in separating gel depends on the molecular size of the protein being separated. See Basic Protocol 1, annotation to step 3. d Best to prepare fresh. Failure to form a firm gel usually indicates a problem with the persulfate, TEMED, or both. 2. Assemble glass sandwiches and stack them in the casting chamber. Stack up to ten 1.5-mm gels and fill in extra space with acrylic blocks or polycarbonate sheets to hold the sandwiches tightly in place. Make sure the spacers are straight along the top, right, and left edges of the glass plates and that all edges of the stack are flush. The presence of loosely fitting sandwiches in the caster will lead to unevenly cast gels, creating distortions during electrophoresis. Polycarbonate inhibits gel polymerization. Therefore, if polycarbonate sheets are placed in the caster before and after the set of glass sandwiches, the entire set will slide out as one block after polymerization. Placing polycarbonate sheets between each gel sandwich makes them easier to separate from one another after polymerization. 3. Place the front sealing plate on the casting chamber, making sure the stack fits snugly. Secure the plate with four spring clamps and tighten the bottom thumb screws. 4. Prepare the separating (resolving) gel solution (Table 6.1.9). A 12-cm separating gel with a 4-cm stacking gel is recommended. If fewer than ten gels are prepared (Table 6.1.9), use the following formula to estimate the amount of separating gel volume needed: volume = gel no. × height (cm) × width (cm) × thickness (cm) + 4 × gel no. + 10 ml. Electrophoresis and Immunoblotting 6.1.17 Current Protocols in Cell Biology Supplement 37 5. Using a 100-ml disposable syringe with flat-tipped needle, inject the resolving gel solution down the side of one spacer into the multiple caster. A channel in the silicone plug distributes the solution throughout the whole caster. Avoid introducing bubbles by giving the caster a quick tap on the benchtop once the caster is filled. 6. Overlay the center of each gel with 100 µl H2 O-saturated isobutyl alcohol and let polymerize for 1 to 2 hr. 7. Drain off the overlay and rinse the surface with 1× Tris·Cl/SDS, pH 8.8. If the gels will not be used immediately, skip to step 12. Pour the stacking gel 8. Prepare the stacking gel solution either singly (see Basic Protocol 1, step 8) or for all the gels at once (Table 6.1.9). The stacking gel solution should be prepared just before it is poured. 9. Fill each sandwich in the caster with stacking gel solution. 10. Insert a comb into each sandwich and let the gel polymerize for 2 hr. Insert the combs at a 45◦ angle to avoid trapping air underneath the comb teeth. Air bubbles will inhibit polymerization and cause dents in the wells and a distorted pattern of protein bands. 11. Remove the combs and rinse wells with 1× SDS electrophoresis buffer. Remove the gels from the caster 12. Remove the gels from the caster and separate by carefully inserting a long razor blade or knife between the gel sandwiches. A plastic wedge (Hoefer’s Wonder Wedge) also works well. 13. Clean the outside of each gel plate with running water to remove the residual polymerized and unpolymerized acrylamide. 14. Overlay gels to be stored with 1× Tris·Cl/SDS, pH 8.8, place in a resealable plastic bag, and store at 4◦ C until needed (up to 1 week). ALTERNATE PROTOCOL 5 SEPARATION OF PROTEINS ON GRADIENT GELS Gels that consist of a gradient of increasing polyacrylamide concentration resolve a much wider size range of proteins than standard single-concentration gels (see Critical Parameters and Troubleshooting). The protein bands are also much sharper, particularly in the low-molecular-weight range. Unlike single-concentration gels, gradient gels separate proteins in a way that can be represented easily to give a linear plot from 10 to 200 kDa. This facilitates molecular weight estimations. The quantities given below provide separating gel solution sufficient for two 0.75-mm gels (∼7 ml of each concentration) or one 1.5-mm gel (∼14 ml of each concentration). Volumes can be adjusted to accommodate gel sandwiches of different dimensions. Additional Materials (also see Basic Protocol 1) Light and heavy acrylamide gel solutions (Table 6.1.10) Bromphenol blue (optional; for checking practice gradient) 10% ammonium persulfate (prepare fresh) TEMED One-Dimensional SDS-PAGE 6.1.18 Supplement 37 Current Protocols in Cell Biology Gradient maker (30 to 50 ml, Hoefer SG30 or SG50; or 30 to 100 ml, Bio-Rad 385) Tygon tubing with micropipet tip Peristaltic pump (optional; e.g., Markson A-13002, A-34040, or A-34105 minipump) Whatman 3MM filter paper Set up the gradient maker and prepare the gel solutions 1. Assemble the magnetic stirrer and gradient maker on a ring stand as shown in Figure 6.1.2. Connect the outlet valve of the gradient maker to Tygon tubing attached to a micropipet tip that is placed over the vertical gel sandwich. If desired, place a peristaltic pump in line between the gradient maker and the gel sandwich. A peristaltic pump will simplify casting by providing a smooth flow rate. 2. Place a small stir-bar into the mixing chamber of the gradient maker (i.e., the chamber connected to the outlet). Table 6.1.10 Light and Heavy Acrylamide Gel Solutions for Gradient Gels Acrylamide concentration in light gel solution (%)a,b Stock solution 5 30% acrylamide/0.8% 2.5 bisacrylamidec 6 7 8 9 10 11 12 13 14 3.0 3.5 4.0 4.5 5.0 5.5 6.0 6.5 7.0 4× Tris·Cl/SDS, pH 8.8c 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 H2 O 8.75 8.25 7.75 7.25 6.75 6.25 5.75 5.25 4.75 4.25 10% ammonium persulfated 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 TEMEDd 0.005 0.005 0.005 0.005 0.005 0.005 0.005 0.005 0.005 0.005 Acrylamide concentration in heavy gel solution (%)a,b Stock solution 10 11 12 13 14 15 16 17 18 19 20 30% acrylamide/0.8% 5.0 bisacrylamidec 5.5 6.0 6.5 7.0 7.5 8.0 8.5 9.0 9.5 10.0 4× Tris·Cl/SDS, pH 8.8c 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 3.75 H2 O 5.0 Sucrose (g) 2.25 2.25 2.25 2.25 2.25 2.25 2.25 2.25 2.25 2.25 2.25 10% ammonium persulfated 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 TEMEDd 0.005 0.005 0.005 0.005 0.005 0.005 0.005 0.005 0.005 0.005 0.005 4.5 4.0 3.5 3.0 2.5 2.0 1.5 1.0 0.5 0 a To survey proteins ≥10 kDa, 5% to 20% gradient gels are recommended. To expand the range between 10 and 200 kDa, a 10% to 20% gradient gel is recommended. b Volumes are in milliliters (sucrose is in grams). Keep light gel solution at room temperature prior to use (no longer than 1 hr). Keep heavy solution on ice. c See Table 6.1.1 for preparation. d Ammonium persulfate and TEMED are added directly to the gradient chambers immediately before the gel is poured. It is best to prepare ammonium persulfate fresh. Failure to form a firm gel usually indicates a problem with the ammonium persulfate, TEMED, or both. Electrophoresis and Immunoblotting 6.1.19 Current Protocols in Cell Biology Supplement 37 Figure 6.1.2 control. Gradient gel setup. A peristaltic pump, though not required, will provide better 3. Using the recipes in Table 6.1.10, prepare light and heavy acrylamide gel solutions without ammonium persulfate or TEMED. Recommended gradient ranges are 5% to 20% for most applications (to separate proteins of 10 to several hundred kilodaltons). Deaeration is not recommended for either the light or heavy solution. Omitting the deaeration will allow polymerization to proceed more slowly, letting the gradient establish itself in the gel sandwich before polymerization takes place. Keep the heavy solution on ice until use. Once the ammonium persulfate is added to the heavy solution, it will polymerize without TEMED, albeit more slowly; keeping the solution on ice prevents this. The gel solution will come to room temperature during casting. The higher the percentage of acrylamide, the more severe the problem of premature polymerization. 4. With the outlet port and interconnecting valve between the two chambers closed, pipet 7 ml of light (low-concentration) acrylamide gel solution into the reservoir chamber for one 0.75-mm-thick gradient gel. A practice run with heavy and light solutions is recommended. Bromphenol blue should be added to the heavy solution to demonstrate linearity of the practice gradient. 5. Open the interconnecting valve briefly to allow a small amount (∼200 µl) of light solution to flow through the valve and into the mixing chamber. The presence of air bubbles in the interconnecting valve may obstruct the flow between chambers during casting. 6. Add 7 ml of heavy (high-concentration) acrylamide gel solution to the mixing chamber. 7. Add 23 µl of 10% ammonium persulfate and ∼2.3 µl TEMED per 7 ml acrylamide solution to each chamber. Mix the solutions in each chamber with a disposable pipet. Form the gradient and cast the gel 8. Open the interconnecting valve completely. One-Dimensional SDS-PAGE Some of the heavy solution will flow back into the reservoir chamber containing light solution as the two chambers equilibrate. This will not affect the formation of the gradient. 6.1.20 Supplement 37 Current Protocols in Cell Biology 9. Turn on the magnetic stirrer and adjust the rate to produce a slight vortex in the mixing chamber. 10. Open the outlet of the gradient maker slowly. Adjust the outlet valve to a flow rate of 2 ml/min. If using a peristaltic pump, calibrate the flow rate with a graduated cylinder prior to casting the gel. Some adjustment of the flow rate may be necessary during casting. If the light solution is not flowing into the mixing chamber, a bubble may be caught in the interconnecting valve. Quickly close the outlet and cover the top of the reservoir chamber with a gloved thumb. Push down with the thumb to increase the pressure in the chamber and force the air bubble out of the center valve. 11. Fill the gel sandwich from the top. Place the pipet tip against one side of the sandwich so the solution flows down one plate only. The heavy solution will flow into the sandwich first, followed by progressively lighter solution. 12. Watch as the last of the light solution drains into the outlet tube and adjust the flow rate to ensure that the last few milliliters of solution do not flow quickly into the gel sandwich and disturb the gradient. 13. Overlay the gradient gel with H2 O-saturated isobutyl alcohol. Allow the gel to polymerize ∼1 hr. In this gel system, the gel will polymerize from the bottom (i.e., heavy solution) up. Because polymerization is an exothermic reaction, heat can be felt evolving from the bottom of the gel sandwich during polymerization. A sharp optical discontinuity at the gel-overlay interface indicates that polymerization has occurred. In general, 1 hr is adequate for polymerization. 14. Remove the H2 O-saturated isobutyl alcohol and rinse with 1× Tris·Cl/SDS, pH 8.8. Cast the stacking gel (see Basic Protocol 1, steps 8 to 11). The gel can be covered with 1× Tris·Cl/SDS, pH 8.8, sealed in a plastic bag, and stored for up to 1 week. Load and run the gel 15. Prepare the protein sample and protein molecular-weight-standards mixture. Load and run the gel (see Basic Protocol 1, steps 13 to 26). The gel can be stained with Coomassie blue or silver (UNIT 6.6). 16. After staining, dry the gels onto Whatman 3MM or equivalent filter paper. Gradient gels >0.75 mm thick require special handling during drying to prevent cracking. The simplest approach to drying gradient gels is to use thin gels; ≤0.75-mm gradient gels with ≤20% acrylamide solutions will dry without cracking as long as the vacuum pump is working properly and the cold trap is dry at the onset of drying. For gradient gels >0.75 mm thick, add 3% (w/v) glycerol to the final destaining solution to help prevent cracking. Another method is to dehydrate and shrink the gel in 30% methanol for up to 3 hr prior to drying. Then place the gel in distilled water for 5 min before drying. CASTING MULTIPLE GRADIENT GELS Casting gradient gels in a multiple gel caster has several advantages. In addition to the time savings, batch casting produces gels that are essentially identical. This is particularly important for gradient gels, where slight variations in casting technique can cause variations in protein mobility. The gels may be stored for up to 1 week after casting to ensure internal consistency from run to run during the week. Furthermore, gels with several ranges of concentrations (e.g., 5% to 20% and 10% to 20% acrylamide) can be cast and stored, giving much more flexibility to optimize separations. SUPPORT PROTOCOL 2 Electrophoresis and Immunoblotting 6.1.21 Current Protocols in Cell Biology Supplement 37 Additional Materials (also see Alternate Protocol 5) Plug solution (see recipe) Light and heavy acrylamide gel solutions for multiple gradient gels (Table 6.1.11) TEMED H2 O-saturated isobutyl alcohol Multiple gel caster (Bio-Rad, Hoefer) Peristaltic pump (25 ml/min) 500- or 1000-ml gradient maker (Bio-Rad, Hoefer) Tygon tubing Set up system and pour separating gel 1. Assemble the multiple caster as in casting multiple single-concentration gels (see Support Protocol 1, steps 1 to 3), making sure to remove the triangular space filler plugs in the bottom of the caster. The plug is used only when casting single-concentration gels. Table 6.1.11 Light and Heavy Acrylamide Gel Solutions for Casting Multiple Gradient Gels Acrylamide concentration in light gel solution (%)a,b Stock solution 5 6 7 8 9 10 11 12 13 14 30% acrylamide/0.8% bisacrylamidec 28 33 39 44 50 55 61 66 72 77 4× Tris·Cl/SDS, pH 8.8c 41 41 41 41 41 41 41 41 41 41 H2 O 96 91 85 80 74 69 63 58 52 47 10% ammonium persulfated 0.55 0.55 0.55 0.55 0.55 0.55 0.55 0.55 0.55 0.55 TEMED 0.054 0.054 0.054 0.054 0.054 0.054 0.054 0.054 0.054 0.054 Acrylamide concentration in heavy gel solution (%)a,b Stock solution 10 11 12 13 14 15 16 17 18 19 20 30% acrylamide/0.8% bisacrylamidec 55 61 66 72 77 83 88 94 99 105 110 4× Tris·Cl/SDS, pH 8.8c 41 41 41 41 41 41 41 41 41 41 41 H2 O 55 50 44 39 33 28 22 17 11 5.5 0 Sucrose (g) 25 25 25 25 25 25 25 25 25 25 25 10% ammonium persulfated 0.55 0.55 0.55 0.55 0.55 0.55 0.55 0.55 0.55 0.55 0.55 TEMED 0.054 0.054 0.054 0.054 0.054 0.054 0.054 0.054 0.054 0.054 0.054 a To survey proteins ≥10 kDa, 5% to 20% gradient gels are recommended. To expand the range between 10 and 200 kDa, a 10% to 20% gradient gel is recommended. b Volumes are in milliliters (sucrose is in grams). Recipes produce ten 1.5-mm-thick gradient gels with 10 ml extra solution to account for losses in tubing. Keep light gel solution at room temperature prior to use (no longer than 1 hr). Keep heavy solution on ice. c See Table 6.1.1 for preparation. d Best to prepare fresh. Failure to form a firm gel usually indicates a problem with the ammonium persulfate, TEMED, or both. One-Dimensional SDS-PAGE 6.1.22 Supplement 37 Current Protocols in Cell Biology Figure 6.1.3 Setup for casting multiple gradient gels. Casting multiple gradient gels requires a peristaltic pump and a multiple gel caster. Gel solution is introduced through the bottom of the multiple caster. 2. Set up the peristaltic pump (Fig. 6.1.3). Using a graduated cylinder and water, adjust the flow rate so that the volume of the gradient solution plus volume of plug solution is poured in ∼15 to 18 min (∼25 ml/min). 3. Set up the gradient maker. Close all valves and place a stir-bar in the mixing chamber, which is the one with the outlet port. Attach one end of a piece of Tygon tubing to the outlet of the gradient maker. Run the other end of the tubing through the peristaltic pump and attach it to the red inlet port at the bottom of the caster. Choose a gradient maker that holds no more than four times the total volume of the gradient solution to be poured (i.e., a 1000- or 500-ml gradient maker). 4. Prepare solutions for the gradient maker (Table 6.1.11). Deaeration is not recommended for gradient gels. 5. Immediately after adding TEMED to the gel solutions, pour the light (lowconcentration) solution into the mixing chamber (the one with the port). Open the mixing valve slightly to allow the tunnel to fill and to avoid air bubbles. Close the valve again and pour the heavy (high-concentration) acrylamide solution into the reservoir chamber. 6. Start the magnetic stirrer and open the outlet valve; then start the pump and open the mixing valve. In units for casting multiple gels, acrylamide solution flows in from the bottom. To use a multiple casting unit, the light solution is placed in the mixing chamber and the heavy solution in the reservoir. This is the reverse of casting a single gel (see Alternate Protocol 5). Thus, light solution enters the multiple caster first, followed by progressively heavier solution. Finally, the acrylamide solution is stabilized in the multiple caster with a heavy plug solution and allowed to polymerize (see step 8 and manufacturer’s instructions). 7. When almost all the acrylamide solution is gone from the gradient maker, stop the pump and close the mixing valve. Tilt the gradient maker toward the outlet side and remove the last milliliters of the mix. Do not allow air bubbles to enter the tubing. 8. Add the plug solution to the mixing chamber and start the pump. Make sure that no bubbles are introduced. Continue pumping until the bottom of the caster is filled with plug solution to just below the glass plates; then turn off the pump. Clamp the tubing close to the red port of the casting chamber. Electrophoresis and Immunoblotting 6.1.23 Current Protocols in Cell Biology Supplement 37 9. Quickly overlay each separate gel sandwich with 100 µl H2 O-saturated isobutyl alcohol. Use the same amount on each sandwich. Allow the gels to polymerize for ∼1 hr. Failure to use the same amount of overlay solution will cause the gel sandwiches to polymerize at different heights. 10. Drain off the overlay and rinse the surface of the gels with 1× Tris·Cl/SDS, pH 8.8. Pour stacking gel and remove gels from caster 11. Prepare and cast the stacking gel as in casting multiple single-concentration gels (see Support Protocol 1, steps 8 to 11). 12. Remove gels from the caster and clean the gel sandwiches (see Support Protocol 1, steps 12 and 13). Store gels, if necessary, according to the instructions for multiple single-concentration gels (see Support Protocol 1, step 14). BASIC PROTOCOL 2 ELECTROPHORESIS IN SINGLE-CONCENTRATION MINIGELS Separation of proteins in a small-gel format is becoming increasingly popular for applications that range from isolating material for peptide sequencing to performing routine protein separations. The unique combination of speed and high resolution is the foremost advantage of small gels. Additionally, small gels are easily adapted to singleconcentration, gradient, and two-dimensional SDS-PAGE procedures. The minigel procedures described are adaptations of larger gel systems. This protocol describes the use of a multiple gel caster. The caster is simple to use, and up to five gels can be prepared at one time with this procedure. Single gels can be prepared using adaptations in the manufacturer’s instructions. A multiple gel caster is the only practical way to produce small linear polyacrylamide gradient gels (see Support Protocol 3). Materials Minigel vertical gel unit (Hoefer Mighty Small SE 250/280 or Bio-Rad Mini-Protean II) with glass plates, clamps, and buffer chambers 0.75-mm spacers Multiple gel caster (Hoefer SE-275/295 or Bio-Rad Mini-Protean II multicasting chamber) Acrylic plate (Hoefer SE-217 or Bio-Rad 165-1957) or polycarbonate separation sheet (Hoefer SE-213 or Bio-Rad 165-1958) 10- and 50-ml syringes Combs (Teflon, Hoefer SE-211A series or Bio-Rad Mini-Protean II) Long razor blade Micropipet Additional reagents and equipment for standard denaturing SDS-PAGE (see Basic Protocol 1) Pour the separating gel 1. Assemble each gel sandwich by stacking, in order, the notched (Hoefer) or small rectangular (Bio-Rad) plate, 0.75-mm spacers, and the larger rectangular plate. Be sure to align the spacers properly, with the ends flush with the top and bottom edge of the two plates, when positioning the sandwiches in the multiple gel caster (Fig. 6.1.4). One-Dimensional SDS-PAGE The protocol described is basically for the Hoefer system. For other systems, make adjustments according to the manufacturer’s instructions. Alternatively, precast minigels can be purchased from a number of suppliers (see Table 6.1.4). 6.1.24 Supplement 37 Current Protocols in Cell Biology Figure 6.1.4 Minigel sandwiches positioned in the multiple gel caster. Extra glass or acrylic plates or polycarbonate sheets are used to fill any free space in the caster and to ensure that the gel sandwiches are held firmly in place. The multiple casters from Hoefer have a notch in the base designed for casting gradient gels. A silicone rubber insert fills up this space when casting single-concentration gels. The Hoefer spacers are T-shaped to prevent slipping. The flanged edge of the spacer must be positioned against the outside edge of the glass plate. Placing a sheet of wax paper between the gel sandwiches will help separate the sandwiches after polymerization. 2. Fit the gel sandwiches tightly in the multiple gel caster. Use an acrylic plate or polycarbonate separation sheet to eliminate any slack in the chamber. Loosely fitting sandwiches in the caster will lead to unevenly cast gels, creating distortions during electrophoresis. 3. Place the front faceplate on the caster, clamp it in place against the silicone gasket, and verify alignment of the glass plates and spacers. 4. Prepare the separating gel solution as directed in Table 6.1.1. For five 0.75-mm-thick gels, prepare ∼30 ml solution (i.e., double the volumes listed). To compute the total gel volume needed, multiply the area of the gel (e.g., 7.3 × 8.3 cm) by the thickness of the gel (e.g., 0.75 mm) and then by the number of gels in the caster. If needed, add ∼4 to 5 ml of extra gel solution to account for the space around the outside of the gel sandwiches. Do not add TEMED and ammonium persulfate until just before use. 5. Fill a 50-ml syringe with the separating gel solution and slowly inject it into the caster until the gels are 6 cm high, allowing 1.5 cm for the stacking gel. 6. Overlay each gel with 100 µl H2 O-saturated isobutyl alcohol. Allow the gels to polymerize for ∼1 hr. Electrophoresis and Immunoblotting 6.1.25 Current Protocols in Cell Biology Supplement 37 Pour the stacking gel 7. Remove the isobutyl alcohol and rinse with 1× Tris·Cl/SDS, pH 8.8. Stacking gels can be cast one at a time with the gel mounted on the electrophoresis unit, or all at once in the multiple caster. 8. Practice placing a comb in the gel sandwiches before preparing the stacking gel solution. Press the comb against the rectangular or taller plate so that all teeth of the comb are aligned with the opening in the gel sandwich, then insert into the sandwich. Remove combs after practicing. 9. Prepare the stacking gel solution (2 ml per gel) as directed in Table 6.1.1. Fill a 10-ml syringe with stacking gel solution and inject the solution into each gel sandwich. 10. Insert combs, taking care not to trap bubbles. Allow the gels to polymerize 1 hr. 11. Remove the front faceplate. Carefully pull the gels out of the caster, using a long razor blade to separate the sandwiches. If the gels are left to polymerize for prolonged periods, they will be difficult to remove from the caster. The gels can be stored tightly wrapped in plastic wrap with the combs left in place inside a sealable bag to prevent drying for ∼1 week. Without the stacking gel, the separating gel can be stored for 2 to 3 weeks. Keep gels moist with 1× Tris·Cl/SDS, pH 8.8, at 4◦ C. Do not store gels in the multiple caster. Prepare the sample, load the gel, and conduct electrophoresis 12. Remove the combs and rinse the sample wells with 1× SDS electrophoresis buffer. Place a line indicating the bottom of each well on the front glass plate with a marker. 13. Fill the upper and lower buffer chambers with 1× SDS electrophoresis buffer. The upper chamber should be filled to 1 to 2 cm over the notched plate. 14. Prepare the protein sample and protein standards mixture (see Basic Protocol 1, step 12). 15. Load the sample using a micropipet. Insert the pipet tip through the upper buffer and into the well. The mark on the glass plate will act as a guide. Dispense the sample into the well. For a complex mixture, 20 to 25 µg protein in 10 µl SDS sample buffer will give a strongly stained Coomassie blue pattern. Much smaller amounts (1 to 5 µg) are required for highly purified proteins, and a 10- to 100-fold smaller amount of protein in the same volume (e.g., 10 µl) is required for silver staining. 16. Electrophorese samples at 10 to 15 mA per 0.75-mm gel until the dye front reaches the bottom of the gel (∼1 to 1.5 hr). 17. Disassemble the gel (see Basic Protocol 1, steps 23 to 26). Proceed with detection of proteins. SUPPORT PROTOCOL 3 One-Dimensional SDS-PAGE PREPARING MULTIPLE GRADIENT MINIGELS Polyacrylamide gradients not only enhance the resolution of larger-format gels but also greatly improve protein separation in the small format. Casting gradient minigels one at a time is not generally feasible because of the small volumes used, but multiple gel casters make it easy to cast several small gradient gels at one time. The gels are cast from the bottom in multiple casters, with the light acrylamide solution entering first. This is the opposite of casting one gel at a time, in which the heavy solution enters from the top of the gel sandwich and flows down to the bottom. 6.1.26 Supplement 37 Current Protocols in Cell Biology Additional Materials (also see Basic Protocol 2) Plug solution (see recipe) Additional reagents and equipment for preparing gradient gels (see Alternate Protocol 5) Set up the system and prepare the gel solutions 1. Assemble minigel sandwiches in the multiple gel caster as described for singleconcentration minigels (see Basic Protocol 2, steps 1 to 3). 2. Set up the 30-ml gradient maker, magnetic stirrer, peristaltic pump (optional), and Tygon tubing as in Figure 6.1.3. Connect the outlet of the 30-ml gradient maker to the inlet at the base of the front faceplate of the caster. The monomer solution will be introduced through the inlet at the bottom of the front faceplate of the caster first, followed by progressively heavier solution. 3. Prepare light and heavy acrylamide gel solutions (Table 6.1.10). Use ∼12 ml of each solution for five 0.75-mm-thick minigels. Adjust volumes if a different thickness or number of gels is needed. Do not add ammonium persulfate until just before use. Deaeration is not recommended for gradient gels. 4. With the outlet and interconnecting valve closed, add the heavy solution to the reservoir chamber. Briefly open the interconnecting valve to let a small amount of heavy solution through to the mixing chamber, clearing the valve of air. 5. Fill the mixing chamber with light solution. Add 4 µl TEMED per 12 ml acrylamide solution to each chamber and mix with a disposable pipet. Form the gradient and cast the gels 6. Turn on the magnetic stirrer. Open the interconnecting valve and allow the chambers to equilibrate. Then slowly open the outlet port to allow the solution to flow from the gradient maker to the multiple caster by gravity (a peristaltic pump may be used for better control). Adjust the flow rate to 3 to 4 ml/min. Faster flow rates are possible and will also produce good gradients. However, a fast flow increases the potential for introduction of bubbles into the caster. 7. Close the outlet port as the last of the gradient solution leaves the mixing chamber, just before air enters the outlet tube. Fill the two chambers with plug solution and slowly open the outlet once again. 8. Allow the plug solution to push the acrylamide in the caster up into the plates. Close the outlet when the plug solution reaches the bottom of the plates. A discontinuity between the bottom of the gels and the plug solution will be obvious. 9. Quickly add 100 µl H2 O-saturated isobutyl alcohol to each gel sandwich. Let the gels polymerize undisturbed for ∼1 hr. 10. Prepare and pour the stacking gel (see Basic Protocol 2, steps 9 and 10). Disassemble the system 11. Disconnect the gradient maker, place the caster in a sink, and remove the front faceplate. The plug solution will drain out from the bottom of the caster. 12. Remove the gels (see Basic Protocol 2, step 11). Gradient minigels can be stored as described for single-concentration minigels (see Basic Protocol 2, step 11 annotation). For instructions on preparing, loading, and running the gels, see Basic Protocol 2, steps 12 to 17. Electrophoresis and Immunoblotting 6.1.27 Current Protocols in Cell Biology Supplement 37 SUPPORT PROTOCOL 4 CALCULATING MOLECULAR MASS Determining the molecular mass of an unknown protein or nucleic acid fragment is straightforward given the use of calibration size standards in the same gel. Typically, a tracking dye such as bromphenol blue is added to the sample prior to loading on the gel (e.g., see recipe for SDS sample buffer). The tracking dye moves ahead of the proteins and serves as a relative mobility marker. A set of protein standards is separated in the same gel as the protein sample containing the unknown. The standards are used to create a standard curve of relative mobility versus size or molecular mass. Although digital image analysis has greatly simplified calculating the mass of an unknown protein separated by electrophoresis, manual assessments of molecular mass are useful and use the same basic calculations. 1. Calculate the relative mobility (Rf ) using following formula: Rf = distance migrated by protein/distance migrated by marker. Placing a molecular mass/Rf mobility acetate overlay calculator (Fig. 6.1.5) on the gel is a quick way to determine Rf . Simply align the top and bottom of the overlay with the top of the gel and the dye front, respectively, to get a read out of Rf . Figure 6.1.5 Example of an Rf calculator. This sheet is copied to transparency film using a paper copier and used as an overlay on the gel. When the transparency is placed on top of the gel, so that the top of the gel aligns with the top of the calculator and the dye front aligns with the bottom of the calculator, the Rf can be read directly off the overlay. Note that the calculator accommodates a range of gel lengths. The overlay should be copied at a 1:1 ratio so that the centimeter scale remains accurate. However, as long as the overlay can fit the top and bottom of the gel, the Rf numbers will be accurate. 6.1.28 Supplement 37 Current Protocols in Cell Biology 2. Plot log protein mass on the y axis versus relative mobility of the standards on the x axis (Fig. 6.1.6). 3. Perform linear regression using a calculator or analysis program. 4. Use the linear regression equation (y = mx + b) to estimate the mass of the unknown: Log molecular weight = (slope)(mobility of unknown) + y intercept. Figure 6.1.6 Standard protein molecular weight curves for (A) single concentration (5% and 12.5%) and (B) gradient (5% to 20%) gels. Protein standards are separated via SDS-PAGE, visualized by staining with Coomassie blue (UNIT 6.6), and measured relative to the dye front to give the relative mobility (Rf ). Note the single-concentration gel has a more limited range of linearity than the gradient gel. The standard curve permits the calculation of the molecular weight of an unknown by using the Rf of the unknown to predict the molecular weight. Electrophoresis and Immunoblotting 6.1.29 Current Protocols in Cell Biology Supplement 37 REAGENTS AND SOLUTIONS Use Milli-Q water in all recipes and protocol steps. For common stock solutions, see APPENDIX 2A; for suppliers, see SUPPLIERS APPENDIX. Anode buffer 121.1 g Tris base (0.2 M final) 500 ml H2 O Adjust to pH 8.9 with concentrated HCl Dilute to 5 liters with H2 O Store at 4◦ C up to 1 month Final concentration is 0.2 M Tris·Cl, pH 8.9. Cathode buffer 12.11 g Tris base (0.1 M final) 17.92 g tricine (0.1 M final) 1 g SDS [0.1% w/v final; recrystallization (see recipe) optional] Dilute to 1 liter with H2 O Do not adjust pH Store at 4◦ C up to 1 month Coomassie blue G-250 staining solution 200 ml acetic acid (20% v/v final) 1800 ml H2 O 0.5 g Coomassie blue G-250 (0.025% w/v final) Mix 1 hr and filter (Whatman no. 1 paper) Store at room temperature indefinitely Phosphate/SDS electrophoresis buffer Dilute 500 ml of 4× phosphate/SDS, pH 7.2 (Table 6.1.8) with H2 O to 2 liters. Store at 4◦ C up to 1 month. Final concentrations are 0.1 M sodium phosphate (pH 7.2)/0.1% (w/v) SDS. Phosphate/SDS sample buffer, 2× ( for continuous systems) 0.5 ml 4× phosphate/SDS, pH 7.2 (Table 6.1.8; 20 mM sodium phosphate final) 0.2 g SDS [2% w/v final; recrystallization (see recipe) optional] 0.1 mg bromphenol blue (0.001% w/v final) 0.31 g DTT (0.2 M final) 2.0 ml glycerol (20% v/v final) Add H2 O to 10 ml and mix Plug solution 0.125 M Tris·Cl, pH 8.8 (APPENDIX 2A) 50% (w/v) sucrose 0.001% (w/v) bromphenol blue Store at 4◦ C up to 1 month Recrystallized SDS (optional) High-purity SDS is available from several suppliers, but for some sensitive applications (e.g., protein sequencing) recrystallization is useful. Commercially available electrophoresis-grade SDS is usually of sufficient purity for most applications. One-Dimensional SDS-PAGE continued 6.1.30 Supplement 37 Current Protocols in Cell Biology Add 100 g SDS to 450 ml ethanol and heat to 55◦ C. While stirring, gradually add 50 to 75 ml hot H2 O until all SDS dissolves. Add 10 g activated charcoal (Norit 1, Sigma) to solution. After 10 min, filter solution through Whatman no. 5 paper on a Buchner funnel to remove charcoal. Chill filtrate 24 hr at 4◦ C and 24 hr at −20◦ C. Collect crystalline SDS on a coarse-frit (porosity A) sintered-glass funnel and wash with 800 ml −20◦ C ethanol (reagent grade). Repeat crystallization without adding activated charcoal. Dry recrystallized SDS under vacuum overnight at room temperature. Store in a desiccator over phosphorous pentoxide (P2 O5 ) in a dark bottle. If proteins will be electroeluted or electroblotted for protein sequence analysis, it may be desirable to crystallize the SDS twice from ethanol/H2 O (Hunkapiller et al., 1983). SDS electrophoresis buffer, 5× 15.1 g Tris base (0.125 M final) 72.0 g glycine (0.96 M final) 5.0 g SDS [0.5% w/v final; recrystallization (see recipe) optional] H2 O to 1000 ml Dilute to 1× or 2× for working solution, as appropriate Do not adjust the pH of the stock solution, as the solution is pH 8.3 when diluted. Store at 0◦ to 4◦ C until use (up to 1 month). SDS sample buffer, 2× ( for discontinuous systems) 25 ml 4× Tris·Cl/SDS, pH 6.8 (Table 6.1.1) 20 ml glycerol (20% final) 4 g SDS [4% w/v final; recrystallization (see recipe) optional] 2 ml 2-ME or 3.1 g DTT (0.2% v/v 2-ME or 0.2 M DTT final) 1 mg bromphenol blue (0.001% w/v final) Add H2 O to 100 ml and mix Store in 1-ml aliquots at −70◦ C To avoid reducing proteins to subunits (if desired), omit 2-ME or DTT (reducing agent) and add 10 mM iodoacetamide to prevent disulfide interchange. SDS sample buffer, 6× ( for discontinuous systems) 7 ml 4× Tris·Cl/SDS, pH 6.8 (Table 6.1.1) 3.0 ml glycerol (30% v/v final) 1 g SDS [10% w/v final; recrystallization (see recipe) optional] 0.93 g DTT (0.6 M final) 1.2 mg bromphenol blue (0.012% w/v final) Add H2 O to 10 ml (if needed) Store in 0.5-ml aliquots at −70◦ C Tricine sample buffer, 2× 2 ml 4× Tris·Cl/SDS, pH 6.8 (Table 6.1.1; 0.1 M) 2.4 ml (3.0 g) glycerol (24% v/v final) 0.8 g SDS [8% w/v final; recrystallization (see recipe) optional] 0.31 g DTT (0.2 M final) 2 mg Coomassie blue G-250 (0.02% w/v final) Add H2 O to 10 ml and mix Electrophoresis and Immunoblotting 6.1.31 Current Protocols in Cell Biology Supplement 37 COMMENTARY Background Information One-Dimensional SDS-PAGE Although electrophoresis has been studied for over two centuries, Arne Tiselius (University of Uppsala, Sweden) put the technique on the map with his Ph.D. thesis in 1930, which demonstrated moving zones of serum proteins in a special square-shaped, free-solution electrophoresis cell. His original work showed for the first time that protein components in serum could be separated, giving the now familiar designations for α, β, and γ globulin. Arne Tiselius was awarded the Nobel Prize in Chemistry in 1948 (http://nobelprize.org/ chemistry/laureates/1948/index.html) “. . . for his research on electrophoresis and adsorption analysis, especially for his discoveries concerning the complex nature of the serum proteins.” Electrophoresis is the movement of a charged particle, including large molecules such as DNA and proteins, in a liquid medium under the influence of an electric field. The driving force (QE) on the charged molecule is a product of the charge (Q) and the electric field (E) across the separation gel. Larger proteins move more slowly, as do proteins with a lower net charge. Furthermore, if a protein is in native (compact) form it will migrate more quickly than the same protein fully denatured and extended, where it experiences more frictional resistance with the surrounding medium. Resistance in electrophoresis is defined as f = 6π rvη, where f is the resistance of the medium to electrophoretic movement, r the radius of the protein (assumed to be a sphere), v the electrophoretic velocity, and η the viscosity of the fluid. The elements contributing to driving force and resistance together indicate that protein charge, size, shape, solution viscosity, and applied voltage are key factors influencing electrophoretic separation. Electrophoresis is used to separate complex mixtures of proteins (e.g., from cells, subcellular fractions, column fractions, or immunoprecipitates), investigate subunit compositions, and verify homogeneity of protein samples (Table 6.1.12). It can also serve to purify proteins for use in further applications. In polyacrylamide gel electrophoresis (PAGE), proteins migrate in response to an electrical field through pores in a gel matrix consisting of polymers of cross-linked acrylamide. The pore size is determined by acrylamide concentration. The combination of gel pore size and protein charge, size, and shape determines the migration rate of the protein. Polyacrylamide gels form after polymerization of monomeric acrylamide into polymeric polyacrylamide chains and cross-linking of the chains by N,N -methylenebisacrylamide (Fig. 6.1.7). The polymerization reaction is initiated by the addition of ammonium persulfate, and the reaction is accelerated by TEMED, which catalyzes the formation of free radicals from ammonium persulfate. Because oxygen inhibits the polymerization process, deaerating the gel solution before the polymerization catalysts are added will speed up polymerization; deaeration is not recommended for the gradient gel protocols because slower polymerization facilitates casting of gradient gels. Precast gels for commonly used vertical minigel and standard-sized SDS-PAGE apparatuses are available from several manufacturers (Table 6.1.4). Flatbed (horizontal) isoelectric focusing (IEF) and SDS-PAGE gels are not listed. Hoefer supplies a range of horizontal gels for a variety of applications and should be consulted for further information. When using precast gels, pay strict attention to shelf life. In general, manufacturers overrate the shelf life, and the sooner the gels are used, the better. When reasonably fresh, precast gels provide excellent resolution that is as good or better than a typical gel cast in the laboratory. The most widely used method for discontinuous gel electrophoresis is the system described by Laemmli (1970). This is the denaturing (SDS) discontinuous method used in Basic Protocol 1. A discontinuous buffer system uses buffers of different pH and composition to generate a discontinuous pH and voltage gradient in the gel. Because the discontinuous gel system concentrates the proteins in each sample into narrow bands, the applied sample may be more dilute than that used for continuous electrophoresis. In the discontinuous system the sample first passes through a stacking gel, which has large pores. The stacking gel buffer contains chloride ions (called the leading ions) whose electrophoretic mobility is greater than the mobility of the proteins in the sample. The electrophoresis buffer contains glycine ions (called the trailing ions) whose electrophoretic mobility is less than the mobility of the proteins in the sample. The net result is that the faster migrating ions leave a zone of lower conductivity between themselves and the migrating protein. The higher voltage gradient in this zone allows the proteins to move faster and to “stack” in the zone between the leading 6.1.32 Supplement 37 Current Protocols in Cell Biology Table 6.1.12 Key Applications of Protein Electrophoresisa For more information Technique Separation principle Application Native PAGE Native charge, size, and shape Purification, determination of native protein size, and identification of protein complexes UNIT 6.5 1-D SDS-PAGE Size dependent: SDS imparts a negative charge to proteins, giving a constant charge to mass ratio Size estimation, purity check, purification, subunit composition, protein expression UNIT 6.1 IEF Intrinsic charge with both native and denatured proteins Purification, purity check, isoenzyme analysis Ploegh (1995) 2-D SDS-PAGE Isoelectric point in the Protein expression, first dimension, size in purification, posttranslational the second analysis, proteomics UNIT 6.4 a Abbreviations: 1-D, one-dimensional; 2-D, two-dimensional; IEF, isoelectric focusing. Figure 6.1.7 Structures of acrylamide and bisacrylamide and the associated reaction producing the polyacrylamide matrix used for protein separation. and trailing ions. After leaving the stacking gel, the protein enters the separating gel. The separating gel has a smaller pore size, a higher salt concentration, and higher pH compared to the stacking gel. In the separating gel, the glycine ions migrate past the proteins, and the proteins are separated according to either molecular size in a denaturing gel (containing SDS) or molecular shape, size, and charge in a nondenaturing gel. Proteins are denatured by heating in the presence of a low-molecular-weight thiol Electrophoresis and Immunoblotting 6.1.33 Current Protocols in Cell Biology Supplement 37 Figure 6.1.8 Structures of sodium dodecyl sulfate, dithiothreitol, and 2-mercaptoethanol: used to break disulfide bonds in proteins so they are fully denatured. One-Dimensional SDS-PAGE (2-ME or DTT) and SDS (Fig. 6.1.8). Most proteins bind SDS in a constant-weight ratio, leading to identical charge densities for the denatured proteins. Thus, the SDS-protein complexes migrate in the polyacrylamide gel according to size, not charge. Most proteins are resolved on polyacrylamide gels containing from 5% to 15% acrylamide and 0.2% to 0.5% bisacrylamide (see Table 6.1.1). The relationship between the relative mobility and log molecular weight is linear over these ranges (Fig. 6.1.6). With the use of plots like those shown in Figure 6.1.6, the molecular weight of an unknown protein (or its subunits) may be determined by comparison with known protein standards (Table 6.1.2). In general, all of the procedures in this unit are suitable for radiolabeled and biotinylated proteins without modification. Basic Protocol 1 relies on denaturing proteins in the presence of SDS and 2-ME or DTT. Under these conditions, the subunits of proteins are dissociated and their biological activities are lost. A true estimate of a protein’s molecular size can be made by comparing the relative mobility of the unknown protein to proteins in a calibration mixture (Support Protocol 4). Gradient gels (Alternate Protocol 5) simplify molecular-weight determinations by producing a linear relationship between log molecular weight of the protein and log % T over a much wider size range than single-concentration gels. Although percent acrylamide monomer is a more common measure of gel concentration, % T, the percentage of total monomer (acrylamide plus bisacrylamide) in the solution or gel, is used for molecular weight calculations in gradient gels. The % T of a stained protein is estimated assuming the acrylamide gradient is linear. For example, proteins in the gel shown in Figure 6.1.9 were separated in a 5.1% to 20.5% T acrylamide gradient. The % T of the point halfway through the resolving gel is 12.5% T. Simply plotting log molecular mass versus distance moved into the gel (or Rf ) also produces a relatively linear standard curve over a fairly wide size range. If two proteins have identical molecular sizes, they more than likely will not be resolved with one-dimensional SDS-PAGE, and twodimensional SDS-PAGE should be considered. Unusual protein compositions can cause anomalous mobilities during electrophoresis (see Critical Parameters and Troubleshooting), but similar-sized proteins of widely different amino acid composition or structure may still be resolved from one another using one-dimensional SDS-PAGE. Purified protein complexes or multimeric proteins consisting of subunits of different molecular size will be resolved into constituent polypeptides. Comparison of the protein bands obtained under nonreducing and reducing conditions provides information about the molecular size of disulfide cross-linked component subunits. The individual polypeptides can be isolated by electroelution or electroblotting, and the amino acid sequences can be determined. Both the tricine (Schagger and von Jagow, 1987) and the modified Laemmli (Okajima et al., 1993) peptide separation procedures presented here (Alternate Protocols 1 and 2) are simple to set up and provide resolution down to 5 kDa. To separate peptides below 5 kDa, the tricine procedure must be modified by preparing a 16.5% T, 2.7% C resolving gel that uses a 10% T spacer gel between the stacking 6.1.34 Supplement 37 Current Protocols in Cell Biology Figure 6.1.9 Separation of membrane proteins by 5.1% to 20.5% T polyacrylamide gradient SDS-PAGE. Approximately 30 µl of 1× SDS sample buffer containing 30 µg of Alaskan pea (Pisum sativum) membrane proteins was loaded in wells of a 14 × 14–cm, 0.75-mm-thick gel. Standard proteins were included in the outside lanes. The gel was run at 4 mA for ≈15 hr. and resolving gel (Schagger and von Jagow, 1987). The % C is the percentage of crosslinker (bisacrylamide) in the total monomer (acrylamide plus bisacrylamide). Continuous electrophoresis, where the same buffer is used throughout the tank and gel, is popular because of its versatility and simplicity. The phosphate system described in Alternate Protocol 3 is based on that of Weber et al. (1972). Although unable to produce the high-resolution separations of the discontinuous SDS-PAGE procedures, continuous SDS-PAGE uses fewer solutions with one basic buffer and no stacking gel. Artifacts are also less likely to occur in continuous systems. Pepsin, for example, migrates anomalously on Laemmli-based discontinuous SDS-PAGE but has the expected mobility after electrophoresis in the phosphate-based continuous system described here. This is also true of cross-linked proteins. Multiple gel casting (Support Protocols 1 to 3) is appropriate when gel-to-gel consistency is paramount or when the number of gels processed exceeds five a week. The variety of multiple gel casters, gradient makers, and inexpensive pumps available from major suppliers simplifies the process of casting gels in the laboratory. Alternatively, precast gradient gels are available for most major brands of gel apparatuses (Table 6.1.4). Minigels (Basic Protocol 2) are generally considered to be in the 8 × 10–cm size range, although there is considerable variation in exact size. Every technique that is used on larger systems can be translated with little difficulty into the minigel format. This includes standard and gradient SDS-PAGE and separations for immunoblotting and peptide sequencing. Two-dimensional SDS-PAGE electrophoresis also adapts well, but here the limitation of separation area becomes apparent; for highresolution separations, large-format gels are required. Gradient minigels (Support Protocol 3) are popular due to the combination of separation range and resolution (Matsudaira and Burgess, 1978). They are particularly useful for separation of proteins prior to peptide sequencing. Mylar support (GelBond) provides a practical way of casting, running, and, staining extremely thin gels. When gels <0.75 mm thick are used, reagents have much better access both into and out of the gel, reducing staining time in both Coomassie blue and silver staining. Double and broadened images caused by differential migration of the protein across the thickness of the gel are minimized, improving resolution. Critical Parameters and Troubleshooting If an electrophoretically separated protein will be electroeluted or electroblotted for sequence analysis, the highest-purity reagents available should be used. If necessary, SDS Electrophoresis and Immunoblotting 6.1.35 Current Protocols in Cell Biology Supplement 37 One-Dimensional SDS-PAGE can be purified by recrystallization following the procedure given in Reagents and Solutions. If the gels polymerize too fast, the amount of ammonium persulfate should be reduced by one-third to one-half. If the gels polymerize too slowly or fail to polymerize all the way to the top, use fresh ammonium persulfate or increase the amount of ammonium persulfate by one-third to one-half. The overlay should be added slowly down the spacer edge to prevent the overlay solution from crashing down and disturbing the gel interface. After a separating gel is poured, it may be stored with an overlay of the same buffer used in the gel. Immediately prior to use, the stacking gel should be poured; otherwise, there will be a gradual diffusion-driven mixing of buffers between the two gels, which will cause a loss of resolution. The protein of interest should be present in 0.2- to 1-µg amounts in a complex mixture of proteins if the gel will be stained by Coomassie blue (UNIT 6.6). Typically, 30 to 50 µg of a complex protein mixture in a total volume of <20 µl is loaded on a 0.75-mm-thick slab gel (16 cm, 10 wells). When casting multiple gradient gels, eliminate all bubbles in the outlet tubing of the gradient maker. If air bubbles get into the outlet tube, they may flow into the caster and then up through the gradient being poured, causing an area of distortion in the polymerized gel. Air bubbles are not so great a problem when casting single gradient gels from the top. As the gels are cast, the stirrer must be slowed so that the vortex in the mixing chamber does not allow air to enter the outlet. Uneven heating of the gel causes differential migration of proteins, with the outer lanes moving more slowly than the center lanes (called smiling). Increased heat transfer eliminates smiling and can be achieved by filling the lower buffer chamber with buffer all the way to the level of the sample wells, by maintaining a constant temperature between 10◦ to 20◦ C, and by stirring the lower buffer with a magnetic stirrer. Alternatively, decrease the heat load by running at a lower current. If the tracking dye band is diffuse, prepare fresh buffer and acrylamide monomer stocks. If the protein bands are diffuse, increase the current by 25% to 50% to complete the run more quickly and minimize band diffusion, use a higher percentage of acrylamide, or try a gradient gel. Lengthy separations using gradient gels generally produce good results (Fig. 6.1.9). Check for possible proteolytic degradation that may cause loss of highmolecular-weight bands and create a smeared banding pattern. If there is vertical streaking of protein bands, decrease the amount of sample loaded on the gel, further purify the protein of interest to reduce the amount of contaminating protein applied to the gel, or reduce the current by 25%. Another cause of vertical streaking of protein bands is precipitation, which can sometimes be eliminated by centrifuging the sample or by reducing the percentage of acrylamide in the gel. Proteins can migrate faster or slower than their actual molecular weight would indicate. Abnormal migration is usually associated with a high proportion of basic or charged amino acids (Takano et al., 1988). Other problems can occur during isolation and preparation of the protein sample for electrophoresis. Proteolysis of proteins during cell fractionation by endogenous proteases can cause subtle band splitting and smearing in the resulting electrophoretogram (electrophoresis pattern). Many endogenous proteases are very active in SDS sample buffers and will rapidly degrade the sample; thus, first heating the samples to 70◦ to 100◦ C for 3 min is recommended. In some cases, heating to 100◦ C in sample buffer will cause selective aggregation of proteins, creating a smeared layer of Coomassie blue–stained material at the top of the gel (Gallagher and Leonard, 1987). To avoid heating artifacts and also prevent proteolysis, the use of specific protease inhibitors during protein isolation and/or lower heating temperatures (70◦ to 80◦ C) have been effective (Dhugga et al., 1988). Although continuous gels suffer from poor band sharpness, they are less prone to artifacts caused by aggregation and protein crosslinking. If streaking or aggregation appear to be a problem with the Laemmli system, then the same sample should be subjected to continuous SDS-PAGE to see if the problem is intrinsic to the Laemmli gel or the sample. If the protein bands spread laterally from gel lanes, the time between applying the sample and running the gel should be reduced in order to decrease the diffusion of sample out of the wells. Alternatively, the acrylamide percentage should be increased in the stacking gels from 4% to 4.5% or 5% acrylamide, or the operating current should be increased by 25% to decrease diffusion in the stacking gel. Use caution when adding 1× SDS electrophoresis buffer to the upper buffer chamber. Samples 6.1.36 Supplement 37 Current Protocols in Cell Biology can get swept into adjacent wells and onto the top of the well arm. If the protein bands are uneven, the stacking gel may not have been adequately polymerized. This can be corrected by deaerating the stacking gel solution thoroughly or by increasing the ammonium persulfate and TEMED concentrations by one-third to onehalf. Another cause of distorted bands is salt in the protein sample, which can be removed by dialysis, gel filtration, or precipitation. Skewed protein bands can be caused by an uneven interface between the stacking and separating gels, which can be corrected by starting over and being careful not to disturb the separating gel while overlaying with isobutyl alcohol. If a run takes too long, the buffers may be too concentrated or the operating current too low. If the run is too short, the buffers may be too dilute or the operating current too high. If double bands are observed, the protein may be partially oxidized or partially degraded. Oxidation can be minimized by increasing the 2-ME concentration in the sample buffer or by preparing a fresh protein sample. If fewer bands than expected are observed and there is a heavy protein band at the dye front, increase the acrylamide percentage in the gel. Anticipated Results Polyacrylamide gel electrophoresis done under denaturing and reducing conditions should resolve any two proteins, except two of identical size. Resolution of proteins in the presence of SDS is a function of gel concentration and the size of the proteins being separated. Under nondenaturing conditions, the biological activity of a protein will be maintained. Comparison of reducing and nonreducing denaturing gels can also provide valuable information about the number of disulfide crosslinked subunits in a protein complex. If the subunits are held together by disulfide linkages, the protein will separate in denaturing gels as a complex or as smaller-sized subunits under nonreducing or reducing conditions, respectively. However, proteins separated on nonreducing denaturing gels appear more diffuse and exhibit less overall resolution than those separated on reducing gels. Gradient gels provide superior proteinband sharpness and resolve a larger size range of proteins, making them ideal for most types of experiments in spite of being more difficult to prepare. Molecular-weight calculations are simplified because of the extended linear relationship between size and protein position in the gel. Increased band sharpness of both high- and low-molecular-weight proteins on the same gel greatly simplifies survey experiments, such as gene expression studies where the characteristics of the responsive protein are not known. Furthermore, the increased resolution dramatically improves autoradiographic analysis. Preparation of gradient gels is straightforward, although practice with gradient solutions containing dye is recommended. The gradient gels can be stored for several days at 0◦ to 4◦ C before casting the stacking gel. Time Considerations Preparation of separating and stacking gels requires 2 to 3 hr. Gradient gels generally take 5 min to cast singly. Casting multiple single-concentration gels requires an additional 10 min for assembly. Casting multiple gradient gels takes 15 to 20 min plus assembly time. It takes 4 to 5 hr to run a 14 × 14–cm, 0.75-mm gel at 15 mA (70 to 150 V), and 3 to 4 hr to run a 0.75-mm gel at 20 mA (80 to 200 V). Overnight separations of ∼12 hr require 4 mA per 0.75-mm gel. It takes 4 to 5 hr to run a 1.5-mm gel at 30 mA. Electrophoresis is normally performed at 15◦ to 20◦ C, with the temperature held constant using a circulating water bath. For air-cooled electrophoresis units, lower currents and thus longer run times are recommended. It takes ∼1 hr to run a 0.75-mm minigel at 20 mA (100 to 120 V). Separation times are not significantly different for gradient minigels. Literature Cited Dhugga, K.S., Waines, J.G., and Leonard, R.T. 1988. Correlated induction of nitrate uptake and membrane polypeptides in corn roots. Plant Physiol. 87:120-125. Gallagher, S.R. and Leonard, R.T. 1987. Electrophoretic characterization of a detergenttreated plasma membrane fraction from corn roots. Plant Physiol. 83:265-271. Hunkapiller, M.W., Lujan, E., Ostrander, F., and Hood, L.E. 1983. Isolation of microgram quantities of proteins from polyacrylamide gels for amino acid sequence analysis. Methods Enzymol. 91:227-236. Laemmli, U.K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227:680-685. Matsudaira, P.T. and Burgess, D.R. 1978. SDS microslab linear gradient polyacrylamide gel electrophoresis. Anal. Biochem. 87:386-396. Okajima, T., Tanabe, T., and Yasuda, T. 1993. Nonurea sodium dodecyl sulfatepolyacrylamide gel electrophoresis with Electrophoresis and Immunoblotting 6.1.37 Current Protocols in Cell Biology Supplement 37 high-molarity buffers for the separation of proteins and peptides. Anal. Biochem. 211:293300. Ploegh, H.L. 1995. One-Dimensional Isoelectric Focusing of Proteins in Slab Gels. In Current Protocols in Protein Science (J.E. Coligan, B.M. Dunn, D.W. Speicher, and P.T. Wingfield, eds.) pp. 10.2.1-10.2.8. John Wiley & Sons, Hoboken, N.J. Schagger, H. and von Jagow, G. 1987. Tricinesodium dodecyl sulfate-polyacrylamide gel electrophoresis for the separation of proteins in the range from 1 to 100 kDa. Anal. Biochem. 166:368-379. Takano, E., Maki, M., Mori, H., Hatanaka, N., Marti, T., Titani, K., Kannagi, R., Ooi, T., and Murachi, T. 1988. Pig heart calpastatin: Identification of repetitive domain structures and anomalous behavior in polyacrylamide gel electrophoresis. Biochemistry 27:1964-1972. Weber, K., Pringle, J.R., and Osborn, M. 1972. Measurement of molecular weights by electrophoresis on SDS-acrylamide gel. Methods Enzymol. 