Nexus 1262/1272 Meter User Manual V.1.21

Nexus 1262/1272 Meter User Manual V.1.21
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN
Nexus® 1262/1272 Meter Installation and Operation Manual Version 1.21
Published by:
Electro Industries/GaugeTech
1800 Shames Drive
Westbury, NY 11590
All rights reserved. No part of this publication may be reproduced or transmitted in
any form or by any means, electronic or mechanical, including photocopying, recording, or information storage or retrieval systems or any future forms of duplication, for
any purpose other than the purchaser's use, without the expressed written permission
of Electro Industries/GaugeTech.
© 2015 Electro Industries/GaugeTech
Nexus® and Shark® are registered trademarks of Electro Industries/GaugeTech.
Communicator EXTTM is a trademark of Electro Industries/GaugeTech.
Modbus® is a registered trademark of Schneider Electric, licensed to the Modbus
Organization, Inc.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
i
This page intentionally left blank.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
ii
Customer Service and Support
Customer support is available 9:00 am to 4:30 pm, Eastern Standard Time, Monday
through Friday. Please have the model, serial number and a detailed problem description available. If the problem concerns a particular reading, please have all meter
readings available. When returning any merchandise to EIG, a return materials
authorization number is required. For customer or technical assistance, repair or
calibration, phone 516-334-0870 or fax 516-338-4741.
Product Warranty
Electro Industries/GaugeTech warrants all products to be free from defects in material
and workmanship for a period of four years from the date of shipment. During the
warranty period, we will, at our option, either repair or replace any product that
proves to be defective.
To exercise this warranty, fax or call our customer-support department. You will
receive prompt assistance and return instructions. Send the instrument, transportation prepaid, to EIG at 1800 Shames Drive, Westbury, NY 11590. Repairs will be made
and the instrument will be returned.
This warranty does not apply to defects resulting from unauthorized modification,
misuse, or use for any reason other than electrical power monitoring. The Nexus®
1262/1272 meter is not a user-serviceable product.
THIS WARRANTY IS IN LIEU OF ALL OTHER WARRANTIES, EXPRESSED
OR IMPLIED, INCLUDING ANY IMPLIED WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. ELECTRO INDUSTRIES/
GAUGETECH SHALL NOT BE LIABLE FOR ANY INDIRECT, SPECIAL OR
CONSEQUENTIAL DAMAGES ARISING FROM ANY AUTHORIZED OR
UNAUTHORIZED USE OF ANY ELECTRO INDUSTRIES/GAUGETECH
PRODUCT. LIABILITY SHALL BE LIMITED TO THE ORIGINAL COST OF
THE PRODUCT SOLD.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
iii
Use of Product for Protection
Our products are not to be used for primary over-current protection. Any protection
feature in our products is to be used for alarm or secondary protection only.