26:3-27. Key Reference Hames, B.D. and Rickwood, D. (eds.) 1990. Gel Electrophoresis of Proteins: A Practical Approach, 2nd ed. Oxford University Press, New York. An excellent book describing gel electrophoresis of proteins. One-Dimensional SDS-PAGE 6.1.38 Supplement 37 Current Protocols in Cell Biology ,PPXQREORWWLQJDQG,PPXQRGHWHFWLRQ 81,7 ,PPXQREORWWLQJRIWHQUHIHUUHGWRDVZHVWHUQEORWWLQJLVXVHGWRLGHQWLI\VSHFLILFDQWLJHQV UHFRJQL]HG E\ SRO\FORQDO RU PRQRFORQDO DQWLERGLHV 3URWHLQ VDPSOHV DUH VROXELOL]HG XVXDOO\ZLWKVRGLXPGRGHF\OVXOIDWH6'6DQGUHGXFLQJDJHQWVVXFKDVGLWKLRWKUHLWRO '77RUPHUFDSWRHWKDQRO0()ROORZLQJVROXELOL]DWLRQWKHPDWHULDOLVVHSDUDWHG E\6'63$*(81,77KHDQWLJHQVDUHWKHQHOHFWURSKRUHWLFDOO\WUDQVIHUUHGLQDWDQN VHH%DVLF3URWRFRORUDVHPLGU\WUDQVIHUDSSDUDWXVVHH$OWHUQDWH3URWRFROWRD QLWURFHOOXORVH39')RUQ\ORQPHPEUDQHDSURFHVVWKDWFDQEHPRQLWRUHGE\UHYHUVLEOH VWDLQLQJ VHH 6XSSRUW 3URWRFRO RU E\ 3RQFHDX 6 VWDLQLQJ VHH 6XSSRUW 3URWRFRO 3UHYLRXVO\VWDLQHGJHOVPD\DOVREHEORWWHGVHH$OWHUQDWH3URWRFRO 7KHWUDQVIHUUHGSURWHLQVDUHERXQGWRWKHVXUIDFHRIWKHPHPEUDQHSURYLGLQJDFFHVVIRU UHDFWLRQ ZLWK LPPXQRGHWHFWLRQ UHDJHQWV $OO UHPDLQLQJ ELQGLQJ VLWHV DUH EORFNHG E\ LPPHUVLQJWKHPHPEUDQHLQDVROXWLRQFRQWDLQLQJHLWKHUDSURWHLQRUGHWHUJHQWEORFNLQJ DJHQW $IWHU SURELQJ ZLWK WKH SULPDU\ DQWLERG\ WKH PHPEUDQH LV ZDVKHG DQG WKH DQWLERG\DQWLJHQFRPSOH[HVDUHLGHQWLILHGZLWKKRUVHUDGLVKSHUR[LGDVH+532RUDONDOLQH SKRVSKDWDVHHQ]\PHVFRXSOHGWRWKHVHFRQGDU\DQWL,J*DQWLERG\HJJRDWDQWL¤UDEELW ,J*7KHHQ]\PHVDUHDWWDFKHGGLUHFWO\VHH%DVLF3URWRFRORUYLDDQDYLGLQELRWLQ EULGJHVHH$OWHUQDWH3URWRFROWRWKHVHFRQGDU\DQWLERG\&KURPRJHQLFRUOXPLQHVFHQW VXEVWUDWHVVHH%DVLF3URWRFRODQG$OWHUQDWH3URWRFRODUHWKHQXVHGWRYLVXDOL]HWKH DFWLYLW\)LQDOO\PHPEUDQHVPD\EHVWULSSHGDQGUHSUREHGVHH6XSSRUW3URWRFRO 127(:KHQKDQGOLQJJHOVDQGPHPEUDQHVZHDUSRZGHUIUHHJORYHV 3527(,1%/277,1*:,7+7$1.75$16)(56<67(06 ,Q WKLV SURFHGXUH EORWWLQJ LV SHUIRUPHG LQ D WDQN RI EXIIHU ZLWK WKH JHO LQ D YHUWLFDO RULHQWDWLRQFRPSOHWHO\VXEPHUJHGEHWZHHQWZRODUJHHOHFWURGHSDQHOV,QVRPHV\VWHPV XSWRIRXUJHOVFDQEHWUDQVIHUUHGDWRQHWLPH)RUGLIILFXOWWRWUDQVIHUSURWHLQV!N'D RUK\GURSKRELFHJP\RVLQWDQNEORWWLQJLVSUHIHUDEOHWRVHPLGU\V\VWHPVVHH%DVLF 3URWRFROEHFDXVHSURORQJHGWUDQVIHUVDUHSRVVLEOHZLWKRXWEXIIHUGHSOHWLRQ+RZHYHU WUDQVIHUV!KUDWKLJKSRZHUUHTXLUHFRROLQJXVLQJDKHDWH[FKDQJHUDQGDFLUFXODWLQJ ZDWHUEDWKWKDWFDQPDLQWDLQDFRQVWDQWWUDQVIHUWHPSHUDWXUHRI°WR°& %$6,& 35272&2/ 0DWHULDOV 6DPSOHVIRUDQDO\VLV 3URWHLQPROHFXODUZHLJKWVWDQGDUGV81,7SUHVWDLQHG6LJPDRU %LR5DGRUELRWLQ\ODWHG9HFWRU/DEVRU6LJPD 7UDQVIHUEXIIHUVHHUHFLSH 3RZGHUIUHHJORYHV 6FRWFK%ULWHSDGV0RUHTXLYDOHQWVSRQJH :KDWPDQ00ILOWHUSDSHURUHTXLYDOHQW 7UDQVIHUPHPEUDQHµPQLWURFHOOXORVH0LOOLSRUHRU6FKOHLFKHU6FKXHOO 39')0LOOLSRUH,PPRELORQ3QHXWUDOQ\ORQ3DOO%LRG\QH$RUSRVLWLYHO\ FKDUJHGQ\ORQ3DOO%LRG\QH%%LR5DG=HWDELQGPHPEUDQH (OHFWUREORWWLQJDSSDUDWXV(&$SSDUDWXV%LR5DGRU$PHUVKDP3KDUPDFLD %LRWHFK ,QGHOLEOHSHQHJ3DSHU0DWHEDOOSRLQWRUVRIWOHDGSHQFLO $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUJHOHOHFWURSKRUHVLV81,7DQGVWDLQLQJ SURWHLQVLQJHOVDQGRQPHPEUDQHVVHH6XSSRUW3URWRFRO 127('HLRQL]HGGLVWLOOHGZDWHUVKRXOGEHXVHGWKURXJKRXWWKLVSURWRFRO (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &RQWULEXWHGE\6HDQ*DOODJKHU6FRWW(:LQVWRQ6WHYHQ$)XOOHUDQG-RKQ*5+XUUHOO &XUUHQW3URWRFROVLQ&HOO%LRORJ\ &RS\ULJKWE\-RKQ:LOH\6RQV,QF (OHFWURSKRUHVHWKHSURWHLQVDPSOH 3UHSDUHDQWLJHQLFVDPSOHVDQGVHSDUDWHSURWHLQVXVLQJVPDOORUVWDQGDUGVL]HGRQH RUWZRGLPHQVLRQDOJHOV81,7,QFOXGHSUHVWDLQHGRUELRWLQ\ODWHGSURWHLQPROHFX ODUZHLJKWVWDQGDUGVLQRQHRUPRUHJHOODQHV 7KHSURWHLQPDUNHUVZLOOWUDQVIHUWRWKHPHPEUDQHDQGFRQYHQLHQWO\LQGLFDWHPHPEUDQH RULHQWDWLRQDQGVL]HVRISURWHLQVDIWHULPPXQRVWDLQLQJ $YDULHW\RIJHOVL]HVDQGSHUFHQWDJHVRIDFU\ODPLGHFDQEHXVHG81,70RVWURXWLQHO\ XVHGDUHHLWKHUFP×FPפPPJHOVRUFP×FPפPPPLQLJHOV $FU\ODPLGHFRQFHQWUDWLRQVYDU\IURPWREXWDUHXVXDOO\LQWKHWRUDQJH $VVHPEOHWKHLPPXQREORWVDQGZLFK :KHQHOHFWURSKRUHVLVLVFRPSOHWHGLVDVVHPEOHJHOVDQGZLFKDQGUHPRYHVWDFNLQJ JHO(TXLOLEUDWHJHOPLQDWURRPWHPSHUDWXUHLQWUDQVIHUEXIIHU 2LOIURPKDQGVEORFNVWKHWUDQVIHU 0DWFKWKHDSSURSULDWHWUDQVIHUEXIIHUWRWKHPHPEUDQHVHH5HDJHQWVDQG6ROXWLRQV *HOHTXLOLEUDWLRQLVUHTXLUHGWRSUHYHQWDFKDQJHLQWKHVL]HRIWKHJHOGXULQJWUDQVIHU$Q\ VKLIWLQJHOGLPHQVLRQZLOOUHVXOWLQDEOXUUHGWUDQVIHUSDWWHUQ $VVHPEOHWUDQVIHUVDQGZLFKLQDWUD\ODUJHHQRXJKWRKROGWKHSODVWLFWUDQVIHUFDVVHWWH )LOOZLWKWUDQVIHUEXIIHUVRWKDWFDVVHWWHLVFRYHUHG 7KHWUDQVIHUFDVVHWWHVKRXOGEHDVVHPEOHGXQGHUEXIIHUWRPLQLPL]HWUDSSLQJRIDLUEXEEOHV 8VH)LJXUHDVDJXLGHWRDVVHPEO\ 2QERWWRPKDOIRISODVWLFWUDQVIHUFDVVHWWHSODFH6FRWFK%ULWHSDGRUVSRQJHIROORZHG E\DVKHHWRIILOWHUSDSHUFXWWRVDPHVL]HDVJHODQGSUHZHWZLWKWUDQVIHUEXIIHU pad cathode anode + + plastic support filter paper gel nitrocellulose electroblotting buffer direction of protein transfer ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ )LJXUH ,PPXQREORWWLQJ ZLWK D WDQN EORWWLQJ XQLW 7KH SRO\DFU\ODPLGH JHO FRQWDLQLQJ WKH SURWHLQLVODLGRQDVKHHWRIILOWHUSDSHU7KHXQFRYHUHGVLGHRIWKHJHOLVRYHUODLGZLWKDVKHHWRI PHPEUDQHSUHFXWWRWKHVL]HRIWKHJHOSOXVWRPPRQHDFKHGJHWKHQWKLVPHPEUDQHLVRYHUODLG ZLWKDQRWKHUVKHHWRIILOWHUSDSHU7KHILOWHUSDSHUFRQWDLQLQJWKHJHODQGPHPEUDQHLVVDQGZLFKHG EHWZHHQ6FRWFK%ULWHSDGV7KLVVDQGZLFKLVSODFHGLQDSODVWLFVXSSRUWDQGWKHHQWLUHDVVHPEO\ LV SODFHG LQ D WDQN FRQWDLQLQJ WUDQVIHU EXIIHU )RU WUDQVIHU RI QHJDWLYHO\ FKDUJHG SURWHLQ WKH PHPEUDQHLVSRVLWLRQHGRQWKHDQRGHVLGHRIWKHJHO)RUWUDQVIHURISRVLWLYHO\FKDUJHGSURWHLQWKH PHPEUDQHLVSODFHGRQWKHFDWKRGHVLGHRIWKHJHO&KDUJHGSURWHLQVDUHWUDQVIHUUHGHOHFWURSKRUHWL FDOO\IURPWKHJHORQWRWKHPHPEUDQH7UDQVIHULVDFKLHYHGE\DSSO\LQJDYROWDJHRI9IRUWR KUZLWKFRROLQJRU9RYHUQLJKW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 3ODFHJHORQWRSRIILOWHUSDSHU7KHVLGHRIWKHJHOWRXFKLQJWKHSDSHUDUELWUDULO\ EHFRPHVWKHFDWKRGHVLGHRIWKHJHOLHXOWLPDWHO\WRZDUGWKHQHJDWLYHHOHFWURGH ZKHQSRVLWLRQHGLQWKHWDQN5HPRYHDQ\DLUEXEEOHVEHWZHHQJHODQGILOWHUSDSHU E\JHQWO\UROOLQJDWHVWWXEHRUJODVVURGRYHUVXUIDFHRIJHO $Q\EXEEOHVEHWZHHQWKHILOWHUSDSHUJHODQGPHPEUDQHZLOOEORFNFXUUHQWIORZDQGSUHYHQW SURWHLQWUDQVIHU7KLVSUREOHPLVLQGLFDWHGRQWKHPHPEUDQHE\VKDUSO\GHILQHGZKLWHDUHDV GHYRLGRIWUDQVIHUUHGSURWHLQ 3URWHLQVDUHXVXDOO\QHJDWLYHO\FKDUJHGLQWUDQVIHUEXIIHUDQGPRYHWRZDUGWKHSRVLWLYH DQRGH+RZHYHUVRPHSURWHLQVPD\EHSRVLWLYHO\FKDUJHG$QDGGLWLRQDOPHPEUDQHSODFHG RQWKHFDWKRGHVLGHRIWKHJHOZLOOELQGWKHVHSURWHLQV 3UHSDUHWUDQVIHUPHPEUDQH&XWPHPEUDQHWRVDPHVL]HDVJHOSOXVWRPPRQ HDFKHGJH3ODFHLQWRGLVWLOOHGZDWHUVORZO\ZLWKRQHHGJHDWD°DQJOH(TXLOLEUDWH WRPLQLQWUDQVIHUEXIIHU 7KHZDWHUZLOOZLFNXSLQWRWKHPHPEUDQHZHWWLQJWKHHQWLUHVXUIDFH,ILWLVLQVHUWHGWRR TXLFNO\LQWRWKHZDWHUDLUJHWVWUDSSHGDQGZLOODSSHDUDVZKLWHEORWFKHVLQWKHPHPEUDQH 3URWHLQZLOOQRWWUDQVIHURQWRWKHVHDUHDV 7KLVZHWWLQJSURFHGXUHZRUNVIRUQLWURFHOOXORVHDQGQ\ORQPHPEUDQHVRQO\39')PHP EUDQHVDUHK\GURSKRELFDQGZLOOQRWZHWVLPSO\IURPEHLQJSODFHGLQWRGLVWLOOHGZDWHURU WUDQVIHUEXIIHU)RUWKHVHPHPEUDQHVILUVWLPPHUVHWRVHFLQPHWKDQROWKHQ HTXLOLEUDWHWRPLQZLWKWUDQVIHUEXIIHU'RQRWOHWPHPEUDQHGU\RXWDWDQ\WLPH,I WKLVRFFXUVZHWRQFHDJDLQZLWKPHWKDQRODQGWUDQVIHUEXIIHUDVGHVFULEHGDERYH 0RLVWHQVXUIDFHRIJHOZLWKWUDQVIHUEXIIHU3ODFHSUHZHWWHGPHPEUDQHGLUHFWO\RQ WRSVLGHRIJHOLHDQRGHVLGHDQGUHPRYHDOODLUEXEEOHVDVLQVWHS 3RRUFRQWDFWEHWZHHQWKHJHODQGPHPEUDQHZLOOFDXVHDVZLUOHGSDWWHUQRIWUDQVIHUUHG SURWHLQVRQWKHPHPEUDQH6RPHSURWHLQVZLOOWUDQVIHUDVVRRQDVWKHJHOLVSODFHGRQWKH PHPEUDQHUHSRVLWLRQLQJWKHJHORUPHPEUDQHFDQUHVXOWLQDVPHDUHGRUGRXEOHLPDJHRQ WKHGHYHORSHGEORW 7KHXVHRIµPPHPEUDQHVPD\LPSURYHUHWHQWLRQRIVPDOOHUPROHFXODUZHLJKWSUR WHLQV :HWDQRWKHUSLHFHRI:KDWPDQ00ILOWHUSDSHUSODFHRQDQRGHVLGHRIPHPEUDQH DQGUHPRYHDOODLUEXEEOHV3ODFHDQRWKHU6FRWFK%ULWHSDGRUVSRQJHRQWRSRIWKLV ILOWHUSDSHU &RPSOHWHDVVHPEO\E\ORFNLQJWRSKDOIRIWKHWUDQVIHUFDVVHWWHLQWRSODFH)LJ ,WLVLPSRUWDQWWRRULHQWWKHVDQGZLFKVRWKDWWKHPHPEUDQHIDFHVWKHDQRGHSRVLWLYHO\ FKDUJHGVLGHRIWKHWDQN 7UDQVIHUSURWHLQVIURPJHOWRPHPEUDQH )LOOWDQNZLWKWUDQVIHUEXIIHUDQGSODFHWUDQVIHUFDVVHWWHFRQWDLQLQJVDQGZLFKLQWR HOHFWUREORWWLQJDSSDUDWXVLQFRUUHFWRULHQWDWLRQ&RQQHFWOHDGVRISRZHUVXSSO\WR FRUUHVSRQGLQJDQRGHDQGFDWKRGHVLGHVRIHOHFWUREORWWLQJDSSDUDWXV 7UDQVIHU EXIIHU VKRXOG FRYHU WKH HOHFWURGH SDQHOV EXW VKRXOG QRW WRXFK WKH EDVH RI WKH EDQDQDSOXJ (OHFWURSKRUHWLFDOO\WUDQVIHUSURWHLQVIURPJHOWRPHPEUDQHIRUPLQWRKUDW 9ZLWKFRROLQJRURYHUQLJKWDW9FRQVWDQWYROWDJHLQDFROGURRP 7UDQVIHUWLPHLVGHSHQGHQWRQWKHWKLFNQHVVDQGWKHSHUFHQWDFU\ODPLGHRIWKHJHODVZHOO DVWKHVL]HRIWKHSURWHLQEHLQJWUDQVIHUUHG,QJHQHUDOSURWHLQVDUHWUDQVIHUUHGZLWKLQWR KU EXW KLJKPROHFXODUZHLJKW PROHFXOHV PD\ WDNH ORQJHU 2YHUQLJKW WUDQVIHU DW ORZ YROWDJHLVUHOLDEOHDQGFRQYHQLHQW&RROLQJDW°WR°&LVUHTXLUHGIRUWUDQVIHUV!KU DWKLJKSRZHU+HDWH[FKDQJHUFRROLQJFRUHVXVLQJDFLUFXODWLQJZDWHUEDWKDUHSODFHGLQWR WKHWUDQVIHUXQLWIRUFRROLQJ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7XUQRIIWKHSRZHUVXSSO\DQGGLVDVVHPEOHWKHDSSDUDWXV5HPRYHPHPEUDQHIURP EORWWLQJDSSDUDWXVDQGQRWHRULHQWDWLRQE\FXWWLQJDFRUQHURUPDUNLQJZLWKDVRIWOHDG SHQFLORU3DSHU0DWHEDOOSRLQWSHQ 0DQ\EDOOSRLQWLQNVFRPHRIIEXW3DSHU0DWHVWD\VRQWKHPHPEUDQH 0HPEUDQHVFDQEHGULHGDQGVWRUHGLQUHVHDODEOHSODVWLFEDJVDW°&IRU\HDURUORQJHU DWWKLVSRLQW3ULRUWRIXUWKHUSURFHVVLQJGULHG39')PHPEUDQHVPXVWEHSODFHGLQWRD VPDOODPRXQWRIPHWKDQROWRZHWWKHPHPEUDQHWKHQLQGLVWLOOHGZDWHUWRUHPRYH WKHPHWKDQRO 6WDLQJHOIRUWRWDOSURWHLQZLWK&RRPDVVLHEOXHWRYHULI\WUDQVIHUHIILFLHQF\,IGHVLUHG VWDLQPHPEUDQHUHYHUVLEO\WRYLVXDOL]HWUDQVIHUUHGSURWHLQVVHH6XSSRUW3URWRFRO RULUUHYHUVLEO\ZLWK&RRPDVVLHEOXH,QGLDLQNQDSKWKROEOXHRUFROORLGDOJROG 7KHVHVWDLQLQJSURFHGXUHVDUHLQFRPSDWLEOHZLWKQ\ORQPHPEUDQHV ,I PHPEUDQH VKRZV VLJQLILFDQW VWDLQLQJ RQ WKH EDFNVLGH HLWKHU WKH JHO ZDV KHDYLO\ RYHUORDGHGRUWKHPHPEUDQHKDVSRRUSURWHLQELQGLQJFDSDFLW\VHH7URXEOHVKRRWLQJ,Q HLWKHUFDVHSURWHLQELQGLQJVLWHVRQWKHVLGHIDFLQJWKHJHODUHVDWXUDWHGDOORZLQJSURWHLQ WR PLJUDWH WR WKH RWKHU VLGH RI WKH PHPEUDQH 1LWURFHOOXORVH LQ SDUWLFXODU ZLOO VKRZ GLPLQLVKHGELQGLQJFDSDFLW\ZLWKDJHRUSRRUVWRUDJHFRQGLWLRQVHJKLJKWHPSHUDWXUH DQGKXPLGLW\,QDGGLWLRQVRPHSURWHLQVVLPSO\GRQRWELQGZHOOWRDSDUWLFXODUPDWUL[ %\XVLQJVHYHUDOPHPEUDQHVKHHWVLQSODFHRIRQHWKHSURWHLQFDQEHGHWHFWHGDVLWSDVVHV WKURXJKHDFKFRQVHFXWLYHVKHHW7KLVZLOOJLYHDQLQGLFDWLRQRIKRZHIILFLHQWO\WKHPHPEUDQH ELQGVWRDSDUWLFXODUSURWHLQ 3URFHHGZLWKLPPXQRSURELQJDQGYLVXDOGHWHFWLRQRISURWHLQVVHH%DVLF3URWRFROV DQGDQG$OWHUQDWH3URWRFROVDQG $/7(51$7( 35272&2/ 3527(,1%/277,1*:,7+6(0,'5<6<67(06 (YHQ DQG HIILFLHQW WUDQVIHU RI PRVW SURWHLQV LV DOVR SRVVLEOH ZLWK VHPLGU\ EORWWLQJ D FRQYHQLHQWDOWHUQDWLYHWRWDQNWUDQVIHUV\VWHPV,QVWHDGRIEHLQJSODFHGYHUWLFDOO\LQWRD WDQN ILOOHG ZLWK WUDQVIHU EXIIHU WKH JHO LV KHOG KRUL]RQWDOO\ EHWZHHQ EXIIHUVDWXUDWHG EORWWLQJ SDSHU WKDW LV LQ FRQWDFW ZLWK WKH HOHFWURGHV )LJ JUHDWO\ UHGXFLQJ WKH DPRXQWRIEXIIHUUHTXLUHG7KHHOHFWURGHVDUHFORVHWRJHWKHUJLYLQJKLJKILHOGVWUHQJWKV DQGUDSLGWUDQVIHUZLWKDVWDQGDUGHOHFWURSKRUHVLVSRZHUVXSSO\3URORQJHGWUDQVIHUV! KUDUHQRWUHFRPPHQGHGWDQNEORWWLQJVHH%DVLF3URWRFROVKRXOGEHXVHGIRUSURWHLQV WKDWUHTXLUHORQJEORWWLQJWLPHVIRUHIILFLHQWWUDQVIHU $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO 6L[VKHHWVRI:KDWPDQ00ILOWHUSDSHURUHTXLYDOHQWFXWWRVL]HRIJHO DQGVDWXUDWHGZLWKWUDQVIHUEXIIHU 6HPLGU\WUDQVIHUXQLW$PHUVKDP3KDUPDFLD%LRWHFK%LR5DGRU6DUWRULXV 3UHSDUHVDPSOHVDQGVHSDUDWHSURWHLQVXVLQJVPDOORUVWDQGDUGVL]HGRQHRUWZRGL PHQVLRQDOJHOV81,7 %HFDXVHWUDQVIHUHIILFLHQF\GHSHQGVRQPDQ\IDFWRUVHJJHOFRQFHQWUDWLRQDQGWKLFNQHVV SURWHLQVL]HVKDSHDQGQHWFKDUJHUHVXOWVPD\YDU\%HORZLVDJXLGHOLQHIRU¤PP¤ WKLFN6'63$*(JHOVWUDQVIHUUHGE\VHPLGU\EORWWLQJ ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ 3HUFHQWDFU\ODPLGH UHVROYLQJJHO 6L]HUDQJHWUDQVIHUUHG (∼HIILFLHQF\ ¤ ¤ ¤ ¤ ¤N'D ¤N'D N'D N'D &XUUHQW3URWRFROVLQ&HOO%LRORJ\ - cathode buffer-soaked filter paper gel membrane buffer-soaked filter paper transfer stack cellophane gel membrane buffer-soaked filter paper transfer stack buffer-soaked filter paper Mylar mask + anode )LJXUH ,PPXQREORWWLQJZLWKDVHPLGU\WUDQVIHUXQLW*HQHUDOO\WKHORZHUHOHFWURGHLVWKH DQRGHDQGRQHJHOLVWUDQVIHUUHGDWDWLPH$0\ODUPDVNRSWLRQDOLQVRPHXQLWVLVSXWLQSODFH RQWKHDQRGH7KLVLVIROORZHGE\WKUHHVKHHWVRIWUDQVIHUEXIIHU¤VRDNHGILOWHUSDSHUWKHPHPEUDQH WKHJHODQGILQDOO\WKUHHPRUHVKHHWVRIEXIIHUVRDNHGILOWHUSDSHU7RWUDQVIHUPXOWLSOHJHOVFRQVWUXFW WUDQVIHUVWDFNVDVLOOXVWUDWHGDQGVHSDUDWHHDFKZLWKDVKHHWRISRURXVFHOORSKDQH)RUWUDQVIHURI QHJDWLYHO\FKDUJHGSURWHLQWKHPHPEUDQHLVSRVLWLRQHGRQWKHDQRGHVLGHRIWKHJHO)RUWUDQVIHU RISRVLWLYHO\FKDUJHGSURWHLQWKHPHPEUDQHLVSODFHGRQWKHFDWKRGHVLGHRIWKHJHO7UDQVIHULV DFKLHYHGE\DSSO\LQJDPD[LPXPFXUUHQWRIP$FPRIJHODUHD)RUDW\SLFDOPLQLJHO× FPDQGVWDQGDUGVL]HGJHO×FPWKLVPHDQVDQGP$UHVSHFWLYHO\ 3UHSDUHWUDQVIHUPHPEUDQHVHH%DVLF3URWRFROVWHS 'LVDVVHPEOHJHOVDQGZLFK5HPRYHDQGGLVFDUGVWDFNLQJJHO (TXLOLEUDWLRQRIWKHVHSDUDWLQJJHOZLWKWUDQVIHUEXIIHULVQRWQRUPDOO\UHTXLUHGIRUVHPLGU\ EORWWLQJEXWLWPD\LPSURYHWUDQVIHULQVRPHFDVHV 3ODFHWKUHHVKHHWVRIILOWHUSDSHUVDWXUDWHGZLWKWUDQVIHUEXIIHURQWKHDQRGH)LJ 0RVW WUDQVIHU XQLWV DUH GHVLJQHG VR WKDW QHJDWLYHO\ FKDUJHG SURWHLQV PRYH GRZQZDUG WRZDUGHLWKHUDSODWLQXPRUJUDSKLWHSRVLWLYHHOHFWURGHDQRGH &$36WUDQVIHUEXIIHUS+VHHUHFLSHIRUWUDQVIHUEXIIHUFDQEHXVHGLQSODFHRIWKH 7ULVJO\FLQHPHWKDQROWUDQVIHUEXIIHURI%DVLF3URWRFRO&$36EXIIHUVKRXOGEHXVHGLI WKHSURWHLQLVWREHVHTXHQFHGULJKWRQWKHPHPEUDQH0RRVDVJO\FLQHZLOOLQWHUIHUH ZLWKWKLVSURFHGXUH 7KHILOWHUSDSHUVKRXOGEHFXWWRWKHH[DFWVL]HRIWKHJHO7KLVIRUFHVWKHFXUUHQWWRIORZ RQO\WKURXJKWKHJHODQGQRWWKURXJKRYHUODSSLQJILOWHUSDSHU6RPHPDQXIDFWXUHUVHJ $PHUVKDP3KDUPDFLD%LRWHFKUHFRPPHQGSODFLQJD0\ODUPDVNRQWKHORZHUSODWLQXP DQRGH:LWKDQRSHQLQJWKDWLVVOLJKWO\OHVVWKDQWKHVL]HRIWKHJHOWKHPDVNIRUFHVWKH FXUUHQWWRIORZWKURXJKWKHJHODQGQRWWKHVXUURXQGLQJHOHFWURGHDUHDGXULQJWUDQVIHU 3ODFHHTXLOLEUDWHGWUDQVIHUPHPEUDQHRQWRSRIILOWHUSDSHUVWDFN5HPRYHDOOEXEEOHV EHWZHHQPHPEUDQHDQGILOWHUSDSHUE\UROOLQJDWHVWWXEHRYHUVXUIDFHRIPHPEUDQH $Q\EXEEOHVLQWKHILOWHUSDSHUVWDFNRUEHWZHHQWKHILOWHUSDSHUPHPEUDQHDQGJHOZLOO EORFNFXUUHQWIORZDQGSUHYHQWSURWHLQWUDQVIHU7KLVSUREOHPLVLQGLFDWHGRQWKHPHPEUDQH E\VKDUSO\GHILQHGZKLWHDUHDVGHYRLGRIWUDQVIHUUHGSURWHLQ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 3ODFHJHORQWRSRIPHPEUDQH*HQWO\UROODWHVWWXEHRYHUVXUIDFHRIJHOWRHQVXUH LQWLPDWHFRQWDFWEHWZHHQJHODQGPHPEUDQHDQGWRUHPRYHDQ\LQWHUIHULQJEXEEOHV 3RRUFRQWDFWEHWZHHQWKHJHODQGPHPEUDQHZLOOFDXVHDVZLUOHGSDWWHUQRIWUDQVIHUUHG SURWHLQVRQWKHPHPEUDQH6RPHSURWHLQVZLOOWUDQVIHUDVVRRQDVWKHJHOLVSODFHGRQWKH PHPEUDQHUHSRVLWLRQLQJWKHJHORUPHPEUDQHFDQUHVXOWLQDVPHDUHGRUGRXEOHLPDJHRQ WKHGHYHORSHGEORW &RPSOHWHWKHWUDQVIHUVWDFNE\SXWWLQJWKHWKUHHUHPDLQLQJVKHHWVRIILOWHUSDSHURQ WRSRIJHO5ROORXWEXEEOHVDVGHVFULEHGDERYH 0XOWLSOH JHOV FDQ EH WUDQVIHUUHG XVLQJ VHPLGU\ EORWWLQJ 6LPSO\ SXW D VKHHW RI SRURXV FHOORSKDQH$PHUVKDP3KDUPDFLD%LRWHFKRUGLDO\VLVPHPEUDQH%LR5DGRU6DUWRULXV HTXLOLEUDWHGZLWKWUDQVIHUEXIIHUEHWZHHQHDFKWUDQVIHUVWDFN)LJ7UDQVIHUHIIL FLHQF\LVGHSHQGHQWRQWKHSRVLWLRQRIWKHWUDQVIHUVWDFNLQWKHEORWWLQJXQLWDQGIRUFULWLFDO DSSOLFDWLRQVWUDQVIHUULQJRQHJHODWDWLPHLVUHFRPPHQGHG7KHJHOQH[WWRWKHDQRGHWHQGV WREHPRUHHIILFLHQWO\WUDQVIHUUHGZKHQEORWWLQJPRUHWKDQRQHJHODWDWLPH 7UDQVIHUSURWHLQVIURPJHOWRPHPEUDQH 3ODFHWRSHOHFWURGHRQWRWUDQVIHUVWDFN 0RVW XQLWV KDYH VDIHW\LQWHUORFN IHDWXUHV DQG FDQ RQO\ EH DVVHPEOHG RQH ZD\ &RQVXOW PDQXIDFWXUHU©VLQVWUXFWLRQVIRUGHWDLOV 2QFHDVVHPEOHGGRQRWPRYHWKHWRSHOHFWURGH7KLVFDQVKLIWWKHWUDQVIHUVWDFNDQGPRYH WKHJHOUHODWLYHWRWKHPHPEUDQH6RPHWUDQVIHUZLOORFFXUDVVRRQDVWKHJHOFRQWDFWVWKH PHPEUDQHDQGDQ\VKLIWLQJRIWKHWUDQVIHUVWDFNDIWHUDVVHPEO\ZLOOGLVWRUWWKHWUDQVIHU SDWWHUQ &DUHIXOO\ FRQQHFW KLJKYROWDJH OHDGV WR WKH SRZHU VXSSO\ VHH 81,7 IRU VDIHW\ SUHFDXWLRQV$SSO\FRQVWDQWFXUUHQWWRLQLWLDWHSURWHLQWUDQVIHU7UDQVIHUVRIKUDUH JHQHUDOO\VXIILFLHQW ,QJHQHUDOGRQRWH[FHHGP$FPRIJHODUHD)RUDW\SLFDOPLQLJHO×FPDQG VWDQGDUGVL]HGJHO×FPWKLVPHDQV∼DQGP$UHVSHFWLYHO\ 0RQLWRUWKHWHPSHUDWXUHRIWKHWUDQVIHUXQLWGLUHFWO\DERYHWKHJHOE\WRXFK7KHXQLWVKRXOG QRWH[FHHG°&,IWKHRXWVLGHRIWKHXQLWLVZDUPWRRPXFKFXUUHQWLVEHLQJDSSOLHG1RWH WKDWXQLWVZLWKJUDSKLWHHOHFWURGHVDUHPRUHSURQHWRKHDWLQJEHFDXVHJUDSKLWHKDVPXFK PRUHUHVLVWDQFHWRFXUUHQWIORZWKDQSODWLQXPRUVWHHOHOHFWURGHV $IWHUWUDQVIHUWXUQRIISRZHUVXSSO\DQGGLVDVVHPEOHXQLW5HPRYHPHPEUDQHIURP WUDQVIHUVWDFNPDUNLQJRULHQWDWLRQDVLQVWHSRI%DVLF3URWRFRO3URFHHGZLWK VWDLQLQJDQGLPPXQRSURELQJVHH%DVLF3URWRFROVWHSVDQG $/7(51$7( 35272&2/ ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ %/277,1*2)67$,1('*(/6 *HOV VWDLQHG ZLWK &RRPDVVLH EOXH 5 FDQ EH HIIHFWLYHO\ LPPXQREORWWHG E\ WKH IROORZLQJSURFHGXUHEDVHGRQ3HULGHVHWDODQG'LRQLVLHWDO%ULHIO\WKH VWDLQHGJHOLVVRDNHGLQDVHULHVRIVROXWLRQVGHVLJQHGWRLQFUHDVHWKHVROXELOLW\RIWKH SURWHLQVDIWHUVWDLQLQJDQGIL[DWLRQ$IWHUWUDQVIHUWKHPHPEUDQHVDUHWUHDWHGZLWK RU PHWKDQRO WR GHFUHDVH WKH &RRPDVVLH EOXH ERXQG WR WKH PHPEUDQH SULRU WR SURFHVVLQJIRUFKURPRJHQLFGHYHORSPHQW)RUFKHPLOXPLQHVFHQWGHYHORSPHQWUHPRYDO RIWKH&RRPDVVLHEOXHLVJHQHUDOO\QRWQHHGHG 0DWHULDOV 'HVWDLQHGJHOFRQWDLQLQJSURWHLQVRILQWHUHVW P07ULVEDVHP0JO\FLQH6'6 P07ULVEDVHP0JO\FLQH6'6 &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6RDNGHVWDLQHGJHOFRQWDLQLQJSURWHLQVRILQWHUHVWLQGLVWLOOHGZDWHUIRUPLQ (TXLOLEUDWHJHOZLWKP07ULVEDVHP0JO\FLQH6'6IRUKUZLWKJHQWOH DJLWDWLRQ 7UDQVIHUJHOWRP07ULVEDVHP0JO\FLQH6'6DQGHTXLOLEUDWHPLQ ZLWKJHQWOHDJLWDWLRQ 7RLQFUHDVHWUDQVIHUHIILFLHQF\RIODUJHUSURWHLQVWKHJHOVKRXOGEHWUDQVIHUUHGWRWKHDERYH VROXWLRQZLWK0XUHDIRUDQDGGLWLRQDOPLQ 3URFHHGZLWKWUDQVIHUVHH%DVLF3URWRFROVWHSVWR )RUWKHPRVWHIILFLHQWWUDQVIHUDQGELQGLQJWRWKHPHPEUDQHWKHWUDQVIHUEXIIHUVKRXOG FRQWDLQ6'6 $IWHUWUDQVIHUVRDNPHPEUDQHVIRUWRPLQLQPHWKDQROQLWURFHOOXORVHRU PHWKDQROQ\ORQRU39')WRUHPRYHWKHERXQG&RRPDVVLHEOXH 7KLVVWHSLVQRWQHHGHGLIXVLQJFKHPLOXPLQHVFHQWUHDFWLRQVRUUDGLRODEHOHGSURWHLQ$IRU LPPXQRGHYHORSPHQW'HVWDLQLQJRIWKHQLWURFHOOXORVHPHPEUDQHLVHQKDQFHGE\DGGLQJD VPDOOEDOORIODERUDWRU\WLVVXHWRWKHPHWKDQROWRDEVRUEWKH&RRPDVVLHEOXH 3URFHHGZLWKLPPXQRSURELQJDQGYLVXDOGHWHFWLRQRISURWHLQVVHH%DVLF3URWRFROV DQGDQG$OWHUQDWH3URWRFROVDQG 5(9(56,%/(67$,1,1*2)75$16)(55('3527(,16 7R YHULI\ WUDQVIHU HIILFLHQF\ QLWURFHOOXORVH DQG 39') PHPEUDQHV FDQ EH UHYHUVLEO\ VWDLQHG7KLVPHWKRGZLOOQRWZRUNRQQ\ORQPHPEUDQHV 6833257 35272&2/ $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO 3RQFHDX6VROXWLRQVHHUHFLSH $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUSKRWRJUDSKLQJPHPEUDQHV )ROORZLQJ SURWHLQ WUDQVIHU WR QLWURFHOOXORVH RU 39') VHH %DVLF 3URWRFRO RU $OWHUQDWH 3URWRFRO SODFH PHPEUDQH LQ 3RQFHDX 6 VROXWLRQ PLQ DW URRP WHPSHUDWXUH 'HVWDLQPLQLQZDWHU3KRWRJUDSKPHPEUDQHLIUHTXLUHGDQGPDUNWKHPROHFXODU ZHLJKWVWDQGDUGEDQGORFDWLRQVZLWKLQGHOLEOHLQN &RPSOHWHO\GHVWDLQPHPEUDQHE\VRDNLQJDQDGGLWLRQDOPLQLQZDWHU 48$17,7$7,212)3527(,1:,7+321&($86 ,QDGGLWLRQWRTXDOLWDWLYHO\YLVXDOL]LQJSURWHLQVRQPHPEUDQHVDIWHUEORWWLQJ3RQFHDX6 SURYLGHVDFRQYHQLHQWPHWKRGIRUTXDQWLI\LQJWKHDPRXQWRISURWHLQLQDJLYHQODQH%\ HOXWLQJWKHG\HRIIWKHVWULSDQGUHDGLQJLQDVSHFWURSKRWRPHWHU$DQLQWHUQDOFRQWURO YDOXHRISURWHLQRQDODQHLVREWDLQHG7KLVYDOXHLVXVHGWRFRUUHFWIRUDQ\GLIIHUHQFHVLQ SURWHLQORDGLQJIURPODQHWRODQH&RPSDULVRQRIWKH3RQFHDX6YDOXHWRWKHFKHPLOXPL QHVFHQWRUFKURPRJHQLFLPPXQRGHWHFWLRQYDOXHGHWHUPLQHGE\GHQVLWRPHWU\SURYLGHVD VWUDLJKWIRUZDUGFRUUHFWLRQIRUODQHWRODQHYDULDWLRQ7KLVPHWKRGZRUNVEHVWIRUFRPSOH[ PL[WXUHVZKHUHWKHLPPXQRGHWHFWHGSURWHLQUHSUHVHQWVDVPDOOSURSRUWLRQRIWKHWRWDO SURWHLQ.OHLQHWDO $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO 6SHFWURSKRWRPHWHUDQGPOFXYHWWH 6833257 35272&2/ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ )ROORZLQJSURWHLQWUDQVIHUWRQLWURFHOOXORVH39')RUQ\ORQVHH%DVLF3URWRFRORU $OWHUQDWH3URWRFROVWDLQPHPEUDQHSKRWRJUDSKDQGGHVWDLQVHH6XSSRUW3URWR FRO 0HPEUDQHVVKRXOGEHGHVWDLQHGXQWLOWKHEDFNJURXQGEHFRPHVZKLWH 0DUNODQHVZLWKDVRIWSHQFLODQGFXWODQHVLQWRVWULSV 3ODFHHDFKVWULSLQWRPORIGLVWLOOHGZDWHUIRUPLQDQGUHPRYHWKHUHVXOWLQJVROXWLRQ ,IDQ\SDUWLFXODWHVDUHYLVLEOHFHQWULIXJHPLQDWUSPWRUHPRYHWKHP 5HDG$LQDPOFXYHWWH $Q\ YDULDWLRQ LQ JHOWRJHO VDPSOH ORDGLQJ DQG EORWWLQJ HIILFLHQF\ ZLOO EH UHIOHFWHG LQ D FKDQJHLQ$RIWKHVDPSOHODQHVZKHQFRPSDUHGWRWKHFRQWURO7KHFKDQJHLQ$FDQEH FDOLEUDWHGWRDNQRZQDPRXQWRISURWHLQORDGHGRQWKHFRQWUROODQH7KLVZLOOEHDUHODWLYH YDOXHKRZHYHUVLQFHWKHWUDQVIHURXWRIWKHJHODQGELQGLQJWRWKHPHPEUDQHLVUDUHO\ %$6,& 35272&2/ ,00812352%,1*:,7+',5(&7/<&21-8*$7('6(&21'$5< $17,%2'< ,PPRELOL]HGSURWHLQVDUHSUREHGZLWKVSHFLILFDQWLERGLHVWRLGHQWLI\DQGTXDQWLWDWHDQ\ DQWLJHQVSUHVHQW7KHPHPEUDQHLVLPPHUVHGLQEORFNLQJEXIIHUWRILOODOOSURWHLQELQGLQJ VLWHVZLWKDQRQUHDFWLYHSURWHLQRUGHWHUJHQW1H[WLWLVSODFHGLQDVROXWLRQFRQWDLQLQJ WKH DQWLERG\ GLUHFWHG DJDLQVW WKH DQWLJHQ SULPDU\ DQWLERG\ 7KH EORW LV ZDVKHG DQG H[SRVHGWRDQHQ]\PHDQWLERG\FRQMXJDWHGLUHFWHGDJDLQVWWKHSULPDU\DQWLERG\VHFRQ GDU\ DQWLERG\ HJ JRDW DQWLUDEELW ,J* $QWLJHQV DUH LGHQWLILHG E\ FKURPRJHQLF RU OXPLQHVFHQWYLVXDOL]DWLRQVHH%DVLF3URWRFRODQG$OWHUQDWH3URWRFRORIWKHDQWL JHQSULPDU\ DQWLERG\VHFRQGDU\ DQWLERG\HQ]\PH FRPSOH[ ERXQG WR WKH PHPEUDQH 7ZHHQLVDFRPPRQDOWHUQDWLYHWRSURWHLQEORFNLQJDJHQWVZKHQXVLQJQLWURFHOOXORVH RU39')ILOWHUV 0DWHULDOV 0HPEUDQHZLWKWUDQVIHUUHGSURWHLQVVHH%DVLF3URWRFRORU$OWHUQDWH3URWRFRO %ORFNLQJEXIIHUDSSURSULDWHIRUPHPEUDQHDQGGHWHFWLRQSURWRFROVHHUHFLSH 3ULPDU\DQWLERG\VSHFLILFIRUSURWHLQRILQWHUHVW 77%6QLWURFHOOXORVHRU39')RU7%6Q\ORQVHH$33(1',;$IRUUHFLSHV 6HFRQGDU\DQWLERG\FRQMXJDWHKRUVHUDGLVKSHUR[LGDVH+532¤RUDONDOLQH SKRVSKDWDVH$3¤DQWL,JFRQMXJDWH&DSSHO9HFWRU/DEV.LUNHJDDUG3HUU\ RU6LJPDGLOXWHDVLQGLFDWHGE\PDQXIDFWXUHUDQGVWRUHIUR]HQLQµODOLTXRWV XQWLOXVH +HDWVHDODEOHSODVWLFEDJ 3RZGHUIUHHJORYHV 3ODVWLFER[ 3ODFHPHPEUDQHLQKHDWVHDODEOHSODVWLFEDJZLWKPOEORFNLQJEXIIHUDQGVHDOEDJ ,QFXEDWHPLQWRKUDWURRPWHPSHUDWXUHZLWKDJLWDWLRQRQDQRUELWDOVKDNHURU URFNLQJSODWIRUP 8VXDOO\POEXIIHULVVXIILFLHQWIRUWZRWRWKUHHPHPEUDQHVפFPVL]H,IPHPEUDQH LVWREHVWULSSHGDQGUHSUREHGVHH6XSSRUW3URWRFROEORFNLQJEXIIHUPXVWFRQWDLQFDVHLQ IRU$3V\VWHPVRUQRQIDWGU\PLON 3ODVWLFLQFXEDWLRQWUD\VDUHRIWHQXVHGLQSODFHRIKHDWVHDODEOHEDJVDQGFDQEHHVSHFLDOO\ XVHIXOZKHQSURFHVVLQJODUJHQXPEHUVRIVWULSVLQGLIIHUHQWSULPDU\DQWLERG\VROXWLRQV ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ 'LOXWHSULPDU\DQWLERG\LQEORFNLQJEXIIHU 3ULPDU\DQWLERG\GLOXWLRQLVGHWHUPLQHGHPSLULFDOO\EXWLVW\SLFDOO\WRIRUD SRO\FORQDODQWLERG\)LJWRIRUK\EULGRPDVXSHUQDWDQWVDQG≥ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 1/6400 1/3200 1/1600 1/800 1/400 1/200 1/100 1/50 Serum dilution Mr (kDa) 200 116 97 66 )LJXUH 6HULDOGLOXWLRQRISULPDU\ DQWLERG\GLUHFWHGDJDLQVWWKHN'D FDWDO\WLFVXEXQLWRIWKHSODQWSODVPD PHPEUDQH$73DVH%ORWZDVGHYHORSHGZLWK +532FRXSOHGDYLGLQELRWLQUHDJHQWV DFFRUGLQJWRWKHVHFRQGDOWHUQDWHSURWRFRO DQGYLVXDOL]HGZLWKFKORURQDSKWKRO &11RWHKRZEDFNJURXQGLPSURYHVZLWK GLOXWLRQ 43 24 18 IRUPXULQHDVFLWHVIOXLGFRQWDLQLQJPRQRFORQDODQWLERGLHV7HQWRRQHKXQGUHGIROGKLJKHU GLOXWLRQVFDQEHXVHGZLWKDONDOLQHSKRVSKDWDVH¤RUOXPLQHVFHQFH¤EDVHGGHWHFWLRQV\V WHPV %RWK SULPDU\ DQG VHFRQGDU\ DQWLERG\ VROXWLRQV FDQ EH XVHG DW OHDVW WZLFH EXW ORQJWHUPVWRUDJHLH!GD\VDW°&LVQRWUHFRPPHQGHG 2SHQEDJDQGSRXURXWEORFNLQJEXIIHU5HSODFHZLWKGLOXWHGSULPDU\DQWLERG\DQG LQFXEDWHPLQWRKUDWURRPWHPSHUDWXUHZLWKFRQVWDQWDJLWDWLRQ 8VXDOO\POGLOXWHGSULPDU\DQWLERG\VROXWLRQLVVXIILFLHQWIRUWZRWRWKUHHPHPEUDQHV פFPVL]H,QFXEDWLRQWLPHPD\YDU\GHSHQGLQJRQFRQMXJDWHXVHG :KHQXVLQJSODVWLFWUD\VWKHSULPDU\DQGVHFRQGDU\DQWLERG\VROXWLRQYROXPHVKRXOGEH LQFUHDVHGWRWRPO)RUPHPEUDQHVWULSVLQFXEDWLRQWUD\VZLWKLQGLYLGXDOVORWVDUH UHFRPPHQGHG7\SLFDOO\WRPOVROXWLRQVORWLVQHHGHG 5HPRYHPHPEUDQHIURPSODVWLFEDJZLWKJORYHGKDQG3ODFHLQSODVWLFER[DQGZDVK IRXUWLPHVE\DJLWDWLQJZLWKPO77%6QLWURFHOOXORVHRU39')RU7%6Q\ORQ WRPLQHDFKWLPH 'LOXWHVHFRQGDU\DQWLERG\+532RU$3DQWL,JFRQMXJDWHLQEORFNLQJEXIIHU &RPPHUFLDOO\DYDLODEOHHQ]\PH¤FRQMXJDWHGVHFRQGDU\DQWLERG\LVXVXDOO\GLOXWHG WRSULRUWRXVH+DUORZDQG/DQH 3ODFHPHPEUDQHLQQHZKHDWVHDODEOHSODVWLFEDJDGGGLOXWHG+532RU$3DQWL,J FRQMXJDWHDQGLQFXEDWHPLQWRKUDWURRPWHPSHUDWXUHZLWKFRQVWDQWDJLWDWLRQ :KHQXVLQJSODVWLFLQFXEDWLRQWUD\VVHHVWHSDQQRWDWLRQIRUSURSHUDQWLERG\VROXWLRQ YROXPHV 5HPRYHPHPEUDQHIURPEDJDQGZDVKDVLQVWHS'HYHORSDFFRUGLQJWRDSSURSULDWH YLVXDOL]DWLRQSURWRFROVHH%DVLF3URWRFRORU$OWHUQDWH3URWRFRO (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ $/7(51$7( 35272&2/ ,00812352%,1*:,7+$9,',1%,27,1&283/,1*72 6(&21'$5<$17,%2'< 7KH IROORZLQJ SURFHGXUH LV EDVHG RQ WKH 9HFWDVWDLQ $%& NLW IURP 9HFWRU /DEV VHH 6833/,(56 $33(1',;,WXVHVDQDYLGLQELRWLQFRPSOH[WRDWWDFKKRUVHUDGLVKSHUR[LGDVH +532RUDONDOLQHSKRVSKDWDVH$3WRWKHELRWLQ\ODWHGVHFRQGDU\DQWLERG\$YLGLQELR WLQV\VWHPVDUHFDSDEOHRIH[WUHPHO\KLJKVHQVLWLYLW\GXHWRWKHPXOWLSOHUHSRUWHUHQ]\PHV ERXQG WR HDFK VHFRQGDU\ DQWLERG\ ,Q DGGLWLRQ WKH GHWHUJHQW 7ZHHQ LV D SRSXODU DOWHUQDWLYHWRSURWHLQEORFNLQJDJHQWVZKHQXVLQJQLWURFHOOXORVHRU39')ILOWHUV $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO %ORFNLQJEXIIHUDSSURSULDWHIRUPHPEUDQHDQGGHWHFWLRQSURWRFROVHHUHFLSH 77%6QLWURFHOOXORVHRU39')RU7%6QHXWUDORUSRVLWLYHO\FKDUJHGQ\ORQVHH $33(1',;$IRUUHFLSHV 9HFWDVWDLQ$%&+532RU$%&$3$3NLW9HFWRU/DEVFRQWDLQLQJWKH IROORZLQJUHDJHQW$DYLGLQUHDJHQW%ELRWLQ\ODWHG+532RU$3DQG ELRWLQ\ODWHGVHFRQGDU\DQWLERG\UHTXHVWPHPEUDQHLPPXQRGHWHFWLRQSURWRFROV ZKHQRUGHULQJ (TXLOLEUDWHPHPEUDQHLQDSSURSULDWHEORFNLQJEXIIHULQKHDWVHDOHGSODVWLFEDJZLWK FRQVWDQWDJLWDWLRQXVLQJDQRUELWDOVKDNHURUURFNLQJSODWIRUP)RUQLWURFHOOXORVHDQG 39')LQFXEDWHWRPLQDWURRPWHPSHUDWXUH)RUQ\ORQLQFXEDWH≥KUDW°& 77%6 LV ZHOO VXLWHG IRU DYLGLQELRWLQ V\VWHPV )RU Q\ORQ SURWHLQELQGLQJ DJHQWV DUH UHFRPPHQGHG%HFDXVHQRQIDWGU\PLONFRQWDLQVUHVLGXDOELRWLQZKLFKZLOOLQWHUIHUHZLWK WKHLPPXQRDVVD\LWPXVWEHXVHGLQWKHEORFNLQJVWHSRQO\,IPHPEUDQHLVWREHVWULSSHG DQG UHSUREHG VHH 6XSSRUW 3URWRFRO EORFNLQJ EXIIHU PXVW FRQWDLQ FDVHLQ IRU $3 V\VWHPVRUQRQIDWGU\PLON 3ODVWLFLQFXEDWLRQWUD\VDUHRIWHQXVHGLQSODFHRIKHDWVHDODEOHEDJVDQGFDQEHHVSHFLDOO\ XVHIXOZKHQSURFHVVLQJODUJHQXPEHUVRIVWULSVLQGLIIHUHQWSULPDU\DQWLERG\VROXWLRQV 3UHSDUHSULPDU\DQWLERG\VROXWLRQLQ77%6QLWURFHOOXORVHRU39')RU7%6Q\ORQ 'LOXWLRQVRIVHUDFRQWDLQLQJSULPDU\DQWLERG\JHQHUDOO\UDQJHIURPWR 7KLVGHSHQGVLQODUJHSDUWRQWKHVHQVLWLYLW\RIWKHGHWHFWLRQV\VWHP:LWKKLJKVHQVLWLYLW\ DYLGLQELRWLQV\VWHPVGLOXWLRQVIURPWRDUHFRPPRQ+LJKHUGLOXWLRQV FDQEHXVHGZLWK$3RUOXPLQHVFHQFHEDVHGGHWHFWLRQV\VWHPV7RGHWHUPLQHWKHDSSUR SULDWHFRQFHQWUDWLRQRIWKHSULPDU\DQWLERG\DGLOXWLRQVHULHVLVHDVLO\SHUIRUPHGZLWK PHPEUDQHVWULSV6HSDUDWHDQWLJHQVRQDSUHSDUDWLYHJHOLHDVLQJOHODUJHVDPSOHZHOO DQGLPPXQREORWWKHHQWLUHJHO&XWWRPPVWULSVE\KDQGRUZLWKDPHPEUDQHFXWWHU 6FKOHLFKHUDQG6FKXHOO,QRWHFKDQGLQFXEDWHLQGLYLGXDOVWULSVLQDVHWRIVHULDOGLOXWLRQV RISULPDU\DQWLERG\7KHFRUUHFWGLOXWLRQVKRXOGJLYHORZEDFNJURXQGDQGKLJKVSHFLILFLW\ )LJ 2SHQEDJUHPRYHEORFNLQJEXIIHUDQGDGGHQRXJKSULPDU\DQWLERG\VROXWLRQWRFRYHU PHPEUDQH,QFXEDWHPLQDWURRPWHPSHUDWXUHZLWKJHQWOHURFNLQJ 8VXDOO\POGLOXWHGSULPDU\DQWLERG\VROXWLRQLVVXIILFLHQWIRUWZRWRWKUHHPHPEUDQHV פFPVL]H,QFXEDWLRQWLPHPD\YDU\GHSHQGLQJRQFRQMXJDWHXVHG :KHQXVLQJSODVWLFWUD\VWKHSULPDU\DQGVHFRQGDU\DQWLERG\VROXWLRQYROXPHVKRXOGEH LQFUHDVHGWRWRPO)RUPHPEUDQHVWULSVLQFXEDWLRQWUD\VZLWKLQGLYLGXDOVORWVDUH UHFRPPHQGHG7\SLFDOO\WRPOVROXWLRQVORWLVQHHGHG ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ 5HPRYHPHPEUDQHIURPEDJDQGSODFHLQSODVWLFER[:DVKPHPEUDQHWKUHHWLPHV RYHUDPLQVSDQLQ77%6QLWURFHOOXORVHRU39')RU7%6Q\ORQ$GGHQRXJK 77%6RU7%6WRIXOO\FRYHUWKHPHPEUDQHHJWRPOVWULSRUWRPOZKROH PHPEUDQH &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 3UHSDUHELRWLQ\ODWHGVHFRQGDU\DQWLERG\VROXWLRQE\GLOXWLQJWZRGURSVELRWLQ\ODWHG DQWLERG\ZLWKWRPO77%6QLWURFHOOXORVHRU39')RU7%6Q\ORQ 7KLVGLOXWLRQJLYHVERWKKLJKVHQVLWLYLW\DQGHQRXJKYROXPHWRHDVLO\FRYHUDODUJH× ¤FPPHPEUDQH 7UDQVIHU PHPEUDQH WR IUHVK SODVWLF EDJ FRQWDLQLQJ VHFRQGDU\ DQWLERG\ VROXWLRQ ,QFXEDWHPLQDWURRPWHPSHUDWXUHZLWKVORZURFNLQJWKHQZDVKDVLQVWHS :KHQXVLQJSODVWLFLQFXEDWLRQWUD\VVHHVWHSDQQRWDWLRQVIRUSURSHUDQWLERG\VROXWLRQ YROXPHV :KLOHPHPEUDQHLVEHLQJLQFXEDWHGZLWKVHFRQGDU\DQWLERG\SUHSDUHDYLGLQELRWLQ +532RU$3FRPSOH[0L[WZRGURSV9HFWDVWDLQUHDJHQW$DQGWZRGURSVUHDJHQW %LQWRPO77%6QLWURFHOOXORVHRU39')RU7%6Q\ORQ,QFXEDWHPLQDW URRPWHPSHUDWXUHWKHQIXUWKHUGLOXWHWRPOZLWK77%6RU7%6 'LOXWLQJWKH$DQG%UHDJHQWVWRPOH[SDQGVWKHDPRXQWRIPHPEUDQHWKDWFDQEHSUREHG ZLWKRXWJUHDWO\DIIHFWLQJVHQVLWLYLW\6RGLXPD]LGHLVDSHUR[LGDVHLQKLELWRUDQGVKRXOGQRW EHXVHGDVDSUHVHUYDWLYH&DVHLQQRQIDWGU\PLONVHUXPDQGVRPHJUDGHVRI%6$PD\ LQWHUIHUHZLWKWKHIRUPDWLRQRIWKHDYLGLQELRWLQFRPSOH[DQGVKRXOGQRWEHXVHGLQWKH SUHVHQFHRIDYLGLQRUELRWLQUHDJHQWV*LOOHVSLHDQG+XGVSHWK9HFWRU/DEV 7UDQVIHU PHPEUDQH WR DYLGLQELRWLQHQ]\PH VROXWLRQ ,QFXEDWH PLQ DW URRP WHPSHUDWXUHZLWKVORZURFNLQJWKHQZDVKRYHUDPLQVSDQDVLQVWHS 'HYHORSPHPEUDQHDFFRUGLQJWRWKHDSSURSULDWHYLVXDOL]DWLRQSURWRFROVHH%DVLF 3URWRFRORU$OWHUQDWH3URWRFRO 9,68$/,=$7,21:,7+&+5202*(1,&68%675$7(6 %RXQG DQWLJHQV DUH W\SLFDOO\ YLVXDOL]HG ZLWK FKURPRJHQLF VXEVWUDWHV 7KH VXEVWUDWHV &1'$%1L&ODQG70%DUHFRPPRQO\XVHGZLWKKRUVHUDGLVKSHUR[LGDVH+532¤ EDVHG LPPXQRGHWHFWLRQ SURFHGXUHV ZKLOH %&,31%7 LV UHFRPPHQGHG IRU DONDOLQH SKRVSKDWDVH$3¤EDVHGSURFHGXUHVVHH7DEOH$IWHULQFXEDWLRQZLWKSULPDU\DQG VHFRQGDU\ DQWLERGLHV WKH PHPEUDQH LV SODFHG LQ WKH DSSURSULDWH VXEVWUDWH VROXWLRQ 3URWHLQEDQGVXVXDOO\DSSHDUZLWKLQDIHZPLQXWHV %$6,& 35272&2/ 0DWHULDOV 0HPEUDQHZLWKWUDQVIHUUHGSURWHLQVDQGSUREHGZLWKDQWLERG\HQ]\PHFRPSOH[ VHH%DVLF3URWRFRORU$OWHUQDWH3URWRFRO 7%6$33(1',;$ &KURPRJHQLFYLVXDOL]DWLRQVROXWLRQ7DEOH $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUJHOSKRWRJUDSK\ ,IILQDOPHPEUDQHZDVKVHH%DVLF3URWRFROVWHSRUVHH$OWHUQDWH3URWRFRO VWHSZDVSHUIRUPHGLQ77%6ZDVKPHPEUDQHPLQDWURRPWHPSHUDWXUHLQ PO7%6 7KH7ZHHQLQ77%6LQWHUIHUHVZLWK&1GHYHORSPHQW%MHUUXPHWDO 3ODFHPHPEUDQHLQWRFKURPRJHQLFYLVXDOL]DWLRQVROXWLRQ%DQGVVKRXOGDSSHDULQ WRPLQ 7HUPLQDWHUHDFWLRQE\ZDVKLQJPHPEUDQHLQGLVWLOOHGZDWHU$LUGU\DQGSKRWRJUDSK IRUDSHUPDQHQWUHFRUG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7DEOH &KURPRJHQLFDQG/XPLQHVFHQW9LVXDOL]DWLRQ6\VWHPVD 6\VWHP 5HDJHQWE 5HDFWLRQ'HWHFWLRQ &RPPHQWVF &KURPRJHQLF +532EDVHG &1 2[LGL]HGSURGXFWVIRUPSXUSOH SUHFLSLWDWH 1RWYHU\VHQVLWLYH7ZHHQ LQKLELWVUHDFWLRQIDGHVUDSLGO\ XSRQH[SRVXUHWROLJKW '$%1L&OG )RUPVGDUNEURZQSUHFLSLWDWH 0RUHVHQVLWLYHWKDQ&1EXW SRWHQWLDOO\FDUFLQRJHQLFUHVXOWLQJ PHPEUDQHHDVLO\VFDQQHG 70%H )RUPVGDUNSXUSOHVWDLQ 0RUHVWDEOHOHVVWR[LFWKDQ '$%1L&OPD\EHVRPHZKDW PRUHVHQVLWLYHHFDQEHXVHGZLWKDOO PHPEUDQHW\SHVNLWVDYDLODEOHIURP .LUNHJDDUG3HUU\76,0RVVDQG 9HFWRU/DEV %&,31%7 %&,3K\GURO\VLVSURGXFHVLQGLJR SUHFLSLWDWHDIWHUR[LGDWLRQZLWK 1%7UHGXFHG1%7SUHFLSLWDWHV GDUNEOXHJUD\VWDLQUHVXOWV 0RUHVHQVLWLYHDQGUHOLDEOHWKDQ RWKHU$3SUHFLSLWDWLQJVXEVWUDWHV QRWHWKDWSKRVSKDWHLQKLELWV$3 DFWLYLW\ /XPLQRO+2 SLRGRSKHQRO 2[LGL]HGOXPLQROVXEVWUDWHJLYHV RIIEOXHOLJKWSLRGRSKHQRO LQFUHDVHVOLJKWRXWSXW 9HU\FRQYHQLHQWVHQVLWLYHV\VWHP UHDFWLRQGHWHFWHGZLWKLQDIHZ VHFRQGVWRKU 6XEVWLWXWHG GLR[HWDQHSKRVSKDWHV HJ$033'&63' /XPLJHQ33'/XPL 3KRVI 'HSKRVSKRU\ODWHGVXEVWUDWHJLYHV RIIOLJKW 3URWRFROGHVFULEHGJLYHVUHDVRQDEOH VHQVLWLYLW\RQDOOPHPEUDQHW\SHV FRQVXOWLQVWUXFWLRQVRIUHDJHQW PDQXIDFWXUHUIRUPD[LPXPVHQVL WLYLW\DQGPLQLPXPEDFNJURXQG VHH7URXEOHVKRRWLQJ $3EDVHG /XPLQHVFHQW +532EDVHG $3EDVHG D$EEUHYLDWLRQV$033'RU/XPLJHQ33'GLVRGLXPPHWKR[\VSLUR^GLR[HWDQH′WULF\FOR>@GHFDQ`\OSKHQ\OSKRVSKDWH$3 DONDOLQHSKRVSKDWDVH%&,3EURPRFKORURLQGRO\OSKRVSKDWH&1FKORURQDSWKRO&63'$033'ZLWKVXEVWLWXWHGFKORULQHPRLHW\RQ DGDPDQWLQHULQJ'$%′GLDPLQREHQ]LGLQH+532KRUVHUDGLVKSHUR[LGDVH1%7QLWUREOXHWHWUD]ROLXP70%′′WHWUDPHWK\OEHQ]LGLQH E5HFLSHVDQGVXSSOLHUVDUHOLVWHGLQ5HDJHQWVDQG6ROXWLRQVH[FHSWIRU703IRUZKLFKXVHRIDNLWLVUHFRPPHQGHG F6HH&RPPHQWDU\IRUIXUWKHUGHWDLOV G'$%1L&O FDQEHXVHGZLWKRXWWKHQLFNHOHQKDQFHPHQWEXWLWLVPXFKOHVVVHQVLWLYH H0F.LPP%UHVFKNLQUHSRUWHGWKDWLIQLWURFHOOXORVHILOWHUVDUHILUVWWUHDWHGZLWKGH[WUDQVXOIDWHIRUPLQLQP0FLWUDWH('7$S+ 70%SUHFLSLWDWHVRQWRWKHPHPEUDQHZLWKDVHQVLWLYLW\PXFKJUHDWHUWKDQ&1RU'$%DQGHTXDOWRRUEHWWHUWKDQWKDWRI%&,31%7 I/XPL3KRVFRQWDLQVGLR[HWDQHSKRVSKDWH0J&O &7$%FHW\OWULPHWK\ODPPRQLXPEURPLGHDQGIOXRUHVFHQWHQKDQFHULQDS+EXIIHU $/7(51$7( 35272&2/ 9,68$/,=$7,21:,7+/80,1(6&(1768%675$7(6 $QWLJHQVFDQDOVREHYLVXDOL]HGZLWKOXPLQHVFHQWVXEVWUDWHV'HWHFWLRQZLWKOLJKWRIIHUV ERWK VSHHG DQG HQKDQFHG VHQVLWLYLW\ RYHU FKURPRJHQLF DQG UDGLRLVRWRSLF SURFHGXUHV $IWHUWKHILQDOZDVKWKHEORWLVLPPHUVHGLQDVXEVWUDWHVROXWLRQFRQWDLQLQJOXPLQROIRU KRUVHUDGLVKSHUR[LGDVH+532V\VWHPVRUGLR[HWDQHSKRVSKDWHIRUDONDOLQHSKRVSKDWDVH $3V\VWHPVVHDOHGLQWKLQSODVWLFZUDSDQGSODFHGILUPO\DJDLQVWILOP([SRVXUHVUDQJH IURPDIHZVHFRQGVWRVHYHUDOKRXUVDOWKRXJKW\SLFDOO\VWURQJVLJQDOVDSSHDUZLWKLQDIHZ VHFRQGVRUPLQXWHV ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO /XPLQHVFHQWVXEVWUDWHEXIIHUP07ULV⋅&OS++532$33(1',;$RU GLR[HWDQHSKRVSKDWHVXEVWUDWHEXIIHUDONDOLQHSKRVSKDWDVHVHHUHFLSH 1LWUR%ORFNVROXWLRQ$3UHDFWLRQVRQO\YY1LWUR%ORFN7URSL[LQ GLR[HWDQHSKRVSKDWHVXEVWUDWHEXIIHUSUHSDUHGMXVWEHIRUHXVH /XPLQHVFHQWYLVXDOL]DWLRQVROXWLRQ7DEOH &OHDUSODVWLFZUDS $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUDXWRUDGLRJUDSK\81,7 127( 6HH 7URXEOHVKRRWLQJ VHFWLRQ IRU VXJJHVWLRQV FRQFHUQLQJ RSWLPL]DWLRQ RI WKLV SURWRFROSDUWLFXODUO\ZKHQHPSOR\LQJ$3EDVHGV\VWHPV (TXLOLEUDWHPHPEUDQHLQWZRPLQZDVKHVZLWKPOVXEVWUDWHEXIIHU )RUEORWVRIZKROHJHOVXVHPOVXEVWUDWHEXIIHUIRUVWULSVXVHWRPOVWULS )RU $3 UHDFWLRQV XVLQJ QLWURFHOOXORVH RU 39') PHPEUDQHV ,QFXEDWH PLQ LQ 1LWUR%ORFNVROXWLRQIROORZHGE\PLQLQVXEVWUDWHEXIIHUYROXPHVDVLQVWHS 1LWUR%ORFNHQKDQFHVOLJKWRXWSXWIURPWKHGLR[HWDQHVXEVWUDWHLQUHDFWLRQVXVLQJ$033' &63'RU/XPLJHQ33'FRQFHQWUDWH,WLVUHTXLUHGIRUQLWURFHOOXORVHDQGUHFRPPHQGHG IRU 39') PHPEUDQHV ,W LV QRW QHHGHG IRU /XPL3KRV $3 UHDFWLRQV RQ Q\ORQ PHPEUDQHVRU+532EDVHGUHDFWLRQVRQDQ\W\SHRIPHPEUDQH/XPL3KRVLVQRW UHFRPPHQGHGIRUQLWURFHOOXORVHPHPEUDQHV 7UDQVIHUPHPEUDQHWRYLVXDOL]DWLRQVROXWLRQ6RDNVHF+532UHDFWLRQVWRPLQ $3UHDFWLRQVYROXPHVDVLQVWHS $OWHUQDWLYHO\OD\RXWDVTXDUHRISODVWLFZUDSDQGSLSHWWRPOYLVXDOL]DWLRQVROXWLRQ LQWRWKHPLGGOH3ODFHPHPEUDQHRQWKHSODVWLFVRWKDWWKHYLVXDOL]DWLRQVROXWLRQVSUHDGV RXWHYHQO\IURPHGJHWRHGJH)ROGZUDSEDFNRQWRPHPEUDQHVHDODQGSURFHHGWRVWHS 5HPRYHPHPEUDQHGUDLQDQGSODFHIDFHGRZQRQDVKHHWRIFOHDUSODVWLFZUDS)ROG ZUDSEDFNRQWRPHPEUDQHWRIRUPDOLTXLGWLJKWHQFORVXUH 7RHQVXUHDQRSWLPDOLPDJHRQO\RQHOD\HURISODVWLFVKRXOGEHEHWZHHQWKHPHPEUDQH DQGILOP6HDODEOHEDJVDUHDQHIIHFWLYHDOWHUQDWLYH0RLVWXUHPXVWQRWFRPHLQFRQWDFWZLWK WKH;UD\ILOP ,QDGDUNURRPSODFHPHPEUDQHIDFHGRZQRQWRILOP 'RWKLVTXLFNO\DQGGRQRWUHSRVLWLRQDGRXEOHLPDJHZLOOEHIRUPHGLIWKHPHPEUDQHLV PRYHGZKLOHLQFRQWDFWZLWKWKHILOP$EOXUUHGLPDJHLVXVXDOO\FDXVHGE\SRRUFRQWDFW EHWZHHQPHPEUDQHDQGILOPXVHDILOPFDVVHWWHWKDWHQVXUHVDWLJKWILW ([SRVHILOPIRUDIHZVHFRQGVWRVHYHUDOKRXUV 7\SLFDOO\ LPPXQREORWV SURGXFH YHU\ VWURQJ VLJQDOV ZLWKLQ D IHZ VHFRQGV RU PLQXWHV +RZHYHUZHDNVLJQDOVPD\UHTXLUHVHYHUDOKRXUVWRDQRYHUQLJKWH[SRVXUH,IQRLPDJHLV GHWHFWHGH[SRVHILOPPLQWRKUDQGLIQHHGHGRYHUQLJKWVHH7URXEOHVKRRWLQJ ,IGHVLUHGZDVKPHPEUDQHLQWZRPLQZDVKHVRIPO7%6DQGSURFHVVIRU FKURPRJHQLFGHYHORSPHQWVHH%DVLF3URWRFRO &KHPLOXPLQHVFHQWDQGFKURPRJHQLFLPPXQREORWWLQJFDQEHHDVLO\FRPELQHGRQDVLQJOH EORWWRSURYLGHDSHUPDQHQWYLVXDOPDUNHURIDNQRZQSURWHLQ)LUVWSUREHPHPEUDQHZLWK WKHFKHPLOXPLQHVFHQWUHDFWLRQVWRUHFRUGRQILOP,IVWULSSLQJDQGUHSURELQJLVQHHGHGWKHQ SURFHVVE\ZHWWLQJDQG1D2+WUHDWPHQWVHH6XSSRUW3URWRFRO)RUWKHODVWUHDFWLRQ XVHFKURPRJHQLFGHYHORSPHQWWRSURGXFHDSHUPDQHQWYLVXDOUHFRUGRIWKHEORW$OWHUQD WLYHO\RQFHWKHILOPUHFRUGRIWKHFKHPLOXPLQHVFHQWEORWLVUHFRUGHGWKHEORWFDQEHULQVHG EULHIO\ ZLWK GLVWLOOHG ZDWHU DQG SODFHG LQ WKH DSSURSULDWH FKURPRJHQLF VROXWLRQ IRU FKURPRJHQLFGHYHORSPHQWRIWKHEORW7KLVUHVXOWVLQDSHUPDQHQWUHIHUHQFHVWDLQRQWKH EORWIRUFRPSDULVRQWRWKHPRUHHDVLO\VFDQQHGDQGTXDQWLWDWHGILOPUHFRUG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6833257 35272&2/ 675,33,1*$1'5(86,1*0(0%5$1(6 7KLVVWULSSLQJSURFHGXUHZRUNVZLWKEORWWHGPHPEUDQHVIURPRQHDQGWZRGLPHQVLRQDO JHOVDVZHOODVZLWKSURWHLQVEORWWHGIURPSUHYLRXVO\VWDLQHGJHOV6XFNDQG.UXSLQVND 5HSURELQJ39')PHPEUDQHVWKDWKDYHEHHQGHYHORSHGZLWKFKHPLOXPLQHVFHQW UHDJHQWV LV VLPSOH DQG VWUDLJKWIRUZDUG $OO UHVLGXDO DQWLERGLHV DUH UHPRYHG IURP WKH PHPEUDQHE\ILUVWUHZHWWLQJLWLQZDWHUDQGWKHQEULHIO\WUHDWLQJLWZLWK1D2+$OWKRXJK UHSHDWHGUHSURELQJFDQOHDGWRORVVRIVLJQDOXSWRILYHUHSURELQJVJHQHUDOO\DUHIHDVLEOH 7KHEORWVKRXOGKDYHEHHQSUHYLRXVO\EORFNHGZLWKQRQIDWGU\PLONSULRUWRWUHDWPHQW 0DWHULDOV 01D2+ :DVKEORWPLQLQGLVWLOOHGZDWHU ,QRUGHUWRHIIHFWLYHO\UHSUREHWKHPHPEUDQHVFDVHLQIRU$3V\VWHPVRUQRQIDWGU\PLON PXVWEHXVHGDVWKHEORFNLQJDJHQW&KURPRJHQLFGHYHORSPHQWOHDYHVDSHUPDQHQWVWDLQ RQWKHPHPEUDQHWKDWLVGLIILFXOWWRUHPRYHDQGVKRXOGQRWEHXVHGZKHQUHSURELQJ7KH VWDLQFDQLQWHUIHUHZLWKVXEVHTXHQWDQDO\VLVLIUHDFWLYHEDQGVIURPVHTXHQWLDOLPPXQRVWDLQ LQJVDUHFORVHWRJHWKHU 7UDQVIHUWR01D2+DQGZDVKPLQ :DVKEORWPLQLQGLVWLOOHGZDWHU 3URFHHGZLWKLPPXQRSURELQJSURFHGXUHVHH%DVLF3URWRFRODQG$OWHUQDWH3URWR FRO &DVHLQRUQRQIDWGU\PLONLVUHFRPPHQGHGDVEORFNLQJDJHQWZKHQUHSURELQJPHPEUDQHV 5($*(176$1'62/87,216 8VHGHLRQL]HGRUGLVWLOOHGZDWHULQDOOUHFLSHVDQGSURWRFROVWHSV)RUFRPPRQVWRFNVROXWLRQVVHH $33(1',;$IRUVXSSOLHUVVHH6833/,(56$33(1',;)RUVHOHFWLRQRIDSSURSULDWHFKURPRJHQLFRU OXPLQHVFHQWVROXWLRQVDQGIRUGHILQLWLRQRIDEEUHYLDWLRQVVHH7DEOH $ONDOLQHSKRVSKDWHVXEVWUDWHEXIIHU P07ULV⋅&OS+ P01D&O P00J&O %&,31%7YLVXDOL]DWLRQVROXWLRQ 0L[µO1%7VWRFNPJ1%7LQPODW'0)VWRUHG\HDUDW°& DQGPODONDOLQHSKRVSKDWHVXEVWUDWHEXIIHUVHHUHFLSH$GGµO%&,3VWRFN PJ%&,3LQPORI'0)VWRUHG\HDUDW°&DQGPL[6WDEOHKU DWURRPWHPSHUDWXUH 5HFLSH LV IURP +DUORZ DQG /DQH $OWHUQDWLYHO\ %&,31%7 VXEVWUDWHV PD\ EH SXUFKDVHGIURP6LJPD.LUNHJDDUG3HUU\0RVVDQG9HFWRU/DEV %ORFNLQJEXIIHU &RORULPHWULFGHWHFWLRQ )RUQLWURFHOOXORVHDQG39')YY7ZHHQLQ7%677%6$33(1',;$ )RUQHXWUDODQGSRVLWLYHO\FKDUJHGQ\ORQ7ULVEXIIHUHGVDOLQH7%6 $33(1',;$ FRQWDLQLQJZYQRQIDWGU\PLON3UHSDUHMXVWEHIRUHXVH 77%6FDQEHVWRUHG≤ZHHNDW°& ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ /XPLQHVFHQFHGHWHFWLRQ )RUQLWURFHOOXORVH39')DQGQHXWUDOQ\ORQHJ3DOO%LRG\QH$FDVHLQHJ +DPPDUVWHQJUDGHRU,%ORFN7URSL[LQ77%6$33(1',;$3UHSDUHMXVWEHIRUH XVH FRQWLQXHG &XUUHQW3URWRFROVLQ&HOO%LRORJ\ )RU SRVLWLYHO\ FKDUJHG Q\ORQ ZY FDVHLQ YY SRO\YLQ\O S\UUROLGRQH 393LQ77%6$33(1',;$:LWKFRQVWDQWPL[LQJDGGFDVHLQDQG393WRZDUP °&77%66WLUIRUPLQ&RROEHIRUHXVH3UHSDUHMXVWEHIRUHXVH &1YLVXDOL]DWLRQVROXWLRQ 0L[POLFHFROGPHWKDQROZLWKPJ&16HSDUDWHO\PL[µORI+2 ZLWKPO7%6$33(1',;$DWURRPWHPSHUDWXUH5DSLGO\PL[WKHWZRVROXWLRQV DQGXVHLPPHGLDWHO\ '$%1L&OYLVXDOL]DWLRQVROXWLRQ POP07ULV⋅&OS+$33(1',;$ µO'$%VWRFNPJPOLQ+2VWRUHGLQµODOLTXRWVDW−°& µO1L&OVWRFNPJPOLQ+2VWRUHGLQµODOLTXRWVDW−°& µO+2 0L[MXVWEHIRUHXVH &$87,21+DQGOH'$%FDUHIXOO\ZHDULQJJORYHVDQGPDVNLWLVDFDUFLQRJHQ 6XSSOLHUVRISHUR[LGDVHVXEVWUDWHVDUH6LJPD.LUNHJDDUG3HUU\0RVVDQG9HFWRU/DEV 'LR[HWDQHSKRVSKDWHVXEVWUDWHEXIIHU P00J&O 0GLHWKDQRODPLQH VRGLXPD]LGHRSWLRQDO $GMXVWWRS+ZLWK+&ODQGXVHIUHVK 7UDGLWLRQDOO\WKH$033'VXEVWUDWHEXIIHUKDVEHHQDVROXWLRQFRQWDLQLQJP00J&ODQG P0VRGLXPFDUERQDWHELFDUERQDWHS+*LOOHVSLHDQG+XGVSHWK7KHXVHRI GLHWKDQRODPLQHUHVXOWVLQEHWWHUOLJKWRXWSXW7URSL[:HVWHUQ/LJKWLQVWUXFWLRQV $OWHUQDWLYHO\P07ULV⋅&OS+P01D&OP00J&OFDQEHXVHG6DQGKXHW DO 'LR[HWDQHSKRVSKDWHYLVXDOL]DWLRQVROXWLRQ 3UHSDUH PJPO $033' RU &63' 7URSL[ RU /XPLJHQ33' /XPLJHQ VHH 7DEOHVXEVWUDWHLQGLR[HWDQHSKRVSKDWHVXEVWUDWHEXIIHUVHHUHFLSH3UHSDUH MXVWEHIRUHXVH/XPL3KRV%RHKULQJHU0DQQKHLPRU/XPLJHQLVDUHDG\WR XVHVROXWLRQDQGFDQEHDSSOLHGGLUHFWO\WRWKHPHPEUDQH 7KLVFRQFHQWUDWLRQRI$033'VXEVWUDWHµ0LVWKHPLQLPXPUHFRPPHQGHGE\7URSL[ :HVWHUQ/LJKW7HQIROGORZHUFRQFHQWUDWLRQVFDQEHXVHGEXWUHTXLUHORQJHUH[SRVXUHV /XPLQROYLVXDOL]DWLRQVROXWLRQ PO×OXPLQROVWRFN>PJOXPLQRO6LJPDLQPO'[email protected] PO×SLRGRSKHQROVWRFN>RSWLRQDOPJ$OGULFKLQPO'[email protected] POP07ULV⋅&OS+$33(1',;$ µO+2 +2WRPO 3UHSDUHMXVWEHIRUHXVH 5HFLSHLVIURP6FKQHSSHQKHLPHWDO3UHPL[HGOXPLQROVXEVWUDWHPL[0DVW,PPX QRV\VWHPV$PHUVKDP(&/'X3RQW1(15HQDLVVDQFH.LUNHJDDUG3HUU\/XPL*/2 PD\DOVREHXVHGSLRGRSKHQROLVDQRSWLRQDOHQKDQFLQJDJHQWWKDWLQFUHDVHVOLJKWRXWSXW /XPLQRODQGSLRGRSKHQROVWRFNVFDQEHVWRUHGIRU≤PRQWKVDW−°& 3RQFHDX6VROXWLRQ 'LVVROYHJ3RQFHDX6LQPOJODFLDODFHWLFDFLG%ULQJWRPOZLWKZDWHU 3UHSDUHMXVWEHIRUHXVH (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7UDQVIHUEXIIHU $GGJ7ULVEDVHDQGJJO\FLQHWROLWHUVRIZDWHU$GGPOPHWKDQRO DQGEULQJWROLWHUVZLWKZDWHU7KHS+RIWKHVROXWLRQLV∼WR)RUXVHZLWK 39') ILOWHUV GHFUHDVH PHWKDQRO FRQFHQWUDWLRQ WR IRU Q\ORQ ILOWHUV RPLW PHWKDQRODOWRJHWKHU &$36WUDQVIHUEXIIHUFDQDOVREHXVHG$GGJF\FORKH[\ODPLQRSURSDQHVXOIRQLFDFLG &$36IUHHDFLGJ'77POPHWKDQRODQGZDWHUWROLWHU$GMXVWWRS+ZLWK 1D2+DQGFKLOOWR°&)RUSURWHLQV!N'DUHGXFHPHWKDQROFRQWHQWWR0RRV &200(17$5< %DFNJURXQG,QIRUPDWLRQ ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ ,PPXQRSUHFLSLWDWLRQKDVEHHQZLGHO\XVHG WRYLVXDOL]HWKHDQWLJHQVUHFRJQL]HGE\YDULRXV DQWLERGLHV ERWK SRO\FORQDO DQG PRQRFORQDO 81,7+RZHYHUWKHUHDUHVHYHUDOSUREOHPV LQKHUHQW ZLWK WKLV PHWKRG LQFOXGLQJ WKH UH TXLUHPHQWIRUUDGLRODEHOLQJRIDQWLJHQFRSUH FLSLWDWLRQ RI WLJKWO\ DVVRFLDWHG PDFURPROH FXOHV RFFDVLRQDO GLIILFXOW\ LQ REWDLQLQJ SUH FLSLWDWLQJ DQWLERGLHV DQG LQVROXELOLW\ RI YDULRXVDQWLJHQV7DOERWHWDO 7RFLUFXPYHQWWKHVHSUREOHPVHOHFWUREORW WLQJ7RZELQHWDO¥VXEVHTXHQWO\SRSX ODUL]HGDVZHVWHUQEORWWLQJRULPPXQREORWWLQJ %XUQHWWH ¥ZDV FRQFHLYHG ,PPXQR EORWWLQJLVDUDSLGDQGVHQVLWLYHDVVD\IRUWKH GHWHFWLRQDQGFKDUDFWHUL]DWLRQRISURWHLQVWKDW ZRUNVE\H[SORLWLQJWKHVSHFLILFLW\LQKHUHQWLQ DQWLJHQDQWLERG\ UHFRJQLWLRQ ,W LQYROYHV WKH VROXELOL]DWLRQDQGHOHFWURSKRUHWLFVHSDUDWLRQRI SURWHLQVJO\FRSURWHLQVRUOLSRSRO\VDFFKDULGHV E\ 6'63$*( 81,7 RU XUHD3$*( IRO ORZHGE\TXDQWLWDWLYHWUDQVIHUDQGLUUHYHUVLEOH ELQGLQJWRQLWURFHOOXORVH39')RUQ\ORQ7KLV WHFKQLTXHKDVEHHQXVHIXOLQLGHQWLI\LQJVSH FLILF DQWLJHQV UHFRJQL]HG E\ SRO\FORQDO RU PRQRFORQDODQWLERGLHVDQGLVKLJKO\VHQVLWLYH QJRIDQWLJHQFDQEHGHWHFWHG (OHFWUREORWWLQJRISUHYLRXVO\VWDLQHGJHOVLV DFRQYHQLHQWZD\WRYLVXDOL]HDQGGRFXPHQWWKH JHOSULRUWRLPPXQREORWWLQJ7UDQVIHUHIILFLHQ FLHVDWDOOPROHFXODUZHLJKWVZLOOEHORZHUZLWK IL[HGDQGVWDLQHGJHOV7KLVLVSDUWLFXODUO\WUXH RISURWHLQV!N'D3HULGHVHWDO7KH DGGLWLRQDOLQFXEDWLRQLQ0XUHDZLOOVLJQLIL FDQWO\ LQFUHDVH WUDQVIHU HIILFLHQF\ RI DOO SUR WHLQVDQGLVUHTXLUHGIRUSURWHLQV!N'D 3RQFHDX6VWDLQLQJSURYLGHVDQHDV\PHWKRG IRUFDOLEUDWLQJDQGTXDQWLWDWLQJWKHDPRXQWRI PDWHULDORQDQLWURFHOOXORVHRU39')EORW$Q DOWHUQDWLYHWRWKLVPHWKRGLVWRXVHDQLQWHUQDO SURWHLQFRQWUROZLWKDVHSDUDWHDQWLERG\SUREH EXWWKHVHWHQGWREHH[SHQVLYHDQGWLPHFRQ VXPLQJWRXVH2WKHUDSSOLFDWLRQVIRU3RQFHDX 6FDOLEUDWLRQLQFOXGHPRQLWRULQJWUDQVIHUHIIL FLHQF\XQGHUYDULHGFRQGLWLRQVIRURSWLPL]DWLRQ RIWDQNDQGVHPLGU\EORWWLQJ ,PPXQREORWWHGSURWHLQVFDQEHGHWHFWHGE\ FKURPRJHQLFRUOXPLQHVFHQWDVVD\VVHH7DEOH IRUDGHVFULSWLRQRIWKHUHDJHQWVDYDLODEOH IRUHDFKV\VWHPWKHLUUHDFWLRQVDQGDFRPSDUL VRQ RI WKHLU DGYDQWDJHV DQG GLVDGYDQWDJHV /XPLQHVFHQW GHWHFWLRQ PHWKRGV RIIHU VHYHUDO DGYDQWDJHVRYHUWUDGLWLRQDOFKURPRJHQLFSUR FHGXUHV,QJHQHUDOOXPLQHVFHQWVXEVWUDWHVLQ FUHDVHWKHVHQVLWLYLW\RIERWK+532DQGSKRV SKDWDVHV\VWHPVZLWKRXWWKHQHHGIRUUDGLRLVR WRSHV 6XEVWUDWHV IRU WKH ODWWHU KDYH RQO\ UHFHQWO\EHHQDSSOLHGWRSURWHLQEORWWLQJVHH *LOOHVSLHDQG+XGVSHWK6DQGKXHWDO %URQVWHLQHWDO/XPLQHVFHQWGH WHFWLRQFDQEHFRPSOHWHGLQDVOLWWOHDVDIHZ VHFRQGVH[SRVXUHVUDUHO\JRPRUHWKDQKU 'HSHQGLQJ RQ WKH V\VWHP WKH OXPLQHVFHQFH FDQODVWIRUGD\VSHUPLWWLQJPXOWLSOHH[SR VXUHVRIWKHVDPHEORW)XUWKHUPRUHWKHVLJQDO LVGHWHFWHGE\ILOPDQGYDU\LQJWKHH[SRVXUH FDQUHVXOWLQPRUHRUOHVVVHQVLWLYLW\/XPLQHV FHQW EORWV FDQ EH HDVLO\ HUDVHG DQG UHSUREHG EHFDXVHWKHUHDFWLRQSURGXFWVDUHVROXEOHDQG GRQRWGHSRVLWRQWKHPHPEUDQHVHHEHORZ &RPSDUHG WR FKURPRJHQLF GHYHORSPHQW WKH OXPLQHVFHQWLPDJHUHFRUGHGRQILOPLVHDVLHUWR SKRWRJUDSKDQGWRTXDQWLWDWHE\GHQVLWRPHWU\ $ONDOLQH SKRVSKDWDVH¤EDVHG OXPLQHVFHQW SURWRFROV WKDW DFKLHYH PD[LPXP VHQVLWLYLW\ ZLWK PLQLPXP EDFNJURXQG FDQ EH FRPSOH[ DQGWKHPDQXIDFWXUHU©VLQVWUXFWLRQVVKRXOGEH FRQVXOWHG VHH 5HDJHQWV DQG 6ROXWLRQV 7KH SURFHGXUH GHVFULEHG LQ $OWHUQDWH 3URWRFRO JLYHVUHDVRQDEOHVHQVLWLYLW\RQQLWURFHOOXORVH 39')DQGQ\ORQPHPEUDQHVZLWKDPLQLPXP RIVWHSV &ULWLFDO3DUDPHWHUV )LUVWDQGIRUHPRVWWKHDQWLERG\EHLQJXVHG VKRXOGUHFRJQL]HGHQDWXUHGDQWLJHQ1RQVSH FLILFELQGLQJRIDQWLERGLHVFDQRFFXUVRFRQWURO DQWLJHQVDQGDQWLERGLHVVKRXOGDOZD\VEHUXQ LQSDUDOOHO7LPHRIWUDQVIHUDQGSULPDU\DQWL &XUUHQW3URWRFROVLQ&HOO%LRORJ\ ERG\DQGFRQMXJDWHGLOXWLRQVVKRXOGDOZD\VEH RSWLPL]HG $ YDULHW\ RI DJHQWV DUH FXUUHQWO\ XVHG WR EORFNELQGLQJVLWHVRQWKHPHPEUDQHDIWHUEORW WLQJ+DUORZDQG/DQH7KHVHLQFOXGH 7ZHHQ393QRQIDWGU\PLONFDVHLQ%6$ DQGVHUXP$YYVROXWLRQRI7ZHHQ LQ 7%6 77%6 D FRQYHQLHQW DOWHUQDWLYH WR SURWHLQEDVHG EORFNLQJ DJHQWV LV UHFRP PHQGHG IRU FKURPRJHQLF GHYHORSPHQW RI QL WURFHOOXORVH DQG 39') PHPEUDQHV%ODNHHW DO,QFRQWUDVWWRGU\PLON7%6EORFNLQJ VROXWLRQ%/277277%6LVVWDEOHDQGKDVD ORQJVKHOIOLIHDW°&)XUWKHUPRUH77%6JHQ HUDOO\SURGXFHVDFOHDQEDFNJURXQGDQGSHUPLWV VXEVHTXHQWVWDLQLQJZLWK,QGLDLQN+RZHYHU HYHQ ZLWK WKH DSSOLFDWLRQ RI VXFK VWDQGDUG EORFNLQJSURFHGXUHVDVWRPLONSURWHLQ RUWR7ZHHQEDFNJURXQGFDQ VWLOOEHDVLJQLILFDQWSUREOHP,IWKLVKDSSHQV XVLQJDEORFNLQJSURWHLQHJJRDWKRUVHRU UDEELWQRUPDOVHUXPIURPWKHVDPHVSHFLHVDV WKH SULPDU\ DQWLERG\ FDQ UHGXFH WKH EDFN JURXQGSUHVXPDEO\E\UHGXFLQJFURVVUHDFWLY LW\ EHWZHHQ WKH SULPDU\ DQWLERGLHV DQG WKH EORFNLQJ DJHQW &RPELQDWLRQV RI EORFNLQJ DJHQWVFDQDOVREHHIIHFWLYH7KXVKXPDQ VHUXPDOEXPLQ+6$DQG7ZHHQLQ 7%6 LV UHFRPPHQGHG ZKHQ SURELQJ ,PPR ELORQ3PHPEUDQHVZLWKKXPDQVHUXP&UDLJ HW DO +RZHYHU WKLV FDQ DOVR OHDG WR RYHUDOOORVVRIDQWLJHQVLJQDOUHTXLULQJDWHQ IROGLQFUHDVHLQWKHSULPDU\DQWLERG\VHUXP FRQFHQWUDWLRQ WR DFKLHYH DQ DGHTXDWH EDFN JURXQGIUHHDQWLJHQVLJQDO :KHQXVLQJFKHPLOXPLQHVFHQWGHWHFWLRQIRU LPPXQREORWWLQJ KLJK EDFNJURXQG IUHTXHQWO\ RFFXUVSDUWLFXODUO\IRUVWURQJVLJQDOV3DPSRUL HWDO6HYHUDOPHWKRGVDUHDYDLODEOHIRU UHGXFLQJWKHEDFNJURXQGIURPFKHPLOXPLQHV FHQWUHDFWLRQV7KHVHLQFOXGHFKDQJLQJWKHW\SH DQG FRQFHQWUDWLRQ RI EORFNLQJ DJHQWV VHH DERYH RSWLPL]LQJ DQWLERG\ FRQFHQWUDWLRQV OHWWLQJWKHUHDFWLRQSURFHHGIRUVHYHUDOPLQXWHV EHIRUHH[SRVLQJWRILOPRUVLPSO\OLPLWLQJWKH H[SRVXUH WLPH RI WKH ILOP RQ WKH EORW 7KHVH SURFHGXUHVDUHQRWDOZD\VVXFFHVVIXOKRZHYHU DQGFDQOHDGWRLQFRQVLVWHQWUHVXOWV$QDOWHUQD WLYHDSSURDFKLVWRUHGXFHWKHFRQFHQWUDWLRQRI UHDJHQWVWHQIROG7KLVHIIHFWLYHO\UHPRYHVWKH EDFNJURXQG DQG KDV D QXPEHU RI DGYDQWDJHV ZKLFKLQFOXGHORZHUFRVWLQFUHDVHGVLJQDOWR QRLVHUDWLRDQGUHGXFHGGHWHFWLRQRIFURVVUH DFWLQJVSHFLHV 7ZRW\SHVRIQ\ORQPHPEUDQHDUHXVHGIRU ZHVWHUQ WUDQVIHU¥QHXWUDO HJ 3DOO %LRG\QH $DQGSRVLWLYHO\FKDUJHGHJ3DOO%LRG\QH % $OWKRXJK WKH SRVLWLYHO\ FKDUJHG PHP EUDQHVKDYHYHU\JRRGSURWHLQELQGLQJFKDUDF WHULVWLFVWKH\WHQGWRJLYHDKLJKHUEDFNJURXQG 7KHVH PHPEUDQHV UHPDLQ SRVLWLYHO\ FKDUJHG IURPS+WRS+1HXWUDOQ\ORQPHPEUDQHV DUHDOVRFKDUJHGKDYLQJDPL[RIDPLQRDQG FDUER[\OJURXSVWKDWJLYHDQLVRHOHFWULFSRLQW RI%HFDXVHRIWKHLUKLJKELQGLQJFDSDFLW\ SRVLWLYHO\FKDUJHGPHPEUDQHVDUHSRSXODUIRU SURWHLQDSSOLFDWLRQVXVLQJOXPLQHVFHQFH 1\ORQ PHPEUDQHV UHTXLUH PRUH VWULQJHQW EORFNLQJVWHSV+HUHQRQIDWGU\PLONLQ 7%6LVUHFRPPHQGHGIRUFKURPRJHQLFGHYHO RSPHQW 'XULQJ OXPLQHVFHQFH GHYHORSPHQW KRZHYHU EDFNJURXQG LV D PRUH VLJQLILFDQW SUREOHP&RPSDUHGWRGU\PLONSXULILHGFDVHLQ KDVPLQLPDOHQGRJHQRXVDONDOLQHSKRVSKDWDVH DFWLYLW\$3DFWLYLW\OHDGVWRKLJKEDFNJURXQG DQG LV WKHUHIRUH UHFRPPHQGHG DV D EORFNLQJ DJHQW IRU QLWURFHOOXORVH 39') DQG Q\ORQ PHPEUDQHV3RVLWLYHO\FKDUJHGQ\ORQUHTXLUHV PXFKPRUHVWULQJHQWEORFNLQJZLWKZY FDVHLQ DQG YY SRO\YLQ\OS\UUROLGRQH 393%HFDXVHQRQIDWGU\PLONDQGFDVHLQPD\ FRQWDLQELRWLQWKDWZLOOLQWHUIHUHZLWKDYLGLQ ELRWLQ UHDFWLRQV VXEVHTXHQW VWHSV DUH GRQH ZLWKRXW SURWHLQEORFNLQJ DJHQWV ZKHQ XVLQJ WKHVH V\VWHPV ,I EDFNJURXQG LV D SUREOHP KLJKO\SXULILHGFDVHLQWRDGGHGWR WKHDQWLERG\LQFXEDWLRQEXIIHUVPD\KHOS ,IUHSURELQJLVGHVLUHGEORWVFDQEHDLUGULHG DQGVWRUHGDW°&IRUPRQWKVDIWHUFKHPLOX PLQHVFHQFHGHWHFWLRQ$IWHUGU\LQJVWRUHLQD VHDOHGIUHH]HUEDJXQWLOXVH5HSHDWHGSURELQJ ZLOO OHDG WR D JUDGXDO ORVV RI VLJQDO DQG LQ FUHDVHGEDFNJURXQG+RZHYHUWKLVZLOOGHSHQG LQSDUWRQWKHSURSHUWLHVRIWKHVDPSOH ,IWKHSULPDU\SURFHGXUHLVSUREOHPDWLFGXH WRORVVRIVHQVLWLYLW\RUDQLQFUHDVHLQWKHEDFN JURXQG WKHQ WZR SRVVLEOH DOWHUQDWLYH SURFH GXUHV IRU VWULSSLQJ PHPEUDQHV DUH UHFRP PHQGHG7KHILUVWXVHVPHUFDSWRHWKDQRODQG 6'6.DXIPDQQHWDO7HVIDLJ]LHWDO %ULHIO\WKHPHPEUDQHVDUHLQFXEDWHGLQ 6'6 P0 7ULV⋅&O S+ P0 PHUFDSWRHWKDQROIRUPLQDW°&HIIHF WLYHO\ UHPRYLQJ SULPDU\ DQG VHFRQGDU\ DQWL ERGLHV$VZLWKWKHSULPDU\SURFHGXUHUHFRP PHQGHGDERYHWKHUHSHDWHGSURELQJVKRXOGEH GRQHZLWKFDXWLRQGXHWRWKHSRWHQWLDOORVVRI GHWHFWLRQ VLJQDO DQG QRQIDW GU\ PLON LV UHTXLUHGDVDEORFNLQJDJHQW7KHPLONEORFNLQJ DJHQWIDFLOLWDWHVDQWLERG\UHPRYDOIURPWKHEORW .DXIPDQQ HW DO 7KH VHFRQG XVHV JXDQLGLQH⋅+&O )RU Q\ORQ DQG 39') PHP EUDQHVGRQRWXVHZLWKQLWURFHOOXORVHLQFX EDWHWKHLPPXQREORWLQ0JXDQLGLQH⋅+&OIRU (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ PLQDWURRPWHPSHUDWXUH7KHVKRUWZDVK WLPH LV FULWLFDO DV JXDQLGLQH⋅+&O LV D YHU\ VWURQJGHQDWXUDQWVRGRQRWOHDYHWKHILOWHULQ WKLVVROXWLRQ!PLQ3RXURIIH[FHVVJXDQL GLQH⋅+&ODQGWKHQULQVHWKHPHPEUDQHVHYHUDO WLPHVLQ×77%65HEORFNWKHPHPEUDQHDQG SURFHHGZLWKWKHVWDQGDUGLPPXQREORWWLQJSUR FHGXUH0HPEUDQHVVWULSSHGXVLQJWKLVSURFH GXUHFDQJHQHUDOO\EHUHXVHGWKUHHRUIRXUWLPHV 7URXEOHVKRRWLQJ ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ 7KHUHDUHVHYHUDOSUREOHPVDVVRFLDWHGZLWK LPPXQREORWWLQJ7KHDQWLJHQLVVROXELOL]HGDQG HOHFWURSKRUHVHGLQWKHSUHVHQFHRIGHQDWXULQJ DJHQWVHJ6'6RUXUHDDQGVRPHDQWLERGLHV PD\QRWUHFRJQL]HWKHGHQDWXUHGIRUPRIWKH DQWLJHQWUDQVIHUUHGWRWKHPHPEUDQH7KHUH VXOWV REVHUYHG PD\ EH HQWLUHO\ GHSHQGHQW RQ WKHGHQDWXUDWLRQDQGWUDQVIHUV\VWHPXVHG)RU H[DPSOH ]ZLWWHULRQLF GHWHUJHQWV KDYH EHHQ VKRZQWRUHVWRUHWKHDQWLJHQLFLW\RIRXWHUPHP EUDQH SURWHLQV LQ LPPXQREORWWLQJ 0DQGUHOO DQG=ROOLQJHU*HOHOHFWURSKRUHVLVXQGHU QRQGHQDWXULQJ FRQGLWLRQV FDQ DOVR EH SHU IRUPHG 2WKHUSRWHQWLDOSUREOHPVLQFOXGHKLJKEDFN JURXQGQRQVSHFLILFRUZHDNFURVVUHDFWLYLW\RI DQWLERGLHVSRRUSURWHLQWUDQVIHURUPHPEUDQH ELQGLQJHIILFLHQF\DQGLQVXIILFLHQWVHQVLWLYLW\ )RUDQH[WHQVLYHVXUYH\DQGGLVFXVVLRQRILP PXQREORWWLQJSUREOHPVDQGDUWLIDFWVVHH%MHU UXPHWDO ,IQRWUDQVIHURISURWHLQKDVRFFXUUHGFKHFN WKHSRZHUVXSSO\DQGHOHFWUREORWDSSDUDWXVWR PDNHVXUHWKDWWKHSURSHUHOHFWULFDOFRQQHFWLRQV ZHUHPDGHDQGWKDWSRZHUZDVGHOLYHUHGGXULQJ WUDQVIHU,QDGGLWLRQFKHFNWKDWWKHFRUUHFWRUL HQWDWLRQRIILOWHUDQGJHOUHODWLYHWRWKHDQRGH DQGFDWKRGHHOHFWURGHVZDVXVHG ,IWKHWUDQVIHUHIILFLHQF\XVLQJWKHWDQNV\V WHPDSSHDUVWREHORZLQFUHDVHWKHWUDQVIHUWLPH RU SRZHU &RROLQJ XVLQJ WKH XQLW©V EXLOWLQ FRROLQJFRUHVLVJHQHUDOO\UHTXLUHGIRUWUDQV IHUV!KU$WQRWLPHVKRXOGWKHEXIIHUWHP SHUDWXUH JR DERYH °& 3URORQJHG WUDQVIHUV !KUDUHQRWSRVVLEOHLQVHPLGU\WUDQVIHUXQLWV GXHWRUDSLGEXIIHUGHSOHWLRQ $OWHUQDWLYHO\ WKH WUDQVIHU EXIIHU FDQ EH PRGLILHGWRLQFUHDVHHIILFLHQF\$GGLQJ6'6DW DFRQFHQWUDWLRQRIWRWKHWUDQVIHUEXIIHU LPSURYHVWKHWUDQVIHURIDOOSURWHLQVRXWRIWKH JHOSDUWLFXODUO\WKRVHDERYHWRN'LQVL]H /RZHULQJ WKH FRQFHQWUDWLRQ RI PHWKDQRO ZLOO DOVRLPSURYHWKHUHFRYHU\RISURWHLQVIURPWKH JHO7KHVHSURFHGXUHVDUHWUDGHRIIV0HWKDQRO LPSURYHVWKHELQGLQJRISURWHLQVWR39')DQG QLWURFHOOXORVH EXW DW WKH VDPH WLPH KLQGHUV WUDQVIHU:LWK6'6SUHVHQWWUDQVIHUHIILFLHQF\ LV LPSURYHG EXW WKH 6'6 FDQ LQWHUIHUH ZLWK SURWHLQ ELQGLQJ WRWKHPHPEUDQH1\ORQDQG 39')PHPEUDQHVDUHSDUWLFXODUO\VHQVLWLYHWR 6'6LQWHUIHUHQFH,IQHHGHGWR 6'6PD\EHXVHGLQ39')PHPEUDQHWUDQVIHU EXIIHUV0LOOLSRUH6'6DQGPHWKDQRO VKRXOG QRW EH XVHG LQ WKH WUDQVIHU EXIIHU IRU Q\ORQ3HOXVRDQG5RVHQEHUJ *HOFURVVOLQNLQJDQGWKLFNQHVVDOVRKDYHD SURIRXQG HIIHFW RQ WKH WUDQVIHU HIILFLHQF\ ,Q JHQHUDOWRPPWKLFNJHOVZLOOWUDQV IHU PXFK PRUH HIILFLHQWO\ WKDQ WKLFNHU JHOV HJPPWKLFN*HOVZLWKDKLJKHUDFU\O DPLGH SHUFHQWDJH ZLOO DOVR WUDQVIHU OHVV HIIL FLHQWO\3URWHLQVFDQEHSDUWLFXODUO\GLIILFXOWWR WUDQVIHUIURPJUDGLHQWJHOVDQGDFRPELQDWLRQ RI ORQJHU WUDQVIHU WLPHV WKLQ JHOV DQG WKH DGGLWLRQRI6'6WRWKHWUDQVIHUEXIIHUPD\EH QHHGHG ,IWKHSURWHLQEDQGVDUHGLIIXVHFKHFNWKH WUDQVIHUFDVVHWWH7KHJHOPXVWEHKHOGILUPO\ DJDLQVW WKH PHPEUDQH GXULQJ WUDQVIHU ,I WKH WUDQVIHUVDQGZLFKLVORRVHLQWKHFDVVHWWHDGG DQRWKHU WKLQ VSRQJH RU PRUH EORWWHU SDSHU WR ERWKVLGHV 2FFDVLRQDOO\DJULGSDWWHUQZLOOEHDSSDUHQW RQ WKH PHPEUDQH DIWHU WDQN WUDQVIHU 7KLV LV FDXVHGE\KDYLQJHLWKHUWKHJHORUWKHPHPEUDQH WRRFORVHWRWKHVLGHVRIWKHFDVVHWWH&RUUHFW WKLV E\ DGGLQJ PRUH OD\HUV RI ILOWHU SDSHU WR GLIIXVHWKHFXUUHQWIORZLQJWKURXJKWKHJHODQG PHPEUDQH 8VH D WKLQQHU VSRQJH DQG PRUH ILOWHUSDSHULIQHFHVVDU\ ,IDLUEXEEOHVDUHWUDSSHGEHWZHHQWKHILOWHU DQGWKHJHOWKH\ZLOODSSHDUDVFOHDUZKLWHDUHDV RQ WKH ILOWHU DIWHU EORWWLQJ DQG VWDLQLQJ 7DNH H[WUD FDUH WR PDNH VXUH WKDW DOO EXEEOHV DUH UHPRYHG ,QVXIILFLHQWEORFNLQJRUQRQVSHFLILFELQGLQJ RIWKHSULPDU\RUVHFRQGDU\DQWLERG\ZLOOFDXVH DKLJKEDFNJURXQGVWDLQ$FRQWUROXVLQJSUH LPPXQHVHUXPRURQO\WKHVHFRQGDU\DQWLERG\ ZLOOGHWHUPLQHLIWKHVHSUREOHPVDUHGXHWRWKH SULPDU\ DQWLERG\ 7U\ VZLWFKLQJ WR DQRWKHU EORFNLQJ DJHQW SURWHLQ EORFNLQJ DJHQWV PD\ ZHDNO\ FURVVUHDFW /RZHULQJ WKH FRQFHQWUD WLRQRISULPDU\DQWLERG\VKRXOGGHFUHDVHEDFN JURXQGDQGLPSURYHVSHFLILFLW\)LJ 'XHWRWKHQDWXUHRIOLJKWDQGWKHPHWKRGRI GHWHFWLRQ FHUWDLQ SUHFDXWLRQV DUH ZDUUDQWHG ZKHQ XVLQJ OXPLQHVFHQW YLVXDOL]DWLRQ HJ +DUSHUDQG0XUSK\9HU\VWURQJVLJQDOV FDQRYHUVKDGRZQHDUE\ZHDNHUVLJQDOVRQWKH PHPEUDQH%HFDXVHOLJKWZLOOSLSHWKURXJKWKH PHPEUDQH DQG WKH VXUURXQGLQJ SODVWLF ZUDS RYHUH[SRVXUHZLOOSURGXFHDEURDGGLIIXVHLP &XUUHQW3URWRFROVLQ&HOO%LRORJ\ DJHRQWKHILOP7KHVLJQDOFDQDOVRVDWXUDWHWKH ILOP H[SRVLQJ WKH ILOP WR D SRLQW ZKHUHE\ LQFUHDVHGH[SRVXUHZLOOQRWFDXVHDOLQHDULQ FUHDVHLQWKHGHQVLW\RIWKHLPDJHRQWKHILOP :LWK WKH DONDOLQH SKRVSKDWDVH VXEVWUDWH $033' QLWURFHOOXORVH 39') DQG Q\ORQ PHPEUDQHVUHTXLUHDQGWRKUUHVSHF WLYHO\ WR UHDFK PD[LPXP OLJKW HPLVVLRQ ,Q DGGLWLRQ39')LVUHSRUWHGWRJLYHDVWURQJHU VLJQDO WKDQ QLWURFHOOXORVH 7URSL[ :HVWHUQ /LJKW LQVWUXFWLRQV 3RVLWLYHO\ FKDUJHG Q\ORQ UHTXLUHVVSHFLDOEORFNLQJSURFHGXUHVWRPLQL PL]H EDFNJURXQG *LOOHVSLH DQG +XGVSHWK 7KHVHSURFHGXUHVLQFOXGHXVLQJDEORFN LQJDQGSULPDU\DQWLERG\VROXWLRQFRQWDLQLQJ FDVHLQSRO\YLQ\OS\UUROLGRQH393 P01D1P0('7$DQG3%6S+ 3ULRUWRXVHWKHFDVHLQPXVWEHKHDWHGWR °&WRUHGXFHDONDOLQHSKRVSKDWDVHDFWLYLW\LQ WKHFDVHLQLWVHOI,QDGGLWLRQPD[LPXPVHQVL WLYLW\ KDV EHHQ REVHUYHG ZKHQ IUHH ELRWLQ RU ELRWLQ\ODWHGSURWHLQVDUHUHPRYHGE\SUHWUHDW LQJWKHFDVHLQZLWKDYLGLQDJDURVH6LJPD $QWLFLSDWHG5HVXOWV ,PPXQREORWWLQJVKRXOGUHVXOWLQWKHGHWHF WLRQRIRQHRUPRUHEDQGV$OWKRXJKDQWLERGLHV GLUHFWHGDJDLQVWDVLQJOHSURWHLQVKRXOGSURGXFH DVLQJOHEDQGGHJUDGDWLRQRIWKHVDPSOHHJ YLDHQGRJHQRXVSURWHRO\WLFDFWLYLW\PD\FDXVH YLVXDOL]DWLRQRIPXOWLSOHEDQGVRIVOLJKWO\GLI IHUHQWVL]H0XOWLPHUVZLOODOVRIRUPVSRQWDQH RXVO\FDXVLQJKLJKHUPROHFXODUZHLJKWEDQGV RQWKHEORW,IVLPXOWDQHRXVO\WHVWLQJPXOWLSOH DQWLERGLHVGLUHFWHGDJDLQVWDFRPSOH[SURWHLQ PL[WXUHHJXVLQJSDWLHQWVHUDDJDLQVW6'6 3$*(VHSDUDWHGYLUDOSURWHLQVLQ$,'6ZHVW HUQEORWWHVWPXOWLSOHEDQGVZLOOEHYLVXDOL]HG 7\SLFDOO\SLFRJUDPWRQDQRJUDPVHQVLWLYLWLHV DUHFRPPRQLQSURWHLQEORWWLQJDQGLPPXQRGH WHFWLRQSURFHGXUHV 7LPH&RQVLGHUDWLRQV 7KH HQWLUH LPPXQREORWWLQJ SURFHGXUH FDQ EH FRPSOHWHG LQ WR GD\V GHSHQGLQJ RQ WUDQVIHUWLPHDQGW\SHRIJHO*HOHOHFWURSKRUH VLVUHTXLUHVWRKURQDUHJXODUJHODQGKU RQDPLQLJHO7UDQVIHUWLPHFDQEHKUKLJK SRZHUWUDQVIHUWRRYHUQLJKW%ORFNLQJFRQMX JDWHLQFXEDWLRQDQGZDVKLQJHDFKWDNHPLQ WRKU)LQDOO\VXEVWUDWHLQFXEDWLRQUHTXLUHV WRPLQFKURPRJHQDQGDIHZVHFRQGVWR VHYHUDOKRXUVOXPLQHVFHQFH /LWHUDWXUH&LWHG %MHUUXP2-/DUVHQ.3DQG+HHJDDUG1++ 1RQVSHFLILF ELQGLQJ DQG DUWLIDFWVVSHFL ILFLW\SUREOHPVDQGWURXEOHVKRRWLQJZLWKDQDWODV RILPPXQREORWWLQJDUWLIDFWV,Q&5&+DQGERRN RI,PPXQREORWWLQJRI3URWHLQV9RO,7HFKQLFDO 'HVFULSWLRQV 2- %MHUUXP DQG 1++ +HHJDDUGHGVSS&5&3UHVV%RFD 5DWRQ)OD %ODNH 06 -RKQVWRQ .+ 5XVVHOO-RQHV *- DQG *RWVFKOLFK (& $ UDSLG VHQVLWLYH PHWKRG IRU GHWHFWLRQ RI DONDOLQH SKRVSKDWDVH¤ FRQMXJDWHGDQWLDQWLERG\RQ:HVWHUQEORWV$QDO %LRFKHP %URQVWHLQ,9R\WD-&0XUSK\2-%UHVQLFN /DQG.ULFND/-,PSURYHGFKHPLOXPL QHVFHQW :HVWHUQ EORWWLQJ SURFHGXUH %LR7HFK QLTXHV %XUQHWWH :1 :HVWHUQ EORWWLQJ (OHFWUR SKRUHWLF WUDQVIHU RI SURWHLQV IURP VRGLXP GR GHF\OVXOIDWHSRO\DFU\ODPLGHJHOVWRXQPRGLILHG QLWURFHOOXORVH DQG UDGLRJUDSKLF GHWHFWLRQ ZLWK DQWLERG\ DQG UDGLRLRGLQDWHG SURWHLQ $ $QDO %LRFKHP &UDLJ:<3RXOLQ6(&ROOLQV0)/HGXH7% DQG5LWFKLH5)%DFNJURXQGVWDLQLQJLQ LPPXQREORWDVVD\V5HGXFWLRQRIVLJQDOFDXVHG E\FURVVUHDFWLYLW\ZLWKEORFNLQJDJHQWV-,P PXQRO0HWKRGV 'LRQLVL+0&KHFD6.DQG9LDOH$0 3URWHLQ LPPXQREORWWLQJ RI VWDLQHG JHOV %LR7HFKQLTXHV *LOOHVSLH3*DQG+XGVSHWK$-&KHPLOX PLQHVFHQFH GHWHFWLRQ RI SURWHLQV IURP VLQJOH FHOOV 3URF 1DWO $FDG 6FL 86$ +DUORZ(DQG/DQH',PPXQREORWWLQJ,Q $QWLERGLHV$/DERUDWRU\0DQXDOSS &6+/DERUDWRU\&ROG6SULQJ+DUERU1< +DUSHU '5 DQG 0XUSK\ * 1RQXQLIRUP YDULDWLRQLQEDQGSDWWHUQZLWKOXPLQROKRUVHUDG LVKSHUR[LGDVH:HVWHUQEORWWLQJ$QDO%LRFKHP .DXIPDQQ 6+ (ZLQJ &0 DQG 6KDSHU -+ 7KHHUDVDEOH:HVWHUQEORW$QDO%LRFKHP .OHLQ ' .HUQ 50 DQG 6RNRO 5= $ PHWKRGIRUTXDQWLILFDWLRQDQGFRUUHFWLRQRISUR WHLQV DIWHU WUDQVIHU WR LPPRELOL]DWLRQ PHP EUDQHV%LRFKHP0RO%LRO,QW 0DQGUHOO 5( DQG =ROOLQJHU :' 8VH RI ]ZLWWHULRQLFGHWHUJHQWIRUWKHUHVWRUDWLRQRIDQWL ERG\ELQGLQJFDSDFLW\RIHOHFWUREORWWHGPHQLQ JRFRFFDORXWHUPHPEUDQHSURWHLQV-,PPXQRO 0HWKRGV 0F.LPP%UHVFKNLQ -/ 7KH XVH RI WHWUD PHWK\OEHQ]LGLQHIRUVROLGSKDVHLPPXQRDVVD\V -,PPXQRORJLFDO0HWKRGV 0LOOLSRUH3URWHLQEORWWLQJSURWRFROVIRU,P PRELORQ3WUDQVIHUPHPEUDQH%HGIRUG0DVV (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 0RRV0,VRODWLRQRISURWHLQVIRUPLFURVH TXHQFHDQDO\VLV,Q&XUUHQW3URWRFROVLQ,PPX QRORJ\ -( &ROLJDQ $0 .UXLVEHHN '+ 0DUJXOLHV(06KHYDFKDQG:6WUREHUHGV SS*UHHQH3XEOLVKLQJ$VVRFLDWHV DQG-RKQ:LOH\6RQV1HZ<RUN .H\5HIHUHQFHV 3DPSRUL1$3DPSRUL0.DQG6KDSLUR%+ 'LOXWLRQ RI WKH FKHPLOXPLQHVFHQFH UH DJHQWVUHGXFHVWKHEDFNJURXQGQRLVHRQ:HVWHUQ EORWV%LR7HFKQLTXHV 'HVFULEHVWKHVHPLGU\EORWWLQJV\VWHP 3HOXVR5:DQG5RVHQEHUJ*+4XDQWLWD WLYHHOHFWURWUDQVIHURISURWHLQVIURPVRGLXPGR GHF\OVXOIDWHSRO\DFU\ODPLGHJHOVRQWRSRVLWLYHO\ FKDUJHG Q\ORQ PHPEUDQHV $QDO %LRFKHP 3HULGHV*3ODJHQV8DQG7UDXE33URWHLQ WUDQVIHUIURPIL[HGVWDLQHGDQGGULHGSRO\DFU\ ODPLGH JHOV DQG LPPXQREORW ZLWK SURWHLQ $¤ JROG$QDO%LRFKHP 6DQGKX*6(FNORII%:DQG.OLQH%& &KHPLOXPLQHVFHQWVXEVWUDWHVLQFUHDVHVHQVLWLY LW\ RI DQWLJHQ GHWHFWLRQ LQ :HVWHUQ EORWV %LR 7HFKQLTXHV 6FKQHSSHQKHLP5%XGGH8'DKOPDQQ1DQG 5DXWHQEHUJ 3 /XPLQRJUDSK\¥D QHZ KLJKO\VHQVLWLYHYLVXDOL]DWLRQPHWKRGIRUHOHFWUR SKRUHVLV(OHFWURSKRUHVLV %MHUUXP2-DQG6FKDIHU1LHOVHQ&%XIIHU V\VWHPV DQG WUDQVIHU SDUDPHWHUV IRU VHPLGU\ HOHFWUREORWWLQJ ZLWK D KRUL]RQWDO DSSDUDWXV ,Q (OHFWURSKRUHVLV © 0- 'XQQ HG SS 9&+3XEOLVKHUV'HHUILHOG%HDFK)OD *LOOHVSLHDQG+XGVSHWK6HHDERYH 'HVFULEHVDONDOLQHSKRVSKDWDVH¤OXPLQHVFHQWGHWHF WLRQPHWKRGV +DUORZDQG/DQH6HHDERYH 'HWDLOVDOWHUQDWLYHGHWHFWLRQPHWKRGV 6DOLQRYLFK2DQG0RQWHODUR5&5HYHUV LEOH VWDLQLQJ DQG SHSWLGH PDSSLQJ RI SURWHLQV WUDQVIHUUHGWRQLWURFHOOXORVHDIWHUVHSDUDWLRQE\ VRGLXPGRGHF\OVXOIDWHSRO\DFU\ODPLGHJHOHOHF WURSKRUHVLV$QDO%LRFKHP 'HVFULEHV WKH XVH RI 3RQFHDX 6 VWDLQLQJ IRU LP PXQREORWWLQJ 6FKQHSSHQKHLPHWDO6HHDERYH 'HWDLOV SHUR[LGDVHEDVHG OXPLQHVFHQW GHWHFWLRQ PHWKRGV 6XFN 5:/ DQG .UXSLQVND . 5HSHDWHG SURELQJRI:HVWHUQEORWVREWDLQHGIURP&RRPDV VLH%ULOOLDQW%OXH¤VWDLQHGRUXQVWDLQHGSRO\DFU\ ODPLGHJHOV%LR7HFKQLTXHV &RQWULEXWHGE\6HDQ5*DOODJKHU 0RWRUROD&RUSRUDWLRQ 7HPSH$UL]RQD 7DOERW 39 .QREOHU 5/ DQG %XFKPHLHU 0 :HVWHUQDQGGRWLPPXQREORWWLQJDQDO\VLV RIYLUDODQWLJHQVDQGDQWLERGLHV$SSOLFDWLRQWR PXULQH KHSDWLWLV YLUXV - ,PPXQRO 0HWKRGV 6FRWW(:LQVWRQDQG6WHYHQ$ )XOOHUWDQNWUDQVIHUV\VWHPV 8QLYD[%LRORJLFV 5RFNYLOOH0DU\ODQG 7HVIDLJ]L-6PLWK+DUULVRQ:DQG&DUOVRQ'0 $VLPSOHPHWKRGIRUUHXVLQJZHVWHUQEORWV RQ 39') PHPEUDQHV %LR7HFKQLTXHV -RKQ*5+XUUHOOWDQNWUDQVIHUV\VWHPV UHYHUVLEOHVWDLQLQJRISURWHLQV %RHKULQJHU0DQQKHLP%LRFKHPLFDOV ,QGLDQDSROLV,QGLDQD 7RZELQ + 6WDHKHOLQ 7 DQG *RUGRQ - (OHFWURSKRUHWLF WUDQVIHU RI SURWHLQV IURP SRO\DFU\ODPLGH JHOV WR QLWURFHOOXORVH VKHHWV 3URFHGXUH DQG VRPH DSSOLFDWLRQV 3URF 1DWO $FDG6FL86$ ,PPXQREORWWLQJ DQG ,PPXQRGHWHFWLRQ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ Detection and Quantitation of Radiolabeled Proteins in Gels and Blots UNIT 6.3 This unit presents procedures for visualizing and quantitating radiolabeled proteins separated by sodium dodecyl sulfate–polyacrylamide gel electrophoresis (SDS-PAGE; UNIT 6.1) or affixed to filter membranes. Autoradiography (see Basic Protocol) is the most common method by which this is accomplished, and X-ray film is the traditional recording medium. The use of autoradiography with gels requires that the gel be dried prior to being placed in contact with the film (see Support Protocol 1). The decay of radioactive materials within the dried gel or filter leaves an image on the film that reflects its distribution in the sample. Film images can be quantified by densitometry (see Support Protocol 4) to obtain a relative measure of the amount of radioactivity in the sample. The use of X-ray films for autoradiography, however, suffers from two drawbacks: lack of sensitivity and a limited linear range over which the image density reflects the amount of radioactivity. Lack of sensitivity can be overcome by fluorography (see Alternate Protocol 1) or by the use of intensifying screens (see Support Protocol 2), both of which enhance the radioactive signal. Ensuring that the exposure is within a linear range requires careful controls; film is often preflashed (see Support Protocol 3) to increase the linear measurement range for weakly radioactive samples, and it is important to ensure that the film not be saturated to attain strong radioactive signals. Sensitivity and linear ranges of measurement can be greatly extended by using a phosphor imaging system (see Alternate Protocol 2). Phosphor imaging also makes it much faster and easier to quantify radioactive samples. To enhance radioactive signals, solid-state scintillation is frequently employed to convert the energy released by radioactive molecules to visible light. This is accomplished in several different ways. In fluorography (see Alternate Protocol 1) organic scintillants are incorporated into the sample to increase the proportion of emitted energy detected from low-energy β particles (e.g., from 3H, 14C, and 35S). Another method uses high-density, fluorescent “intensifying screens” (see Support Protocol 2), which are placed next to the sample and used to capture the excess energy of γ rays (e.g., those produced by 125I) and high-energy β particles (e.g., from 32P). CAUTION: When working with radioactivity, take appropriate precautions to avoid contamination of the experimenter and the surroundings. Carry out the experiment and dispose of wastes in appropriately designated areas, following the guidelines provided by your local radiation safety officer (also see APPENDIX 1D). AUTORADIOGRAPHY Autoradiography uses X-ray film to visualize and quantitate radioactive molecules that have been electrophoresed through agarose or polyacrylamide gels (UNIT 6.1), hybridized to filters (e.g., immunoblots; UNIT 6.2), or chromatographed through paper or thin-layer plates. A photon of light or the β particles and γ rays released from radioactive molecules “activate” silver bromide crystals on the film emulsion. This renders them capable of being reduced through the developing process to form silver metal (a “grain”). The silver grains on the film form the image. The choice of film is critical for autoradiography. Double-coated films (e.g., Kodak X-Omat AR and Fuji RX) contain two emulsion layers on either side of a polyester support and are most commonly used for autoradiography (Laskey and Mills, 1977). Doublecoated films are ideal for detecting the high-energy β particles emitted by 32P and 125I, Contributed by Daniel Voytas and Ning Ke Current Protocols in Cell Biology (1998) 6.3.1-6.3.10 Copyright © 1998 by John Wiley & Sons, Inc. BASIC PROTOCOL Electrophoresis and Immunoblotting 6.3.1 Supplement 10 since they can penetrate the polyester support and expose both emulsion layers. These films are normally used with calcium tungstate (CaWO4) intensifying screens at reduced temperature (−70°C); they are highly sensitive to the blue light emitted by these screens. The green-light-sensitive BioMax MS film (Kodak) is a double-coated film spectrally matched to the blue- and green-light-emitting BioMax MS intensifying screen. The BioMax MS film/BioMax MS intensifying screen system normally gives greatest sensitivity to 32P (four times greater than that of X-Omat AR film with CaWO4 screens). Single-coated films, containing one emulsion layer (e.g., Kodak BioMax MR), are optimized for direct-exposure techniques with medium-energy radioisotopes (e.g., 14C, 35 S, and 33P, but not 3H). The majority of the β particles emitted by these isotopes cannot pass through the polyester support of double-coated films, and therefore the emulsion layer on the other side of the film is useless. Even though direct exposure with singlecoated films gives better clarity for medium-energy isotopes, single-coated films often require longer exposure times. Fluorography, therefore, is often used to enhance sensitivity. The blue-light-sensitive double-coated X-Omat AR film is generally used for fluorography with 2,5-diphenyloxazole (PPO; which emits at 388 nm), sodium salicylate (which emits at 420 nm), and commercial fluorographic solutions and sprays (e.g., from Amersham and DuPont NEN; which emit light in the blue end of the spectrum). Materials Fixed and dried gel (see Support Protocol 1) or filter (e.g., from immunoblotting; UNIT 6.2) Developer: Kodak developer and replenisher, prepared according to the manufacturer’s instructions, 18° to 20°C Fixer: Kodak fixer and replenisher, prepared according to the manufacturer’s instructions, 18° to 20°C Metal film cassette or paper film cassette with particle-board supports and metal binder clips Plastic wrap (e.g., Saran Wrap) X-ray film Trays to hold film processing solutions Clips for hanging film 1. In a darkroom illuminated with a safelight, place the sample (e.g., dried gel or filter) in the film cassette. Cover the sample with plastic wrap to prevent it from sticking to the film and contaminating the cassette with radioactivity. The safelight should be a bulb of <15 W that is equipped with a Kodak GBX-2 red filter (or equivalent). Fluorescent glow-in-the-dark ink (available at craft stores) is a convenient way to mark samples exposed to film. The ink can be spread on adhesive labels, which in turn are placed on the plastic wrap around the edge of the sample. If exposed to light prior to autoradiography, the ink will fluoresce and expose the film, making it possible to orient the film image on the dried gel after developing. 2. Place a sheet of X-ray film on top of the sample, then close and secure the film cassette (see Fig. 6.3.1). Detection and Quantitation of Radiolabeled Proteins in Gels and Blots If preflashed film is used for direct exposure (see Support Protocol 3), the exposed side should face the sample. Preflashed film should be used if sample is weakly radioactive or if quantitation of the radioactivity is desired. For single-coated film, the emulsion layer should face the sample. If a paper cassette is used, particle-board supports the same size as the cassette should be placed on either side and secured with the metal binder clips. This will ensure that the sample and film are held in contact and do not shift during exposure. 6.3.2 Supplement 10 Current Protocols in Cell Biology film cassette intensifying screen film sample film cassette Figure 6.3.1 Autoradiography setup: intensifying screen, film, and sample in film cassette. 3. Expose the film for the desired length of time and at the appropriate temperature. Time of exposure will depend on the strength of the radioactivity in the sample and, in most cases, will have to be determined empirically by making multiple exposures for different lengths of time. To help estimate exposure time, a Geiger counter can often be used to detect the relative amount of radioactivity in the sample. With experience, this can help alleviate the trial and error often associated with obtaining the optimum exposure. Time of exposure and use of internal controls are particularly important if quantitative comparisons between experiments are desired. 4. After exposure, return cassette to the darkroom and remove film for developing. If the film was exposed at −70°C, allow the cassette to come to room temperature before developing. This will avoid static discharge, which can cause black dots or stripes on the autoradiogram. Automated film developers are also available and can be used to develop the film. 5. Immerse the film for 5 min in 18° to 20°C developer, then wash 1 min in running water at room temperature. Shorter periods of time in developer will yield a lighter image. The amount of time in developer, therefore, can be used to roughly control intensity of the image. 6. Immerse the film for 5 min in 18° to 20°C fixer, then wash for 15 min in running water. 7. Hang the film to dry. The orientation of the film with respect to the gel can be determined by the images of the fluorescent markers. FIXING AND DRYING GELS FOR AUTORADIOGRAPHY SDS-PAGE gels containing radiolabeled proteins should be fixed and dried before exposure to film. This will prevent the gel from sticking to the film, improve the sharpness of the image, and increase sensitivity slightly. However, if the specific activity of the sample is high or the detection method is sensitive (e.g., where a phosphor imager is used; see Alternate Protocol 2), then fixing and drying the gel may not be necessary. Gel dryers are available from a number of manufacturers (e.g., Bio-Rad), most of which use heat and a vacuum to accelerate the drying process. SUPPORT PROTOCOL 1 Electrophoresis and Immunoblotting 6.3.3 Current Protocols in Cell Biology Materials Gel from SDS-PAGE (UNIT 6.1) Fixing solution: 10% (v/v) glacial acetic acid/20% (v/v) methanol in H2O Alternative fixing solution (for gels with ≥15% acrylamide or thicker than 1.5 mm): 3% (v/v) glycerol/10% (v/v) glacial acetic acid/20% (v/v) methanol in H2O Glass dish Rotary shaker Filter paper (Whatman 3MM) in sheets at least 1 to 2 cm larger than gel Plastic wrap (e.g., Saran Wrap) Gel dryer with vacuum pump 1. After electrophoresis, remove the gel and the supporting glass plates from the electrophoresis apparatus and place in a glass dish. Carefully remove the upper glass plate by gently prying apart the corners with a metal spatula. Make a notch in the upper right hand corner of the gel for orientation. Since the gel contains radiolabeled proteins, be sure to follow the necessary guidelines for handling radioactivity. Everything that comes in contact with the gel is potentially radioactive. 2a. For gels with <15% acrylamide and <1.5 mm thick: Place the glass dish in a fume hood and pour enough fixing solution into the dish to cover the gel. Place the dish on a rotary shaker and gently rotate until 5 min after all of the blue color from the bromphenol blue in the sample buffer (if used) has disappeared (∼30 min total). The bromphenol blue typically used in SDS-PAGE sample buffer will turn yellow as the acidic fixing solution diffuses into the gel. During fixing, the gel will typically slide off the lower glass plate, which can be removed. 2b. For gels with ≥15% acrylamide or >1.5 mm thick: Fix gel as in step 2a, but soak 1 hr in alternative fixing solution. The glycerol in the alternative fixing solution should help prevent cracking during drying. 3. Pour off the fixing solution and rinse the gel for a few minutes with deionized water. CAUTION: Remember that solutions that come in contact with the gel are potentially radioactive. 4. Carefully pour off the water and position the gel in the center of the glass dish. Be sure that any excess water is drained. Place a sheet of Whatman 3MM filter paper, at least 1 to 2 cm larger than the gel, over the gel. The gel will stick to the filter paper, which will allow it to be lifted and turned over with the gel side facing up. 5. Cover gel with plastic wrap. Smooth the wrap with a piece of tissue paper to remove any air bubbles or wrinkles. 6. Place a piece of filter paper on the gel support of the gel dryer to prevent contamination of the dryer by radioactivity. 7. Place the filter paper/gel/plastic wrap sandwich on the filter paper in the gel dryer with the plastic sheet facing up. Detection and Quantitation of Radiolabeled Proteins in Gels and Blots 8. Position the rubber sealing gasket of the gel dryer over the gel. Set the appropriate heat setting on the gel dryer (normally 80°C; 60°C if the gel contains a fluor). Apply the vacuum and allow the gel to dry (typically 2 hr for a gel of 1 mm thickness). 6.3.4 Current Protocols in Cell Biology Removing the gel before it is completely dry can lead to cracking; it is therefore not a good idea to rush the drying process. A rough indication of whether the gel is dry can be obtained by feeling the gel under the sealing gasket. If the gel is dry, it should be warm over the entire surface. 9. Remove gel from dryer and proceed with autoradiography (see Basic Protocol). USE OF INTENSIFYING SCREENS Intensifying screens are used to enhance the film image generated by radioactive molecules (Laskey and Mills, 1977; Laskey, 1980). They are used strictly in conjunction with strong β-emitting isotopes such as 32P or γ-emitting isotopes such as 125I. Emissions from these forms of radiation will frequently pass completely through a film, but they can be absorbed by an intensifying screen which fluoresces and exposes the film with multiple photons of light. While an intensifying screen will substantially enhance the film image as compared with direct exposure (Table 6.3.1), some loss of image resolution will occur due to light scatter. Intensifying screens are distributed by most laboratory supply companies (e.g., Fisher, Sigma, and Kodak). SUPPORT PROTOCOL 2 As shown in Figure 6.3.1, the film should be placed between the sample and the intensifying screen. Preflashed film (see Support Protocol 3) should be used if the sample is weakly radioactive or if quantitation of the radioactivity is desired. The preflashed side of the film should be placed adjacent to the intensifying screen. For very weakly radioactive samples, a second screen can be placed on the other side of the radioactive sample (i.e., screen, then sample, then film, then screen), but this causes further loss in resolution due to light scatter. Also, the sample and sample support must be sufficiently transparent to allow light from the second screen to reach the film. The film should be exposed at −70°C to stabilize the silver bromide crystals activated by the radioactivity or the light emitted from the screen. Table 6.3.1 Different Methods for Isotope Detection and Their Sensitivitiesa Isotope Methodb Sensitivityc Enhancement over direct autoradiographyd 125I S S F F F 100 50 400 400 8000 16 10.5 15 15 >100 32P 14C 35S 3H aExposures conducted at −70°C using preexposed film. bS, intensifying screen; F, fluorography using PPO. cDefined as dpm/cm2 required for detectable image (A 540 = 0.02) in 24 hr. dDirect autoradiography for comparison was performed on Kodirex film (Laskey, 1980). Electrophoresis and Immunoblotting 6.3.5 Current Protocols in Cell Biology SUPPORT PROTOCOL 3 PREFLASHING (PREEXPOSING) FILM Silver bromide crystals that are activated by light, β particles, or γ rays are highly unstable and quickly revert back to their stable form. The absorption of several photons increases their stability but does not ensure development; approximately five photons of light are required to obtain a 50% probability that any single silver bromide crystal will be developed during film processing. This inefficiency means that film images produced by very low levels of exposure will be disproportionately faint. However, two measures can be taken to maximize efficiency and linearity of exposure at the low levels commonly encountered in ordinary use. First, the film should be preexposed to a hypersensitizing flash of light, which provides several photons per silver bromide crystal and stably activates them without providing enough exposure to cause them to become developed. This allows a linear relationship to be drawn between the film image and the amount of radioactivity in the sample. Second, film exposure should be conducted at low temperatures (−70°C) to slow the reversal of activated silver bromide crystals to their stable form (Laskey and Mills, 1975). Film can be hypersensitized by exposure to a flash of light (<1 msec) provided by a photographic flash unit or a stroboscope before being placed onto the radioactive sample for exposure of the autoradiogram (Laskey and Mills, 1975, 1977). As the optimal light intensity required for preexposure varies with the type of film and the flash unit being used, the ideal exposure is best determined empirically as described below. Materials Stroboscope or flash unit (e.g., Auto 22 Electronic Flash from Vivitar or Sensitize Pre-Flash from Amersham Pharmacia Biotech) Neutral-density filter (Kodak) Orange filter (Wratten 22; Kodak) X-ray film Spectrophotometer 1. Cover the stroboscope or flash unit with the neutral-density and orange filter. This serves to decrease the intensity of emitted light, particularly the blue wavelengths to which X-ray films are most sensitive. Filters are not required for the Amersham flash unit. 2. Place the film perpendicular to the light source at a distance of ≥50 cm to ensure uniform illumination. 3. Expose a series of test films for different flash lengths, then develop them (see Basic Protocol). An uneven fog level on film can be remedied by placing a porous paper diffuser, such as Whatman no. 1 filter paper, between the film and the light source. 4. Cut the films into pieces that fit into a cuvette holder of a spectrophotometer and measure the absorbance at 540 nm. Choose an exposure time that causes the absorbance of the preexposed film to increase by 0.15 with respect to film that was not preexposed. Detection and Quantitation of Radiolabeled Proteins in Gels and Blots 6.3.6 Current Protocols in Cell Biology FLUOROGRAPHY Organic scintillants can be included in radioactive samples to obtain autoradiograms of weak β-emitting isotopes such as 3H, 14C, and 35S. The scintillant fluoresces upon absorption of β particles from these isotopes, facilitating film exposure. Fluorographs of radioactive molecules in polyacrylamide gels have traditionally used the scintillant PPO (2,5-diphenyloxazole; Laskey and Mills, 1975). PPO, however, has largely been replaced with commercial scintillation formulations that reduce the amount of preparation time and are considerably safer to use. These scintillants (e.g., Enhance from NEN Life Science) come with complete instructions for their use. In addition, spray applicators are also available that can be used on filters or thin-layer plates. The expected levels of image enhancement obtained through fluorography are listed in Table 6.3.1. Sodium salicylate can also be used for fluorography as described below (Chamberlain, 1979). It yields levels of image enhancement comparable to organic scintillants, although it sometimes causes a more diffuse film image. The conditions should work for most standard sizes and thicknesses of gels. ALTERNATE PROTOCOL 1 CAUTION: Gloves should be worn at all times; sodium salicylate can elicit allergic reactions and is readily absorbed through the skin. Materials Polyacrylamide gel 1 M sodium salicylate, pH 5 to 7, freshly prepared Additional reagents and equipment for fixing and drying gels (see Support Protocol 1) 1. If gel is acid-fixed, soak for 1 to 5 hr in ∼20 vol water to prevent precipitation of salicylic acid from the sodium salicylate. 2. Soak gel 30 min in 10 vol of 1 M sodium salicylate, pH 5 to 7. To prevent cracking of gels with >15% acrylamide or thicker than 1.5 mm, 2% (v/v) glycerol can be added to the 1 M sodium salicylate. 3. Dry the gel (see Support Protocol 1) and proceed with autoradiography (see Basic Protocol). DENSITOMETRY Film images obtained by autoradiographic methods can be quantified by densitometry. Densitometers work by comparing the intensity of light transmitted through a sample with the intensity of the incident light. The amount of light transmitted will be proportional to the amount of radioactivity in the gel, provided that the film has been properly preexposed (see Support Protocol 3). The linear range of correctly preexposed film is 0.1 to 1.0 absorbance units. However, if the preexposure is excessive—i.e., an increase of >0.2 absorbance units (A540) treated film/untreated film—smaller amounts of radioactivity will produce disproportionately dense images. Autoradiograms that exceed an absorbance of 1.4 absorbance units (A540) have saturated all available silver bromide crystals and also cannot be evaluated quantitatively. Densitometers are available from several manufacturers (e.g., Molecular Dynamics, Bio-Rad, and UVP). Most models come with software that facilitates calculations and allows the user to define the region of the film to be measured. Procedures for the use of these machines vary and instructions are provided by the manufacturer. Densitometers are also available that measure light reflected from a sample. Reflectance densitometers are useful in instances where the sample medium is completely opaque—e.g., filters that have been probed using nonradioactive colorimetric detection assays. SUPPORT PROTOCOL 4 Electrophoresis and Immunoblotting 6.3.7 Current Protocols in Cell Biology ALTERNATE PROTOCOL 2 PHOSPHOR IMAGING Phosphor imaging screens can be used as an alternative to film for recording and quantifying autoradiographic images (Johnston et al., 1990). They can detect radioisotopes such as 32P, 125I, 14C, 35S, and 3H. There are several advantages of phosphor imaging over film: (1) linear dynamic ranges are 5 orders of magnitude, compared to ∼1.5 orders of magnitude for film (Fig. 6.3.2); (2) exposure times are 10 to 250 times faster than with film; (3) quantification is much easier and faster, and most imagers come with software to directly analyze data; (4) fluorography and gel drying are often unnecessary because of the sensitivity of phosphor imaging; and (5) phosphor screens can be reused indefinitely if handled carefully. Phosphor imaging screens are composed of crystals of BaFBr:Eu+2. When the screen is exposed to ionizing radiation such as α, β, or γ radiation, or wavelengths of light shorter than 380 nm, the electrons from Eu+2 are excited and then trapped in an “F-center” of the BaFBr− complex; this results in the oxidation of Eu+2 to Eu+3, which forms the latent image on the screen. After exposure, the latent image is released by scanning the screen with a laser (633 nm). During scanning, Eu3+ reverts back to Eu+2, releasing a photon at 390 nm. The luminescence can then be collected and measured in relation to the position of the scanning laser beam. The result is a representation of the latent image on the storage phosphor imaging plates. The image can then be viewed on a video monitor and analyzed with the aid of appropriate software. Some companies (e.g., Bio-Rad) offer different screens for use with different isotopes. They vary principally in the protective coating on the screen, which is optimized for lowor high-energy β particles or γ rays. No coating is typically used for weak β emitters such as tritium. More recently, screens have also been developed that measure chemiluminescence. Such screens are particularly valuable for use with many nonradioactive labeling protocols. 10 5 3 10 4 2.5 10 3 2 10 2 1.5 101 1 10 0 .05 10 -1 Densitometric counts OD Phosphor imager signal The protocol below is for the PhosphorImager system from Molecular Dynamics; other phosphor imaging systems are available from Bio-Rad, Imaging Research, and National Diagnostics. 0 101 10 2 10 3 10 4 105 106 107 10 8 Detection and Quantitation of Radiolabeled Proteins in Gels and Blots Disintegrations/mm2 Figure 6.3.2 32P dilution series quantified on Model GS-525 phosphor imager (squares), compared to film (circles). Image courtesy of Bio-Rad, Hercules, Calif. 6.3.8 Current Protocols in Cell Biology Materials Gel or filter (e.g., from immunoblotting; UNIT 6.2) PhosphorImager system (Molecular Dynamics) including: ImageEraser light box Exposure cassette with phosphor screen Scanning software 1. Erase any latent image on the phosphor screen left by a previous user, or caused by background radiation, by exposure to visible light. The PhosphorImager system comes with an extra-bright light box (ImageEraser) for this purpose. Standard laboratory light boxes may also be used. 2. Cover gel or filter with plastic wrap to protect the exposure cassette. Place wrapped gel or filter in the PhosphorImager cassette and close to begin exposure. The gel does not have to be dried for this procedure. The phosphor screen is affixed to the lid of the cassette. Exposure times are typically one-tenth of the time required for film exposure. 3. After exposure, slide the screen face down into the PhosphorImager system. 4. Select the scanning area using the software supplied with the PhosphorImager and start scanning. The blue light emitted during scanning is collected to produce the latent image. 5. Analyze and quantitate the image using the software provided. 6. Erase the phosphor screen by exposing it to visible light as in step 1. COMMENTARY Background Information The ability to detect radiolabeled proteins is critical to many studies in cell biology. A variety of labeling methods are described throughout this manual, many of which are used to follow protein purification, protein processing, or the movement of proteins within the cell. More often than not, detection of radiolabeled proteins is coupled with the resolving power of SDS polyacrylamide gel electrophoresis (SDSPAGE; UNIT 6.1). Radiolabeled proteins separated on gels can be used directly to obtain an autoradiographic image. Alternatively, proteins separated by SDS-PAGE are frequently transferred to membranes (UNIT 6.2) and detected using radiolabeled probes such as antibodies and 125I-labeled protein A. The autoradiographic image, whether generated on film or a phosphor screen, reflects the distribution of the radioactive proteins on the two-dimensional surface of the gel or filter. Molecular sizes of radiolabeled proteins, therefore, can be determined by correlating their positions with molecular markers. Also, the density of the band images can be used to determine the relative quantities of the radiolabeled proteins in the sample. Critical Parameters The sensitivity of the detection device and the strength of the radioactive signal are the two most important parameters for autoradiography. Sensitivity can be enhanced by treating samples with fluors or by using intensifying screens (Table 6.3.2). Because phosphor imaging is 10 to 250 times more sensitive than film (Johnston et al., 1990), this technology makes it possible to monitor radioactive samples that would previously have gone undetected with film. A second important parameter is the range over which the measurement device is linear. Film requires preflashing in order for the intensity of the image to be linear with respect to the amount of radioactivity, particularly for weakly radioactive samples (Laskey and Mills, 1975, 1977). Phosphor imaging offers a much wider linear range of measurement (5 orders of magnitude compared to 1.5 for film; Johnston et al., 1990). This makes it possible to accurately Electrophoresis and Immunoblotting 6.3.9 Current Protocols in Cell Biology Table 6.3.2 Film Choice and Exposure Temperature for Autoradiography Isotope Enhancement method Film Exposure temperature 3H Fluorography None Fluorography CaWO4 intensifying screens Double-coated Single-coated Double-coated Double-coated −70°C Room temperature −70°C −70°C 35S, 14C, 32P 35S, 14C, 32P 32P, 125I quantitate very weak or very strong radioactive samples. Troubleshooting Detection and Quantitation of Radiolabeled Proteins in Gels and Blots Cracking is one of the most common problems encountered when drying gels. This often occurs if the gel is removed from the dryer before it has adequately dried or if drying temperatures are too high. To overcome this problem, drying times should be extended and the performance of the vacuum pump and heater unit should be checked. For many gels, particularly for those with high percentages of polyacrylamide or >1.5 mm thick, cracking can be reduced by using an alternative fixing solution containing glycerol (3% glycerol/10% glacial acetic acid/20% methanol; see Support Protocol 1). Among the biggest problems encountered in autoradiography are images that are either too weak or too intense. Such problems can be solved by varying the exposure time. Estimating initial exposure time is difficult, since the amount of radioactivity in the sample is often unknown. A Geiger counter can offer some guidance with certain isotopes. For highly exposed film, the length of time in developer can be reduced to produce a lighter image. It is particularly important to remember that if accurate quantification of the film image is desired, film must be preflashed so that there is a linear relationship between the amount of radioactivity in the sample and the image intensity. Artifacts, such as black spots and stripes, can be avoided during developing by making sure that no moisture comes in contact with the film and that films exposed at −70°C are brought to room temperature before developing. Also, it must be noted that β particles from weak isotopes such as 3H cannot penetrate plastic wrap, and plastic wraps can attenuate signals from 35S and 14C up to two-fold. Anticipated Results The protocols described here should yield a film image of a gel that can be quantified, stored, and photographed for publication. Time Considerations Fixing a gel will require ∼45 min. Drying will take an additional 2 hr for a gel 1 mm in thickness. Incorporation of a fluor will add ∼45 min to the processing time. For gels >1.5 mm thick or with >15% acrylamide, an additional 30 min will be required for fixing and ∼30 additional minutes will be required for drying. The length of exposure for films in autoradiography can range from a few minutes to a few weeks, depending on the strength of the radioactivity in the sample. Most exposures last from several hours to a few days. Exposure time can be reduced more than 10-fold with a phosphor imager. Literature Cited Chamberlain, J.P. 1979. Fluorographic detection of radioactivity in polyacrylamide gels with the water-soluble fluor, sodium salicylate. Anal. Biochem. 98:132-135. Johnston, R.F., Pickett, S.C., and Barker, D.L. 1990. Autoradiography using storage phosphor technology. Electrophoresis 11:355-360. Laskey, R.A. 1980. The use of intensifying screens or organic scintillators for visualizing radioactive molecules resolved by gel electrophoresis. Methods Enzymol. 65:363-371. Laskey, R.A. and Mills, A.D. 1975. Quantitative film detection of 3H and 14C in polyacrylamide gels by fluorography. Eur. J. Biochem. 56:335-341. Laskey, R.A. and Mills, A.D. 1977. Enhanced autoradiographic detection of 32P and 125I using intensifying screens and hypersensitized film. FEBS Lett. 82:314-316. Contributed by Daniel Voytas and Ning Ke Iowa State University Ames, Iowa 6.3.10 Current Protocols in Cell Biology 7ZR'LPHQVLRQDO*HO(OHFWURSKRUHVLV 81,7 7ZRGLPHQVLRQDOJHOHOHFWURSKRUHVLVFRPELQHVWZRGLIIHUHQWHOHFWURSKRUHWLFVHSDUDWLQJ WHFKQLTXHVLQSHUSHQGLFXODUGLUHFWLRQVWRSURYLGHDPXFKJUHDWHUVHSDUDWLRQRIFRPSOH[ SURWHLQPL[WXUHVWKDQHLWKHURIWKHLQGLYLGXDOSURFHGXUHV7KHPRVWFRPPRQWZRGLPHQ VLRQDOWHFKQLTXHXVHVLVRHOHFWULFIRFXVLQJ,()VHH%DVLF3URWRFROVDQGIROORZHG E\VRGLXPGRGHF\OVXOIDWH¤SRO\DFU\ODPLGHJHOHOHFWURSKRUHVLV6'63$*(LQDSHUSHQ GLFXODUGLUHFWLRQVHH%DVLF3URWRFRO7KLVFRPELQDWLRQRILVRHOHFWULFSRLQWS,DQG VL]HVHSDUDWLRQLVWKHPRVWSRZHUIXOWRROIRUSURWHLQVHSDUDWLRQVFXUUHQWO\DYDLODEOH$IWHU VWDLQLQJ SURWHLQV DSSHDURQWKHILQDOWZRGLPHQVLRQDOJHODVURXQGRUHOOLSWLFDOVSRWV LQVWHDGRIWKHUHFWDQJXODUEDQGVREVHUYHGRQRQHGLPHQVLRQDOJHOV$OWKRXJKWKHWRWDO VHSDUDWLQJSRZHURIODUJHIRUPDWWZRGLPHQVLRQDOJHOVLVHVWLPDWHGWREH!VSRWVSHU JHO LQ SUDFWLFH D VLQJOH WZRGLPHQVLRQDO VHSDUDWLRQ RI D FRPSOH[ PL[WXUH VXFK DV D ZKROHFHOO RU WLVVXH H[WUDFW PD\ SURGXFH WR ZHOOUHVROYHG VSRWV ZKHQ D VHQVLWLYHGHWHFWLRQPHWKRGLVXVHG 8QWLO UHFHQWO\ WKH PRVW FRPPRQ ,() SURFHGXUHV ZHUH EDVHG RQ WKH XVH RI VROXEOH DPSKRO\WHVUHODWLYHO\VPDOORUJDQLFPROHFXOHVZLWKYDULRXVLVRHOHFWULFSRLQWVDQGEXII HULQJFDSDFLWLHV7KHS+JUDGLHQWIRU,()JHOVLVSURGXFHGZKHQWKHVROXEOHDPSKRO\WHV PLJUDWH LQ WKH JHO PDWUL[ XQWLO WKH\ UHDFK WKHLU LVRHOHFWULF SRLQW %HFDXVH VWDEOH S+ JUDGLHQWVRXWVLGHWKHS+WRUDQJHDUHGLIILFXOWWRFUHDWHZLWKVROXEOHDPSKRO\WHV DOWHUQDWLYH SURWRFROV XVLQJ QRQHTXLOLEULXP FRQGLWLRQV DUH UHTXLUHG WR UHVROYH SURWHLQV ZLWKS,YDOXHVEHORZVHH$OWHUQDWH3URWRFROIRUDFLGLFSURWHLQVRUDERYHVHH $OWHUQDWH3URWRFROIRUEDVLFSURWHLQV2QHRIWKHPRUHLPSRUWDQWOLPLWDWLRQVRIVROXEOH DPSKRO\WHVLVWKHGLIILFXOW\LQREWDLQLQJKLJKO\UHSURGXFLEOHS+SURILOHVHVSHFLDOO\ZKHQ YHU\QDUURZS+UDQJHVDUHQHHGHG $QLQFUHDVLQJO\DWWUDFWLYHDOWHUQDWLYHWRVROXEOHDPSKRO\WHVLVWKHXVHRILPPRELOL]HGS+ JUDGLHQW,3*JHOVVHH%DVLF3URWRFRO,QWKLVV\VWHPWKHEXIIHULQJVLGHFKDLQVDUH FRYDOHQWO\LQFRUSRUDWHGLQWRWKHDFU\ODPLGHPDWUL[DQGDQ\S+UDQJHDQGFXUYHVKDSH FDQEHJHQHUDWHGE\SRXULQJDJUDGLHQWJHOXVLQJWZRVROXWLRQVWKDWGLIIHULQDPSKRO\WH FRPSRVLWLRQUDWKHUWKDQDFU\ODPLGHFRQFHQWUDWLRQ$VZLWKWXEHJHOVWKHLQLWLDOHOHFWUR SKRUHVLVLVIROORZHGE\DVHFRQGVHSDUDWLRQXVLQJ6'63$*(LQDSHUSHQGLFXODUGLUHFWLRQ VHH%DVLF3URWRFRO7KHXVHRI,3*JHOVKDVUHFHQWO\LQFUHDVHGIRUDWOHDVWWKUHHPDMRU UHDVRQVPDQ\RIWKHWHFKQLFDOSUREOHPVDVVRFLDWHGZLWKWKHLUXVHKDYHEHHQVROYHGRU VXEVWDQWLDOO\PLQLPL]HGUHSURGXFLEOHSUHPDGH,3*JHOVDUHQRZFRPPHUFLDOO\DYDLODEOH DQGODWHO\VWURQJLQWHUHVWKDVDULVHQLQXVLQJWZRGLPHQVLRQDOJHOVIRUSURWHRPHDQDO\VLV VWXGLHV DQDO\]LQJ DQG FRPSDULQJ WKH FRPSOHWH SURWHLQ SURILOHV RI FHOO OLQHV WLVVXH VDPSOHVRUVLQJOHFHOOHGRUJDQLVPV $QRWKHU FRPPRQ WZRGLPHQVLRQDO HOHFWURSKRUHVLV IRUPDW LV D QRQUHGXFLQJUHGXFLQJ HOHFWURSKRUHWLFVHSDUDWLRQVHH$OWHUQDWH3URWRFROZKLFKSURYLGHVXVHIXOLQIRUPDWLRQ DERXWLQWHUVXEXQLWGLVXOILGHVRUSURWHLQSURWHLQFRPSOH[HVWKDWKDYHEHHQFURVVOLQNHG XVLQJDELIXQFWLRQDOFKHPLFDOFURVVOLQNHUFRQWDLQLQJDGLVXOILGHERQGZLWKLQWKHOLQNHU UHJLRQ 7KLVXQLWDOVRLQFOXGHVVXSSRUWSURWRFROVGHVFULELQJS,VWDQGDUGVDQGS+SURILOHPHDV XUHPHQWVVHH6XSSRUW3URWRFROHOHFWURSKRUHVLVRILPPRELOL]HGS+JUDGLHQWJHOVVHH 6XSSRUW3URWRFROFDVWLQJ,PPRELOLQHJHOVVHH6XSSRUW3URWRFROSUHSDUDWLRQRI WLVVXHFXOWXUHFHOOVDQGVROLGWLVVXHVIRULVRHOHFWULFIRFXVLQJVHH6XSSRUW3URWRFROVDQG SUHSDUDWLRQ RI PROHFXODU ZHLJKW VWDQGDUGV IRU WZRGLPHQVLRQDO JHOV VHH 6XSSRUW 3URWRFRODQGWZRGLPHQVLRQDOSURWHLQGDWDEDVHVVHH6XSSRUW3URWRFRO &RQWULEXWHGE\6DQGUD+DUSHU-DFHN0R]G]DQRZVNLDQG'DYLG6SHLFKHU &XUUHQW3URWRFROVLQ&HOO%LRORJ\ &RS\ULJKWE\-RKQ:LOH\6RQV,QF (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ 6XSSOHPHQW 127(+LJKSXULW\ZDWHUHJ0LOOL4ZDWHURUHTXLYDOHQWLVHVVHQWLDOIRUDOOVROXWLRQV )RUFDXWLRQVUHODWLQJWRHOHFWULFLW\DQGHOHFWURSKRUHVLVVHH6DIHW\&RQVLGHUDWLRQVLQWKH LQWURGXFWLRQWR81,7 %$6,& 35272&2/ +,*+5(62/87,21(48,/,%5,80,62(/(&75,&)2&86,1* ,178%(*(/6 7KLVSURWRFROGHVFULEHVWKHSUHSDUDWLRQRIEURDGUDQJHILUVWGLPHQVLRQJHOVXVLQJVROXEOH DPSKRO\WHVWKDWUHVROYHSURWHLQVZLWKS,YDOXHVEHWZHHQDSSUR[LPDWHO\DQGDQG LVEDVHGRQWKHRULJLQDOSURFHGXUHGHVFULEHGE\2©)DUUHOO7KHSURFHGXUHSUHVHQWHG KHUHUHIHUVVSHFLILFDOO\WRPP,()WXEHJHOVILUVWGLPHQVLRQFRPELQHGZLWKPP WKLFNפFPVL]HRIVHSDUDWLQJJHOVHFRQGGLPHQVLRQJHOVVHH%DVLF3URWRFRO DQGPD\EHHDVLO\DGDSWHGWRDYDULHW\RIGLIIHUHQWJHOVL]HVVHH7DEOH$PP ,()JHOKDVDWRWDOSURWHLQFDSDFLW\RI∼µJIRUFRPSOH[SURWHLQPL[WXUHVVXFKDV ZKROHFHOOH[WUDFWV7KHPD[LPXPFDSDFLW\RIDQ\VLQJOHSURWHLQVSRWLV∼WRµJ GHSHQGLQJRQWKHVROXELOLW\RIWKHSURWHLQQHDULWVLVRHOHFWULFSRLQWDQGWKHVHSDUDWLRQ GLVWDQFHIURPDQ\QHDUQHLJKERUV ,QWKLVSURWRFROJHOVDUHFDVWDQGSUHIRFXVHGEHIRUHWKHVDPSOHLVORDGHG7KHSURWHLQV DUHWKHQVHSDUDWHGDFFRUGLQJWRLVRHOHFWULFSRLQWDQGWKHJHOVDUHH[WUXGHGIURPWKHWXEHV DQGVWRUHG0HDVXULQJS+SURILOHVLQ,()JHOVLVDFRQYHQLHQWDQGDFFXUDWHPHWKRGIRU GHWHUPLQLQJS,VHH6XSSRUW3URWRFRO7RSURYLGHRSWLPDOUHSURGXFLELOLW\PXOWLSOHJHOV VKRXOG EH FDVW DQG UXQ VLPXOWDQHRXVO\ 7KLV LV HVSHFLDOO\ LPSRUWDQW IRU FRPSDUDWLYH VWXGLHVLQYROYLQJFRPSOH[PL[WXUHVRISURWHLQV 7KH,()JHOVPD\EHFDVWHLWKHUE\SRXULQJWKHJHOVROXWLRQLQWRWKHJHOWXEHVVWHSVDWR DRUE\XVLQJK\GURVWDWLFSUHVVXUHVWHSVEWRE3RXULQJWKHJHOVROXWLRQLQWRWKHJHO WXEHVLVFRQYHQLHQWIRUPPGLDPHWHU,()JHOVDQGUHTXLUHVRQO\DPLQLPDOH[FHVVRI UHDJHQWV%HFDXVHWKHJHOVDUHFDVWXVLQJDORQJQHHGOHDQGV\ULQJHIRUQDUURZHUJHOV ZKHUHWKHQHHGOHGRHVQRWILWLQVLGHWKHJHOWXEHFDVWLQJXVLQJK\GURVWDWLFSUHVVXUHLV PRUHDSSURSULDWH7KLVPHWKRGUHTXLUHVDODUJHUH[FHVVRIUHDJHQWVDQGVSHFLDOFDVWLQJ F\OLQGHUV0DQ\W\SHVRIDPSKRO\WHVDUHUHDGLO\DYDLODEOHIURPGLIIHUHQWVXSSOLHUVWRIRUP WKH GHVLUHG S+ SURILOHV $V DPSKRO\WHV PD\ YDU\ VLJQLILFDQWO\ LQ WKHLU SHUIRUPDQFH FDUHIXOVHOHFWLRQRIWKHDSSURSULDWHDPSKRO\WHVLVXVXDOO\QHFHVVDU\VHH&RPPHQWDU\ 0DWHULDOV &KURPLFDFLGLQDFLGUHVLVWDQWFRQWDLQHU 8UHDXOWUDSXUH DFU\ODPLGHELVDFU\ODPLGHVHHUHFLSH ZY7ULWRQ;VHHUHFLSH $PSKRO\WHVHJS+'(6$ 7(0('111′1′WHWUDPHWK\OHWK\OHQHGLDPLQH ZYDPPRQLXPSHUVXOIDWHVHHUHFLSHSUHSDUHLPPHGLDWHO\EHIRUHXVH 0XUHDVHHUHFLSHSUHSDUHLPPHGLDWHO\EHIRUHXVH 0RUWKRSKRVSKRULFDFLG+32VHHUHFLSH 01D2+PDNHIUHVKGDLO\ /\VLVEXIIHUVHHUHFLSH 3URWHLQVDPSOHVWREHDQDO\]HG (TXLOLEUDWLRQEXIIHUVHHUHFLSH 0HUFDSWRHWKDQRO 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV ,VRHOHFWULFIRFXVLQJDSSDUDWXVHJ3URWHDQ,,[L'IURP%LR5DGRUHTXLYDOHQW ZLWKJODVVWXEHVFDVWLQJVWDQGEXIIHUFKDPEHUVUXEEHUJURPPHWVDQGSOXJV °&ZDWHUEDWK FRQWLQXHG 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ °&RYHQ POV\ULQJHHTXLSSHGZLWKILOWHUFDSVXOHRUµPHJ&RVWDUµ6WDU/% POV\ULQJHHTXLSSHGZLWKEOXQWQHHGOH>HJ*×LQFPRU *×[email protected] /DUJHJODVVF\OLQGHUVHDOHGDWERWWRPZLWK3DUDILOPRSWLRQDOIRUK\GURVWDWLF SUHVVXUHFDVWLQJPHWKRGRQO\ 9SRZHUVXSSO\ POV\ULQJH 0HWDORUSODVWLFVFRRS 'U\LFHSHOOHWV :DVKWXEHVDQGSUHSDUHWKHJHOPL[WXUH 5HPRYHWKHJODVVWXEHVIURPDFKURPLFDFLG¤ILOOHGFRQWDLQHU([WHQVLYHO\ZDVKWKH WXEHVZLWKZDWHUXVLQJKLJKSXULW\ZDWHUIRUWKHODVWZDVK'U\WKHWXEHVDWOHDVW KULQDQRYHQDW°&DQGVWRUHWKHPDWURRPWHPSHUDWXUHFRYHUHGZLWKDOXPLQXP IRLO 7RSUHYHQWJHOVIURPVWLFNLQJWRWKHJODVVWXEHVJHOWXEHVKDYHWREHYHU\FOHDQ6DWLVIDFWRU\ UHVXOWVDUHREWDLQHGE\VWRULQJWKHWXEHVLQFKURPLFDFLGEHWZHHQXVHVDQGZDVKLQJWKHP VKRUWO\EHIRUHXVH%HFDXVHGU\LQJWKHWXEHVUHTXLUHVDWOHDVWKUFOHDQLQJVWHSVVKRXOG EHSHUIRUPHGWKHGD\EHIRUHJHOVZLOOEHFDVW &$87,21&KURPLFDFLGLVKLJKO\FRUURVLYHIROORZVXSSOLHU©VSUHFDXWLRQVFDUHIXOO\ 3UHSDUHWKHJHOVROXWLRQE\PL[LQJ JXUHD PORIDFU\ODPLGHELVDFU\ODPLGH PORIZY7ULWRQ; POZDWHU PODPSKRO\WHV %ULHIO\ZDUPWKHPL[WXUHLQD°&ZDWHUEDWKWRVROXELOL]HXUHDLIQHHGHG 7RPLQLPL]HGHFRPSRVLWLRQRIXUHDQHYHUZDUPDQ\VROXWLRQVFRQWDLQLQJXUHDDERYH°& XVHXOWUDSXUHXUHDDQGSUHSDUHVROXWLRQVLPPHGLDWHO\EHIRUHXVH &KRLFH RI DPSKRO\WH FRPSRVLWLRQ LV RQH RI WKH NH\ IDFWRUV GHWHUPLQLQJ WKH TXDOLW\ RI LVRHOHFWULFIRFXVLQJVHSDUDWLRQV6XEVWDQWLDOGLIIHUHQFHVLQSHUIRUPDQFHUHVROXWLRQDQG VKDSHRIWKHS+JUDGLHQWIRUPHGPD\EHREVHUYHGZLWKGLIIHUHQWFRPELQDWLRQVRIDPSKR O\WHVDQGZLWKDPSKRO\WHVIURPGLIIHUHQWVXSSOLHUV(6$©VDPSKRO\WHVS+'DUH VXLWHGIRUPRVWDSSOLFDWLRQVDQGJLYHUHSURGXFLEOHUHVXOWV $OWKRXJKSXULW\RIDOOUHDJHQWVLVLPSRUWDQWWKHSXULW\RIXUHDDQGFKRLFHRIDPSKRO\WHV DUHDPRQJWKHPRVWFULWLFDOIDFWRUVIRUWKHTXDOLW\DQGSHUIRUPDQFHRILVRHOHFWULFIRFXVLQJ 0RVW FRPPHUFLDOO\ DYDLODEOH UHDJHQWV PDUNHWHG VSHFLILFDOO\ IRU WZRGLPHQVLRQDO JHO HOHFWURSKRUHVLVVKRXOGEHVXLWDEOHDOWKRXJKLQGLYLGXDOORWVRIUHDJHQWVIURPDQ\VXSSOLHU PD\SURYLGHYDULDELOLW\DQGRUXQDFFHSWDEOHUHVXOWV &DVWJHOVE\SRXULQJ D :UDSRQHHQGRIHDFKJODVVWXEHZLWK3DUDILOPDQGPRXQWWKHWXEHLQDFDVWLQJVWDQG 0DUNDOOWKHWXEHVWRLQGLFDWHWKHGHVLUHGJHOKHLJKW )RUUHSURGXFLEOHUHVXOWVDOOJHOVVKRXOGEHWKHVDPHKHLJKW D )LOWHUWKHJHOVROXWLRQXVLQJDPOV\ULQJHHTXLSSHGZLWKDV\ULQJHWLSILOWHUFDSVXOH %ULHIO\GHJDVWKHJHOVROXWLRQ∼PLQHLWKHUE\VRQLFDWLRQRUXQGHUYDFXXP7KHQ DGGµO7(0('DQGµORIZYDPPRQLXPSHUVXOIDWHVROXWLRQWR WKHILOWHUHGJHOPL[WXUHDQGVZLUOJHQWO\WRPL[ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW D 8VLQJDPOV\ULQJHZLWKDEOXQWQHHGOHILOOHDFKJODVVWXEHZLWKJHOVROXWLRQWR WKHGHVLUHGKHLJKW0DNHVXUHWKHUHDUHQRDLUEXEEOHVWUDSSHGLQWKHJHO $QHHGOHLVWKHEHVWFKRLFHIRUFDVWLQJJHOVLIWXEHVRIPPLQQHUGLDPHWHUDUHXVHG)RU QDUURZHUWXEHVWKHXVHRIK\GURVWDWLFSUHVVXUHLVPRUHDSSURSULDWHVHHVWHSVEWRE EHORZ )RU ORQJ JHOV WKH QHHGOH FDQ EH H[WHQGHG E\ LQVHUWLQJ D SLHFH RI FDSLOODU\ SRO\HWK\OHQHWXELQJRYHUWKHQHHGOHWLS7KHDPRXQWRIJHOVROXWLRQGHVFULEHGLQVWHSLV VXIILFLHQWIRUVL[WHHQPPWXEHJHOVWKDWDUHFPORQJ D ,PPHGLDWHO\RYHUOD\HDFKJHOZLWK∼µORI0XUHD $SLSHWWRUZLWKDFDSLOODU\SLSHWWLSLVDFRQYHQLHQWWRROIRURYHUOD\LQJZLWKXUHD$YRLG PL[LQJ WKH RYHUOD\ DQG JHO VROXWLRQV 3RO\PHUL]DWLRQ VWDUWV WR RFFXU ∼ PLQ DIWHU WKH DGGLWLRQRI7(0('DQGDPPRQLXPSHUVXOIDWH,WLVHVVHQWLDOWKDWWKHJHOVEHSRXUHGDQG RYHUODLGEHIRUHVLJQLILFDQWSRO\PHUL]DWLRQKDVRFFXUUHG D /HWWKHJHOVSRO\PHUL]HDWOHDVWKUSULRUWRXVH 8UHDGHFRPSRVHVDWDVXEVWDQWLDOUDWHDWURRPWHPSHUDWXUHWKHUHIRUHWKHJHOVVKRXOGEH XVHGWKHVDPHGD\WKH\DUHFDVW &DVWJHOVXVLQJK\GURVWDWLFSUHVVXUH E 3ODFHDUXEEHUEDQGDURXQGWKHJHOWXEHVVRWKH\IRUPDWLJKWEXQGOH3ODFHWKHEXQGOH LQVLGH D ODUJHU JODVV F\OLQGHU WKDW LV VHDOHG DW WKH ERWWRP ZLWK VHYHUDO OD\HUV RI 3DUDILOP$OOWXEHVPXVWEHSUHFLVHO\YHUWLFDO 7KHGLPHQVLRQVRIWKHODUJHUF\OLQGHUGHSHQGRQWKHGLPHQVLRQVDQGQXPEHURIJHOWXEHV ([FHVVLYHVSDFHZLOOUHTXLUHPRUHJHOVROXWLRQWRFDVWWKHJHOV E )LOWHUWKHJHOVROXWLRQXVLQJDPOV\ULQJHDQGILOWHUFDSVXOH'HJDVWKHJHOVROXWLRQ EULHIO\∼PLQHLWKHUZLWKVRQLFDWLRQRUXQGHUYDFXXP$GGµO7(0('DQG µORIDPPRQLXPSHUVXOIDWHVROXWLRQDQGVZLUO E 3LSHWWKHJHOVROXWLRQLQWRWKHERWWRPRIWKHJODVVF\OLQGHU*HQWO\UXQZDWHUGRZQ WKHRXWVLGHRIWKHWXEHEXQGOHXVLQJDZDVKERWWOH.HHSDGGLQJZDWHUXQWLOWKHJHO PL[UHDFKHVWKHGHVLUHGKHLJKW +\GURVWDWLFSUHVVXUHZLOOIRUFHWKHJHOVROXWLRQLQWRWKHWXEHV6XIILFLHQWJHOVROXWLRQPXVW EHXVHGWRREWDLQWKHGHVLUHGJHOKHLJKWZKLOHDYRLGLQJIRUFLQJDQ\ZDWHULQWRWKHWXEHV 7KHYROXPHRIJHOVROXWLRQUHTXLUHGFDQEHHVWLPDWHGDVIROORZVQXPEHURIJHOV×× WXEHLQWHUQDOUDGLXVLQFP×KHLJKWLQFP+∼POWRNHHSDVDIHOHYHORIJHOPL[DWWKH ERWWRPRIWKHFDVWLQJF\OLQGHU$VZDWHULVOHVVGHQVHWKDQWKHJHOVROXWLRQWKHZDWHUOHYHO ZLOOEHVOLJKWO\KLJKHUWKDQWKHOHYHORIJHOVROXWLRQLQVLGHWKHWXEHV E 2YHUOD\WKHJHOVZLWK0XUHD 8UHDGHFRPSRVHVDWDVXEVWDQWLDOUDWHDWURRPWHPSHUDWXUHWKHUHIRUHWKHJHOVVKRXOGEH XVHGWKHVDPHGD\WKH\DUHFDVW E /HWWKHJHOVSRO\PHUL]HDWOHDVWKUSULRUWRXVH 0RXQWWKHJHOVLQWKHHOHFWURSKRUHVLVXQLW 3UHSDUHWKHORZHUHOHFWURGHVROXWLRQE\GHJDVVLQJWKHSURSHUDPRXQWRI0+32 XQGHUYDFXXPZLWKVWLUULQJIRUDWOHDVWPLQ)LOOWKHERWWRPHOHFWURSKRUHVLVFKDPEHU 7KH DPRXQW RI SKRVSKRULF DFLG GHSHQGV RQ WKHOHQJWKRIWKHJHOWXEHVDQGWKHW\SHRI HOHFWURSKRUHVLVXQLW7KHVROXWLRQVKRXOGFRYHUWKHHQWLUHJHOIRUJRRGKHDWGLVVLSDWLRQ $SSUR[LPDWHO\OLWHUVDUHUHTXLUHGIRU3URWHDQ,,[L'HOHFWURSKRUHVLVXQLWV 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 5HPRYH WKH JHO WXEHV IURP WKH FDVWLQJ VWDQG UHPRYH WKH 3DUDILOP IURP WKH WXEH ERWWRPVDQGLQVSHFWJHOVIRULUUHJXODULWLHVRUWUDSSHGDLUEXEEOHV'LVFDUGLPSHUIHFW JHOV,IXVLQJJHOVFDVWZLWKK\GURVWDWLFSUHVVXUHUHPRYHWKHEXQGOHRIWXEHVHQEORF FXWRIIH[FHVVDFU\ODPLGHZLWKDUD]RUEODGHDQGWKHQULQVHDZD\UHPDLQLQJDFU\ ODPLGHSDUWLFOHVIURPWKHRXWVLGHRIHDFKWXEH 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 3ODFHDUXEEHUJURPPHWRQWKHWRSRIWKHWXEH$SSUR[LPDWHO\PPRIWKHWXEH VKRXOGEHYLVLEOHDERYHWKHXSSHUHGJHRIWKHJURPPHW 0RXQWWKHWXEHZLWKWKHJURPPHWLQWKHXSSHUUHVHUYRLUDQGSOXJDQ\XQXVHGKROHV $IWHUWKHWXEHLVVHDWHGLWVORZHUHQGPXVWEHVXEPHUJHGLQWKHORZHUHOHFWURGHVROXWLRQ %HVXUHWRUHPRYHDQ\DLUEXEEOHVWUDSSHGDWWKHERWWRPRIWKHWXEHE\VKDNLQJRUWDSSLQJ WKHWXEHJHQWO\$OWHUQDWLYHO\ZLWKVRPHXQLWVEXEEOHVFDQEHGLVORGJHGE\UDLVLQJDQG ORZHULQJWKHWXEHVRUE\XVLQJDORQJFXUYHGQHHGOHDQGV\ULQJH 3UHIRFXVWKHJHOV 3UHSDUHWKH01D2+XSSHUHOHFWURGHVROXWLRQE\GHJDVVLQJXQGHUYDFXXPZLWK VWLUULQJIRUDWOHDVWPLQ 7KHDPRXQWRIXSSHUHOHFWURGHVROXWLRQQHFHVVDU\GHSHQGVRQWKHW\SHRIHOHFWURSKRUHVLV FKDPEHU,ID%LR5DG3URWHDQ,,[L'DSSDUDWXVLVXVHGOLWHURI01D2+LVVXIILFLHQW IRUERWKSUHIRFXVLQJDQGWKHVHSDUDWLRQ 5HPRYHWKH0XUHDRYHUOD\IURPWKHWRSRIWKHJHOVXVLQJD3DVWHXUSLSHWDQGSODFH ∼µOO\VLVEXIIHURQWKHWRSRIHDFKJHO 2YHUOD\O\VLVEXIIHUZLWKWKHGHJDVVHG01D2+WRILOOWKHJHOWXEHV$YRLGPL[LQJ RI1D2+ZLWKWKHO\VLVEXIIHU 3RXUWKHGHJDVVHG01D2+LQWRWKHXSSHUFKDPEHUPDNLQJVXUHWKDWDOOWKHJHO WXEHV DUH FRYHUHG ZLWK WKH HOHFWURGH VROXWLRQ &KHFN FDUHIXOO\ IRU OHDNV DQG DLU EXEEOHVWKHQSODFHOLGRQDSSDUDWXV &RQQHFWWKHHOHFWURGHVWRDSRZHUVXSSO\E\WKHUHG+OHDGWRWKHORZHUFKDPEHU DQGWKHEODFN−OHDGWRWKHXSSHUFKDPEHU 7KHYROWDJHVDQGFXUUHQWVXVHGGXULQJHOHFWURSKRUHVLVDUHGDQJHURXVDQGSRWHQWLDOO\OHWKDO 6DIHW\FRQVLGHUDWLRQVDUHJLYHQLQWKH(OHFWULFLW\DQG(OHFWURSKRUHVLVVHFWLRQRI81,7 3UHIRFXVIRUPLQXVLQJ9FRQVWDQWYROWDJH /RDGWKHVDPSOHV 7XUQRIISRZHUVXSSO\VHH6DIHW\&RQVLGHUDWLRQVLQ81,7GLVFRQQHFWOHDGVDQG UHPRYHOLG8VLQJDPOV\ULQJHUHPRYHWKHHOHFWURGHVROXWLRQ01D2+IURP WKHXSSHUFKDPEHU 5HPRYHWKHHOHFWURGHVROXWLRQDQGWKHRYHUOD\VROXWLRQIURPHDFKWXEH%HFDUHIXO QRWWRGDPDJHWKHJHOVXUIDFH 3ODFH∼µOO\VLVEXIIHURQWKHWRSRIHDFKJHO:DLWDWOHDVWPLQ 5HPRYHWKHO\VLVEXIIHUIURPWKHWXEHV 5LQVLQJWKHJHOVZLWKO\VLVEXIIHUUHPRYHVDQ\UHVLGXDO1D2+DQGSURWHFWVWKHVDPSOHV DJDLQVWH[SRVXUHWRKLJKS+ /RDGSURWHLQVDPSOHVWREHDQDO\]HGDQGFDUHIXOO\RYHUOD\HDFKVDPSOHZLWK∼µO O\VLVEXIIHUGLOXWHGZLWKZDWHUYY$YRLGPL[LQJWKHEXIIHUZLWKWKHVDPSOH 7KHRYHUOD\VROXWLRQSURWHFWVVDPSOHVIURPGLUHFWFRQWDFWZLWKWKHVWURQJEDVHXVHGDVDQ XSSHUHOHFWURGHVROXWLRQ'LOXWLRQRIWKHO\VLVEXIIHUZLWKZDWHULVQHFHVVDU\WRGHFUHDVH WKHGHQVLW\VRWKHRYHUOD\GRHVQRWPL[ZLWKWKHVDPSOH $PPLG×FPORQJ,()JHOKDVDWRWDOSURWHLQFDSDFLW\RI∼µJIRUZKROHFHOO H[WUDFWVDQGRWKHUFRPSOH[SURWHLQPL[WXUHV7KHPD[LPXPFDSDFLW\IRUDQ\VLQJOHSURWHLQ VSRWLV∼WRµJGHSHQGLQJRQLWVVROXELOLW\QHDULWVLVRHOHFWULFSRLQWDQGWKHVHSDUDWLRQ GLVWDQFH IURP DQ\ QHDU QHLJKERUV 3UHSDUDWLRQ RI UHODWLYHO\ SXUH SURWHLQ VDPSOHV IRU (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW LVRHOHFWULFIRFXVLQJLVJHQHUDOO\VWUDLJKWIRUZDUG7KHVDPSOHXVXDOO\PD\EHSUHSDUHGLQ RQHRIWKHIROORZLQJZD\VGLDO\]HLQWRDQ\FRPSDWLEOHORZLRQLFVWUHQJWKEXIIHUO\RSKLOL]H LQ D YRODWLOH RU FRPSDWLEOH ORZLRQLFVWUHQJWK EXIIHU DQG GLVVROYH LQ O\VLV EXIIHU RU SUHFLSLWDWHWKHSURWHLQXVLQJWULFKORURDFHWLFDFLG7&$DQGUHGLVVROYHLQO\VLVEXIIHU)RU SUHSDULQJH[WUDFWVIURPFXOWXUHGFHOOVDQGIURPWLVVXHVDPSOHVVHH6XSSRUW3URWRFRODQG 6XSSRUW3URWRFROUHVSHFWLYHO\ 7KHPLQLPXPVDPSOHFRQFHQWUDWLRQRISURWHLQRUUDGLRDFWLYLW\KDVWREHVXIILFLHQWIRUWKH GHVLUHGGHWHFWLRQPHWKRG)RUFRPSOH[SURWHLQPL[WXUHVVXFKDVWLVVXHRUFHOOH[WUDFWVD µJWRWDOORDGLVUHFRPPHQGHGIRU&RRPDVVLHEOXHVWDLQLQJRUHOHFWUREORWWLQJ81,7 IRUVXEVHTXHQWVWUXFWXUDODQDO\VLVDµJWRWDOSURWHLQORDGVKRXOGEHVXIILFLHQWIRUVLOYHU VWDLQLQJ RU LPPXQREORWWLQJ DQG QR OHVV WKDQ FRXQWVJHO LV UHFRPPHQGHG IRU SURWHLQVODEHOHGZLWK+&RU6IRUDXWRUDGLRJUDSK\SXUSRVHV6DPSOHYROXPHVVKRXOG EH<µOIRUPPJHOVDQG<µOIRUPPJHOV7KLVLPSOLHVDWOHDVWDµJµOSURWHLQ FRQFHQWUDWLRQLQWKHVDPSOHIRUJHOVWREHVWDLQHGZLWK&RRPDVVLHEOXH &DUHIXOO\ILOODOOWXEHVZLWK01D2+$YRLGPL[LQJWKH1D2+VROXWLRQZLWKWKH RYHUOD\VROXWLRQDQGWKHVDPSOH )LOOWKHXSSHUUHVHUYRLUZLWK01D2+%HVXUHWKDWDOOJHOWXEHVDUHFRYHUHGZLWK WKHVROXWLRQ 5XQWKHJHOV &RQQHFWWKHHOHFWURGHVWRDSRZHUVXSSO\ZLWKUHG+WRWKHORZHUFKDPEHUDQGEODFN −WRWKHXSSHUFKDPEHU )RFXVIRUDWRWDORI9KU 8QOLNH RWKHU HOHFWURSKRUHWLF WHFKQLTXHV LQ ,() WKH YROWKRXU LV WKH PRVW FRPPRQ XQLW GHVFULELQJWKH¦WLPH§RILVRHOHFWULFIRFXVLQJ7KHLQLWLDOYROWDJHLVXVXDOO\VHWDFFRUGLQJ WRWKHGHVLUHGQXPEHURIYROWKRXUVLQDZD\WKDWLVFRQYHQLHQWIRUWKHRSHUDWRULHVR WKDWWKHVHSDUDWLRQZLOOUXQRYHUQLJKWEXWLWVKRXOGQRWEH97KHXSSHUYROWDJHOLPLW LVUHVWULFWHGE\KHDWUHOHDVHGLQWKHJHOVGXULQJLVRHOHFWULFIRFXVLQJ$WFRQVWDQWYROWDJHWKH FXUUHQWZLOOEHWKHKLJKHVWGXULQJWKHILUVWKRXURIVHSDUDWLRQ7KHLQLWLDOFXUUHQWZLOOEH VWURQJO\LQIOXHQFHGE\WKHLRQLFVWUHQJWKRIWKHVDPSOHVORDGHGRQWRWKHJHOV$QLQLWLDO YROWDJHRI9LVUHFRPPHQGHGIRUPPJHOVORDGHGZLWKVDPSOHVFRQWDLQLQJOHVVWKDQ P0VDOWVEXIIHUVWKHYROWDJHFRXOGEHLQFUHDVHGWR9DIWHU∼KULIFRROLQJLV XVHG7KHFXUUHQWLVDGHULYDWLYHRIYROWDJHDQGLVQHYHUSUHVHWIRULVRHOHFWULFIRFXVLQJ SXUSRVHV6RPHSRZHUVXSSOLHVDOORZSUHSURJUDPPLQJWKHGHVLUHGQXPEHURIYROWKRXUV DQG FRQWLQXRXVO\ DGMXVW YROWDJH DQG FXUUHQW GXULQJ WKH LVRHOHFWULF IRFXVLQJ SURFHGXUH FRQVWDQWSRZHU7KHWRWDOQXPEHURIYROWKRXUVLVDPDMRUIDFWRUWKDWDIIHFWVVHSDUDWLRQ LQWKHILUVWGLPHQVLRQ2SWLPDOIRFXVLQJWLPHZLOOYDU\IRUGLIIHUHQWDPSKRO\WHFRPELQD WLRQVEXW9KULVDUHDVRQDEOHYDOXHIRUPRVWV\VWHPV7RDFKLHYHDWRWDORI 9KUVHWWKHSRZHUVXSSO\WR9IRUKU7KHVHFRQGLWLRQVDUHFRQYHQLHQWIRUDQRYHUQLJKW VHSDUDWLRQDQGGRQRWUHTXLUHXVHRIDFRROLQJXQLW+LJKHUYROWDJHVFDQEHXVHGEXWPD\ FDXVH RYHUKHDWLQJ RI JHOV XQOHVV D KLJKO\ HIILFLHQW FRROLQJ V\VWHP LV HPSOR\HG 7KH PD[LPXPSUDFWLFDOYROWDJHGHFUHDVHVZLWKLQFUHDVHGJHOWXEHLQQHUGLDPHWHU)RFXVLQJIRU WRRORQJPD\FDXVHFDWKRGLFGULIWDQGUHVXOWLQDVKLIWHGS+SURILOHLQWKHJHOZKHUHDV IRFXVLQJIRUDVKRUWWLPHZLOOGHFUHDVHUHVROXWLRQ ([WUXGHDQGVWRUHJHOV 7XUQRIISRZHUVXSSO\DQGFDUHIXOO\GLVFRQQHFWOHDGV'HWDFKWKHOLGDQGUHPRYHWKH 1D2+VROXWLRQIURPWKHXSSHUUHVHUYRLURIWKHHOHFWURSKRUHVLVFKDPEHUXVLQJDPO GLVSRVDEOHSODVWLFV\ULQJH 5HPRYHRQHJHOWXEHDWDWLPHIURPWKHFKDPEHU 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 8VLQJDPOV\ULQJHHTXLSSHGZLWKDEOXQWQHHGOHVORZO\DQGFDUHIXOO\LQMHFWZDWHU EHWZHHQWKHJHODQGJODVVWXEH6WDUWIURPWKHERWWRPRIWKHWXEHWKHQUHSHDWWKH SURFHGXUHIURPWKHWRS7KHJHOVKRXOGVOLGHRXWRIWKHJODVVWXEH 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ ,WLVFRQYHQLHQWWROHWWKHJHOVOLGHIURPWKHJODVVWXEHRQWRDPHWDORUSODVWLFVFRRSZKLFK IDFLOLWDWHVWUDQVIHURIWKHJHOLQWRDVWRUDJHYLDO,WLVUHODWLYHO\HDV\WREUHDNWKHJHOGXULQJ H[WUXVLRQDQGSUDFWLFLQJRQVHYHUDOXQXVHGJHOVLVUHFRPPHQGHG7RH[WUXGHVPDOOHUGL DPHWHUJHOVXVHZDWHUSUHVVXUHJHQHUDWHGE\DV\ULQJHFRQQHFWHGWRWKHJHOWXEHZLWK7\JRQ WXELQJ,IFOHDQXQVFUDWFKHGJODVVWXEHVDUHXVHGH[WUXVLRQVKRXOGEHHDV\ 8VLQJWKHVFRRSVOLGHWKHJHOLQWRDPOFU\RYLDOFRQWDLQLQJPOHTXLOLEUDWLRQ EXIIHUDQGµOPHUFDSWRHWKDQRO&ORVHWKHYLDOLQFXEDWHH[DFWO\PLQDWURRP WHPSHUDWXUHWKHQIUHH]HE\SODFLQJWKHWXEHKRUL]RQWDOO\RQWRSRIGU\LFHSHOOHWV'R QRWPRYHRUDJLWDWHWKHWXEHZKLOHWKHVDPSOHLVIUHH]LQJ 7KH,()JHOVPD\EHUXQRQDVHFRQGGLPHQVLRQJHOLPPHGLDWHO\VHH%DVLF3URWRFRO RUFDQEHVWRUHGDW−°&IRUPDQ\ZHHNV(YHQZKHQWKHVHFRQGGLPHQVLRQLVWREHUXQ LPPHGLDWHO\H[WUXGHGJHOVVKRXOGEHIUR]HQDIWHUDFDUHIXOO\FRQWUROOHGLQFXEDWLRQWLPHDW URRPWHPSHUDWXUHVXFKDVWKHPLQFLWHGDERYHIRUPPLGJHOVWRPLQLPL]HGLIIXVLRQ RISURWHLQVRXWRIWKH,()JHO7KLVVKRUWLQFXEDWLRQEHIRUHIUHH]LQJZLOODOORZJO\FHUROWR GLIIXVHLQWRWKHJHO7RRVKRUWDQLQFXEDWLRQRUDJLWDWLRQGXULQJIUHH]LQJFDQUHVXOWLQJHO EUHDNDJH7KHWRWDOLQFXEDWLRQWLPHLQHTXLOLEUDWLRQEXIIHUVXPRIWKHWLPHSULRUWRIUHH]LQJ DQGDIWHUWKDZLQJLVFULWLFDODQGVKRXOGEHFDUHIXOO\FRQWUROOHG,QVXIILFLHQWLQFXEDWLRQ WLPHLQHTXLOLEUDWLRQEXIIHUZLOOQRWDOORZVXIILFLHQWWLPHIRU6'6WRGLIIXVHLQWRWKHJHODQG VDWXUDWHVLWHVRQWKHSURWHLQV([FHVVLYHLQFXEDWLRQWLPHVFDQUHVXOWLQDSSUHFLDEOHSURWHLQ ORVVHVGXHWRGLIIXVLRQRXWRIWKHKLJKO\SRURXV,()JHO &21'8&7,1*S+352),/(0($685(0(176 6WDQGDUGVZLWKGLIIHUHQWLVRHOHFWULFSRLQWVFDQKHOSLQHYDOXDWLQJWKHSHUIRUPDQFHRID VSHFLILFV\VWHPDQGGHWHUPLQLQJWKHHIIHFWLYHS+UDQJHLQWKHLVRHOHFWULFIRFXVLQJJHO 0DQ\S,VWDQGDUGVDUHFRPPHUFLDOO\DYDLODEOHIURPGLIIHUHQWVXSSOLHUV,WLVPRVWXVHIXO WRVHSDUDWHDPL[WXUHRIVWDQGDUGSURWHLQVWKDWLVSUHSDUHGIURPVHYHUDOLQGLYLGXDOSURWHLQV RUSXUFKDVHGDVDSUHIRUPXODWHGNLW7KLVPL[WXUHVKRXOGEHUXQLQSDUDOOHOZLWKH[SHUL PHQWDOVDPSOHVRQDVHSDUDWHUHIHUHQFHJHO,WLVJHQHUDOO\QRWUHFRPPHQGHGWRUXQS, VWDQGDUGVWRJHWKHULQWKHVDPHJHOZLWKVDPSOHVEHFDXVHRISRVVLEOHLQWHUIHUHQFHZLWK PLJUDWLRQDQGLGHQWLILFDWLRQRISURWHLQVRILQWHUHVW,QVWHDGRIDQDO\]LQJVWDQGDUGSURWHLQV DPRUHSUHFLVHHYDOXDWLRQRIWKHS+SURILOHFDQEHPDGHE\GLUHFWO\PHDVXULQJWKHS+ WKURXJKRXWWKHJHOXVLQJHLWKHUDVXUIDFHS+HOHFWURGHRUWKHIROORZLQJSURFHGXUH 6833257 35272&2/ 3UHSDUHDQGIRFXVRQHRUWZRJHOVVHH%DVLF3URWRFROVWHSVWRZLWKRXWDQ\ VDPSOHLQSDUDOOHOZLWKH[SHULPHQWDOVDPSOHV 3UHSDUHWRJODVVWHVWWXEHVHDFKFRQWDLQLQJPOKLJKSXULW\GHJDVVHGZDWHUIRU HDFKJHOWKDWZLOOEHXVHGWRPHDVXUHWKHS+JUDGLHQWPHDVXUHPHQWVRQGXSOLFDWH JHOVDUHUHFRPPHQGHG 7KHQXPEHURIWXEHVUHTXLUHGSHUJHOHTXDOVWZLFHWKHJHOOHQJWKLQFP $IWHUHOHFWULFIRFXVLQJLVFRPSOHWHGH[WUXGHWKHEODQNJHOVVHH%DVLF3URWRFRO VWHSVWR%ULHIO\ULQVHWKHJHOVZLWKZDWHU $IWHUH[WUXVLRQJHOVXUIDFHVPD\EHFRQWDPLQDWHGZLWKHOHFWURGHVROXWLRQV5LQVLQJZLWK ZDWHULVHVVHQWLDOIRUREWDLQLQJUHOLDEOHS+SURILOHV 3ODFHWKHJHORQDJODVVSODWHZLWKDSODVWLFUXOHUEHORZWKHSODWH&XWWKHJHOLQWR FPSLHFHVXVLQJDVKDUSUD]RUEODGH 3ODFHHDFKJHOSLHFHLQDWHVWWXEHFRQWDLQLQJPOZDWHU 'RQRWPL[WKHRUGHURIVDPSOHVEHFDXVHHDFKJHOSLHFHUHSUHVHQWVDVLQJOHS+SURILOHGDWD SRLQW 3ODFHDOOWHVWWXEHVRQDVKDNHUDQGVKDNHJHQWO\IRUKUDWURRPWHPSHUDWXUH (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 5HDGWKHS+RIHDFKVROXWLRQDQGSORWWKHS+SURILOHDVDIXQFWLRQRIWKHGLVWDQFH IURPWKHWRSRIWKHJHO $/7(51$7( 35272&2/ 121(48,/,%5,80,62(/(&75,&)2&86,1*2)9(5< $&,',&3527(,16 %DVLF3URWRFROLVVXIILFLHQWIRUVHSDUDWLQJSURWHLQVZLWKLVRHOHFWULFSRLQWVJUHDWHUWKDQ ∼WR)RUYHU\DFLGLFSURWHLQVKRZHYHUDQRQHTXLOLEULXPV\VWHPLVQHHGHG7KH PDMRUIHDWXUHVRIWKLVPHWKRGDUHXWLOL]DWLRQRIDVKRUWHUIRFXVLQJWLPHZLWKRXWUHDFKLQJ HTXLOLEULXPDPRGLILHGDPSKRO\WHPL[WXUHDQGGLIIHUHQWHOHFWURGHVROXWLRQV $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO ZYDPPRQLXPSHUVXOIDWHSUHSDUHLPPHGLDWHO\EHIRUHXVH &RQFHQWUDWHGVXOIXULFDFLGXVHGLQORZHUFKDPEHUHOHFWURGHVROXWLRQ $PSKRO\WHVS+XVHGLQXSSHUFKDPEHUHOHFWURGHVROXWLRQ 7R DQDO\]H YHU\ DFLGLF SURWHLQVIROORZ%DVLF3URWRFROZLWKWKHVHH[FHSWLRQVLQWKH LQGLFDWHGVWHSV :KHQSUHSDULQJWKHJHOVROXWLRQXVHWKHIROORZLQJPL[WXUHRIDPSKRO\WHVPO DPSKRO\WHVS+DQGPODPSKRO\WHVS+ )ROORZLQJWKHSURFHGXUHIRUFDVWLQJJHOVE\SRXULQJDGGµORIDPPRQLXP SHUVXOIDWHVROXWLRQVZLUODGGµO7(0('DQGVZLUODJDLQ *HOPL[WXUHVFRQWDLQLQJHQWLUHO\RUSUHGRPLQDQWO\YHU\DFLGLFRUYHU\EDVLFDPSKRO\WHV DUHJHQHUDOO\GLIILFXOWWRSRO\PHUL]H8VHRIDQLQFUHDVHGDPPRQLXPSHUVXOIDWHFRQFHQWUD WLRQDQGDGKHUHQFHWRWKHSURSHURUGHURIDGGLQJWKHUHDJHQWVVKRXOGHQVXUHSRO\PHUL]D WLRQ 3UHSDUHWKHERWWRPFKDPEHUHOHFWURGHVROXWLRQE\DGGLQJPOFRQFHQWUDWHGVXOIXULF DFLGWROLWHUVZDWHU'HJDVDWOHDVWPLQ 2PLWVWHSVWRGRQRWSUHIRFXVWKHJHOV 5HPRYHWKH0XUHDSRO\PHUL]DWLRQRYHUOD\VROXWLRQDQGSODFH∼µOO\VLVEXIIHU RQWRSRIHDFKJHO:DLWDWOHDVWPLQWKHQUHPRYHWKHO\VLVEXIIHU &DUHIXOO\ILOODOOWXEHVZLWKWKHXSSHUFKDPEHUHOHFWURGHDQRGHVROXWLRQSUHSDUHG E\PL[LQJS+DPSKRO\WHVZLWKZDWHULQDUDWLR )LOOWKHXSSHUEXIIHUFKDPEHUDQRGHZLWKWKHVROXWLRQGHVFULEHGLQVWHS ,PLQRGLDFHWLFDFLGP0PD\EHDPRUHHFRQRPLFDODOWHUQDWLYHDQRGHVROXWLRQ )RFXVIRUDWRWDORI9KU $/7(51$7( 35272&2/ 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 121(48,/,%5,80,62(/(&75,&)2&86,1*2)%$6,&3527(,16 ,Q JHQHUDO PRVW HTXLOLEULXP ,() JHO V\VWHPV XVLQJ VROXEOH DPSKRO\WHV SURGXFH S+ JUDGLHQWVWKDWGRQRWH[FHHGS+RQWKHEDVLFHQG\HWPDQ\SURWHLQVKDYHKLJKHUS, YDOXHV)RUWKLVUHDVRQVDPSOHVFRQWDLQLQJYHU\EDVLFSURWHLQVDUHXVXDOO\IRFXVHGXVLQJ DQRQHTXLOLEULXPV\VWHP,QDQHTXLOLEULXPV\VWHPSURWHLQVDUHORDGHGRQWKHEDVLFHQG RIWKHJHODQGPLJUDWHWRZDUGWKHDFLGLFHQGXQWLOWKH\UHDFKDS+HTXDOWRWKHLUS,,Q QRQHTXLOLEULXPV\VWHPVWKHVDPSOHLVORDGHGRQWKHDFLGLFHQGRIWKHJHODQGIRFXVLQJ LVWHUPLQDWHGDIWHUDUHODWLYHO\VKRUWWLPHIHZHUYROWKRXUV 7RUXQQRQHTXLOLEULXP,()JHOVIROORZWKHSURFHGXUHSUHYLRXVO\GHVFULEHGVHH%DVLF 3URWRFROZLWKWKHVHDOWHUDWLRQVLQWKHLQGLFDWHGVWHSV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 8VH01D2+DVWKHORZHUHOHFWURGHVROXWLRQ (OHFWURGHVROXWLRQVDQGHOHFWURGHVDUHUHYHUVHGLQWKLVSURFHGXUHUHODWLYHWRHTXLOLEULXP LVRHOHFWULFIRFXVLQJ 2PLWVWHSVWRGRQRWSUHIRFXVWKHJHOV 5HPRYHWKH0XUHDSRO\PHUL]DWLRQRYHUOD\VROXWLRQDQGSODFHµOO\VLVEXIIHU RQWRSRIHDFKJHO:DLWDWOHDVWPLQWKHQUHPRYHWKHO\VLVEXIIHU $IWHUORDGLQJWKHVDPSOHVDQGRYHUOD\LQJZLWKO\VLVEXIIHUGLOXWHGZLWKZDWHU YYDVLQ%DVLF3URWRFROXVH0+32LQVWHDGRI1D2+WRILOODOOJHOWXEHV 8VH0+32DVWKHXSSHUHOHFWURGHVROXWLRQ 5HYHUVH WKH FRQQHFWLRQ RI HOHFWURGHV¥LH FRQQHFW WKH UHG + OHDG WR WKH XSSHU FKDPEHUDQGWKHEODFN−OHDGWRWKHORZHUFKDPEHU )RFXVIRUDWRWDORIWR9KU 7KHRSWLPDOQXPEHURIYROWKRXUVGHSHQGVRQWKHQDWXUHRIWKHVDPSOHDQGWKHDPSKRO\WHV XVHG7KHYDOXHVUHFRPPHQGHGDERYHPD\QHHGWREHDGMXVWHGHPSLULFDOO\ ,62(/(&75,&)2&86,1*86,1*,002%,/,=('S+*5$',(17*(/ 675,36 ,Q LPPRELOL]HG S+ JUDGLHQW ,3* JHOV WKH DPSKRO\WHV DUH FRYDOHQWO\ OLQNHG WR WKH DFU\ODPLGHPDWUL[ZKLFKIDFLOLWDWHVSURGXFWLRQRIKLJKO\UHSURGXFLEOHJUDGLHQWVDVZHOO DVYHU\QDUURZS+JUDGLHQWVIRURSWLPDOUHVROXWLRQRIPLQRUFKDUJHGLIIHUHQFHV$YDULHW\ RISUHFDVWJHOVDQGDOOWKHQHFHVVDU\HTXLSPHQWDUHFRPPHUFLDOO\DYDLODEOHIURPHLWKHU $PHUVKDP3KDUPDFLD%LRWHFKRU%LR5DG(TXLSPHQWDQGFKHPLFDOVDUHDOVRDYDLODEOH IRUWKHXVHUWRFDVWJHOVLQWKHODERUDWRU\VHH6XSSRUW3URWRFRODOWKRXJKSUHFDVWJHOV DUHOLNHO\WRVXIILFHIRUWKHPDMRULW\RIDSSOLFDWLRQV1DUURZVWULSVRISUHFDVW,()JHOV ,PPRELOLQH'U\6WULSVRU5HDG\6WULS,3*VWULSVPD\EHXVHGWRDFKLHYHDILUVWGLPHQ VLRQVHSDUDWLRQIRUWZRGLPHQVLRQDOJHOHOHFWURSKRUHVLVDQGEURDGHUSUHFDVWVODEJHOV ,PPRELOLQH'U\3ODWHVFDQEHXVHGWRFRPSDUHPXOWLSOHVDPSOHVDIWHU,()VHSDUDWLRQ RQO\ VHH 6XSSRUW 3URWRFRO DQG 7DEOH ,Q WKLV SURWRFRO SUHFDVW ,PPRELOLQH 'U\6WULSV IURP $PHUVKDP 3KDUPDFLD %LRWHFK DUH UHK\GUDWHG RYHUQLJKW XVLQJ WKH UHVZHOOLQJFDVVHWWHRQHWRWZHOYHVDPSOHVWULSVPD\EHKDQGOHGDWDWLPHVDPSOHVDUH DSSOLHGXVLQJVDPSOHFXSKROGHUVDQGJHOVWULSVDUHLVRHOHFWULFIRFXVHGRYHUQLJKW7KLV SURFHGXUHKDVEHHQDGDSWHGIURPLQVWUXFWLRQERRNOHWVSURYLGHGE\$PHUVKDP3KDUPDFLD %LRWHFKZLWK,PPRELOLQH'U\6WULS.LWVDQGZLWKWKH,PPRELOLQH'U\6WULSUHVZHOOLQJ WUD\5HFHQWO\ERWK$PHUVKDP3KDUPDFLD%LRWHFKDQG%LR5DGKDYHGHYHORSHGQHZHU ,()V\VWHPVWKH,3*SKRU,VRHOHFWULF)RFXVLQJ6\VWHPDQGWKH3URWHDQ,()&HOOUHVSHF WLYHO\ 7KHVH V\VWHPV VLPSOLI\ ,3* VWULSKDQGOLQJDQGWKHRYHUDOOLVRHOHFWULFIRFXVLQJ SURFHGXUH7KH,3*SKRUV\VWHPDOVRLQWHJUDWHV,3*VWULSUHVZHOOLQJDQGHOHFWURSKRUHVLV VWHSVLQDVLQJOHVWULSKROGHU7KHVHV\VWHPVLQFOXGHYHU\KLJKYROWDJHSRZHUVXSSOLHV LQWHJUDWHG ZLWK HIILFLHQW FRROLQJ XQLWV WR SHUPLW PRUH UDSLG LVRHOHFWULF IRFXVLQJ ,Q JHQHUDO SUHPDGH FRPPHUFLDO ,3* VWULSV IURP DQ\ VXSSOLHU FDQ EH XVHG ZLWK DQ\ LVRHOHFWULFIRFXVLQJGHYLFHWKDWFDQSK\VLFDOO\DFFRPPRGDWHWKHVWULS7KHDSSURSULDWH XVHUPDQXDOVVKRXOGEHFRQVXOWHGIRUVSHFLILFGHWDLOV %$6,& 35272&2/ 6LQFHWKHUHLVDJUHDWHUVHOHFWLRQRIS+UDQJHVIRUSUHPDGH,PPRELOLQH'U\3ODWHVWKDQ 'U\6WULSVLWLVVRPHWLPHVFRQYHQLHQWWRFXW'U\3ODWHVLQWRVWULSVSULRUWRUHK\GUDWLQJWKH JHO WR REWDLQ QDUURZHU S+ UDQJHV ZKHUH QHHGHG 6HH %DVLF 3URWRFRO IRU GHWDLOV FRQFHUQLQJSUHSDULQJDQGUXQQLQJWKHVHFRQGGLPHQVLRQJHO :HDUJORYHVWKURXJKRXWWKHSURFHGXUHDQGKDQGOHWKH,PPRELOLQH'U\6WULSVZLWKIRUFHSV ZKHUHIHDVLEOHWRSUHYHQWH[WUDQHRXVSURWHLQFRQWDPLQDWLRQRIWKHJHOVDQGJHOVROXWLRQV (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 7DEOH 5HK\GUDWLRQ6ROXWLRQVIRU,PPRELOLQH'U\6WULSVD &RPSRQHQW 8OWUDSXUHXUHDE 7KLRXUHDE &+$36F 3KDUPDO\WHS+ 3KDUPDO\WHS+ 3KDUPDO\WHS+ $PSKROLQHS+ '77 %URPSKHQROEOXH 0LOOL4ZDWHU )LQDOFRQF 0 0 G 7UDFH 'U\6WULSW\SH / 1/ / J J J µO J J J J J J µO µO µO PJ $IHZJUDLQV 7RPO µO PJ $IHZJUDLQV 7RPO PJ $IHZJUDLQV 7RPO D5HK\GUDWLRQ VROXWLRQV VKRXOG EH SUHSDUHG IUHVK LPPHGLDWHO\ EHIRUHXVHRUVWRUHGDVIUR]HQ DOLTXRWVDQGVKRXOGEHILOWHUHGXVLQJDµPILOWHU0LQLPL]HWRWDOWLPHWKHVROXWLRQLVDWURRP WHPSHUDWXUHSULRUWRXVHWRPLQLPL]HGHFRPSRVLWLRQRIXUHD,IWKHUHVZHOOLQJWUD\LVXVHGa RUµOUHK\GUDWLRQVROXWLRQLVUHTXLUHGSHURUFP'U\6WULSUHVSHFWLYHO\ E$WRWDOXUHDFRQFHQWUDWLRQRI0LVW\SLFDOO\XVHG7KLRXUHDLVPRUHHIIHFWLYHWKDQXUHDIRU PLQLPL]LQJ SURWHLQ SUHFLSLWDWLRQ GXULQJ LVRHOHFWULF IRFXVLQJ EXW LWV VROXELOLW\ LV ORZHU 7KH FRPELQDWLRQ RI 0 XUHD 0 WKLRXUHD XVXDOO\ UHVXOWV LQ VXSHULRU VDPSOH VROXELOL]DWLRQ DQG LVRHOHFWULFIRFXVLQJDVFRPSDUHGZLWK0XUHDDORQH F7KHRSWLPDOGHWHUJHQWDQGGHWHUJHQWFRQFHQWUDWLRQVKRXOGEHHPSLULFDOO\GHWHUPLQHG2WKHU FRPPRQDOWHUQDWLYHVDUH7ULWRQ;DQGRFW\OJOXFRVLGH7KHGHWHUJHQWXVHGPXVWEHQRQLRQLF RU]ZLWWHULRQLFWRDYRLGKLJKFXUUHQWDQGFRQVHTXHQWRYHUKHDWLQJGXULQJLVRHOHFWURIRFXVLQJ G$OWHUQDWLYHO\VROXEOHDPSKRO\WHVDUHDYDLODEOHDVSUHIRUPXODWHG,3&EXIIHUFRQFHQWUDWHVIRU HDFKW\SHRI,3*VWULS 7KRURXJKO\FOHDQDOOHTXLSPHQWZLWKDPLOGODERUDWRU\GHWHUJHQWVROXWLRQULQVHZHOOZLWK 0LOOL4ZDWHUDQGDOORZWRGU\EHIRUHXVLQJ6ROXWLRQVFRQWDLQLQJ0XUHDPD\EH KHDWHGEULHIO\WR°WR°&WRDLGLQVROXELOL]DWLRQ 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 0DWHULDOV 8UHDXOWUDSXUH &+$36RU7ULWRQ; 3KDUPDO\WHDQGRUVROXEOHDPSKRO\WHVVHH7DEOH $PHUVKDP3KDUPDFLD%LRWHFK $PSKROLQHS+$PHUVKDP3KDUPDFLD%LRWHFK '77GLWKLRWKUHLWRO %URPSKHQROEOXH 3UHFDVW,PPRELOLQH'U\6WULSV$PHUVKDP3KDUPDFLD%LRWHFK 'U\6WULSFRYHUIOXLG$PHUVKDP3KDUPDFLD%LRWHFK ,PPRELOLQH'U\6WULSNLW$PHUVKDP3KDUPDFLD%LRWHFKLQFOXGLQJ &DWKRGHHOHFWURGH $QRGHHOHFWURGH 6DPSOHFXSEDU 7UD\ 6DPSOHFXSV ,PPRELOLQHVWULSDOLJQHU ,()HOHFWURGHVWULSV 6DPSOHDSSOLFDWLRQSLHFHV ,QVWUXFWLRQPDQXDO FRQWLQXHG 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 3URWHLQVDPSOHWREHDQDO\]HG /\VLVEXIIHUVHHUHFLSH ,PPRELOLQH'U\6WULSUHVZHOOLQJWUD\$PHUVKDP3KDUPDFLD%LRWHFK )RUFHSV )LOWHUSDSHU *ODVVSODWH )ODWEHGHOHFWURSKRUHVLVXQLW$PHUVKDP3KDUPDFLD%LRWHFK0XOWLSKRU,,RU HTXLYDOHQW 5HFLUFXODWLQJFRROLQJZDWHUEDWK 3RZHUVXSSO\PLQLPXPFDSDFLW\RIWR9 3HWULGLVKHV $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUSURWHLQGHWHFWLRQE\VWDLQLQJ$33(1',; DQGRUIRUHOHFWUREORWWLQJ81,7RSWLRQDO 5HK\GUDWHWKH,PPRELOLQH'U\6WULSV 3UHSDUHDQDSSURSULDWHUHK\GUDWLRQVROXWLRQIRUWKHW\SHRI'U\6WULSVWREHXVHGDV GHVFULEHGLQ7DEOH∼µOUHK\GUDWLRQVROXWLRQSHUFP'U\6WULS 7KHUHK\GUDWLRQVROXWLRQVKRXOGFRQWDLQ0XUHD0WKLRXUHDDQG&+$36RUDQRWKHU DSSURSULDWHGHWHUJHQW]ZLWWHULRQLFRUQRQLRQLFVXFKDV7ULWRQ;13RUQRFW\O JOXFRVLGHVKRXOGEHLQFOXGHGLQWKHUHK\GUDWLRQVROXWLRQWRDLGLQVDPSOHVROXELOLW\7KH RSWLPDOGHWHUJHQWDQGGHWHUJHQWFRQFHQWUDWLRQPD\YDU\ZLWKW\SHRIVDPSOHDQGVKRXOG EHGHWHUPLQHGHPSLULFDOO\ 2QHSRVVLEOHPHWKRGRIORDGLQJODUJHVDPSOHYROXPHVRQWR,3*JHOVLVWRDGGWKHVDPSOH GLUHFWO\WRWKHUHK\GUDWLRQVROXWLRQ6DPSOHORDGLQJGXULQJUHK\GUDWLRQLVSUHIHUUHGZKHQ XVLQJWKH,3*SKRUV\VWHPZLWKLWVVLQJOHVWULSKROGHUIRUERWKUHK\GUDWLRQDQGLVRHOHFWULF IRFXVLQJ 6ROXWLRQVFRQWDLQLQJXUHDVKRXOGEHILOWHUHGXVLQJDµPILOWHUEHIRUHXVH 6OLGH WKH SURWHFWLYH OLG RII WKH UHVZHOOLQJ WUD\ DQGOHYHOWKHWUD\E\DGMXVWLQJWKH OHYHOLQJIHHWXQWLOWKHOHYHOLQJEXEEOHLVFHQWHUHG )RU DQ FP JHO SLSHW WR µO RI UHK\GUDWLRQ VROXWLRQ LQWR D VORW RI WKH UHVZHOOLQJWUD\0RYHWKHSLSHWDORQJWKHOHQJWKRIWKHZHOOZKLOHDGGLQJWKHVROXWLRQ WR VSUHDG LW HYHQO\ WKURXJKRXW WKH OHQJWK RI WKH VORW $YRLG H[FHVVLYH DLU EXEEOH IRUPDWLRQZKLOHSLSHWWLQJWKLVVROXWLRQ ,IWKH,3*SKRUV\VWHPLVXVHGSLSHWWKHUHK\GUDWLRQVROXWLRQFRQWDLQLQJWKHSURWHLQVDPSOH LQWRHDFKFOHDQHGFHUDPLFKROGHU 5HPRYHWKHSURWHFWLYHFRYHUIURPWKH,PPRELOLQH'U\6WULSVDQGJHQWO\SODFHWKHP JHOVLGHGRZQLQWRWKHSUHSDUHGVORW 7RIDFLOLWDWHWKHLUUHPRYDODIWHUUHK\GUDWLRQWKHVWULSVVKRXOGEHRULHQWHGZLWKWKHLUSRLQWHG HQGVDWWKHVORSHGHQGRIWKHVORWVLQWKHUHK\GUDWLRQWUD\%HFDUHIXOQRWWRWUDSDQ\DLU EXEEOHVXQGHUWKHJHOVWULSV 2YHUOD\HDFKVWULSZLWKWRPORI'U\6WULSFRYHUIOXLGWRSUHYHQWHYDSRUDWLRQDQG XUHDFU\VWDOOL]DWLRQ6OLGHWKHSURWHFWLYHOLGLQWRSODFHDQGDOORZJHOVWRUHK\GUDWH RYHUQLJKW∼KRXUVDWURRPWHPSHUDWXUH 6KRUWHUUHK\GUDWLRQWLPHVFDQEHXVHGDOWKRXJKDPLQLPXPRIWRKULVXVXDOO\QHHGHG WRFRPSOHWHO\DQGUHSURGXFLEO\UHK\GUDWHWKHJHOV'RQRWVXEVWDQWLDOO\H[FHHGKUDV H[WHQVLYH LQFXEDWLRQ HVSHFLDOO\ UHK\GUDWLQJ JHOV RYHU D ZHHNHQG LQFUHDVHV SRWHQWLDO SUREOHPV GXH WR HYDSRUDWLRQ DQG VXEVHTXHQW XUHD FU\VWDOOL]DWLRQ ,Q DGGLWLRQ ORQJ LQFXEDWLRQWLPHVLQFUHDVHWKHH[WHQWRIXUHDGHFRPSRVLWLRQZKLFKZLOOLQFUHDVHWKHULVNRI DPLQRJURXSPRGLILFDWLRQRQSURWHLQVE\WKHF\DQDWHSURGXFHGIURPXUHDGHFRPSRVLWLRQ ,IWKH,3*SKRUV\VWHPLVXVHGDORZYROWDJHWR9FDQEHDSSOLHGGXULQJUHK\GUDWLRQ ZKLFKLPSURYHVLVRHOHFWULFIRFXVLQJDQGSURWHLQ\LHOGVRIVRPHVDPSOHV:LWKWKLVGHYLFH (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW SURWRFROVFDQEHSUHSURJUDPPHGVRDVWRDOORZLVRHOHFWULFIRFXVLQJWRLPPHGLDWHO\IROORZ UHK\GUDWLRQ +HQFH ERWK UHK\GUDWLRQ ZLWK ORZ YROWDJH DQG LVRHOHFWULF IRFXVLQJ FDQ EH FRPSOHWHGRYHUQLJKWVLQFH∼KULVVXIILFLHQWIRUUHK\GUDWLRQDQGXSWR9FDQEHXVHG LQODWHUVWDJHVRILVRHOHFWULFIRFXVLQJWRVKRUWHQWKHWRWDOIRFXVLQJWLPH $IWHUWKHRYHUQLJKWUHK\GUDWLRQVOLGHWKHOLGRIIWKHUHVZHOOLQJWUD\3ODFHDIRUFHSVWLS LQWRWKHVOLJKWGHSUHVVLRQXQGHUHDFKVWULSDQGUHPRYHWKHVWULS*HQWO\EORWDQ\H[FHVV RLORUPRLVWXUHIURPWKHSODVWLFEDFNLQJRIWKHUHK\GUDWHGVWULSVZLWKILOWHUSDSHU$GDPS SLHFHRIILOWHUSDSHUPD\DOVREHXVHGWREORWWKHVXUIDFHRIWKHJHO6RPHRIWKHSDSHU PD\DGKHUHWRWKHJHODQGVKRXOGEHJHQWO\SHHOHGDZD\7KHJHOLVQRZUHDG\WREHSODFHG LQWKHVWULSDOLJQHURQWKHFRROLQJSODWHRIWKHHOHFWURSKRUHVLVXQLW 'RQRWDOORZWKHJHOWRGHK\GUDWHSULRUWRSODFLQJLWRQWKHFRROLQJSODWHLQVWHS6WHSV WRVKRXOGEHFRPSOHWHGSULRUWRUHPRYLQJWKHVWULSVIURPWKHUHVZHOOLQJWUD\ 5XQWKHILUVWGLPHQVLRQ /HYHOWKH0XOWLSKRU,,HOHFWURSKRUHVLVXQLWWKHQFRQQHFWLWWRDFLUFXODWLQJFRROLQJ ZDWHUEDWK$OORZLWWRFRROWR°&IRUWRKUWRHQVXUHHYHQFRROLQJ'RQRWFRRO EHORZ°&WRSUHYHQWSUHFLSLWDWLRQRIXUHDLQWKHJHOV 3LSHW∼PO'U\6WULSFRYHUIOXLGRQWRWKHVXUIDFHRIWKH0XOWLSKRU,,FRROLQJSODWH 3RVLWLRQWKH,PPRELOLQH'U\6WULSWUD\RQWKHFRROLQJSODWHRULHQWHGZLWKWKHUHG DQRGLFHOHFWURGHDWWKHWRSQHDUWKHFRROLQJWXEHV $YRLGODUJHDLUEXEEOHVEHWZHHQWKHFRROLQJSODWHDQGWKHWUD\VPDOOEXEEOHVVKRXOGQRW FDXVHDSUREOHP &RQQHFWWKHUHGDQGEODFNHOHFWURGHOHDGVRQWKHWUD\WRWKHLUUHVSHFWLYHSRVLWLRQVRQ WKH 0XOWLSKRU ,, XQLW 3RXU PO RI 'U\6WULS FRYHU IOXLG LQWRWKHWUD\3ODFHWKH ,PPRELOLQH'U\6WULSDOLJQHURQWRSRIWKHRLOJURRYHVLGHXS $YRLGJHWWLQJRLORQWRSRIWKHVWULSDOLJQHU7KHSRVVLEOHSUHVHQFHRIVPDOODLUEXEEOHV XQGHUWKHVWULSDOLJQHULVQRWLPSRUWDQW &XWWZRHOHFWURGHVWULSVWRDOHQJWKRIFPUHJDUGOHVVRIWKHQXPEHURI'U\6WULSV XVHG3ODFHWKHHOHFWURGHVWULSVRQWRDFOHDQJODVVSODWHDQGVRDNHDFKRQHZLWK PO0LOOL4ZDWHU%ORWZLWKD.LPZLSHRUWLVVXHSDSHUWRUHPRYHH[FHVVZDWHU 7KHHOHFWURGHVWULSVVKRXOGEHHYHQO\VRDNHGDQGMXVWGDPSDIWHUEORWWLQJ([FHVVLYHZDWHU FRXOGFDXVHVDPSOHVWUHDNLQJ 7UDQVIHUWKHVWULSVIURPVWHSWRDGMDFHQWJURRYHVLQWKHDOLJQHUWUD\3RVLWLRQWKH URXQGHGDFLGLFHQGRIHDFKVWULSQHDUWKHWRSRIWKHWUD\DWWKHUHGHOHFWURGHDQRGH QHDUWKHFRROLQJWXEHVDQGWKHVTXDUHHQGDWWKHERWWRPRIWKHWUD\QHDUWKHEODFN HOHFWURGHFDWKRGH%HVXUHWKDWWKHHGJHVRIDOOJHOVWULSVDWWKHDQRGHHQGDUHOLQHG XSHYHQO\ 3ODFHWKHEORWWHGHOHFWURGHVWULSVIURPVWHSRQWRSRIWKHJHOVXUIDFHRIWKH'U\6WULSV QHDU WKH DQRGH DQG FDWKRGH HQGV RI WKH JHO 3RVLWLRQ WKH UHG DQRGH DQG EODFN FDWKRGHHOHFWURGHVRQWRSRIWKHHOHFWURGHVWULSVDWWKHLUUHVSHFWLYHHQGV $IWHUWKHHOHFWURGHVKDYHEHHQSUHVVHGGRZQRQWRSRIWKHHOHFWURGHVWULSVFKHFNWKDWWKH JHOVWULSVKDYHQRWVKLIWHGSRVLWLRQ 3XVKWKHVDPSOHFXSVRQWRWKHVDPSOHFXSEDU3ODFHWKHVDPSOHFXSEDUQHDUWKH DQRGHHQGRIWKHJHOVRWKDWWKHVPDOOVSDFHUDUPMXVWWRXFKHVWKHHOHFWURGHDQGWKH VDPSOHFXSVDUHQHDUHVWWRWKHHOHFWURGHEXWGRQRWDOORZWKHFXSVWRWRXFKWKHJHO 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 7KHVDPSOHFXSVVKRXOGIDFHWKHQHDUHVWHOHFWURGH7KHDFLGLFHQGRIWKHJHOFDQXVXDOO\ EH XVHG IRU VDPSOH DSSOLFDWLRQ KRZHYHU WKH RSWLPDO ORDGLQJ SRVLWLRQ PD\ QHHG WR EH GHWHUPLQHGHPSLULFDOO\IRUGLIIHUHQWW\SHVRIVDPSOHV$WKLJKSURWHLQFRQFHQWUDWLRQVDQGRU DWQRQRSWLPDOS+VDPSOHVPD\SUHFLSLWDWHLQWKHJHODWWKHORDGLQJSRVLWLRQ 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 3RVLWLRQRQHVDPSOHFXSDERYHHDFKJHOVWULSDQGSXVKGRZQWRHQVXUHJRRGFRQWDFW EHWZHHQWKHERWWRPRIWKHVDPSOHFXSDQGWKHJHOVWULS0DNHVXUHWKHJHOVWULSVKDYH QRWVKLIWHGSRVLWLRQ 3RXUWRPORI'U\6WULSFRYHUIOXLGLQWRWKHWUD\LWZLOOFRYHUWKHJHOV,IRLO OHDNVLQWRWKHVDPSOHFXSVDGMXVWWKHFXSVWRVWRSOHDNDJH:KHQWKHUHLVQROHDNDJH LQWR WKH VDPSOH FXSV DGG HQRXJK FRYHU IOXLG WR WKH WUD\ WR FRPSOHWHO\ FRYHUWKH VDPSOHFXSVaPO 3LSHW SURWHLQ VDPSOHV LQ O\VLV EXIIHU LQWR WKH VDPSOH FXSV E\ XQGHUOD\LQJ 7KH VDPSOHVKRXOGVLQNWRWKHERWWRPRIWKHFXS&KHFNIRUOHDNDJHRIWKHVDPSOHRXWRI WKHVDPSOHFXS 6DPSOHVVKRXOGHLWKHUEHO\RSKLOL]HGDQGWKHQVROXELOL]HGLQO\VLVEXIIHURUGLOXWHGSDUWV O\VLVEXIIHUWRSDUWVDPSOH7KHPD[LPXPYROXPHHDFKVDPSOHFXSKROGVLVµO7KH FRPSOH[LW\RIWKHVDPSOHWKHVDPSOHVROXELOLW\DWWKHORDGLQJFRQFHQWUDWLRQDQGS+XVHG WKHWKLFNQHVVRIWKHVHFRQGGLPHQVLRQJHODQGWKHGHWHFWLRQPHWKRGWREHHPSOR\HGVKRXOG EHFRQVLGHUHGZKHQGHFLGLQJKRZPXFKSURWHLQWRORDG$VDVWDUWLQJUHIHUHQFHW\SLFDO ORDGLQJUDQJHVIRUWRPPWKLFNFP×FPJHOVZRXOGEH∼WRQJSHUPDMRU VSRWIRUVLOYHUVWDLQLQJDQG∼WRµJSHUPDMRUVSRWIRU&RRPDVVLHEOXHVWDLQLQJ:KHQ YHU\FRPSOH[VDPSOHVDUHXVHGVXFKDVZKROHFHOOH[WUDFWVWRWDOSURWHLQORDGVDUHOLNHO\WR EH∼WRµJIRUVLOYHUVWDLQLQJDQG∼WRµJIRU&RRPDVVLHEOXHVWDLQLQJ7KH VDOWFRQFHQWUDWLRQLQVDPSOHVVKRXOGEHNHSWP0DQGLIWKHVDPSOHFRQWDLQV6'6WKH ILQDO6'6FRQFHQWUDWLRQVKRXOGEH 3ODFHWKHOLGRQWKH0XOWLSKRU,,XQLWDQGFRQQHFWWKHOHDGVWRDSRZHUVXSSO\)RFXV WKHJHOVZLWKFRQVWDQWYROWDJHIRUWRKUDW9IROORZHGE\WRKUDW 9IRUDWRWDORIWRN9KU5HIHUWRWKHXVHUPDQXDOIRUH[DFWUHFRPPHQGHGYROWDJH FRQGLWLRQVIRUHDFKW\SHRI,PPRELOLQH'U\6WULS 7KHRSWLPDOQXPEHURI9KUZLOOGHSHQGXSRQWKHS+UDQJHRIWKH,PPRELOLQH6WULSXVHG WKHW\SHRIVDPSOHDQGWKHVDPSOHORDGDQGYROXPHWKHUHIRUHWKHRSWLPDO9KUVKRXOGEH HPSLULFDOO\GHWHUPLQHGIRUGLIIHUHQWDSSOLFDWLRQV :KHQLVRHOHFWULFIRFXVLQJLVFRPSOHWHGLVFRQQHFWWKHSRZHUVXSSO\DQGUHPRYHWKH FRYHUIURPWKH0XOWLSKRU,,XQLW5HPRYHWKHHOHFWURGHVHOHFWURGHVWULSVDQGVDPSOH FXSEDUIURPWKHWUD\ ,IJHOVDUHWREHUXQLQWKHVHFRQGGLPHQVLRQLPPHGLDWHO\DIWHULVRIRFXVLQJVWHSVWRRI %DVLF3URWRFROVKRXOGEHFRPSOHWHGSULRUWRWHUPLQDWLQJLVRIRFXVLQJ 8VLQJIRUFHSVUHPRYHWKH'U\6WULSVIURPWKHWUD\,IWKHJHOVDUHWREHUXQLQWKH VHFRQGGLPHQVLRQLPPHGLDWHO\SODFHLQDSHWULGLVKZLWKWKHVXSSRUWILOPDORQJWKH ZDOORIWKHGLVKDQGSURFHHGGLUHFWO\WRHTXLOLEUDWLRQRIWKHJHOVHH%DVLF3URWRFRO VWHS$OWHUQDWLYHO\JHOVPD\EHVWRUHGVHDOHGLQDSODVWLFEDJDW−°&XQWLO UHDG\WRUXQWKHVHFRQGGLPHQVLRQJHO *HOVPD\EHVWRUHGDWOHDVWWRPRQWKVDW−°&'RQRWSODFHLQWKHHTXLOLEUDWLRQ EXIIHUVUHTXLUHGIRUWKHVHFRQGGLPHQVLRQSULRUWRVWRUDJH (/(&7523+25(6,621,002%,/,=('S+*5$',(17*(/6 ,QWKLVSURWRFRODIWHUSUHFDVW,()JHOV,PPRELOLQH'U\3ODWHVIURP$PHUVKDP3KDUPD FLD%LRWHFKDUHUHK\GUDWHGVDPSOHVDUHORDGHGDQGVXEMHFWHGWRLVRHOHFWULFIRFXVLQJ*HOV DUHW\SLFDOO\UXQDWWR9DQGUHTXLUHIRFXVLQJWLPHVRIWRKU3URWHLQVDPSOHV PD\ EH GHWHFWHG E\ FRQYHQWLRQDO PHWKRGV VXFK DV &RRPDVVLH EOXH RU VLOYHU VWDLQLQJ ,VRHOHFWULFSRLQWVFDQEHGHWHUPLQHGZLWKWKHXVHRIS,FDOLEUDWLRQSURWHLQVDOWHUQDWLYHO\ EHFDXVHWKHJUDGLHQWLVOLQHDURQHFDQPHDVXUHWKHPLJUDWLRQGLVWDQFHDFURVVWKHJHODQG HVWLPDWHWKHS,DWHDFKORFDWLRQ$VQRWHGLQ%DVLF3URWRFRO,PPRELOLQH'U\3ODWHVFDQ EHFXWLQWRPPZLGHVWULSVWRXVHDVWKHILUVWGLPHQVLRQRIWZRGLPHQVLRQDOJHOVVLQFH 6833257 35272&2/ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 'U\3ODWHVDUHDYDLODEOHLQQDUURZHUS+UDQJHVWKDQ'U\6WULSV'U\3ODWHVFDQDOVREHXVHG DV GHVFULEHG LQ WKLV SURWRFRO WR VLPXOWDQHRXVO\ VHSDUDWH PXOWLSOH VDPSOHV LQ D VLQJOH GLPHQVLRQ$SSOLFDWLRQVRIWKLVPHWKRGLQFOXGHLQLWLDOVFUHHQLQJRIVDPSOHVWRGHWHUPLQH WKHRSWLPDOS+JUDGLHQWSULRUWRUXQQLQJPRUHWLPHFRQVXPLQJWZRGLPHQVLRQDOJHOV SUHVFUHHQLQJIUDFWLRQVIURPDFKURPDWRJUDSKLFSXULILFDWLRQVWHSSULRUWRUXQQLQJWZRGL PHQVLRQDOJHOVDQGHYDOXDWLRQRIFKDUJHKHWHURJHQHLW\RISXULILHGSURWHLQV $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO 3UHFDVW'U\3ODWHJHO$PHUVKDP3KDUPDFLD%LRWHFK 5HSHO6LODQH$PHUVKDP3KDUPDFLD%LRWHFK 3DUDIILQRLO 3URWHLQVDPSOHVWREHDQDO\]HG 5HVZHOOLQJ&DVVHWWHNLW$PHUVKDP3KDUPDFLD%LRWHFKLQFOXGLQJ ×פPPJODVVSODWHZLWKPP8IUDPH ×פPPJODVVSODWH 6LOLFRQHWXELQJ 3LQFKFRFN &ODPSV POV\ULQJH 5ROOHU$PHUVKDP3KDUPDFLD%LRWHFK :KDWPDQQRILOWHUSDSHU )ODWEHGHOHFWURSKRUHVLVXQLW$PHUVKDP3KDUPDFLD%LRWHFK0XOWLSKRU,, °RU°&FRROLQJZDWHUEDWK (OHFWURGHVWULSV 6DPSOHDSSOLFDWRUVWULSRUVDPSOHDSSOLFDWLRQSLHFHV 3RZHUVXSSO\PLQLPXPFDSDFLW\WR9 $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUSURWHLQGHWHFWLRQE\VWDLQLQJ$33(1',; DQGIRUHOHFWUREORWWLQJ81,7RSWLRQDO 5HK\GUDWHWKHJHO 5HPRYHSUHFDVWJHOIURPSDFNDJLQJ,IWKHHQWLUHJHOLVQRWQHHGHGFXWRIIWKHUHTXLUHG QXPEHURIODQHVDQGUHVHDOWKHXQXVHGJHO0DUNWKHSRODULW\RIWKHJHOVHFWLRQWREHXVHG E\FXWWLQJDVPDOOWULDQJOHRIIWKHDQRGHFRUQHU+DQGOHWKHJHOE\WKHVXSSRUWILOPRQO\ ,WLVFULWLFDOWKDWWKHODQHVDUHFXWIURPWKHJHOLQWKHSURSHURULHQWDWLRQWRSUHVHUYHWKHS+ JUDGLHQWVHH)LJDQGSRODULW\PXVWEHLQGLFDWHGIRUSURSHURULHQWDWLRQRIHOHFWURGHV ODWHULQWKHSURFHGXUH anode side (+) cut corner (anode side) cut in this direction 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV anode corner cut by manufacturer cathode side (- ) )LJXUH 0DUNLQJRULHQWDWLRQRIDSUHFDVW,3*JHOZKHQRQO\DSRUWLRQRIWKHJHOLVXVHG 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 8VHWKH5HVZHOOLQJ&DVVHWWHWRUHK\GUDWHWKHJHO&RQQHFWVLOLFRQHWXELQJWKURXJK KROHLQWKHERWWRPFRUQHURIWKH8IUDPHSODWHVHDOZLWKVLOLFRQHJOXHDQGFRQQHFW WKHSLQFKFRFNWRWKHRWKHUHQGRIWKHWXELQJ3ODFHDJODVVSODWHRQDFOHDQIODWVXUIDFH DQGZHWZLWKDIHZGURSVRIZDWHU3ODFHWKHJHORQWKHSODWHJHOVLGHXS*HQWO\UROO ZLWKDFOHDQUXEEHUUROOHUWRUHPRYHDQ\DLUEXEEOHV &RYHUWKHSODWHDQGJHOZLWKWKHSODWHILWWHGZLWKWKH8IUDPH 7KH8IUDPHSODWHVKRXOGEHFRDWHGZLWKDWKLQOD\HURI5HSHO6LODQHWRSUHYHQWWKHJHO IURPVWLFNLQJWRWKHSODWH 3ODFHFODPSVDURXQGWKHHGJHVRIWKHSODWHVPDNLQJVXUHWKHVHDOLVWLJKW 6ORZO\ILOOWKHFDVVHWWHZLWKWKHGHVLUHGUHK\GUDWLRQVROXWLRQXVLQJDPOV\ULQJH FRQQHFWHGWRWKHVLOLFRQHWXELQJDQGOHWVWDQGIRUWKHUHFRPPHQGHGDPRXQWRIWLPH 3UHFRROHOHFWURSKRUHVLVXQLWWRKUSULRUWRHOHFWURSKRUHVLVVHHVWHS 5HVZHOOLQJZLWKZDWHUIRUWRKULVQRUPDOO\VXIILFLHQW,IXVLQJDGGLWLYHVVXFKDVXUHD 7ULWRQJO\FHURORUUHGXFLQJDJHQWVDOORZWKHJHOWRUHK\GUDWHRYHUQLJKW$GGLWLYHVFDQEH XVHGWRLPSURYHVROXELOLW\RISURWHLQVQHDUWKHLULVRHOHFWULFSRLQW5HGXFLQJUHDJHQWVVXFK DV'77DUHXVHGWRUHGXFHGLVXOILGHERQGV :KHQJHOKDVEHHQDOORZHGWRUHK\GUDWHFRPSOHWHO\UHPRYHWKHFODPSVDQGJHQWO\ SU\WKHSODWHVDSDUW 0RLVWHQDSLHFHRIILOWHUSDSHUZLWKZDWHUDQGSODFHRQWRSRIWKHJHOWKHQOD\HUZLWK DSLHFHRIGU\ILOWHUSDSHU *HQWO\EORWWKHJHOE\UROOLQJRYHUWKHGU\ILOWHUSDSHUZLWKWKHUXEEHUUROOHUWRUHPRYH H[FHVVZDWHU7KHJHOLVQRZUHDG\WREHSODFHGRQWKHFRROLQJSODWH 'RQRWOHWWKHJHOGHK\GUDWHSULRUWRSODFLQJLWRQWKHFRROLQJSODWHLQVWHS 5XQWKHJHO &RQQHFWWKHIODWEHGHOHFWURSKRUHVLVXQLWWRDUHFLUFXODWLQJFRROLQJZDWHUEDWK$OORZ WRFRROWR°&IRUWRKUWRHQVXUHHYHQFRROLQJ,IWKHJHOKDVEHHQUHK\GUDWHGLQ WKHSUHVHQFHRIXUHDGRQRWFRROEHORZ°&VRWKDWXUHDGRHVQRWSUHFLSLWDWH 3LSHWWRPOSDUDIILQRLORQWRWKHVXUIDFHRIWKHFRROLQJSODWH 3RVLWLRQWKHJHORQWKHFRROLQJSODWHEHLQJFDUHIXOQRWWRWUDSDLUEXEEOHVEHWZHHQ WKHJHODQGWKHSODWH2ULHQWWKHJHOVRWKDWWKHSRODULW\RIWKHJHOPDWFKHVWKHSRODULW\ RIWKHFRROLQJSODWH 6RDNWZRHOHFWURGHVWULSVZLWK∼POZDWHUWKHQEORWWRUHPRYHH[FHVVZDWHU /D\DEORWWHGHOHFWURGHVWULSDORQJHDFKORQJHGJHRIWKHJHO&XWRIIWKHHQGVRIWKH HOHFWURGHVWULSVRWKDWLWGRHVQRWH[WHQGEH\RQGWKHHGJHRIWKHJHO /RDGSURWHLQVDPSOHVWREHDQDO\]HGRQWRWKHJHO8VHDQDSSOLFDWRUVWULSIRUVDPSOH YROXPHVEHWZHHQDQGµOPDNHVXUHFRQWDFWEHWZHHQWKHVWULSDQGWKHJHOLV XQLIRUP8VHVDPSOHDSSOLFDWLRQSLHFHVIRUVDPSOHYROXPHV>µO5HPRYHWKH DSSOLFDWLRQ SLHFHV KDOIZD\ WKURXJK IRFXVLQJ )RU VDPSOH YROXPHV RI WR µO VDPSOHV PD\ EH VSRWWHG GLUHFWO\ RQ WKH JHO ZLWKRXW XVLQJ DSSOLFDWRU VWULSV 6HH PDQXIDFWXUHU©VLQVWUXFWLRQVIRUIXUWKHUGHWDLOV $Q LPSRUWDQW H[SHULPHQWDO FRQVLGHUDWLRQ LV WKH SRVLWLRQ LQ WKH S+ JUDGLHQW ZKHUH WKH VDPSOHLVDSSOLHG7KHDFLGLFHQGRIWKHJHOFDQXVXDOO\EHXVHGIRUVDPSOHDSSOLFDWLRQ KRZHYHUWKHRSWLPDOORDGLQJSRVLWLRQPD\QHHGWREHGHWHUPLQHGHPSLULFDOO\IRUGLIIHUHQW W\SHVRIVDPSOHV$WKLJKSURWHLQFRQFHQWUDWLRQVDQGRUDWQRQRSWLPDOS+VVDPSOHVPD\ SUHFLSLWDWHLQWKHJHODWWKHORDGLQJSRVLWLRQ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 6DPSOHVVKRXOGFRQWDLQ<P0VDOWRUEXIIHUFRPSRQHQWVJUHDWHUFRQFHQWUDWLRQVZLOO FDXVHORFDORYHUKHDWLQJRIWKHJHO,ISRVVLEOHVDOWIUHHVDPSOHVVKRXOGEHVROXELOL]HGRU GLDO\]HGLQWKHUHK\GUDWLRQEXIIHU $OLJQWKHHOHFWURGHVZLWKWKHHOHFWURGHVWULSVSXWWKHVDIHW\OLGLQSODFHDQGFRQQHFW WKHDSSDUDWXVWRWKHSRZHUVXSSO\&RQGXFWHOHFWURSKRUHVLVDW9 %URDGUDQJH,3*JHOVVXFKDV,PPRELOLQH'U\3ODWHS+VKRXOGEHUXQDW∼9 IRUWRKU1DUURZHUUDQJHJHOVDUHDOVRUXQDW9EXWPD\UHTXLUHDIRFXVLQJWLPH RIWRKU $IWHUUHPRYLQJJHOVIURPWKHHOHFWURSKRUHVLVDSSDUDWXVGHWHFWSURWHLQVXVLQJDQ\ FRQYHQWLRQDOVWDLQLQJWHFKQLTXHVXFKDV&RRPDVVLHEOXHRUVLOYHUVWDLQLQJ 3UHVHUYHWKHJHOVE\VHDOLQJLQDSODVWLFEDJRUE\GU\LQJIRUDSHUPDQHQWUHFRUG $OWHUQDWLYHO\HOHFWURWUDQVIHUWKHSURWHLQVRQWKHJHOWRDPHPEUDQH 7RGU\DJHOSUHVRDNLWILUVWLQDSUHVHUYDWLRQVROXWLRQ)RUVLOYHUVWDLQHGJHOVXVHDVROXWLRQ RIWRZYJO\FHUROYYHWKDQROIRU&RRPDVVLHEOXH¤VWDLQHGJHOVXVHD VROXWLRQRIWRZYJO\FHUROYYHWKDQROZYDFHWLFDFLG$IWHUVRDNLQJ WKH JHO SODFH LW RQ D JODVV SODWH JHO VLGH XS FRYHU ZLWK D FHOORSKDQH VKHHW VRDNHG LQ SUHVHUYDWLRQVROXWLRQDQGDOORZWRGU\DWURRPWHPSHUDWXUH )RUHOHFWURWUDQVIHU81,7XVHILOPUHPRYHUWRUHPRYHWKHSODVWLFVXSSRUWILOPIURPWKH JHO(OHFWURWUDQVIHURISURWHLQVWRDSRO\YLQ\OLGHQHGLIOXRULGH39')PHPEUDQHXVLQJD 0XOWLSKRU ,, 1RYD%ORW WUDQVIHU NLW $PHUVKDP 3KDUPDFLD %LRWHFK LV UHFRPPHQGHG 7UDQVIHUULQJ,3*JHOVUHTXLUHVVSHFLDOSURFHGXUHVVHHWKHWUDQVIHUNLWPDQXDOIRULQVWUXF WLRQV 6833257 35272&2/ &$67,1*$1,002%,/,1(*(/ $QDOWHUQDWLYHWRSUHFDVW,3*JHOVLVWKHXVHRI$PHUVKDP3KDUPDFLD%LRWHFK,PPRELOLQHV WRFDVWLPPRELOL]HGS+JUDGLHQWJHOVZLWKFXVWRPL]HGS+JUDGLHQWVDQGUDQJHVLQFOXGLQJ YHU\QDUURZS+UDQJHVWRLPSURYHVHSDUDWLRQRISURWHLQVZLWKVPDOOFKDUJHGLIIHUHQFHV 7KLVSURWRFROGHVFULEHVWKHJHQHUDOSURFHGXUHRIFDVWLQJFXVWRPPDGH,PPRELOLQHJHOV 7KH5HVZHOOLQJ&DVVHWWHXVHGLQ%DVLF3URWRFROIRUUHK\GUDWLQJJHOVLVHPSOR\HGIRU FDVWLQJWKHJHOVZKLFKDUHSRO\DFU\ODPLGHJHOVSRXUHGZLWKDJUDGLHQWRI,PPRELOLQHV IROORZLQJLQVWUXFWLRQVSURYLGHGE\$PHUVKDP3KDUPDFLD%LRWHFKDSSOLFDWLRQQRWH $GGLWLRQDO0DWHULDOVDOVRVHH6XSSRUW3URWRFRO *HO%RQG3$*ILOP$PHUVKDP3KDUPDFLD%LRWHFK ,PPRELOLQHVROXWLRQV$PHUVKDP3KDUPDFLD%LRWHFK YYJO\FHURO *UDGLHQWPDNHU 2UELWDOVKDNHU $GGLWLRQDOPDWHULDOVDQGHTXLSPHQWIRUUHK\GUDWLQJLPPRELOL]HGS+JUDGLHQWJHOV VHH%DVLF3URWRFRO &DVWWKHJHO &RDWWKHSODWHZLWKWKH8IUDPHZLWK5HSHO6LODQHWRSUHYHQWWKHJHOIURPVWLFNLQJWR WKHJODVVSODWH 3ODFHDJODVVSODWHRQDFOHDQIODWVXUIDFHDQGZHWZLWKVHYHUDOGURSVRIZDWHU&RYHU ZLWKDVKHHWRI*HO%RQG3$*ILOPK\GURSKLOLFVLGHXS8VHWKHUROOHUWRUHPRYHDQ\ DLUEXEEOHVWUDSSHGEHWZHHQWKHILOPDQGWKHJODVVSODWH 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 3ODFHWKHSODWHZLWKWKH8IUDPHRQWRSRIWKH*HO%RQG3$*ILOP&ODPSWKHSODWHV WRJHWKHURQWKUHHVLGHV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 0L[ WKH ,PPRELOLQH VROXWLRQV IROORZLQJ WKH LQVWUXFWLRQV SURYLGHG E\ $PHUVKDP 3KDUPDFLD%LRWHFKDSSOLFDWLRQQRWHWRSUHSDUHWKHGHVLUHGS+UDQJH&DVWWKHS+ JUDGLHQWJHOXVLQJDJUDGLHQWPDNHU 2QFHWKHFDWDO\VWVKDYHEHHQDGGHGWRWKHJHOVROXWLRQLWLVLPSRUWDQWWRZRUNTXLFNO\WR HQVXUHWKDWWKHJUDGLHQWLVSRXUHGEHIRUHSRO\PHUL]DWLRQRFFXUV6HH81,7IRULQVWUXF WLRQVIRUXVLQJJUDGLHQWPDNHUV 'RQRWGLVWXUEWKHJHOGXULQJWKHILUVWPLQWRDOORZWKHJUDGLHQWWRVWDELOL]H$OORZ WKHJHOWRSRO\PHUL]HKULQD°&RYHQ 'U\DQGVWRUHWKHJHO $OORZWKHJHOWRFRROWRURRPWHPSHUDWXUHWKHQGLVDVVHPEOHWKHFDVVHWWH&XWRIID VPDOOFRUQHUWRODEHOWKHDQRGHHQGRIWKHJHO :DVKWKHJHOWRKUZLWKWRPOZDWHU8VHDQRUELWDOVKDNHUDQGFKDQJH WKHZDWHUWZRRUWKUHHWLPHV $WWKLVVWDJHWKHJHOPD\EHXVHGLPPHGLDWHO\LIQRDGGLWLYHVDUHQHHGHGRUGULHGDV GHVFULEHGLQVWHSVWR :DVKWKHJHOPLQWRKUZLWKWRPORIYYJO\FHURO 3ODFHWKHJHORQDJODVVSODWHJHOVLGHXSLQDGXVWIUHHHQYLURQPHQWDQGDOORZWR GU\DWURRPWHPSHUDWXUHRYHUQLJKW 6WRUHWKHGULHGJHOLQDVHDOHGSODVWLFEDJDW−°&IRUXSWRPRQWKV 7KHJHOVPD\EHUHK\GUDWHGZKHQQHHGHGVHH6XSSRUW3URWRFRO 35(3$5,1*7,668(&8/785(&(//(;75$&76 )25,62(/(&75,&)2&86,1* 6833257 35272&2/ 3UHSDUDWLRQ RI VDPSOHV FRQWDLQLQJ UHODWLYHO\ SXUH SURWHLQV IRU LVRHOHFWULF IRFXVLQJ LV JHQHUDOO\VWUDLJKWIRUZDUGVHH%DVLF3URWRFROVWHS,QFRQWUDVWFRPSOH[VDPSOHV VXFKDVZKROHFHOOH[WUDFWVWLVVXHH[WUDFWVRUVXEFHOOXODUIUDFWLRQVDUHPRUHGLIILFXOWWR SUHSDUHIRUVXFFHVVIXOLVRHOHFWULFIRFXVLQJ6ROXELOLW\OLPLWDWLRQVERWKSULRUWRLVRHOHFWUR IRFXVLQJDQGGXULQJIRFXVLQJUHVWULFWDQDO\VLVRIWKHVHFRPSOH[VDPSOHVWRSURWRFROVWKDW LQFOXGHQRQLRQLFGHWHUJHQWVDQGXUHDVHH%DVLF3URWRFRO,QDGGLWLRQWKHSUHVHQFHRI '1$ DQG 51$ LQ FUXGH FHOO H[WUDFWV IXUWKHU FRPSOLFDWHV LVRHOHFWULF IRFXVLQJ 7KH SURWRFROSUHVHQWHGEHORZLVVXLWDEOHIRUSUHSDULQJVDPSOHVIURPFHOOFXOWXUHVDQGLVEDVHG RQTXDQWLWLHVFRPSDWLEOHZLWKVLOYHUVWDLQLQJRU&RRPDVVLHEOXHVWDLQLQJ,IVPDOOHUFHOO QXPEHUV DQG KLJKVHQVLWLYLW\ GHWHFWLRQ PHWKRGV VXFK DV DXWRUDGLRJUDSK\ DUH XVHG YROXPHVDQGTXDQWLWLHVVKRXOGEHDGMXVWHGDVQHHGHG ,QWKLVSURWRFROWKHFHOOVDUHKDUYHVWHGDQGZDVKHGLQSKRVSKDWHEXIIHUHGVDOLQH3%6 ZLWKSURWHRO\VLVLQKLELWRUVWKHQO\VHGLQ7ULV6'6EXIIHUXVLQJVRQLFDWLRQDIWHUZKLFK WKHWRWDOSURWHLQFRQFHQWUDWLRQLVGHWHUPLQHGLQWKHO\VDWH7KHO\VDWHLVIXUWKHUWUHDWHG ZLWKDPL[WXUHRI'1DVHDQG51DVHDQGDGGLWLRQDO6'6DQGUHGXFLQJDJHQWDUHDGGHG $WWKLVVWDJHWKHVDPSOHVFDQEHVWRUHGDW−°&IRUDQH[WHQGHGWLPHRUDIWHUDGGLWLRQ RIXUHDDQGO\VLVEXIIHUPD\EHORDGHGGLUHFWO\RQWRSUHIRFXVHG,()JHOV)LOWUDWLRQRI WKHILQDOVDPSOHSULRUWRORDGLQJRQWRWKH,()JHOLVHVVHQWLDOIRUTXDOLW\RILVRHOHFWULF IRFXVLQJ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 0DWHULDOV &HOOFXOWXUHIODVNVFRQWDLQLQJFHOOVRILQWHUHVW 3%6ZLWKSURWHRO\VLVLQKLELWRUV3%6,EXIIHUVHHUHFLSH 'U\LFHHWKDQRORSWLRQDOIRUIUHH]LQJVDPSOHV 7ULV6'6EXIIHUVHHUHFLSH %&$SURWHLQDVVD\NLW3LHUFH '1DVHDQG51DVHVROXWLRQVHHUHFLSH ZY6'6$33(1',;( 0HUFDSWRHWKDQRO 8UHDXOWUDSXUH /\VLVEXIIHUVHHUHFLSH POFHQWULIXJHWXEH &HQWULIXJHZLWKURWRUHJ%HFNPDQ-6°& WRPOFU\RYLDOV 0LFURFHQWULIXJH°& 6RQLFDWRUZLWKPLFURWLS µPPLFURFHQWULIXJHILOWHUXQLWVHJ0LOOLSRUH8OWUDIUHH0&ILOWHUXQLWV +DUYHVWDQGZDVKWKHFHOOV 3ODFHFHOOFXOWXUHIODVNVFRQWDLQLQJFHOOVRILQWHUHVWRQLFH 5DSLGO\ZDVKFHOOVWKUHHWLPHVZLWKWRPO3%6,EXIIHU.HHSWKHIODVNVRQLFH 7KHUHTXLUHGYROXPHRI3%6,EXIIHUGHSHQGVRQWKHIODVNVL]H)RUH[DPSOHXVHPOIRUD FPWLVVXHFXOWXUHIODVNDQGPOIRUDFPWLVVXHFXOWXUHIODVN $GGWRPO3%6,EXIIHUWRWKHIODVNVFUDSHWKHFHOOVXVLQJDFHOOVFUDSHUDQG WUDQVIHUWKHVXVSHQVLRQWRDPOFHQWULIXJHWXEH5HSHDWWKLVVWHSZLWKDQRWKHUWR POEXIIHUWRHQVXUHFRPSOHWHWUDQVIHURIWKHFHOOV &HOOVJURZQLQVXVSHQVLRQDUHZDVKHGLQDQDQDORJRXVPDQQHUXVLQJUHSHWLWLYHFHQWULIX JDWLRQ &ROOHFWWKHFHOOVE\FHQWULIXJLQJPLQDW×JUSPLQ%HFNPDQ-6 URWRU°& 'LVFDUGWKHVXSHUQDWDQWDQGUHVXVSHQGWKHFHOOVLQDVPDOOYROXPHRI3%6,EXIIHU 7UDQVIHUWKHFHOOVXVSHQVLRQWRDODEHOHGFU\RYLDO 7KHZHLJKWRIWKHHPSW\FU\RYLDOFDQEHGHWHUPLQHGSULRUWRXVHLIWKHZHWZHLJKWRIWKH FHOOSHOOHWLVGHVLUHGDVDUHIHUHQFHYDOXHUDWKHUWKDQFHOOQXPEHUUDGLRDFWLYLW\RUDQRWKHU FULWHULRQ 0LFURFHQWULIXJHWKHFHOOVPLQDWPD[LPXPVSHHG°& 5HPRYHDQGGLVFDUGWKHVXSHUQDWDQWXVLQJDSLSHWWRURU3DVWHXUSLSHW:HLJKWKHYLDO FRQWDLQLQJWKHFHOOSHOOHW5HFRUGWKHZHWZHLJKWRIWKHFHOOSHOOHWLQPJ )UHH]HWKHFHOOSHOOHWLQDGU\LFHHWKDQROPL[WXUHRSWLRQDO )UR]HQFHOOVFDQEHVWRUHGDW−°&IRUDWOHDVWVHYHUDOPRQWKV 3UHSDUHWKHFHOOSHOOHWVIRULVRHOHFWULFIRFXVLQJ 5HWULHYHFHOOSHOOHWVIURP−°&VWRUDJHLIVDPSOHVZHUHIUR]HQ $GGµO7ULV6'6EXIIHUSHUWRPJFHOOSHOOHWZHWZHLJKW.HHSWKHFHOOV RQLFHDWDOOWLPHV 7KHWRWDODPRXQWRISURWHLQLQWKHSHOOHWLVURXJKO\RIWKHZHWSHOOHWZHLJKW 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6RQLFDWHWKHVDPSOHWKUHHWLPHVIRUVHFXVLQJDVRQLFDWRUZLWKDPLFURWLSDWPHGLXP SRZHU.HHSWKHVDPSOHVRQLFHGXULQJVRQLFDWLRQ 8VHSXOVHVRQLFDWLRQRUZDLWDWOHDVWPLQEHWZHHQVRQLFDWLRQV0LQLPL]LQJKHDWJHQHUD WLRQLVHVVHQWLDOEHFDXVHVXEVWDQWLDOSURWHRO\VLVFDQRFFXULIWKHVDPSOHZDUPVDSSUHFLDEO\ ,IDGGLWLRQDOVRQLFDWLRQLVQHFHVVDU\LHLIWKHVDPSOHLVQRWKRPRJHQHRXVOHWWKHVDPSOH FRROGRZQRQLFHEHIRUHWKHQH[WVHULHVRIVRQLFDWLRQV 5XQD%&$SURWHLQDVVD\WRGHWHUPLQHWKHSURWHLQFRQFHQWUDWLRQLIVDPSOHZLOOEH ORDGHGRQWKDWEDVLV)RUPD[LPXPDFFXUDF\XVHWKHVDPHDPRXQWRI7ULV6'6EXIIHU LQVWDQGDUGVDVLQH[SHULPHQWDOVDPSOHV 3UHSDUHODEHOHGFU\RYLDOVWRVWRUHDOLTXRWVRIWKHVDPSOHLIGHVLUHG3UHFRROYLDOVRQ LFHSULRUWRPDNLQJDOLTXRWV 7KHDPRXQWRISURWHLQSHUDOLTXRWGHSHQGVRQWKHDQWLFLSDWHGIXWXUHXVHVRIWKHVDPSOHDV UHSHDWHGIUHH]LQJDQGWKDZLQJVKRXOGEHDYRLGHG$ERXWµJJHOZKROHFHOOH[WUDFWLV DPD[LPXPORDGIRUSUHSDUDWLYHSXUSRVHVXVLQJPPJHOVLHLVRODWLRQRISURWHLQVIRU VHTXHQFLQJRURWKHUVWUXFWXUDOZRUN$SSUR[LPDWHO\µJJHOLVDQDSSURSULDWHORDGIRU VLOYHUVWDLQLQJ7KHILQDOSURWHLQFRQFHQWUDWLRQDIWHUFRPSOHWLRQRIWKHSURWRFROVWHSV WRZLOOHTXDOWKHFRQFHQWUDWLRQIRXQGE\SURWHLQDVVD\GLYLGHGE\RZLQJWRWKH DGGLWLRQRIUHDJHQWVDIWHUWKHSURWHLQDVVD\VWHS $GGµO'1DVHDQG51DVHVROXWLRQSHUµO7ULV6'6EXIIHUXVHGIRUVRQLFDWLRQ VWHS,QFXEDWHPLQRQLFH $GGµORI6'6VROXWLRQDQGµORIPHUFDSWRHWKDQROSHUµO7ULV6'6 EXIIHUXVHGLQVWHS,QFXEDWHPLQDW°& 4XLFNO\GLYLGHVDPSOHVLQWRSUHYLRXVO\SUHSDUHGFU\RYLDOVDQGLPPHGLDWHO\IUHH]H DOLTXRWVXVLQJDGU\LFHHWKDQROEDWK6WRUHDW−°&6DPSOHVVWRUHGDW−°&DUH VWDEOH≥\HDU :RUNTXLFNO\WRPLQLPL]HSRWHQWLDOSURWHRO\VLV 7KLVVWHSPD\EHRPLWWHGLIWKHVDPSOHVDUHWREHORDGHGRQ,()JHOVLPPHGLDWHO\*HQHUDOO\ WKHWRWDODPRXQWRIVDPSOHJUHDWO\H[FHHGVWKHDPRXQWUHTXLUHGIRUDQ,()JHODQGIUHH]LQJ DOLTXRWVLVEHQHILFLDO7RDYRLGSRWHQWLDOUHSURGXFLELOLW\SUREOHPVDOOVDPSOHVVKRXOGEH SURFHVVHGLGHQWLFDOO\ 3UHSDUHWKHVDPSOHVIRULVRHOHFWULFIRFXVLQJ ,IFHOOH[WUDFWVZHUHIUR]HQWKDZVDPSOHVDQGLPPHGLDWHO\DGGGU\XUHDWR0ILQDO FRQFHQWUDWLRQ 7KHDPRXQWRIXUHDLQPJHTXDOVWLPHVWKHVDPSOHYROXPHLQµO)RUH[DPSOHXVH PJXUHDSHUµOVDPSOH7KHILQDOYROXPHRIWKHVDPSOHZLWKXUHDDGGHGHTXDOV WLPHVWKHLQLWLDOYROXPHµOLQWKHVDPHH[DPSOH $GGDQHTXDOYROXPHRIO\VLVEXIIHUµOLQWKHDERYHH[DPSOHDQGZDUPEULHIO\ LIQHFHVVDU\WRGLVVROYHXUHD )LOWHU VDPSOHV XVLQJ D µP PLFURFHQWULIXJH ILOWHU XQLWE\PLFURFHQWULIXJLQJDW PD[LPXPVSHHGURRPWHPSHUDWXUHXQWLOWKHHQWLUHVDPSOHKDVSDVVHGWKURXJKWKH ILOWHU/RDGWKHGHVLUHGYROXPHRQWRWKH,()JHO ,IDµJWRWDOSURWHLQORDGSHUPPJHOLVGHVLUHGDSUDFWLFDOPD[LPXPORDGIRUPRVW ZKROHFHOOH[WUDFWVWKHSURWHLQFRQFHQWUDWLRQGHWHUPLQHGGXULQJWKHSURWHLQDVVD\KDVWR EH≥µJµO,IWKHVDPSOHLVOHVVFRQFHQWUDWHGWKHVDPSOHYROXPHUHTXLUHGZLOOEHWRRODUJH IRUDPP,()JHO$OWHUQDWLYHO\VDPSOHORDGVFDQEHEDVHGRQFHOOQXPEHUVUDGLRDFWLYLW\ RUDQ\RWKHUDSSURSULDWHUHIHUHQFHVHH%DVLF3URWRFROVWHS (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 6833257 35272&2/ 35(3$5,1*3527(,16,17,668(6$03/(6 7LVVXH VDPSOHV DUH XVXDOO\ VROXELOL]HG LQ O\VLV EXIIHU XVLQJ KRPRJHQL]DWLRQ $IWHU FHQWULIXJDWLRQWKHSURWHLQVDPSOHFDQEHORDGHGRQWRWKHILUVWGLPHQVLRQJHO,QJHQHUDO PXFKKLJKHUVDPSOHWRVDPSOHYDULDELOLW\LVH[SHFWHGZKHQWLVVXHVDPSOHVDUHDQDO\]HG 0DWHULDOV 7LVVXHVDPSOHV /\VLVEXIIHUVHHUHFLSH 'RXQFHKRPRJHQL]HURUHTXLYDOHQW 8OWUDFHQWULIXJHDQGURWRUHJ%HFNPDQ7L°& 3ODFHWLVVXHVDPSOHLQD'RXQFHKRPRJHQL]HUDGG∼POO\VLVEXIIHUSHUPJ WLVVXHDQGKRPRJHQL]HWKHVDPSOHRQLFHHJWRVWURNHV /HWWKHPL[WXUHVWDQGDIHZPLQXWHVWKHQWUDQVIHUWRDQDSSURSULDWHO\VL]HGXOWUDFHQ WULIXJHWXEHGHSHQGLQJRQWRWDOVDPSOHYROXPH &HQWULIXJHKUDW×JHJUSPLQD%HFNPDQ7LURWRUIRU ×JRUKUDW×J°& 'LYLGH WKH VXSHUQDWDQW LQWR DOLTXRWV DQG IUHH]H DW −°& RU LPPHGLDWHO\ ORDG DQ DSSURSULDWHYROXPHRQWRWKH,()JHO %$6,& 35272&2/ 6(&21'',0(16,21(/(&7523+25(6,62),()78%(*(/6 6HFRQGGLPHQVLRQ JHOV DUH LGHQWLFDO WR WKRVH GHVFULEHG LQ 81,7 H[FHSW IRU VDPSOH ORDGLQJZKLFKUHTXLUHVDEURDGIODWZHOO$EURDGZHOOFDQEHFDVWXVLQJDQDSSURSULDWH WZRGLPHQVLRQDOFRPELIWKHVHFRQGGLPHQVLRQJHOWKLFNQHVVLVVOLJKWO\ODUJHUWKDQWKDW RIWKHILUVWGLPHQVLRQJHO$OWHUQDWLYHO\ZKHQWKHVHFRQGGLPHQVLRQJHOLVEHLQJFDVW ZDWHUFDQEHOD\HUHGRYHUWKHHQWLUHVXUIDFHRIWKHJHOWRSURGXFHDIODWVXUIDFHWKDWZLOO DFFRPPRGDWHWKHILUVWGLPHQVLRQJHO 1DUURZDQDO\WLFDOLVRHOHFWULFIRFXVLQJJHOV≤PPWKDWILWEHWZHHQWKHJODVVSODWHVRI WKHVHFRQGGLPHQVLRQJHOGRQRWJHQHUDOO\UHTXLUHDVWDFNLQJJHODOWKRXJKDVWDFNLQJJHOPD\ LPSURYHUHVROXWLRQXQGHUVRPHFLUFXPVWDQFHV6WDFNLQJJHOVDUHHVVHQWLDOZKHQILUVWGLPHQ VLRQJHOV!PPDUHORDGHGRQUHGXFHGWKLFNQHVVVHFRQGGLPHQVLRQJHOVIRUH[DPSOH ZKHQPPILUVWGLPHQVLRQJHOVDUHORDGHGRQPPVHFRQGGLPHQVLRQJHOV7RHQVXUHWKH EHVWUHSURGXFLELOLW\FDVWLQJPXOWLSOHVHFRQGGLPHQVLRQJHOVLQDPXOWLJHOFDVWLQJVWDQGLV VWURQJO\ UHFRPPHQGHG 7KLV LV HVSHFLDOO\ LPSRUWDQW ZKHQ JUDGLHQW JHOV DUH XVHG IRUWKH VHFRQGGLPHQVLRQDQGRUFULWLFDOFRPSDULVRQVRIPXOWLSOHVDPSOHVDUHSODQQHG 7KLVSURWRFROGHVFULEHVDOOWKHVSHFLILFVWHSVUHTXLUHGIRUVXFFHVVIXOO\FDVWLQJDQGUXQQLQJ WKHVHFRQGGLPHQVLRQJHO7KHXVHRIEHYHOHGSODWHVDQGDQDJDURVHRYHUOD\LVHVSHFLDOO\ LPSRUWDQWZKHQPP,()JHOVDUHORDGHGRQWRPPVHFRQGGLPHQVLRQJHOV 0DWHULDOV ZYDJDURVHVHHUHFLSH (TXLOLEUDWLRQEXIIHUVHHUHFLSH ,VRHOHFWULFIRFXVLQJJHOVFRQWDLQLQJSURWHLQVDPSOHVWREHDQDO\]HGVHH%DVLF 3URWRFRO 3LHFHRIDJDURVHFRQWDLQLQJPROHFXODUZHLJKWVWDQGDUGVVHH6XSSRUW3URWRFRO 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV %HYHOHGJODVVSODWHV %RLOLQJZDWHUEDWK 0HWDORUSODVWLFVFRRS $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUOLQHDUDQGJUDGLHQW/DHPPOLJHOV81,7 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ A B agarose overlay IEF gel water overlay electrophoresis central cooling core stacking gel, unpolymerized polymerized stacking gel outer plate inner plate outer plate inner plate )LJXUH &DVWLQJ WKH VHFRQGGLPHQVLRQ JHO DQG ORDGLQJ WKH ,() JHO $7KHVWDFNLQJJHO VROXWLRQVKRXOGUHDFKWRWKHXSSHUHGJHRIWKHEHYHOHGSODWHDQGWKHQWKHJHOVROXWLRQKDVWREH RYHUODLGZLWKDPLQLPXPYROXPHRIZDWHU7KHZDWHUZLOOVWD\RQWKHVXUIDFHEHFDXVHRIVXUIDFH WHQVLRQ%$IWHUSRO\PHUL]DWLRQWKHJHOLVPRXQWHGRQWKHFHQWUDOFRROLQJFRUHRIWKHHOHFWURSKR UHVLVXQLWDQGWKHHTXLOLEUDWHG,()JHOLVSODFHGRQWRSRIWKHSRO\PHUL]HGVWDFNLQJJHO([FHVV EXIIHULVUHPRYHGDQGWKH,()JHOLVRYHUODLGZLWKKRWDJDURVHHTXLOLEUDWLRQEXIIHUPL[WXUH$IWHUWKH DJDURVHVROLGLILHVWKHXSSHUHOHFWURSKRUHVLVFKDPEHULVILOOHGZLWKEXIIHU &DVWWKHVHFRQGGLPHQVLRQJHOV $VVHPEOHWKHJODVVSODWHVDQGZLFKRIDQHOHFWURSKRUHVLVDSSDUDWXVXVLQJDEHYHOHG SODWHIRUWKHVKRUWHUVLGHRIWKHJHOVDQGZLFK $ EHYHOHG SODWH SURYLGHV PRUH VSDFH IRU D WKLFNHU ,() JHO DQG ZLOO DFFRPPRGDWH D ILUVWGLPHQVLRQJHOWKDWLVDWOHDVWWRPPODUJHUWKDQWKHWKLFNQHVVRIWKHVHFRQGGLPHQ VLRQJHO ,IWKHWKLFNQHVVRIWKHILUVWGLPHQVLRQJHOH[FHHGVWKDWRIWKHVHFRQGGLPHQVLRQJHO SRXUDVHSDUDWLQJJHORIWKHGHVLUHGDFU\ODPLGHFRQFHQWUDWLRQDQGLPPHGLDWHO\RYHUOD\ ZLWK ZDWHU WR SURGXFH D VPRRWK VXUIDFH 7KH VHSDUDWLQJ JHO KHLJKW VKRXOG EH D PLQLPXPRIFPEHORZWKHWRSRIWKHEHYHOHGSODWHWRDFFRPPRGDWHWKHVWDFNLQJJHO $IWHUWKHVHSDUDWLQJJHOKDVSRO\PHUL]HGDVKDUSLQWHUIDFHEHWZHHQWKHSRO\PHUL]HG JHODQGWKHZDWHURYHUOD\ZLOOUHDSSHDUUHPRYHWKHRYHUOD\ULQVHWKHJHOVXUIDFH ZLWKZDWHUDQGSRXUWKHVWDFNLQJJHO7KHVWDFNLQJJHOVROXWLRQVKRXOGUHDFKWRWKH WRS RI WKH EHYHO ,PPHGLDWHO\ RYHUOD\ WKH VWDFNLQJ JHO VROXWLRQ ZLWK D PLQLPXP DPRXQWRIZDWHUZKLFKZLOODGKHUHRZLQJWRWKHVXUIDFHWHQVLRQVHH)LJ$ $ZDWHURYHUOD\RIWKHVWDFNLQJJHOSURYLGHVDVPRRWKVXUIDFHDQGEHWWHUFRQWDFWEHWZHHQ WKH,()JHODQGVHFRQGGLPHQVLRQJHO$VPDOOYROXPHRIZDWHUKDVWREHXVHGWRDYRLG ORZHULQJWKHXSSHUHGJHRIWKHVWDFNLQJJHOEHORZWKHHGJHRIWKHEHYHOHGSODWH7KHVWDFNLQJ JHOKHLJKWPXVWEHEHWZHHQDQGFP7KHVROXWLRQLVILOOHGWRWKHWRSRIWKHEHYHOVR WKDWDIWHUWKHVOLJKWVKULQNDJHWKDWRFFXUVGXULQJSRO\PHUL]DWLRQWKHWRSRIWKHSRO\PHUL]HG JHOZLOOEHQHDUWKHERWWRPRIWKHEHYHOVHH)LJ% /RDGWKHLVRHOHFWULFIRFXVLQJJHOVRQWRWKHVHFRQGGLPHQVLRQJHOV $VVHPEOHVHFRQGGLPHQVLRQJHOVLQDQHOHFWURSKRUHVLVFKDPEHU'RQRWSRXUHOHF WURSKRUHVLVEXIIHULQWRWKHXSSHUFKDPEHU 0HOWZYDJDURVHLQDERLOLQJZDWHUEDWKDQGDGGDQHTXDOYROXPHRIHTXLOLEUD WLRQEXIIHUIRUXVHLQVWHS.HHSDJDURVHHTXLOLEUDWLRQEXIIHULQWKHERLOLQJZDWHU EDWKXQWLOVWHSLVFRPSOHWHG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 5HWULHYHLVRHOHFWULFIRFXVLQJJHOVFRQWDLQLQJSURWHLQVDPSOHVWREHDQDO\]HGIURP VWRUDJH,QFXEDWHFU\RWXEHVFRQWDLQLQJIUR]HQ,()JHOVLQD°&ZDWHUEDWKIRU PLQIRUDPPWXEHJHO$WRPLQLQFXEDWLRQLVVXIILFLHQWIRUPPRUWKLQQHU ,()JHOV'RQRWDJLWDWHGXULQJWKDZLQJDVYLJRURXVDJLWDWLRQRIDSDUWLDOO\WKDZHG JHOFDQEUHDNWKHJHO 'XULQJWKLVWKDZLQJHTXLOLEUDWLRQVWHS6'6LQWKHHTXLOLEUDWLRQVROXWLRQLQZKLFKWKHJHOV ZHUHIUR]HQGLIIXVHVLQWRWKHJHOPDWUL[DQGELQGVWRSURWHLQVLQWKH,()JHO7KHOHQJWKRI LQFXEDWLRQLQWKHHTXLOLEUDWLRQEXIIHULVFULWLFDOEHFDXVHLQVXIILFLHQWVDWXUDWLRQRISURWHLQV ZLWK 6'6 ZLOO FRQWULEXWH WR YHUWLFDO VWUHDNV RQ VWDLQLQJ 2Q WKH RWKHU KDQG H[WHQGHG LQFXEDWLRQLQHTXLOLEUDWLRQEXIIHUZLOOUHVXOWLQH[FHVVLYHORVVRISURWHLQVRZLQJWRGLIIXVLRQ RISURWHLQRXWRIWKHJHOZKLFKLVHVSHFLDOO\FULWLFDOIRUWKLQ,()JHOV)RUWKLVUHDVRQLWLV UHFRPPHQGHGWKDWDIWHUH[WUXVLRQIURPWKH,()WXEH,()JHOVEHLQLWLDOO\LQFXEDWHGIRU PLQWRDOORZDGHTXDWHGLIIXVLRQRIJO\FHUROLQWRWKHJHOWRPLQLPL]HJHOEUHDNDJHIROORZHG E\ IUHH]LQJ RQ GU\ LFH VHH %DVLF 3URWRFRO VWHS 7KLV LV GHVLUDEOH HYHQ LI WKH VHFRQGGLPHQVLRQJHOZLOOEHUXQGLUHFWO\DIWHULVRHOHFWULFIRFXVLQJDVLWLVWKHPRVWIHDVLEOH ZD\RISUHFLVHO\FRQWUROOLQJWKHHTXLOLEUDWLRQWLPHZKLOHWKHUHPDLQLQJJHOVLQWKH,()UXQ DUHH[WUXGHG 3RXUWKHJHODQGHTXLOLEUDWLRQVROXWLRQRXWRIWKHFU\RYLDORQWRDPHWDORUSODVWLF VFRRS&DUHIXOO\UHPRYHH[FHVVHTXLOLEUDWLRQEXIIHUZLWKDSLSHW 3ODFHDIHZPLOOLOLWHUVRIHOHFWURSKRUHVLVEXIIHURQWKHWRSRIWKHVHFRQGGLPHQVLRQJHO 6ORZO\VOLGHWKH,()JHORIIWKHVFRRSDQGRQWRWKHWRSRIWKHVHFRQGGLPHQVLRQJHO 5HPRYH DOO DLU EXEEOHV WUDSSHGEHWZHHQWKHJHOV5HPRYHH[FHVVHOHFWURSKRUHVLV EXIIHUIURPWKHWRSRIWKHVHFRQGGLPHQVLRQJHO 7KHEDVLFHQGRIWKHJHOPD\EHSODFHGRQHLWKHUWKHOHIWRUULJKWVLGHRIWKHVHFRQGGLPHQ VLRQJHO+RZHYHURQFHDFRQYHQWLRQLVHVWDEOLVKHGDOOJHOVVKRXOGEHRULHQWHGWKHVDPH ZD\7KHDFLGLFHQGRIWKH,()JHOFDQEHUHFRJQL]HGLQWZRZD\VWKHEURPSKHQROEOXH ZLOOXVXDOO\EH\HOORZDQGDEXOJHLQFUHDVHGJHOGLDPHWHUZLOOEHSUHVHQW 3ODFHDSLHFHRIDJDURVHFRQWDLQLQJPROHFXODUZHLJKWVWDQGDUGVVHH6XSSRUW3URWR FROEHVLGHWKHEDVLFVLGHRIWKH,()JHORSWLRQDO 1RWHWKDWZKHQPROHFXODUZHLJKWVWDQGDUGVDUHXVHGWKHLVRHOHFWULFIRFXVLQJJHOKDVWREH VKRUWHUWKDQWKHZLGWKRIWKHVHFRQGGLPHQVLRQJHO &DUHIXOO\RYHUOD\WKH,()JHODQGWKHJHOSLHFHZLWKVWDQGDUGSURWHLQVZLWKWKHKRW DJDURVHHTXLOLEUDWLRQEXIIHUPL[WXUH∼POJHOSUHSDUHGLQVWHS/HWWKHDJDURVH VROLGLI\ 7KHDJDURVHSUHYHQWVWKH,()JHOIURPVKLIWLQJSRVLWLRQDQGHQVXUHVJRRGFRQWDFWEHWZHHQ WKH,()DQGVHFRQGGLPHQVLRQJHOV &DUHIXOO\SRXUHOHFWURSKRUHVLVEXIIHULQWRWKHXSSHUUHVHUYRLUWDNLQJFDUHWRDYRLG GLVWXUELQJWKHDJDURVHFRYHUHG,()JHO &RQQHFWHOHFWURGHVDQGUXQWKHJHOV 6HH81,7IRUHOHFWURSKRUHVLVFRQGLWLRQV %$6,& 35272&2/ 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 6(&21'',0(16,21(/(&7523+25(6,62),3**(/6 ,QWKLVSURWRFROYHUWLFDOJHOHOHFWURSKRUHVLVLVXVHGDVWKHVHFRQGGLPHQVLRQIRU,3*JHOV LQDQDQDORJRXVPDQQHUWRWKHSURWRFROGHVFULEHGIRUWKHVHFRQGGLPHQVLRQRI,()WXEH JHOVVHH%DVLF3URWRFRO2QHGLIIHUHQFHLVWKHXVHRIVHFRQGGLPHQVLRQJHOVSDFHUVRU JHODSSDUDWXVWKDWZLOODFFRPPRGDWHDQFPORQJ,PPRELOLQH'U\6WULS%LR5DGRIIHUV DFRQYHUVLRQNLWWRLQFUHDVHWKHJHOZLGWKIURPFPWRFPDQG$PHUVKDP3KDUPDFLD %LRWHFKRIIHUVWKH,VR'DOWJHOV\VWHP7KHXVHRIEHYHOHGSODWHVLVQRWQHFHVVDU\DVWKH PPVWULSVDUHQDUURZHUWKDQWKHVHFRQGGLPHQVLRQJHORUPPWKLFN$QRWKHU FKDQJHLQYROYHVDWZRVWHSHTXLOLEUDWLRQRIWKHVWULSVSULRUWRHOHFWURSKRUHVLV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO 'U\6WULSHTXLOLEUDWLRQVROXWLRQVDQGVHHUHFLSHVSUHSDUHIUHVKLQVWHS ,PPRELOLQH,3*'U\6WULSZLWKIRFXVHGSURWHLQVHH%DVLF3URWRFRO 3ODWIRUPVKDNHU &DVWWKHVHFRQGGLPHQVLRQJHO $VVHPEOHWKHJODVVSODWHVDQGZLFKRIDQHOHFWURSKRUHVLVDSSDUDWXVXVLQJJHOSODWHV ZLGHHQRXJKWRDFFRPPRGDWHDQFPORQJ'U\6WULSJHO %HYHOHGSODWHVDUHQRWQHFHVVDU\,IWKHVSDFHUVDUHQRWZLGHHQRXJKWRDFFRPPRGDWHDQ FPJHOWKHHQGVRIWKHJHOVWULSPD\EHWULPPHGDZD\IURPWKH,3*JHOVRWKDWLWZLOO ILWRQWRSRIWKHVHFRQGGLPHQVLRQKRZHYHUVRPHYHU\EDVLFRUDFLGLFSURWHLQVPD\EHORVW 3RXU D VHSDUDWLQJ JHO RI WKH GHVLUHG DFU\ODPLGH FRQFHQWUDWLRQ DQG LPPHGLDWHO\ RYHUOD\ZLWKZDWHUWRSURGXFHDVPRRWKVXUIDFH 7KHVHSDUDWLQJJHOVKRXOGEHDPLQLPXPRI∼FPEHORZWKHWRSRIWKHLQQHUSODWHWR DFFRPPRGDWHDFPVWDFNLQJJHO $IWHUWKHVHSDUDWLQJJHOKDVSRO\PHUL]HGUHPRYHWKHZDWHURYHUOD\ULQVHWKHJHO VXUIDFHZLWKZDWHUWRUHPRYHDQ\XQSRO\PHUL]HGDFU\ODPLGHDQGSRXUWKHVWDFNLQJ JHOWRDKHLJKWRIFPIURPWKHWRSRIWKHSODWH2YHUOD\ZLWKZDWHUWRSURGXFHD VPRRWKVXUIDFH $ ZDWHU RYHUOD\ SURYLGHV D VPRRWK VXUIDFH IRU EHWWHU FRQWDFW EHWZHHQ WKH ,PPRELOLQH 'U\6WULSDQGWKHVHFRQGGLPHQVLRQJHO7KHVWDFNLQJJHOKHLJKWVKRXOGEH∼FP /RDGWKH,PPRELOLQH,3*'U\6WULSJHORQWRWKHVHFRQGGLPHQVLRQJHO 3UHSDUH,PPRELOLQH'U\6WULSHTXLOLEUDWLRQVROXWLRQVDQGVHHUHFLSH $VVHPEOH WKH VHFRQGGLPHQVLRQ JHOV LQ D HOHFWURSKRUHVLV FKDPEHU 'R QRW SRXU HOHFWURSKRUHVLVEXIIHULQWRWKHXSSHUFKDPEHU 0HOWZYDJDURVHLQDERLOLQJZDWHUEDWK0L[DVROXWLRQRISDUWDJDURVH WRSDUWVHTXLOLEUDWLRQVROXWLRQ .HHSDJDURVHHTXLOLEUDWLRQEXIIHUPL[WXUHLQERLOLQJZDWHUEDWKXQWLOVWHSLVFRPSOHWHG 7KHDJDURVHSUHYHQWVWKH,3*'U\6WULSIURPVKLIWLQJSRVLWLRQDQGHQVXUHVJRRGFRQWDFW EHWZHHQWKH,()DQGVHFRQGGLPHQVLRQJHOV 8VLQJIRUFHSVUHPRYHWKH,3*JHOVIURPWKHHOHFWURSKRUHVLVWUD\DIWHULVRHOHFWULF IRFXVLQJLVFRPSOHWHRUIURPWKH−°&IUHH]HUVHH%DVLF3URWRFROVWHSDQG SODFHHDFKVWULSLQDVHSDUDWHSHWULGLVKZLWKWKHVXSSRUWILOPVLGHRIWKHVWULSIDFLQJ WKHSHWULGLVKZDOO$GGPORI'U\6WULSHTXLOLEUDWLRQEXIIHU&RYHUDQGSODFHRQ DSODWIRUPVKDNHUIRUPLQ 6WULSVPD\EHUXQLQWKHVHFRQGGLPHQVLRQLPPHGLDWHO\DIWHULVRIRFXVLQJRUDIWHUVWRUDJH DW−°&,IWKHVWULSVKDYHEHHQVWRUHGDW−°&UHPRYHWKHPIURPWKHIUHH]HUWKHQSODFH LQSHWULGLVKDVVWDWHGDQGFRQWLQXHZLWKWKHHTXLOLEUDWLRQSURFHGXUH 'LVFDUGHTXLOLEUDWLRQEXIIHUDQGDGGPORIHTXLOLEUDWLRQEXIIHU&RYHUDQG SODFHRQDSODWIRUPVKDNHUIRUPLQ 'DPSHQDSLHFHRIILOWHUSDSHUDQGSODFHRQDJODVVSODWH5HPRYHWKH'U\6WULSVIURP HTXLOLEUDWLRQEXIIHU3ODFHHDFKVWULSRQLWVHGJHRQWKHILOWHUSDSHUWRUHPRYHDQ\ H[FHVVEXIIHU 6WULSVVKRXOGQRWEHOHIWLQWKLVSRVLWLRQIRU!PLQRUVSRWVKDUSQHVVPD\EHDIIHFWHG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW $GG D VPDOO DPRXQW RI 6'6 HOHFWURGH EXIIHU DORQJ WKH JODVV SODWH DERYH WKH VHFRQGGLPHQVLRQJHO3ODFHWKH'U\6WULSJHOLQWKHZHOOZLWKWKHJHOIDFLQJRXWDQG WKHEDVLFVLGHWRWKHOHIW3XVKWKH'U\6WULSGRZQVRWKDWLWLVILUPO\LQFRQWDFWZLWK WKHVWDFNLQJJHORIWKHVHFRQGGLPHQVLRQJHO5HPRYHH[FHVVUXQQLQJEXIIHU 2YHUOD\WKH,3*JHOVWULSZLWKWKHDJDURVHHTXLOLEUDWLRQEXIIHUIURPVWHSDQGDOORZ DJDURVHWRVROLGLI\ &DUHIXOO\SRXUHOHFWURSKRUHVLVEXIIHULQWRWKHXSSHUUHVHUYRLUWDNLQJFDUHWRDYRLG GLVWXUELQJWKHDJDURVHHPEHGGHG,3*'U\6WULS &RQQHFWHOHFWURGHVDQGUXQWKHJHOV 6HH81,7IRUHOHFWURSKRUHVLVFRQGLWLRQV 6833257 35272&2/ 35(3$5,1*02/(&8/$5:(,*+767$1'$5'6)25 7:2',0(16,21$/*(/6 0ROHFXODUZHLJKWPDUNHUVDUHXVXDOO\QHFHVVDU\IRUWKHLGHQWLILFDWLRQRISURWHLQVRUDV UHIHUHQFHVWRGHVFULEHH[SHULPHQWDOSURWHLQVRQWZRGLPHQVLRQDOJHOV,QPDQ\FDVHV PROHFXODUZHLJKWPDUNHUVDUHUHTXLUHGRQO\DWWKHEHJLQQLQJRIDSURMHFW2QFHWKHV\VWHP LVHVWDEOLVKHGFRPPRQSURWHLQVLQWKHVDPSOHHJDFWLQRUWXEXOLQSURYLGHVXIILFLHQW UHIHUHQFHV IRU PROHFXODU ZHLJKW LGHQWLILFDWLRQ RQ VXEVHTXHQW JHOV 7R PLQLPL]H DQ\ GLIIHUHQFHV LQ PLJUDWLRQ RI WKH PROHFXODU ZHLJKW VWDQGDUGV DQG LVRHOHFWULF IRFXVHG SURWHLQVWKHVWDQGDUGSURWHLQVVKRXOGEHORDGHGRQWKHVHFRQGGLPHQVLRQJHOLQWKHVDPH PDQQHUDVWKH,()JHO7KLVSURWRFROGHVFULEHVWKHSUHSDUDWLRQRIVWDQGDUGVLQVROLGLILHG DJDURVH7KHDJDURVHSLHFHVPD\EHVWRUHGDW−°&IRUDWOHDVWD\HDUDQGSURYLGHD FRQYHQLHQWVRXUFHRIVWDQGDUGVIRUWKHVHFRQGGLPHQVLRQJHO7KHSURFHGXUHGHVFULEHGLV UHFRPPHQGHGIRUPP,()JHOV1DUURZVWDQGDUGVLQVROLGLILHGDJDURVHPDGHLQWXEHV ≤PPLQGLDPHWHUFDQEHSUHSDUHGE\WKHVDPHPHWKRGEXWH[WUXVLRQRIWKHWKLQQHU DJDURVHJHOZLWKRXWEUHDNLQJLVPRUHGLIILFXOW7KHSURWRFROVXSSOLHVPROHFXODUZHLJKW PDUNHUVFRQWDLQLQJ∼µJRIHDFKVWDQGDUGVXLWDEOHIRU&RRPDVVLHEOXHVWDLQLQJRU µJRIHDFKVWDQGDUGIRUVLOYHUVWDLQLQJ 0DWHULDOV 0ROHFXODUZHLJKWVWDQGDUGV7DEOH ×6'6VDPSOHEXIIHU81,7 ZYDJDURVHVHHUHFLSH %RLOLQJZDWHUEDWK *ODVVWXEHVPPLQQHUGLDPHWHU 3ODVWLFRUPHWDOWUD\ 3UHSDUHPOPROHFXODUZHLJKWVWDQGDUGVLQ×6'6VDPSOHEXIIHUXVLQJµJRI HDFKVWDQGDUG 7KHVWDWHGDPRXQWLVDSSURSULDWHIRU&RRPDVVLHEOXHVWDLQLQJRIJHOV,IVLOYHUVWDLQLQJLV SODQQHGXVHµJRIHDFKVWDQGDUG 0L[WKHVWDQGDUGVZLWKPORIZYDJDURVHPHOWHGLQDERLOLQJZDWHUEDWK 3UHSDUHFOHDQJODVVWXEHVE\ZUDSSLQJRQHHQGZLWK3DUDILOP3RXUWKHKRWPL[WXUH LQWRWKHWXEHVDQGOHWWKHDJDURVHVROLGLI\ &DUHIXOO\H[WUXGHWKHDJDURVHIURPWKHWXEHV &XWDJDURVHURGVLQWRPPSLHFHVXVLQJDUD]RUEODGH 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV )UHH]HDOOSLHFHVVHSDUDWHO\RQDSODVWLFRUPHWDOWUD\XVLQJGU\LFH &ROOHFWIUR]HQSLHFHVLQDSODVWLFERWWOHDQGVWRUHDW−°&7KHVWDQGDUGVPD\EH VWRUHG≥\HDU 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ ',$*21$/*(/(/(&7523+25(6,61215('8&,1* 5('8&,1**(/6 $/7(51$7( 35272&2/ 3URWHLQ VXEXQLW FRPSRVLWLRQV DQG FURVVOLQNHG SURWHLQ FRPSOH[HV FDQ EH DQDO\]HG E\ WZRGLPHQVLRQDOJHOHOHFWURSKRUHVLVXVLQJVHSDUDWLRQXQGHUQRQUHGXFLQJFRQGLWLRQVLQ WKH ILUVW GLPHQVLRQ IROORZHG E\ UHGXFWLRQ RI GLVXOILGH ERQGV DQG VHSDUDWLRQ XQGHU UHGXFLQJFRQGLWLRQVLQWKHVHFRQGGLPHQVLRQ0RVWSURWHLQVZLOOPLJUDWHHTXDOGLVWDQFHV LQERWKGLPHQVLRQVIRUPLQJDGLDJRQDOSDWWHUQ3URWHLQVFRQWDLQLQJLQWHUFKDLQGLVXOILGH ERQGVZLOOEHGLVVRFLDWHGLQWRLQGLYLGXDOVXEXQLWVDQGFDQEHUHVROYHGLQWKHVHFRQGGL PHQVLRQJHO 7KHDSSURDFKLVVLPLODUWRWKDWGHVFULEHGIRUWZRGLPHQVLRQDOJHOHOHFWURSKRUHVLVVHH %DVLF3URWRFROH[FHSWLQWKLVSURWRFROWKHILUVWGLPHQVLRQJHOVDUHQRQUHGXFLQJLH PHUFDSWRHWKDQRORUGLWKLRWKUHLWROLVRPLWWHGIURPVDPSOHEXIIHU6'6GHQDWXULQJJHOV LQVWHDG RI LVRHOHFWULF IRFXVLQJ JHOV 8VH RI PP WXEH JHOV IRU WKH ILUVWGLPHQVLRQ VHSDUDWLRQDQGPPVODEJHOVIRUWKHVHFRQGGLPHQVLRQUXQLVUHFRPPHQGHG $GGLWLRQDO0DWHULDOVDOVRVHH%DVLF3URWRFRO 6HSDUDWLQJDQGVWDFNLQJJHOVROXWLRQVVHH7DEOH ×6'6VDPSOHEXIIHUZLWKRXWUHGXFLQJDJHQWV81,7 5HGXFLQJEXIIHUVHHUHFLSH ZYDJDURVHLQUHGXFLQJEXIIHUVHHUHFLSHRSWLRQDOIRUVHFXULQJ ILUVWGLPHQVLRQJHORQVHFRQGGLPHQVLRQJHO 7ZRGLPHQVLRQDOFRPERSWLRQDO $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUFDVWLQJWXEHJHOVVHH%DVLF3URWRFRO 6'63$*(81,7DQGSURWHLQVWDLQLQJ$33(1',; 3RXUDQGUXQWKHILUVWGLPHQVLRQJHO &OHDQDQGGU\PPJODVVJHOWXEHVIRUWKHILUVWGLPHQVLRQJHOVHH%DVLF3URWR FROVWHS 3UHSDUH D VHSDUDWLQJ JHO VROXWLRQ ZLWK WKH GHVLUHG SHUFHQWDJH DFU\ODPLGH 7DEOH RPLWWKHVWDFNLQJJHOIRUWKHILUVWGLPHQVLRQ 6WDFNLQJJHOVFDQXVXDOO\EHDYRLGHGLQWKHILUVWGLPHQVLRQE\NHHSLQJVDPSOHYROXPHV VPDOOLH≤µO /HVVWKDQµORIJHOVROXWLRQLVUHTXLUHGWRFDVWDVLQJOHPPWXEHJHOFPLQOHQJWK $GMXVWWKHDPRXQWVIURP7DEOHDFFRUGLQJO\ &DVWWKHILUVWGLPHQVLRQSRO\DFU\ODPLGHJHOVLQPPWXEHVXVLQJDV\ULQJHZLWKD ORQJQHHGOHVHH%DVLF3URWRFROVWHSD2YHUOD\ZLWKZDWHUDQGDOORZWKHJHOVWR SRO\PHUL]H 3UHSDUHVDPSOHVLQ×6'6VDPSOHEXIIHUZLWKRXWDQ\UHGXFLQJUHDJHQWVLHQR PHUFDSWRHWKDQRORU'77/RDGWKHVDPSOHVDQGHOHFWURSKRUHVHXQWLOWKHWUDFNLQJ G\HLV∼FPIURPWKHERWWRPRIWKHWXEH 5HGXFHVDPSOHDQGUXQWKHVHFRQGGLPHQVLRQJHO ([WUXGHWKHJHOIURPWKHWXEHVHH%DVLF3URWRFROVWHSVWR 3ODFHWKHH[WUXGHGJHOLQDWHVWWXEHFRQWDLQLQJPOUHGXFLQJEXIIHU(TXLOLEUDWH PLQDW°&ZLWKJHQWOHDJLWDWLRQ &DVWWKHVHFRQGGLPHQVLRQVHSDUDWLQJDQGVWDFNLQJJHOVVHH%DVLF3URWRFROVWHSV WRPDNLQJVXUHWKDWWKHWRSRIWKHVWDFNLQJJHOLVDWOHDVWPPEHORZWKHWRSRI (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW WKHVKRUWJODVVSODWH/D\HUZDWHUDFURVVWKHHQWLUHVWDFNLQJJHORUXVHDWZRGLPHQ VLRQDOFRPE 0RVWWZRGLPHQVLRQDOJHOFRPEVKDYHDVHSDUDWHVPDOOZHOOIRUDVWDQGDUGRUUHIHUHQFH VDPSOH 7KHXVHRIEHYHOHGSODWHVVHH%DVLF3URWRFROVWHSVWRLVQRWHVVHQWLDOEXWLVVWLOO SUHIHUUHGEHFDXVHLWZLOOIDFLOLWDWHORDGLQJRIWKHILUVWGLPHQVLRQJHO,QWKLVSURFHGXUHWKH ILUVWGLPHQVLRQJHOZLOOILWEHWZHHQWKHJODVVSODWHVLIPPWXEHVDUHXVHGIRUWKHILUVW GLPHQVLRQDQGPPJHOVDUHXVHGIRUWKHVHFRQGGLPHQVLRQ /RDGWKHILUVWGLPHQVLRQJHORQWRWKHVHFRQGGLPHQVLRQJHO5HPRYHDQ\DLUEXEEOHV WUDSSHGEHWZHHQWKHJHOV ,IWKHILUVWGLPHQVLRQJHOGRHVQRWUHPDLQVHFXUHO\LQSODFHLWFDQEHHPEHGGHGXVLQJ ZYDJDURVHLQUHGXFLQJEXIIHU &DUHIXOO\ SRXU HOHFWURSKRUHVLV EXIIHU LQWR WKH XSSHU HOHFWURSKRUHVLV FKDPEHU DQG HOHFWURSKRUHVHXVLQJYROWDJHVDQGWLPHVDSSURSULDWHIRUWKHJHOW\SHVHOHFWHG 3DUDPHWHUVIRUHOHFWURSKRUHVLVDUHJLYHQLQ81,7 6833257 35272&2/ 86,1*7:2',0(16,21$/3527(,1'$7$%$6(6 &RPSXWHUL]HGLPDJHDFTXLVLWLRQDQGPDQLSXODWLRQFRQVWLWXWHWKHRQO\SUDFWLFDOPHWKRG IRUV\VWHPDWLFTXDOLWDWLYHDQGTXDQWLWDWLYHHYDOXDWLRQRIFRPSOH[SURWHLQSDWWHUQVIURP GLIIHUHQWVDPSOHVWKDWDUHWREHFRPSDUHGE\KLJKUHVROXWLRQWZRGLPHQVLRQDOJHODQDO\ VLV([DPSOHVRIH[SHULPHQWDODSSOLFDWLRQVLQFOXGHFRPSDULVRQVRIWXPRUFHOOVRUWLVVXHV ZLWKDSSURSULDWHQRUPDOFRQWUROVDQGFRPSDULVRQVRIDVLQJOHFHOOOLQHXQGHUGLIIHUHQW H[SHULPHQWDOFRQGLWLRQV 7KHUH DUH FXUUHQWO\ D QXPEHU RI FRPPHUFLDOO\ DYDLODEOH LPDJH DFTXLVLWLRQFRPSXWHU V\VWHPVVSHFLILFDOO\GHVLJQHGIRUFRPSDULQJWZRGLPHQVLRQDOJHOVDQGVWRULQJDVVRFLDWHG LQIRUPDWLRQLQDGDWDEDVH7KHV\VWHPVLQFOXGHERWKKDUGZDUHDQGWKHQHFHVVDU\VRIWZDUH IRUFRPSDULQJGLIIHUHQWJHOVDQGSURGXFLQJGDWDEDVHVFRQWDLQLQJWKHWZRGLPHQVLRQDO SURWHLQSDWWHUQVZLWKRSWLRQVIRUDQQRWDWLQJVSHFLILFVSRWVDQGSURGXFLQJTXDQWLWDWLYH FRPSDULVRQVDPRQJODUJHQXPEHUVRIGLIIHUHQWVDPSOHV:LWKPRVWV\VWHPVLPDJHVFDQ EHDFTXLUHGIURPHLWKHUVWDLQHGJHOVRUDXWRUDGLRJUDSKV7KHHTXLSPHQWXVHGWRREWDLQ WZRGLPHQVLRQDOJHOLPDJHVLQFOXGHVODVHUVFDQQHUVYLGHRFDPHUDVDQGSKRVSKRLPDJHUV $IWHULPDJHDFTXLVLWLRQVRIWZDUHUXQQLQJRQDPLFURFRPSXWHURUZRUNVWDWLRQLVXVHGWR UHILQHWKHLPDJHGHWHFWVSRWVDQGPDWFKVSRWVEHWZHHQGLIIHUHQWJHOV ,WLVHVVHQWLDOWKDWYHU\KLJKTXDOLW\UHSURGXFLEOHJHOVEHXVHGIRUFRPSXWHUL]HGFRPSDUL VRQV7KHJUHDWHVWG\QDPLFUDQJHLQSURWHLQDEXQGDQFHIRUDVLQJOHWZRGLPHQVLRQDOJHO FDQEHREWDLQHGXVLQJDXWRUDGLRJUDSK\RUSKRVSKRLPDJLQJ81,7:LWKWKHVHPHWKRGV XSWRVHYHUDOWKRXVDQGVSRWVFDQEHFRPSDUHGDQGWUDFNHG$UHSUHVHQWDWLYHUHIHUHQFHJHO RUDFRPSRVLWHLPDJHFDQEHVWRUHGDQGXVHGDVDUHIHUHQFHIRUIXWXUHH[SHULPHQWV 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV ,QIRUPDWLRQUHODWHGWRHDFKVSRWRQWKHWZRGLPHQVLRQDOSDWWHUQLQFOXGLQJWKHTXDQWLW\ RISURWHLQLQWKHLQGLFDWHGVSRWRQGLIIHUHQWJHOVXVHGLQWKHFRPSDULVRQFDQEHDUFKLYHG DQGXSGDWHG2WKHUNQRZQLQIRUPDWLRQUHODWHGWRDVSHFLILFVSRWFDQDOVREHDGGHGWRWKH LQYHVWLJDWRUEXLOWGDWDEDVHLQFOXGLQJWKHS,PROHFXODUZHLJKWDPLQRDFLGFRPSRVLWLRQ VHTXHQFHDQGRULGHQWLW\RIWKHSURWHLQDQGDQ\RWKHULPSRUWDQWDWWULEXWHVFRUUHODWHGZLWK WKHLQGLFDWHGVSRW$QXPEHURIUHVHDUFKJURXSVLQFOXGLQJWKRVHRI*DUUHOVDQG&HOLV *DUUHOV*DUUHOVDQG)UDQ]D&HOLVHWDOKDYHH[WHQVLYHO\FKDUDF WHUL]HG KXQGUHGV RI VSRWV IURP VSHFLILF FHOO OLQHV DQG KDYH XVHG PXOWLSOH PHWKRGV WR FKDUDFWHUL]HSURWHLQVRILQWHUHVW7KHPRVWGHILQLWLYHPHWKRGVIRUHVWDEOLVKLQJWKHLGHQWL 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ WLHV IRU SURWHLQV RI LQWHUHVW GHWHFWHG E\ FRPSXWHUDVVLVWHG FRPSDULVRQV DUH SURWHLQ VHTXHQFH DQDO\VLV DQG PRUH UHFHQWO\ PDVV VSHFWURPHWU\ RI WU\SWLF IUDJPHQWV %RWK PHWKRGV DUH FRPSDWLEOH ZLWK WKH TXDQWLWLHV RI SURWHLQ WKDW FDQ EH UHFRYHUHG IURP WZRGLPHQVLRQDOJHOV 5($*(176$1'62/87,216 8VH0LOOL4SXULILHGZDWHURUHTXLYDOHQWLQDOOUHFLSHVDQGSURWRFROVWHSV)RUFRPPRQVWRFNVROXWLRQV VHH$33(1',;$IRUVXSSOLHUVVHH6833/,(56$33(1',; DFU\ODPLGHELVDFU\ODPLGH JDFU\ODPLGH JELVDFU\ODPLGH +2WRPO )LOWHU VROXWLRQ WKURXJK WR µP ILOWHU HJ 0LFUR )LOWUDWLRQ 6\VWHPV FHOOXORVHQLWUDWHµP6WRUHDW°&VWDEOHDWOHDVWPRQWKV &$87,21$FU\ODPLGHLVDQHXURWR[LQ:HDUJORYHVDQGDGXVWPDVNZKHQKDQGOLQJVROLG DFU\ODPLGH:HDUJORYHVZKHQZRUNLQJZLWKDFU\ODPLGHVROXWLRQ1HYHUSLSHWDFU\ODPLGH VROXWLRQVE\PRXWK $JDURVHLQUHGXFLQJEXIIHUZY 0L[JDJDURVHDQGPOUHGXFLQJEXIIHUVHHUHFLSH+HDWLQERLOLQJZDWHU EDWKXQWLOGLVVROYHG3UHSDUHLPPHGLDWHO\EHIRUHXVH $JDURVHZY 0L[JDJDURVHDQGPOZDWHU6WLURQDKRWSODWHXQWLOGLVVROYHG.HHSLQJWKH VROXWLRQQHDU°&GLYLGHE\SODFLQJPODOLTXRWVLQPOJODVVVFUHZFDSWXEHV /HWWKHDOLTXRWVVROLGLI\6WRUHDW°&VWDEOHDWOHDVWPRQWKV $PPRQLXPSHUVXOIDWHZY JDPPRQLXPSHUVXOIDWH +2WRPO 3UHSDUHLPPHGLDWHO\EHIRUHXVH '1DVHDQG51DVHVROXWLRQ 0L[PORI07ULV⋅&OS+$33(1',;$µORI00J&O$33(1',; $DQGPOZDWHU$GGWRPJ'1DVH:RUWKLQJWRQDQGGLVVROYH'1DVH$GG PJ 51DVH LQ VROXWLRQ :RUWKLQJWRQ 0L[ ZHOO GLYLGH LQWR RU µO DOLTXRWVDQGVWRUHDW−°&VWDEOHDWOHDVW\HDU 7KHYROXPHRI51DVHVROXWLRQQHHGHGLVYDULDEOHDQGGHSHQGVRQWKHSURWHLQFRQFHQWUDWLRQ ZKLFKLVUHSRUWHGRQWKHYLDOODEHOLQPJPO7KHYROXPHRI51DVHDGGHGVKRXOGEH µOLIDODUJHUYROXPHLVXVHGWKHDPRXQWRI+2VKRXOGEHGHFUHDVHGSURSRUWLRQDOO\ )LQDOFRQFHQWUDWLRQVDUH07ULV⋅&OS+00J&OZY'1DVHDQG 51DVH 'U\6WULSHTXLOLEUDWLRQVROXWLRQV PO07ULV⋅&OS+$33(1',;$ JXOWUDSXUHXUHD POJO\FHURO JVRGLXPGRGHF\OVXOIDWH6'6 PO0LOOL4SXULILHGZDWHU )RUVROXWLRQ$GGPJ'77SHUPORIHTXLOLEUDWLRQEXIIHU )RUVROXWLRQ$GGJLRGRDFHWDPLGHDQGDIHZJUDLQVEURPSKHQROEOXHSHU PORIHTXLOLEUDWLRQEXIIHU 0DNHIUHVKLPPHGLDWHO\EHIRUHXVH )LQDOFRQFHQWUDWLRQVDUHP07ULV⋅&OS+0XUHDJO\FHURODQG6'6LQD ILQDOYROXPHRIPO (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW ('7$ZY J1D('7$ +2WRPO $GMXVWWRS+ZLWK1D2+ 6WRUHDWURRPWHPSHUDWXUHVWDEOHVHYHUDOPRQWKV 7LWUDWHZKLOHGLVVROYLQJ('7$LVGLIILFXOWWRGLVVROYHZLWKRXWDGGLWLRQRI1D2+HYHQZKHQ WKHGLVRGLXPVDOWLVXVHG (TXLOLEUDWLRQEXIIHU J6'6 POZY('7$S+VHHUHFLSH POJO\FHURO PO07ULV⋅&OS+$33(1',;$ POEURPSKHQROEOXHVDWXUDWHGVROXWLRQLQ+2 +2WRPO 6WRUHDWURRPWHPSHUDWXUHVWDEOHIRUVHYHUDOZHHNV )LQDOFRQFHQWUDWLRQVDUHZY6'6P0('7$YYJO\FHURODQGP0 7ULV⋅&OS+ /HXSHSWLQPJPO PJOHXSHSWLQ POZDWHU 'LYLGHLQWRFRQYHQLHQWYROXPHV 6WRUHDW−°&VWDEOHDWOHDVW\HDU /\VLVEXIIHU JXUHDXOWUDSXUH PO+2 POPHUFDSWRHWKDQRO PODPSKRO\WHV POZY7ULWRQ;VROXWLRQVHHUHFLSH 3UHSDUHLPPHGLDWHO\EHIRUHXVH 8VHVDPHDPSKRO\WHVDVIRUWKH,()JHOIRUPXODWLRQ7RGLVVROYHXUHDZDUPWKHPL[WXUHLQ D°&ZDWHUEDWKLIQHFHVVDU\ 2UWKRSKRVSKRULFDFLG+320 POSKRVSKRULFDFLG :DWHUWROLWHUV 0DNHIUHVKGDLO\ 0XVWEHGHJDVVHGSULRUWRXVH 3%6× J1D&O JPRQREDVLFVRGLXPSKRVSKDWHDQK\GURXV PO+2 $GMXVWS+WR∼ZLWK1D2+ $GG+2WROLWHUV 6WRUHDWURRPWHPSHUDWXUHVWDEOHDWOHDVWPRQWK 7KH×VROXWLRQVKRXOGEHS+WR)LQDOFRQFHQWUDWLRQVDUHP01D&ODQGP0 VRGLXPSKRVSKDWH 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 3%6ZLWKSURWHRO\VLVLQKLELWRUV3%6,EXIIHU PO×3%6VHHUHFLSH POZY('7$S+VHHUHFLSH FRQWLQXHG 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ µO0SKHQ\OPHWK\OVXOIRQ\OIOXRULGH306)LQSURSDQRO µOPJPOOHXSHSWLQVHHUHFLSH µOPJPOSHSVWDWLQVHHUHFLSH $GMXVWWRS+ZLWK+&O $GG+2WRPO 3UHSDUHLPPHGLDWHO\EHIRUHXVH 'LLVRSURS\OIOXRURSKRVSKDWH')3LVDEHWWHUVHULQHSURWHDVHLQKLELWRUWKDQ306)DWORZHU WHPSHUDWXUHV°WR°&KRZHYHUDOWKRXJKERWKFRPSRXQGVDUHWR[LFH[FHSWLRQDOFDXWLRQ PXVWEHH[HUFLVHGZLWK')3RZLQJWRLWVYRODWLOLW\,I')3LVXVHGZRUNLQDFKHPLFDOIXPH KRRGDQGFDUHIXOO\IROORZWKHVXSSOLHU©VSUHFDXWLRQV')3DQG306)KDYHKDOIOLYHVRQWKH RUGHURIKRXUVLQDTXHRXVQHXWUDOVROXWLRQVDQGWKHGHJUDGDWLRQUDWHLQFUHDVHVUDSLGO\DV WKHS+LVLQFUHDVHGDERYHQHXWUDO0DNHDTXHRXVVROXWLRQVLPPHGLDWHO\EHIRUHXVH8VHRI 01D2+LVFRQYHQLHQWWRLQDFWLYDWHUHVLGXDO')3RU306) )LQDOFRQFHQWUDWLRQVDUHP0VRGLXPSKRVSKDWHP01D&O('7$P0 306)µJPOOHXSHSWLQDQGµJPOSHSVWDWLQ 3HSVWDWLQPJPO PJSHSVWDWLQ PODQK\GURXVHWKDQRO 'LYLGHLQWRFRQYHQLHQWYROXPHV 6WRUHDW−°&VWDEOHDWOHDVW\HDU 7KDZDOLTXRWVDQGPL[ZHOOLPPHGLDWHO\EHIRUHXVH 5HGXFLQJEXIIHU JGLWKLRWKUHLWRO'77 J6'6 J7ULVEDVH $GMXVWWRS+ZLWK+&O $GG+2WRPO 3UHSDUHIUHVKHYHU\WLPH )LQDOFRQFHQWUDWLRQVDUHZY'77ZY6'6DQGP07ULV⋅&OS+ 7ULV6'6EXIIHU J6'6 J7ULVEDVH $GMXVWWRS+ZLWK+&O $GG+2WRPO 'LYLGHLQWRPODOLTXRWV 6WRUHDW−°&VWDEOHDWOHDVW\HDU )LQDOFRQFHQWUDWLRQVDUHZY6'6DQGP07ULV⋅&OS+ 7ULWRQ;VROXWLRQZY J7ULWRQ; PO+2 :DUPLQ°&ZDWHUEDWKWRGLVVROYH7ULWRQ; 6WRUHDW°&VWDEOH∼ZHHNV 8UHD0 JXOWUDSXUHXUHD PO+2 3UHSDUHLPPHGLDWHO\EHIRUHXVH $YRLGKHDWLQJDERYHURRPWHPSHUDWXUH (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW &200(17$5< %DFNJURXQG,QIRUPDWLRQ 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 7ZRGLPHQVLRQDO JHO HOHFWURSKRUHVLV XVLQJ LVRHOHFWULFIRFXVLQJIROORZHGE\6'63$*(LV WKHVLQJOHPRVWSRZHUIXODQDO\WLFDOPHWKRGFXU UHQWO\ DYDLODEOH IRUVHSDUDWLQJFRPSOH[SURWHLQ PL[WXUHVVXFKDVZKROHFHOORUWLVVXHH[WUDFWV,W LVWKHUHIRUHDYDOXDEOHPHWKRGIRUIROORZLQJGLV HDVHUHODWHGFKDQJHVRUIRUGHWHFWLQJFKDQJHVLQ SURWHLQ H[SUHVVLRQ XQGHU GLYHUVH H[SHULPHQWDO FRQGLWLRQV7RDFKLHYHPD[LPXPUHSURGXFLELOLW\ EHWZHHQVDPSOHVWREHFRPSDUHGPXOWLSOHJHOV VKRXOGEHFDVWDQGUXQVLPXOWDQHRXVO\$QGHUVRQ DQG$QGHUVRQDE 'HVSLWH WKH H[FHSWLRQDOO\ KLJK UHVROYLQJ SRZHURIWKHPHWKRGWKHWRWDOQXPEHURISURWHLQV WKDWFDQEHUHVROYHGLQDVLQJOHWZRGLPHQVLRQDO JHO LV RQO\ ∼ WR ZKHUHDV WKH WRWDO QXPEHURISURWHLQVLQDVLQJOHPDPPDOLDQFHOO W\SHLVOLNHO\WREHDWOHDVWWRWLPHVKLJKHU 7KHUHIRUHWKHROGJXLGHOLQHWKDWDVLQJOHVSRWRQ DWZRGLPHQVLRQDOJHOLVDVLQJOHSURWHLQQHHGVWR EH UHYLVHG DV DQDO\WLFDO GHWHFWLRQ PHWKRGV LP SURYH&RQYHUVHO\DVLQJOHSURWHLQVLQJOHJHQH SURGXFWFDQSURGXFHPXOWLSOHXVXDOO\DGMDFHQW VSRWVLQWKHLVRHOHFWULFIRFXVLQJGLPHQVLRQRZLQJ WR YDULDEOH GHJUHHV RI FKHPLFDO RU SRVWWUDQVOD WLRQDOPRGLILFDWLRQ&RPPRQH[DPSOHVRIYDUL DEOHSRVWWUDQVODWLRQDOPRGLILFDWLRQVWKDWFDQXVX DOO\EHGHWHFWHGRQWZRGLPHQVLRQDOJHOVLQFOXGH SKRVSKRU\ODWLRQJO\FRV\ODWLRQDQGDFHW\ODWLRQ ([DPSOHVRIFKHPLFDOPRGLILFDWLRQVWKDWFDXVH FKDUJH KHWHURJHQHLW\ LQFOXGH GHDPLGDWLRQ RI VLGHFKDLQDPLQHVXVXDOO\DVSDUDJLQHVR[LGD WLRQRIVHQVLWLYHVLGHFKDLQVDQGPRGLILFDWLRQRI O\VLQHV3RWHQWLDOPRGLILFDWLRQRIO\VLQHVE\XUHD LV SDUWLFXODUO\ LPSRUWDQW EHFDXVH XUHD UDSLGO\ GHFRPSRVHVWRIRUPF\DQDWHZKLFKUHDGLO\UHDFWV ZLWKDPLQRJURXSVHVSHFLDOO\DERYHS+'H VSLWH SRWHQWLDO VLGH UHDFWLRQV XUHD LV WKH PRVW XVHIXO,()DGGLWLYHIRUPDLQWDLQLQJVROXELOLW\RI SURWHLQVQHDUWKHLULVRHOHFWULFSRLQWV 7ZRGLPHQVLRQDO3$*(KDVEHFRPHDYDOX DEOHSUHSDUDWLYHWRROIRUSURWHLQLVRODWLRQLQDGGL WLRQWRLWVKLVWRULFDOUROHDVDQDQDO\WLFDOPHWKRG 7KHVHQVLWLYLW\RIPDQ\SURWHLQDQDO\VLVPHWKRGV KDVLPSURYHGWRWKHSRLQWZKHUHRQHRUVHYHUDO VSRWVIURPWZRGLPHQVLRQDOJHOVDUHVXIILFLHQWIRU SURWHLQ LGHQWLILFDWLRQ XVLQJ PDVV VSHFWURPHWU\ PHWKRGV &RPPHUFLDOO\ DYDLODEOH HTXLSPHQW IRU UXQ QLQJ WZRGLPHQVLRQDO JHOV FDQ EH GLYLGHG LQWR IRXUJURXSVEDVHGRQVL]HPLFURJHOV$PHUVKDP 3KDUPDFLD%LRWHFK3KDVWV\VWHPPLQLJHOVHJ %LR5DG RU $PHUVKDP 3KDUPDFLD %LRWHFK VWDQGDUGRUIXOOVL]HGJHOVHJ%LR5DGRU$PHU VKDP3KDUPDFLD%LRWHFKDQGODUJHRU¦JLDQW§ JHOV(6$,QYHVWLJDWRU'JHOV\VWHPRU$PHU VKDP 3KDUPDFLD %LRWHFK ,VR'DOW JHO V\VWHP ,QJHQHUDOWKHODUJHUWKHJHOWKHEHWWHUWKHILQDO UHVROXWLRQEXWDVJHOVL]HLQFUHDVHVVRGRFRVWV GLIILFXOW\ RI JHO KDQGOLQJ DQG WLPH UHTXLUH PHQWV 6WDQGDUGVL]H JHOV SURYLGH DGHTXDWH UHVROX WLRQIRUPRVWDSSOLFDWLRQVDQGDUHUHODWLYHO\HDV\ WRKDQGOH$PPVROXEOHDPSKRO\WHWXEH,() JHORUDPP×PP×FP,PPRELOLQHJHO KDVDWRWDOSURWHLQFDSDFLW\RI∼µJIRUFRP SOH[SURWHLQPL[WXUHVVXFKDVZKROHFHOOH[WUDFWV 7KH PD[LPXP FDSDFLW\ IRU DQ\ VLQJOH SURWHLQ VSRWLV∼WRµJGHSHQGLQJRQWKHVROXELOLW\ RIWKHSURWHLQQHDULWVLVRHOHFWULFSRLQWDQGWKH VHSDUDWLRQGLVWDQFHIURPDQ\QHDUQHLJKERUV$ YDULHW\RIDOWHUQDWLYHJHOVL]HVWKHLUOLPLWVDQG WKHLUDGYDQWDJHVDUHVXPPDUL]HGLQ7DEOH 7KHORZHUSURWHLQOLPLWIRUDQ\RIWKHV\VWHPVLV GHWHUPLQHG VWULFWO\ E\ WKH DYDLODEOH GHWHFWLRQ PHWKRGV 3URWHLQVFDQEHGHWHFWHGLQWZRGLPHQVLRQDO JHOVE\WKHVDPHZLGHUDQJHRIWHFKQLTXHVXVHG IRURQHGLPHQVLRQDOJHOV$XWRUDGLRJUDSK\81,7 VLOYHUVWDLQLQJDQGHOHFWUREORWWLQJWR39') PHPEUDQHV81,7IROORZHGE\FROORLGDOJROG RUFROORLGDOVLOYHUVWDLQLQJRULPPXQRGHWHFWLRQ 81,7DUHDPRQJWKHPRVWVHQVLWLYHWHFKQLTXHV DYDLODEOH,IDODUJHUDPRXQWRISURWHLQLVDYDLODEOH &RRPDVVLHEOXHVWDLQLQJRIWKHJHORUDPLGREODFN VWDLQLQJRID39')PHPEUDQHDIWHUHOHFWURWUDQV IHU81,7ZRXOGEHWKHGHWHFWLRQPHWKRGVRI FKRLFH 7KHPDMRUWHFKQLFDOOLPLWDWLRQLQWZRGLPHQ VLRQDOJHOHOHFWURSKRUHVLVLVJHOWRJHOYDULDWLRQ (YHQZKHQH[WUHPHFDUHLVH[HUFLVHGWRSURGXFH KLJKO\UHSURGXFLEOHILUVWDQGVHFRQGGLPHQVLRQ JHOVVRPHJHOUHODWHGYDULDELOLW\DPRQJJHOVFDVW DWWKHVDPHWLPHLVOLNHO\WRSHUVLVW$QRWKHUVRXUFH RIYDULDELOLW\LQFOXGHVGLIIHUHQFHVLQH[WUDFWLRQRU UHFRYHU\RISURWHLQVGXULQJVDPSOHVROXELOL]DWLRQ DQGKDQGOLQJ0D[LPL]LQJUHVROXWLRQDQGUHSUR GXFLELOLW\LVHVSHFLDOO\LPSRUWDQWLIFRPSXWHUL]HG FRPSDULVRQVRIWZRGLPHQVLRQDOJHOVRIFRPSOH[ SURWHLQPL[WXUHVVXFKDVFHOORUWLVVXHH[WUDFWVDUH EHLQJDWWHPSWHG ,VRHOHFWULFIRFXVLQJXVLQJVROXEOH DPSKRO\WHV 6ROXEOHDPSKRO\WHVDUHPL[WXUHVRIORZPR OHFXODUZHLJKWRUJDQLFFRPSRXQGVZLWKGLIIHULQJ VLGHFKDLQS.DYDOXHVWKDWSURYLGHEXIIHULQJFD SDFLW\,QDQ,()JHOWKHDPSKRO\WHVPLJUDWHWR WKHLULVRHOHFWULFSRLQWZKHUHWKH\SURYLGHEXIIHU 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7DEOH 6L]H2SWLRQVIRU7ZR'LPHQVLRQDO*HO(OHFWURSKRUHVLV *HOW\SH 0LFURJHOVPLQLJHOVF )XOOVL]HJHOVH *LDQWJHOVI )LUVWGLPHQVLRQJHO 'LDPHWHU' /HQJWK/ PP FP < > < < > < > < < < > > 6HFRQGGLPHQVLRQJHOD 7KLFNQHVV7 PP +HLJKW+ FP <' >' <'G <' >' <'G >' <'G < < < > > 3XUSRVH $QDO\WLFDO $QDO\WLFDO $QDO\WLFDOSUHSDUDWLYH $QDO\WLFDO $QDO\WLFDO $QDO\WLFDOSUHSDUDWLYH $QDO\WLFDO $QDO\WLFDOSUHSDUDWLYH &RPPHQWVE D7KHVHFRQGGLPHQVLRQJHOZLGWKKDVWREHDWOHDVWHTXDOWRWKH,()WXEHJHOKHLJKW E.H\WRFRPPHQWVWXEHJHOFDQQRWEHSODFHGGLUHFWO\RQWRSRIVHFRQGGLPHQVLRQJHODQGXVHRIDJDURVHLVUHFRPPHQGHG XVHRIVWDFNLQJJHOLVUHFRPPHQGHGH[WUXVLRQDQGKDQGOLQJDUHUHODWLYHO\GLIILFXOWWRWDOSURWHLQORDGLVOLPLWHGWR XVXDOO\≤µJIRUZKROHFHOORUWLVVXHH[WUDFWVWXEHJHOFDQEHSODFHGGLUHFWO\RQWRSRIVHFRQGGLPHQVLRQJHODQGXVHRI DJDURVHLVQRWQHFHVVDU\XVHRIDVWDFNLQJJHOLVQRWQHFHVVDU\WRWDOSURWHLQORDGFDSDFLW\LVUHODWLYHO\ODUJHH[WUXVLRQ DQGKDQGOLQJDUHUHODWLYHO\VLPSOHH[WUXVLRQDQGKDQGOLQJDUHYHU\GLIILFXOW F0LQLJHOV\VWHPVSURYLGHUDSLGVHSDUDWLRQVZLWKPRGHUDWHUHVROXWLRQ0LFURJHOV3KDVWJHOVDUHSUHFDVWJHOVWKDWDUHVOLJKWO\ VPDOOHUWKDQPRVWPLQLJHOV G8VHRIVHFRQGGLPHQVLRQJHOVWKLFNHUWKDQPPLVJHQHUDOO\QRWUHFRPPHQGHGRZLQJWRGLIILFXOW\ZLWKHLWKHUHIILFLHQWVWDLQLQJ RUHIILFLHQWHOHFWUREORWWLQJ H)XOOVL]HJHOVSURYLGHUHVROXWLRQVDWLVIDFWRU\IRUPRVWDSSOLFDWLRQV I*LDQWJHOVSURYLGHYHU\JRRGUHVROXWLRQ6SHFLDOL]HGHTXLSPHQWLVUHTXLUHGVXFKDV,QYHVWLJDWRU'(6$ ,VR'DOW+RHIIHU3KDUPDFLDRUKRPHPDGHJLDQWVL]HJHOV\VWHPV LQJFDSDFLW\DQGKHQFHSURGXFHVWDEOHS+JUD GLHQWV,QWKHRU\DQ\GHVLUHGS+JUDGLHQWFRXOG EH SURGXFHG E\ EOHQGLQJ DPSKRO\WHV ZLWK DS SURSULDWH S.DYDOXHV,QSUDFWLFHLWLVUHODWLYHO\ HDV\WRSURGXFHS+JUDGLHQWVIURP∼S+RU WRS+EXWVWDEOHVROXEOHJUDGLHQWVRXWVLGHWKLV UDQJHDUHXVXDOO\QRWWHFKQLFDOO\IHDVLEOH:LWKLQ WKHVHS+OLPLWVVRPHPDQLSXODWLRQRIWKHJUDGL HQWVKDSHDQGS+UDQJHLVSRVVLEOHE\EOHQGLQJ GLIIHUHQWDPRXQWVRIVSHFLILFS+UDQJHDPSKR O\WHV)RUH[DPSOHPORIS+DPSKRO\WHV SOXVPORIS+DPSKRO\WHVFDQEHXVHG LQVWHDGRIPORIS+DPSKRO\WHVDORQHWR LQFUHDVHWKHVHSDUDWLRQGLVWDQFHRISURWHLQVLQWKH S+WRUDQJH %DVLF 3URWRFRO LV EDVHG RQ XVH RI PP ILUVWGLPHQVLRQLVRHOHFWULFIRFXVLQJJHOVDQG PP VHFRQGGLPHQVLRQ JHOV XVLQJ WKH %LR5DG WZRGLPHQVLRQDOJHODSSDUDWXV3URWHDQ,,[L' 7KHPHWKRGFDQEHHDVLO\DGDSWHGWRHTXLSPHQW IURPRWKHUVXSSOLHUVRUWRGLIIHUHQWVL]HGJHOVE\ DGMXVWLQJ WKH TXDQWLWLHV RI UHDJHQWV XVHG 7KH SURWRFRO XVHV 0 XUHD DQG 7ULWRQ ; DV VROXELOL]LQJDJHQWV6ROXELOL]DWLRQRIWKHSURWHLQ VDPSOHDSSOLHGWRWKHJHODVZHOODVPDLQWHQDQFH RIVROXELOLW\GXULQJHOHFWULFIRFXVLQJDUHWKHPRVW FULWLFDO IDFWRUV LQIOXHQFLQJ WKH TXDOLW\ RI VHSD UDWLRQLQWKHILUVWGLPHQVLRQ7KHPRVWFRPPRQ PRGLILFDWLRQ WR 7ULWRQ ;¤EDVHG SURFH GXUHV LV DGGLWLRQ RI >FKRODPLGRSURS\OGL PHWK\[email protected] &+$36 WR WKH JHO DQG VROXELOL]LQJ EXIIHU PL[WXUHV$GGLWLRQRI6'6WRFRPSOH[VDPSOHV VXFKDVWLVVXHRUFHOOH[WUDFWVFDQDOVRHQKDQFH UHSURGXFLEOH VROXELOL]DWLRQ RI WKH ODUJHVW SRV VLEOH VXEVHW RI SURWHLQV $OWKRXJK 6'6 LV FKDUJHG LQ WKH SUHVHQFH RI 7ULWRQ ; LW LV VHSDUDWHG IURP SURWHLQV GXULQJ IRFXVLQJ DQG PLJUDWHVWRWKHDFLGLFHQGRIWKHJHO5HJDUGOHVV RIWKHPHWKRGXVHGWRPDLQWDLQVROXELOLW\VRPH SURWHLQV HVSHFLDOO\ WKRVH > N'D WHQG WR SUHFLSLWDWHDWS+YDOXHVDSSURDFKLQJWKHLULVRHOHF WULFSRLQWDQGWKXVSURGXFHKRUL]RQWDOVPHDUVRQ WKHILQDOVHFRQGGLPHQVLRQJHO %DVLF 3URWRFRO UHTXLUHV VHYHUDO PRGLILFD WLRQV IRU VXFFHVVIXO VHSDUDWLRQ RI YHU\ DFLGLF $OWHUQDWH 3URWRFRO RU YHU\ EDVLF $OWHUQDWH 3URWRFROSURWHLQV,QERWKFDVHVSUHIRFXVLQJ RIWKHJHOVPXVWEHDYRLGHGDQGWKHLVRHOHFWUR IRFXVLQJWLPHKDVWREHUHGXFHG$VKRUWVHSDUD WLRQ WLPH GRHV QRW DOORZ WKH V\VWHP WR UHDFK HTXLOLEULXPDQGLVXVHGWRHVWDEOLVKWKHGHVLUHG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 7DEOH &RPPHUFLDOO\$YDLODEOH3UHFDVW,3**HOVDQG,PPRELOLQH&KHPLFDOV 1DPH 8VH $YDLODEOHS+UDQJH ,PPRELOLQH'U\3ODWHD 5XQQLQJRQHGLPHQVLRQDOLPPRELOL]HG S+JUDGLHQWJHOV S+S+S+ S+S+ ,PPRELOLQH'U\6WULSD 5XQQLQJILUVWGLPHQVLRQLQWZR GLPHQVLRQDOJHOV PP PP S+/S+/ S+/S+/FS+1/G ,3*5HDG\6WULSVE FP FP ,PPRELOLQH,,D 5XQQLQJILUVWGLPHQVLRQLQWZR GLPHQVLRQDOJHOV &UHDWLQJFXVWRPJUDGLHQWLPPRELOL]HG S+JUDGLHQWJHOV S+S+S+S+S+ S+S+S+S+S+ S.S.S.S. S.S. D)URP$PHUVKDP3KDUPDFLD%LRWHFK E)URP%LR5DG F$OLQHDUJUDGLHQWZLWKPD[LPXPUHVROXWLRQDERYHS+ G$QRQOLQHDUJUDGLHQWZLWKEHVWUHVROXWLRQDWS+ S+JUDGLHQW6HSDUDWLRQRIYHU\DFLGLFSURWHLQV UHTXLUHVPRGLILFDWLRQVRIJHODQGHOHFWURGHVR OXWLRQV 6HSDUDWLRQ RI YHU\ EDVLF SURWHLQV KDV WREHSHUIRUPHGZLWKWKHSRVLWLRQVRIHOHFWURGHV DQGHOHFWURGHVROXWLRQVUHYHUVHGLQWKHHOHFWUR SKRUHVLV FKDPEHU 7KHWRWDOSURWHLQORDGSHUJHOGHSHQGVRQWKH FRPSOH[LW\RIWKHVDPSOHWKHVROXELOLW\RISUR WHLQVLQWKHVDPSOHDQGWKHGLDPHWHURIWKHILUVW GLPHQVLRQJHO$SSUR[LPDWHO\WLPHVDVPXFK WRWDOVDPSOHFDQEHDSSOLHGWRDPPJHOFRP SDUHGZLWKDPPJHO$QRWKHUDGYDQWDJHRID ODUJHUGLDPHWHU LVRHOHFWULF IRFXVLQJ JHO LV WKDW H[WUXVLRQ DQGJHOKDQGOLQJDUHHDVLHURZLQJWR LPSURYHGVWUHQJWKRIWKHJHO,IFDUHLVH[HUFLVHG LQORDGLQJWKHILUVWGLPHQVLRQJHORQWRWKH PP VHFRQGGLPHQVLRQ JHO WKH ILQDO UHVROXWLRQ ZLOOEHVLPLODUWRWKDWREWDLQHGXVLQJVPDOOHUGL DPHWHU ,() JHOV 7KH VHSDUDWLQJ RU UHVROYLQJ SRZHURIDV\VWHPLVGHSHQGHQWRQWKHTXDOLW\RI DPSKRO\WHVXVHGWKHVORSHRIWKHS+JUDGLHQW DQGWKHOHQJWKVRIERWKILUVWDQGVHFRQGGLPHQ VLRQJHOV 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV ,PPRELOL]HGS+JUDGLHQWJHOV ,QLPPRELOL]HGS+JUDGLHQW,3*JHOV%DVLF 3URWRFROWKHS+JUDGLHQWLVDQLQWHJUDOSDUWRI WKHSRO\DFU\ODPLGHPDWUL[6WUDKOHUDQG+DQDVK %HFDXVH WKH S+ JUDGLHQW LV FRYDOHQWO\ DVVRFLDWHG ZLWK WKH SRO\DFU\ODPLGH JHOPDWUL[ SUHFLVH UHSURGXFLEOH DQG YHU\ KLJKUHVROXWLRQ VHSDUDWLRQVFDQEHDFKLHYHG$YDULHW\RISUHFDVW JHOVDQGDOOWKHQHFHVVDU\HTXLSPHQWDUHFRPPHU FLDOO\DYDLODEOHIURPHLWKHU$PHUVKDP3KDUPDFLD %LRWHFK RU %LR5DG 5HSURGXFLEOH WZRGLPHQ VLRQDOJHOVFDQEHREWDLQHGE\UXQQLQJDVDPSOH RQ D QDUURZ VWULS RI LPPRELOL]HG S+ JUDGLHQW JHO DQG WKHQ UXQQLQJ LW LQ D YHUWLFDO 6'6 VHF RQGGLPHQVLRQ JHO ,VRHOHFWURIRFXVLQJ LV SHU IRUPHG LQ D KRUL]RQWDO HOHFWURSKRUHVLV XQLW LQ ZKLFK PXOWLSOH JHO VWULSV PD\ EH UXQ VLPXOWD QHRXVO\(TXLSPHQWDQGUHDJHQWVDUHDOVRDYDLO DEOHIRUWKHXVHUWRFDVWFXVWRP,PPRELOLQHJHOV LQ WKH ODERUDWRU\ 6RPHRIWKHPDMRUDGYDQWDJHVRIXVLQJSUHFDVW ,3*JHOVDUHWKHLUHDVHRIXVHDQGKLJKUHSURGXFL ELOLW\WKHWLPHVDYLQJVUHDOL]HGDQGWKHIDFWWKDW SUHFLVLRQQDUURZUDQJHJUDGLHQWVFDQEHXVHGWR UHVROYHVPDOOFKDUJHGLIIHUHQFHV%HFDXVHWKHS+ JUDGLHQWLVFRYDOHQWO\FRXSOHGWRWKHSRO\DFU\ ODPLGHJHOPDWUL[WKHS+JUDGLHQWUHPDLQVVWDEOH DQGOLQHDUGXULQJSURORQJHGHOHFWURSKRUHVLVWKXV HQVXULQJ UHSURGXFLELOLW\ 7KLV LV LQ FRQWUDVW WR FRQYHQWLRQDO,()JHOVZKHUHJUDGLHQWGULIWRFFXUV GXULQJSURORQJHGHOHFWURSKRUHVLV$GGLWLRQDOO\ WKHSUHFDVWJHOVFDQEHUHK\GUDWHGLQZDWHURULQ VROXWLRQVZLWKRQHRUPRUHDGGLWLYHVVXFKDVXUHD &+$36 RU 7ULWRQ ; FDUULHU DPSKRO\WHV JO\FHURODQGUHGXFLQJDJHQWVZKLFKPD\KHOSWR LQFUHDVHSURWHLQVROXELOLW\3UHFDVWJHOVWULSVDUH DYDLODEOHZLWKS+UDQJHVVXFKDVS+WR RUS+WRDVZHOODVQDUURZHUUDQJHVDV 'U\3ODWHV,QDGGLWLRQDYDULHW\RI,PPRELOLQHV SHUPLWVWKHXVHUWRFDVW,3*JHOVZLWKFXVWRPL]HG S+ JUDGLHQWV RI DQ\ JUDGLHQW UDQJH DQG VKDSH EHWZHHQS+DQGS+ 7DEOHOLVWVW\SHVRIFRPPHUFLDOO\DYDLO DEOHJHOVDQG,PPRELOLQHV:LWKWKH,PPRELOLQH 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ V\VWHPWKHDSSDUHQWS,RIDJLYHQSURWHLQPD\ EH VOLJKWO\ GLIIHUHQW IURP WKDW GHWHUPLQHG E\ RWKHU PHWKRGV 7KHUHIRUH LW LV UHFRPPHQGHG WKDW D EURDGUDQJH JUDGLHQW EH WULHG LQLWLDOO\ IROORZHG E\ D QDUURZHUUDQJH JUDGLHQW LI QHHGHG 'LDJRQDOJHOHOHFWURSKRUHVLV 'LDJRQDOJHOHOHFWURSKRUHVLVLVDIRUPRIWZR GLPHQVLRQDODQDO\VLVXVHIXOIRULQYHVWLJDWLQJWKH VXEXQLW FRPSRVLWLRQ RI PXOWLVXEXQLW SURWHLQV FRQWDLQLQJLQWHUFKDLQGLVXOILGHERQGV*RYHUPDQ DQG/HZLV3URWHLQVDUHHOHFWURSKRUHVHGLQ WKHILUVWGLPHQVLRQLQDWXEHJHORUDVODEJHO XQGHUQRQUHGXFLQJFRQGLWLRQV7KHSURWHLQVDUH WKHQUHGXFHGLQVLWXDQGWKHILUVWJHORUDVWULS WKHUHRILVOD\HUHGRQWRDVHFRQGJHODQGHOHFWUR SKRUHVHG,QWKHVHFRQGJHOWKHSURWHLQVPLJUDWH DW ULJKW DQJOHV WR WKH RULJLQDO ILUVWGLPHQVLRQ PLJUDWLRQ0RVWFHOOXODUSURWHLQVDUHQRWGLVXO ILGHOLQNHGDQGZLOOIDOORQWKH¦GLDJRQDO§LQWKLV V\VWHPWKDWLVWKH\PLJUDWHDSSUR[LPDWHO\HTXDO GLVWDQFHVLQERWKGLUHFWLRQVGXULQJHOHFWURSKRUH VLV DQG OLH DSSUR[LPDWHO\ RQ WKH GLDJRQDO OLQH FRQQHFWLQJRSSRVLWHFRUQHUVRIWKHJHO2QUHGXF WLRQFRPSRQHQWVXEXQLWVRISURWHLQVFRQQHFWHG E\LQWHUFKDLQGLVXOILGHERQGVZLOOUHVROYHEHORZ WKHGLDJRQDOEHFDXVHWKHLQGLYLGXDOVXEXQLWVPL JUDWH IDVWHU WKDQ WKH GLVXOILGHOLQNHG FRPSOH[ GXULQJWKHVHFRQGHOHFWURSKRUHVLV6RPHSURWHLQV ZLWKLQWHUQDOGLVXOILGHERQGVEXWQRLQWHUFKDLQ GLVXOILGHVPD\PLJUDWHVOLJKWO\DERYHWKHGLDJR QDOEHFDXVHLQWHUQDOGLVXOILGHVFDQSURGXFHDPRUH FRPSDFWPROHFXODUVKDSHFDXVLQJIDVWHUPLJUD WLRQLQWKHILUVWGLPHQVLRQ ,QYHVWLJDWRU'JHOV\VWHP 7KH ,QYHVWLJDWRU ' JHO V\VWHP ZDV LQWUR GXFHGLQE\0LOOLSRUHDVWKHILUVWFRPPHU FLDO ¦ODUJH§ RU¦JLDQW§IRUPDWWZRGLPHQVLRQDO JHOV\VWHPGHVLJQHGIRUDQDO\WLFDOSXUSRVHVDO WKRXJKDQDORJRXVKRPHPDGHXQLWVKDGEHHQUH SRUWHGHDUOLHU*DUUHOV<RXQJHWDO 7KLV SURGXFW OLQH LQFOXGLQJ SUHFDVW ILUVW DQG VHFRQGGLPHQVLRQ JHOV FDQ QRZ EH SXUFKDVHG IURP(6$7KH,QYHVWLJDWRU'JHOV\VWHPXVHV ODUJHUJHOVL]HVWKDQWKHJHOVGHVFULEHGLQWKLVXQLW DV ZHOO DV D QXPEHU RI QRYHO DSSURDFKHV DQG UHDJHQWVGHVLJQHGWRHQKDQFHUHVROXWLRQDQGJHO WRJHOUHSURGXFLELOLW\7KHPDMRUIHDWXUHVRIWKLV V\VWHPLQFOXGHWKHIROORZLQJDQLQFUHDVHGOHQJWK RIWKHILUVWGLPHQVLRQJHOFPDQLQFUHDVHG OHQJWKDQGZLGWKRIWKHVHFRQGGLPHQVLRQJHO ×FPDWKUHDGUHLQIRUFHPHQWRIWKHLVRHOHFWULF IRFXVLQJJHOWHPSHUDWXUHFRQWUROGXULQJHOHFWUR SKRUHVLVRIWKHVHFRQGGLPHQVLRQJHODQGXVHRI DVSHFLDOKLJKWHQVLOHVWUHQJWKDFU\ODPLGHWRID FLOLWDWH KDQGOLQJ RI WKH ODUJH WKLQ VHFRQGGL PHQVLRQJHO1DUURZJHOWXEHVPPIRUWKH ILUVWGLPHQVLRQ DUH VWDQGDUG EXW PPLQQHU GLDPHWHU WXEHV DUH DYDLODEOH WR DFFRPPRGDWH ODUJHUSURWHLQORDGV7KHPP,()JHOVGRQRW KDYH WKH WKUHDG UHLQIRUFHPHQW 2QH PRGLILFD WLRQ UHODWHG WR WKH DERYH SURWRFRO LQFOXGHV DG GLWLRQRIZY&+$36LQWKHJHOVROXWLRQ ZKLFK LV LQWHQGHG WR LPSURYH WKH VROXELOLW\ RI SURWHLQV DQG WKHLU PLJUDWLRQ DQG VHSDUDWLRQ LQ WKH JHO 7KH V\VWHP LV VXSSOLHG ZLWK D PDQXDO WKDW DGHTXDWHO\ GHVFULEHV WKH PHWKRG &ULWLFDO3DUDPHWHUVDQG 7URXEOHVKRRWLQJ $OWKRXJKQRLQGLYLGXDOVWHSVLQWZRGLPHQ VLRQDOJHODQDO\VLVDUHH[FHSWLRQDOO\GLIILFXOWWKH ODUJHQXPEHURIVWHSVLQYROYHGLQFUHDVHWKHOLNH OLKRRGDQGSRVVLEOHVHYHULW\RIHUURUVRUSUREOHPV 6HYHUDOVWHSVDUHHVSHFLDOO\FULWLFDODQGPD\UH TXLUHRSWLPL]DWLRQ7KHILUVWLVVDPSOHSUHSDUD WLRQ 3URWHLQV DSSOLHG WR ,() JHOV KDYH WR EH FRPSOHWHO\ VROXELOL]HG 5HVLGXDO SUHFLSLWDWH RU HYHQVROXEOHDJJUHJDWHVDUHOLNHO\WRFDXVHDUWL IDFWVRQWKHHQGRIWKHWXEHJHORUSRVLWLRQRQWKH ,3*VWULSZKHUHWKHVDPSOHLVORDGHG3UHFLSLWDWHG RU DJJUHJDWHG SURWHLQV PD\ DOVR LQWHUDFW ZLWK VROXEOHSURWHLQVFDXVLQJFRPSRQHQWVZLWKQRU PDOO\JRRGVROXELOLW\WRFRSUHFLSLWDWHRUPLJUDWH DQRPDORXVO\ 7ZRJHQHUDOUXOHVRIWKXPEDSSO\WRVDPSOH VROXELOLW\WKHPRUHFRPSOH[WKHVDPSOHRUWKH PRUHFUXGHWKHH[WUDFWWKHPRUHOLNHO\SUREOHPV ZLOOEHHQFRXQWHUHGZLWKVDPSOHVROXELOLW\DQG WKHKLJKHUWKHSURWHLQORDGDSSOLHGWRWKHJHO WKH PRUH OLNHO\ VROXELOLW\ SUREOHPV ZLOO DULVH &DUH PXVW DOVR EH WDNHQ WR DYRLG SURWHRO\VLV GXULQJVDPSOHSUHSDUDWLRQHVSHFLDOO\ZKHQFRP SOH[ LPSXUH VDPSOHV DUH XVHG ,I VDPSOHV DUH IUR]HQHLWKHUEHIRUHRUDIWHUVROXELOL]DWLRQWKH\ VKRXOG EH VWRUHG DW −°& DQG VKRXOG QRW EH VXEMHFWHGWRUHSHDWHGIUHH]HWKDZLQJ$GGLWLRQRI 6'6WRWKHVROXELOL]DWLRQVROXWLRQLQFUHDVHVWKH VROXELOL]DWLRQ RI VRPH SURWHLQV KRZHYHU 6'6 VKRXOGRQO\EHXVHGZKHQWKH,()JHOVFRQWDLQ XUHDDQG7ULWRQ;DVWKHVROXELOL]LQJDJHQWV DUH UHTXLUHG IRU HIIHFWLYH VHSDUDWLRQ RI WKH VWURQJO\DQLRQLF6'6PROHFXOHVIURPWKHSURWHLQV GXULQJLVRHOHFWULFIRFXVLQJ+HDWLQJRIVDPSOHV LQXUHDFRQWDLQLQJVROXWLRQVPXVWEHDYRLGHGEH FDXVHXUHDUHDGLO\GHFRPSRVHVWRF\DQDWHZKLFK UHDFWVZLWKDPLQRJURXSVDQGFDXVHVFKDUJHKHW HURJHQHLW\+LJKFRQFHQWUDWLRQVRIVDOWVDQGEXII HUVLQWKHVDPSOHVKRXOGEHDYRLGHG,RQLFFRP SRXQGVLQFUHDVHWKHFRQGXFWLYLW\RIWKHVDPSOH DQGFDQUHVXOWLQORFDOL]HGRYHUKHDWLQJHVSHFLDOO\ IRU,PPRELOLQHJHOV (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 6DPSOHVDQDO\]HGRQLPPRELOL]HGS+JUDGL HQWJHOVVKRXOGQRWFRQWDLQSUHFLSLWDWHV7KHFRQ FHQWUDWLRQRIVDOWVDQGEXIIHULRQVLQWKHVDPSOH VKRXOGEHNHSWWRDPLQLPXP<P0WRDYRLG ORFDORYHUKHDWLQJRIWKHJHOGXULQJHOHFWURSKRUH VLV,IWKHVDPSOHIRUPVDJJUHJDWHVRUSUHFLSLWDWHV DWWKHSRLQWRIDSSOLFDWLRQDSSO\WKHVDPSOHWRD GLIIHUHQWORFDWLRQGLIIHUHQWS+RQWKHJHORUORDG WKHVDPSOHGXULQJWKHUHK\GUDWLRQVWHS (DUO\GHFLVLRQVWKDWPXVWEHPDGHLQFOXGHWKH VL]HRIWKHJHOVUHTXLUHGDQGZKHWKHUDVROXEOH DPSKRO\WHV\VWHPRUDQ,PPRELOLQHJHOZLOOEH XVHG7KHPDMRUFRQVLGHUDWLRQDIIHFWLQJDSSURSUL DWHJHOVL]HLVWKHGHJUHHRIUHVROXWLRQQHHGHG,Q JHQHUDOWKHVPDOOHVWJHOIRUPDWVKRXOGEHVHOHFWHG WKDWZLOOSURYLGHWKHQHHGHGGHJUHHRIUHVROXWLRQ EHFDXVHVPDOOHUJHOVDUHHDVLHUOHVVH[SHQVLYH DQGIDVWHUWRUXQ7KHUHIRUHTXLFNVFUHHQLQJRI VDPSOHVRUDQDO\VLVRIUHODWLYHO\VLPSOHVDPSOHV FDQ HDVLO\ EH DFFRPSOLVKHG ZLWK PLFURJHOV RU PLQLJHOV ,Q FRQWUDVW LI GHWDLOHG TXDOLWDWLYH RU TXDQWLWDWLYHFRPSDULVRQVRIFHOORUWLVVXHH[WUDFWV DUHSODQQHGVWDQGDUGVL]HRUODUJHJHOVDUHLQGL FDWHG6LPLODUO\PPRUODUJHUILUVWGLPHQVLRQ WXEHJHOVIROORZHGE\PPVHFRQGGLPHQVLRQ JHOVLQWKHVWDQGDUGRUODUJHIRUPDWDUHLQGLFDWHG LIWKHWZRGLPHQVLRQDOJHOVZLOOEHXVHGIRUSUHSD UDWLYHLVRODWLRQRIDSURWHLQIRUDSSOLFDWLRQVVXFK DV UDLVLQJ DQWLERGLHV RU FRQGXFWLQJ VWUXFWXUDO DQDO\VLV ,PPRELOL]HG S+ JUDGLHQW JHOV VKRXOG YHU\VHULRXVO\EHFRQVLGHUHGDVDQDOWHUQDWLYHWR VROXEOHDPSKRO\WHJHOVIRUPRVWVHSDUDWLRQVRZ LQJWRWKHLUVWDEOHDQGUHSURGXFLEOHS+SURILOHV 7KH,3*JHOVDUHSDUWLFXODUO\DSSURSULDWHZKHQD QDUURZS+UDQJHLVUHTXLUHG ,PPRELOL]HGS+JUDGLHQWJHOVDUHW\SLFDOO\UXQ DWWR9DQGW\SLFDOO\UHTXLUHDIRFXVLQJ WLPHRIWRKU8VHRIKLJKYROWDJHWR 9 LQWHJUDWHG SRZHU VXSSOLHVFRROLQJ XQLWVFDQVKRUWHQIRFXVLQJWLPHVWRKU2SWLPDO IRFXVLQJFRQGLWLRQVPD\EHH[SHULPHQWDOO\GH WHUPLQHG E\ DSSO\LQJ WKH VDPSOH WR GLIIHUHQW SRVLWLRQVRQWKHJHODQGHVWLPDWLQJWKHWLPHIRU WKHPLJUDWLRQSDWWHUQVWRFRLQFLGH6RPHSURWHLQV PD\UHTXLUHORQJHUUXQWLPHVWRUHDFKWKHLUS, %HFDXVHWKHUHLVQRJUDGLHQWGULIWWKHSRWHQWLDO SUREOHPV ZLWK ORQJHU UXQ WLPHV DUH OLPLWHG WR VDPSOH PRGLILFDWLRQV RU GU\LQJ RXW RI WKH JHO 7KHVH SUREOHPV XVXDOO\ FDQ EH PLQLPL]HG E\ LQFOXGLQJ D UHGXFLQJ DJHQW LQ WKH UHK\GUDWLRQ VROXWLRQDQGFRDWLQJWKHWRSVXUIDFHRIWKHJHOZLWK SDUDIILQRLO 7KHTXDOLW\RIWKHILUVWGLPHQVLRQDOVHSDUDWLRQ LVVWURQJO\GHSHQGHQWRQWKHSXULW\RIWKHUHDJHQWV XVHG HVSHFLDOO\ WKH XUHD DQG DPSKRO\WHV 2QH IDLUO\FRPPRQO\HQFRXQWHUHGIUXVWUDWLRQZKHQ VROXEOHDPSKRO\WHJHOVDUHXVHGLVWKDWGLIIHUHQW EDWFKHV RI DPSKRO\WHV IURP WKH VDPH VXSSOLHU ZLOO VRPHWLPHV SURGXFH PDUNHGO\ GLIIHUHQW WZRGLPHQVLRQDO JHO SDWWHUQV 7KHUHIRUH LW LV DGYLVDEOH WR SXUFKDVH DQ DGHTXDWH VXSSO\ RI D VLQJOH ORW RI DPSKRO\WHV WR PHHW DQWLFLSDWHG QHHGV IRU DQ HQWLUH VWXG\ ZKHUH VXFK DQ DS SURDFK LV IHDVLEOH +RZHYHU ZKHUHDV DPSKR O\WHV XVXDOO\ KDYH D UHDVRQDEO\ ORQJ VKHOI OLIH DW°&XVXDOO\XSWRD\HDUVKHOIOLIHDVZHOODV WRWDO DPSKRO\WH UHTXLUHPHQWV RIWHQ FDQQRW EH SUHGLFWHGZLWKPXFKFHUWDLQW\ :KHQ DQ\ GRXEW DULVHV DERXW WKH SXULW\ RU TXDOLW\RIDPSKRO\WHVRUDQ\RWKHUUHDJHQWWKH UHDJHQWVKRXOGEHUHSODFHGLPPHGLDWHO\&RQVWDQW PRQLWRULQJRIWKHV\VWHPSHUIRUPDQFHHVSHFLDOO\ ZKHQFKDQJLQJORWVRIDPSKRO\WHVXUHDRUDFU\ ODPLGHFDQKHOSPLQLPL]HSRWHQWLDOUHDJHQWDV VRFLDWHGSUREOHPV,QPRVWFDVHVWKHEHVWVWDQG DUGIRUDJLYHQWZRGLPHQVLRQDOJHOV\VWHPLVDQ H[SHULPHQWDOVDPSOHRUFRQWUROWKDWLVDYDLODEOH LQ VXIILFLHQW TXDQWLW\ VR WKDW PDQ\ UHSOLFDWH DOLTXRWVFDQEHIUR]HQDQGVWRUHGIRUDQH[WHQGHG WLPHDW−°&DOWHUQDWLYHO\DVDPSOHWKDWFDQEH UHSURGXFLEO\ SUHSDUHG RYHU D ORQJ WLPH IUDPH ZRXOG PDNH DQ DFFHSWDEOH VWDQGDUG 6XFK DQ H[SHULPHQWDOVWDQGDUGRUUHIHUHQFHLVPRUHOLNHO\ WR GHWHFW VXEWOH EXW H[SHULPHQWDOO\ LPSRUWDQW FKDQJHVLQWKHWZRGLPHQVLRQDOJHOV\VWHPWKDQ FRPPHUFLDOO\DYDLODEOH,()RU6'6JHOVWDQGDUG PL[HV $QRWKHUFULWLFDOIDFWRULVHTXLOLEUDWLRQRIWKH ILUVWGLPHQVLRQ JHO LQ WKH VHFRQGGLPHQVLRQ HTXLOLEUDWLRQ EXIIHU 'XULQJ WKLV VWHS XUHD GLI IXVHVRXWRIWKH,()JHOZKLOH6'6DQGUHGXFLQJ UHDJHQWGLIIXVHLQWRWKHJHO,IWKHJHOLVLQDGH TXDWHO\ VDWXUDWHG ZLWK 6'6 YHUWLFDO VWUHDNLQJ ZLOOUHVXOW+RZHYHULIWKHJHOLVLQFXEDWHGLQWKH HTXLOLEUDWLRQEXIIHUIRUDQH[WHQGHGWLPHDVXE VWDQWLDODPRXQWRIWKHSURWHLQFDQUDSLGO\GLIIXVH RXWRIWKHODUJHSRUH,()JHO/RVVHVDULVLQJIURP GLIIXVLRQFDQEHFULWLFDOIRUDQ\H[SHULPHQWEH FDXVHGLIIHUHQWSURWHLQVZLOOGLIIXVHDWGLIIHUHQW UDWHVEXWULJRURXVFRQWURORIWKHLQFXEDWLRQVWHS LVHVSHFLDOO\LPSRUWDQWLITXDQWLWDWLYHFRPSDUL VRQV DPRQJ JHOV DUH SODQQHG 7KH VLPSOHVW PHWKRGRIFRQWUROOLQJWKHLQFXEDWLRQWLPHLVWR IUHH]HWKHH[WUXGHG,()JHODIWHUDFDUHIXOO\FRQ WUROOHGPLQLQFXEDWLRQLQWKHHTXLOLEUDWLRQEXII HUDQ\DGGLWLRQDOHTXLOLEUDWLRQLQFXEDWLRQWLPH UHTXLUHGFDQWKHQEHLQFRUSRUDWHGDQGFDUHIXOO\ FRQWUROOHGZKHQWKHVDPSOHLVWKDZHGIRUORDGLQJ RQWRWKHVHFRQGGLPHQVLRQJHO $QRWKHUFUXFLDOVWHSLVORDGLQJRIWKHHTXLOL EUDWHG,()JHORQWRWKHWRSRIWKHVHFRQGGLPHQ VLRQJHO$Q\LUUHJXODULW\RUREVWUXFWLRQEHWZHHQ WKH WZR JHOV LQFOXGLQJ SDUWLFOHV RI GLUW RU DLU EXEEOHVZLOODIIHFWWKHIORZRIFXUUHQWDQGGLVUXSW 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ WKHUHVROXWLRQRISURWHLQVLQWKHILQDOJHO6LPL ODUO\SRRUFRQWDFWRUDQ\PRYHPHQWRIWKH,() JHO GXULQJ HOHFWURSKRUHVLV RI WKH SURWHLQV RXW RI WKH ,() JHO LQWR WKH VHFRQGGLPHQVLRQ JHO ZLOO OHDG WR DUWLIDFWV 7KHUHIRUH LW LV DGYLVDEOH WR HPEHG WKH ,() JHO LQ D EXIIHUHG DJDURVH PDWUL[ WR HQVXUH JRRG HOHFWULFDO FRQWDFW EH WZHHQ WKH JHOV DQG WR SUHYHQW JHO PRYHPHQW DIWHU HOHFWURSKRUHVLV LV LQLWLDWHG )LQDOO\WKHFKRLFHRIVHFRQGGLPHQVLRQJHO FRPSRVLWLRQDQGVHSDUDWLRQFRQGLWLRQVFDQLQIOX HQFHWKHTXDOLW\RIUHVXOWV$SURSHUSHUFHQWDJH RI DFU\ODPLGH VKRXOG EH VHOHFWHG WR RSWLPL]H UHVROXWLRQ ZLWKLQ WKH GHVLUHG PROHFXODU PDVV UDQJH,IJUDGLHQWJHOVDUHQHHGHGXVHRIDPXOWL SOH JHO FDVWLQJ VWDQG LV WKH EHVWZD\WRHQVXUH UHSURGXFLELOLW\ DPRQJ VDPSOHV ZLWKLQ D VLQJOH H[SHULPHQW )XUWKHU GHWDLOV RQ RSWLPL]DWLRQ RI WZRGLPHQVLRQDO JHO V\VWHPV DUH SUHVHQWHG E\ +RFKVWUDVVHUHWDO :KHQ QR WHFKQLFDO VDPSOHUHODWHG RU UH DJHQWUHODWHGSUREOHPVDUHHQFRXQWHUHGWKHILQDO VWDLQHGWZRGLPHQVLRQDOJHOVVKRXOGFRQWDLQQX PHURXVURXQGHGRUVOLJKWO\HOOLSWLFDOVSRWV7\SL FDOO\PRUHWKDQVSRWVFDQEHGHWHFWHGRQD VWDQGDUGפFPJHOZKHQXVLQJDVHQVLWLYH VWDLQLQJSURWRFROVXFKDVVLOYHUVWDLQLQJRUDXWRUD GLRJUDSK\DQGDZKROHFHOOH[WUDFWDVDVDPSOH 6RPHKRUL]RQWDOVWUHDNVIRUPRVWKLJKPROHFX ODUPDVVSURWHLQVSURWHLQVH[FHHGLQJ∼N'D DUHFRPPRQRZLQJWRWKHGHFUHDVHGVROXELOLW\RI ODUJHUSURWHLQVQHDUWKHLULVRHOHFWULFSRLQWVHYHQ LQWKHSUHVHQFHRIXUHDDQGQRQLRQLFGHWHUJHQW +RZHYHUH[FHVVLYHKRUL]RQWDOVPHDULQJRISUR WHLQVVPDOOHUWKDQN'DLQGLFDWHVSRRULVRHOHF WULFIRFXVLQJZKLFKFRXOGEHUHODWHGWRRQHRU PRUHRIWKHIROORZLQJIDFWRUVVDPSOHLPSURSHUO\ VROXELOL]HGRUFRQWDPLQDWHGZLWKLQWHUIHULQJVXE VWDQFHVVXFKDVODUJHQXFOHLFDFLGPROHFXOHVSRRU SXULW\ RI UHDJHQWV FKHFN WKH XUHD ILUVW SRRU TXDOLW\DPSKRO\WHVRULQVXIILFLHQWLVRHOHFWULFIR FXVLQJWRWDOYROWKRXUVWRRORZ,WLVLPSRUWDQW WRQRWHWKDWLQJHQHUDOWKHVROXELOLW\RIDQ\SURWHLQ LVWKHORZHVWQHDULWVLVRHOHFWULFSRLQWEXWWKHUH DUHYDVWGLIIHUHQFHVDPRQJSURWHLQVLQWHUPVRI ERWKWKHPLQLPXPFRQFHQWUDWLRQZKHUHSUHFLSL WDWLRQEHFRPHVDSUREOHPDQGWKHGHJUHHWRZKLFK SUHFLSLWDWLRQFDQEHSUHYHQWHGE\DGGLQJGLIIHUHQW VROXELOL]DWLRQ DJHQWV 7KH EHVW FRQGLWLRQV IRU PDLQWDLQLQJVROXELOLW\GXULQJLVRHOHFWULFIRFXVLQJ IRU D JLYHQ VDPSOH W\SH PXVW EH GHWHUPLQHG HPSLULFDOO\DOWKRXJKWKHPRVWXQLYHUVDOFRQGL WLRQVDUHWKRVHGHVFULEHGLQWKHSURWRFROVLQWKLV XQLW,QFRQWUDVW,()V\VWHPVWKDWGRQRWXVHDQ\ GHWHUJHQWVRUGHQDWXUDQWVDUHOLPLWHGWRWKDWIDLUO\ VPDOOSHUFHQWDJHRISURWHLQVZKLFKPDLQWDLQJRRG VROXELOLW\QHDUWKHLULVRHOHFWULFSRLQW ,I KLJKPROHFXODUZHLJKW SURWHLQV DUH H[ SHFWHGEXWDUHQRWSUHVHQWLQWKHILQDOWZRGLPHQ VLRQDOJHOFKHFNWKHVDPSOHSUHSDUDWLRQSURWRFRO DVZHOODVWKHVDPSOHVWRUDJHFRQGLWLRQV7KHPRVW OLNHO\ SUREOHP LV SURWHRO\VLV GXULQJ VDPSOH SUHSDUDWLRQ 0XOWLSOH IUHH]HWKDZLQJ F\FOHV FRXOGFRQWULEXWHWRWKLVSUREOHP9HUWLFDOVPHDUV RQWKHWZRGLPHQVLRQDOJHOVXJJHVWLQVXIIL FLHQWHTXLOLEUDWLRQRIWKH,()JHOQRWHQRXJK6'6 ERXQGWRWKHSURWHLQVSRRUFRQWDFWEHWZHHQ WKH,()DQGVHFRQGGLPHQVLRQJHOVRUSURE OHPVUHODWHGWRWKHVWDFNLQJJHOWRRVKRUWRUZURQJ EXIIHU8VHRIDVWDFNLQJJHOLVHVSHFLDOO\LPSRU WDQWZKHQODUJHGLDPHWHU,()JHOVDUHORDGHGRQWR VPDOOHUVHFRQGGLPHQVLRQJHOV 2PLVVLRQRI7ULWRQ;RURWKHUQRQLRQLF RU]ZLWWHULRQLFGHWHUJHQWIURPWKHILQDOVDPSOH ORDGHGRQWKHJHOFDQ\LHOGSRRUUHVXOWVHVSHFLDOO\ IRUVDPSOHVFRQWDLQLQJ6'6EHFDXVHWKHDPRXQW RIGHWHUJHQWLQWKH,()JHOVDORQHPD\EHLQVXI ILFLHQWWRUHPRYHERXQG6'6IURPSURWHLQV7KH SUHVHQFHRI7ULWRQ;LQWKHVDPSOHLVHVSH FLDOO\LPSRUWDQWZKHQ6'6VDPSOHEXIIHULVXVHG WRVROXELOL]HSURWHLQVDPSOHVLHDIWHULPPXQR SUHFLSLWDWLRQ7KHDPRXQWRI7ULWRQ;LQWKH O\VLV EXIIHU LV QRUPDOO\ VXIILFLHQW IRU HIIHFWLYH GLVVRFLDWLRQRI6'6IURPSURWHLQV,ISRRUUHVXOWV DUH HQFRXQWHUHGZLWK6'6FRQWDLQLQJVDPSOHV WU\GHFUHDVLQJWKHILQDO6'6FRQFHQWUDWLRQDQGRU LQFUHDVLQJWKHILQDO7ULWRQ;FRQFHQWUDWLRQ LQWKHVDPSOH ,IQRSURWHLQVDUHGHWHFWHGRQWKHJHOFKHFN ZKHWKHUWKHWRWDOSURWHLQORDGLVDSSURSULDWH IRUWKHGHWHFWLRQPHWKRGXVHGWKHRULHQWDWLRQ RI HOHFWULFDO FRQQHFWLRQV LV ZURQJ RU HOHFWULFDO FRQQHFWLRQGXULQJLVRHOHFWULFIRFXVLQJLVSRRUDOO JHOVIURPWKDWUXQZLOOEHEODQNDQDLUEXEEOH REVWUXFWVFXUUHQWLQDVLQJOH,()WXEHRUWKH HOHFWULFDOFRQQHFWLRQLVLQFRUUHFWRULVSRRUGXULQJ WKH VHFRQGGLPHQVLRQ JHO VHSDUDWLRQ &DUHIXO PRQLWRULQJRIFXUUHQWDQGYROWDJHDWWKHEHJLQ QLQJ GXULQJ DQG DW WKH HQG RI HOHFWURSKRUHWLF VHSDUDWLRQVLVVWURQJO\UHFRPPHQGHG5HFRUGLQJ WKHLQLWLDODQGILQDOFXUUHQWDQGYROWDJHZLOODOVR IDFLOLWDWHWURXEOHVKRRWLQJ$GGLWLRQDOJXLGHOLQHV IRU WURXEOHVKRRWLQJ DQG HYDOXDWLQJ DUWLIDFWV LQ WZRGLPHQVLRQDO JHO HOHFWURSKRUHVLV DUH GH VFULEHGE\'XQEDU $QWLFLSDWHG5HVXOWV $WZRGLPHQVLRQDOHOHFWURSKRUHWLFVHSDUDWLRQ RISURWHLQVVKRXOGSURGXFHDSDWWHUQRIURXQGRU HOOLSWLFDOVSRWVVHSDUDWHGIURPRQHDQRWKHU7KH S,UDQJHRIWKHVHSDUDWHGSURWHLQVDVZHOODVWKH REVHUYHGPROHFXODUZHLJKWUDQJHGHSHQGRQWKH ILUVWGLPHQVLRQLVRHOHFWULFIRFXVLQJSURWRFRODQG WKHSHUFHQWDJHRIDFU\ODPLGHXVHGIRUWKHVHFRQG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW GLPHQVLRQJHO$FRPSOH[SURWHLQPL[WXUHVXFK DV D ZKROHFHOO H[WUDFW VKRXOG SURGXFH PRUH WKDQ VLOYHUVWDLQHG VSRWV GLVWULEXWHG RYHU PRVW RI WKH JHO DUHD )HZHU VSRWV ZLOO EH GH WHFWHG ZLWK OHVV VHQVLWLYH GHWHFWLRQ WHFKQLTXHV VXFKDV&RRPDVVLHEOXHVWDLQLQJ2QWKHRWKHU KDQG VHSDUDWLRQ RI UDGLRODEHOHG SURWHLQV DQG XVH RI PXOWLSOH H[SRVXUHV SHUPLW GHWHFWLRQ RI PDQ\ ORZDEXQGDQFH SURWHLQV 7LPH&RQVLGHUDWLRQV 7LPHUHTXLUHPHQWVDUHYHU\GHSHQGHQWRQJHO VL]HDQGZKHWKHUDQH[WHUQDOFRROLQJXQLWLVXVHG WRSHUPLWIDVWHUVHSDUDWLRQV,VRHOHFWULFIRFXVLQJ XVLQJWKHVWDQGDUGVL]HJHOIRUPDWGHVFULEHGLQ %DVLF3URWRFROZLWKPPWXEHVLVPRVWFRQ YHQLHQWO\GRQHLQDQRYHUQLJKWUXQRI∼WR KU7KLVVHSDUDWLRQWLPHFDQEHGHFUHDVHGWR∼WR KUXVLQJKLJKHUYROWDJHVDQGDQH[WHUQDOFRROLQJ GHYLFH,VRHOHFWULFIRFXVLQJRIFPORQJ,3* JHOV UHTXLUHV ∼ WR KU ([WUXGLQJ D VHW RI VL[WHHQ,()WXEHJHOVDQGIUHH]LQJWKHPLQHTXLOL EUDWLRQEXIIHUWDNHVWRKULQFOXGLQJVHWXSWLPH 3UHSDULQJDQGUXQQLQJ6'6JHOVLVGHVFULEHGLQ 81,7 ,WWDNHV∼PLQWRWKDZHTXLOLEUDWH DQGORDGWZRVHFRQGGLPHQVLRQJHOV 2YHUDOOLIVWDQGDUGVL]HJHOVDUHXVHGZLWKRXW H[WHUQDO FRROLQJ LW ZLOO WDNH ∼ ZRUNLQJ GD\V EHIRUHWKHUHVXOWVRIWZRGLPHQVLRQDOHOHFWURSKR UHVLVDUHREWDLQHG$VLQJOHSHUVRQFDQFRQYHQ LHQWO\UXQDERXWWZRGLPHQVLRQDOJHOVLQRQH ZHHNGHSHQGLQJRQWKHDPRXQWRIHOHFWURSKRUH VLVHTXLSPHQWDYDLODEOH7KHUDWHOLPLWLQJVWHSLQ PRVWODERUDWRULHVLVUXQQLQJWKHVHFRQGGLPHQ VLRQJHOVEHFDXVHVROXEOHDPSKRO\WH,()JHOV RU,3*JHOVFDQEHIRFXVHGLQRQHUXQEXW ORDGLQJUXQQLQJDQGGHWHFWLQJUHVXOWVIURPWR VHFRQGGLPHQVLRQ JHOV UHTXLUHV VXEVWDQWLDO RSHUDWRUWLPHDQGHOHFWURSKRUHVLVHTXLSPHQW /LWHUDWXUH&LWHG $QGHUVRQ1*DQG$QGHUVRQ1/D7ZRGL PHQVLRQDODQDO\VLVRIVHUXPDQGWLVVXHSURWHLQV 0XOWLSOH LVRHOHFWULF IRFXVLQJ $QDO %LRFKHP $QGHUVRQ1/DQG$QGHUVRQ1*E7ZRGL PHQVLRQDODQDO\VLVRIVHUXPDQGWLVVXHSURWHLQV 0XOWLSOHJUDGLHQWVODEJHOHOHFWURSKRUHVLV$QDO %LRFKHP WHLQSDWWHUQVDQGWKHLUOLQNWRJHQRPH'1$VH TXHQFHGDWD8VHIXOQHVVRIWZRGLPHQVLRQDOJHO HOHFWURSKRUHVLVDQGPLFURVHTXHQFLQJ)$6(%- 'XQEDU%7URXEOHVKRRWLQJDQGDUWLIDFWVLQ WZRGLPHQVLRQDO SRO\DFU\ODPLGH JHO HOHFWUR SKRUHVLV ,Q 7ZR'LPHQVLRQDO (OHFWURSKRUHVLV DQG ,PPXQRORJLFDO 7HFKQLTXHV %6 'XQEDU HGSS3OHQXP1HZ<RUN *DUUHOV-,7ZRGLPHQVLRQDOJHOHOHFWURSKR UHVLVDQGFRPSXWHUDQDO\VLVRISURWHLQVV\QWKH VL]HG E\ FORQHG FHOO OLQHV - %LRO &KHP *DUUHOV-,7KH48(67V\VWHPIRUTXDQWLWD WLYH DQDO\VLV RI WZRGLPHQVLRQDO JHOV - %LRO &KHP *DUUHOV-,DQG)UDQ]D-U%57KH5() SURWHLQGDWDEDVH0HWKRGVRIGDWDEDVHFRQVWUXF WLRQDQGDQDO\VLVXVLQJWKH48(67V\VWHPDQG FKDUDFWHUL]DWLRQVRISURWHLQSDWWHUQVIURPSUROLI HUDWLQJ DQG TXLHVFHQW 5() FHOOV - %LRO &KHP *RYHUPDQ - DQG /HZLV . 6HSDUDWLRQ RI GLVXOILGHERQGHG SRO\SHSWLGHV XVLQJ WZRGL PHQVLRQDO GLDJRQDO JHO HOHFWURSKRUHVLV 0HWK RGV +RFKVWUDVVHU')+DUULQJWRQ0&+RFKVWUDVVHU $&0LOOHU0-DQG0HUULO&50HWK RGVIRULQFUHDVLQJWKHUHVROXWLRQRIWZRGLPHQ VLRQDO SURWHLQ HOHFWURSKRUHVLV $QDO %LRFKHP 2©)DUUHOO 3+ +LJK UHVROXWLRQ WZRGLPHQ VLRQDOHOHFWURSKRUHVLVRISURWHLQV-%LRO&KHP 6WUDKOHU-5DQG+DQDVK60,PPRELOL]HG S+ JUDGLHQWV $QDO\WLFDO DQG SUHSDUDWLYH XVH 0HWKRGV <RXQJ'$9RULV%30D\WLQ(9DQG&ROEHUW 5$ 9HU\ KLJK UHVROXWLRQ WZRGLPHQ VLRQDOHOHFWURSKRUHWLFVHSDUDWLRQRISURWHLQVRQ JLDQWJHOV0HWKRGV(Q]\PRO .H\5HIHUHQFH +RFKVWUDVVHUHWDO6HHDERYH 'LVFXVVHVPHWKRGVIRULPSURYLQJDQGWURXEOHVKRRW LQJWZRGLPHQVLRQDOVHSDUDWLRQ &RQWULEXWHGE\6DQGUD+DUSHU-DFHN 0R]G]DQRZVNLDQG'DYLG6SHLFKHU 7KH:LVWDU,QVWLWXWH 3KLODGHOSKLD3HQQV\OYDQLD &HOLV-(5DVPXVVHQ++/HIIHUV+0DGVHQ 3 +RQRUH % *HVVHU % 'HMJDDUG . DQG 9DQGHNHUFNKRYH-+XPDQFHOOXODUSUR 7ZR'LPHQVLRQDO *HO (OHFWURSKRUHVLV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 2QH'LPHQVLRQDO(OHFWURSKRUHVLV8VLQJ 1RQGHQDWXULQJ&RQGLWLRQV 81,7 1RQGHQDWXULQJRU¦QDWLYH§HOHFWURSKRUHVLV¥LHHOHFWURSKRUHVLVLQWKHDEVHQFHRIGHQD WXUDQWVVXFKDVGHWHUJHQWVDQGXUHD¥LVDQRIWHQRYHUORRNHGWHFKQLTXHIRUGHWHUPLQLQJ WKHQDWLYHVL]HVXEXQLWVWUXFWXUHDQGRSWLPDOVHSDUDWLRQRIDSURWHLQ%HFDXVHPRELOLW\ GHSHQGVRQWKHVL]HVKDSHDQGLQWULQVLFFKDUJHRIWKHSURWHLQQRQGHQDWXULQJHOHFWURSKR UHVLVSURYLGHVDVHWRIVHSDUDWLRQSDUDPHWHUVGLVWLQFWO\GLIIHUHQWIURPPDLQO\VL]HGHSHQG HQWGHQDWXULQJVRGLXPGRGHF\OVXOIDWH¤SRO\DFU\ODPLGHJHOHOHFWURSKRUHVLV6'63$*( 81,76 DQG FKDUJHGHSHQGHQW LVRHOHFWULF IRFXVLQJ ,() 81,7 7ZRSURWRFROVDUH SUHVHQWHGEHORZ&RQWLQXRXV3$*(VHH%DVLF3URWRFROLVKLJKO\IOH[LEOHSHUPLWWLQJ FDWLRQLFDQGDQLRQLFHOHFWURSKRUHVLVRYHUDIXOOUDQJHRIS+7KHGLVFRQWLQXRXVSURFHGXUH VHH $OWHUQDWH 3URWRFRO LV OLPLWHG WR SURWHLQV QHJDWLYHO\ FKDUJHG DW QHXWUDO S+ EXW SURYLGHVKLJKUHVROXWLRQIRUDFFXUDWHVL]HFDOLEUDWLRQ &217,18286(/(&7523+25(6,6,1121'(1$785,1* 32/<$&5</$0,'(*(/6 %$6,& 35272&2/ 6HSDUDWLRQ RI SURWHLQV E\ QRQGHQDWXULQJ HOHFWURSKRUHVLV UHTXLUHV WKH VDPH W\SH RI HTXLSPHQWXVHGIRUGHQDWXULQJVODEJHOV81,7DQGLVDGDSWDEOHWRDUDQJHRIJHOVL]HV HJIURPפFPPLQLJHOVWRפFPIXOOVL]HJHOVDQGPDWUL[W\SHVHJ VLQJOHFRQFHQWUDWLRQ DQG JUDGLHQW JHOV 7KLV SURWRFRO RXWOLQHV VWUDLJKWIRUZDUG SURFH GXUHVIRUPDNLQJDFU\ODPLGHVROXWLRQVFDVWLQJVHSDUDWLQJJHOVVWDFNLQJJHOVDUHRPLWWHG ORDGLQJVDPSOHVDQGFRQGXFWLQJHOHFWURSKRUHVLV&RQWLQXRXVV\VWHPVDOWKRXJKIOH[LEOH GRQRWJLYHWKHKLJKUHVROXWLRQVHSDUDWLRQIRXQGLQGLVFRQWLQXRXVV\VWHPVVHH$OWHUQDWH 3URWRFRO 6HSDUDWLRQLQDFRQWLQXRXVV\VWHPLHLQZKLFKWKHVDPHEXIIHULVXVHGIRUSUHSDULQJ DFU\ODPLGHVROXWLRQVDQGILOOLQJHOHFWURSKRUHVLVFKDPEHUVLVJRYHUQHGE\S+DQGWKLV SURWRFROGHVFULEHVIRXUW\SHVRIEXIIHUVXVHIXORYHUGLVFUHWHUDQJHVIURPS+WRS+ 8VHRIXQDGMXVWHGDFHWLFDFLGJHOEXIIHUFDQH[WHQGWKHUDQJHWRS+7KHFKRLFH RIS+DQGWKXVWKHEXIIHUV\VWHPGHSHQGVRQWKHSURWHLQEHLQJVWXGLHGLHLWVLVRHOHFWULF SRLQWDQGRIWHQPXVWEHGHWHUPLQHGHPSLULFDOO\,QJHQHUDOWKHV\VWHPVKRXOGEHEHWZHHQ S+DQGIRURSWLPDOUHVXOWV([WUHPHVRIS+FDQOHDGWRSUHFLSLWDWLRQRUGHQDWXUDWLRQ RIWKHSURWHLQ$FU\ODPLGHFRQFHQWUDWLRQVDUHHPSLULFDOO\GHWHUPLQHGEXWWKHKLJKHUWKH SHUFHQWDFU\ODPLGHWKHVKDUSHUWKHSURWHLQEDQGV ,WLVLPSRUWDQWWRLQFOXGHQDWLYHSURWHLQVWDQGDUGVLQWKHHOHFWURSKRUHVLVUXQV6HYHUDO PDQXIDFWXUHUVVXSSO\VWDQGDUGVIRULVRHOHFWULFIRFXVLQJWKDWDUHDOVRVXLWDEOHIRUQDWLYH HOHFWURSKRUHVLV 7KH VWDQGDUGV KDYH D UDQJH RI LVRHOHFWULF SRLQWV DQG ZLOO FDUU\ D QHW SRVLWLYHQHJDWLYHRU]HURFKDUJHGHSHQGLQJRQWKHS+RIWKHJHOV\VWHP$OWHUQDWLYHO\ 6LJPDVXSSOLHVDVWDQGDUGNLWWKDWLVXVHIXOIRUFDOFXODWLQJPROHFXODUZHLJKWVXQGHUQHXWUDO S+ QRQGHQDWXULQJ FRQGLWLRQV 7KH VDPSOHV DQG VWDQGDUG SURWHLQV VKRXOG EH XVHG DW FRQFHQWUDWLRQVRI∼WRµJµO 0DWHULDOV ×DFHWLFDFLGJHOEXIIHUP0DFHWLFDFLGS+WRVHHUHFLSH ×SKRVSKDWHJHOEXIIHUP0VRGLXPSKRVSKDWHS+WRVHHUHFLSH ×7ULVJHOEXIIHUP07ULV⋅&OS+WRVHHUHFLSH ×JO\FLQHJHOEXIIHUP0JO\FLQHS+WRVHHUHFLSH P0VRGLXPVXOILWHJLQPO+2XVHGLQDFHWLFDFLGJHOSUHSDUDWLRQ 3URWHLQVDPSOHVWREHDQDO\]HG &RQWULEXWHGE\6HDQ5*DOODJKHU &XUUHQW3URWRFROVLQ&HOO%LRORJ\ &RS\ULJKWE\-RKQ:LOH\6RQV,QF (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ 6XSSOHPHQW 1DWLYHSURWHLQVWDQGDUGV (OHFWURSKRUHVLVEXIIHUDSSURSULDWH×JHOEXIIHUGLOXWHGWR×ZLWK+2 POVLGHDUPIODVNXVHGLQJHOSUHSDUDWLRQ $GGLWLRQDOUHDJHQWVDQGHTXLSPHQWIRUJHOHOHFWURSKRUHVLV81,7DQGVWDLQLQJ SURWHLQVLQJHOV$33(1',; 3UHSDUHWKHJHO $VVHPEOHWKHJODVVSODWHVDQGZLFKRIWKHJHOHOHFWURSKRUHVLVXQLWDQGVHFXUHLWWRWKH FDVWLQJVWDQG (LWKHUVLQJOHFRQFHQWUDWLRQRUJUDGLHQWJHOVFDQEHXVHGLQWKHPLQLJHORUVWDQGDUGVL]H IRUPDW*UDGLHQWJHOVZLOOHQKDQFHWKHEDQGVKDUSQHVVRIWKHVHSDUDWHGSURWHLQV 3UHSDUHDFU\ODPLGHVROXWLRQVDFFRUGLQJWRWKHUHFLSHVLQ7DEOH7DEOH 7DEOHRU7DEOHDGGLQJWKHDPPRQLXPSHUVXOIDWHDQG7(0('MXVWEHIRUH XVH 'HDHUDWLRQ RI WKH VROXWLRQ EHIRUH WKH SRO\PHUL]DWLRQ FDWDO\VWV DUH DGGHG ZLOO VSHHG SRO\PHUL]DWLRQE\UHPRYLQJLQKLELWRU\R[\JHQEXWWKLVLVQRWJHQHUDOO\UHTXLUHG7KHS+ XVHGGHSHQGVRQPDQ\IDFWRUV7KHPRVWLPSRUWDQWDUHWKHS,YDOXHVRIERWKWKHSURWHLQRI LQWHUHVWDQGDQ\FRQWDPLQDQWVDVZHOODVSURWHLQPRELOLW\DQGSURWHLQVROXELOLW\'HWHU PLQLQJ ZKLFK S+ DQG WKXV ZKLFK EXIIHU V\VWHP WR XVH LV ODUJHO\ HPSLULFDO +RZHYHU H[WUHPHVRIS+<DQG>FDQOHDGWRGHQDWXUDWLRQDQGVKRXOGEHDYRLGHG3ULRU NQRZOHGJHRIWKHS,RIDSURWHLQ81,76DOORZVGHWHUPLQDWLRQRIWKHQHWFKDUJHXQGHU 7DEOH 5HFLSHVIRU$FHWLF$FLG1RQGHQDWXULQJ3RO\DFU\ODPLGH*HOVDS+5DQJH WRE 6WRFNVROXWLRQF DFU\ODPLGH ELVDFU\ODPLGH P0VRGLXPVXOILWHH ×DFHWLFDFLGJHOEXIIHU +2 ZYDPPRQLXP SHUVXOIDWHHI 7(0('I )LQDODFU\ODPLGHFRQFHQWUDWLRQLQJHOG 3UHSDUDWLRQRIJHO ,QDPOVLGHDUPIODVNPL[DFU\ODPLGHELVDFU\ODPLGHVROXWLRQ VHH 7DEOH P0 VRGLXP VXOILWH × DFHWLF DFLG JHO EXIIHU VHH 5HDJHQWVDQG6ROXWLRQVDQG+2,IGHVLUHGWRVSHHGSRO\PHUL]DWLRQGHJDV XQGHUYDFXXP∼PLQ$GGDPPRQLXPSHUVXOIDWHDQG7(0('6ZLUO JHQWO\WRPL[8VHLPPHGLDWHO\ D7KHUHFLSHVSURGXFHPOJHOVROXWLRQZKLFKLVDGHTXDWHIRURQHJHORIGLPHQVLRQVPP×FP×FPRU WZRJHOVRIGLPHQVLRQVPP×FP×FP E7KHS+UDQJHFDQEHH[WHQGHGWR∼WKHS+RIDFHWLFDFLGE\XVLQJXQDGMXVWHGDFHWLFDFLGLQSODFHRI×DFHWLF DFLGJHOEXIIHUDOWKRXJKWKHUHLVOLWWOHEXIIHULQJFDSDFLW\DWWKLVS+ 2QH'LPHQVLRQDO (OHFWURSKRUHVLV 8VLQJ 1RQGHQDWXULQJ &RQGLWLRQV F$OOUHDJHQWVDQGVROXWLRQVXVHGLQWKHSURWRFROPXVWEHSUHSDUHGZLWK0LOOL4SXULILHGZDWHURUHTXLYDOHQW G8QLWVRIQXPEHUVLQWDEOHERG\DUHPLOOLOLWHUV7KHGHVLUHGSHUFHQWDJHRIDFU\ODPLGHLQWKHJHOVROXWLRQGHSHQGV RQWKHPROHFXODUVL]HRIWKHSURWHLQEHLQJVHSDUDWHG H0XVWEHIUHVKO\PDGH6RGLXPVXOILWHLVQHHGHGIRUHIILFLHQWSRO\PHUL]DWLRQDWDFLGS+ I$GGHGMXVWEHIRUHSRO\PHUL]DWLRQ 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7DEOH 5HFLSHVIRU3KRVSKDWH1RQGHQDWXULQJ3RO\DFU\ODPLGH*HOVDS+5DQJHWR 6WRFNVROXWLRQE DFU\ODPLGH ELVDFU\ODPLGH ×SKRVSKDWHJHOEXIIHU +2 ZYDPPRQLXP SHUVXOIDWHGH 7(0('H )LQDODFU\ODPLGHFRQFHQWUDWLRQLQJHOF 3UHSDUDWLRQRIJHO ,QDPOVLGHDUPIODVNPL[DFU\ODPLGHELVDFU\ODPLGHVROXWLRQ VHH7DEOH×SKRVSKDWHJHOEXIIHUVHH5HDJHQWVDQG6ROXWLRQVDQG +2,IGHVLUHGGHJDVXQGHUYDFXXP∼PLQWRVSHHGSRO\PHUL]DWLRQ$GG DPPRQLXPSHUVXOIDWHDQG7(0('6ZLUOJHQWO\WRPL[8VHLPPHGLDWHO\ D7KHUHFLSHVSURGXFHPOJHOVROXWLRQZKLFKLVDGHTXDWHIRURQHJHORIGLPHQVLRQVPP×FP×FPRU WZRJHOVRIGLPHQVLRQVPP×FP×FP E$OOUHDJHQWVDQGVROXWLRQVXVHGLQWKHSURWRFROPXVWEHSUHSDUHGZLWK0LOOL4SXULILHGZDWHURUHTXLYDOHQW F8QLWVRIQXPEHUVLQWDEOHERG\DUHPLOOLOLWHUV7KHGHVLUHGSHUFHQWDJHRIDFU\ODPLGHLQWKHJHOVROXWLRQGHSHQGVRQ WKHPROHFXODUVL]HRIWKHSURWHLQEHLQJVHSDUDWHG G0XVWEHIUHVKO\PDGH H$GGHGMXVWEHIRUHSRO\PHUL]DWLRQ WKHVHSDUDWLRQFRQGLWLRQVLHLIJHOS+<SURWHLQS,WKHSURWHLQZLOOKDYHDQHWSRVLWLYH FKDUJHLIJHOS+>SURWHLQS,WKHSURWHLQZLOOEHQHJDWLYHO\FKDUJHG 3RXUJHOWRFPIURPWKHWRSRIWKHJHOPROGDQGLQVHUWWKHFRPE$YRLGWUDSSLQJDLU EXEEOHVXQGHUWKHFRPEWHHWK $LUEXEEOHVZLOOFDXVHVPDOOVHPLFLUFXODUGHSUHVVLRQVLQWKHZHOODQGOHDGWRGLVWRUWLRQV LQWKHSURWHLQEDQGLQJSDWWHUQ $OORZJHOVROXWLRQWRSRO\PHUL]HWRKU 3RO\PHUL]DWLRQLVLQGLFDWHGE\DVKDUSRSWLFDOGLVFRQWLQXLW\DURXQGWKHZHOOV 3UHSDUHVDPSOHVDQGORDGWKHZHOOV 6ROXELOL]HWKHSURWHLQVDPSOHWREHDQDO\]HGXVLQJZYVXFURVHLQZDWHURUGLOXWH WRP0JHOEXIIHULISRVVLEOH$OVRSUHSDUHQDWLYHSURWHLQVWDQGDUGV 7KHFRQFHQWUDWLRQRISURWHLQZLOOYDU\GHSHQGLQJRQWKHVDPSOHFRPSOH[LW\DQGGHWHFWLRQ PHWKRG)RU&RRPDVVLHEOXHVWDLQLQJRIKLJKO\HQULFKHGVDPSOHVVXFKDVWKHVWDQGDUGV XVHWRPJPOWRµJµO)RUPRUHFRPSOH[PL[WXUHVXVHWRPJPOWR µJµO/RDGWRIROGOHVVIRUVLOYHUVWDLQLQJ,QJHQHUDOVDPSOHVVKRXOGEHORDGHG LQDPLQLPXPYROXPHSUHIHUDEO\WRµOIRUDQGPPWKLFNJHOVUHVSHFWLYHO\ :LWKWKLQJHOVWKLVPHDQVXVLQJDPRUHFRQFHQWUDWHGSURWHLQVDPSOH 5HPRYHFRPEFDUHIXOO\DQGULQVHZHOOVZLWKHOHFWURSKRUHVLVEXIIHUDSSURSULDWH× JHOEXIIHUGLOXWHGWR× 5LQVLQJZLWKHOHFWURSKRUHVLVEXIIHULVQHHGHGWRUHPRYHUHVLGXDOXQSRO\PHUL]HGDFU\ODPLGH PRQRPHUZKLFKZLOOFRQWLQXHWRSRO\PHUL]HDIWHUFRPEUHPRYDOFUHDWLQJXQHYHQZHOOV WKDWPD\LQWHUIHUHZLWKVDPSOHORDGLQJ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 7DEOH 5HFLSHVIRU7ULV1RQGHQDWXULQJ3RO\DFU\ODPLGH*HOVDS+5DQJHWR 6WRFNVROXWLRQE DFU\ODPLGH ELVDFU\ODPLGH ×7ULVJHOEXIIHU +2 ZYDPPRQLXP SHUVXOIDWHGH 7(0('H )LQDODFU\ODPLGHFRQFHQWUDWLRQLQJHOF 3UHSDUDWLRQRIJHO ,QDPOVLGHDUPIODVNPL[DFU\ODPLGHELVDFU\ODPLGHVROXWLRQ VHH7DEOH×7ULVJHOEXIIHUVHH5HDJHQWVDQG6ROXWLRQVDQG+2,I GHVLUHGGHJDVXQGHUYDFXXP∼PLQWRVSHHGSRO\PHUL]DWLRQ$GGDPPR QLXPSHUVXOIDWHDQG7(0('6ZLUOJHQWO\WRPL[8VHLPPHGLDWHO\ D7KHUHFLSHVSURGXFHPOJHOVROXWLRQZKLFKLVDGHTXDWHIRURQHJHORIGLPHQVLRQVPP×FP×FPRU WZRJHOVRIGLPHQVLRQVPP×FP×FP E$OOUHDJHQWVDQGVROXWLRQVXVHGLQWKHSURWRFROPXVWEHSUHSDUHGZLWK0LOOL4SXULILHGZDWHURUHTXLYDOHQW F8QLWVRIQXPEHUVLQWDEOHERG\DUHPLOOLOLWHUV7KHGHVLUHGSHUFHQWDJHRIDFU\ODPLGHLQWKHJHOVROXWLRQGHSHQGVRQ WKHPROHFXODUVL]HRIWKHSURWHLQEHLQJVHSDUDWHG G0XVWEHIUHVKO\PDGH H$GGHGMXVWEHIRUHSRO\PHUL]DWLRQ )LOOZHOOVZLWKHOHFWURSKRUHVLVEXIIHU,IGHVLUHGSUHUXQJHO 7KHJHOFDQEHSUHUXQDWWKLVSRLQWWRUHPRYHDQ\FKDUJHGPDWHULDOVXFKDVDPPRQLXP SHUVXOIDWHIURPWKHJHOSULRUWRORDGLQJWKHVDPSOH$VVHPEOHWKHHOHFWURSKRUHVLVXQLWDQG ILOOWKHEXIIHUFKDPEHUVZLWKHOHFWURSKRUHVLVEXIIHU5XQWKHJHODW9XQWLOWKHFXUUHQW QRORQJHUGURSV7KLVVKRXOGWDNH∼PLQ'LVDVVHPEOHWKHXQLWGLVFDUGWKHEXIIHUDQG SURFHHGWRWKHQH[WVWHS &DUHIXOO\ORDGXSWRµOPPJHOVRUµOPPJHOVVDPSOHSHUODQHDV D WKLQ OD\HU DW WKH ERWWRP RI WKH ZHOOV /RDG FRQWURO ZHOOV ZLWK QDWLYH SURWHLQ VWDQGDUGV $GG DQ HTXDO YROXPH RI HOHFWURSKRUHVLV EXIIHU WR DQ\ HPSW\ ZHOOV WR SUHYHQWVSUHDGLQJRIDGMRLQLQJODQHV 0RELOLW\ 5I PDUNHUV UHTXLUH VSHFLDO FRQVLGHUDWLRQ LQ QRQGHQDWXULQJ JHO V\VWHPV )RU FDWLRQLFV\VWHPVF\WRFKURPHFS,∼WRWRµJODQHZRUNVZHOODVDQ5IPDUNHU %URPSKHQROEOXHµJPOLVDVXLWDEOHPDUNHUIRUDQLRQLFV\VWHPV7KHPDUNHUVKRXOG EHLQFOXGHGLQWKHVROXELOL]DWLRQEXIIHUZLWKWKHVDPSOH 3HUIRUPWKHVHSDUDWLRQ $VVHPEOHWKHJHOXQLWILOOWKHXSSHUDQGORZHUEXIIHUFKDPEHUVZLWKHOHFWURSKRUHVLV EXIIHU DQG FRQQHFW WKH XQLW WR WKH SRZHU VXSSO\ 6HW FXUUHQW WR P$ IRU D PPWKLFNJHOP$IRUDPPWKLFNJHO 2QH'LPHQVLRQDO (OHFWURSKRUHVLV 8VLQJ 1RQGHQDWXULQJ &RQGLWLRQV ,I WKH SURWHLQ LV QHJDWLYHO\ FKDUJHG XQGHU WKH VHSDUDWLRQ FRQGLWLRQV WKHQ WKH VWDQGDUG 6'63$*(HOHFWURGHSRODULW\VKRXOGEHXVHGSURWHLQVZLOOPLJUDWHWRWKHDQRGHRUSRVLWLYH HOHFWURGHVHH81,7,IWKHSURWHLQLVSRVLWLYHO\FKDUJHGWKHQWKHHOHFWURGHVVKRXOGEH UHYHUVHGDWWKHSRZHUVXSSO\LHUHGKLJKYROWDJHFDEOHWRWKHEODFNRXWSXWDQGEODFN KLJKYROWDJH OHDG WR WKH UHG RXWSXW VR WKH SRVLWLYHO\ FKDUJHG SURWHLQ PLJUDWHV WR WKH QHJDWLYHFDWKRGH 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7DEOH 5HFLSHVIRU*O\FLQH1RQGHQDWXULQJ3RO\DFU\ODPLGH*HOVDS+5DQJH WR 6WRFNVROXWLRQE DFU\ODPLGH ELVDFU\ODPLGH ×JO\FLQHJHOEXIIHU +2 ZYDPPRQLXP SHUVXOIDWHGH 7(0('H )LQDODFU\ODPLGHFRQFHQWUDWLRQLQJHOF 3UHSDUDWLRQRIJHO ,QDPOVLGHDUPIODVNPL[DFU\ODPLGHELVDFU\ODPLGHVROXWLRQ VHH7DEOH×JO\FLQHJHOEXIIHUVHH5HDJHQWVDQG6ROXWLRQVDQG+2 ,I GHVLUHG GHJDV XQGHU YDFXXP ∼ PLQ WR VSHHG SRO\PHUL]DWLRQ $GG DPPRQLXPSHUVXOIDWHDQG7(0('6ZLUOJHQWO\WRPL[8VHLPPHGLDWHO\ D7KHUHFLSHVSURGXFHPOJHOVROXWLRQZKLFKLVDGHTXDWHIRURQHJHORIGLPHQVLRQVPP×FP×FPRU WZRJHOVRIGLPHQVLRQVPP×FP×FP E$OOUHDJHQWVDQGVROXWLRQVXVHGLQWKHSURWRFROPXVWEHSUHSDUHGZLWK0LOOL4SXULILHGZDWHURUHTXLYDOHQW F8QLWVRIQXPEHUVLQWDEOHERG\DUHPLOOLOLWHUV7KHGHVLUHGSHUFHQWDJHRIDFU\ODPLGHLQWKHJHOVROXWLRQGHSHQGVRQ WKHPROHFXODUVL]HRIWKHSURWHLQEHLQJVHSDUDWHG G0XVWEHIUHVKO\PDGH H$GGHGMXVWEHIRUHSRO\PHUL]DWLRQ &RQWLQXHHOHFWURSKRUHVLVXQWLOWKH5IPDUNHUUHDFKHVWKHERWWRPRIWKHJHO )RUPLQLJHOVHOHFWURSKRUHVLVZLOOWDNHWRKU6WDQGDUGJHOVUHTXLUHWRKUUXQV 7XUQRIISRZHUVXSSO\GLVDVVHPEOHWKHXQLWDQGUHPRYHJHOIURPVDQGZLFK 6WDLQWKHJHODFFRUGLQJWR$33(1',; 1$7,9(',6&217,18286(/(&7523+25(6,6$1'*(1(5$7,212) 02/(&8/$5:(,*+767$1'$5'&859(6)(5*86213/276 $/7(51$7( 35272&2/ 2QHVWUDLJKWIRUZDUGDSSURDFKWRGLVFRQWLQXRXVQDWLYHHOHFWURSKRUHVLVLVWROHDYHRXWWKH 6'6DQGUHGXFLQJDJHQW'77IURPWKHVWDQGDUG/DHPPOL6'63$*(SURWRFRO81,7 7KHJHOVDUHSUHSDUHGDVGHVFULEHGLQ81,7H[FHSWWKDWWKHVDPSOHEXIIHUFRQWDLQV QR6'6RU'77VDPSOHVDUHQRWKHDWHGDQGWKHJHODQGHOHFWURSKRUHVLVVROXWLRQVDUH SUHSDUHGZLWKRXW6'67KLVSURWRFROLOOXVWUDWHVWKHVHSDUDWLRQRIVWDQGDUGSURWHLQVDWIRXU GLIIHUHQW FRQFHQWUDWLRQV RI DFU\ODPLGH DQG KRZ WKH UHVXOWV DUH XVHG WR FRQVWUXFW D PROHFXODUZHLJKWVWDQGDUGFXUYH)HUJXVRQSORWZLWKRXWWKHQHHGIRU6'6%\SORWWLQJ UHODWLYHPRELOLW\DJDLQVW7SHUFHQWDJHZHLJKWSHUYROXPHRIDFU\ODPLGHSOXVELVDFU\ ODPLGHLQWKHJHOWKHSUHVHQFHRILVRIRUPVDQGPXOWLPHULFSURWHLQVFDQDOVREHGHWHFWHG 0DWHULDOV ×7ULV⋅&OS+07ULV⋅&O$33(1',;$ ×7ULV⋅&OS+07ULV⋅&O 3URWHLQVDPSOHRILQWHUHVW ×7ULVJO\FHUROVDPSOHEXIIHUVHHUHFLSH (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 1DWLYHSURWHLQVWDQGDUGVHJ6LJPDQRQGHQDWXUHGSURWHLQPROHFXODUZHLJKWNLW 7ULVJO\FLQHHOHFWURSKRUHVLVEXIIHUVHHUHFLSH $VVHPEOHWKHJODVVSODWHVDQGZLFKRIWKHJHOHOHFWURSKRUHVLVXQLWDQGSODFHLWLQWKH FDVWLQJVWDQG 3UHSDUHDQGFDVWWKHJHOVXVLQJ×7ULV⋅&OS+IRUWKHVHSDUDWLQJJHODQG× 7ULV⋅&OS+IRUWKHVWDFNLQJJHOLQVWHDGRIWKH6'6FRQWDLQLQJFRXQWHUSDUWV7DEOH 3UHSDUHDPLQLPXPRIIRXUVHSDUDWHJHOVDWGLIIHUHQWDFU\ODPLGHFRQFHQWUD WLRQV $ W\SLFDO UDQJH RI FRQFHQWUDWLRQV LV IURP WR HJ DFU\ODPLGH$VZLWK6'63$*(W\SLFDOJHOWKLFNQHVVUDQJHVIURPWRPP7KH PPWKLFNJHOVDUHUHFRPPHQGHGEHFDXVHWKH\RIIHUDFRPELQDWLRQRIIDVWVWDLQLQJDQG KLJKUHVROXWLRQ 0L[SURWHLQVDPSOHRILQWHUHVWZLWK×7ULVJO\FHUROVDPSOHEXIIHUWRDWWDLQD WRµJµOILQDOFRQFHQWUDWLRQ$OVRSUHSDUHQDWLYHSURWHLQVWDQGDUGV5HPRYHFRPE ULQVHZHOOVDQGORDGWRµOSHUZHOOIRU&RRPDVVLHEULOOLDQWEOXHVWDLQLQJDQG WRµOIRUVLOYHUVWDLQLQJ 6RPHSURWHLQVPXVWEHGLVVROYHGLQP01D&ORUZDWHUWREHFRPHIXOO\VROXELOL]HGSULRU WRPL[LQJZLWKWKHVDPSOHEXIIHU6LJPD $VVHPEOHJHOHOHFWURSKRUHVLVXQLWXVLQJ7ULVJO\FLQHHOHFWURSKRUHVLVEXIIHUWRILOO ERWKORZHUDQGXSSHUEXIIHUFKDPEHUV&RQQHFWSRZHUVXSSO\DQGFRQGXFWHOHFWUR SKRUHVLV &RQGLWLRQVIRUVHSDUDWLRQDUHWKHVDPHDVIRUGLVFRQWLQXRXV6'63$*(LHP$IRU PPWKLFNJHOVP$IRUPPWKLFNJHOV)RUVWDQGDUGVL]HJHOVWKHVHSDUDWLRQ WDNHVWRKUIRUPLQLJHOVWRKULVUHTXLUHG$OWHUQDWLYHO\VWDQGDUGJHOVFDQEHUXQ DWWRP$JHORYHUQLJKW $IWHUWKHEURPSKHQROEOXH5IPDUNHUKDVUHDFKHGWKHERWWRPRIWKHJHOIL[DQGVWDLQ WKHSURWHLQVLQWKHJHOVDFFRUGLQJWR $33(1',;(VWLPDWHUHODWLYHPRELOLWLHVRIWKH SURWHLQV $QH[DPSOHRIDVWDLQHGJHOLVVKRZQLQ)LJXUH$PLQLPXPRIIRXUJHOFRQFHQWUDWLRQV LVUHFRPPHQGHG,Q)LJXUH6LJPDQDWLYHPROHFXODUZHLJKWVWDQGDUGVZHUHVHSDUDWHG RQ DQG DFU\ODPLGH JHOV DQG 7 UHVSHFWLYHO\ 3ORWORJ5IDJDLQVWJHOFRQFHQWUDWLRQ7)LJ'HWHUPLQHWKHVORSHRI.U XVLQJOLQHDUUHJUHVVLRQ 3ORW−ORJ.URIWKHFXUYHVIURPVWHSDJDLQVWORJPROHFXODUZHLJKWRIWKHVWDQGDUGV )LJ'HWHUPLQHWKHVORSHXVLQJOLQHDUUHJUHVVLRQ (VWLPDWHWKHVL]HRIWKHVWDQGDUGVDQGXQNQRZQVIURPWKHJHQHUDWHGFXUYH)HUJXVRQ SORW 8VHWKHFXUYHJHQHUDWHGE\OLQHDUUHJUHVVLRQWRHVWLPDWHWKHSUHGLFWHGVL]HRIWKHVWDQGDUG IRUFRPSDULVRQWRWKHDFWXDOVL]HVWDWHGE\WKHVXSSOLHU7KLVLQGLFDWHVWKHDFFXUDF\RIWKH FXUYH7KH−ORJ.'UYDOXH\RIWKHXQNQRZQLVWKHQXVHGWRSUHGLFWWKHPROHFXODUZHLJKW [ 2QH'LPHQVLRQDO (OHFWURSKRUHVLV 8VLQJ 1RQGHQDWXULQJ &RQGLWLRQV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ )LJXUH 6HSDUDWLRQRIQDWLYH SURWHLQVWDQGDUGVXQGHUQRQGHQDWXULQJ FRQGLWLRQVE\GLVFRQWLQXRXV SRO\DFU\ODPLGHJHOHOHFWURSKRUHVLVDW 7$SSUR[LPDWHO\µJSURWHLQ ZDVORDGHGSHUODQHRQDPPWKLFN FPORQJJHO7KHJHODQGVDPSOHV ZHUHSUHSDUHGDFFRUGLQJWRWKH $OWHUQDWH3URWRFRODQGZHUH HOHFWURSKRUHVHGKUDWP$3URWHLQV ZHUHVWDLQHGZLWK&RRPDVVLHEOXH A B Log Rf 1.0 0.10 4 6 8 10 %T 12 14 4 6 8 10 12 14 %T )LJXUH (IIHFWRI7RQWKHUHODWLYHPRELOLW\RIVHYHUDOQDWLYHSURWHLQV7KHUHODWLYHPRELOLW\ 5IRIWKHVWDQGDUGSURWHLQVVKRZQLQ)LJXUHZDVGHWHUPLQHGDWIRXUGLIIHUHQWJHOFRQFHQWUD WLRQVDQGSORWWHGDVORJ5IDJDLQVW76HHWH[WIRUGHWDLOV$%6$PRQRPHUVTXDUHVDQGGLPHU FLUFOHV%FDUERQLFDQK\GUDVHLVRIRUPV (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 0.3 r 2 = 0.9863 - Log K r 0.2 0.1 0.09 0.08 0.07 0.06 0.05 0.04 0.03 0.02 0.01 14 29 45 66 132 545 Log molecular weight )LJXUH 1DWLYHPROHFXODUZHLJKWVWDQGDUGFXUYH7KH−ORJVORSHRIWKHOLQH.UIURP)LJXUH LVSORWWHGDJDLQVWORJPROHFXODUZHLJKWRIWKHVWDQGDUGV 5($*(176$1'62/87,216 8VH0LOOL4SXULILHGZDWHURUHTXLYDOHQWIRUWKHSUHSDUDWLRQRIDOOEXIIHUV)RUFRPPRQVWRFNVROXWLRQV VHH$33(1',;$IRUVXSSOLHUVVHH6833/,(56$33(1',; $FHWLFDFLGJHOEXIIHU× ×P0DFHWLFDFLGS+WR POJODFLDODFHWLFDFLG $GGWRPO+2 $GMXVWWRS+WRZLWK01D2+ $GG+2WRPO 6WRUHXSWRPRQWKDW°& *O\FLQHJHOEXIIHU× ×P0JO\FLQHS+WR JJO\FLQH $GGWRPO+2 $GMXVWWRS+WRZLWK01D2+ $GG+2WRPO 6WRUHXSWRPRQWKDW°& 2QH'LPHQVLRQDO (OHFWURSKRUHVLV 8VLQJ 1RQGHQDWXULQJ &RQGLWLRQV 3KRVSKDWHJHOEXIIHU× ×P0VRGLXPSKRVSKDWHS+WR J1D+32⋅+2 $GGWRPO+2 $GMXVWWRS+WRZLWK01D2+ $GG+2WRPO 6WRUHXSWRPRQWKDW°& 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7ULVJHOEXIIHU× ×P07ULV⋅⋅&OS+WR J7ULVEDVH $GGWRPO+2 $GMXVWWRS+WRZLWK0+&O $GG+2WRPO 6WRUHXSWRPRQWKDW°& 7ULVJO\FHUROVDPSOHEXIIHU× PO07ULV⋅&OS+$33(1',;$ POJO\FHURO PJEURPSKHQROEOXH $GG+2WRPODQGPL[ 6WRUHLQPODOLTXRWVXSWRPRQWKVDW−°& 7ULVJO\FLQHHOHFWURSKRUHVLVEXIIHU J7ULVEDVH JJO\FLQH +2WRPO 6WRUHXSWRPRQWKDW°& &200(17$5< %DFNJURXQG,QIRUPDWLRQ 8QGHUQRQGHQDWXULQJFRQGLWLRQVLQZKLFK SURWHLQDFWLYLW\QDWLYHFKDUJHDQGFRQIRUPD WLRQ DUH VXVWDLQHG HOHFWURSKRUHWLF VHSDUDWLRQ GHSHQGVRQPDQ\IDFWRUVLQFOXGLQJVL]HVKDSH DQG FKDUJH &KDUDFWHULVWLFV VXFK DV LQWULQVLF PROHFXODUZHLJKWLHLQWKHDEVHQFHRIGHQDWX UDWLRQWKHQXPEHURILVRIRUPVDQGWKHSUHV HQFHRIPXOWLPHULFSURWHLQVFDQEHGHWHUPLQHG ZLWK QRQGHQDWXULQJ HOHFWURSKRUHVLV RIWHQ FDOOHGQDWLYHHOHFWURSKRUHVLV 7KH PRVW LPSRUWDQWDSSOLFDWLRQRIQRQGH QDWXULQJHOHFWURSKRUHVLVLVLQWKHGHWHUPLQDWLRQ RIQDWLYHSURWHLQVL]HVHH$OWHUQDWH3URWRFRO )HUJXVRQSORWVUHYLHZHGE\$QGUHZV ZHUHILUVWGHVFULEHGIRUVWDUFKJHOV)HUJXVRQ DQGWKHQIRUSRO\DFU\ODPLGHJHOV+H GULFN DQG 6PLWK )HUJXVRQ SORWV DUH SUHSDUHGE\VHSDUDWLQJSURWHLQVXQGHUQRQGH QDWXULQJFRQGLWLRQVDWVHYHUDOGLIIHUHQWJHOFRQ FHQWUDWLRQV $V WKH DFU\ODPLGH FRQFHQWUDWLRQ 7LVLQFUHDVHGWKHUHODWLYHPRELOLW\5IRI WKH SURWHLQ GHFUHDVHV 7KLV LV SORWWHG DV ORJ UHODWLYHPRELOLW\RQWKH\D[LVYHUVXV7RQ WKH[D[LVWRSURGXFHDVWUDLJKWOLQH7KHVORSH RI WKLV OLQH LV UHIHUUHG WR DV WKH UHWDUGDWLRQ FRHIILFLHQW.UDQGPHDVXUHVKRZHIIHFWLYHO\ DSURWHLQLVVORZHGE\WKHLQFUHDVHLQ7/DUJH SURWHLQV ZLOO EH UHWDUGHG PXFK PRUH VLJQLIL FDQWO\WKDQVPDOOSURWHLQVZLWKLQFUHDVLQJJHO FRQFHQWUDWLRQZLWKWKHVL]HRIWKHSURWHLQEHLQJ SURSRUWLRQDOWRWKHVORSHRIWKHFXUYH2QFHWKH .USORWVIRUVHYHUDOVL]HVWDQGDUGVDUHJHQHUDWHG )LJWKH .UYDOXHVDUHSORWWHGDJDLQVW WKHPROHFXODUZHLJKWRIWKHVWDQGDUGSURWHLQV XVLQJDORJORJJUDSK)LJ7KHUHWDUGD WLRQFRHIILFLHQWDOVRGHSHQGVRQDODUJHQXPEHU RI RWKHU YDULDEOHV LQFOXGLQJ WHPSHUDWXUH S+ EXIIHU W\SH LRQLF VWUHQJWK DQG & SHUFHQW ELVDFU\ODPLGH FURVVOLQNHU $OO WKHVH IDFWRUV VKRXOGEHNHSWFRQVWDQWIRUDJLYHQH[SHULPHQW ,QDGGLWLRQWRHVWLPDWHGVL]HRWKHUW\SHVRI LQIRUPDWLRQ DUH DYDLODEOH IURP WKH )HUJXVRQ SORWV 5RGEDUG DQG &KUDPEDFK $Q GUHZV)RUH[DPSOHLIWZRFRPSRQHQWV GLIIHULQVL]HEXWKDYHWKHVDPHFKDUJHSHUXQLW VL]HHJIRUDPXOWLPHULFSURWHLQZLWKLGHQWL FDOVXEXQLWVFXUYHVVLPLODUWRWKRVHLOOXVWUDWHG E\%6$PRQRPHUDQGGLPHU)LJ$ZLOO UHVXOW1RWHWKDWZKHQWKHFXUYHLVH[WUDSRODWHG EDFNWR7LWLVHYLGHQWWKDWWKHPRQRPHU DQGWKHGLPHUKDYHVLPLODUIUHHVROXWLRQPRELOL WLHV)XUWKHUPRUHDVWKHDFU\ODPLGHFRQFHQWUD WLRQ LV LQFUHDVHG WKH VHSDUDWLRQ EHWZHHQ WKH WZR DOVR LQFUHDVHV +RZHYHU LI WZR SURWHLQV KDYH VLPLODU VL]HV EXW GLIIHUHQW DPRXQWV RI FKDUJHWKHFXUYHVZLOOEHSDUDOOHORQWKHORJ SORW7KLVLVLOOXVWUDWHGE\WKHFDUERQLFDQK\ GUDVHLVRIRUPV)LJ%,QWKLVH[DPSOH RSWLPDOVHSDUDWLRQRIWKHLVRIRUPVRFFXUVDWWKH ORZHUFRQFHQWUDWLRQVRIDFU\ODPLGHDVWKLVLVD ORJSORW )XUWKHUDSSOLFDWLRQVRIQRQGHQDWXULQJHOHF WURSKRUHVLV LQFOXGH SUHSDUDWLYH SXULILFDWLRQ 7KHS+RIWKHJHOGHWHUPLQHVWKHQHWFKDUJHRQ WKH SURWHLQ %HORZ LWV LVRHOHFWULF SRLQWS,D SURWHLQZLOOKDYHDQHWSRVLWLYHFKDUJHZKHUHDV DERYHLWVS,LWZLOOKDYHDQHWQHJDWLYHFKDUJH (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW ,Q JHQHUDO PRVW SURWHLQV ZLOO EH SRVLWLYHO\ FKDUJHGDWS+WRDERYHS+PRVW SURWHLQVZLOOEHQHJDWLYHO\FKDUJHG$VWKHVH JHQHUDOJXLGHOLQHVLPSO\WKHPDMRULW\RISUR WHLQVKDYHLVRHOHFWULFSRLQWVEHWZHHQS+DQG 7KHUHDUHKRZHYHUPDQ\H[FHSWLRQV$ SURWHLQ ZLWK D KLJKO\ DFLGLF LVRHOHFWULF SRLQW HJ SHSVLQ ZLWK D S, RI ZLOO UHPDLQ QHJDWLYHO\ FKDUJHG DW D S+ GRZQ WR LWV S, $OWKRXJKDIXOOUDQJHRIS+RSWLRQVDUHJLYHQ H[WUHPHV RI S+ < DQG > VKRXOG EH DYRLGHGLISRVVLEOHWRPLQLPL]HGHQDWXUDWLRQ RULQDFWLYDWLRQ%\SLFNLQJDQDSSURSULDWHHOHF WURSKRUHVLVS+LWLVSRVVLEOHWRHQVXUHWKDWWKH SURWHLQRILQWHUHVWZLOOEHHLWKHUSRVLWLYHO\RU QHJDWLYHO\FKDUJHGVRWKDWLWFDQEHVHOHFWLYHO\ UXQLQWRWKHJHOH[FOXGLQJDODUJHSURSRUWLRQ RI FRQWDPLQDQWV WKDWKDYHWKHRSSRVLWHRUQR FKDUJH)XUWKHUPRUHWKHS+FRQGLWLRQVGHWHU PLQHWKHPRELOLW\DQGFDQEHDGMXVWHGWRHQVXUH DGLIIHUHQFHLQPRELOLW\EHWZHHQWKHSURWHLQRI LQWHUHVWDQGFRQWDPLQDQWV &RQWLQXRXVJHOV\VWHPVVHH%DVLF3URWRFRO RIIHUWKHPRVWIOH[LELOLW\LQWHUPVRIVHSDUDWLRQ GHVLJQ7KHS+FDQEHWDLORUHGVRWKDWDJLYHQ SURWHLQKDVDQHWSRVLWLYHQHXWUDORUQHJDWLYH FKDUJH'HSHQGLQJRQWKHSRODULW\RIWKHJHO WKHSURWHLQFDQWKHQEHH[FOXGHGIURPRUHOHF WURSKRUHVHG LQWR WKH JHO 'LVFRQWLQXRXV JHOV KDYHDIL[HGS+DQGJHOSRODULW\)RUWKHQRQ GHQDWXULQJ/DHPPOLJHOSUHVHQWHGLQWKH$OWHU QDWH 3URWRFRO WKH SURWHLQV RI LQWHUHVW VKRXOG KDYHDQLVRHOHFWULFSRLQWRI≤LQRUGHUWREH QHJDWLYHO\FKDUJHGVRWKDWWKH\PRYHLQWRWKH JHO2WKHUPRUHEDVLFDQGPRUHDFLGLFGLVFRQ WLQXRXV JHO V\VWHPV FDQ EH IRXQG LQ +DPHV DQG6FKlJJHU &ULWLFDO3DUDPHWHUV 2QH'LPHQVLRQDO (OHFWURSKRUHVLV 8VLQJ 1RQGHQDWXULQJ &RQGLWLRQV 7KHVXFFHVVRIDJHOVHSDUDWLRQXQGHUQRQ GHQDWXULQJ FRQGLWLRQV GHSHQGV RQ PDQ\ IDF WRUVDQGWZRRIWKHPRVWLPSRUWDQWDUHSURWHLQ VROXELOLW\ DQG LVRHOHFWULF SRLQW 7KH SURWHLQ PXVWEHVROXEOHDWWKHS+DQGWKHLRQLFVWUHQJWK RIWKHJHODQGLWPXVWEHFKDUJHGDWWKDWS+LQ RUGHUWRPRYHLQWRWKHJHO,IWKHSURWHLQH[SH ULHQFHVDS+EHORZLWVLVRHOHFWULFSRLQWWKHQLW ZLOOKDYHDQHWSRVLWLYHFKDUJHDQGZLOOPRYH WRWKHQHJDWLYHHOHFWURGH1RWHWKDWWKLVLVWKH UHYHUVH RI W\SLFDO 6'63$*( ,I WKH SURWHLQ H[SHULHQFHVDS+DERYHLWVLVRHOHFWULFSRLQWLW ZLOOKDYHDQHWQHJDWLYHFKDUJHDQGZLOOPLJUDWH WRWKHSRVLWLYHHOHFWURGH 6ROXELOLW\LVDFRPSOH[LVVXH0HPEUDQHDV VRFLDWHG DQG RWKHU K\GURSKRELF SURWHLQV DUH GLIILFXOWWRVHSDUDWHE\QRQGHQDWXULQJHOHFWUR SKRUHVLV 6FKlJJHU 1RQLRQLF GHWHU JHQWVDWFRQFHQWUDWLRQVXSWRDQGVROXELOL] LQJUHDJHQWVVXFKDVXUHDWR0FDQEHXVHG EXWWKHVHUHDJHQWVHVSHFLDOO\XUHDDUHOLNHO\WR DOWHUWKHSURWHLQ©VFRQIRUPDWLRQDQGPRVWOLNHO\ WKH LVRHOHFWULF SRLQW E\ H[SRVLQJ SUHYLRXVO\ KLGGHQ FKDUJHG JURXSV ,I GHWHUJHQW RU XUHD PXVWEHLQFOXGHGIRUVROXELOL]DWLRQWKHPLQL PXPUHTXLUHGWRVROXELOL]HWKHSURWHLQVKRXOG EHXVHG6FKlJJHUOLVWVVHYHUDOQRQLRQLF GHWHUJHQWVVXLWDEOHIRUVROXELOL]DWLRQ$PRQJ WKH PRUH SRSXODU DUH RFW\OJOXFRVLGH DQG &+$36,QJHQHUDOGHWHUJHQWVVKRXOGEHXVHG QHDUWKHFULWLFDOPLFHOOHFRQFHQWUDWLRQ&0& WRGHSHQGLQJRQWKHGHWHUJHQW 7KHJHOFRQFHQWUDWLRQKDVDGUDPDWLFHIIHFW RQUHVROXWLRQDQGVKRXOGEHRSWLPL]HGLQRUGHU WRDFKLHYHWKHEHVWVHSDUDWLRQDQGEDQGVKDUS QHVV ,Q JHQHUDO LQFUHDVLQJ WKH 7 ZLOO LP SURYHEDQGVKDUSQHVV 7URXEOHVKRRWLQJ *HOSRO\PHUL]DWLRQDWDFLGS+FDQEHSURE OHPDWLFDQGVRGLXPVXOILWHLVQHHGHGIRUHIIL FLHQW SRO\PHUL]DWLRQ $QGUHZV %RWK WKHDPPRQLXPSHUVXOIDWHDQGWKHVRGLXPVXO ILWH PXVW EH IUHVKO\ PDGH DQG WKH KLJKHVW TXDOLW\UHDJHQWVDYDLODEOHVKRXOGEHXVHG)XU WKHUPRUHWKHJHOVROXWLRQVVKRXOGEHDWURRP WHPSHUDWXUHIRUHIIHFWLYHSRO\PHUL]DWLRQ ,IWKHSURWHLQGRHVQRWHQWHUWKHJHODQGQR VWDLQHGPDWHULDOLVSUHVHQWDWWKHZHOOVXUIDFH WU\ UHYHUVLQJ WKH SRODULW\ RI WKH HOHFWURGH ,I PDWHULDOFRQFHQWUDWHVDWWKHWRSRIWKHJHOWU\ ORZHULQJWKHDFU\ODPLGHFRQFHQWUDWLRQ6WDLQHG PDWHULDODWWKHWRSRIWKHJHOPD\DOVRLQGLFDWH SRRU VROXELOL]DWLRQ DQG LQFUHDVLQJ WKH LRQLF VWUHQJWKRIWKHVROXELOL]DWLRQEXIIHURUDGGLQJ DVPDOODPRXQWRIXUHDDQGRUQRQLRQLFGHWHU JHQWPD\EHUHTXLUHG $QWLFLSDWHG5HVXOWV 3URWHLQV ZLOO UHVROYH GHSHQGLQJ RQ WKHLU VROXELOLW\DQGQDWLYHFKDUJHDWWKHFKRVHQS+ ,GHDOO\DGLVWLQFWEDQGUHSUHVHQWLQJWKHSURWHLQ RILQWHUHVWZLOOEHYLVLEOH,IWKHEDQGLVGLIIXVH WKHQLQFUHDVLQJWKHJHOFRQFHQWUDWLRQRUXVLQJ D JUDGLHQW JHO ZLOO LPSURYH UHVROXWLRQ ,IWKH EDQGLVQRWYLVLEOHWKHQWKHSURWHLQPD\EHDW LWVLVRHOHFWULFSRLQWRUPD\KDYHPRYHGRXWRI WKHJHOEHFDXVHLWKDGWKHZURQJFKDUJH&RQ WLQXRXVJHOV\VWHPVDOWKRXJKPRUHYHUVDWLOH ZLOOJLYHORZHUUHVROXWLRQWKDQGLVFRQWLQXRXV JHOV 'HWHUJHQWV RU RWKHU VROXELOL]LQJ DJHQWV VXFKDVXUHDPD\EHQHHGHGWRIXOO\VROXELOL]H DQG UHVROYH WKH SURWHLQ 2QFH WKH FRQGLWLRQV WKDW UHVROYH WKH SURWHLQ DUH GHWHUPLQHG )HU JXVRQ SORWV ZLOO JLYH LQGLFDWLRQV RI PXOWLSOH 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ VXEXQLWVWUXFWXUHQDWLYHVL]HDQGSRWHQWLDOLVR IRUPUHODWLRQVKLSV 7LPH&RQVLGHUDWLRQV 6HSDUDWLRQV ZLOO EH FRPSOHWH ZKHQ WKH WUDFNLQJG\HRUSURWHLQUHDFKHVWKHERWWRPRI WKHJHO)RUPLQLJHOVWKLVJHQHUDOO\WDNHVWR KUXVLQJRUP$IRURUPP WKLFN JHOV UHVSHFWLYHO\ 6WDQGDUGIRUPDW JHOV UHTXLUHWRKUDWRUP$IRURU PPWKLFN JHOV UHVSHFWLYHO\ 6WDQGDUG IRUPDWJHOVFDQDOVRUXQRYHUQLJKWDWWRRU WR P$ IRU RU PPWKLFN JHOV UHVSHFWLYHO\ /LWHUDWXUH&LWHG $QGUHZV$7(OHFWURSKRUHVLV7KHRU\7HFK QLTXHV DQG %LRFKHPLFDO DQG &OLQLFDO $SSOLFD WLRQV QG HG 2[IRUG 8QLYHUVLW\ 3UHVV 1HZ <RUN )HUJXVRQ.$6WDUFKJHOHOHFWURSKRUHVLV¥ DSSOLFDWLRQWRWKHFODVVLILFDWLRQRISLWXLWDU\SUR WHLQVDQGSRO\SHSWLGHV0HWDEROLVP +DPHV'2QHGLPHQVLRQDOSRO\DFU\ODPLGH JHO HOHFWURSKRUHVLV ,Q *HO (OHFWURSKRUHVLV RI 3URWHLQV $ 3UDFWLFDO $SSURDFK QG HG %' +DPHVDQG'5LFNZRRGHGVSS2[ IRUG8QLYHUVLW\3UHVV1HZ<RUN +HGULFN-/DQG6PLWK$-6L]HDQGFKDUJH LVRPHU VHSDUDWLRQ DQG HVWLPDWLRQ RI PROHFXODU ZHLJKWVRISURWHLQVE\GLVFJHOHOHFWURSKRUHVLV $UFK%LRFKHP%LRSK\V 5RGEDUG'DQG&KUDPEDFK$(VWLPDWLRQ RIPROHFXODUUDGLXVIUHHPRELOLW\DQGYDOHQFH XVLQJSRO\DFU\ODPLGHJHOHOHFWURSKRUHVLV$QDO %LRFKHP 6FKlJJHU+1DWLYHJHOHOHFWURSKRUHVLV,Q$ 3UDFWLFDO*XLGHWR0HPEUDQH3URWHLQ3XULILFD WLRQ*9RQ-DJRZDQG+6FKlJJHUHGVSS $FDGHPLF3UHVV6DQ'LHJR 6LJPD 1RQGHQDWXUHG SURWHLQ PROHFXODU ZHLJKWPDUNHUNLW7HFKQLFDO%XOOHWLQ1R0.5 6LJPD&KHPLFDO&RPSDQ\6W/RXLV0R .H\5HIHUHQFH $QGUHZV6HHDERYH &RYHUVDYDULHW\RIHOHFWURSKRUHWLFWHFKQLTXHVLQ FOXGLQJ QRQGHQDWXULQJ HOHFWURSKRUHVLV DQG )HU JXVRQSORWV &RQWULEXWHGE\6HDQ5*DOODJKHU 0RWRUROD&RUSRUDWLRQ%LR&KLS6\VWHPV 7HPSH$UL]RQD (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 6WDLQLQJ3URWHLQVLQ*HOV 81,7 3RO\DFU\ODPLGHJHOHOHFWURSKRUHVLV3$*(LVDSRZHUIXOPHWKRGIRUWKHUHVROXWLRQRI SURWHLQPL[WXUHVDFFRUGLQJWRWKHSURWHLQV©FKDUJHWRPDVVUDWLRQRQGHQDWXULQJ3$*( 81,7PDVV6'63$*(81,7LVRHOHFWULFSRLQWLVRHOHFWULFIRFXVLQJRUFRPELQD WLRQVRIWKHVHSURSHUWLHVWZRGLPHQVLRQDO3$*(81,7$QXPEHURISURWRFROVKDYH EHHQGHYHORSHGWRYLVXDOL]HWKHVHSDUDWHGSURWHLQEDQGVIROORZLQJHOHFWURSKRUHVLV,QWKLV XQLW IRXU GLIIHUHQW PHWKRGV ZKLFK DUH ZLGHO\ XVHG LQ FHOO ELRORJ\ ODERUDWRULHV DUH GHVFULEHG 7KHVH DUH VWDLQLQJ ZLWK WKH G\H &RRPDVVLH EOXH %DVLF 3URWRFRO DQG $OWHUQDWH3URWRFROVLOYHUVWDLQLQJ%DVLF3URWRFROIOXRUHVFHQWVWDLQLQJZLWK6<352 5XE\%DVLF3URWRFRODQGQHJDWLYHVWDLQLQJZLWK]LQF%DVLF3URWRFRO 6WDLQLQJZLWK&RRPDVVLHEOXH%DVLF3URWRFROLVDUHODWLYHO\VLPSOHDQGYHU\SRSXODU PHWKRGDOEHLWOHVVVHQVLWLYHWKDQRWKHUSURFHGXUHV$YDULDWLRQRIWKLVSURWRFROVXLWDEOH IRUVWDLQLQJSURWHLQVLQLVRHOHFWULFIRFXVLQJJHOVLVGHVFULEHGXQGHU$OWHUQDWH3URWRFRO 6WDLQLQJZLWKVLOYHU%DVLF3URWRFROLVSUREDEO\WKHPRVWVHQVLWLYHPHWKRGDOWKRXJK LWLVWLPHFRQVXPLQJDQGLQFRPSDWLEOHZLWKVRPHGRZQVWUHDPDSSOLFDWLRQVVHH&RP PHQWDU\7KHUHPDLQLQJWZRPHWKRGV%DVLF3URWRFROVDQGDUHPRUHVHQVLWLYHWKDW &RRPDVVLHEOXHVWDLQLQJDQGUHFRPPHQGHGIRUGRZQVWUHDPDSSOLFDWLRQVZKHUHSURWHLQ IL[DWLRQQHHGVWREHDYRLGHGHJDQDO\VLVRIELRORJLFDODFWLYLW\6RPHRIWKHSURWRFROV FDQEHFRPELQHG)RULQVWDQFHVRPHUHVHDUFKHUVSUHIHUWRVWDLQJHOVILUVWZLWK&RRPDVVLH EOXH%DVLF3URWRFRORU]LQF%DVLF3URWRFRODQGLIKLJKHUVHQVLWLYLW\LVQHFHVVDU\ VXEVHTXHQWO\ZLWKVLOYHU%DVLF3URWRFRO)XUWKHUGHWDLOVRQWKHGLIIHUHQFHVEHWZHHQ WKHPHWKRGVDVZHOODVJXLGHOLQHVIRUWKHLUVHOHFWLRQDFFRUGLQJWRVSHFLILFDSSOLFDWLRQV DUHGLVFXVVHGLQWKH&RPPHQWDU\ ,QWKHIROORZLQJSURWRFROVWKHYROXPHVRIVROXWLRQVDUHLQGLFDWHGLQ¦JHOYROXPHV§:KHQ VWDLQLQJVODEPLQLJHOVJHOYROFRUUHVSRQGWR∼WRPO 67$,1,1*3527(,1*(/6:,7+&220$66,(%/8( &RRPDVVLHEULOOLDQWEOXH5DWULSKHQ\OPHWKDQHDQLRQLFG\HELQGVDYLGO\WRDOPRVW DOOSURWHLQVLQHLWKHUQDWLYHRUGHQDWXUHGVWDWHVDQGLVZLGHO\XVHGIRUGHWHFWLRQRISURWHLQV LQSRO\DFU\ODPLGHJHOV,QWKLVSURWRFROSURWHLQVVHSDUDWHGE\HLWKHUQRQGHQDWXULQJRU 6'63$*( RQH RU WZRGLPHQVLRQDO DUH IL[HG DQG VWDLQHG E\ VRDNLQJ WKH JHO LQ D &RRPDVVLHEOXHVWDLQLQJVROXWLRQWKHXQERXQGG\HLVVXEVHTXHQWO\UHPRYHGE\ZDVKLQJ ZLWKGHVWDLQLQJVROXWLRQWR\LHOGEOXHSURWHLQEDQGVRQDFOHDUEDFNJURXQG %$6,& 35272&2/ 0DWHULDOV 3RO\DFU\ODPLGHJHOFRQWDLQLQJSURWHLQVRILQWHUHVWVHH81,7 &RRPDVVLHEOXHVWDLQLQJVROXWLRQVHHUHFLSH 'HVWDLQLQJVROXWLRQYYPHWKDQROYYDFHWLFDFLGLQGLVWLOOHGZDWHU VWRUHXSWRPRQWKVDWURRPWHPSHUDWXUH 6WRUDJHVROXWLRQYYDFHWLFDFLGYYPHWKDQROLQGLVWLOOHGZDWHUVWRUH XSWRPRQWKVDWURRPWHPSHUDWXUH 3ODVWLFFRQWDLQHUZLWKOLGSLSHWWLSFRQWDLQHUVDUHDSSURSULDWHIRUVWDLQLQJ PLQLJHOV 3ODWIRUPVKDNHURSWLRQDO &$87,21*ODFLDODFHWLFDFLGDQGPHWKDQRODUHYRODWLOHDQGWR[LF7KHGHVWDLQLQJDQG VWRUDJHVROXWLRQVVKRXOGEHSUHSDUHGLQDFKHPLFDOIXPHKRRGDQGJORYHVVKRXOGEHZRUQ WKURXJKRXWWKHVWDLQLQJSURFHGXUH &RQWULEXWHGE\(VWHEDQ&'HOO©$QJHOLFDDQG-XDQ6%RQLIDFLQR &XUUHQW3URWRFROVLQ&HOO%LRORJ\ &RS\ULJKWE\-RKQ:LOH\6RQV,QF (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ 6XSSOHPHQW 127($OOVWHSVVKRXOGEHSHUIRUPHGDWURRPWHPSHUDWXUH 5HPRYHSRO\DFU\ODPLGHJHOIURPHOHFWURSKRUHVLVDVVHPEO\DQGSODFHLWLQDSODVWLF FRQWDLQHUZLWKOLGFRQWDLQLQJDODUJHH[FHVV∼JHOYRORI&RRPDVVLHEOXHVWDLQLQJ VROXWLRQ ,QFXEDWHZLWKJHQWOHDJLWDWLRQIRU≥PLQIRUDJHO≤PPWKLFNRU≥KUIRUDJHO !PPWKLFN 7KHXVHRIDSODWIRUPVKDNHULVUHFRPPHQGHG0RVWSURWHLQVDUHIL[HGGXHWRWKHSUHVHQFH RIPHWKDQROLQWKHVWDLQLQJVROXWLRQJHOVFDQWKHUHIRUHEHOHIWLQVWDLQLQJVROXWLRQIRUPDQ\ KRXUVLHRYHUQLJKWZLWKRXWDQ\DGYHUVHHIIHFWXQOHVVWKHSURWHLQVRILQWHUHVWLVYHU\ VPDOON'DDQGFDQEHORVWE\GLIIXVLRQGXHWRLQFRPSOHWHIL[DWLRQ 5HPRYHWKH&RRPDVVLHEOXHVWDLQLQJVROXWLRQDQGULQVHWKHJHOEULHIO\ZLWKGLVWLOOHG ZDWHU 7KH&RRPDVVLHEOXHVWDLQLQJVROXWLRQFDQEHUHXVHGVHYHUDOWLPHV $GG∼JHOYRORIGHVWDLQLQJVROXWLRQDQGLQFXEDWHZLWKJHQWOHDJLWDWLRQXQWLOWKH VROXWLRQEHFRPHVDVGDUNDVWKHJHOPDWUL[ 'LVFDUGWKHGHVWDLQLQJVROXWLRQ 5HSHDWVWHSVDQGVHYHUDOWLPHVXQWLODFOHDUEDFNJURXQGLVREWDLQHG %RWKWKHWRWDODPRXQWRIGHVWDLQLQJVROXWLRQDQGWKHGHVWDLQLQJWLPHFDQEHUHGXFHGE\ SODFLQJDSLHFHRIDGVRUEHQWPDWHULDOZLWKDIILQLW\IRUWKH&RRPDVVLHG\HHJ:KDWPDQ 00ILOWHUSDSHULQVLGHWKHFRQWDLQHUKDYLQJWKHJHOLQGHVWDLQLQJVROXWLRQ 127($YRLGH[FHVVLYHLQFXEDWLRQRIWKHJHOZLWKGHVWDLQLQJVROXWLRQDVLWFDQUHVXOWLQ GHFUHDVHGVHQVLWLYLW\GXHWRGLVVRFLDWLRQRISURWHLQG\HFRPSOH[HV $GG∼JHOYROVWRUDJHVROXWLRQDQGLQFXEDWHIRUWRPLQZLWKJHQWOHDJLWDWLRQ $WWKLVSRLQWWKHJHOFDQEHVWRUHGDW°&IRUVHYHUDOPRQWKVLQDSODVWLFFRQWDLQHURUVHDOHG SODVWLFEDJFRQWDLQLQJVWRUDJHVROXWLRQ$OWHUQDWLYHO\LWFDQEHVRDNHGLQYYJO\FHURO IRUWRPLQSODFHGRQWR:KDWPDQ00ILOWHUSDSHUDQGVXEVHTXHQWO\GULHGRQD YDFXXPV\VWHP $/7(51$7( 35272&2/ 67$,1,1*3527(,1*(/6:,7+&220$66,(%/8($)7(5 ,62(/(&75,&)2&86,1* ,QSRO\DFU\ODPLGHJHOLVRHOHFWULFIRFXVLQJSURWHLQVDUHUHVROYHGEDVHGRQWKHLULVRHOHFWULF SRLQWV RQ D S+ JUDGLHQW JHQHUDWHG E\ D PL[WXUH RI DPSKRO\WHV 0DQ\ FRPPHUFLDOO\ DYDLODEOHDPSKRO\WHVELQG&RRPDVVLHEOXHDQGWKHUHIRUHLQWHUIHUHZLWKSURWHLQGHWHFWLRQ 7R RYHUFRPH WKLV SUREOHP WKH IROORZLQJ SURFHGXUH LQYROYHV WUHDWPHQW ZLWK WULFKOR URDFHWLFDFLG7&$WRIL[SURWHLQVZKLOHUHPRYLQJDPSKRO\WHVDQGXVHV&X62LQWKH VWDLQLQJVROXWLRQWRKHOSUHGXFHWKHEDFNJURXQG5LJKHWWLDQG'U\VGDOH $GGLWLRQDO0DWHULDOVVHHDOVR%DVLF3URWRFRO 3RO\DFU\ODPLGHLVRHOHFWULFIRFXVLQJJHOZLWKSURWHLQVRILQWHUHVWHJ81,76 ZY7&$VROXWLRQLQZDWHU ,()&RRPDVVLHEOXHVWRFNVROXWLRQVHHUHFLSH ZY&X62LQGLVWLOOHGZDWHUVWRUHIRUXSWRPRQWKVDWURRPWHPSHUDWXUH 6WDLQLQJ3URWHLQV LQ*HOV &$87,217&$LVH[WUHPHO\FDXVWLF3URWHFWH\HVDQGZHDUJORYHVZKHQSUHSDULQJDQG KDQGOLQJ7&$VROXWLRQV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 0DNHIUHVKVWDLQLQJVROXWLRQE\PL[LQJPORIGHVWDLQLQJVROXWLRQPORI,() &RRPDVVLHEOXHVWRFNVROXWLRQDQGPORIZY&X62LQGLVWLOOHGZDWHU 5HPRYH SRO\DFU\ODPLGH JHO IURP LVRHOHFWULF IRFXVLQJ DVVHPEO\ DQG SODFH LW LQ D SODVWLFFRQWDLQHUZLWKOLGFRQWDLQLQJWRJHOYRORIZY7&$VROXWLRQLQ ZDWHU ,QFXEDWHIRUWRPLQZLWKJHQWOHDJLWDWLRQ 7KHXVHRIDSODWIRUPVKDNHULVUHFRPPHQGHG,QWKLVVWHSSURWHLQVDUHVHOHFWLYHO\IL[HG ZKLOHDPSKRO\WHVDUHUHPRYHGIURPWKHJHO 5HPRYHWKH7&$VROXWLRQDQGDGG∼JHOYROGHVWDLQLQJVROXWLRQ 'RQRWUHXVHWKH7&$VROXWLRQGLVSRVHRILWIROORZLQJDSSOLFDEOHVDIHW\UHJXODWLRQVIRU FKHPLFDOZDVWH,QWKLVVWHSWKH7&$LVUHPRYHGIURPWKHJHO ,QFXEDWHPLQZLWKJHQWOHDJLWDWLRQ 'LVFDUGWKHGHVWDLQLQJVROXWLRQDQGDGGIUHVKO\SUHSDUHGVWDLQLQJVROXWLRQIURPVWHS ,QFXEDWHZLWKJHQWOHDJLWDWLRQIRU≥PLQIRUDJHO≤PPWKLFNRU≥KUIRUDJHO !PPWKLFN 5HPRYHWKHVWDLQLQJVROXWLRQDQGULQVHWKHJHOEULHIO\ZLWKGLVWLOOHGZDWHU 'RQRWUHXVHWKHVWDLQLQJVROXWLRQ 'HVWDLQWKHJHOVHH%DVLF3URWRFROVWHSVWR 67$,1,1*3527(,1*(/6:,7+6,/9(5 6LOYHUVWDLQLQJLVEDVHGRQWKHVHOHFWLYHUHGXFWLRQRIVLOYHULRQVDWVLWHVRIWKHJHOWKDW FRQWDLQSURWHLQVDQGRWKHUPDFURPROHFXOHV7KHIROORZLQJSURWRFROLVDGDSWHGIURPWKDW RI %OXP HW DO DQG LQYROYHV SUHWUHDWPHQW RI D IL[HG SRO\DFU\ODPLGH JHO ZLWK WKLRVXOIDWH VWHS IROORZHG E\ LPSUHJQDWLRQ ZLWK VLOYHU QLWUDWH VWHS DQG FRORU GHYHORSPHQW ZLWK IRUPDOGHK\GH DW D KLJK S+ VWHSV DQG 3UHWUHDWPHQW ZLWK WKLRVXOIDWH VLJQLILFDQWO\ LQFUHDVHV WKH VHQVLWLYLW\ DQG LPSURYHV WKH FRQWUDVW RI SURWHLQ VWDLQLQJ ,Q DGGLWLRQ WKH SUHVHQFH RI ORZ FRQFHQWUDWLRQV RI WKLRVXOIDWH GXULQJ FRORU GHYHORSPHQWUHGXFHVQRQVSHFLILFVWDLQLQJRIWKHJHOVXUIDFH7KHSURFHGXUHLVDSSOLFDEOH IRUERWKQRQGHQDWXULQJ81,7DQG6'63$*(RQHRUWZRGLPHQVLRQDO81,7DQG 81,7DQG\LHOGVGDUNEURZQWREODFNSURWHLQEDQGVRQDFOHDUEDFNJURXQG %$6,& 35272&2/ 0DWHULDOV 3RO\DFU\ODPLGHJHOFRQWDLQLQJSURWHLQVRILQWHUHVWVHH81,76HLWKHU XQIL[HGRUIL[HGDQGVWDLQHGZLWK&RRPDVVLHEOXHVHH%DVLF3URWRFRODQG $OWHUQDWH3URWRFRO 'HLRQL]HGZDWHU+3/&JUDGHRU0LOOL4 YYHWKDQROLQGHLRQL]HGZDWHU )L[DWLYHVROXWLRQVHHUHFLSH 7KLRVXOIDWHVROXWLRQVHHUHFLSH 6LOYHUQLWUDWHVROXWLRQVHHUHFLSH 'HYHORSHUVROXWLRQVHHUHFLSH YYPHWKDQROYYDFHWLFDFLGLQGHLRQL]HGZDWHU YYPHWKDQROLQZDWHU FRQWLQXHG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 3ODVWLFFRQWDLQHUZLWKOLGSLSHWWLSFRQWDLQHUVDUHDSSURSULDWHIRUVWDLQLQJ PLQLJHOV &OHDQSODVWLFFRQWDLQHUVDWOHDVWVL[OLGVRISLSHWWLSFRQWDLQHUVDUHDSSURSULDWHIRU VWDLQLQJPLQLJHOV $OXPLQXPIRLO 3ODWIRUPVKDNHURSWLRQDO &$87,21*ODFLDODFHWLFDFLGDQGPHWKDQRODUHYRODWLOHDQGWR[LFVROXWLRQVFRQWDLQLQJ WKHVHVROYHQWVVKRXOGEHSUHSDUHGLQDFKHPLFDOIXPHKRRGDQGKDQGOHGZLWKFDUH 127($OOVROXWLRQVVKRXOGEHSUHSDUHGLQGHLRQL]HGZDWHU0LOOL4RU+3/&JUDGH$W DOOWLPHVZHDUJORYHVWKDWKDYHEHHQULQVHGH[WHQVLYHO\ZLWKGLVWLOOHGZDWHU+DQGOHWKH JHO E\ XVLQJ FOHDQ IRUFHSV KDYLQJ EOXQW WLSV RU E\ WRXFKLQJ WKH FRUQHUV ZLWK FOHDQ SRZGHUIUHHJORYHV$OOVWHSVVKRXOGEHSHUIRUPHGDWURRPWHPSHUDWXUH )L[WKHJHO 5HPRYHSRO\DFU\ODPLGHJHOIURPHOHFWURSKRUHVLVDVVHPEO\DQGSODFHLWLQDSODVWLF FRQWDLQHUZLWKOLGFRQWDLQLQJDODUJHH[FHVV∼JHOYRORIIL[DWLYHVROXWLRQ 6WHSVDQGDUHIRUXQIL[HGJHOVRQO\,IWKHSRO\DFU\ODPLGHJHOZDVSUHYLRXVO\IL[HGDQGRU VWDLQHGZLWK&RRPDVVLHEOXH%DVLF3URWRFRORU$OWHUQDWLYH3URWRFROSURFHHGGLUHFWO\ WRVWHS ,QFXEDWHIRU≥PLQZLWKJHQWOHDJLWDWLRQ 7KHXVHRIDSODWIRUPVKDNHULVUHFRPPHQGHG 3UHWUHDWWKHJHO 7UDQVIHUWKHJHOWRDFOHDQSODVWLFFRQWDLQHUKDYLQJ∼JHOYRORIHWKDQROLQ GHLRQL]HGZDWHU,QFXEDWHPLQZLWKJHQWOHDJLWDWLRQ 5HSODFHWKHVROXWLRQZLWKDQRWKHU∼JHOYRORIYYHWKDQROLQGHLRQL]HGZDWHU ,QFXEDWHPLQZLWKJHQWOHDJLWDWLRQ5HSHDWWKLVVWHSRQFHWRWDORIWKUHHSUHWUHDW PHQWVWHSV 7KHSODVWLFFRQWDLQHUXVHGLQVWHSVDQGFDQEHUHXVHGLQVWHS'LVFDUGWKHHWKDQRO VROXWLRQDQGULQVHWKHFRQWDLQHUEULHIO\ZLWKGHLRQL]HGZDWHU 7UDQVIHUWKHJHOWRDFOHDQSODVWLFFRQWDLQHUKDYLQJ∼JHOYROGHLRQL]HGZDWHUDQG LQFXEDWHWRPLQZLWKJHQWOHDJLWDWLRQ 'LVFDUGWKHZDWHUDQGDGG∼JHOYROWKLRVXOIDWHVROXWLRQ,QFXEDWHIRUH[DFWO\PLQ ZLWKJHQWOHDJLWDWLRQ ,QFXEDWLRQVORQJHUWKDQPLQZLOOUHVXOWLQLQFUHDVHGEDFNJURXQGVWDLQLQJ 7UDQIHUWKHJHOWRDFOHDQSODVWLFFRQWDLQHUKDYLQJ∼JHOYROGHLRQL]HGZDWHUDQG LQFXEDWHH[DFWO\VHF &KDQJHWKHZDWHULQWKHFRQWDLQHUDQGLQFXEDWHH[DFWO\VHF3HUIRUPWKLVVWHSWZLFH IRUDWRWDORIWKUHH 7KHSODVWLFFRQWDLQHUXVHGLQVWHSVDQGFDQEHUHXVHGLQVWHSVDQGEXWVKRXOG ILUVWEHULQVHGWKRURXJKO\ZLWKGHLRQL]HGZDWHU 6WDLQWKHJHO 7UDQVIHUWKHJHOWRDFOHDQSODVWLFFRQWDLQHUFRQWDLQLQJWRJHOYROVLOYHUQLWUDWH VROXWLRQ&RYHUWKHFRQWDLQHUZLWKDOXPLQXPIRLODQGLQFXEDWHPLQZLWKJHQWOH DJLWDWLRQ 6WDLQLQJ3URWHLQV LQ*HOV /LJKWH[SRVXUHFDXVHVWKHUHGXFWLRQRIVLOYHULRQVDQGPD\WKHUHIRUHUHVXOWLQLQFUHDVHG EDFNJURXQGVWDLQLQJ 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7UDQVIHUWKHJHOWRDFOHDQSODVWLFFRQWDLQHUKDYLQJ∼JHOYROGHLRQL]HGZDWHUDQG LQFXEDWHH[DFWO\VHF &KDQJHWKHZDWHULQWKHFRQWDLQHUDQGLQFXEDWHDJDLQH[DFWO\VHF 7KHSODVWLFFRQWDLQHUXVHGLQVWHSVDQGFDQEHUHXVHGLQVWHSVDQGEXWVKRXOG ILUVWEHULQVHGZLWKGHLRQL]HGZDWHU 'HYHORSWKHJHOVWDLQ 7UDQVIHUWKHJHOWRDFOHDQSODVWLFFRQWDLQHUKDYLQJ∼JHOYROGHYHORSHUVROXWLRQ ,QFXEDWHZLWKJHQWOHDJLWDWLRQXQWLOWKHSURWHLQEDQGVRILQWHUHVWEHFRPHVYLVLEOH RUXQWLOWKHJHOPDWUL[EHJLQVWRJHWWRRGDUN 7KLVVWHSODVWVDIHZPLQXWHV≤PLQDQGUHTXLUHVFRQWLQXRXVYLVXDOLQVSHFWLRQDVWKH SURWHLQEDQGVPD\GHYHORSUDSLGO\DQGORQJLQFXEDWLRQVPD\UHVXOWLQKLJKEDFNJURXQG VWDLQLQJ6LQFHVRPHGHYHORSLQJZLOOVWLOORFFXUGXULQJVWHSVDQGLWLVDGYLVDEOHWR SURFHHGWRWKHQH[WVWHSDVVRRQDVWKHVWDLQLQJLVMXGJHGWREHRSWLPDO 7UDQVIHU WKH JHO WR D FOHDQ SODVWLF FRQWDLQHU KDYLQJ ∼ JHO YRO GHLRQL]HG ZDWHU ,QFXEDWHVHF &KDQJHWKHZDWHULQWKHFRQWDLQHUDQGLQFXEDWHDQDGGLWLRQDOVHF 7UDQVIHUWKHJHOWRDFOHDQSODVWLFFRQWDLQHUKDYLQJ∼JHOYROPHWKDQRO DFHWLFDFLGLQGHLRQL]HGZDWHU,QFXEDWHPLQZLWKJHQWOHDJLWDWLRQ 5HPRYHWKHVROXWLRQIURPWKHFRQWDLQHUDQGDGG∼JHOYRORIPHWKDQRO 7KHJHOFDQEHVWRUHGLQWKLVVROXWLRQIRUVHYHUDOPRQWKVDW°&$OWHUQDWLYHO\WKHJHOFDQ EHUHK\GUDWHGE\VRDNLQJLQZDWHUIRUWRPLQVRDNHGLQYYJO\FHUROIRUDQRWKHU WRPLQSODFHGRQWR:KDWPDQ00ILOWHUSDSHUDQGWKHQGULHGRQDYDFXXPV\VWHP )/825(6&(1&('(7(&7,212)3527(,16,1*(/6 ,QWKLVPHWKRGSURWHLQVVHSDUDWHGRQSRO\DFU\ODPLGHJHOV>HLWKHUQRQGHQDWXULQJ81,7 RU 6'63$*( RQH RU WZRGLPHQVLRQDO 81,7 RU 81,7 @ DUH LQFXEDWHG ZLWK 6<3525XE\DFRPPHUFLDOO\DYDLODEOHIOXRUHVFHQWFRPSRXQGWKDWLQWHUDFWVVSHFLILFDOO\ ZLWK SURWHLQV )ROORZLQJ LQFXEDWLRQ SURWHLQ EDQGV FDQ EH UHDGLO\ YLVXDOL]HG XVLQJ VWDQGDUGQPWUDQVLOOXPLQDWLRQ %$6,& 35272&2/ 0DWHULDOV 3RO\DFU\ODPLGHJHOFRQWDLQLQJSURWHLQVRILQWHUHVWVHH81,781,7RU81,7 6<3525XE\SURWHLQJHOVWDLQ0ROHFXODU3UREHV 'LVWLOOHGZDWHU 3ODVWLFFRQWDLQHUZLWKOLGSLSHWWLSFRQWDLQHUVDUHDSSURSULDWHIRUVWDLQLQJ PLQLJHOV 3ODWIRUPVKDNHURSWLRQDO QP89WUDQVLOOXPLQDWRU 3KRWRJUDSKLFFDPHUDRU&&'FDPHUDRSWLRQDO &$87,217KHSRWHQWLDOWR[LFLW\RIWKH6<3525XE\G\HZKLFKFRPSULVHVDQRUJDQLF FRPSRQHQWDQGUXWKHQLXPKDVQRWEHHQIXOO\HYDOXDWHG*ORYHVVKRXOGEHZRUQWKURXJK RXW WKH VWDLQLQJ SURFHGXUH )RU GLVSRVDO WKH VWDLQ VROXWLRQ VKRXOG EH SRXUHG WKURXJK DFWLYDWHGFKDUFRDODQGWKHG\HDGVRUEHGWRDFWLYDWHGFKDUFRDOGHVWUR\HGLQDFKHPLFDO LQFLQHUDWRUIROORZLQJORFDOHQYLURQPHQWDOUHJXODWLRQV 127(3URWHFW6<3525XE\SURWHLQJHOVWDLQIURPOLJKW,IWKHSODVWLFFRQWDLQHUZLWKOLG XVHGIRUVWDLQLQJLVWUDQVSDUHQWFRYHULWFRPSOHWHO\ZLWKDOXPLQXPIRLO (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 127($OOVWHSVVKRXOGEHSHUIRUPHGDWURRPWHPSHUDWXUH 5HPRYHSRO\DFU\ODPLGHJHOIURPHOHFWURSKRUHVLVDVVHPEO\DQGSODFHLWLQDSODVWLF FRQWDLQHUZLWKOLGFRQWDLQLQJDODUJHH[FHVV∼JHOYRORI6<3525XE\SURWHLQ JHOVWDLQ ,QFXEDWHKUZLWKJHQWOHDJLWDWLRQ 7KHXVHRIDSODWIRUPVKDNHULVUHFRPPHQGHG 5HPRYHWKH6<3525XE\SURWHLQJHOVWDLQDQGULQVHWKHJHOEULHIO\ZLWKGLVWLOOHG ZDWHU 'RQRWUHXVHWKHVWDLQVROXWLRQ)ROORZORFDOUHFRPPHQGDWLRQVIRUWKHGLVSRVDORISRWHQ WLDOO\WR[LFRUJDQLFFRPSRXQGV $GG∼JHOYROGLVWLOOHGZDWHUDQGLQFXEDWHPLQZLWKJHQWOHDJLWDWLRQ &KDQJHWKHGLVWLOOHGZDWHULQWKHFRQWDLQHUDQGLQFXEDWHDQRWKHUPLQZLWKJHQWOH DJLWDWLRQ 9LVXDOL]HSURWHLQEDQGVE\IOXRUHVFHQFHRQDQP89WUDQVLOOXPLQDWLRQXQLW ,PDJHVFDQEHDFTXLUHGXVLQJDSKRWRJUDSKLFFDPHUDZLWKDSSURSULDWHILOPHJ3RODURLG EODFNDQGZKLWHSULQWILOPRUD&&'FDPHUD &$87,218VH89UDWHGH\HSURWHFWLRQWRDYRLGGLUHFWH[SRVXUHRIWKHH\HVWRWKH89 OLJKW $W WKLV SRLQW WKH JHO LV UHDG\ IRU GRZQVWUHDP DSSOLFDWLRQV HJ HOHFWURHOXWLRQ DQG LPPXQREORWWLQJ %$6,& 35272&2/ 5(9(56,%/(3527(,167$,1,1*:,7+=,1& ,QWKLVPHWKRGSURWHLQEDQGVVHSDUDWHGRQ6'63$*(JHOV>RQHRUWZRGLPHQVLRQDO 81,7RU81,[email protected]]HGDVFOHDUVSRWVRQDQRSDTXHZKLWHEDFNJURXQGWKHODWWHU EHLQJJHQHUDWHGE\SUHFLSLWDWLRQRI6'6ZLWK]LQFLRQV7KLVQHJDWLYHVWDLQLQJSURFHGXUH LVVHQVLWLYHIDVWDQGFRPSOHWHO\UHYHUVLEOHXSRQUHPRYDORI]LQFZLWKDFKHODWLQJDJHQW 0DWHULDOV 3RO\DFU\ODPLGHJHOFRQWDLQLQJSURWHLQVRILQWHUHVWVHH81,7 *HO&RGH(=LQF5HYHUVLEOH6WDLQ.LW3LHUFHFRQWDLQLQJ (=LQF6WDLQ (=LQF'HYHORSHU (=LQF(UDVHU 'LVWLOOHGZDWHU 3ODVWLFFRQWDLQHUZLWKOLGSLSHWWLSFRQWDLQHUVDUHDSSURSULDWHIRUVWDLQLQJ PLQLJHOV 3ODWIRUPVKDNHURSWLRQDO 127($OOVWHSVVKRXOGEHSHUIRUPHGDWURRPWHPSHUDWXUH 6WDLQWKHJHO 5HPRYHSRO\DFU\ODPLGHJHOIURPHOHFWURSKRUHVLVDVVHPEO\DQGSODFHLWLQDSODVWLF FRQWDLQHUZLWKOLGFRQWDLQLQJ∼JHOYRO(=LQF6WDLQVROXWLRQ ,QFXEDWHPLQZLWKJHQWOHDJLWDWLRQ 6WDLQLQJ3URWHLQV LQ*HOV 7KHXVHRIDSODWIRUPVKDNHULVUHFRPPHQGHG 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 5HPRYHWKH(=LQF6WDLQVROXWLRQIURPWKHFRQWDLQHUDQGUHSODFHLWZLWK∼JHOYRO (=LQF'HYHORSHUVROXWLRQ 'RQRWUHXVHWKHVWDLQVROXWLRQ ,QFXEDWHWRPLQZLWKJHQWOHDJLWDWLRQ3URFHHGWRWKHQH[WVWHSDVVRRQDVWKH VWDLQLQJLVMXGJHGWREHRSWLPDO 5HPRYHWKH(=LQF'HYHORSHUVROXWLRQIURPWKHFRQWDLQHUDQGUHSODFHLWZLWK∼ JHOYROGLVWLOOHGZDWHU 'RQRWUHXVHWKHGHYHORSHUVROXWLRQ :DVKWKHJHO ,QFXEDWHPLQZLWKJHQWOHDJLWDWLRQ &KDQJHWKHZDWHULQWKHFRQWDLQHU 9LVXDOL]HWKHSURWHLQEDQGVE\SODFLQJWKHSRO\DFU\ODPLGHJHORQDGDUNEODFNRU EOXHVXUIDFH 7KHVWDLQHGJHOFDQEHNHSWLQZDWHUIRUVHYHUDOZHHNVDW°& 6ROXELOL]HWKH6'6]LQFSUHFLSLWDWHRSWLRQDO ,QFXEDWHWKHJHOZLWK∼JHOYRO(=LQF(UDVHUZLWKJHQWOHDJLWDWLRQXQWLOWKHJHO PDWUL[LVFRPSOHWHO\FOHDU∼WRPLQ 7KHVHWZRVWHSVLQYROYHVROXELOL]DWLRQRIWKH6'6]LQFSUHFLSLWDWHWRFRPSOHWHO\GHVWDLQWKH JHOWKXVDOORZLQJIXUWKHUDQDO\VLVRIWKHSURWHLQEDQGVRILQWHUHVW 5LQVHWKHJHOZLWKGLVWLOOHGZDWHU $W WKLV SRLQW WKH JHO LV UHDG\ IRU GRZQVWUHDP DSSOLFDWLRQV HJ HOHFWURHOXWLRQ LP PXQREORWWLQJHWF 5($*(176$1'62/87,216 8VH+3/&JUDGHRU0LOOL4SXULILHGZDWHURUHTXLYDOHQWLQDOOUHFLSHVDQGSURWRFROVWHSV)RUFRPPRQ VWRFNVROXWLRQVVHH$33(1',;$IRUVXSSOLHUVVHH6833/,(56$33(1',; &RRPDVVLHEOXHVWDLQLQJVROXWLRQ )RUPO'LVVROYHJ&RRPDVVLHEULOOLDQWEOXH5LQDPL[WXUHRIPO PHWKDQRODQGPOZDWHU6XEVHTXHQWO\DGGPORIZDWHUDQGPORIJODFLDO DFHWLFDFLG6WRUHIRUXSWRPRQWKVDWURRPWHPSHUDWXUH &$87,21*ODFLDODFHWLFDFLGDQGPHWKDQRODUHYRODWLOHDQGWR[LFDQGVKRXOGEHKDQGOHG LQDFKHPLFDOIXPHKRRG 7KLVVROXWLRQLVZY&RRPDVVLHEULOOLDQWEOXH5LQPHWKDQRODFHWLFDFLGZDWHU YYY 'HYHORSHUVROXWLRQ 'LVVROYHJ1D&2LQPOZDWHU$GGµORIIRUPDOGHK\GHDQGPORI WKLRVXOIDWHVROXWLRQVHHUHFLSH3UHSDUHIUHVKEHIRUHXVH &$87,21)RUPDOGHK\GHLVWR[LFDQGFDUFLQRJHQLF:HDUJORYHVDQGKDQGOHWKHFRQFHQ WUDWHGVROXWLRQLQDFKHPLFDOKRRG )L[DWLYHVROXWLRQ 0L[PORIPHWKDQROZLWKPOJODFLDODFHWLFDFLGDQGDGGZDWHUWRPO$GG µORIIRUPDOGHK\GH3UHSDUHIUHVKEHIRUHXVH &$87,21*ODFLDODFHWLFDFLGDQGPHWKDQRODUHYRODWLOHDQGWR[LF)RUPDOGHK\GHLVWR[LF DQGFDUFLQRJHQLF:HDUJORYHVDQGSUHSDUHWKHVROXWLRQLQDFKHPLFDOIXPHKRRG (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW ,()&RRPDVVLHEOXHVWRFNVROXWLRQ 'LVVROYHZY&RRPDVVLHEULOOLDQWEOXH5DQGYYPHWKDQROLQ ZDWHU6WRUHIRUXSWRPRQWKVDWURRPWHPSHUDWXUH 6LOYHUQLWUDWHVROXWLRQ 'LVVROYHJ$J12LQPOZDWHU$GGµORIIRUPDOGHK\GH3URWHFW WKHVROXWLRQIURPOLJKW3UHSDUHIUHVKEHIRUHXVH &$87,21)RUPDOGHK\GHLVWR[LFDQGFDUFLQRJHQLF:HDUJORYHVDQGKDQGOHWKHFRQFHQ WUDWHGVROXWLRQLQDFKHPLFDOIXPHKRRG 'LVFDUGWKHVROXWLRQLILWEHFRPHVFORXG\ 7KLRVXOIDWHVROXWLRQ 'LVVROYHPJ1D62⋅+2LQPOZDWHU3UHSDUHIUHVKEHIRUHXVH &200(17$5< %DFNJURXQG,QIRUPDWLRQ 6WDLQLQJ3URWHLQV LQ*HOV 7KHILUVWSURWRFROVGHYHORSHGIRUWKHYLVX DOL]DWLRQRISURWHLQVEDQGVDIWHUHOHFWURSKRUH VLV LQ SRO\DFU\ODPLGH RU RWKHU JHO PDWULFHV UHOLHGRQWKHXVHRIG\HVZLWKVHOHFWLYHDYLGLW\ IRU SRO\SHSWLGHV $PRQJ WKHVH G\HV ZKLFK LQFOXGHGDPLGREODFN%DQGIDVWJUHHQ)&) WKH&RRPDVVLHEOXHG\HVJDYHKLJKHUVHQVLWLY LW\:LOVRQDQGEHFDPHURXWLQHO\XVHG $ ODUJH QXPEHU RI VWDLQLQJ SURWRFROV XVLQJ &RRPDVVLHEULOOLDQWEOXH5DVDG\HKDYH EHHQSXEOLVKHGVHH1HXKRIIHWDODQG UHIHUHQFHVWKHUHLQ7KHSURWRFROGHVFULEHGLQ WKLVXQLW%DVLF3URWRFROLQYROYHVVLPXOWD QHRXVSURWHLQIL[DWLRQDQGVWDLQLQJLQDVROX WLRQ FRQWDLQLQJ WKH G\H LQ PHWKDQRODFHWLF DFLGZDWHU IROORZHG E\ UHPRYDO RI WKH XQ ERXQG G\H E\ ZDVKLQJ ZLWK PHWKDQRODFHWLF DFLGZDWHU 7KLV LV WKH PRVW FRPPRQO\ XVHG SURWRFROIRUSURWHLQVWDLQLQJLQJHOV3URSRVHG YDULDWLRQVWRWKLVSURFHGXUHLQFOXGHXVLQJQR PHWKDQROWRUHWDLQVPDOOSRO\SHSWLGHV6FKlJ JHUDQGYRQ-DJRZGHFUHDVLQJWKHFRQ FHQWUDWLRQVRIERWKPHWKDQRODQGDFHWLFDFLGWR OLPLWSURWHLQIL[DWLRQ5RVHQIHOGHWDO DQGXVLQJLRQSDLULQJDJHQWVWRUHGXFHEDFN JURXQG&KRLHWDO3URWRFROVXVLQJD FROORLGDOIRUPRI&RRPDVVLHEULOOLDQWEOXH* ZKLFK ULYDO LQ VHQVLWLYLW\ WKRVH XVLQJ &RRPDVVLHEULOOLDQWEOXH5KDYHDOVREHHQ GHVFULEHG VHH IRU H[DPSOH 1HXKRII HW DO 'H6LOYD $ GUDPDWLF LQFUHDVH LQ VHQVLWLYLW\ ZDV DFKLHYHGZLWKWKHLQWURGXFWLRQRISURWHLQVWDLQ LQJPHWKRGVEDVHGRQWKHVHOHFWLYHUHGXFWLRQRI VLOYHU LRQV WR IRUP PHWDOOLF VLOYHU LPDJHV 6ZLW]HUHWDO7KHPHWKRGUHOLHVRQWKH DXWRFDWDO\WLF UHGXFWLRQ RI VLOYHU D NH\ SKH QRPHQRQRIWKHSKRWRJUDSKLFSURFHVVDQGGLI IHUHQFHVLQUHGXFWLRQSRWHQWLDORIVLOYHUDWWKH VLWHV RFFXSLHG E\ PDFURPROHFXOHVUHODWLYHWR WKDWDWWKHUHVWRIWKHJHOPDWUL[7KHGLIIHUHQFHV LQUHGXFWLRQSRWHQWLDOVFDQEHPDQLSXODWHGWR REWDLQ HLWKHU D SRVLWLYH RU QHJDWLYH LPDJH RI SURWHLQEDQGV3RVLWLYHVLOYHUVWDLQLQJSURWRFROV FRPSULVHWKHIROORZLQJVWDJHVIL[DWLRQRI SURWHLQV DQG HOLPLQDWLRQ RI LQWHUIHULQJ VXE VWDQFHVHJDPLQRDFLGV7ULV6'6VHQ VLWL]DWLRQZLWKDQDJHQWWRLQFUHDVHVHQVLWLYLW\ DQGRU FRQWUDVW LPSUHJQDWLRQ ZLWK VLOYHU VROXWLRQVLOYHUQLWUDWHEDVLFVLOYHUDPPRQLDRU VLOYHUGLDPLQHFRPSOH[FRQWUROOHGULQVHWR UHPRYHVLOYHULRQVQRWDVVRFLDWHGZLWKSURWHLQV LPDJHGHYHORSPHQWDQGLPDJHGHYHO RSPHQWVWRSSLQJUHYLHZHGE\5DELOORXGHWDO 7KHSURFHGXUHGHVFULEHGLQ%DVLF3UR WRFRO%OXPHWDOLQYROYHVVHQVLWL]D WLRQZLWKWKLRVXOIDWHLPSUHJQDWLRQZLWKVLOYHU QLWUDWHDQGLPDJHGHYHORSPHQWXVLQJDGLOXWH IRUPDOGHK\GH VROXWLRQ DW KLJK S+ 6PDOO DPRXQWVRIWKLRVXOIDWHLQFOXGHGLQWKHGHYHO RSHUVROXWLRQKHOSWRNHHSWKHEDFNJURXQGORZ E\FRPSOH[LQJVLOYHULRQVWKDWRWKHUZLVHFRXOG IRUPVSXULRXVVLOYHUGHSRVLWVLQWKHJHOPDWUL[ 7KLVSURFHGXUHLVKLJKO\VHQVLWLYHDQGFRPSDW LEOHZLWKYLUWXDOO\DOOW\SHVRI3$*(V\VWHPV 8QOLNH RWKHU VLOYHU VWDLQLQJ SURWRFROV ZKLFK \LHOGDPL[WXUHRISRVLWLYHDQGQHJDWLYHEDQGV RU GLIIHUHQW EDQG FRORUV WKH LPDJHV RI WKH SURWHLQEDQGVDUHUDWKHUXQLIRUP$GUDZEDFN RIWKLVDQGRWKHUVLOYHUVWDLQLQJPHWKRGVLVWKDW WKH\ FDQ DOVR VWDLQ RWKHU PDFURPROHFXOHV QDPHO\'1$51$DQGEDFWHULDOOLSRSRO\VDF FKDULGHV 3URFHGXUHV IRU WKH IOXRUHVFHQW VWDLQLQJ RI SURWHLQVLQSRO\DFU\ODPLGHJHOVLQFOXGHFRYD OHQWPRGLILFDWLRQZLWKIOXRUHVFDPLQHRUIOXR UHVFHLQLVRWKLRF\DQDWHDQGQRQFRYDOHQWVWDLQ LQJ ZLWK WKH K\GURSKRELF SUREHV DQLOL QRQDSKWKDOHQHVXOIRQLFDFLGRUQLOHUHGVHH 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6WHLQEHUJHWDODQGUHIHUHQFHVWKHUHLQ $IDPLO\RIIOXRUHVFHQWSURWHLQVWDLQUHDJHQWV LQFOXGLQJ 6<3522UDQJH6<3525HGDQG 6<352 5XE\ KDV UHFHQWO\ EHHQ LQWURGXFHG DQGUHSRUWHGWREHKLJKO\VHQVLWLYHDQGSURWHLQ VSHFLILF6WHLQEHUJHWDO7KHVHUHDJHQWV GHWHFWSURWHLQ6'6FRPSOH[HVUDWKHUWKDQSUR WHLQIXQFWLRQDOJURXSVDQGDUHFRPSDWLEOHZLWK PRVW GRZQVWUHDP DSSOLFDWLRQV .QRZQ LQWHU IHUHQFHVDUHFRORUHGVWDLQVRUSURVWKHWLFJURXSV 7ULWRQ ; DQG WKH H[FHVV RI 6'6 DW WKH PLJUDWLRQIURQW$VLPSOHSURWRFROIRUSURWHLQ VWDLQLQJZLWK6<3525XE\ZKLFKLVFRPPHU FLDOO\DYDLODEOHDQGVDLGWREHWKHPRVWVHQVLWLYH G\HZLWKLQWKH6<352IDPLO\LVGHVFULEHGLQ %DVLF3URWRFRO $GLIIHUHQWJURXSRISURWHLQVWDLQLQJPHWK RGVIRU6'63$*(DUHEDVHGRQWKHUHYHUVLEOH IRUPDWLRQ RI 6'6 SUHFLSLWDWHV WKXV DOORZLQJ YLVXDOL]DWLRQRISURWHLQEDQGVDVFOHDUDUHDVRQ DQRSDTXHEDFNJURXQG$OWKRXJK6'6SUHFLSL WDWLRQFDQEHVLPSO\DFKLHYHGE\ORZHULQJWKH WHPSHUDWXUHRIWKHJHOWR°WR°&IRUDIHZ KRXUV IDVWHU DQG PRUH VHQVLWLYH PHWKRGV LQ YROYH WKH IRUPDWLRQ RI LQVROXEOH FRPSOH[HV ZLWKKHDY\PHWDOVDOWVVXFKDVFRSSHU*DUILQ RU]LQF)HUQiQGH]3DWURQHWDOD $SURWRFROIRUUDSLGUHYHUVLEOHVWDLQLQJZLWK ]LQFLVGHVFULEHGLQ%DVLF3URWRFRO7KHSUR WRFROXVHVDNLWWKDWLVFRPPHUFLDOO\DYDLODEOH DWDUHDVRQDEOHSULFH,IFRVWLVDPDMRULVVXH KRZHYHUWKHUHDGHULVUHIHUUHGWRWKHSURWRFRO GHVFULEHGE\)HUQiQGH]3DWURQHWDOD $GGLWLRQDOVWDLQLQJPHWKRGVQRWGLVFXVVHG LQ WKLV XQLW LQFOXGH UDGLRODEHOLQJ ZLWK >[email protected]:DOODFHDQG 6DOX]FRPELQHG&RRPDVVLHEOXH]LQF VWDLQLQJ)HUQiQGH]3DWURQHWDOEDQG PL[HG(YDQVEOXHUKRGDPLQH%VWDLQLQJ1DHW DO &ULWLFDO3DUDPHWHUV &RPSDULVRQRIVWDLQLQJSURFHGXUHV 1RQHRIWKHVWDLQLQJPHWKRGVLVRSWLPDOIRU DOOW\SHVRIDSSOLFDWLRQV7KHFKRLFHRIWKHPRVW DSSURSULDWHPHWKRGIRUDSDUWLFXODUH[SHULPHQW ZLOO GHSHQG RQ D QXPEHU RI FRQVLGHUDWLRQV LQFOXGLQJ VHQVLWLYLW\ VLPSOLFLW\ GXUDWLRQ ORQJWHUP GRFXPHQWDWLRQ TXDQWLWDWLRQ DQG GRZQVWUHDPDSSOLFDWLRQV7KHIROORZLQJJXLGH OLQHVDUHUHVWULFWHGWRWKHSURFHGXUHVGHVFULEHG LQ WKLVXQLWQDPHO\VWDLQLQJZLWK&RRPDVVLH EOXH%DVLF3URWRFRODQG$OWHUQDWH3URWRFRO VLOYHU %DVLF 3URWRFRO 6<352 5XE\ %DVLF3URWRFRODQG]LQF%DVLF3URWRFRO 6HQVLWLYLW\ )LJXUH VKRZV D FRPSDUDWLYH H[SHUL PHQWLQZKLFKVHULDOGLOXWLRQVRISURWHLQVWDQG DUGV ZHUH UXQ RQ 6'63$*( 81,7 DQG VXEVHTXHQWO\VWDLQHGIROORZLQJWKHIRXU%DVLF 3URWRFROVGHVFULEHGLQWKLVXQLW$PRQJWKHIRXU PHWKRGV VLOYHU )LJ % DQG &RRPDVVLH EOXHVWDLQLQJ)LJ$JDYHWKHKLJKHVWDQG ORZHVWVHQVLWLYLW\UHVSHFWLYHO\7KHGHWHFWLRQ OLPLWRIIOXRUHVFHQWVWDLQLQJZLWK6<3525XE\ FRXOG EH JUHDWO\ HQKDQFHG E\ WKH LQWHJUDWLRQ HIIHFWRID&&'RUSKRWRJUDSKLFFDPHUD7KXV ZKLOHE\GLUHFWREVHUYDWLRQRQD89WUDQVLOOX PLQDWLRQXQLW6<3525XE\VWDLQLQJZDVVLJ QLILFDQWO\ OHVV VHQVLWLYH WKDQ QHJDWLYH ]LQF VWDLQLQJERWKPHWKRGVJDYHFRPSDUDEOHVHQVL WLYLWLHVXSRQWKHXVHRID&&'FDPHUDWRLQWH JUDWHWKHVLJQDORI6<3525XE\VWDLQHGEDQGV )LJ&DQG' 6LPSOLFLW\ :KLOH VWDLQLQJ ZLWK &RRPDVVLH EOXH 6<352 5XE\ RU ]LQF DUH UHODWLYHO\ VLPSOH PHWKRGVVLOYHUVWDLQLQJLQYROYHVDQXPEHURI VWHSVWKDWQHHGWREHFDUHIXOO\FRQWUROOHGPRVW QRWDEO\ VHQVLWL]DWLRQ ZLWK WKLRVXOIDWH %DVLF 3URWRFROVWHSULQVLQJZLWKZDWHUEHIRUH DQGDIWHUVLOYHULPSUHJQDWLRQ%DVLF3URWRFRO VWHSVWRDQGWRUHVSHFWLYHO\DQG LPDJHGHYHORSPHQW%DVLF3URWRFROVWHS ,QIDFWWKHGXUDWLRQRIWKHLPDJHGHYHORSPHQW VWHSFULWLFDOO\LQIOXHQFHVWKHVHQVLWLYLW\RIVLOYHU VWDLQLQJ WKXV UHVXOWLQJ LQ H[SHULPHQWWRH[ SHULPHQW YDULDWLRQV LQ EDQG FRORU LQWHQVLW\ 6WDLQLQJ ZLWK 6<352 5XE\ UHTXLUHV D 89 WUDQVLOOXPLQDWRUWRYLVXDOL]HWKHSURWHLQEDQGV DQGWKHFDUHIXOGLVSRVDORIWKLVSRWHQWLDOO\WR[LF G\HVHH%DVLF3URWRFRO 'RFXPHQWDWLRQ *HOVVWDLQHGZLWK&RRPDVVLHEOXHVLOYHURU ]LQF FDQ EH VWRUHG DW °& IRU VHYHUDO ZHHNV ZLWKRXWVLJQLILFDQWGHFUHDVHLQVHQVLWLYLW\)RU ORQJWHUPVWRUDJHJHOVVWDLQHGZLWK&RRPDVVLH EOXH VLOYHU RU 6<352 5XE\ FDQ EH HTXLOL EUDWHGLQZYJO\FHURODQGGULHGRQDJHO GU\HUDOWKRXJKLQWKHFDVHRI6<3525XE\¤ VWDLQHGJHOVWKLVFDQUHVXOWLQGHFUHDVHGVHQVL WLYLW\)RUSKRWRJUDSK\RUGLJLWDOLPDJHDFTXL VLWLRQ WKH EOXH EDQGV RI &RRPDVVLH EOXH VWDLQHG JHOV KDYH OHVV FRQWUDVW WKDQ WKH GDUN EURZQEODFNEDQGVRIVLOYHUVWDLQHGJHOVDQG 6<3525XE\¤VWDLQHGJHOVUHTXLUHWKHXVHRI DQDSSURSULDWHSKRWRJUDSKLFILOPHJ3RODU RLG EODFN DQG ZKLWH ILOP RU D VHQVLWLYH &&'FDPHUD1HJDWLYHO\]LQFVWDLQHGJHOVFDQ (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW EHSUREOHPDWLFIRUSKRWRJUDSK\RULPDJLQJRQ D&&'FDPHUD LQWKHVDPSOHLHWKDWWKHLUVWDLQLQJUHVXOWVLQ WKHVDPHEDQGLQWHQVLW\SHUSURWHLQPDVVXQLW 7KLVDVVXPSWLRQLVQRWQHFHVVDULO\FRUUHFWHV SHFLDOO\IRU&RRPDVVLHEOXHRUVLOYHUVWDLQLQJ ZKHUHEDQGLQWHQVLWLHVDUHNQRZQWREHLQIOX HQFHG E\ WKH SURWHLQV© DPLQR DFLG FRPSRVL WLRQV$QRWKHUOLPLWDWLRQLVWKDWPHDVXUHPHQWV VKRXOG EH PDGH RQO\ ZLWKLQ D OLQHDU UDQJH 6WDLQLQJZLWK6<352G\HVZKLFKLQWHUDFWZLWK WKH SURWHLQ6'6 FRPSOH[ UDWKHU WKDQ SURWHLQ IXQFWLRQDO JURXSV KDV EHHQ UHSRUWHG WR JLYH UHODWLYHO\OHVVSURWHLQWRSURWHLQYDULDELOLW\DQG 4XDQWLWDWLYHDQDO\VLV 6FDQQLQJGHQVLWRPHWULFDQDO\VHVRISURWHLQ EDQGVIURPVWDLQHGSRO\DFU\ODPLGHJHOVKDYH EHHQXVHGWRGHWHUPLQHWKHUHODWLYHDEXQGDQFH RISURWHLQVLQFRPSOH[PL[WXUHVWKHSXULW\RI SURWHLQVDPSOHVDQGHYHQWKHVWRLFKLRPHWU\RI PXOWLVXEXQLWSURWHLQFRPSOH[HV7KHVHTXDQWL WDWLYHDQDO\VHVDUHSHUIRUPHGDVVXPLQJLGHQWL FDOVWDLQLQJSURSHUWLHVRIWKHGLIIHUHQWSURWHLQV A B Molecular mass (kDa) 205 97 66 45 29 14 C D Molecular mass (kDa) 205 97 66 45 29 14 ng per band 6WDLQLQJ3URWHLQV LQ*HOV 6XSSOHPHQW 1000 300 100 30 10 3 1 1000 300 100 30 10 3 1 )LJXUH &RPSDULVRQRIWKHSURWHLQVWDLQLQJPHWKRGVGHVFULEHGLQWKLVXQLW6HULDOGLOXWLRQVRID PL[WXUHRIUDEELWPXVFOHP\RVLQ∼N'DUDEELWPXVFOHSKRVSKRU\ODVHE∼N'DERYLQHVHUXP DOEXPLQ∼N'DFKLFNHQRYDOEXPLQ∼N'DERYLQHHU\WKURF\WHFDUERQLFDQK\GUDVH∼N'D DQGFKLFNHQHJJO\VR]\PH∼N'DZHUHUHVROYHGE\6'63$*(RQDWR7JUDGLHQWJHODQG VWDLQHGZLWK$&RRPDVVLHEOXH%DVLF3URWRFRO%VLOYHU%DVLF3URWRFRO&6<3525XE\ %DVLF3URWRFRORU']LQF%DVLF3URWRFRO7KHDPRXQWVLQQDQRJUDPVSHUEDQGORDGHGRQ HDFKODQHDUHLQGLFDWHGDWWKHERWWRPRIWKHILJXUH,PDJHVRIVWDLQHGJHOVZHUHDFTXLUHGRQD%LR5DG *HO'RFJHOGRFXPHQWDWLRQV\VWHPXVLQJDVWDQGDUG89QPWUDQVLOOXPLQDWRUZLWK$% 'RUZLWKRXW&D89ZKLWHOLJKWFRQYHUVLRQVFUHHQ%LR5DG7KHLPDJHVKRZQLQ&ZDVDFTXLUHG XVLQJDQLQWHJUDWLRQWLPHRIVHFLQRUGHUWRRSWLPL]HVHQVLWLYLW\ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 7DEOH 7URXEOHVKRRWLQJ*XLGHIRU6WDLQLQJZLWK&RRPDVVLH%OXH%DVLF3URWRFRO 3UREOHP 1REDQGVDUHGHWHFWHG %DFNJURXQGLVFRPSOHWHO\FOHDU %DFNJURXQGLVGDUNEOXH 3URWHLQEDQGVDUHWRRIDLQW &DXVH $PRXQWRISURWHLQVEHORZ GHWHFWLRQOLPLW ,QVXIILFLHQWGHVWDLQLQJ 6WDLQLQJVROXWLRQLVWRRROGLH PHWKDQROKDVHYDSRUDWHG ,QVXIILFLHQWVWDLQLQJWLPH ([FHVVLYHGHVWDLQLQJ +LJKEDFNJURXQGDUHDV +LJKEDFNJURXQGUHVWULFWHGWR ODQHVZLWKVDPSOHV %OXHVSRWVDWWKHJHOVXUIDFH ,QWHUIHULQJFRPSRXQGVLQWKH VDPSOHV 3RZGHURUGLUWGHSRVLWHGRQWKH VXUIDFHGXULQJKDQGOLQJRIWKHJHO 6ROXWLRQ &KHFNSURWHLQFRQFHQWUDWLRQLQRULJLQDO VDPSOH6WDLQWKHJHOZLWKVLOYHU%DVLF 3URWRFRO &RQWLQXHWRGHVWDLQWKHJHOXQWLOWKH EDFNJURXQGLVFOHDUVWHSVWR 3UHSDUHQHZ&RRPDVVLHEOXHVWDLQLQJ VROXWLRQ 5HVWDLQWKHJHOXVLQJDORQJHUVWDLQLQJ WLPHVWHS 5HVWDLQWKHJHOPRQLWRULQJEDQGDQG EDFNJURXQGFRORUGXULQJGHVWDLQLQJ VWHSVWR )L[SURWHLQVZLWK7&$EHIRUHVWDLQLQJ VHH$OWHUQDWH3URWRFROVWHSVWR 8VHFOHDQSRZGHUIUHHJORYHV5HPRYH SRZGHURUGLUWE\JHQWO\WRXFKLQJWKH VXUIDFHZLWKDSRZGHUIUHHJORYH 7DEOH 7URXEOHVKRRWLQJ*XLGHIRU6WDLQLQJZLWK6LOYHU%DVLF3URWRFRO 3UREOHP 3URWHLQEDQGVDUHDEVHQWRUWRR IDLQW %DFNJURXQGLVFOHDU &DXVH $PRXQWRISURWHLQVEHORZ GHWHFWLRQOLPLW ,QVXIILFLHQWLPDJHGHYHORSPHQW )RUPDOGHK\GHLVWRRROGZKLWH SRO\PHUVLQFRQFHQWUDWHGVROXWLRQ 6LOYHUQLWUDWHVROXWLRQLVQRWIUHVK %DFNJURXQGLVWRRGDUN *HOKDVEHHQRYHUGHYHORSHG 3RRUTXDOLW\RIUHDJHQWV %DQGLPDJHVDQGEDFNJURXQG FRORUGHYHORSWRRIDVW 0HWDOOLFVLOYHULVGHSRVLWHGRQ WKHJHOVXUIDFH &RQFHQWUDWLRQRIVRGLXP WKLRVXOIDWH1D62LQGHYHORSHU DQGWKLRVXOIDWHVROXWLRQVLVQRW RSWLPDO 3RZGHURUGLUWGHSRVLWHGRQWKH VXUIDFHGXULQJJHOKDQGOLQJ 0HWDOOLFVLOYHUSUHVHQWLQWKHVLOYHU QLWUDWHVROXWLRQ 6ROXWLRQ &KHFNSURWHLQFRQFHQWUDWLRQLQRULJLQDO VDPSOH 5HVWDLQWKHJHOH[WHQGLQJWKHLPDJH GHYHORSPHQWVWHSVWHSXQWLO EDFNJURXQGEHJLQVWRJHWWRRGDUN 8VHIRUPDOGHK\GHIURPDIUHVK FRQFHQWUDWHGVROXWLRQ 3UHSDUHIUHVKVLOYHUQLWUDWHVROXWLRQMXVW EHIRUHXVH'LVFDUGWKHVROXWLRQLILW EHFRPHVFORXG\ 0RQLWRULPDJHGHYHORSPHQWVWHS FRQWLQXRXVO\3URFHHGWRWKHQH[WVWHSDV VRRQDVWKHVWDLQLQJLVFRQVLGHUHG VDWLVIDFWRU\ 8VHUHDJHQWVRIWKHKLJKHVWSXULW\ DYDLODEOH3UHSDUHWKHVROXWLRQVXVLQJ +3/&JUDGHZDWHU ,QFUHDVHVRGLXPWKLRVXOIDWHFRQFHQWUDWLRQ LQERWKVROXWLRQVHJWRIROG'R QRWUHXVHWKHVROXWLRQV +DQGOHWKHJHOVZLWKFOHDQIRUFHSVRU JORYHVWKDWKDYHEHHQULQVHGZLWKZDWHU 3URWHFWWKHVROXWLRQIURPOLJKW'LVFDUG WKHVROXWLRQLILWJHWVFORXGO\ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW 7DEOH 7URXEOHVKRRWLQJ*XLGHIRU)OXRUHVFHQW6WDLQLQJ%DVLF3URWRFRO 3UREOHP &DXVH 3URWHLQEDQGVDUHDEVHQWRUWRR IDLQW &OHDUEDFNJURXQG $PRXQWRISURWHLQVEHORZ GHWHFWLRQOLPLW 'LUHFWH\HYLVXDOL]DWLRQLVQRW VHQVLWLYHHQRXJK 3KRWRJUDSKLFRULPDJLQJ FRQGLWLRQVDUHQRWDSSURSLDWH 6WDLQVROXWLRQWRRROGRULQDFWLYDWHG E\OLJKW 3URWHLQVRILQWHUHVWSUHVWDLQHGRU FRQWDLQLQJFRORUHGSURVWKHWLF JURXSV +LJKO\IOXRUHVFHQWEDFNJURXQG +HDY\VWDLQDWWKH6'63$*( PLJUDWLRQIURQW 2GGPDUNVDWWKHJHOVXUIDFH 6ROXWLRQ &KHFNSURWHLQFRQFHQWUDWLRQLQRULJLQDO VDPSOH6WDLQWKHJHOZLWKVLOYHU%DVLF 3URWRFRO 9LVXDOL]HWKHEDQGVE\XVLQJD&&' FDPHUDRUE\SKRWRJUDSK\ 8VHVHQVLWLYHSKRWRJUDSKLFILOPV 3RODURLGEODFNDQGZKLWHRUVLPLODU ILOPRUDSSURSLDWH&&'FDPHUD ,QFUHDVHH[SRVXUHLQWHJUDWLRQWLPH 8VHIUHVKVWDLQVROXWLRQ3URWHFWLWIURP WKHOLJKW'RQRWUHXVHLW ,ISRVVLEOHUHPRYHSURVWKHWLFJURXSV IURPSURWHLQVDQGDYRLGXVLQJSUHVWDLQHG SURWHLQV2WKHUZLVHXVHDQDOWHUQDWLYH VWDLQLQJPHWKRGHJ%DVLF3URWRFRORU %DVLF3URWRFRO 7RRPXFKXQERXQGG\HUHPDLQVLQ WKHJHOPDWUL[ *HOLVSODFHGIRUYLVXDOL]DWLRQRQ DQDXWRIOXRUHVFHQWSODVWLFVXUIDFH HJ6DUDQ:UDS *HOLVDWWDFKHGWRDSRO\HVWHU VXUIDFHZLWKDIILQLW\IRUWKHG\H HJEDFNLQJPDWHULDORI 3KDVW*HOV 5LQVHWKHJHOIXUWKHUZLWKZDWHULH UHSHDWVWHSVDQG 3ODFHWKHJHOGLUHFWO\RQWRWKHVXUIDFHRI WKH89WUDQVLOOXPLQDWLRQXQLW 6<352G\HVELQGPLFHOODU6'6DW WKHPLJUDWLRQIURQW 3RUWLRQVRIWKHJHOVTXHH]HGRU KDYHSRZGHUGHSRVLWVGXHWR KDQGOLQJ $OORZWKH6'6IURQWWRPLJUDWHRXWRIWKH JHO +DQGOHWKHJHOJHQWO\ZHDULQJJORYHV WKDWKDYHEHHQULQVHGZLWKZDWHU 5HPRYHWKHJHOIURPWKHSRO\HVWHU VXUIDFHEHIRUHYLVXDOL]DWLRQ 7DEOH 7URXEOHVKRRWLQJ*XLGHIRU6WDLQLQJZLWK=LQF%DVLF3URWRFRO 3UREOHP &DXVH 3URWHLQEDQGVDUHDEVHQWRUWRR IDLQW ,QVXIILFLHQWFRQWUDVWGXHWRWKHXVH RIFOHDUVXUIDFHVIRUYLVXDOL]DWLRQ *HOLVRYHUGHYHORSHG $PRXQWRISURWHLQVEHORZ GHWHFWLRQOLPLW %ODFNJURXQGGRHVQRWWXUQ RSDTXH 6WDLQVROXWLRQRUGHYHORSHUDUHWRR ROG 6ROXWLRQ 9LVXDOL]HWKHEDQGVE\SODFLQJWKHJHO DJDLQVWDGDUNVXUIDFH 'HVWDLQWKHJHOVWHSVDQGDQGVWDLQ DJDLQPRQLWRULQJWKHDSSHDUDQFHRI EDQGVDJDLQVWDGDUNVXUIDFH &KHFNSURWHLQFRQFHQWUDWLRQLQRULJLQDO VDPSOH6WDLQWKHJHOZLWKVLOYHU%DVLF 3URWRFRO 8VHIUHVKVWDLQDQGGHYHORSHUVROXWLRQV GRQRWUHXVHWKHP 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ ORQJHU OLQHDU UDQJHV WKDQ WKH RWKHU VWDLQLQJ PHWKRGV6WHLQEHUJHWDO1HYHUWKHOHVV LQRUGHUWRFKHFNWKHYDOLGLW\RIWKHPHDVXUH PHQWVLWLVDOZD\VDGYLVDEOHWRORDGLQWKHJHO WRJHWKHUZLWKWKHVDPSOHVWREHTXDQWLWDWHG LQWHUQDO FRQWUROV RU D FDOLEUDWLRQ FXUYH ZLWK VWDQGDUGSURWHLQV 'RZQVWUHDPDSSOLFDWLRQV $OWKRXJK3$*(ZDVLQLWLDOO\XVHGRQO\IRU DQDO\WLFDOSXUSRVHVDODUJHYDULHW\RIPLFUR WHFKQLTXHVKDYHEHHQGHYHORSHGWKDWXVH3$*( DVDSUHSDUDWLYHVWHS3URWHLQVVHSDUDWHGE\RQH RUWZRGLPHQVLRQDO3$*(FDQEHWUHDWHGLQJHO ZLWKSURWHDVHV5RVHQIHOGHWDORUF\ DQRJHQEURPLGH&yUGREDHWDOWRRE WDLQ SHSWLGH IUDJPHQWV IRU PLFURVHTXHQFLQJ HOHFWURHOXWHGRUWUDQVIHUUHGWRQLWURFHOOXORVHRU SRO\YLQ\OLGHQH GLIOXRULGH 39') PHP EUDQHV 81,7 IRU IXUWKHU DQDO\VLV VXFK DV LPPXQRGHWHFWLRQRU(GPDQGHJUDGDWLRQ3UR WHLQVVHSDUDWHGE\QRQGHQDWXULQJ3$*(81,7 RUVRPHWLPHVHYHQE\6'63$*(FDQEH DQDO\]HGLQJHOIRUHQ]\PDWLFRUOLJDQGELQG LQJDFWLYLW\%RWKWKH6<3525XE\DQGQHJD WLYH]LQFVWDLQLQJPHWKRGVDUHFRPSDWLEOHZLWK YLUWXDOO\ DOO RI WKHVH DSSOLFDWLRQV $ QRWDEOH H[FHSWLRQLVDFWLYLW\DQDO\VLVRISURWHLQVVHSD UDWHGE\QRQGHQDWXULQJ3$*(ZKLFKDUHVHQVL WLYHWR6'6DVERWKVWDLQLQJSURFHGXUHVUHTXLUH WKHSUHVHQFHRI6'6IRUEDQGYLVXDOL]DWLRQ2Q WKHRWKHUKDQG&RRPDVVLHEOXHDQGVLOYHUJHO VWDLQLQJLQYROYHSURWHLQIL[DWLRQDQGWKHUHIRUH DUHFRPSDWLEOHZLWKIHZHUGRZQVWUHDPDSSOL FDWLRQV,WLVZRUWKPHQWLRQLQJKRZHYHUWKDW &RRPDVVLHVWDLQHGSURWHLQVFDQEHHIILFLHQWO\ HOHFWURWUDQVIHUUHGWR39')PHPEUDQHVIRU(G PDQ GHJUDGDWLRQ VHTXHQFLQJ 8 +HOOPDQ SHUV FRPPXQ DOWKRXJK IRU LPPXQREORW DQDO\VLV WKH &RRPDVVLH EOXH G\H LV D NQRZQ LQWHUIHUHQFH&RRPDVVLHEOXHVWDLQLQJKDVEHHQ ZLGHO\XVHGWRYLVXDOL]HSURWHLQEDQGVGHVWLQHG IRULQJHOJHQHUDWLRQRISHSWLGHVIRUPLFURVH TXHQFLQJ PDLQO\ EHFDXVH WKHVH GRZQVWUHDP DSSOLFDWLRQVKDYHQRWEHHQVHQVLWLYHHQRXJKWR DOORZDQDO\VLVRISURWHLQEDQGVEHORZWKHGH WHFWLRQOLPLWRIWKHG\H5HFHQWPHWKRGRORJLFDO LPSURYHPHQWVKRZHYHUKDYHPDGHLWSRVVLEOH WRREWDLQVHTXHQFHLQIRUPDWLRQIURPDVOLWWOHDV QJ RI SURWHLQ IURP SRO\DFU\ODPLGH JHOV VWDLQHGZLWKVLOYHU:LOPHWDO 7URXEOHVKRRWLQJ 7DEOHV WR VXPPDUL]H FRPPRQ SUREOHPV WKDW PD\ DULVH GXULQJ VWDLQLQJ RI SURWHLQVLQSRO\DFU\ODPLGHJHOV%HIRUHXVLQJ DQ\RIWKHPHWKRGVWRDQDO\]HD¦UHDO§VDPSOH LWLVDGYLVDEOHWRWHVWWKHPHWKRGILUVWRQDJHO FRQWDLQLQJNQRZQDPRXQWVRIVWDQGDUGSURWHLQV HJVHH)LJ $QWLFLSDWHG5HVXOWV 7KHSURWRFROVGHVFULEHGLQWKLVXQLWVKRXOG DOORZGHWHFWLRQRIVXEPLFURJUDPDPRXQWVRI SURWHLQVHSDUDWHGE\3$*(DVH[HPSOLILHGE\ )LJXUH 7LPH&RQVLGHUDWLRQV %\ IDU QHJDWLYH VWDLQLQJ ZLWK ]LQF LV WKH IDVWHVWPHWKRGDPRQJWKHRQHVGHVFULEHGLQWKLV XQLW ,PDJHV FDQ EH REWDLQHG ZLWKLQ PLQ DIWHUWKHSRO\DFU\ODPLGHJHOLVUHPRYHGIURP WKH HOHFWURSKRUHVLV XQLW 6LOYHU VWDLQLQJ UH TXLUHVPLQIRUIL[DWLRQDQGDQRWKHU∼KU WRFRPSOHWHWKHSURFHGXUH%RWKWKH&RRPDVVLH EOXHDQG6<3525XE\SURFHGXUHVUHTXLUH∼ KUIRUREWDLQLQJRSWLPDOSURWHLQWREDFNJURXQG VWDLQLQJ UDWLR 6XERSWLPDO VWDLQLQJ ZLWK 6<3525XE\FDQEHREWDLQHGE\LQFXEDWLQJ WKHJHOZLWKVWDLQVROXWLRQIRUWRPLQDQG VNLSSLQJWKHVXEVHTXHQWZDVKLQJVWHSV%DVLF 3URWRFRO VWHSV DQG ,Q WKH FDVH RI &RRPDVVLHEOXHVWDLQLQJELQGLQJRIWKHG\HWR SURWHLQVLVDIDVWSURFHVVWKDWGHSHQGVPDLQO\ RQ LWV UDWH RI GLIIXVLRQ LQWR WKH JHO PDWUL[ +LWFKPDQDQG(NVWURP5HPRYDORIWKH XQERXQG&RRPDVVLHG\HIURPWKHJHOZKLFK DOVRUHOLHVRQGLIIXVLRQFDQEHDFFHOHUDWHGE\ SODFLQJDQDGVRUEHQWPDWHULDOZLWKDIILQLW\IRU WKHG\HHJ:KDWPDQ00ILOWHUSDSHULQWR WKHGHVWDLQLQJVROXWLRQZLWKWKHJHORUE\LQ FUHDVLQJWKHWHPSHUDWXUHRIGHVWDLQLQJHJWR °&,QERWKFDVHVKRZHYHUFDXWLRQVKRXOG EH WDNHQ WR DYRLG H[FHVVLYH GHVWDLQLQJ WKDW FRXOGGHFUHDVHVHQVLWLYLW\ /LWHUDWXUH&LWHG %OXP+%HLHU+DQG*URVV+-,PSURYHG VLOYHUVWDLQLQJRISODQWSURWHLQV51$DQG'1$ LQSRO\DFU\ODPLGHJHOV(OHFWURSKRUHVLV &KRL-.1D'6+RQJ+<&KRL'.<RRQ 6+DQG<RR*6$IDVWDQGVHQVLWLYH &RRPDVVLH EOXH VWDLQLQJ IRU SURWHLQV LQ SRO\DFU\ODPLGH JHOV XVLQJ LRQSDLULQJ DJHQW $QDO/HWW &yUGRED2//LQVNHQV6%'DFFL(DQG6DQ WRPp-$¦,QJHO§FOHDYDJHZLWKF\DQR JHQEURPLGHIRUSURWHLQLQWHUQDOVHTXHQFLQJ- %LRFKHP%LRSK\V0HWKRGV 'H6LOYD703URWHLQGHWHFWLRQLQJHOVXVLQJ IL[DWLRQ,Q&XUUHQW3URWRFROVLQ3URWHLQ6FLHQFH -( &ROLJDQ %0 'XQQ +/ 3ORHJK ': 6SHLFKHU DQG 37 :LQJILHOG HGV SS -RKQ:LOH\6RQV1HZ<RUN )HUQiQGH]3DWURQ & &DOHUR 0 &ROOD]R 35 *DUF©D-50DGUD]R-0XVDFFKLR$6RUL (OHFWURSKRUHVLV DQG ,PPXQREORWWLQJ &XUUHQW3URWRFROVLQ&HOO%LRORJ\ 6XSSOHPHQW DQR)(VWUDGD5)UDQN5&DVWHOODQRV6HUUD /5 DQG 0HQGH] ( D 3URWHLQ UHYHUVH VWDLQLQJ¥+LJKHIILFLHQF\PLFURDQDO\VLVRIXQ PRGLILHG SURWHLQV GHWHFWHG RQ HOHFWURSKRUHVLV JHOV$QDO%LRFKHP 6FKlJJHU+DQGYRQ-DJRZ*7ULFLQHVR GLXP GRGHF\O VXOIDWHSRO\DFU\ODPLGH JHO HOHF WURSKRUHVLVIRUWKHVHSDUDWLRQRISURWHLQVLQWKH UDQJH IURP WR N'D $QDO %LRFKHP )HUQiQGH]3DWURQ&+DUG\(6RVD$6HRDQH - DQG &DVWHOODQRV6HUUD /5 E 'RXEOH VWDLQLQJ RI &RRPDVVLH EOXHVWDLQHG SRO\DFU\ ODPLGHJHOVE\LPLGD]ROHVRGLXPGRGHF\OVXOIDWH ]LQF UHYHUVH VWDLQLQJ¥VHQVLWLYH GHWHFWLRQ RI &RRPDVVLHEOXH¤XQGHWHFWHGSURWHLQV$QDO%LR FKHP 6WHLQEHUJ 7+ -RQHV /- +DXJODQG 53 DQG 6LQJHU9/6<3522UDQJHDQG6<352 5HG SURWHLQ JHO VWDLQV 2QHVWHS IOXRUHVFHQW VWDLQLQJ RI GHQDWXULQJ JHOV IRU GHWHFWLRQ RI QDQRJUDP OHYHOV RI SURWHLQ $QDO %LRFKHP *DUILQ'(2QHGLPHQVLRQDOJHOHOHFWURSKR UHVLV0HWKRGV(Q]\PRO +LWFKPDQ0/DQG(NVWURP%$QLQYHVWL JDWLRQRIWKHIDFWRUVFRQWUROOLQJWKHVWDLQLQJDQG GHVWDLQLQJRIHOHFWURSKRUHVLVJHOV(OHFWURSKRUH VLV 1D '6 +RQJ +< <RR *6 DQG &KRL -. (YDQVEOXHVWDLQLQJPHWKRGIRUGHWHFWLRQ RI SURWHLQV RQ SRO\DFU\ODPLGH JHOV ZLWK UKR GDPLQH%$QDO/HWW 1HXKRII 9 6WDPP5DQG(LEO+&OHDU EDFNJURXQGDQGKLJKO\VHQVLWLYHSURWHLQVWDLQLQJ ZLWK &RRPDVVLH EOXH G\HV LQ SRO\DFU\ODPLGH JHOV $ V\VWHPDWLF DQDO\VLV (OHFWURSKRUHVLV 5DELOORXG79XLOODUG/*LOO\&DQG/DZUHQFH -- 6LOYHUVWDLQLQJ RI SURWHLQV LQ SRO\DFU\ODPLGHJHOV$JHQHUDORYHUYLHZ&HOO 0RO%LRO 5LJKHWWL3*DQG'U\VGDOH-:,VRHOHFWULF IRFXVLQJLQJHOV-&KURPDWRJU 5RVHQIHOG-&DSGHYLHOOH-*XLOOHPRW-&DQG )HUUDUD3,QJHOGLJHVWLRQRISURWHLQVIRU LQWHUQDOVHTXHQFHDQDO\VLVDIWHUGLPHQVLRQDORU GLPHQVLRQDO JHO HOHFWURSKRUHVLV $QDO %LR FKHP 6ZLW]HU5&0HUULO&5DQG6KLIULQ6$ KLJKO\VHQVLWLYHVLOYHUVWDLQIRUGHWHFWLQJSURWHLQ DQGSHSWLGHVLQSRO\DFU\ODPLGHJHOV$QDO%LR FKHP :DOODFH$DQG6DOX]+38OWUDPLFURGHWHF WLRQ RI SURWHLQV LQ SRO\DFU\ODPLGH JHOV $QDO %LRFKHP :LOP06KHYFKHQNR$+RXWKDHYH7%UHLW6 6FKZHLJHUHU/)RWVLV7DQG0DQQ0 )HPWRPROH VHTXHQFLQJ RI SURWHLQV IURP SRO\DFU\ODPLGHJHOVE\QDQRHOHFWURVSUD\PDVV VSHFWURPHWU\1DWXUH :LOVRQ &0 6WXGLHV DQG FULWLTXH RI DPLGR EODFN % &RRPDVVLH EOXH 5 DQG IDVW JUHHQ )&)DVVWDLQVIRUSURWHLQVDIWHUSRO\DFU\ODPLGH JHOHOHFWURSKRUHVLV$QDO%LRFKHP &RQWULEXWHGE\(VWHEDQ&'HOO©$QJHOLFD DQG-XDQ6%RQLIDFLQR 1DWLRQDO,QVWLWXWHRI&KLOG+HDOWKDQG +XPDQ'HYHORSPHQW 1DWLRQDO,QVWLWXWHVRI+HDOWK %HWKHVGD0DU\ODQG 6WDLQLQJ3URWHLQV LQ*HOV 6XSSOHPHQW &XUUHQW3URWRFROVLQ&HOO%LRORJ\ Agarose Gel Electrophoresis of Proteins UNIT 6.7 This unit describes the use of agarose gel as a matrix for the electrophoresis of proteins. Although agarose is widely used as a material for molecular sieving, it is not often used for the electrophoresis of proteins. When it is used for this purpose, it is generally employed for the electrophoresis of very large proteins. In other electrophoresis procedures it is part of a composite polyacrylamide/agarose system. The system described below utilizes agarose alone as the gel matrix. As with acrylamide gels, the proteins thus separated may be transferred to a membrane (immunoblotting) for further analysis, or the proteins may be identified directly in the gel using stains or labeled antibodies. A particular advantage of the method described in the Basic Protocol is the preparation of the gel in a horizontal electrophoresis bed which saves time and eliminates many of the difficulties commonly encountered in the preparation of acrylamide or composite gels in a vertical preparation apparatus. These protocols describe methods for the separation and identification of von Willebrand factor (vWF), an extremely large plasma protein that is comprised of multimers ranging from 850,000 to 20,000,000 Da. The methods can be applied to other mixtures containing large proteins, multimeric proteins, and other large protein complexes such as fibrinogen and fibrin complexes (Shainoff, 1991). While the use of an SDS buffer system allows separation of proteins on the basis of size, nondenatured proteins can be separated in “native” agarose gels if their charge and configuration allow for satisfactory partitioning. Von Willebrand factor multimers are stable in SDS due to their disulfide linkages, and the protocols below utilize SDS. The agarose gel electrophoresis and blotting with immunodetection procedure (see Basic Protocol) utilizes identification of protein by a specific antibody followed by chemiluminescent detection methods. Major advantages of this method include the technical ease of preparing the gel, increased sensitivity, and a much shorter turn-around time than in-gel antibody analysis (see Alternate Protocol). It also eliminates the use of radioactive isotopes. In addition, the primary and secondary antibodies can be easily removed and the membrane (PVDF) probed again with a different detection antibody. This allows the laboratory the opportunity to detect a second protein or antigenic site on the same protein and also a “second chance” to correct an omission in the procedure, especially for samples in limited supply (UNIT 6.2); however, the immunoblotting step of such large proteins must be done with care in order to assure the adequate transfer of the largest proteins. The Alternate Protocol uses direct identification of the protein in the gel by a specific radiolabeled antibody, eliminating the immunoblotting step, but sacrificing sensitivity. AGAROSE GEL ELECTROPHORESIS AND BLOTTING WITH IMMUNODETECTION The following is a method for separating a complex mixture of human plasma proteins by continuous SDS horizontal (submerged) agarose gel electrophoresis. The very large multimers of circulating plasma von Willebrand factor (or more highly purified preparations of this protein) are identified using a specific antibody and visualized using a chemiluminescent reagent. This protocol utilizes a 20 × 25–cm horizontal gel apparatus. Dry agarose is weighed, mixed with electrophoresis buffer, and melted in a hot water bath. The agarose is allowed to partially cool, then is poured into a horizontal casting frame with a Teflon comb in place, and allowed to solidify. The gel is covered with 1 to 2 mm cold electrophoresis buffer and the comb is carefully removed. Prepared samples containing the proteins of interest are diluted with sample buffer and loaded into wells. Electrophoresis is carried out for 3 to 6 hours at 4°C. The gel is placed into a vertical tank transfer Contributed by Dennis M. Krizek and Margaret E. Rick Current Protocols in Cell Biology (2002) 6.7.1-6.7.13 Copyright © 2002 by John Wiley & Sons, Inc. BASIC PROTOCOL Electrophoresis and Immunoblotting 6.7.1 Supplement 15 apparatus (UNIT 6.2), and the proteins are transferred overnight onto an immobilization matrix (PVDF membrane). The membrane is blocked and probed with a polyclonal primary antibody specific for the antigen of interest and, after washing, a conjugated secondary antibody is introduced. After incubation the membrane is washed again, and the protein bands of interest are illuminated with a chemiluminescent detection system. Materials SeaKem HGT(P) agarose (Bio Whittaker or equivalent) 1× electrophoresis buffer, 4°C (see recipe) Protein samples 2× sample buffer (see recipe) 0.25× transfer buffer without methanol (see recipe) Blocking buffer (UNIT 6.2) containing 5% (w/v) nonfat dry milk, fresh Antibodies: Primary: rabbit anti-vWF (Dako) Secondary: donkey horseradish peroxidase–linked anti-rabbit Ig (Amersham Pharmacia) ECL Western Blotting Analysis system (Amersham Pharmacia) Aluminum foil Boiling waterbath (optional) Horizon 20-25 horizontal electrophoresis apparatus (Life Technologies) or equivalent Teflon comb (e.g., 1 × 9–mm, 20-well) Pipet with fine tip or equivalent 0.45-µm Immobilon-P polyvinylidene fluoride (PVDF) membrane (Millipore) Additional reagents and equipment for protein transfer to membranes and immunoblotting (UNIT 6.2) Cast agarose gels 1. Weigh 1.2 g SeaKem HGT(P) agarose and transfer to a 250-ml flask containing 200 ml of 1× electrophoresis buffer. Add a Teflon-coated magnetic stir bar and tightly cover the flask with aluminum foil. 2. Heat in a boiling water bath, with slow mixing to avoid bubbles, until clear. Alternatively, microwave until boiling CAUTION: Whenever a solution is heated in a microwave the chance of superheating (“boil up”) is always present. Protective gloves, gown, and eyewear should be worn at all times. 3. Assemble Horizon 20-25 horizontal electrophoresis apparatus or equivalent according to manufacturer’s recommendations. The wedge shaped casting dams of the Horizon (Life Technologies) horizontal apparatus are easily placed in backwards, resulting in leaking of liquid agarose. Care should be exercised so that the dams form a perpendicular angle with the UVT tray. 4. Cool agarose to 55° to 60°C and pour the molten agarose into the electrophoresis apparatus to a depth of 4 mm. It is often helpful to prewarm the electrophoresis apparatus with warm water or in an oven to avoid cooling the agarose and causing the agarose to solidify unevenly. Agarose Gel Electrophoresis of Proteins 5. Carefully insert the desired (e.g., 1 × 9–mm, 20-well) Teflon comb with care to avoid bubbles. 6.7.2 Supplement 15 Current Protocols in Cell Biology Removing the comb while the agarose is still in a molten state and then reinserting often eliminates the formation of bubbles under the teeth of the comb. 6. After the agarose has solidified, place the apparatus at 4°C and allow the agarose to age 20 to 30 minutes. The electrophoresis is to be carried out at 4°C. The apparatus may either be placed in a cold room, the electrophoresis buffer can be circulated through a refrigeration unit, or the apparatus can be packed in wet ice. 7. Overlay the solidified gel with 2 to 3 mm electrophoresis buffer, 4° C. 8. Remove the sample comb by lifting vertically in one smooth motion. It is helpful to hold the gel down with the gloved fingers of the other hand to keep the gel from being pulled up when the comb is removed. Prepare and load sample 9. Dilute the protein samples to twice the desired concentration using distilled water. Immediately add the diluted sample to an equal volume of 2× sample buffer. 10. Load a sample volume of 10 to 15 µl into the bottom of each sample well using a pipet with a fine tip or equivalent. Prior to sample loading examine each sample well to ascertain that air bubbles are not trapped in the well. Electrophorese gel (also see UNIT 6.1) 11. Run samples into the gel matrix at a constant current of 25 mA for ∼30 min or until the sample dye has completely entered the gel. 12. Pause the electrophoresis and decrease the level of the electrophoresis buffer to ~1 mm above the upper surface of the gel. Increase the constant current to 50 mA and run for an additional 3 to 4 hr, or until the marker dye has migrated at least 6 to 7 cm. Blotting the gel 13. Perform immunoblotting to a 0.45-µm Immobilon-P polyvinylidene fluoride (PVDF) membrane in a tank transfer system as described (UNIT 6.2), with the exception of the following conditions: a. Electrophoretically transfer at a constant current of 100 mA at 4°C overnight. b. Use 0.25× transfer buffer without methanol. c. Use blocking buffer containing 5% (w/v) nonfat dry milk. Immunodetect protein 14. Perform immunoprobing with directly conjugated secondary antibody as described (UNIT 6.2), except with the following variations which are specific for immunodetection of von Willebrand Factor protein: a. Dilute primary antibody, rabbit anti-vWF, to a concentration of 1:4000. b. Dilute secondary antibody, donkey horseradish peroxidase–linked anti-rabbit Ig, to a concentration of 1:2000. Visualization 15. Visualize von Willebrand factor protein on the PVDF membrane by meticulously following the recommendations enclosed in the ECL Western Blotting Analysis system. Electrophoresis and Immunoblotting 6.7.3 Current Protocols in Cell Biology Supplement 15 Visualization with Luminescent Substrates is discussed in UNIT 6.2. To determine the optimal concentration of antibody, run a preliminary gel followed by immunoblotting. Cut the blot into several vertical test strips, each containing 1 to 2 lanes. Use the supplier’s recommended concentration of antibody as a starting point and process the test strips with 3- to 10- to 30-fold increased and decreased antibody concentrations in separate containers. ALTERNATE PROTOCOL AGARAOSE GEL ELECTROPHORESIS WITH IN-GEL ANTIBODY ANALYSIS This alternative protocol describes a method for separating large plasma proteins using SDS agarose electrophoresis and visualizing the protein of interest directly in the gel with a 125I-radiolabeled rabbit antibody, in this case, to human von Willebrand factor protein, and autoradiography (see also UNIT 6.3). The methodology applied to agarose electrophoresis of von Willebrand factor is outlined below. The gel preparation consists of mating two glass plates on a horizontal surface separated by a 0.5-mm spacer. A sheet of GelBond support film is fixed to the glass plate to provide support for the agarose. Agarose at a concentration of 1.35% (w/v) is poured between the glass plate and the spacer plate. After the gel is solidified, the apparatus is disassembled and 1.0 × 0.1–cm wells are punched into the gel. The gel is placed into a horizontal electrophoresis chamber, presoaked wicks are attached to the gel, and sample volumes of 8 µl are loaded. The prepared samples are electrophoresed until the sample dye has migrated 8 to 10 cm. The gel is immediately fixed with isopropanol/glacial acetic acid fixing solution. After the gel is washed, it is blocked with ethanolamine/BSA. The gel, after a second series of washes, is incubated with 125I-labeled anti-vWF antibody for 10 to 24 hours at room temperature. After extensive washing and drying the gel is placed in a cassette with film and exposed 1 to 5 days. Materials In-gel sample buffer, fresh (see recipe) Borate saline buffer (BSB; see recipe) Sample 0.5% (w/v) bromphenol blue in H2O Isopropanol Agarose gel buffer (see recipe) SeaKem HGT(P) agarose (FMC/BioWhittaker Molecular) Agarose running buffer (see recipe) Fixing buffer (see recipe) Blocking buffer, in-gel (see recipe) 125 I-labeled rabbit anti-human vWF polyclonal antibody (Dako #A0082): radiolabel using protocol of choice and immunopurify (Hoyer and Shainoff, 1980; also see UNIT 7.10) 2% (w/v) human IgG (see recipe) High-salt wash buffer (see recipe) Agarose Gel Electrophoresis of Proteins 12 × 75–mm polypropylene tube 12.5 × 26.0 × 0.3–cm glass plate (Amersham Pharamacia Biotech) 12.5 × 24.0–cm spacer plate with adherent 0.5-mm spacers (Amersham Pharmacia Biotech) 12.4 × 25.8–cm GelBond film (Amersham Pharmacia Biotech) Flexiclamps (Amersham Pharmacia Biotech) 20-ml syringe 60°C oven Aluminum foil Gelman Delux electrophoresis chamber (Gelman Sciences) or equivalent 6.7.4 Supplement 15 Current Protocols in Cell Biology 104 × 253–mm paper electrophoresis electrode wicks (Amersham Pharmacia Biotech) Flattened no. 2 cork borer Forceps, fine Horizontal rotary mixer Forced hot-air dryer (optional) Kodak X-Omatic film cassette with Lanex screens and film CAUTION: When working with radioactivity, take apptopriate precautions to avoid contamination of the experimenter and the surroundings. Carry out the experiment and dispose of wastes in an appropriately designated area, following the guidelines provided by your local radiations safety officer (also see APPENDIX 1D). Prepare sample 1. Prepare 3 ml fresh in-gel sample buffer. 2. Label a 12 × 75–mm polypropylene tube for each sample to be assayed. Add 20 µl borate saline buffer (BSB), 120 µl sample buffer, and 10 µl sample into each tube. 3. Cover each tube, vortex gently, and incubate 2 hr at 37°C. 4. Add 8 µl of 0.5% bromphenol blue to each sample and mix gently. Prepare agarose gel 5. Prepare a boiling water bath by placing approximately 50 ml distilled water in a 250-ml beaker and incubating on a hot plate with magnetic stirring capabilities. 6. Use isopropanol to clean the 12.5 × 26.0 × 0.3–cm glass plate and 12.5 × 24.0–cm spacer plate with its adherent 0.5–mm spacers. Dry with a lint-free tissue (e.g., Kimwipe). It is advisable, because of the fragile nature of this gel, to prepare sufficient materials to pour a gel in reserve in the eventuality that one is rendered unusable. 7. Place a few milliliters of distilled water on the glass plate and adhere the hydrophilic side of a 12.4 × 25.8–cm GelBond film. Express any trapped air or excess water with a lint-free tissue. 8. Mate the glass plate with the adherent GelBond film and the spacer plate. Clamp with two flexiclamps. The gel-forming sandwich should consist of the glass plate (the larger of the two plates) with an adherent piece of GelBond film (hydrophilic side to the glass plate) and the spacer plate with its adherent spacer bars placed on top of the GelBond (Fig. 6.7.1). 9. Place the clamped plates and a 20-ml syringe in a 60°C oven for ∼10 minutes to equilibrate. 10. Measure 40 ml agarose gel buffer into a 50-ml Erlenmeyer flask and add a Tefloncoated magnetic stir bar. Pour 0.54 g SeaKem HGT(P) agarose into the flask, tightly cover with aluminum foil, and place the flask into the boiling water bath (step 5). Dissolve the agarose with constant stirring. After the solution becomes clear, continue boiling an additional 10 min. 11. Remove the heated glass plate assembly (gel-forming sandwich) and the 20-ml syringe from the oven. Quickly fill the heated syringe with 20 ml hot agarose, and holding the plate assembly at an ∼75° angle, fill the narrow space in the plate assembly using a back and forth motion to prevent bubbles from being trapped in the gel. Use of a needle with the syringe is optional. Electrophoresis and Immunoblotting 6.7.5 Current Protocols in Cell Biology Supplement 15 “glass plate” GelBond film “spacer plate” with 0.5-mm spacers flexiclamps Figure 6.7.1 Diagram of casting gel in the Alternate Protocol. The layers include (back to front): the “glass plate” (the larger of the two plates), GelBond film (hydrophilic side adherent to the glass plate), and the “spacer plate” with attached 0.5-mm spacer bars. The agarose fills the narrow space between the GelBond and the “spacer plate.” 12. After filling, lay the plate assembly flat and allow to cool and solidify ∼45 min. Electrophorese gel 13. Position the Gelman Delux electrophoresis chamber or equivalent electrophoresis apparatus on a flat surface and fill each electrode chamber with 400 to 450 ml agarose running buffer. Place 104 × 253–mm paper electrophoresis electrode wicks in each chamber to equilibrate in running buffer. 14. Remove the flexiclamps. Insert a thin spatula blade between the spacer plate and the gel attached to the glass plate. Carefully pry upward to separate the spacer plate. Examine the gel against a bright light for bubbles, thin areas, or areas of separation from the GelBond film. The agarose gel should now be attached to the GelBond support backing and be easily handled. 15. Punch the required number of 0.1 × 10-mm wells using a flattened no. 2 cork borer. Use a fine set of forceps to remove the agarose from the interior of each well. It is helpful to construct a template to place under the gel to facilitate punching the wells in an evenly spaced straight line. Also, it is necessary to work quickly because these gels are very thin and dry out rapidly. Agarose Gel Electrophoresis of Proteins 16. Place a glass plate across the bridge on the electrophoresis chamber and place the gel attached to the GelBond on top of the plate. Affix the presoaked wicks (step 13) on each side of the gel so that there is continuity between the agarose running buffer in the electrode chambers and the gel. 6.7.6 Supplement 15 Current Protocols in Cell Biology 17. Load 8 µl of sample into each well. Place the cover over the electrophoresis apparatus and connect the power supply. 18. Electrophorese at 25 V for ∼30 min at room temperature to allow the samples to enter the gel matrix. Increase the power supply to 50 V and continue electrophoresis until the dye marker has migrated 8 to 10 cm from the wells (∼3 to 5 hr). Fix gel 21. Add 200 ml fixing buffer to a container appropriate to the size of the gel. Carefully remove the paper wicks and place the gel in fixing buffer 1 hr without agitation. The gel can also fix overnight in fixing buffer for a convenient stopping point. 22. Wash the gel 1 hr with 200 to 300 ml BSB with gentle mixing on a horizontal rotary mixer. A prerinse ∼1 to 2 min before the wash with ∼100 ml BSB is recommended 23. Prepare 250 ml fresh in-gel blocking buffer. Block gel 1 hr with gentle mixing. 24. Prerinse gel with ∼100 ml BSB. Wash 1 hr with 200 to 300 ml BSB. Immunodetect protein 25. Prepare a solution of dilute 125I-labeled rabbit anti-human vWF polyclonal antibody in BSB to a concentration of ∼2 × 106 cpm in a volume sufficient to cover the gel. Add 0.5 ml of 2% human IgG to the antibody solution. The majority of the gels can be covered with 50 to 70 ml. In an effort to minimize the volume of radioactive solutions, the authors’ laboratory keeps a supply of dedicated plasticware to accommodate a wide variety of gel sizes. Strict laboratory precaution should be exercised in the preparation, handling, and disposal of radioactive materials. 26. Incubate the gel in the antibody solution at least 16 to 24 hr with gentle mixing. 27. Discard the antibody solution, adhering to standard radiation safety waste disposal protocols. 28. Wash the gel 1 hr in 200 ml high-salt wash buffer with gentle mixing using a horizontal rotary mixer. 29. Repeat the wash an additional three to four times. The washes should be monitored and continued until all excess 125I is removed. 30. Wash 1 hr in 200 ml distilled water. Repeat once. 31. Dry the gel with a forced hot-air dryer directed on the gel, or air dry the gel. Autoradiograph the gel 32. Place the gel in a Kodak X-Omatic film cassette with a Lanex screen. Under dark room conditions, place a piece of Kodak X-Omat film on the gel and then incubate the cassette at −70°C. Expose for an appropriate amount of time. Times vary from 1 to 5 days. It is helpful to secure the gel to the cassette with tape to keep it from changing position. Electrophoresis and Immunoblotting 6.7.7 Current Protocols in Cell Biology Supplement 15 REAGENTS AND SOLUTIONS Use deionized or distilled water in all recipes and protocol steps. For common solutions, see APPENDIX 2A; for suppliers, see SUPPLIERS APPENDIX. Agarose gel buffer 0.05 M Na2HP04 0.1% (w/v) SDS Adjust pH to 7.0 with concentrated HCl Filter and store up to 3 months at room temperature Agarose running buffer 0.1 M Na2HP04 0.1% (w/v) SDS Adjust pH to 7.0 with concentrated HCl Store up to 3 months at room temperature Blocking buffer, in-gel 15 ml 16.6 M ethanolamine (1.0 M) 250 mg fatty-acid-free Fraction V BSA Add H2O to ∼200 ml Adjust pH to 8.0 with concentrated HCl Add H2O to 250 ml Prepare fresh on the day of use Borate saline buffer (BSB) 15.4 g boric acid (36 mM) 65.06 g NaCl (143 mM) 1.40 g NaOH (0.005 N) Add 1.56 ml concentrated HCl to adjust pH to 7.83 Adjust volume to 7 liters with H2O Store up to 3 months at room temperature Electrophoresis buffer, 1× Dilute 10× TAE (see recipe) 1/10 in water. Add 10 ml of 20% (w/v) SDS (APPENDIX 2A) per 2 liters. Final concentrations are 40 mM Tris-acetate, 1 mM EDTA, and 0.1% (w/v) SDS. Final pH is 7.8 to 8.3. Store up to 1 week at room temperature. The solution is also referred to as 1× TAE-SDS. Two liters are required for the application. Fixing buffer 50 ml isopropanol (25%) 20 ml glacial acetic acid (10%) 130 ml H2O Prepare fresh on the day of use Agarose Gel Electrophoresis of Proteins High-salt wash buffer 56.78 g Na2HPO4 (0.1 M final) 233.6 g NaCl (1 M final) Adjust pH to 7.0 with concentrated HCl Add H2O to 4 liters Store up to 3 months at room temperature 6.7.8 Supplement 15 Current Protocols in Cell Biology Human IgG, 2% 2.0 g human IgG in 100 ml BSB (see recipe) Store in aliquots up to 1 year at −20°C In-gel sample buffer Stock solution 0.01M Na2HP04 Adjust pH to 7.0 with HCl Filter and store up to 3 months at room temperature Working solution To 3 ml stock solution add: 20.64 mg iodoacetamide 37.5 mg SDS Prepare fresh Sample buffer, 2× 20 ml 10× TAE (see recipe) 1 ml 20% (w/v) SDS (APPENDIX 2A) 20 ml glycerol 0.2 g bromphenol blue Add H2O to 200 ml Store up to 1 year at room temperature TAE, 10× 48.4 g Tris base (400 mM) 20 ml 0.5M EDTA (10 mM; APPENDIX 2A) Adjust pH to 7.8 with glacial acetic acid Adjust volume to 1 liter Store up to 1 year at room temperature Transfer buffer without methanol, 0.25× and 10× For a 10× solution 250 mM Tris⋅Cl, pH 8.3 (APPENDIX 2A) 1.92 M glycine 1.0% (w/v) SDS Store up to 1 year at room temperature This is the stock solution for transfer buffer and is also known as Tris/glycine/SDS (TG/SDS). For a 0.25× solution Dilute 10× transfer buffer 1/40 in distilled water. Final concentrations are 6.25 mM Tris⋅Cl, 48 mM glycine, and 0.025% (w/v) SDS. Final pH is 8.3. Store up to 1 week at room temperature. Four liters are required for the application. Electrophoresis and Immunoblotting 6.7.9 Current Protocols in Cell Biology Supplement 15 Table 6.7.1 Troubleshooting Guide for Agarose Electrophoresis and Immunoblotting Problem Possible cause Agarose electrophoresis Run time too long or too short Band spreads into other lanes Samples leak underneath gel Bands migrate at different rates (visualized as “smiles,” “frowns,” and “sneers”) Buffer concentration too high or too low Verify buffer preparation Voltage too high or too low Review and increase or decrease voltage or current settings Sample diffusing out of well or into Minimize time for sample loading surrounding gel and start electrophoresis promptly Bottom of well torn when removing Remove comb slowly comb Gel cast unevenly Use level to verify that the apparatus is level Uneven heat distribution Bands not in straight lines (visualized Artifacts in wells as a “wiggle”) Bromphenol turns yellow Solution pH change during electrophoresis Decrease power settings. Cool buffer to 4°C. Circulate buffer. Flush wells with electrophoresis buffer Inspect wells for trapped air bubbles Verify pH of buffer Circulate buffer during run Immunoblotting High background Insufficient blocking Overdevelopment Protein contamination Incomplete washing Primary or secondary antibody too concentrated Weak signal or no reaction Sample load insufficient Low antibody specificity Antigen not transferred Conjugate not active Increase concentration and/or time of blocking step Remove membrane from substrate after 1 min Wash or replace fiber pads and clean apparatus Increase wash time and volume Review recipe, especially Tween 20 Review supplier’s recommendations Run test strips to optimize reactions Increase amount of sample Increase antibody concentration Increase transfer time. Stain membrane for protein transfer. Mix more thoroughly COMMENTARY Background Information Agarose Gel Electrophoresis of Proteins The major use of agarose in protein analysis is its application as a matrix for molecular sieving; however, it is also widely used as a material that can be modified to form an affinity matrix for affinity chromatography. Because of its ability to separate proteins of very large size, it is also utilized for electrophoresis and preparation of very large proteins, ranging from several million to approximately fifty-thousand daltons. Agarose has the advantage of being nontoxic. In addition, it may be melted to allow recovery and further studies of the separated protein, and an excised band may be directly injected into an animal for immunization. Also, the use of native gels allows separation and recovery of nondenatured proteins for functional studies. The electrophoresis procedure outlined above illustrates the ability of agarose to separate proteins of molecular weights that exceed 6.7.10 Supplement 15 Current Protocols in Cell Biology 1 2 3 900 kDa 700 kDa 204 kDa 1.50 1.36 Optical density 1.26 1.13 1.01 normal 0.89 2B 2A 0.77 0.64 0.52 0.40 0 10 20 30 40 50 60 70 80 90 100 Millimeters Figure 6.7.2 Luminograph of vWF multimers from normal plasma (lane 1), von Willebrand disease Type 2B plasma (lane 2), and von Willebrand disease Type 2A plasma (lane 3). A densitometric tracing is seen below. Reproduced with permission from Krizek and Rick (2000). 1 × 106 Da. For smaller proteins, higher concentrations of agarose (e.g., 3%) and shorter blotting times may be used. In instances where electroblotting cannot be carried out because of precipitation of the proteins during transfer due to separation from detergent, the proteins can be immobilized in the gel to prevent diffusion before immuno-identification. Immobilization of the proteins also allows for the use of sequential antibodies for identification of protein bands. Additionally, in-gel identification may also be important if there is uneven transfer of proteins due to dissimilar transfer characteristics. Immobilization of the proteins in the gel is accomplished with the use of an agarose gel that is modified by the addition of glycidol to yield a glyceryl agarose that contains aldehyde groups after oxidation by periodate. Proteins are covalently bound in the gel after electrophoresis by reaction of their amino groups with the aldehydes in the presence of the reducing agent, sodium cyanoborohydride. Further direct probing with antibodies can be carried out without the need for transfer to another support (Shainoff, 1993). Composite gels of agarose or glyoxal agarose have also been prepared to provide differing degrees of sieving (Peacock and Dingman, 1968; Shainoff, 1993). Although few proteins are as large as vWF, the evaluation of von Willebrand factor multimers illustrates an important clinical application of the use of agarose as a medium for electrophoresis. Assessment for the presence of the largest multimers is physiologically important for the diagnosis of von Willebrand disease and for selection of the most appropriate treatment (Rick, 2001). The original procedure for this analysis (see Alternate Protocol, with minor modifications) included glycidol in the agarose which served to aid in the fixation of the protein bands while the further washing and antibody identification steps were accomplished (Hoyer and Shainoff, 1980). It was subsequently found that diffusion of protein bands was not a limiting factor with vWF, and this immobilization step was eliminated from the method. Electrophoresis and Immunoblotting 6.7.11 Current Protocols in Cell Biology Supplement 15 1 2 3 4 900 kDa 700 kDa 204 kDa 1.6 1.4 Optical density 1.2 1.0 0.8 plt 0.6 PNP 0.4 0.2 0 10 20 30 40 50 60 Millimeters 70 80 90 Figure 6.7.3 Luminograph of vWF multimers in pooled normal plasma (PNP; lanes 1 and 3) and vWF multimers extracted from platelets (plt; newly synthesized vWF; lanes 2 and 4). The densitometric tracing below shows the earlier “take-off” of the platelet vWF, indicating larger multimers. Adapted with permission from Krizek and Rick (2000). Analysis of the distribution of von Willebrand factor multimers is also used to assess the function of an important protease that cleaves von Willebrand factor and decreases the prothrombotic “unusually high-molecularweight” multimers of von Willebrand factor; these multimers are initially synthesized and secreted into the circulation, but are cleaved by the vWF protease (Krizek and Rick, 2001; Aronson, Krizek, and Rick, 2001). Critical Parameters and Troubleshooting Agarose Gel Electrophoresis of Proteins It is important to maintain the temperature at 4°C during electrophoresis using the horizontal bed (see Basic Protocol). The blotting step must be carried out for a sufficient time to allow transfer of very high-molecular-weight proteins. Thorough washing after blocking buffer and antibody additions is important in both protocols. See Table 6.7.1 for troubleshooting agarose gel electrophoresis and immunoblotting. Anticipated Results The radiographs that result from the chemiluminescent and radioactive detection procedures show a wide distribution of multimer sizes of normal von Willebrand factor. In certain subtypes of von Willebrand disease (i.e., Type 2) there is a marked or modest decrease in the higher-molecular-weight multimers (Fig. 6.7.2). If newly synthesized von Willebrand factor is extracted from platelets, the unusually high-molecular-weight multimers are seen (Fig. 6.7.3). In samples that are incubated under conditions that activate the von Willebrand factor protease, a decrease in the high and intermediate sized multimers is seen (Fig. 6.7.4; Rick and Krizek, unpub. observ.). Time Considerations Both protocols should be started in the morning to allow sufficient time for electrophoresis. Horizontal electrophoresis and blotting can be completed within 48 hours: blotting is conveniently completed overnight and detec- 6.7.12 Supplement 15 Current Protocols in Cell Biology PNP 1 53% 78% 2 3 4 5 79% 6 7 8 900 kDa 700 kDa Figure 6.7.4 Luminograph of pooled normal plasma (PNP) showing normal vWF multimers (lane 1) and proteolysed multimers of normal vWF from PNP after exposure to conditions that activate the vWF protease (lane 2). Paired samples from patients with thrombotic thrombocytopenic purpura who have an inhibitor to the vWF protease are seen in lanes 3 to 8. Odd lanes contain plasma samples using conditions that do not activate the vWF protease, and even lanes contain the paired sample that was exposed to conditions that activate the protease. Very little proteolysis is observed in these patients’ plasmas due to the presence of an inhibitor (even lanes). The numbers above the patient lanes indicate the retention of the high-molecular-weight multimers. tion procedures can be completed the next day. The Alternate Protocol takes up to 5 or more days to obtain results, largely due to the time required for the incubation with antibody and development of the autoradiogram. Also, a radiolabeled antibody specific for the protein to be identified must be available. Literature Cited Aronson, D.L., Krizek, D.M., and Rick, M.E. 2001. A rapid assay for the vWF protease. Thrombosis and Hemostasis 85:184-185. Hoyer, L.W. and Shainoff, J.R. 1980. Factor VIIIrelated protein circulates in normal human plasma as high molecular weight multimers. Blood 55:1056-1059. Krizek, D.M and Rick, M.E. 2000. A rapid method to visualize von Willebrand factor multimers using agarose gel electrophoresis, immunolocalization, and luminographic detection. Thrombosis Research 97:457-62 Krizek, D.M. and Rick, M.E. 2001. Clinical application of a rapid method using agarose gel electrophoresis and western blotting to evaluate von Willebrand factor protease activity. Electrophoresis 22:946-949. Peacock, A.C. and Dingman, W. C. 1968. Molecular weight estimation and separation of ribonucleic acid by electrophoresis in agarose-acrylamide composite gels. Biochemistry 7:668-674. Rick, M.R. 2002. Hemophilia and von Willebrand disease. In UpToDate Clinical Reference Library, Release 9.1 (B.D. Rose, ed.) UpToDate, Wellesley, MA. Shainoff, J.R. 1993. Electrophoresis and direct immunoprobing on glyoxal agarose. In Advances in Electrophoresis, Vol. 6 (A. Chrambach, M.J. Dunn, and B.J. Radola, eds.) pp. 65-176. VCH Publishers, New York. Shainoff, J.R., Urbanic, D.A., and DiBello, P.M. 1991. Immunoelectrophoretic characterizations of the cross-linking of fibrinogen and fibrin by factor XIIIa and tissue transglutaminase. Identification of a rapid mode of hybrid alpha/gamma-chain cross-linking that is promoted by the gamma-chain cross-linking. J. Biol. Chem. 266:6429-6437. Key References Krizek and Rick, 2000. See above. This original paper of the procedure and use of immunoblotting and chemiluminescence for ararose gel electrophoresis provides the background and reasons for the development of this assay in the clinical laboratory setting. Hoyer and Shainoff, 1980. See above. This paper outlines the original “in-gel” procedure for the electrophoresis of very high molecular weight proteins and provides examples of its usefulness in understanding the structure of von Willebrand factor. Shainoff, 1993. See above. This reference provides general background and the rationale for the use of modified ararose for the separation and identification of (large) proteins by electrophoresis. Contributed by Dennis M. Krizek and Margaret E. Rick National Institutes of Health Bethesda, Maryland Electrophoresis and Immunoblotting 6.7.13 Current Protocols in Cell Biology Supplement 15 Fluorescence Detection of Glycoproteins in Gels and on Electroblots UNIT 6.8 The co-translational and post-translational covalent attachment of oligosaccharides to proteins is a common cellular event in eukaryotes, regulated by a variety of glycosidases and glycosyltransferases (Beeley, 1985; Reuter and Gabius, 1999; UNIT 15.2). Glycosylation profiles are dynamic, changing during development, differentiation, and disease. Glycosylation of proteins is critical to the adhesiveness of microorganisms and cells, cellular growth control, cell migration, tissue differentiation, and inflammatory reactions. Differences in glycosylation profiles are often used as a “barometer” to assess disease states. With the advent of proteomics, genome-wide protein analysis, there is renewed interest in the rapid and sensitive identification of glycoproteins by methods that do not require degradation of the protein component of the macromolecule (Packer et al., 1999; Hirabayashi et al., 2001). Until recently, there have been relatively few methods available for the direct analysis of glycans on proteins transferred to membranes and most especially of glycans on proteins within polyacrylamide gels (Packer et al., 1999; Koketsu and Linhardt, 2000; Raju, 2000) . Such methods could readily be incorporated into integrated proteomics platforms that utilize automated gel stainers, image analysis workstations, robotic spot excision instruments, protein digestion work stations, and mass spectrometers (Patton, 2000a,b). There are two principal approaches to the detection of glycoproteins in gels and on blots; reacting carbohydrate groups by periodate/Schiff’s base (PAS) chemistry and noncovalent binding of specific carbohydrate epitopes using lectin-based detection systems. The PAS method involves oxidation of carbohydrate groups, followed by conjugation with a chromogenic substrate (acid fuchsin, Alcian Blue), a fluorescent substrate (dansyl hydrazine, 8-aminonaphthalene-1, 3,6-trisulfonate, Pro-Q Emerald dye), biotin hydrazide, or digoxigenin hydrazide. Signal is detected directly in the case of the chromogenic or fluorescent conjugates and indirectly using enzyme conjugates of antibodies for bound digoxigenin or enzyme conjugates of streptavidin for bound biotin. Lectins permit detection of certain structural subclasses of glycoproteins by similar methods to those used in standard immunoblotting applications. Typically, lectin conjugates of biotin along with enzyme conjugates of streptavidin or direct conjugates of lectin and enzyme are utilized along with chromogenic, fluorogenic, or chemiluminescent substrates. Just as in immunoblotting, the most popular enzymes used to detect lectin or streptavidin are alkaline phosphatase and horseradish peroxidase. This unit describes periodate/Schiff’s base and lectin methods for the detection of glycoproteins. The Pro-Q Emerald 300 glycoprotein detection method permits fluorescent direct detection of glycoproteins in gels (see Basic Protocol 1) or on blots (see Alternate Protocol) without the use of enzyme amplification systems. The method may also be used to detect lipopolysaccharides, constituents of the outer membrane surrounding gram-negative bacteria. The Pro-Q glycoprotein blot stain protocol for concanavalin A (see Basic Protocol 2) is suitable for the detection of glycoproteins containing α-mannopyranosyl and α-glucopyranosyl residues on blots using an alkaline phosphatase–based signal amplification system. Using different enzyme-lectin conjugates, such as alkaline phosphatase conjugates of wheat germ agglutinin or Griffonia simpliifolia lectin II (GS-II), the method can be adapted to the detection of other glycan structures present in glycoproteins. Electrophoresis and Immunoblotting Contributed by Wayne F. Patton Current Protocols in Cell Biology (2002) 6.8.1-6.8.15 Copyright © 2002 by John Wiley & Sons, Inc. 6.8.1 Supplement 16 BASIC PROTOCOL 1 FLUORESCENT DETECTION OF GLYCOPROTEINS IN POLYACRYLAMIDE GELS Pro-Q Emerald 300 Glycoprotein Gel Stain Kit provides a robust method for differentially staining glycosylated and non-glycosylated proteins in the same gel. The technique combines the green fluorescent Pro-Q Emerald 300 glycoprotein stain with the orange-red fluorescent SYPRO Ruby total protein gel stain. Pro-Q Emerald 300 glycoprotein stain reacts with periodate-oxidized carbohydrate groups, creating a bright green-fluorescent signal on glycoproteins. Using this stain allows detection of <1 ng glycoprotein/band, depending upon the nature and the degree of glycosylation, making it 100-fold more sensitive than the standard periodic acid–Schiff base method using acidic fuchsin dye (rosaniline). The green-fluorescent signal from the Pro-Q Emerald 300 stain can be visualized using a standard 300-nm UV (UV-B) illumination source. The Pro-Q Emerald 488 Glycoprotein Gel Stain Kit is quite similar to the Pro-Q Emerald 300 Glycoprotein Gel Stain Kit, but it is optimized for use with gel scanners equipped with 470- to 488-nm lasers. The Pro-Q Emerald dye staining method is more reliable than mobility-shift assays using glycosidases since even glycoproteins that are not susceptible to deglycosylation with specific enzymes may readily be identified as glycoproteins. After detecting glycoproteins with Pro-Q Emerald 300 dye, total protein profiles may be detected using SYPRO Ruby protein gel stain. SYPRO Ruby protein gel stain interacts noncovalently with basic amino acid residues in proteins. The stain is capable of detecting <1 ng of protein/band, making it at least as sensitive as the best silver staining procedures available. The orange-red fluorescent signal from SYPRO Ruby protein gel stain can be visualized using a standard 300-nm UV (UV-B) illumination source, or alternatively may be excited using 470- to 488-nm laser, gas discharge, or xenon arc sources. Materials Protein sample of interest Fix solution (see recipe) Wash solution (see recipe) Pro-Q Emerald 300 Glycoprotein Gel Stain Kit (Molecular Probes) containing: 50× Pro-Q Emerald 300 reagent, concentrate in DMF Pro-Q Emerald 300 dilution buffer Periodic acid (oxidizing reagent; see recipe) CandyCane glycoprotein molecular weight standards (see recipe), sufficient volume for approximately 20 gel lanes SYPRO Ruby protein gel stain Deionized, high quality water 10% (v/v) methanol or ethanol, spectroscopy grade (optional) 7% (v/v) glacial acetic acid (optional) Polystyrene staining dishes (e.g., a weighing boat for minigels or larger container for larger gels) Orbital shaker UV transilluminator Photographic camera or CCD camera and appropriate filters Additional reagents and equipment for SDS-polyacrylamide gel electrophoresis (UNIT 6.1) Fluorescence Detection of Glycoproteins in Gels and on Electroblots 6.8.2 Supplement 16 Current Protocols in Cell Biology Run gel 1. Prepare the protein samples of interest (e.g., crude protein isolates, cell lysates, serum, partially purified plasma membranes) for SDS-polyacrylamide gel electrophoresis. Typically, the protein sample is diluted to ∼10 to 100 ìg/ml with 2× sample buffer, heated for 4 to 5 min to 95°C, and 5 to 10 ìl of diluted sample is then applied per gel lane for 8 × 10–cm gels. Larger gels require proportionally more material. For convenience, CandyCane glycoprotein molecular weight standards may also be applied to a lane or two. Typically, 2 ìl of this standard is diluted in 6 ìl of sample buffer and heated in the same manner as the samples to be characterized. These standards contain a mixture of glycosylated and non-glycosylated proteins ranging from 14 to 180 kDa in molecular weight. The standards serve as molecular weight markers and provide alternating bands as positive and negative controls for glycoprotein and total protein detection. Each protein is present at 0.5 mg/ml. 2. Separate proteins by SDS-polyacrylamide gel electrophoresis using standard methods (UNIT 6.1). The staining procedure is optimized for gels that are 0.5- to 1- mm thick. Fix gel 3. After electrophoresis, fix the gel by immersing it in 75 to 100 ml of fix solution in a polystyrene staining dish and incubating with gentle agitation (e.g., on an orbital shaker at 50 rpm) for 45 min at room temperature. 4. Wash the gel by incubating it in 50 ml wash solution with gentle agitation for 10 min at room temperature. Repeat wash one additional time. 5. Oxidize the gel in 25 ml periodic acid solution with gentle agitation for 30 min at room temperature. 6. Wash the gel in 50 ml wash solution with gentle agitation for 5 to 10 min at room temperature. Repeat this washing step two additional times. Stain gel for glycoproteins 7. Prepare fresh Pro-Q Emerald 300 staining solution by diluting the 50× Pro-Q Emerald 300 concentrate reagent 50-fold into Pro-Q Emerald 300 dilution buffer. For example, dilute 500 ìl of 50× Pro-Q Emerald 300 reagent into 25 ml dilution buffer to make enough staining solution for one 8 × 10–cm gel. 8. Incubate the gel in subdued light in 25 ml of Pro-Q Emerald 300 staining solution (step 7) while gently agitating for 90 to 120 min. The signal can be seen after ∼20 min and maximum sensitivity is reached at ∼120 min. Staining overnight is not recommended. 9. Wash the gel with 50 ml wash solution for 15 min at room temperature. Repeat this wash one additional time. Do not leave the gel in wash solution for >2 hr, as the staining signal will start to decrease. 10. Visualize the stain using a standard UV transilluminator. The Pro-Q Emerald 300 stain has an excitation maximum at ∼280 nm and an emission maximum near 530 nm. Stained glycoproteins can be visualized using a 300 nm UV-B transilluminator. 11. Document results before proceeding to the next step. Use a photographic camera or CCD camera and the appropriate filters to obtain the greatest sensitivity (see Fig. 6.8.1). Pro-Q Emerald dye signal will fade after SYPRO Ruby dye staining. Electrophoresis and Immunoblotting 6.8.3 Current Protocols in Cell Biology Supplement 16 66.0 82.0 66.0 45.0 Molecular weight (kDa) 42.0 31.0 31.0 21.5 18.0 14.0 14.0 6.5 66.0 82.0 66.0 45.0 Molecular weight (kDa) 42.0 31.0 31.0 21.5 18.0 14.0 14.0 6.5 Figure 6.8.1 Sensitivity and specificity of glycoprotein detection in 13% SDS-polyacrylamide gels using Pro-Q Emerald 300 glycoprotein gel stain. (A) Detection of glycoproteins using Pro-Q Emerald 300 glycoprotein gel stain. (B) Detection of the total protein profile using SYPRO Ruby protein gel stain. Lanes 1 and 2, broad range molecular weight markers containing the 45-kDa glycoprotein ovalbumin, 1000 and 250 ng, respectively. Lane 3, blank. Lanes 4 to 12, CandyCane molecularweight markers, a mixture of glycosylated and unglycosylated proteins (1000 to 3.9 ng, as two-fold serial dilutions). Gels were imaged using a Lumi-Imager F1 instrument (Roche Molecular Biochemicals). Both dyes were excited using the instrument’s 300-nm UV-B transilluminator and images were captured using the instrument’s cooled CCD camera. Pro-Q Emerald 300 dye signal was collected using the standard 520-nm band-pass emission filter. Gels were then stained with SYPRO Ruby protein gel stain and SYPRO Ruby dye signal was collected using the 600-nm band-pass emission filter provided with the instrument. Figure courtesy of Courtenay Hart, Molecular Probes. Stain the gel for total protein 12. In order to counter-stain non-glycosylated proteins in the sample, pour the SYPRO Ruby protein gel staining solution into a small, clean plastic dish. For one or two standard-size mini-gels, use ∼50 ml to 100 ml of staining solution; for larger gels, use 500 to 750 ml. 13. Place the gel into the staining solution and gently agitate (e.g., on an orbital shaker at 50 rpm) at room temperature. Fluorescence Detection of Glycoproteins in Gels and on Electroblots The staining time ranges from 90 min to 3 hr, depending upon the thickness and percentage of polyacrylamide in the gel. Specific staining can be seen in as little as 30 min. However, a minimum of 3 hr of staining is required for the maximum sensitivity and linearity. For convenience, gels may be left in the dye solution overnight or longer without over staining. 6.8.4 Supplement 16 Current Protocols in Cell Biology 14. After staining, rinse the gel in water for 30 to 60 min to decrease background fluorescence. Alternatively, to further decrease background fluorescence, the gel can be washed in a mixture of 10% methanol (or ethanol) and 7% acetic acid for 30 min instead of water. The gel may be monitored periodically using UV illumination to determine the level of background fluorescence. 15. Visualize the stain using an appropriate method (see Fig. 6.8.1). The stained gel is best viewed on a standard 300-nm UV-B transilluminator, though stain will be visible using a 254-nm UV-C or 365-nm UV-A transilluminator. Gels may also be visualized using various laser scanners: 473-nm (SHG) laser, 488-nm argon-ion laser, or 532-nm (YAG) laser. Alternatively, use a xenon arc lamp, blue fluorescent light, or blue light–emitting diode (LED) source. Gels may be photographed by Polaroid or CCD camera. Use Polaroid 667 black-and-white print film and the SYPRO protein gel stain photographic filter (Molecular Probes). FLUORESCENT DETECTION OF GLYCOPROTEINS ON ELECTROBLOT MEMBRANES ALTERNATE PROTOCOL Pro-Q Emerald 300 Glycoprotein Blot Stain Kit provides a robust method for differentially staining glycosylated and non-glycosylated proteins on the same electroblot. The technique combines the green fluorescent Pro-Q Emerald 300 glycoprotein stain with the orange-red fluorescent SYPRO Ruby total protein gel stain. The Pro-Q Emerald 300 glycoprotein stain reacts with periodate-oxidized carbohydrate groups, creating a bright green-fluorescent signal on glycoproteins. Using this stain, allows detection of <1 ng glycoprotein/band, depending upon the nature and the degree of glycosylation, making it 100-fold more sensitive than the standard periodic acid–Schiff base method using acidic fuchsin dye (rosaniline). The green-fluorescent signal from Pro-Q Emerald 300 stain can be visualized using a standard 300-nm UV (UV-B) illumination source. The Pro-Q Emerald 488 Glycoprotein Blot Stain Kit is quite similar to the Pro-Q Emerald 300 Glycoprotein Gel Stain Kit, but is optimized for use with gel scanners equipped with 470- to 488-nm lasers. The staining method is more reliable than mobility-shift assays using glycosidases since even glycoproteins that are not susceptible to deglycosylation with specific enzymes may readily be identified as glycoproteins. After detecting glycoproteins with Pro-Q Emerald 300 dye, total protein profiles may be detected using SYPRO Ruby protein blot stain. SYPRO Ruby protein blot stain interacts noncovalently with basic amino acid residues in proteins. The stain is capable of detecting <4 ng of protein/band, making it at least as sensitive as the best colloidal gold staining procedures available. The orange-red fluorescent signal from SYPRO Ruby protein blot stain can be visualized using a standard 300 nm UV (UV-B) illumination source or alternatively may be excited using 470- to 488-nm laser, gas discharge, or xenon arc sources. Materials Protein sample of interest PVDF membrane Fix solution (see recipe) Wash solution (see recipe) Pro-Q Emerald 300 Glycoprotein Blot Stain Kit (Molecular Probes) containing: 50× Pro-Q Emerald 300 reagent, concentrate in DMF Pro-Q Emerald 300 dilution buffer Periodic acid (oxidizing solution; see recipe) Electrophoresis and Immunoblotting 6.8.5 Current Protocols in Cell Biology Supplement 16 CandyCane glycoprotein molecular weight standards (see recipe), sufficient volume for ∼20 gel lanes SYPRO Ruby protein blot stain Methanol, spectroscopy grade (optional) Glacial acetic acid (optional) 95°C heat block Polystyrene staining dishes (e.g., weighing boat for minigels or larger containers for larger gels) Orbital shaker UV epi-illuminator Photographic camera or CCD camera and appropriate filters Additional reagents and equipment for SDS-polyacrylamide gel electrophoresis (UNIT 6.1) and electroblotting (UNIT 6.2) Run gel 1. Prepare the protein samples of interest (e.g., crude protein isolates, cell lysates, serum, partially purified plasma membranes) for SDS-polyacrylamide gel electrophoresis. Typically, the protein sample is diluted to ∼10 to100 ìg/ml with 2× sample buffer, heated for 4 to 5 min at 95°C, and then 5 to 10 ìl of diluted sample is applied per gel lane for 8 × 10–cm gels. Larger gels require proportionally more material. For convenience, CandyCane glycoprotein molecular weight standards may also be applied to a lane or two. Typically, 2 ìl of this standard is diluted in 6 ìl of sample buffer and heated in the same manner as the samples to be characterized. These standards contain a mixture of glycosylated and non-glycosylated proteins ranging from 14 to 180 kDa in molecular weight. The standards serve as molecular weight markers and as alternate bands of positive and negative controls for glycoprotein and total protein detection. Each protein is present at 0.5 mg/ml. 2. Separate proteins by SDS-polyacrylamide gel electrophoresis using standard methods (UNIT 6.1). The procedure is optimized for gels that are 0.5- to 1-mm thick. Prepare blot 3. After electrophoresis, transfer the proteins to PVDF membrane using standard electroblotting procedures (UNIT 6.2). The use of nitrocellulose membranes is not recommended. 4. After transfer, fix the blot by immersing in 25 ml fix solution and incubate with gentle agitation (e.g., on an orbital shaker at 50 rpm) for 45 min at room temperature. 5. Wash the blot by incubating in 25 ml wash solution with gentle agitation for 10 min, room temperature. Repeat this wash step one additional time. 6. Oxidize the blot in 25 ml periodic acid solution with gentle agitation for 30 min. 7. Wash the blot in 25 ml wash solution with gentle agitation for 5 to 10 min. Repeat this washing step two additional times. Fluorescence Detection of Glycoproteins in Gels and on Electroblots Visualize glycoproteins 8. Prepare fresh Pro-Q Emerald 300 staining solution by diluting the 50× Pro-Q Emerald 300 concentrate reagent 50-fold into Pro-Q Emerald 300 dilution buffer. For example, dilute 500 ìl of 50× Pro-Q Emerald 300 concentrate reagent into 25 ml of dilution buffer to make enough staining solution for one 8 × 10–cm gel. 6.8.6 Supplement 16 Current Protocols in Cell Biology 9. Incubate the blot in the dark in 25 ml Pro-Q Emerald 300 staining solution (step 8) while gently agitating for 90 to 120 min, room temperature. The signal can be seen after ∼20 min and maximum sensitivity is reached at ∼120 min. Staining overnight is not recommended. 10. Wash the blot with 25 ml wash solution for 15 min at room temperature. Repeat this wash one additional time. Do not leave the blot in wash solution for >2 hr, as the staining signal will start to decrease. 11. Allow the membrane to air dry. 12. Visualize the stain using a standard 300-nm UV epi-illuminator. The Pro-Q Emerald 300 stain has an excitation maximum at ∼280 nm and an emission maximum near 530 nm. A UV transilluminator may also be used to visualize the glycoproteins, but this results in poorer detection sensitivity. 13. Document results before proceeding to the next step using a photographic camera or CCD camera with the appropriate filters to obtain the greatest sensitivity. Pro-Q Emerald dye signal will fade after SYPRO Ruby dye staining. Visualize total protein 14. In order to counter-stain non-glycosylated proteins in the sample, pour the SYPRO Ruby protein blot stain solution into a small, clean plastic dish. For one or two standard-size mini-blots, use ∼50 ml to 100 ml of staining solution; for larger blots, use 500 to 750 ml. 15. Place the air-dried blot face down onto the surface of the staining solution and gently agitate (e.g., on an orbital shaker at 50 rpm) for 15 min at room temperature. 16. After staining, rinse the blot in four changes of water for 1 min each to decrease background fluorescence. 17. Allow blots to air dry and visualize the stain using an appropriate method. The stained blot is best viewed on a standard 300-nm UV epi-illuminator, though stain will be visible using a 254-nm UV-C or 365-nm UV-A epi-illuminator. Blots may also be visualized using various laser scanners: 473-nm (SHG) laser, 488-nm argon-ion laser, or 532-nm (YAG) laser. Alternatively, use a xenon arc lamp, blue fluorescent light, or blue light–emitting diode (LED) source. Blots may be photographed by Polaroid or CCD camera. Use Polaroid 667 black-and-white print film and the SYPRO protein gel stain photographic filter (Molecular Probes). Exposure times vary with the intensity of the illumination source; for an f-stop of 4.5, ∼1 to 3 sec should be required. FLUORESCENT DETECTION OF GLYCOPROTEINS CONTAINING TERMINAL á-MANNOPYRANOSYL AND á-GLUCOPYRANOSYL RESIDUES ON ELECTROBLOT MEMBRANES Lectins are sugar-binding proteins of nonimmune origin capable of agglutinating cells or precipitating glycoconjugates (Beeley, 1985). The specific interactions between labeled lectins and oligosaccharides form the basis of glycoprotein detection after separation by gel electrophoresis and transfer to membranes by electroblotting. Concanavalin A is a tetrameric protein, with each subunit containing a carbohydrate-binding site, a calcium ion–binding site, and a manganese–ion binding site. Concanavalin A binds specifically BASIC PROTOCOL 2 Electrophoresis and Immunoblotting 6.8.7 Current Protocols in Cell Biology Supplement 16 to α-D-mannopyranosyl and α-D-glucopyranosyl residues, with substitutions or modifications at the C-3, C-4, or C-6 positions of the ring structure leading to greatly diminished binding (Beeley, 1985). The Pro-Q Glycoprotein Blot Stain Kit with concanavalin A utilizes alkaline phosphataseconjugated concanavalin A along with the fluorogenic substrate DDAO phosphate [9H(1,3-dichloro-9,9-dimethylacridin-2-one-7-yl) phosphate] to detect glycoproteins on nitrocellulose and poly(vinylidene difluoride) (PVDF) membranes. The detection procedure is similar to that of standard western (immuno)blotting. DDAO phosphate is rapidly converted to the long wavelength, red-fluorescent product, DDAO. DDAO absorbs maximally at either 275 nm or 646 nm and emits maximally at 659 nm. Consequently, the blots may be imaged using standard UV epi-illumination or with a laser-based gel scanner equipped with appropriate excitation source. The enzymatic amplification step greatly enhances the signal, allowing low nanogram detection of glycoproteins, a sensitivity on par with chemiluminescence detection methods. Pro-Q Glycoprotein Blot Stain kits with wheat germ agglutinin or with Griffonia simpliifolia lectin II (GS-II) allow detection of N-acetylglucosamine and sialic acid residues or terminal N-acetylglucosamine residues, respectively. The detection procedures for these lectins are quite similar to the concanavalin A method, and the same fluorogenic substrate, DDAO-phosphate is used in the kits. Materials Protein samples of interest PVDF membrane 50% methanol Wash solution II (see recipe) Blocking solution (see recipe) Pro-Q Glycoprotein Blot Stain Kit with Concanavalin A (Molecular Probes) containing: Concanavalin A, alkaline phosphatase conjugate (Con A-AP) stock solution (see recipe) DDAO phosphate stock solution (see recipe) Dimethylformamide (DMF) CandyCane glycoprotein molecular weight standards (see recipe), sufficient volume for ∼20 gel lanes Incubation buffer (see recipe) 10 mM Tris/1 mM MgCl2, pH 9.5 Polystyrene staining dishes (e.g., weigh boat for minigel or larger container for larger gels) Plastic wrap UV epi-illumination and a digital or film camera, or a laser equipped with a 633-nm helium-neon laser or 635-nm diode laser source Additional reagents and equipment for SDS-polyacrylamide gel electrophoresis (UNIT 6.1), electroblotting procedures (UNIT 6.2), and SYPRO Ruby protein blot staining (see Alternate Protocol) Run gel 1. Prepare the protein samples of interest (e.g., crude protein isolates, cell lysates, serum, partially purified plasma membranes) for SDS-polyacrylamide gel electrophoresis (UNIT 6.1). Fluorescence Detection of Glycoproteins in Gels and on Electroblots Typically, the protein sample is diluted to ∼10 to 100 ìg/ml with 2× sample buffer, heated for 4 to 5 min at 95°C, and 5 to 10 ìl of diluted sample is then applied per gel lane for 8× 10–cm gels. Larger gels require proportionally more material. 6.8.8 Supplement 16 Current Protocols in Cell Biology For convenience, CandyCane glycoprotein molecular weight standards may also be applied to a lane or two. Typically, 2 ìl of this standard is diluted in 6 ìl of sample buffer and heated in the same manner as the samples to be characterized. These standards contain a mixture of glycosylated and non-glycosylated proteins ranging from 14 to 180 kDa in molecular weight. The standards serve as molecular weight markers and as alternating bands of positive and negative controls for glycoprotein and total protein detection. Each protein is present at 0.5 mg/ml. 2. Separate proteins by SDS-polyacrylamide gel electrophoresis using standard methods (UNIT 6.1). The procedure is optimized for gels that are 0.5- to 1-mm thick. Blot proteins 3. After electrophoresis, transfer the proteins to PVDF membrane using standard electroblotting procedures (UNIT 6.2). The use of nitrocellulose membranes is not recommended. 4. Optional: Stain blots with SYPRO Ruby protein blot stain at this point to visualize the total protein pattern and to verify that the blotting procedure was successful. Follow the staining procedure described in Alternate Protocol, steps 14 to 17. Total protein staining must be performed prior to lectin blotting as the blocking mixture will produce very high background on the blot. Since SYPRO Ruby protein blot stain is washed off during the subsequent lectin blotting process, it is important to document staining results before continuing with the procedure. 5. If the PVDF blot is dry, briefly hydrate in 50% methanol and incubate in wash solution II for 10 min at room temperature. Repeat the wash step for a total of three washes. Visualize glycoproteins 6. Incubate the blot in blocking solution for 1 to 2 hr at room temperature. 7. Briefly pellet any potential protein aggregates in the Con A-AP stock solution by microcentrifugation. Using the supernatant only, dilute the Con A-AP stock solution 2000-fold by adding 5 µl to 10 ml of incubation buffer for a final concentration of 1 µg/ml. Remove the blocking solution that the blot is immersed in and incubate the blot with Con A-AP solution for 1 hr at room temperature. 8. Remove the diluted Con A-AP solution and wash the blot in blocking solution four times for 10 min each at room temperature. 9. Perform two final washes in wash solution II for 5 min each at room temperature. 10. Dilute the DDAO phosphate stock solution 1000-fold into 10 mM Tris/1 mM MgCl2, pH 9.5, for a final concentration of 1.25 µM. Approximately 1 ml of the DDAO phosphate staining solution will be needed for an 8× 10–cm blot. Note that DDAO phosphate is unstable when stored at room temperature as an aqueous solution. Always make up the DDAO phosphate staining solution just prior to use. 11. Incubate the blot in freshly prepared DDAO phosphate staining solution. The staining step may be performed either face up or face down, depending on the configuration of the imaging instrumentation being used. If using UV epi-illumination or a laser scanner with a light source that illuminates from above the imaging bed, stain the blot face up. For laser scanners with light sources that illuminate the blot from below the imaging bed, stain the blot face down. 12. Using powder-free gloves, cut a piece of plastic wrap to the size of the blot. For face-up staining, place the blot on the plastic wrap and pipet 1 ml of DDAO phosphate staining solution onto the blot. For face-down staining, pipet 1 ml of the DDAO Electrophoresis and Immunoblotting 6.8.9 Current Protocols in Cell Biology Supplement 16 phosphate staining solution onto the plastic wrap and lay the blot face down onto the solution, being careful not to trap air bubbles. The time required for optimal staining must be determined empirically because the substrate turnover rate depends on the amount of glycoprotein on the blot. Generally, a 5to 20-min incubation is sufficient, but overnight incubation is permissible. Do not wash the blot after staining as this will cause extensive loss of signal. The blot may be air-dried, however. 13. Visualize the fluorescent DDAO product using either UV epi-illumination and a digital or film camera, or using a laser equipped with a 633-nm helium-neon laser or 635-nm diode laser source. For UV epi-illumination, place the blot, signal side up, on a flat surface. For highest sensitivity and lowest background, use a UV-blocking filter, such as the SYPRO gel stain photographic filter. Long-pass filters with a cutoff at ∼630 nm are ideal for CCD-cameras. For laser scanners, place the blot, signal side down, on the scanner bed. For highest sensitivity, match the light sources and filters of the instrument as closely as possible to the absorbance maximum (646 nm) and emission maximum (659 nm) of DDAO. 14. If desired, the Con A-AP complex can be stripped off of the blot and the blot reprobed with another lectin-AP complex or an antibody-AP complex. To strip, incubate the blot in stripping buffer for 40 min at 50°C with gentle agitation. Then, wash the blot in wash buffer two times for 5 min each at room temperature. REAGENTS AND SOLUTIONS Use deionized or distilled water in all recipes and protocol steps. For common stock solutions see APPENDIX 2A; for suppliers, see SUPPLIERS APPENDIX. Blocking solution 50 mM Tris⋅Cl, pH 7.5 (APPENDIX 2A) 150 mM NaCl 0.2% (v/v) Tween 20 0.25% (w/v) Mowiol 4-88 (Calbiochem or VWR) Store up to 6 months at room temperature The use of Mowiol 4-88 in the Blocking buffer is not essential, but does decrease background staining and improves detection sensitivity. As an alternative to Mowiol 4-88, 0.5% (w/v) bovine serum albumin or 4% (w/v) gelatin (high purity, e.g., TopBlock from Juro Supply) may be used. CandyCane molecular weight standards For a standard lane on an 8 × 10–cm gel, dilute 0.5 µl of the standards with 7.5 µl of 2× sample buffer (see recipe) and vortex. This will result in ∼250 ng of each protein per lane, a sufficient amount for detection of the glycoproteins by the Pro-Q Emerald 300 stain. For large 16 × 18–cm gels, double the amount of standard and buffer used. Store up to 6 months at room temperature. Con A-AP stock solution Prepare a 2 mg/ml stock solution of Con A-AP by dissolving the vial contents in 250 µl deionized water and add 2 mM sodium azide. The stock solution is stable for at least 6 months when stored undiluted at 4°C. Do not freeze. Fluorescence Detection of Glycoproteins in Gels and on Electroblots 6.8.10 Supplement 16 Current Protocols in Cell Biology DDAO phosphate stock solution Add 200 µl DMF to the vial containing 250 µg DDAO phosphate {[9H-(1,3-dichloro-9, 9-dimethylacridin-2-one-7-yl] phosphate, diammonium salt} to make 1.25 mg/ml stock solution. Store the stock solution at –20°C, desiccated and protected from light. When properly stored, the stock solution should be stable for at least 6 months. When the solution turns a blue color, the substrate has broken down and is no longer usable. Prepare the working solution fresh. Fix solution Prepare a solution of 50% methanol and 50% deionized water. Store up to 6 months at room temperature. One 8 × 10–cm gel will require ∼100 ml of fix solution. Incubation buffer Prepare blocking solution (see recipe) with 1 mM CaCl2 and 0.5 mM MgCl2. Store up to 6 months at room temperature. Periodic acid solution Add 250 ml of 3% (v/v) acetic acid to the bottle containing the periodic acid (oxidizing solution) and mix until completely dissolved. Store up to 6 months at room temperature. Sample buffer, 2× 100 mM Tris⋅Cl, pH 6.8 (APPENDIX 2A) 20% (v/v) glycerol 4% (w/v) sodium dodecyl sulfate 0.1% (w/v) bromophenol blue Store up to 6 months at room temperature Wash solution Prepare a solution of 3% (v/v) glacial acetic acid in water. Store up to 6 months at room temperature. One 8 × 10–cm gel will require ∼400 ml of wash solution. Wash solution II Prepare a solution of 50 mM Tris⋅Cl, pH 7.5/150 mM NaCl. Store up to 6 months at room temperature. COMMENTARY Background Information The analysis of protein glycosylation is readily accomplished by polyacrylamide gel electrophoresis (Koch and Smith, 1990; Packer et al., 1997; Taverna et al., 1998; Koketsu and Linhardt, 2000). However, relatively few highsensitivity methods have been developed to reliably detect oligosaccharide residues covalently attached to proteins for visualization in polyacrylamide gels or on electroblot membranes (Packer et al., 1997; Packer et al., 1999; Koketsu and Lindhardt, 2000). Perhaps the most common procedure to visualize glycoproteins reported in the literature entails detection by periodic acid/Schiff (PAS) staining using the colorimetric acid fuchsin dye. A major limita- tion of this method is that detection sensitivity is poorer than Coomassie Blue staining, rendering the technique obsolete for modern highsensitivity proteomics investigations. Other methods in use include PAS-labeling with digoxigenin hydrazide followed by immunodetection with anti-digoxigenin antibody conjugated to alkaline phosphatase, or PAS-labeling with biotin hydrazide, followed by detection with horseradish peroxidase or alkaline phosphatase conjugated to streptavidin (Packer et al., 1995). Lectins are commonly employed to detect certain structural subclasses of glycoproteins by methods similar to those employed in immunoblotting (Koketsu and Lindhardt, 2000). All of these methods require that pro- Electrophoresis and Immunoblotting 6.8.11 Current Protocols in Cell Biology Supplement 16 teins be electroblotted to membranes first and many glycoproteins transfer relatively poorly. In addition, detection of glycoproteins after electroblotting is very time consuming compared with direct detection in gels. A recently developed approach to the detection of glycoproteins relies upon the utilization of a new fluorescent hydrazide, Pro-Q Emerald 300 dye, that is affixed to glycoproteins using a standard PAS conjugation mechanism (Steinberg et al., 2001). The glycols present in glycoproteins are initially oxidized to aldehydes using periodic acid. The dye then reacts with the aldehydes on the glycoproteins to generate the fluorescent conjugate. A reduction step with sodium metabisulfite or sodium borohydride is not required to stabilize the resulting conjugate. Critical Parameters All stock solutions should be prepared using deionized water (dH2O) having a resistance of at least 18 MΩ. All stock solutions may be stored for up to 6 months at room temperature, except when specifically indicated. Dilution of the DDAO phosphate stock solution or the Pro-Q Emerald 300 dye solution should be performed immediately prior to their use in the staining protocols. Both reagents are unstable when stored at room temperature as aqueous solutions. The staining methods outlined in this unit are highly sensitive and it is critical that all glassware and staining dishes be scrupulously clean. Gels and blots should never be touched or otherwise manipulated using bare hands. Always wear powder-free latex gloves when handling gels and blots during all staining procedures for the fluorescence detection of glycoproteins. Troubleshooting Fluorescence Detection of Glycoproteins in Gels and on Electroblots Should the detection sensitivity obtained using the cited fluorescence methods be suboptimal, there are two potential sources for the problem, either instrumental or chemical. With respect to the imaging instrument, it is important to clean the surface of the transilluminator after each use with deionized water and a soft cloth (e.g., cheesecloth). Otherwise, fluorescent dyes can accumulate on the glass surface and cause a high background fluorescence. The polyester backing on some pre-cast gels is highly fluorescent. For maximum sensitivity using a UV transilluminator, the gel should be placed polyacrylamide side down and an emission filter used to screen out the blue fluorescence of the plastic. For UV detection of fluorophores, a 300-nm UV-B transilluminator with six 15-watt bulbs is recommended. Excitation with different UV light sources, such as a simple hand held UV lamp will not provide the same level of detection sensitivity as a fullfledged transilluminator. For all three procedures described in this unit, using a Polaroid camera and Polaroid 667 black-and-white print film, the highest sensitivity is achieved with a 490-nm long-pass filter, such as the SYPRO protein gel stain photographic filter (S-6656; Molecular Probes). Gels are typically photographed using an f-stop of 4.5 for 2 to 4 sec, using multiple 1-sec exposures. Using a CCD camera, images are best obtained by digitizing at ∼1024 × 1024–pixels resolution with 12-, 14-, or 16-bit gray-scale levels per pixel. A 520-nm long-pass filter is suitable for visualizing Pro-Q Emerald dye, while a 580-nm longpass filter is appropriate for detection of DDAO. A CCD camera-based image analysis system can gather quantitative information that will allow comparison of fluorescence intensities between different bands or spots. Using such a system, the Pro-Q Emerald dye and the DDAO dye have a linear dynamic range of three orders of magnitude. A potential problem associated with the ProQ Emerald 300 glycoprotein gel stain is nonspecific labeling of non-glycosylated proteins. The most common source of this problem is the presence of residual SDS in the polyacrylamide gel. Adding an extra fixation step to the procedure should prevent its occurrence. The author finds that an overnight fixation step for two-dimensional gels is advisable. When detecting glycans using Pro-Q Emerald 300 glycoprotein gel stain, it is prudent to run control gels in which the periodate oxidation step has been omitted. Similar precautions are advisable when evaluating results using other glycoprotein detection methods. This avoids erroneous interpretation of results arising from low levels of noncovalent binding of dye molecules or confusion arising from the inherent fluorescence of certain high-abundance proteins in the gel profile. The most common problem encountered using the Pro-Q glycoprotein detection kit with concanavalin A is poor signal intensity. This is usually due to decomposition of the DDAO phosphate stock solution. When the stock solution appears by eye to be a blue color, the substrate has broken down and is no longer usable. 6.8.12 Supplement 16 Current Protocols in Cell Biology Table 6.8.1 Comparison of Commonly Used Glycoprotein Detection Methods for Polyacrylamide Gels and Electroblot Membranes Detection method Time required (hr) Detection sensitivity (1) α1-acid glycoprotein (40% CHO)a Number (2) glucose oxidase (12% CHO)a Assets (+) or liabilities (–) of steps (3) avidin (7% CHO)a Gels Blots Acid fuchsin sulfite (pararosaniline) 5-6 7 (1) 75 ng (2) 150 ng (3) 150 ng 20 ng 75 ng 75 ng (+) short procedure (+) can use either on blots or in gels (–) poor sensitivity Biotin hydrazide/ streptavidin-HRP Luminol detection reagents 6 11 (1) na (2) na (3) na 18-37 ng 37 ng 150 ng (–) signal fades over time, optimal image, 20-30 min (–) cannot save and reimage blots Biotin hydrazide/ streptavidin-alkaline phosphatase NBT/BCIP solution 5-6 11 (1) na (2) na (3) na 2 ng 5-9 ng 18-37 ng Pro-Q Glycoprotein Detection Kit with Con-A alkaline phosphatase (see Basic Protocol 2) 4 5 (1) na (2) na (3) na not detected <15.6 ng 15.6 ng Dansyl hydrazine 4 9 (1) 1.25-2.5 ng (2) 1.25-2.5 ng (3) 16-19 ng not tested (+) good sensitivity (+) can save and reimage blots (–) long procedure (–) cross reaction with carbonic anhydrase (+) can save and re-image blots (+) can strip and reprobe (+) can post-stain with total protein stains (+/–) stains specific subsets of glycoproteins (–) long procedure (+) inexpensive (–) requires longer exposure for competitive brightness (–) low-level non-specific detection of unglycosylated proteins (–) requires hot, acidified DMSO 11 (1) na (2) na (3) na 2 ng 5-9 ng 18-37 ng 7 (1) 300 pg (2) 300 pg (3) 1-2 ng 2 ng 18 ng 9 ng 5-6 Digoxigenin-3-Osuccinyl-ε-aminocaproic acid hydrazide/ Anti-digoxigenin-alkaline phosphatase. Stain with NBT/x-phosphate Pro-Q Emerald 300 Dye 2 (blots) 4 (gels) (see Basic Protocol 1 and Alternate Protocol) (+) good sensitivity (+) can save and reimage blots (–) long procedure (–) cross reaction with carbonic anhydrase (+) can use either on blots or in gels (+) great sensitivity (+) can save and re-image blots (+) short procedure (+) can counterstain unglycosylated proteins with SYPRO Ruby dye aAbbreviations: CHO, carbohydrate; na, not applicable. 6.8.13 Current Protocols in Cell Biology Supplement 16 Anticipated Results Literature Cited The performance characteristics of the ProQ Emerald 300 Glycoprotein Gel Stain Kit, Pro-Q Emerald 300 Glycoprotein Blot Stain Kit, and Pro-Q Glycoprotein Detection Kit with Concanavalin A are summarized in Table 6.8.1 and contrasted with alternative glycoprotein detection technologies. The fluorescencebased methods permit detection of lownanogram amounts of glycoprotein with a dynamic range of quantitation that encompasses three orders of magnitude of glycoprotein abundance. Pro-Q Emerald 300 dye may be used to detect a variety of glycoconjugates in addition to glycoproteins, such as bacterial lipopolysaccharides (LPS) and glycogen. Detection sensitivity for chondroitin 4-sulfate, however, is ∼3000-fold poorer than glycogen or LPS, with limits of detection in the vicinity of 16 µg of applied material. This is not unexpected as glycosaminoglycans such as chondroitin sulfate, hyaluronic acid, and keratan sulfate are known to stain poorly by conventional PAS procedures. Concanavalin A specifically binds to nonsubstituted and 2-O-substituted α-mannosyl residues and thus detects fewer glycoproteins than the Pro-Q Emerald 300 dye. For example, α1-acid glycoprotein is not detected by concanavalin A. Similarly, glycoproteins such as ovomucoid (28 kDa) and ovotransferrin (76 kDa) are not effectively detected by concanavalin A. The differences in staining specificity between the Pro-Q glycoprotein detection kit with concanavalin A, the Pro-Q glycoprotein detection kit with wheat germ agglutinin and the Pro-Q Emerald 300 glycoprotein stain kits can be exploited in defining structural features of glycans on glycoproteins. Beeley, J. 1985. Glycoproteins and proteoglycan techniques. In Laboratory Techniques in Biochemistry and Molecular Biology (R. Burdon and P. van Knippenberg, eds.) vol. 16, pp. 5-28. Elsevier Press, New York. Time Considerations The time considerations and number of steps required to detect glycoproteins using the ProQ Emerald 300 Glycoprotein Gel Stain Kit, Pro-Q Emerald 300 Glycoprotein Blot Stain Kit, and Pro-Q Glycoprotein Detection Kit with Concanavalin A are summarized in Table 6.8.1 and contrasted with alternative glycoprotein detection technologies. The methods can be completed in ∼2 to 4 hr and require 5 to 7 steps to complete. This compares favorably with other methods that may require as much as 6 hr and 11 steps to complete. Fluorescence Detection of Glycoproteins in Gels and on Electroblots Hirabayashi, J., Arata, Y., and Kasai, K. 2001. Glycome project: Concept, strategy and preliminary application to Caenorhabditis elegans. Proteomics 1:285-294. Koch, G. and Smith, M. 1990. The analysis of glycoproteins in cells and tissues by two-dimensional polyacrylamide gel electrophoresis. Electrophoresis 11:213-219 Koketsu, M. and Linhardt, R. 2000. Electrophoresis for the analysis of acidic oligosaccharides. Anal. Biochem. 283:136-145. Packer, N., Pawlak, A., Kett, W., Gooley, A., Redmond, J., and Williams, K. 1997. Proteome analysis of glycoforms: A review of strategies for the microcharacterization of glycoproteins separated by two-dimensional polyacrylamide gel electrophoresis. Electrophoresis 18:452-460. Packer, N., Ball, M., and Devine, P. 1999. Glycobiology and proteomics. In 2-D Proteome Analysis Protocols, Methods in Molecular Biology (A. Link, ed.) vol. 112, pp.341-352. Humana Press, Totowa, NJ. Patton, W. 2000a. A thousand Points of light; The application of fluorescence detection technologies to two-dimensional gel electrophoresis and proteomics. Electrophoresis 21:1123-1144. Patton, W. 2000b. Making blind robots see; The synergy between fluorescent dyes and imaging devices in automated proteomics. BioTechniques 28:944-957. Raju, T. 2000. Electrophoretic methods for the analysis of N-linked oligosaccharides. Anal. Biochem. 283:125-132. Reuter, G. and Gabius, H. 1999. Eukaryotic glycosylation: Whim of nature or multipurpose tool? Cell Mol. Life Sci. 55:368-422. Steinberg, T., Pretty On Top, K., Berggren, K., Kemper, C., Jones, L., Diwu, Z., Haugland, R., and Patton, W. 2001. Rapid and simple single nanogram detection of glycoproteins in polyacrylamide gels and on electroblots. Proteomics 1:841-855. Taverna, M., Tran, N., Merry, T., Horvath, E., and Ferrier, D. 1998. Electrophoretic methods for process monitoring and the quality assessment of recombinant glycoproteins. Electrophoresis 19:2572-2594. Key References Steinberg et al., 2001. See above. Describes detection of glycoproteins in gels and on blots using Pro-Q Emerald 300 Glycoprotein Detection Kits as well as the detection of concanavalin A–binding and wheat germ agglutinin–binding glycoproteins on blots using lectin–alkaline phosphatase conjugates and DDAO phosphate. 6.8.14 Supplement 16 Current Protocols in Cell Biology Berggren, K., Steinberg, T., Lauber, W., Carroll, J., Lopez, M., Chernokalskaya, E., Zieske, L., Diwu, Z., Haugland, R., and Patton, W. 1999. A luminescent ruthenium complex for ultrasensitive detection of proteins immobilized on membrane supports. Anal. Biochem. 276:129-143. Internet Resources Describes counter-staining with SYPRO Ruby dye for the detection of total protein profiles on electroblot membranes. http://www.glycosuite.com Berggren, K., Chernokalskaya, E., Steinberg, T., Kemper, C., Lopez, M., Diwu, Z., Haugland, R., and Patton, W. 2000. Background-free, highsensitivity staining of proteins in one- and twodimensional sodium dodecyl sulfate–polyacrylamide gels using a luminescent ruthenium complex. Electrophoresis 21:2509-2521. Describes counter-staining with SYPRO Ruby dye for the detection of total protein profiles in polyacrylamide gels. Lopez, M., Berggren, K., Chernokalskaya, E., Lazarev, A., Robinson, M., and Patton, W. 2000. A comparison of silver stain and SYPRO Ruby protein gel stain with respect to protein detection in two-dimensional gels and identification by peptide mass profilin g. Electrophoresis 21:3673-3683. Describes optimized methods for protein identification by matrix-assisted laser desorption time-offlight mass spectrometry after staining gels with SYPRO Ruby dye. http://www.cbs.dtu.dk/databases/OGLYCBASE/ O-GLYCBASE; a database of 198 glycoprotein entries with experimentally verified O-glycosylation site information. GlycoSuite; a relational database that curates information from the scientific literature on glycoprotein derived glycan structures, their biological sources, the references in which the glycan was described, and the methods used to determine the glycan structure. http://www.expasy.ch/tools/glycomod/ GlycoMod; a software tool designed to find all possible compositions of a glycan structure from its experimentally determined mass. http://www.probes.com Molecular Probes commercial Web site containing information about fluorescence detection technologies, including glycoprotein, total protein, lipopolysaccharides, and nucleic acids. Contributed by Wayne F. Patton Molecular Probes, Inc. Eugene, Oregon Electrophoresis and Immunoblotting 6.8.15 Current Protocols in Cell Biology Supplement 16 Digital Electrophoresis Analysis Gel electrophoresis has become a ubiquitous method in molecular biology for separating biomolecules. This prominence is the result of several factors, including the robustness, speed, and potentially high throughput of the technique. The results of this method are traditionally documented using silver halide–based photography followed by manual interpretation. While this remains an excellent method for qualitative documentation of single-gel results, digital capture offers a number of significant advantages when documentation requires quantitation and sophisticated analysis. Digital images of gel electropherograms can be obtained rapidly using an image-capture device, and the images can be easily manipulated using image analysis software. REASONS FOR DIGITAL DOCUMENTATION AND ANALYSIS There are several reasons to consider digital documentation and analysis of electrophoresis results. These justifications can usually be categorized into issues of ease of handling, accuracy, reproducibility, and cost. Ease of Handling A major advantage of the digital revolution has been in storage and retrieval of information. Storage in notebooks and filing cabinets previously meant that searching for specific data or experiments was a tedious manual process. With digital information, modern search engines can quickly find specific information in a fraction of the time usually required for a manual search. Making backup copies of nondigital data can be difficult, expensive, and time-consuming since it requires copying, retyping, or photographic reproduction. Copies of digital data can be generated more easily and at reduced costs. Manipulation of information is also easier when it is in a digital format. While the cut-andpaste analogy comes from physical documentation, it takes on a new perspective when applied digitally. Electrophoresis images can be resized, cropped, and inserted into reports. Data can be passed to spreadsheets and statistical packages for analysis and later insertion into notebooks and reports. These reports can be passed out via the Internet to colleagues throughout the world. A single individual can do all this in a few hours. Contributed by Scott Medberry and Sean Gallagher Current Protocols in Cell Biology (2002) 6.19.1-6.19.14 Copyright © 2002 by John Wiley & Sons, Inc. UNIT 6.9 Digital analysis also provides an easier method for handling the data when comparing large numbers of results or large numbers of separate experiments. Research that requires comparing the banding patterns on 1000 gels containing 50 lanes each can be an undertaking of heroic proportions if the analysis is performed manually. Database software can dramatically speed the analysis and handle the more mundane tasks, leaving the researcher free to interpret the data. Accuracy The human eye is an extremely versatile measuring instrument. It can handle light intensities covering a range of nearly nine orders of magnitude and is sensitive to a fairly wide spectrum of light (Russ, 1995). Yet the eye cannot accurately and reproducibly quantitate density and patterns, nor can it deal with large numbers of bands or spots. Accuracy of measurement is a primary reason for using digital analysis on electrophoretically separated proteins and nucleic acids. Two categories of accuracy are key to digital analysis: positional accuracy, which is important for mobility determinations such as molecular weight, and quantitative accuracy. Positional accuracy is based on both resolution of the recording medium and measuring accuracy. Silver halide–based recording has a theoretical resolution based on ∼2000 imaging elements (silver grains) per inch. Measurement traditionally occurs using a ruler, with an accuracy of ∼20 to 40 elements (50 to 100 elements per inch). In comparison, typical digital systems have 200 to 600 picture elements (pixels) per inch. The advantage that digital systems have is in measuring accuracy, which can occur at the level of a single imaging element. Quantitative accuracy is also an issue. The amount of material represented by a band or spot is difficult to determine accurately from an image of a gel unless it is a digital image. On a digital image, the amount present is directly correlated with the derived volume of the band or spot—the volume is calculated using the intensity values of the pixels within the object. Reproducibility Any technique or measurement is only as good as its ability to be faithfully replicated. With software-defined routines, measurements Electrophoresis and Immunoblotting 6.9.1 Supplement 16 are performed in the same manner every time. Allowing the computer to do repetitive tasks and complicated calculations minimizes the chance for individual errors. This does not imply that such measurements are correct, just that they are reproducible. An incorrect routine or algorithm can also invalidate data. Cost A consideration when evaluating any laboratory method is cost. Digital electrophoresis analysis equipment can be expensive. In many cases, however, it offers the only method for achieving acceptable analysis performance. In other cases, equal performance can be achieved using silver halide technology. However, traditional photography can also be expensive when the costs of consumable supplies such as film and developers, as well as other expensive requirements such as developing tanks and dark rooms, are included. Often, digital methods can be a good choice when all costs are considered. KEY TERMS FOR IMAGING There are several specialized terms encountered during digital image analysis. The most commonly encountered are contrast, brightness, gamma, saturation, resolution, and dynamic range. They describe controls on how the light detectors report a range of light intensities. Below is a brief description of each. Contrast Digital Electrophoresis Analysis Contrast describes the slope of the light intensity response curve. An increase in the contrast increases the slope of the curve. The result is a more detailed display over a narrowed range of intensities with less detail in the remaining portions of the intensity range. This is depicted in Figure 6.9.1A and 6.9.1B, where a normal, unadjusted image and a contrast-adjusted image are displayed, respectively. The contrast was increased on midrange intensity values in Figure 6.9.1B to highlight band intensity differences at the expense of background information. Images with a narrow range of informative intensities can benefit from increasing the contrast, since that effectively increases the scale and improves detection of minor differences in intensity. Contrast settings should be lowered if information is being lost outside of the contrast range. For example, in Figure 6.9.1B, loss of background information between peaks indicates that this image should not be used for quantitation. Brightness While brightness can have many different definitions, only one will be considered here. Brightness shifts the light intensity response curve without changing its slope as is shown in Figure 6.9.1C. Another name for brightness is black level, since it is commonly used to control the number of black picture elements (pixels) in an image. Incorrect brightness levels can lead either to high background and potential image saturation or, as is illustrated in Figure 6.9.1C, to a total loss of background information and partial loss of band information. Gamma Nonlinear corrections are often applied to images to compensate for how the eye perceives changes in intensity, how display devices reproduce images, or both. The most common correction is an exponential one, with the exponent in the equation termed the gamma. A typical gamma value for camera-based systems is 0.45 to 0.50, and is illustrated in Figure 6.9.1D. This is a compromise value that compensates for the 2.2 to 2.5 gamma present in most video monitors and the print dynamics of most printers. Since it is a nonlinear correction, special care must be taken if quantitation is desired. Unless directed to by the manufacturer, gamma values other than 1.0 should be avoided when quantitating. More information on gamma correction can be found on Poynton’s Gamma FAQ (www.inforamp.net/∼poynton/ Poynton-color.html). Dynamic Range Dynamic range describes the breadth of intensity values detectable by a system and is usually expressed in logarithmic terms such as orders of magnitude, decades, or optical density (OD) units. A large dynamic range is important when trying to quantitate over a wide range of concentrations. The most accurate quantitation occurs in the linear part of the dynamic range, which is usually not the complete dynamic range of the system. An additional consideration is the dynamic range of the visualization method. Many popular visualization methods have linear dynamic ranges of 1 to 2.5 orders of magnitude. An imaging system with greater dynamic range analyzing the results of such a visualization method will not improve the dynamic range. Saturation Saturation occurs when a detector or visualization method receives input levels beyond 6.9.2 Supplement 16 Current Protocols in Cell Biology A normal Output 100 0 0 Input B 100 200 300 400 500 contrast Output 100 0 0 100 200 300 400 500 Input C brightness Output 100 0 0 100 200 300 400 500 Input D gamma Output 100 0 0 Input E 100 200 300 400 500 saturation 100 0 0 100 200 300 400 500 Figure 6.9.1 Examples of how altering image capture settings affects the image and the analysis. The graph on the left displays the light intensity response curve used for image capture while the image and resulting lane profile on the right display how the setting affects the image. The lane profile displays pixel position versus normalized pixel intensity (A). In this case, the output has not been altered, giving a straight line with a slope of 1 on the response curve. (B) The image acquisition was adjusted to increase the contrast of the displayed image. Although useful for images with a narrow range of informative intensity values, increasing the contrast can lead to a loss of low and high values. (C) Decreasing the brightness reduces peak values but also leads to a loss of the weak bands and original background. (D) Gamma adjusts raw data to appear more visually accurate. Note that this leads to a loss of fidelity between the adjusted image and the original. (E) Saturation indicates that the detector is reporting its maximum value or that the dynamic range for the visualization method has been exceeded. Electrophoresis and Immunoblotting 6.9.3 Current Protocols in Cell Biology Supplement 16 high-resolution peaks medium-resolution peaks 42 µm Intensity 168 µm 840 µm 0 100 Pixel position Figure 6.9.2 The effect of spatial resolution on the ability to detect closely spaced objects. Whole-cell protein lysates from E. coli were separated using SDS-PAGE and visualized with Coomassie blue staining. An image was captured at 42 µm (600 dpi), 168 µm (150 dpi), and 840 µm (30 dpi) from a segment of the lane, and a lane profile was generated for each image. The lane profiles have offset intensities to allow for comparison. Only major bands can be detected with the low-resolution image (840 µm); at higher resolutions more bands are detectable. the maximum end of the dynamic range. This results in a loss of detail and quantitative information from those data points that are saturated. For fluorescent and luminescent samples, reduction in the sampling time can sometimes correct saturation problems. Optical densitybased visualization techniques can also generate saturated images, as is illustrated in Figure 6.9.1E; this can sometimes be avoided with longer sampling times or increased detection source intensities. More often, it will be necessary to perform another electrophoresis with more dilute samples or to alter the visualization process to generate a less optically dense material. Resolution Digital Electrophoresis Analysis Resolution is the ability of a system to distinguish between two closely placed or similar objects. Three types of resolution are important for analysis—spatial resolution, intensity resolution, and technique-dependent resolution. Spatial resolution is the ability to detect two closely placed objects in one-, two-, or threedimensional space. It is most accurately described as the closest distance two objects can be placed and still be detected as separate ob- jects. In practice, it is often defined nominally in terms of the number of detectors per unit area such as dots per inch (dpi) or the number of detectors present in total or in each dimension such as 512 × 512 (262,144 total detectors). Actual resolution is less than half the nominal resolution due to the need for two detectors for every resolvable object (one for the object and one for the separation space) and the effects of optical resolution. Figure 6.9.2 demonstrates how spatial resolution can affect detection of objects. The 42-µm resolution image allows detection of closely spaced bands, the 168-µm resolution image detects fewer bands, and the 840-µm resolution image detects only major bands. For instruments with on-line detection systems, a pseudo spatial resolution is often reported in units of time from the start of the separation or the time interval between two objects crossing the detection path. Intensity resolution is the ability to identify small changes in intensity. It is a function of both the dynamic range of a detector and the number of potential values that detector can report. Greater dynamic range decreases the intensity resolution of a given detector. The number of potential values a detector reports is 6.9.4 Supplement 16 Current Protocols in Cell Biology described by its bit depth. An 8-bit detector can report 256 (28) different possible values, while a 12-bit detector can report 4,096 (212) values, and a 16-bit detector can report 65,536 (216) values. The higher the bit depth, the greater the intensity resolution. Technique-dependent resolution directly affects the spatial and intensity resolution. Electrophoretic separation techniques that generate overlapping objects or that have object separation distances shorter than the spatial resolution will fail to provide reliable data. Many factors, including the amount of sample loaded, gel pore size, buffer constituents, and electrophoresis field strengths, can dramatically affect separation and resolution of biomolecules. Likewise, detection methods that can only generate a small range of discrete intensity values will not benefit from systems with improved intensity resolution. IMAGE CAPTURE Devices Capturing digital images involves a detection beam or source, a sensor for that beam or source, and some method of assembling a twodimensional image from the data generated. Most systems use a light source for detection. The light wavelengths used range from ultraviolet (UV) to infrared (IR) and can be broad spectrum or narrow wavelength. Broad-spectrum detection is more versatile since it can often be used for more than one detection wavelength. However, when compared to narrowwavelength sources such as lasers, broad-spectrum detection suffers from reduced sensitivity and reduced dynamic range. While many types of light sensors have been used, including charge-coupled devices (CCDs), charge-injection devices (CIDs), and photon multiplier tubes (PMTs), technology advances in CCDs have led to their dominance. CCDs are semiconductor imaging devices that convert photons into charge. This charge is then read and converted into a digital format via an analogto-digital converter (ADC). The method of image assembly depends on the light source and detector geometry. One method is to capture the image all at once using a two-dimensionally arrayed CCD detector similar to the detectors found in digital and video cameras. Typically a camera-type sensor is paired with a light source that evenly illuminates the sample. This same sensor is often used with fluorescent and chemiluminescent detection methods, as its ability to detect light con- tinuously over the entire sample reduces image capture times. Another method of image assembly is to capture the image a line at a time. This typically involves a linearly arrayed CCD scanning slowly across the sample in conjunction with the detection beam of light. The data from each line is then compiled into a composite image. Spatial resolution in this method can be significantly better on large-format samples than the resolution of a camera-based system. This method is also advantageous when ODbased detection is used, since the more focused light beam is usually of higher intensity and can penetrate denser material. A third method of image assembly is to use a point light source and single-element detector on each point on a sample. The image is then compiled from each point sampled. This method is slower than the others but can offer extremely high resolution and sensitivity. A fourth commonly encountered m eth od is that of generating a pseudoimage of electrophoresis results through the use of a finish line type of detection system. This is comprised of a light source positioned at the bottom of the gel (i.e., the end opposite of the site of sample loading) and light detectors positioned next to each lane to detect the transmitted light or emitted fluorescence. A lane trace is generated using time on the x axis and light intensity on the y axis. The pseudoimage is then generated from this data (Sutherland et al., 1987). Capture Process Prior to image capture, electrophoretic separation and any visualization steps are performed. To calibrate the separation process, standards are usually run at the edges of the gel and often at internal positions. If quantitation of specific proteins or nucleic acids is to be performed, a dilution series of standards with similar properties to the experimental samples should also be included. After separation, the protein or nucleic acid is visualized if necessary. Visualization can include binding of a fluorochrome or chromophore such as Coomassie blue, precipitation of metal ions such as copper, silver, or gold, enzymatic reactions, and exposure of film or phosphor screens to radiant sources. These methods can be grouped based on the type of detection into optical density, fluorescence, chemiluminescence, and radioactivity. The suitability of popular detection devices with these methods is described in Table 6.9.1. Once visualization has occurred, image capture consists of the following steps: previewing the image while Electrophoresis and Immunoblotting 6.9.5 Current Protocols in Cell Biology Supplement 16 Table 6.9.1 Methodsa Compatability of Popular Image-Capture Devices with Common Visualization Image-capture device Visualization method Optical densityb Fluorescence Chemiluminescence Radioactivity Silver halide photography CCD camera Desktop scanner Storage phosphor Fluorescent scanner + + ++ − − + + + + ++ − − − − − ± ++ ++ − − aThe device with the highest sensitivity and greatest dynamic range for a visualization method is marked with a ++, other devices that can detect this visualization method are indicated with a +, and devices that are not suitable for a visualization method are indicated with a −. A ± indicates that only some devices of this type can be used with this visualization method. bOptical density methods include Coomassie blue staining. Digital Electrophoresis Analysis adjusting capture parameters, capturing the image, and saving the image for later analysis. During the preview process, capture parameters are optimized for data content and for ease and rapidity of later processing steps. Typically, the first step is to place the sample so that when the image is captured, the rectangular edges of the gel are horizontal and vertical on the monitor and any lanes are either horizontal or vertical. Since band and spot detection will be much easier if the image is properly oriented, this eliminates the need to later rotate the image digitally. Image rotation is time-consuming and can result in spatial linearity errors (a change in the size and shape of objects in image) caused by rectangular image-capture device geometries. The next step for camera-based systems is to adjust magnification and to focus the sample image. For thicker samples, it might be necessary to reduce the aperture on camerabased systems to get a sufficient depth of field to focus the entire sample. Often at this point image imperfections—e.g., dust, liquid, or other foreign objects that will detract from later analysis—are detected, and they need to be removed. Next, image intensity is set. Within the area of interest on the image, band or spot peaks should have values less than the maximum saturated value, and the background should have nonzero values. This is usually accomplished through adjustment of the lightsource intensity or the sensor signal integration. If the device allows precapture optimization of other parameters such as spatial resolution, contrast, brightness, gain, or gamma, they are adjusted next. Note that this only applies to controls that affect the response of the sensor or processing of the image prior to a data reduction step and not to controls that affect the image at later stages. The latter process can enhance visualization of specific features but is best left to adjustments in look-up tables (LUTs) in later analysis steps rather than during image capture, since there is a risk of data loss during postacquisition image processing. LUTs are indexed palettes or tables where each index value corresponds to color or gray-scale intensity values present in an image. Many image analysis programs alter LUTs instead of image values directly, since it both is faster and does not change the original image data. Once all the capture parameters are optimized, the image capture process is initiated. This might take less than a second for images captured with camera-based detectors and up to hours for scanning single-point detectors. When the image has been captured, it should be carefully examined for content. It should fully capture the area of interest and the parameters should have been set so that all necessary information is detectable. Furthermore, it should be in a form that will allow for easy analysis. Extra time spent optimizing the capture parameters will often result in a reduction in total image analysis time and in an increase in data quality. When the best possible image has been captured, it often contains information outside the area of interest. While this is unlikely to cause problems with later analysis, it is often advantageous to crop the image so that the only portion that is saved contains the area of interest. This reduces the amount of disk space necessary to store the image, and the image usually will load and analyze faster with the analysis software. The last step in image capture is to save the image. Several options are available at this point, including choosing which location to 6.9.6 Supplement 16 Current Protocols in Cell Biology save the image at, what file type or format to use, and whether to use some form of compression. The location where the image is saved is not as trivial a question as it might seem if the image will need to be transferred to another computer at some point. File sizes can easily exceed 15 megabytes on high-resolution images. This is a manageable size for hard drives but exceeds current floppy drive sizes by an order of magnitude. There are software utilities available that will subdivide files into disk-size chunks and then reassemble them at the next computer, but this is an inconvenient and slow method. If the computer used to help capture the image is connected to a network, the image files can easily be transferred this way or potentially saved on a central server. Alternatively, several types of high-capacity removable media are available (e.g., Zip or Jazz). This usually requires the installation of additional hardware onto two or more computers but does make backing up data easier. Since image files can be very large, compression techniques are sometimes used to reduce disk space requirements. Compression algorithms use several methods, typically by replacing frequent or repetitive values or patterns with smaller reference values and by replacing pixel values with the smaller difference values describing the change in adjacent pixels. When the file is later decompressed, the compressed values are then replaced with the original information. Not all images compress equally, with simple images containing mostly repetitive motifs compressible by ≥90%, while complex images will benefit much less from compression. Because compression is a much slower method of saving files and will not benefit every file, compression is not used to save all files. Several different forms of compression are available but are separable into two main classes, lossless and lossy. Lossless methods faithfully and completely restore the image when it is decompressed (no loss of data) but offer only moderate file compression; compression values range from ∼10% to 90%, depending on the image. Examples of lossless compression include Huffman coding (Huffman, 1952), RLE (Run Length Encoding), and LZW (Lempel, Ziv, and Welch; Welch, 1984). In comparison, lossy methods such as JPEG (Joint Photographic Experts Group), MPEG (Moving Picture Experts Group), or fractal compression schemes can reach compression values of ≥98% (Russ, 1995). The trade-off is that not all information from the original file is recovered during decompression. Lossy compression is sometimes necessary for applications with extremely large image files such as real time video capture, but it usually represents an unacceptable loss of data if used with electrophoresis image capture. Many different file types have been developed to store digital images. Some of these file types are proprietary or hardware specific. For example, PICT is a Macintosh format and BMP is a PC-compatible format. Each file type has its own structure. Some types do not allow compression, for others it is optional, and for some it is mandatory. File types vary in the types of images they support, particularly in the number of colors or gray levels. Below is a brief description of a few of the more prevalent file types. TIFF (Tagged-Image File Format) is one of the most commonly used formats. It is particularly versatile since it is an open format that can be modified for specific applications. One reason for its versatility is the ability to attach or tag data to the image. The tags can include information such as optical density calibration, resolution, experimenter, date of capture, and any other data that the application software supports. TIFF images can be monochrome, 4-, 8-, or 16-bit gray-scale, or one of many colorimage formats. Compression is optional, with LZW, RLE, and JPEG often supported (Russ, 1995). Since TIFF is supported by both Macintosh and PC computers, it is a good choice for multiple-platform environments. The versatility of TIFF can also be a weakness. Since there are many different tagging schemes and since not all programs support all possible compression and color schemes, it is sometimes not possible for one program to access the information in a TIFF file generated by a different program. GIF (Graphics Interchange Format) is a file format that is widely encountered on the Internet due to its compactness and standardization. Its compactness is attributable to a mandatory modified LZW compression. Another feature of GIF is the use of a LUT to index the values in the image. One interesting ability of GIF is that it supports storing multiple images within a single file. This can offer some advantages for applications such as time-lapse image capture. A GIF image can contain no more than 256 individual color or gray levels and does not support intensity resolutions higher than 8 bit. In addition, since the image Electrophoresis and Immunoblotting 6.9.7 Current Protocols in Cell Biology Supplement 16 is implemented as a LUT, it also is not a true gray-scale image. Due to these limitations and others, alternative formats such as PNG have been developed to replace GIF. PICT is a file format and graphics metafile language (it contains commands that can be played back to recreate an image) designed for the Apple Macintosh. It can contain both bitmap images and vector-based objects such as polygons and fonts. It supports a ≤256-graylevel LUT, and monochrome images can be RLE compressed. Because it only offers a 256gray-level LUT, it has the same weaknesses that GIF does with true gray-scale and high-intensity-resolution images. In addition, any vector objects in the image are difficult to translate on a PC since they are designed to be interpreted by Macintosh QuickDraw routines. BMP is the native bitmap file format present on Windows-based PCs. It supports 2-, 16-, 256-, or 16-million-level images. With images of ≤256 gray levels, it implements a LUT, while the highest-resolution image is implemented directly. RLE compression is optional for 16and 256-gray-level images. Since compression is prohibited on 16 million-gray-level images and there is no intermediate level supported beyond 256 levels, BMP is not a good choice for images with high-intensity resolution requirements. ANALYSIS Once the image has been captured, the data needs to be analyzed and distilled into information about the results of the electrophoresis experiment. Through the use of standards and experimenter input, this software-driven process can estimate mass and quantity of objects in an image and detect relationships between objects within one image and between similar images. The type of software used depends on the analysis to be performed. Images from single electrophonetic separations are examined by one-dimensional analysis software optimized for lane-based band detection. Images from two-dimensional electrophoresis are best handled by specific programs designed to detect spots and to assign two mobility values and a quantity value to the spot. After the initial characterization of bands and spots, comparisons are often made between bands or spots from different experiments through the use of database programs and matching algorithms. Digital Electrophoresis Analysis Software for One-Dimensional Analysis Lane positioning For one-dimensional analysis, the first activity is to detect the lanes on the image. One of three different methods is commonly employed for this. For images with straight, welldefined lanes with a large number of bands, automatic lane-detection algorithms can quickly and accurately place the lanes. On images with very well-defined lanes, such as pseudoimages from finish-line type electrophoresis equipment, automated lane calling based on image position is possible. For images with “smiling,” bent, or irregular lanes, manual positioning of the lanes is often the fastest and most accurate method of lane definition. Regardless of the method of identifying the lanes, the lane boundaries need to be carefully set for accurate quantitation and mass determinations. Lane widths should be wide enough so that the entire area of all bands in that lane are included, but they should not be so wide as to include bands from adjacent lanes. To accomplish this, curved or bent lanes might need to be used in order to follow the electrophoresis lane pattern. Lane length and position also must be adjusted as necessary so that all bands of interest are included. If mass determinations are necessary, the sample loading point should probably also be included in the lane or be the start of the lane. At this point, lines of equal mobility (often called Rf or iso-molecular-weight lines) are added to the image as necessary. These lines allow for correction of lane-to-lane deviations in the mobility of reference bands and generate more accurate measurements of mass. A similar form of correction is also possible for withinlane correction of mobilities. This correction is important for accurate detection and quantitation of closely spaced bands. Band detection Once the lanes have been defined, the bands present in each lane need to be detected. There are many methods for detecting bands. One method is to systematically scan the lane profile from one end to the other, identifying regions of local maxima as bands. Another common method is to use first- and second-order derivatives of the lane image or lane profile in order to find inflection points in the change of slope in pixel intensity values (Patton, 1995). Regardless of the method used, it is often necessary to alter the search parameters so that they perform reliably under a given experimental condition. 6.9.8 Supplement 16 Current Protocols in Cell Biology Typical search parameters include ones for detection sensitivity, smoothing, minimum interband gaps, and minimum or maximum band peak size. Smoothing reduces the number of bands detected due to noise in the image. A minimum interband gap is often used to avoid detection of false secondary bands on the shoulders of primary bands. Limitations on peak sizes, especially for within-lane comparison to the largest band’s peak, can be a useful way to allow sensitive detection of bands in underloaded lanes without detecting false bands in overloaded lanes. Band edges are often detected in addition to band peaks in order to further define bands or to quantitate band amounts. This can be accomplished by using local minima, derivatives of the lane profile, or fixed parameters such as image distances or a percentage of band peak height. The band edges can be applied as edges perpendicular to the long axis of the lane or as a contour of equal intensity circling the band. The perpendicular method is advantageous for bands with uneven distribution of material across the face of the band, while the latter method is better for “smiling” or misshapen bands. Background subtraction With nearly all electrophoresis procedures, the most informative images have a low level of signal intensity at each pixel that does not result from protein or nucleic acid. Instead, this background intensity is attributable to the gel medium, the visualization method, electronic noise, and other factors. Since this background tends to be nonuniformly distributed throughout the image, failure to subtract it can make band detection and quantitation less accurate. Many methods of background subtraction are possible. Sometimes it is possible to generate a second image under conditions that do not detect the protein or nucleic acid. The second image is then digitally subtracted from the data-containing image to remove the background. More often, background information must be obtained from a single image. If the background varies uniformly across the image, a line that crosses the variation can be defined at a point where no bands are present. The intensity values at each point on the line can be used as the background value for the pixels perpendicular to the line at that point. Commonly, background is also present as variations in intensity along the long axis within each lane. One simple method is to take the lowest point in the lane profile as the background. Another method is to use an average value of the edge of each band as the background for that band. More complicated methods such as valley-tovalley and rolling-disk use local minima points in the lane profile to define a variable background along the length of the lane. Because there can be many different causes and distributions of background, no single method of background determination can be recommended for all experiments. Characterization Once lanes and bands have been detected, it is possible to interpret the mobility of the nucleic acid or protein bands. Depending on the method of electrophoretic separation, information on mass (length or size), pI, or relative mobility (Rf) can be inferred from mobility information. The mobility is characterized using a standard curve with internal standards of known properties. The type of curve depends on several parameters. By definition, with Rfbased separation, a linear first-order curve is used since it represents the linear relationship between mobility and Rf. Similarly, pI and mobility are generally linear in isoelectric focusing separations. For separations based on size, a curve generated from mobility versus the log of the molecular weight provides a relatively good fit as measured by the correlation coefficient (R2). Several other curves have been suggested for size-based separations, including modified hyperbolic curves and curves of mobility versus (molecular weight)2/3 that have good correlation coefficients (Plikaytis et al., 1986). In some cases, no single curve equation can adequately represent the data, and methods of fitting smooth contiguous curves using only neighboring points, such as a Lagrange or spline fit (described in Hamming, 1973), are necessary. This is most common for size separations with a very large range of separation sizes and with nonlinear gradient gels. Care must be taken with multiple-curve techniques since they rely on only a few data points for any one part of the composite curve, and outlying data points can drastically affect the outcome. For size and Rf determination, a uniform position must be found in each lane as a point from which to measure the mobility of each band. Many software analysis packages use the end of the lane as the measuring start point, so for them it is important to position each lane start point at an iso-molecular-weight or iso-Rf point. A convenient point is the well or sampleloading position since it is usually easily de- Electrophoresis and Immunoblotting 6.9.9 Current Protocols in Cell Biology Supplement 16 tectable and at an equal mobility position in each lane. A consistent point on each band must also be chosen to measure mobility. A band’s peak is easily defined in digital image analysis and is commonly used. Since peak positions are harder to detect visually than edges on silver halide images, the leading band edge is sometimes used when comparing digital results with silver halide–based results. Once lanes and bands have been detected, it is also possible to quantify the amount or at least relative amount of nucleic acid or protein present in each band. The amount in a band is related to the sum total of the intensity values of each pixel subtracted by the background value for each pixel in a band. For absorptively detected bands, intensity values are converted to OD values. The total value that is calculated is equivalent to the volume of the band and can be directly compared to other bands that are within the linear range for the visualization method. If standards of known amounts are loaded onto the same gel, they can be used to generate a standard curve that converts band volume into standard units such as micrograms. For greatest accuracy, it is important to be able to generate multiple standard curves when using visualization methods, such as Coomassie blue staining, that are affected by band or spot composition. Quantitation becomes more complicated when bands are not fully resolved. In this case, material from one band is contributing to the volume measurement of an adjacent band and vice versa. The simplest method for handling this is to partition into each band only the volume within its edges. Alternatively, a Gaussian curve can be fitted to each band and the volume contained within the curve used to estimate the amount of the band. Since most electrophoresis bands have a pronounced skew towards the leading edge of the band, modified Gaussian curves have also been used (Smith and Thomas, 1990). In either case, the curvefitting process is calculation intensive and can significantly increase analysis times for images with many bands. Software for Two-Dimensional Analysis Digital Electrophoresis Analysis In two-dimensional analysis, the first-dimension separation is performed in a single column or lane and then a second separation is performed perpendicular to the first. The result after visualization is a rectangular image of up to 10,000 spots. The most common two-dimensional gel type is one in which protein is sepa- rated first by apparent pI and second by molecular weight, although two-dimensional separation of nucleic acids is also possible. While many of the concepts and analysis techniques used with one-dimensional gels are applicable to two-dimensional gels, the complex nature of most two-dimensional gels requires somewhat different methodology. For example, spots are more difficult to detect since they are not conveniently arranged in lanes and can vary more in shape and overlap than bands. In addition, two-dimensional experiments usually require some method of comparing between two images, whereas one-dimensional images usually contain all of the information from an experiment. Spot detection Probably the most difficult aspect of two-dimensional analysis is efficient and accurate spot detection. If it is incorrectly done, it can lead to hours of manual editing. Due to the complexity and computational intensity of some algorithms, the detection process itself can last hours on relatively fast desktop computers. One theoretically effective but computationally intense method is to treat the image as essentially a three-dimensional image with spots treated as hills and background as valleys. A large number of Gaussian curves are then combined to describe the topology of the image. Many other methods make use of a digital-imaging technique known as filtering. In essence, filtering is a way to weight the value of a pixel and its neighbors in order to generate a new value for a pixel. By passing a filter across an image pixel by pixel, a secondary image is generated. Filters can be designed for many tasks, including sharpening an image or removing high-frequency noise. Filters can also be generated to help detect spots by making images that are first and second derivatives of the original image. The derivative images indicate inflection points in the intensity pattern and can be used to detect spot centers and edges. In a different method, called thresholding, filters can be used to detect the edges of objects. Instead of looking for inflection points, threshold filters identify intensities above a set level or at ratios between central and edge pixels above a set value. Since the edges on two-dimensional spots tend to be diffuse, sharpening filters are sometimes used prior to the thresholding filter. In some cases, multiple techniques are used to detect spots (Glasbey and Horgan, 1994). 6.9.10 Supplement 16 Current Protocols in Cell Biology Unlike one-dimensional detection, detection on images of two-dimensional experiments usually requires secondary processing to get acceptable performance. One example of a secondary process is to discard spots with sizes below a set minimum or above a set maximum. Another is to analyze spots that are oval for possible splitting into two spots. Even after secondary processing, it is likely that a small amount of manual editing will be necessary. When manually editing an image, care must be taken to use as objective criteria as possible, especially if two or more images are to be matched and spot volumes compared. Characterization In a two-dimensional system, determination of protein or nucleic acid mobility is complicated by the fact that there are two mobilities to account for and that the second-dimension separation tends to make estimation of the separation which occurred in the first dimension more difficult. One method for dealing with this is to have a series of markers in the sample that, after both separations are completed, are evenly distributed within the gel and image. It is also possible to estimate separation characteristics from calibration points located at the periphery of the gel. For example, distance measurements can be used to pass calibration data from the first dimension separation, and standards can be separated at the ends of the gel to calibrate for mobility in the second dimension. Regardless of the method used, in many instances, a series of related images will be examined and similar spots in each image will be matched. When this occurs, it is possible to calibrate one image and then pass the calibration information via the matches to the related images. Quantity determination is similar in many regards to that which occurs in one-dimensional analysis, but there are some differences. If spot edges are detected, a simple method of determining spot volume is to take the sum of the intensity value of each pixel in the spot reduced by a background intensity value. Multiple Gaussian curves can also be fitted to the spot to approximate the volume (Garrels, 1989). More difficult is attempting to compensate for a skewed distribution in a size-separating dimension while trying to use a regular Gaussian fit for a pI separation, such as is encountered with the most common form of two-dimensional protein separations. The distribution of background makes quantitation more difficult in two-dimensional gels. There is no lane-dependent component, so it is nec- essary to use other methods such as image stripes, finding local minimum values or using values derived from the spot edges to determine background values. Matching Matching is the process in which proteins or nucleic acids with similar separation properties are linked or clustered together. Matching can occur within one image or between multiple images as long as a frame of reference is established. Matching allows for comparisons between samples. It also makes annotation and data entry easier, since if one spot or band is matched to others and is characterized or annotated, this information is easily passed to all the other matches. An underlying assumption of matching is that objects with similar separation properties are actually similar. Care must be taken to confirm the identity of matched spots or bands by other methods on critical experiments. A simple form of matching is to link bands or spots at similar positions on the gel images. This works well when separation and imaging conditions are uniform. This is very seldom the case, since slight differences in the electrophoresis, visualization, and imaging conditions across a gel and between gels generates incorrect matching with this method. Since bands on one-dimensional gels are relatively easy to calibrate for mobility, matching can occur along contours of equal mobility. This dramatically decreases but does not eliminate the variability in detecting similar bands. Much of the remaining variability can be attributed to calibration errors. This error can often be compensated for by allowing a small tolerance in mobility values in determining whether a band is matched or not. Because of the difficulties in calibrating mobility in two-dimensional gels, it is often more practical to use matched spots for calibrating mobility than vice versa. Spot matching between two two-dimensional images starts with finding a small number of landmark spots that are used as seeds for subsequent matches (Appel et al., 1991; Monardo et al., 1994). There are many methods for finding the landmarks in both images, including finding the highest-intensity spots, finding spots in unique clusters, and manual positioning. The most common procedure from this point is to derive a vector that describes the direction and extent of the path from one matched spot to the other when the two images are superimposed. The vector is used as the basis for finding more matches near the landmark matches. To allow Electrophoresis and Immunoblotting 6.9.11 Current Protocols in Cell Biology Supplement 16 Figure 6.9.3 Example of a dendrogram generated from similarity data on band matching between lanes. DNA samples from 22 isolates of Listeria were subjected to Random Amplification of Polymorphic DNA (RAPD) analysis and the resulting electrophoresis image was analyzed with ImageMaster software (Amersham Pharmacia Biotech). Clustering was performed using the Dice coefficient with a tree structure based on the Unweighted Pair-Group Method using Arithmetic Averages (UPGMA). Similarity values between isolates can be determined by locating the node that connects the isolates and reading the value from the scale on the lower left edge of the dendrogram. Digital Electrophoresis Analysis for error, the area within a small radius is searched extending from the end of the vector. Once another match is found, its vector is computed and used as the starting point for finding neighboring matches. From this progression, the entire gel is matched. If all vectors are displayed graphically when matching is complete, questionable matches can often be identified as vectors that are significantly different from neighboring vectors. One specialized use of matching is as an estimator of the similarity and potential genetic relatedness of organisms. For example, on a one-dimensional gel image, a ratio of the matched to unmatched bands for each pairwise combination of lanes can be calculated. This ratio can be used as an indicator of similarity, with values near 1 indicating a pair of highly similar lanes, and values near zero indicating very dissimilar lanes. Assuming that the contents of the lanes are valid samples of the originating organism’s genetic makeup, the information on lane similarity can be converted to estimates of genetic similarity. A convenient way to display this similarity data graphically is to generate a dendrogram with similar objects close to each other and less similar objects more distantly placed. An example of such a dendrogram is presented in Figure 6.9.3, where samples from Listeria isolates are arranged based on banding pattern. 6.9.12 Supplement 16 Current Protocols in Cell Biology Databases In many cases, image analysis is not the last step in the process. The image and analysis data need to be archived in a searchable format. There may be a need to analyze the data from multiple experiments conducted at different sites or in laboratories around the world. Bioinformatic links to diverse data sources might be desired to help develop a unified understanding of the biology behind particular phenomena. When these situations arise, database programs can be utilized to store, link, and search image analysis results. As the number of images that are captured and analyzed grows, it becomes increasingly more difficult to find particular information from the large number of files that are stored. Relatively simple databases can be used if the major requirement is to find previously analyzed images and associated data. Such databases often display a miniaturized version of each image to aid in visual scanning for the file as well as simple searching for image-specific information such as date of analysis, file name, or other information that was entered at the time of image capture. More powerful database products are also available that can perform complex searches on data generated during the analysis. For an example, a search on a two-dimensional database might include finding proteins exhibiting a specific expression profile and having a molecular weight >20 kDa with a pI between 3 and 5 or 8 and 10 with an amount <50 ng in a series of experiments conducted <1 year ago. Such searches can quickly target potentially interesting molecules for further analysis. With the increasing ease of transferring data through the Internet as well as local- and widearea networks, it has become practical to quickly find and examine data from distant locations. Of course, great care must be taken to ensure that similar experimental conditions are employed, as otherwise the results will be difficult to compare. In this manner it is sometimes possible to dramatically increase the sample size and statistical accuracy as well as the probability of detecting rare events. In addition, if one data set is more completely characterized, this extra information can be extracted and applied to the other data set. For example if there is a band in common in two databases and there is sequence information for it in one database, that sequence information can be added to the other database. Currently most public electrophoresis database sites are twodimensional protein databases. A list with links to many of these Internet database sites can be found at http://www-lmmb.ncifcrf.gov/EP/table2Ddatabases.html. With biological questions becoming more complicated and the answers to the questions often requiring information from a variety of sources, it is becoming increasingly important to be able to move easily between information sources. A relational type of database can help achieve this. Unlike a conventional database with a fixed arrangement of data, relational databases have links between related files that allow for easy movement from one file to another. Another approach to interconnecting electrophoresis data with data from other sources is to generate a series of hypertext links between data sets, similar to what occurs on the Internet. Selecting a specific link moves the search to the related network site and the related information. Regardless of the method, the end goal is similar. An example of what is possible: a researcher selects a protein spot on a two-dimensional gel image, which triggers accessing of related information on this protein. The protein sequence is accessed from mass spectroscopy analysis of the spot on a separate gel. The sequence of the gene and the cDNA that generated the protein is retrieved. The expression pattern of the gene in various tissues and conditions, as well as information on similar genes in other organisms, is incorporated. Citations and annotations to this are retrieved as well. All of this information is compiled automatically into an interactive report about the protein. From this report, the researcher can formulate a more refined hypothesis and plan the most appropriate experiments to test it. LITERATURE CITED Appel, R.D., Hochstrasser, D.F., Funk, M., Vargas, J.R., Muller, A.F., and Scherrer, J.-R. 1991. The MELANIE project: From a biopsy to automatic protein map interpretation by computer. Electrophoresis 12:722-735. Garrels, J.I. 1989. The QUEST system for quantitative analysis of two-dimensional gels. J. Biol. Chem. 264:5269-5282. Glasbey, C.A. and Horgan, G.W. 1994. Image Analysis for the Biological Sciences. John Wiley & Sons, Chichester, England. Hamming, R.W. 1973. Numerical methods for scientists and engineers, 2nd ed. Dover Publications, New York. Huffman, D.A. 1952. A method for the construction of minimum-redundancy codes. Proc. Inst. Elect. Radio Eng. 40:9-12. Monardo, P.J., Boutell, T., Garrels, J.I., and Latter, G.I. 1994. A distributed system for two-dimen- Electrophoresis and Immunoblotting 6.9.13 Current Protocols in Cell Biology Supplement 16 sional gel analysis. Comput. Appl. Biosci. 10:137-143. INTERNET RESOURCES rsb.info.nih.gov/nih-image Patton, W.F. 1995. Biologist’s perspective on analytical imaging systems as applied to protein gel electrophoresis. J. Chromatogr. A. 698:55-87. NIH Image is free software that provides basic image analysis tools for the Macintosh. Plikaytis, B.D., Carlone, G.M., Edmonds, P., and Mayer, L.W. 1986. Robust estimation of standard curves for protein molecular weight and linear-duplex DNA base-pair number after gel electrophoresis. Anal. Biochem. 152:346-364. http://www.inforamp.net/∼poynton/Poynton-color .html Russ, J.C. 1995. The Image Processing Handbook. CRC Press, Boca Raton, Fla. Smith, J.M. and Thomas, D.J. 1990. Quantitative analysis of one-dimensional gel electrophoresis profiles. Comput. Appl. Biosci. 6:93-99. Sutherland, J.C., Lin, B., Monteleone, D.C., Mugavero, J., Sutherland, B.M., and Trunk, J. 1987. Electronic imaging system for direct and rapid quantitation of fluorescence from electrophoretic gels: Application to ethidium bromide– stained DNA. Anal. Biochem. 163:446-457. Welch, T.A. 1984. A technique for high performance data compression. IEEE Computer. 17:21-32. Contains an excellent description of gamma correction in the Gamma FAQ. http://www-Immb.ncifcrf.gov/EP/table2Ddatabases .html A list of links to many two-dimensional databases that are available via the Internet. Contributed by Scott Medberry Amersham Pharmacia Biotech San Francisco, California Sean Gallagher Motorola Corporation Tempe, Arizona KEY REFERENCES Glasbey and Horgan, 1994. See above. Describes general image-processing techniques as they are applied to biological images. Russ, 1995. See above. A general reference book on digital image capture and analysis. Sutherland, J.C. 1993. Electronic imaging of electrophoretic gels and blots. In Advances in Electrophoresis, Vol. 6. (A. Chrambach, M.J. Dunn, and B.J. Radola, eds.) pp. 1-41. VCH Verlagsgesellschaft mbH, Weinheim, Germany. Provides an overview of image capture with particular emphasis on types of capture equipment. Digital Electrophoresis Analysis 6.9.14 Supplement 16 Current Protocols in Cell Biology Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis UNIT 6.10 Wolfgang W.A. Schamel1 1 Max Planck-Institut für Immunbiologie und Universität Freiburg, Biologie III, Freiburg, Germany ABSTRACT Multiprotein complexes play crucial roles in nearly all cell biological processes. Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) is a powerful method to study these complexes. It is a native protein separation method that relies on the dye Coomassie blue to confer negative charge for separation. It has a higher resolution than gel filtration or sucrose density ultracentrifugation and can be used for protein complexes from 10 kDa to 10 MDa. If a second-dimension SDS-PAGE is applied (two-dimensional BN/SDSPAGE), the size, subunit composition, and relative abundance of the different multiprotein complexes can be studied. In recent years, there has been a large increase in the number of publications where BN-PAGE was used to study protein-protein interactions. Here, we give detailed protocols for the separation of multiprotein complexes by two-dimensional BN/SDS-PAGE and for a related technique to determine the stoichiometry of these C 2008 by John Wiley & Sons, complexes. Curr. Protoc. Cell Biol. 38:6.10.1-6.10.21. Inc. Keywords: multiprotein complex r native r gel electrophoresis r two-dimensional r Coomassie blue r protein-protein interaction INTRODUCTION Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE; Basic Protocol 1) separates native proteins and protein complexes independently of their individual isoelectric points, with high-resolution capacity. This is done by conferring a negative charge on all proteins via the dye Coomassie blue. The separation depends mainly on the size of the protein complex. In combination with a second-dimension sodium dodecyl sulfate–PAGE (SDSPAGE) in a perpendicular direction (Basic Protocol 2), it is an excellent choice to identify and characterize multiprotein complexes. It allows the determination of the size, subunit composition, and relative abundance of different multiprotein complexes from total cell and tissue homogenates, as well as from purified material. In addition, it is used for a one-step preparative purification of protein complexes. One critical step in performing high-quality BN-PAGE is the preparation of the sample, which has to be devoid of potassium and divalent cations. The most useful source for protein complexes is a cellular lysate or tissue extract. Preparation of a cellular lysate suitable for separation by BN gels is done by dialysis to remove any cations and metabolites (see Support Protocol). A detailed protocol for pouring and running of the BN gradient gels (see Basic Protocol 1) and denaturation of the separated proteins followed by separation using a second dimension SDS-PAGE (see Basic Protocol 2) is given. Visualization of the resulting two-dimensional gel can be done according to standard protocols, including general protein stains (UNIT 6.6) and immunoblotting, often referred to as western blotting (UNIT 6.2). A second dimension is not always required. Proteins can be detected after BN-PAGE by such standard procedures as general protein stains or transfer of the proteins to a Current Protocols in Cell Biology 6.10.1-6.10.21, March 2008 Published online March 2008 in Wiley Interscience (www.interscience.wiley.com). DOI: 10.1002/0471143030.cb0610s38 C 2008 John Wiley & Sons, Inc. Copyright Electrophoresis and Immunoblotting 6.10.1 Supplement 38 membrane under denaturing (see Alternate Protocol 1) or native (see Alternate Protocol 2) conditions followed by immunodetection. Using these protocols, there is a special requirement for the antibodies used to detect the proteins of interest, because Coomassie blue interferes with fluorescence-based visualization methods and because native proteins are often detected by different antibodies than those that detect denatured proteins. A powerful method to determine the stoichiometry of multiprotein complexes is the Native Antibody-based MObility Shift (NAMOS) assay (see Basic Protocol 3). It is based on one-dimensional BN-PAGE and uses the fact that proteins migrate more slowly during the electrophoresis when an anti-subunit antibody is bound. NOTE: High-purity water (e.g., Milli-Q or distilled water) should be used for all solutions. For cautions relating to electricity and electrophoresis, see Safety Considerations in the introduction to UNIT 6.1. NOTE: Wear powder-free gloves throughout the procedure and work on ice or at 4◦ C whenever native proteins/protein complexes are present. CAUTION: Acrylamide is hazardous; see APPENDIX 2A for guidelines on handling, storage, and disposal. BASIC PROTOCOL 1 FIRST-DIMENSION BLUE NATIVE ELECTROPHORESIS In this protocol, the pouring and running of vertical slab blue native (BN) gels is described. BN gels are gradient gels of low acrylamide percentage and strength. Thus, pouring and handling of the gels is not trivial. The gradient has to be even, in order to prevent any step that would result in the erroneous accumulation of proteins at a particular height of the gel. The BN gel solution with the higher acrylamide/bisacrylamide concentration is heavier than the low-percentage gel because of its high glycerol content. This density difference aids in establishment of a uniform gradient inside the glass plates. The same gel equipment that is used for normal SDS-PAGE can be used, but one has to be certain that no traces of SDS are present. To ensure absence of any detergent, the BN equipment should not be used for SDS-PAGE. BN gels are poured at room temperature and are cooled to 4◦ C before samples are loaded in the cold room. Alternatively, gel apparatuses that allow cooling can be used. Precast BN gels have recently been made commercially available, but in the author’s experience, these are not as good as self-made gels. It is strongly recommended to use multicasting equipment to pour several gels at once. This avoids steps of the gradient, saves time, and ensures best reproducibility for critical comparisons of multiple samples. Casting of multiple gradient gels is described in UNIT 6.1, Support Protocols 2 and 3, and Figures 6.1.3 and 6.1.4. Using these protocols, BN gels can be prepared using BN-specific solutions. Materials Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Low-percentage BN separating gel solution (see recipe) High-percentage BN separating gel solution (see recipe) Isobutyl alcohol 3× BN gel buffer (see recipe) BN stacking gel solution (see recipe) 100× pervanadate solution (optional, if phosphorylation must be preserved; see recipe) Sample: dialyzed cell lysate (Support Protocol), tissue homogenate, purified protein complex Marker mixes 1 and 2 (see recipe) BN anode buffer (see recipe) 6.10.2 Supplement 38 Current Protocols in Cell Biology BN cathode buffer (with 0.02% w/v Coomassie blue; see recipe) BN cathode buffer (with low, 0.002% w/v Coomassie; see recipe) Gel electrophoresis apparatus (see UNIT 6.1) Gradient mixer (self-made or, e.g., from BioRad; Fig. 6.1.2) Peristaltic pump (Fig. 6.1.2) Power supply Additional reagents and equipment for polyacrylamide gel electrophoresis (UNIT 6.1) and protein staining in gels (UNIT 6.6) Set up the apparatus 1. Wash glass plates and pouring devices extensively with water. Do not use equipment that has been previously used for SDS-PAGE. No traces of detergent should be present on the glass plates 2. Assemble the glass plate sandwich of an electrophoresis apparatus. UNIT 6.1 describes these procedures in detail. Prepare the gradient 3. Set up the equipment to pour gradient gels as shown in Figure 6.1.2 (UNIT 6.1). Gels will be poured at room temperature. For reproducibility, and to make the pouring more effective, it is recommended to pour at least 10 gels at once using multicasting equipment (e.g., BioRad). 4. Close the valves and place a magnetic stir bar into the mixing chamber of the gradient maker. Prepare low- and high-percentage BN separating gel solutions (see Reagents and Solution). Adjust the acrylamide/bisacrylamide concentration of the high-percentage BN separating gel solution according to your needs (Table 6.10.1). Add APS and TEMED only immediately before use. The volumes of the two solutions combined should be exactly equal to the volume required to fill the glass plate sandwich to the required height. When using multicasting equipment, the dead volume of the apparatus has to be determined empirically and added to the required volume of the gel solutions. 5. Pour the low-percentage (light) BN separating gel solution into the reservoir chambers and the high-percentage (heavy) BN separating gel solution into the mixing chamber of the gradient mixer (Fig. 6.1.2). 6. Open the interconnecting valve and force out the air bubble inside the connecting channel by pressing over the right cylinder with your thumb. CAUTION: Make sure to wear gloves, in order to avoid contact with acrylamide. Cast the Blue Native separating gels 7. Switch on the peristaltic pump, open the outlet valve, and allow the gel to slowly enter between the glass plates. Ensure that the needle at the end of the Tygon tubing is always above the height of the liquid, so that the gradient is not disturbed. When using multicasting equipment, the gel solutions enter between the glass plates from the bottom. In this case, the low-percentage BN separating gel solution has to be placed into the mixing chamber and the high-percentage one into the reservoir chamber (Fig. 6.1.3). Figure 6.1.2 shows a pipet tip at the end of the Tygon tubing, but a needle may be more appropriate since a pipet tip might be too wide to fit between the glass plates. 8. Prepare water-saturated isobutyl alcohol by shaking isobutyl alcohol and water in a glass bottle. Using a Pasteur pipet, overlay the separating gel with water-saturated isobutyl alcohol (upper alcoholic phase from the mix) by gently layering the alcohol Electrophoresis and Immunoblotting 6.10.3 Current Protocols in Cell Biology Supplement 38 Table 6.10.1 Gel Solutions for BN-PAGEa Low% BN separating gel solution High% BN separating gel solution Stacking gel solution 4% 7% 10% 12% 16% 18% 3.2% 40% acrylamide/ bisacrylamide mixb (ml) 3.00 5.25 7.50 9.00 12.00 13.50 1.00 3× BN gel bufferb (ml) 10.00 10.00 10.00 10.00 10.00 10.00 4.17 dH2 O (ml) 17.00 — — — — — 7.33 70% (v/v) glycerol (ml) — 14.75 12.50 11.00 8.00 6.50 — 10% ammonium persulfate (µl) 108 84 84 84 84 84 167 TEMED (µl) 11 8 8 8 8 8 17 a Numbers in the body of the table are milliliters of stock solution, except 10% APS and TEMED which are microliters and should be added only when the low- and high percentage BN gel solutions are already in the chambers of the mixing apparatus. b See recipe in Reagents and Solutions. against the edge of one and then the other of the spacers to produce a smooth surface. In the multicasting equipment, all gels must be overlaid with the same volume of watersaturated isobutyl alcohol. 9. Clean pouring apparatus with water (do not use detergent). 10. Allow the gel to polymerize for at least 30 min at room temperature. Remove the isobutyl alcohol, wash twice with water, and overlay with 1× BN gel buffer. Store at 4◦ C (stable at least 1 year). Pour the stacking gel 11. Just before use, pour the stacking gel using an appropriate comb and the BN stacking gel solution (see Reagents and Solutions). Due to the low percentage of acrylamide/bisacrylamide, the comb might be difficult to remove without damaging the gel. Try to move the comb perpendicular to the plane of the glass plates while removing it to allow air to enter. Alternatively, the percentage of acrylamide/bisacrylamide can be increased to 3.5%. Load the samples and run the Blue Native gels All steps should be performed at 4◦ C (e.g., in a cold room). 12. Add 100× pervanadate solution to the dialysed lysate to a concentration of 1×, if phosphorylation needs to be preserved. 13. Mount the gel in the electrophoresis apparatus and load 5 to 30 µl dialysed cell lysate (prepared as in Support Protocol) in the dry wells of the mounted gel. As control, an aliquot of the sample can be boiled with 1% SDS to destroy all multiprotein complexes. Leave one lane free between this control and the non-SDS samples. 14. Load 10 µl marker mix 1 and 10 µl marker mix 2 in two adjacent wells. Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Only ferritin is seen during the electrophoresis, due to its brown color. Alternatively, commercially available high-molecular-weight markers can be used (e.g., from Invitrogen or GE Healthcare). 6.10.4 Supplement 38 Current Protocols in Cell Biology 15. Carefully overlay the samples in each well with the BN cathode buffer. Fill the upper/inner chamber with BN cathode buffer (containing 0.02% w/v Coomassie blue as described in Reagents and Solutions) and the lower/outer chamber with BN anode buffer. 16. Connect electrodes. If a small gel has been prepared (e.g., using BioRad Protean II or III), run at 100 V; if a large gel has been prepared (e.g., using BioRad Protean II xi), run at 150 V. Continue electrophoresis at the appropriate abovementioned voltage until the sample has entered the separating gel. At that point, increase voltage to 180 V for small gel or 400 V for large gel. Coomassie blue comes into contact with the samples inside the wells during the electrophoresis. 17. Remove the BN cathode buffer (especially from within the wells) after two-thirds of the gel run. Fill the upper/inner chamber with BN cathode buffer (low Coomassie blue) that contains only 0.002% (w/v) Coomassie blue. Continue electrophoresis at 180 V for small gel or 400 V for large gel. This procedure ensures that the individual lanes can be identified after the gel is run and can be omitted if a second-dimension gel is not to be applied (see, e.g., Alternate Protocols 1 and 2), or if precipitated material is visible between the stacking and separating gel. 18. Turn off power supply and remove the electrodes once the dye front has reached the bottom of the gel. Extrude and store Blue Native gels 19. Remove the glass plates, with the gel in-between, from the electrophoresis apparatus. 20. Open the glass plates by lifting the smaller one and keeping the gel attached to the bigger, bottom plate. Remove the stacking gel with the smaller glass plate. 21. Cut away the lanes where the marker mixes were loaded from the rest of the gel using the smaller glass plate. Visualize the marker proteins by standard Coomassie blue or silver staining (UNIT 6.6). For some purposes, the ferritin marker (440 and 880 kDa), which is visible without staining, is sufficient. When assigning the positions of the marker, take into consideration that the gel might shrink upon staining. Alternatively, after the first-dimension BN-PAGE, proteins can be stained directly with silver or Coomassie brilliant blue (UNIT 6.6), or detected by immunoblotting (western blotting; Alternate Protocols 1 and 2). Optionally, stained spots can be cut out and the proteins identified by mass spectroscopy. 22. Stamp out each individual lane with the smaller glass plate. Either immediately run the second dimension SDS-PAGE (Basic Protocol 2), or freeze each lane wrapped in aluminum foil at −20◦ C (stable at least 1 year). Do not bend a frozen gel piece, since it breaks easily. Alternatively, the first-dimension BN gel can be transferred to a membrane followed by immunoblotting to visualize the proteins of interest (Alternate Protocols 1 and 2). PREPARATION OF CELL LYSATES FOR BLUE NATIVE GEL ELECTROPHORESIS SUPPORT PROTOCOL Blue Native (BN) gel electrophoresis is suitable for the separation of pure proteins as well as complex protein mixtures such as subcellular fractions or cell lysates. Sample preparation is one of the critical steps in performing high-quality BN gels. First, the proteins have to be present in soluble and native form. Thus, the choice of detergent is important and one should start BN experiments by testing several nonionic detergents Electrophoresis and Immunoblotting 6.10.5 Current Protocols in Cell Biology Supplement 38 for the protein/protein complex of interest (see Commentary). The detergent should be effective enough to extract the proteins from cellular membranes, but at the same time mild enough to keep multiprotein complexes intact. The most commonly used detergents are given in Reagents and Solutions. The proteins must be eluted in native form, if the purification procedure includes binding to a matrix, as e.g., in immuno- or affinity purifications (often referred to as immunoprecipitation; see UNIT 7.2). Second, the sample has to be prepared without potassium or divalent cations, since Coomassie blue and Coomassie blue–bound proteins precipitate with those ions and consequently do not enter the gel. Hence, cations that interact with Coomassie blue have to be removed and substituted by 6-aminohexanoic acid, in order to maintain a certain ionic strength of the solution, which is necessary for the solubility and stabilization of many protein complexes. Sodium ions are tolerated to a maximum concentration of 50 mM. Third, samples have to be loaded with detergent on BN gels. Otherwise, proteins aggregate during the stacking step of the electrophoresis. Membrane and organelle fractions lysed in BN lysis buffer can be directly applied to BN gels. Cellular lysates have to be dialysed against BN dialysis buffer, in order to remove small cations and metabolites. Proteins bound to a matrix are washed and eluted in BN dialysis buffer. This protocol describes the preparation of cell lysates. Cells are washed and lysed in any lysis buffer, although we recommend using the BN lysis buffer. After removal of insoluble material, the lysate is dialysed against BN dialysis buffer. In this protocol, a self-made dialysis setup utilizing dialysis membranes is described. Alternative desalting methods can be applied as well. Materials Cell culture dish (10 to 15 cm) containing cells of interest (80% confluent) Phosphate-buffered saline (PBS; see recipe), ice cold BN lysis buffer (see recipe) BN dialysis buffer (see recipe) Cell scrapers 10- to 50-ml centrifuge tubes Refrigerated cell culture centrifuge (with adaptor cavities for microcentrifuge tubes in rotor accommodating 50-ml tube) Dialysis membranes, MWCO 10 to 50 kDa (boiled and kept at 4◦ C in 0.001 M EDTA) 1-ml reaction tubes (e.g., microcentrifuge tubes) Beaker (100-ml to 1-liter, depending on sample size) Harvest and wash the cells 1. Place cell culture dish containing cells on ice. 2. For adherent cells, wash cells three times, each time with 2 to 10 ml ice-cold 1× PBS. Cells grown in suspension are washed three times with ice-cold 1× PBS by repeatedly pelleting the cells by centrifugation for 5 min at 350 × g, 4◦ C. The volume of PBS used for one washing step should be equal to the volume of medium in which the cells were cultivated. Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis 3. Add 2 to 10 ml (i.e., volume in which cells were cultivated) of ice-cold 1× PBS to the dish, remove the cells using a cell scraper, and transfer the cell suspension to a 10- to 50-ml centrifuge tube. This step is omitted for cells grown in suspension. 6.10.6 Supplement 38 Current Protocols in Cell Biology 4. Collect cells by centrifugation for 5 min at 350 × g, 4◦ C, and remove supernatant. 5. Resuspend cells in 1 ml cold 1× PBS, transfer cell suspension into a small reaction tube (e.g., microcentrifuge tube), and pellet cells by centrifugation for 5 min at 350 × g, 4◦ C. 6. Remove and discard the supernatant using a pipet. 7. Either move on to step 8 or freeze the cell pellet at −20◦ C. Frozen cells can be stored at −20◦ C for at least 6 months. Prepare the cell lysates 8. Resuspend the cell pellet in ice-cold BN lysis buffer (or other lysis buffer that has been used successfully to extract your multiprotein complex of interest). The concentration of cells per volume lysis buffer depends on the amount of protein that should be loaded on the BN gel. As an approximation, use 106 cells per 250 to 500 µl lysis buffer. 9. Incubate on ice for 15 min to allow cell lysis. The lysis time can be prolonged, if it is convenient—e.g., in the case where many different samples are processed and some of them have to wait for the last ones. 10. Microcentrifuge 15 min at 13,000 × g, 4◦ C, to remove insoluble material. Prepare to dialyze the lysate 11. Melt a hole in the cap of a microcentrifuge tube using the large-diameter end of a hot Pasteur pipet. Chill the tube on ice. 12. Transfer the supernatant from step 10 into the chilled tube from step 11. 13. Place a dialysis membrane over the opened tube and close the cap. Make sure that there are no folds or tears in the dialysis membrane. 14. Seal the cap at the edges with Parafilm. Make sure that the hole in the tube is not covered by the Parafilm. 15. Invert the tube and centrifuge upside-down at the lowest speed possible in the adaptor cavity for 50-ml tubes in a cell culture centrifuge for 10 sec at 4◦ C. 16. Prepare a 100-ml beaker with ice-cold BN dialysis buffer and a magnetic stirrer. Use at least 10 ml dialysis buffer per 100 µl sample. 17. Fix the tube upside down inside the beaker and remove air bubbles from the hole beneath the cap. Make sure that the dialysis membrane is not damaged. Dialyze lysate 18. Switch on the magnetic stirrer and dialyze for 6 hr or overnight in a cold room. Make sure that stirring is not creating air bubbles at the dialysis membrane. 19. Collect the dialysed cell lysate in a new chilled microcentrifuge tube and analyze by BN-PAGE (Basic Protocol 1). If the sample will be subjected to two-dimensional analysis, reserve one-third of the sample to serve as a control in the second-dimension analysis. Freezing and thawing of cell lysates might lead to the aggregation of proteins. Therefore, the cell lysate should be separated immediately by BN-PAGE. For some proteins, freezing might be possible and has to be determined empirically. Electrophoresis and Immunoblotting 6.10.7 Current Protocols in Cell Biology Supplement 38 BASIC PROTOCOL 2 SECOND-DIMENSION DENATURING ELECTROPHORESIS A denaturing second-dimension gel is suitable to identify and characterize multiprotein complexes. It is recommended to use vertical denaturing (SDS) discontinuous gel electrophoresis (Laemlli method of SDS-PAGE; described in detail in UNIT 6.1, Basic Protocol 1). These gels can be linear or gradient slab gels run under reducing or nonreducing conditions. The only exception is that loading of the first-dimension BN gel strip requires a broad, flat well. The BN gel strip has to be fit between the glass plates of the second gel. The easiest way is to slightly increase the thickness of the second dimension compared to the first dimension. If this is done by putting cellophane tape on the spacers of the second dimension gel, the BN gel strip can be inserted without breaking and still sit firmly enough to prevent any movement during the electrophoresis. Alternatively, procedures as described in UNIT 6.4 can be employed. This protocol describes all the specific steps required for successfully casting and running the second-dimension SDS-PAGE, with extensive reference to UNIT 6.1. Typical expected results are depicted in Figure 6.10.1. Materials 2× SDS sample buffer (UNIT 6.1) 1× SDS electrophoresis buffer (UNIT 6.1) Lane from a BN-PAGE gel (Basic Protocol 1) Thin adhesive tape (e.g., tesa tape; http://www.tesatape.com) Platform shaker Additional reagents and equipment for SDS-PAGE (UNIT 6.1) and two-dimensional gel electrophoresis (UNIT 6.4) Cast the second-dimension SDS gels 1. Take spacers of the same thickness as the ones that were used for the first dimension (see Basic Protocol 1). Wrap thin adhesive tape once around them, in order to increase their thickness slightly. 2. Assemble the glass-plate sandwich using these spacers. A second-dimension gel that is slightly thicker than the first-dimension gel allows fitting in the first-dimension gel slice without problems, but still fixing it between the glass plates so that it cannot move. 3. Pour the separating SDS-PAGE gel as described in UNIT 6.1. For everyday purposes, degassing of the gel solution is not necessary. It is recommended to use multicasting equipment to pour several SDS gels at once. It saves time and ensures best reproducibility for comparisons of multiple samples. Casting of multiple gradient gels is described in UNIT 6.1. 4. Pour the stacking gel (UNIT 6.1) using combs that contain one large pocket that is wide enough to accommodate the first-dimension gel slice and one or two additional wells for marker and control samples (UNIT 6.4). After removing the comb, clean the large pocket of polymerized gel remnants using a spacer that has not been enlarged with a layer of tape. Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Load the Blue Native gel strips onto the second-dimension SDS gels 5. Retrieve the first-dimension BN gel strips from storage. Incubate them for 10 min at room temperature in 2× SDS sample buffer by shaking in a small tray on a platform shaker. Make sure to work under a hood if working with a reducing sample buffer containing 2-mercaptoethanol. 6.10.8 Supplement 38 Current Protocols in Cell Biology Figure 6.10.1 Two-dimensional BN/SDS-PAGE of cellular lysates. In this hypothetical experiment, total cellular lysates were prepared and dialyzed (Support Protocol). In (A), proteins were separated by BN-PAGE (Basic Protocol 1) and a subsequent second-dimensional SDS-PAGE (Basic Protocol 2). Visualization of the protein was done with silver staining. Monomeric proteins (#3, #4, and #5b) were localized to a hyperbolic-shaped diagonal, indicating that they had the same size in the first and in the second dimension. In contrast, proteins that were present in the same multiprotein complex were found as individual spots aligned in vertical columns. Complex #1 was a homotetrameric protein complex. Complex #2 was composed of six proteins of small individual sizes. Proteins #6 and #5 as well as #7 and #5 formed dimeric complexes. In addition, protein #5 was found as a monomer (#5b). Thus, protein #5 existed in three different forms. From the intensity of the spots, one could deduce that complex #6:#5 was more abundant than complex #7:#5. In (B), the dialysed lysate was boiled with 1% SDS before separation by BN-PAGE and SDS-PAGE. SDS destroys all multiprotein complexes; thus, the hyperbolic-shaped diagonal can identified. A similar wet experiment is described in Camacho-Carvajal et al. (2004). 6. Heat the strips with the sample buffer in a microwave oven at medium power until the solution boils. Let the gel strips shake for another 10 min at room temperature while cooling down. Heating the proteins in the presence of SDS leads to their unfolding and to the disruption of multiprotein complexes. 7. Fill the large pocket of the second-dimension gel with 1× SDS electrophoresis buffer, removing all air bubbles. Incline the gel with the large glass plate at the bottom. Let the first-dimension gel slice enter between the glass plates. Avoid any air bubbles and push carefully with a spacer without added tape. 8. Place the gel into the electrophoresis apparatus and load the markers and control samples into the small wells. It is recommended to keep one-third of the sample to be separated by the first dimension BN-PAGE (Support Protocol, step 19), boil it in 1× SDS electrophoresis buffer, and use it as a control sample in the second dimension. 9. Overlay the first-dimension gel strip with a 3-mm layer of 2× SDS sample buffer. Run and analyze the second-dimension SDS gel 10. Run and disassemble the gel as described in UNIT 6.1 (Basic Protocol 1). The dye front contains not only the bromphenol blue of the SDS sample buffer but also the Coomassie blue from the first dimension. The dye front of the first dimension will be visible as a dark blue spot at the bottom of the second dimension. Electrophoresis and Immunoblotting 6.10.9 Current Protocols in Cell Biology Supplement 38 11. Visualize proteins using any method available. The most commonly used methods are transfer to a membrane followed by immunodetection (western blotting; UNIT 6.2) or staining with silver or Coomassie brilliant blue (UNIT 6.6). Optionally, stained spots can be cut out and the protein identified by mass spectroscopy. ALTERNATE PROTOCOL 1 DENATURING TRANSFER OF THE PROTEINS FROM THE FIRST-DIMENSION BN-PAGE GEL TO A MEMBRANE FOR IMMUNOBLOTTING Protein complexes separated by BN gels can be visualized by immunoblotting (also referred to as western blotting) without a second-dimension separation. If a cell lysate is analyzed, a very specific antibody is necessary that does not cross-react with other proteins. It is recommended to first test the quality of the antibody by second-dimension BN/SDS-PAGE (see Commentary). In general, the same antibodies that are used for immunodetection after SDS-PAGE are potentially suitable. In this protocol, the proteins/multiprotein complexes are first denatured within the BN gel by boiling in SDS. Subsequent steps, including the transfer to a membrane and the immunoblotting procedure, are similar to the standard protocol used after SDS-PAGE (UNIT 6.2). If PVDF membranes are used, the bound Coomassie blue can partially be removed. This is not the case for nitrocellulose membranes that can be used to immobilize the proteins after BN-PAGE as well. Materials First-dimension BN-PAGE gel (Basic Protocol 1) Phosphate buffered saline (PBS; see recipe for 10×) containing 1% (w/v) SDS Denaturing BN transfer buffer (see recipe) Destaining solution (see recipe) Platform shaker PVDF (polyvinylidene fluoride) membrane (see UNIT 6.2) Additional reagents and equipment for immunoblotting (UNIT 6.2) 1. Soak the first-dimension BN gel in 1× PBS with 1% SDS for 15 min by shaking in a small tray on a platform shaker. 2. Heat in a microwave at medium power until the solution boils. Let the gel shake for another 10 min at room temperature. 3. Transfer the denatured proteins to a PVDF membrane by wet or semi-dry blotting (UNIT 6.2). Use the denaturing BN transfer buffer, since it includes SDS. A protocol for wet transfer is described in UNIT 6.2 (Basic Protocol 1, including Fig. 6.2.1). Semi-dry transfer is described in UNIT 6.2 (Alternate Protocol 1, including Fig. 6.2.2). Before transfer, mark the ferritin marker with a pen on the membrane, since it is difficult to see afterwards. 4. Optional: Partially remove the transferred Coomassie blue from the PVDF membranes by incubation in destaining solution for 30 min. Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Immunodetection can also be performed without the destaining step. Coomassie blue cannot be removed completely and shows strong fluorescence at several wavelengths. Therefore, detection with fluorescently labeled antibodies cannot be done. In this case a second-dimension SDS-PAGE has to be used for immunoanalysis (Basic Protocol 2). 5. Block the membrane and immunodetect under standard conditions (UNIT 6.2). 6.10.10 Supplement 38 Current Protocols in Cell Biology NATIVE TRANSFER OF THE PROTEINS FROM THE FIRST-DIMENSION BN-PAGE GEL TO A MEMBRANE FOR IMMUNOBLOTTING ALTERNATE PROTOCOL 2 Proteins are separated by BN-PAGE under native conditions. Transfer to a membrane and visualization by immunoblotting can also be performed under native conditions. If a cell lysate is analyzed, a very specific antibody that does not cross-react with other proteins is necessary. The antibodies that are used for immunodetection after SDS-PAGE might not be suitable, since they recognize unfolded proteins. Antibodies that recognize folded proteins and protein complexes, as used for immunoisolation (e.g., immunoprecipitation), flow cytometry, or immunofluorescence methods, should be tested for the application in this protocol. In this protocol, the proteins/multiprotein complexes are transferred to a membrane in their native form. The following immunoblotting procedure is similar to the standard protocol used after SDS-PAGE (UNIT 6.2). Materials First-dimension BN-PAGE gel (Basic Protocol 1) Native BN transfer buffer (see recipe) Destaining solution (see recipe) PVDF membrane (see UNIT 6.2) Additional reagents and equipment for immunoblotting (UNIT 6.2) 1. Briefly rinse the first-dimension BN gel in native BN transfer buffer. 2. Transfer the native proteins to a PVDF membrane by semi-dry or wet blotting (UNIT 6.2). Use the native BN transfer buffer, since it does not contain SDS. Conditions for transfer are the same as those used for SDS-PAGE gels (UNIT 6.2). Before transfer, mark the ferritin marker with a pen on the membrane, since it is difficult to see afterwards. 3. Optional: Partially remove the transferred Coomassie blue from the PVDF membranes by incubation in destaining solution for 30 min. Immunodetection can also be performed without the destaining step. Coomassie blue cannot be removed completely and shows strong fluorescence at several wavelengths. Therefore, detection with fluorescently labeled antibodies cannot be accomplished. In this case a second-dimension SDS-PAGE has to be done (Basic Protocol 2). 4. Block the membrane and immunodetect under standard conditions (UNIT 6.2). NATIVE ANTIBODY-BASED MOBILITY SHIFT (NAMOS) ASSAY This protocol is a variant of Basic Protocol 1 and describes a method to determine the stoichiometry of multiprotein complexes based on BN-PAGE. It makes use of the fact that the proteins and protein complexes are separated in their native state. Antibodies that recognize a certain subunit of a protein complex are added to the sample before separation by BN-PAGE. This allows the formation of super-complexes comprising the protein complex and the antibody. Since the migration distance in BN-PAGE depends on the size of a protein complex, it directly reflects the number of bound antibodies and thus the copy number of the subunit they bind to. This method is called the Native Antibodybased MObility Shift (NAMOS) assay. With the NAMOS assay, it is even possible to determine the stoichiometry of a protein complex that is present in low amounts within a total cell lysate. Due to the large amount of added antibody, detection of the protein complex of interest has to be done by immunoblotting as described in Alternate Protocols 1 and 2, and UNIT 6.2. BASIC PROTOCOL 3 Electrophoresis and Immunoblotting 6.10.11 Current Protocols in Cell Biology Supplement 38 Before performing the NAMOS assay, one has to set up the sample preparation (Support Protocol 1) and immunodetection (Alternate Protocols 1 and 2) conditions. It is required that the multiprotein complex of interest be separated as a single, clearly visible complex after BN-PAGE. Typical expected results are displayed in Figure 6.10.2. Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Figure 6.10.2 The Native Antibody-Based Mobility Shift (NAMOS) Assay. In this hypothetical experiment, the protein complex of interest comprises one X and two Y subunits (XY2 ). Its stoichiometry is to be determined by the NAMOS assay (Basic Protocol 3). Cellular lysates containing complex XY2 were separated by BN-PAGE and visualized by anti-XY2 immunoblotting. Indeed, XY2 was one defined complex (lanes 1 and 7, band a). In (A), increasing amounts of an anti-X Fab fragment were incubated with the lysate before separation. Consequently, a new band (band b) appeared with a concomitant loss of band a (lanes 2 to 6). Band b corresponded to a Fab-XY2 complex, indicating that XY2 contained one binding site for the anti-X Fab fragment and, thus, one copy of protein X. An anti-Y Fab fragment produced two bands (lanes 8 to 12, bands b and c), demonstrating that XY2 had two copies of protein Y. In (B) complete antibodies were used for the NAMOS assay. In contrast to the Fab fragment, an antibody is able to simultaneously bind to two XY2 complexes. Using anti-Y, one can see that these “super”-complexes (band d) disappeared with increasing concentrations of the antibody (lanes 2 to 5). At saturating concentrations, all XY2 complexes bound to two antibodies (lanes 5 and 6, band c), indicative of two copies of protein Y in the complex. Thus, complete antibodies also allow the determination of stoichiometry. As a control, an irrelevant anti-Z antibody did not produce any shift of complex XY2 (lanes 7 to 12). A similar wet experiment and possible difficulties in performing the NAMOS assay are described in Swamy et al. (2007). 6.10.12 Supplement 38 Current Protocols in Cell Biology Materials Monoclonal antibodies that react with the proteins of interest BN dialysis buffer (see recipe) Sample for BN-PAGE 1-ml reaction tubes (e.g., microcentrifuge tubes) Additional reagents and equipment for casting and running BN-PAGE gels (see Basic Protocol 1) and analysis of Blue Native gels by immunoblotting (Alternate Protocol 1 or 2) Prepare the samples and load the Blue Native gel 1. Prepare a dilution series of the monoclonal antibodies of interest using the BN dialysis buffer containing the same detergent as the sample. Start with ∼1 µg of antibody in 2 µl in the first reaction tube, then dilute 1:10, 1:100, 1:1,000, and 1:10,000 in another four tubes. Place the tubes on ice. Antibodies are mostly dissolved in PBS and, thus, the nondiluted antibody will be present with sodium chloride. If only 2 µl are used, the resulting salt concentration is tolerated by BN-PAGE. If, however, more than 2 µl have to be used, it is recommended to dialyze the antibody against BN dialysis buffer without any detergent (Support Protocol). Use fresh antibodies that have not been frozen and thawed too often, in order to avoid the presence of antibody aggregates. If possible, use Fab fragments of the antibodies. 2. Use any sample as described in the Support Protocol, e.g., a dialysed lysate or purified proteins. Add 10 to 20 µl of sample to each antibody-containing tube, mix, and incubate 20 min on ice. 3. Cast and pour the BN gel as in Basic Protocol 1. Use an acrylamide concentration (Table 6.10.1) in which the multiprotein complex of interest is located on the lower third of the gel after the electrophoresis. The reason for this is that all “antibody shifts” will be above the protein complex. 4. Load the BN gel at 4◦ C as in Basic Protocol 1. Load the samples in the order of the dilution (see Fig. 6.10.2). At the end, also load the solution containing the multiprotein complex (with no antibody) as reference. Do not load any sample in the well next to the sample with the highest concentration of antibody. In this well, the marker mix can be loaded. If a second series of antibody-added samples is loaded, use the reverse order (see Fig. 6.10.2). Run and analyze the Blue Native gel 5. Run NAMOS BN gels as described in the Basic Protocol 1, except reduce the voltage at the beginning of the separation; if a small gel has been prepared (e.g., using BioRad Protean II or III), run at 50 V; if a large gel has been prepared (e.g., using BioRad Protean II xi), run at 75. Continue electrophoresis at the appropriate abovementioned voltage until the sample has entered the separating gel. At that point, increase voltage to 180 V for small gel or 400 V for large gel. 6. Analyze the gels by immunoblotting (Alternate Protocol 1 or 2) using only antibodies that recognize the protein/protein complex of interest. The detection method should not stain the monoclonal antibodies used at steps 1 and 2. For example, for detection, use directly labeled antibodies or polyclonal rabbit antiserum in combination with labeled anti–rabbit IgG antibodies that do not cross-react with the antibodies that were used for the shift. In order to control for the cross-reactivity, also load the highest concentration of the monoclonal antibody alone, i.e., without adding the protein/protein mixture of interest. Electrophoresis and Immunoblotting 6.10.13 Current Protocols in Cell Biology Supplement 38 REAGENTS AND SOLUTIONS Use deionized, distilled water in all recipes and protocol steps. For common stock solutions, see APPENDIX 2A; for suppliers, see SUPPLIERS APPENDIX. Acrylamide/bisacrylamide mix 50 ml of 19:1 acrylamide/bisacrylamide solution 239 ml of 37.5:1 acrylamide/bisacrylamide solution Store at room temperature (stable at least 1 year) This will result in a ratio of 32:1 with 40% acrylamide. BN anode buffer Dilute 50 ml of 1 M bis-Tris stock solution (pH adjusted to 7.0 with HCl; store up to 1 year at room temperature) to 50 mM final by adding water to 1 liter. BN cathode buffer 15 ml 1 M bis-Tris stock solution (pH adjusted to 7.0 with HCl) (15 mM final) 50 ml 1 M tricine (50 mM final) 0.2 g Coomassie blue G250 (not other Coomassie blues) (0.02% w/v final) H2 O to 1 liter Store at room temperature (stable at least 1 year) BN cathode buffer (low Coomassie) 15 ml 1 M bis-Tris stock solution (pH adjusted to 7.0 with HCl) (15 mM final) 50 ml 1 M tricine (50 mM final) 0.02 g Coomassie blue G250 (not other Coomassie blues) (0.002% w/v final) H2 O to 1 liter Store at room temperature (stable at least 1 year) BN dialysis buffer Mix 2× BN lysis buffer stock solution (see recipe) and the detergent stock solution (see recipe) of choice so that the BN lysis buffer has a final concentration of 1× and the detergent solution has a final concentration of 0.1× (but for digitonin, use 0.3×, due to its low critical micelle concentration). Add PMSF and sodium orthovanadate (see recipe for protease and phosphatase inhibitor stock solutions) to a final concentration of 1×. Prepare fresh just before use and cool to 4◦ C. Upon addition of orthovanadate, the buffer will assume a yellow color. BN gel buffer, 3× 150 ml 1 M bis-Tris stock solution (pH adjusted to 7.0 with HCl) (150 mM final) 200 ml 1 M 6-aminohexanoic acid (Sigma-Aldrich) stock solution (200 mM final) H2 O to 1 liter Store at room temperature (stable at least 1 year) BN lysis buffer Mix 2× BN lysis buffer stock solution (see recipe) and the detergent stock solution (see recipe) of choice so that both have a final concentration of 1×. Add protease and phosphatase inhibitors (see recipe) to a final concentration of 1×. Prepare fresh just before use and cool to 4◦ C. Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Upon addition of orthovanadate, the buffer will assume a yellow color. 6.10.14 Supplement 38 Current Protocols in Cell Biology BN lysis buffer stock solution (without detergent and inhibitors), 2× 40 ml 1 M bis-Tris stock solution (pH adjusted to 7.0 with HCl) (20 mM final) 500 ml 1 M 6-aminohexanoic acid (Sigma-Aldrich) stock solution (500 mM final) 40 ml 1 M NaCl (20 mM final) 4 ml 0.5 M EDTA, pH 8.0 (APPENDIX 2A; 2 mM final) 200 ml glycerol (10% v/v final) H2 O to 1 liter Store at room temperature (stable at least 1 year) Preparation of an EDTA stock solution is described in UNIT 6.4. BN stacking gel solution 3 ml 3× BN gel buffer (see recipe) 0.72 ml acrylamide/bisacrylamide mix (see recipe) 5.28 ml H2 O 120 µl 10% (w/v aqueous) ammonium persulfate (add immediately before pouring gel) 12 µl TEMED (add immediately before pouring gel) This will result in a 3.2% solution. Adjust volumes as necessary. Denaturing BN transfer buffer 5.81 g Tris base (48 mM final) 2.93 g glycine (39 mM final) 200 ml methanol (20% final) 1 g SDS (0.1% final) H2 O to 1 liter Store at 4◦ C (stable at least 1 year) Destaining solution 450 ml methanol (45% v/v final) 100 ml acetic acid (10% v/v final) H2 O to 1 liter Store at room temperature (stable at least 1 year) Detergent stock solutions 2× digitonin: Prepare a 2% (w/v) solution of digitonin (Sigma-Aldrich) in water by heating to 95◦ C. Store in 1- to 10-ml aliquots up to 5 years (possibly longer) at −20◦ C. Thawed solutions are stable at room temperature for up to 1 week. If a precipitate forms, reheat the solution to 95◦ C until the digitonin redissolves. 10× Brij 96: Prepare a 10% (w/v) solution of Brij 96 (e.g., Brij 96V) in water. Store up to 1 year (possibly longer) at room temperature. 10× Triton X-100: Prepare a 10% (w/v) solution of Triton X-100 in water. Store up to 1 year (possibly longer) at room temperature. 10× NP-40: Prepare a 10% (w/v) solution of Nonidet P-40 (NP-40) in water. Store up to 1 year (possibly longer) at room temperature. 10× dodecylmaltoside: Prepare a 10% (w/v) solution of dodecylmaltoside (Sigma-Aldrich) in water. Store up to 1 year (possibly longer) at 4◦ C. Any nonionic detergent that has been proven to be useful for the cells and proteins of interest can be used as well. Electrophoresis and Immunoblotting 6.10.15 Current Protocols in Cell Biology Supplement 38 High-percentage BN separating gel solution 5 ml 3× BN gel buffer (see recipe) 5.63 ml acrylamide/bisacrylamide mix (see recipe) 4.38 ml 70% (v/v) glycerol 42 µl 10% (w/v aqueous) ammonium persulfate (add immediately before pouring gel) 4.2 µl TEMED (add immediately before pouring gel) This will result in a 15% solution. Adjust volumes and acrylamide/bisacrylamide concentration as necessary. Useful concentrations range from 6% to 18%. Low-percentage BN separating gel solution 5 ml 3× BN gel buffer (see recipe) 1.5 ml acrylamide/bisacrylamide mix (see recipe) 8.5 ml H2 O 54 µl 10% (w/v aqueous) ammonium persulfate (add immediately before pouring gel) 5.4 µl TEMED (add immediately before pouring gel) This will result in a 4% solution. Adjust volumes as necessary. Marker mix 1 20 µl 1 M bis-Tris stock solution (pH adjusted to 7.0 with HCl) 20 µl 1 M NaCl 143 µl 70% (v/v) glycerol 5 mg ferritin (440 kDa and 880 kDa) 5 mg catalase (232 kDa) 5 mg bovine serum albumin (66 kDa and 132 kDa) H2 O to 1 ml Store at 4◦ C (stable at least 1 year) Marker mix 2 20 µl 1 M bis-Tris stock solution (pH adjusted to 7.0 with HCl) 20 µl 1 M NaCl 143 µl 70% (v/v) glycerol 5 mg thyroglobulin (670 kDa) 5 mg aldolase (158 kDa) H2 O to 1 ml Store at 4◦ C (stable at least 1 year) Native BN transfer buffer 5.81 g Tris base (48 mM final) 2.93 g glycine (39 mM final) 200 ml methanol (20% final) H2 O to 1 liter Store at 4◦ C (stable at least 1 year) Pervanadate, 100× Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Mix, in the following order: 50 µl 50 mM sodium orthovanadate 57 µl H2 O 15 µl 30% H2 O2 Incubate 5 to 30 min at room temperature (becomes brownish) Prepare fresh 6.10.16 Supplement 38 Current Protocols in Cell Biology Phosphate-buffered saline (PBS), 10× 152 g NaCl (130 mM final) 24 g monobasic sodium phosphate, anhydrous (10 mM final) 1600 ml H2 O Adjust pH to 7.4 with NaOH. Add H2 O to 2 liters Store at room temperature (stable at least 1 year) PBS with 1% (w/v) SDS 100 ml of 10× PBS (see recipe; 1× final) 100 ml 10% (w/v) SDS stock solution (APPENDIX 2A; 1% final) Add H2 O to 1 liter Store at room temperature (stable at least 1 year) Protease and phosphatase inhibitor stock solutions 1000× leupeptin: Prepare a 10 mg/ml solution of leupeptin in water. Store in 1-ml aliquots up to 5 years (possibly longer) at −20◦ C. 1000× aprotinin: Prepare a 10 mg/ml solution of aprotinin in water. Store in 1-ml aliquots up to 5 years (possibly longer) at −20◦ C. 100× PMSF: Prepare a 100 mM solution of phenylmethylsulfonyl fluoride (PMSF) in ethanol. Store in 1-ml aliquots up to 5 years (possibly longer) at −20◦ C. 100× sodium orthovanadate: Prepare a 50 mM solution of sodium orthovanadate in water. Store up to 1 year (possibly longer) at room temperature. 100× sodium fluoride: Prepare 1 M solution of sodium fluoride in water. Store up to 5 years (possibly longer) at room temperature. COMMENTARY Background Information Most if not all proteins require binding to other proteins in order to fulfill their function. Thus, they form multiprotein complexes (MPCs). Most proteins are part of several distinct complexes, as well as being present as monomers. The abundance of distinct complexes of which a certain protein is a subunit can vary enormously. Furthermore, complexes might have different stabilities and these can change over time and space. Therefore, identifying and analyzing complexes is a difficult task. Common techniques to study complexes such as immuno-precipitation (UNIT 7.2) or two-hybrid (UNIT 17.3) methods allow the identification of binding partners of the protein of interest; they, however, do not yield any information about the size, number, composition, and relative abundance of MPCs. A high-resolution method that resolves these problems is Blue Native polyacrylamide gel electrophoresis (BN-PAGE; Schägger and von Jagow, 1991; Schägger et al., 1994). Originally it was developed by Hermann Schägger to separate mitochondrial membrane complexes in the mass range from 10 to 10,000 kDa (Schägger and von Jagow, 1991; Schägger et al., 1994). Later, the protocol was modified for general applicability (Camacho-Carvajal et al., 2004). Since the first description of BN-PAGE, descriptions of its use in publications has increased exponentially. It has been applied successfully in nearly every area of multiprotein research—e.g., purification of complexes, determination of their size (Schägger et al., 1994; Schägger, 1995; Model et al., 2001; Dudkina et al., 2005) and stoichiometry (Schamel et al., 2005; Swamy et al., 2007), protein complex assembly (Model et al., 2001), structure determination by two-dimensional crystallization and electron microscopy (Poetsch et al., 2000), identification of multiprotein complexes with mass spectroscopy (Rexroth et al., 2003; Camacho-Carvajal et al., 2004; Millar et al., Electrophoresis and Immunoblotting 6.10.17 Current Protocols in Cell Biology Supplement 38 2005), or clinical diagnostics of human disorders (Schägger, 1995; Schägger et al., 1996). In principle, BN-PAGE can be used to identify protein complexes in a given biological sample or to further characterize known protein complexes (or protein-protein interactions). For the second application, it is recommended to first test a series of different nonionic detergents for their effects on the extractability and stability of the protein-protein interaction of interest by coimmunoprecipitation (UNIT 7.2) followed by SDS-PAGE (UNIT 6.1). Only a successful copurification indicates that the complex of interest is stable and abundant enough to be detected by BN-PAGE. In BN-PAGE, the dye Coomassie blue, which binds nonspecifically to proteins and is itself negatively charged, is used. Therefore, the electrophoretic mobility of a multiprotein complex is determined by the negative charge of the bound Coomassie blue dye and the size and shape of the complex. Coomassie blue does not act as a detergent and preserves the structure of protein complexes. In contrast to other native gel electrophoresis systems, protein complexes are separated independently of isoelectric point and, therefore, the size of a complex can be estimated. In addition, the binding of Coomassie blue to proteins reduces their tendency to aggregate during the stacking step of the electrophoresis. Following the first-dimension BN-PAGE, a number of subsequent biochemical techniques can be applied. Although proteins are already visible as blue bands after BN-PAGE, it can be useful to stain again with Coomassie blue to reach a higher detection sensitivity. Alternatively, silver staining (UNIT 6.6) or immunoblotting (UNIT 6.2) are commonly used. The individual subunits of a complex can be identified by SDS-PAGE or the Native AntibodyBased Mobility Shift (NAMOS) assay (see Basic Protocol 3). The NAMOS assay is a variant of BN-PAGE in which the stoichiometry of multiprotein complexes can be determined without purification of the complex of interest (Swamy et al., 2007). Critical Parameters and Troubleshooting Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis Potential problems in pouring and running acrylamide gels in general are described in UNIT 6.1. These include problems in the polymerization of the gel and critical factors when using multicasting equipment. Removing the comb of the BN stacking gel might destroy the wells of the stacking gel, due to the low percentage of acrylamide. Try to remove the comb slowly, pulling it out slightly perpendicular to the plane of the gel. This allows air to enter the wells. If this does not help, increase the acrylamide/bisacrylamide concentration of the BN stacking gel by 0.3%. If the gel pieces that form the wells are not broken, but just displaced, try to fix them with a syringe needle. Unwanted air bubbles in the stacking gel can be aspirated using a syringe. Test for leakiness with the BN cathode buffer before loading your sample. A proper acrylamide concentration for the BN gel and the subsequent second-dimension SDS gel should be selected to optimize resolution within the desired molecular weight range. Use 4% to 7% BN gels for protein complexes of more than 1000 kDa, 4% to 10% for 500 kDa, 4% to 12% for 250 kDa, and 4% to 18% for proteins smaller than 100 kDa. The first critical step in BN-PAGE is the preparation of the sample, since potassium and divalent cations that interact with Coomassie blue have to be removed. They are substituted by 6-aminohexanoic acid in order to maintain a certain ionic strength of the solution, which increases the solubility of many proteins. Therefore, the lysate has to be dialysed against BN dialysis buffer. One frequent problem is that Coomassie blue and Coomassie blue–bound proteins precipitate in the gel wells, and subsequently the sample does not enter the gel. In this case, either reduce the amount of sample or improve dialysis of the sample. Use a larger dialysis reservoir volume, remove all air bubbles at the dialysis membrane, or prolong dialysis time. Depending on the detergent, the dye front might contain peaks of detergent that prevent proteins from entering below these areas. This is pronounced when using polyoxyethylene detergents such as Brij 96 and Triton X-100. If your multiprotein complex of interest runs at a higher position than these precipitates, then this might not be a problem. Otherwise reduce the amount of detergent in the BN dialysis buffer. To detect the protein of interest by Coomassie brilliant blue staining, it should be present in 0.5 to 2 µg amounts. If silver staining is used, this amount can be reduced to 0.1 µg. 20 to 40 µg of a protein mixture is typically loaded into a well of 50-µl volume on a 1-mm slab BN gel (16 cm, 15 wells). For immunoblotting, much less protein is required, depending on the quality of the antibody used for detection. 6.10.18 Supplement 38 Current Protocols in Cell Biology Instead of giving a defined band in the first dimension or a circular spot in twodimensional BN/SDS-PAGE, a smear that was generated in the first dimension may be seen. This could have several reasons. First, the electrophoresis might not have been optimal. Try to improve dialysis of the sample (see above). If the protein migrates much higher than the dye front, a shorter electrophoresis might help. Second, the protein might have aggregated. Decrease the amount of sample loaded. Do not freeze and thaw the sample. Try to further purify the protein of interest under native conditions. Third, the protein might be present in several overlapping complexes. A two-dimensional BN/BN-PAGE could prove whether several overlapping complexes coexist that contain the protein of interest. For details and other techniques to explore this possibility, see Schamel et al. (2005). Sometimes the protein is detected in a defined complex, but not in a reproducible manner. In this case the complex might have been an artifact generated during the electrophoresis step. This could be due to a step in the gel gradient—i.e., the gradient was not continuous. When pouring the gradient, make sure that there is a continuous flow of liquid and also that the flow is continuous between the two cylinders of the gradient maker. While loading the first-dimension gel slice onto the seconddimension SDS-PAGE, there could have been a small air bubble under the slice. This prevents entry of protein along that vertical line, giving the impression that two MPCs exist, rather than one. If a certain interaction between two proteins is not seen by co-immunopurifications, do not expect to detect it by BN-PAGE. If the protein of interest is only found as a monomer, although it should be present in a complex, the complex could have been disrupted by detergent or be of low abundance. Thus, the choice of detergent is important in extracting but not disrupting multiprotein complexes. Without detergent, proteins tend to aggregate during the stacking step of the electrophoresis and do not enter the separating gel properly. Thus, a certain concentration of detergent has to be present in the sample. Unfortunately, general rules for the choice of detergent do not exist. Compare several detergents of different classes and three different concentrations of each in preliminary experiments, including detergents that allow successful coimmunopurifications of the proteins expected to be present in a common complex. In the BN lysis buffer, orthovanadate is included to inhibit phosphatases. Since orthovanadate is a small molecule, it is rapidly separated from the sample during the BNPAGE run. Since it is a reversible inhibitor, phosphatases become active once orthovanadate is removed. Thus, phosphorylation of the proteins might be lost during the native electrophoresis, where active phosphatases might be present. Since pervanadate irreversibly inhibits phosphatases, it should not be omitted from the BN dialysis buffer when phosphorylation of proteins needs to be preserved. One common surprise that is encountered in performing BN-PAGE is that the size of the protein complex of interest does not match the expected value. First, the detergent micelle around transmembrane regions adds to the size of the corresponding protein. Hence, the size of the protein or protein complex might be larger than that obtained by simply adding the molecular weights of the individual subunits. Thus, to estimate the size of transmembrane proteins (complexes), the mass calibration markers should also be transmembrane proteins solubilized with the same detergent. Some water-soluble proteins match the calibration curve of dodecylmaltoside-solubilized transmembrane proteins, and therefore might be used as standards (Schägger et al., 1994). Second, protein glycosylation and phosphorylation might alter the running behavior of proteins in BN-PAGE. Note that the marker proteins are usually non-transmembrane, nonglycosylated, and non-phosphorylated proteins. Especially if you work with transmembrane proteins, you cannot deduce the molecular weight of the proteins from BNPAGE. Third, in addition to their molecular weight, proteins are also separated according to their shape and number of bound Coomassie blue molecules. Thus, proteins that deviate significantly from a ball-like shape and very basic proteins show reduced mobility. Lastly, it might be that the expected molecular weight value of the protein complex is wrong. Many antibodies that work well for the immunodetection (western blotting) of your protein of interest after SDS-PAGE do not recognize the protein after the first-dimension BN-PAGE. In the author’s experience, the removal of Coomassie blue from the blotting membrane does not help. Try both conditions for the transfer to the blotting membrane (Alternate Protocols 1 and 2). If this does Electrophoresis and Immunoblotting 6.10.19 Current Protocols in Cell Biology Supplement 38 Two-Dimensional Blue Native Polyacrylamide Gel Electrophoresis not help, then a two-dimensional BN/SDSPAGE must be performed. In any case, one should verify immunoblotting results of a firstdimension BN-PAGE by two-dimensional BN/SDS-PAGE, in order to prove that the detected protein indeed is the protein of interest and not a cross-reactivity of the antibody. Performing a successful NAMOS assay critically depends on the quality of the antibodies used to shift the protein complex of interest (Swamy et al., 2007). Several problems could arise. First, protein complexes clustered by antibodies can be very large; thus, use Alternate Protocol 1 to disassemble these aggregates to efficiently transfer them to the blotting membrane. Second, some antibodies aggregate with themselves, thus producing a ladder-like shift pattern (Swamy et al., 2007). With these antibodies, a continuous increase in antibody concentration leads to a constant generation of new larger bands while smaller ones disappear. Thus, the stoichiometry of a multiprotein complex cannot be determined with this type of antibody; however, it is possible to determine whether all complexes contain the subunit in question. Use a fresh preparation of antibody, prepare Fab fragments, or remove antibody aggregates by ultracentrifugation. Third, it is possible that a given antibody cannot bind to all identical subunits of a multiprotein complex, probably because the complex is not symmetric, rendering the epitope accessible in one copy of the subunit but not in its neighboring copy. Likewise, if the two epitopes are very close within the complex, two antibody molecules might not be able to bind simultaneously due to steric hindrance. This type of antibody gives an underestimate of the actual stoichiometry (Swamy et al., 2007). In conclusion, not all antibodies result in the number of shifts that correspond to the number of subunit copies present in the protein complex. Thus, it is recommended to use several independent antibodies per subunit, and the Fab fragments of those antibodies. Typical results are illustrated in Figures 6.10.1 and 6.10.2. Comparison of two or more samples is possible if the pouring and running of the gels was done in similar way. In combination with modern mass spectroscopy, BNPAGE, with its high-resolution properties, is an excellent choice to identify novel protein complexes from any biological source. Anticipated Results Acknowledgements In BN-PAGE, native protein and multiprotein complexes are separated according to their size. Thus, using two-dimensional BN/SDSPAGE, protein complexes can be identified and characterized in terms of their relative abundance, subunit composition, and size. Since BN-PAGE is only the separation technique, the sensitivity of detection depends on the detection method used. Furthermore, the NAMOS assay allows the determination of the stoichiometries even from nonpurified complexes. I thank Michael Reth and Klaus Pfanner for initially introducing me to BN-PAGE and Hermann Schägger for his invaluable help in setting up the technique. I further thank Balbino Alarcón for his advice on establishing the NAMOS assay and members of my laboratory for constantly improving the various BN techniques: Margarita Camacho-Carvajal, Mahima Swamy, Thomas Bock, Eszter Molnar, Susana Minguet, Elaine Pashupati Dopfer, and Gabrielle Siegers. Time Considerations Preparation of the sample as described in the Support Protocol takes 6 hr or overnight. If purified proteins or organelle fractions are used, the required time can be substantially longer. However, if utilizing desalting columns to obtain samples with low cation concentrations, the time can be shorter. Since the sample should be separated immediately by BN-PAGE (and cannot be frozen and stored), one should reserve some time for gel loading, which usually takes another 0.5 to 1 hr. Depending on the gel size, running of the BNPAGE takes from 6 hr to overnight. Loading of two second-dimension SDS-PAGE gels takes ∼1 to 1.5 hr. Running the SDS-PAGE takes between 1.5 hr and overnight, again depending on the size of the gels. Thus, two-dimensional BN/SDS-PAGE takes at least 1.5 days—not counting the visualization process of the proteins of interest. One rate-limiting step is the running of the second-dimension gels. 30 to 40 lanes can easily be separated in parallel on two BN gels, but loading, running, and detection from 30 to 40 second-dimension gels requires substantial operator time and electrophoresis equipment. Therefore, whenever possible, one should try to use only first-dimension BN gels without the need for the second dimension. Pouring gradient gels is another timeconsuming process. To minimize the time requirement, it is strongly recommended to use multicasting equipment to pour several gels at once. This also ensures best reproducibility for critical comparisons of multiple samples. 6.10.20 Supplement 38 Current Protocols in Cell Biology I also acknowledge financial support by the European Union through an individual Marie Curie fellowship and the Deutsche Forschungsgemeinschaft through the Emmy Noether program (SCHA 976/1) and the SFB620. Literature Cited Camacho-Carvajal, M.M., Wollscheid, B., Aebersold, R., Steimle, V., and Schamel, W.W. 2004. Two-dimensional blue native/SDS gel electrophoresis of multi-protein complexes from whole cellular lysates: A proteomics approach. Mol. Cell. Proteomics 3:176-182. Dudkina, N.V., Eubel, H., Keegstra, W., Boekema, E.J., and Braun, H.P. 2005. Structure of a mitochondrial supercomplex formed by respiratorychain complexes I and III. Proc. Natl. Acad. Sci. U.S.A. 102:3225-3229. Millar, A.H., Heazlewood, J.L., Kristensen, B.K., Braun, H.P., and Moller, I.M. 2005. The plant mitochondrial proteome. Trends Plant Sci. 10:36-43. Model, K., Meisinger, C., Prinz, T., Wiedemann, N., Truscott, K.N., Pfanner, N., and Ryan, M.T. 2001. Multistep assembly of the protein import channel of the mitochondrial outer membrane. Nat. Struct. Biol. 8:361-370. Schägger, H. 1995. Quantification of oxidative phosphorylation enzymes after blue native electrophoresis and two-dimensional resolution: Normal complex I protein amounts in Parkinson’s disease conflict with reduced catalytic activities. Electrophoresis 16:763-770. Schägger, H. and von Jagow, G. 1991. Blue native electrophoresis for isolation of membrane protein complexes in enzymatically active form. Anal. Biochem. 199:223-231. Schägger, H., Cramer, W.A., and von Jagow, G. 1994. Analysis of molecular masses and oligomeric states of protein complexes by blue native electrophoresis and isolation of membrane protein complexes by two-dimensional native electrophoresis. Anal. Biochem. 217:220230. Schägger, H., Bentlage, H., Ruitenbeek, W., Pfeiffer, K., Rotter, S., Rother, C., BottcherPurkl, A., and Lodemann, E. 1996. Electrophoretic separation of multiprotein complexes from blood platelets and cell lines: Technique for the analysis of diseases with defects in oxidative phosphorylation. Electrophoresis 17:709-714. Swamy, M., Minguet, S., Siegers, G.M., Alarcon, B., and Schamel, W.W. 2007. A native antibodybased mobility-shift technique (NAMOS-assay) to determine the stoichiometry of multiprotein complexes. J. Immunol. Methods 324:74-83. Poetsch, A., Neff, D., Seelert, H., Schägger, H., and Dencher, N.A. 2000. Dye removal, catalytic activity and 2D crystallization of chloroplast H(+)-ATP synthase purified by blue native electrophoresis. Biochim. Biophys. Acta 1466:339349. Key References Rexroth, S., Meyer zu Tittingdorf, J.M., Krause, F., Dencher, N.A., and Seelert, H. 2003. Thylakoid membrane at altered metabolic state: Challenging the forgotten realms of the proteome. Electrophoresis 24:2814-2823. Schägger and von Jagow, 1991. See above. Describes, for first time, BN-PAGE and seconddimension BN/SDS-PAGE using solubilized mitochondria. Schamel, W.W., Arechaga, I., Risueno, R.M., van Santen, H.M., Cabezas, P., Risco, C., Valpuesta, J.M., and Alarcon, B. 2005. Coexistence of multivalent and monovalent TCRs explains high sensitivity and wide range of response. J. Exp. Med. 202:493-503. Camacho-Carvajal et al., 2004. See above. Describes the separation of cellular lysates by BNPAGE. Swamy et al., 2007. See above. Details the NAMOS assay with an extensive discussion of anticipated results. Electrophoresis and Immunoblotting 6.10.21 Current Protocols in Cell Biology Supplement 38
* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project
advertisement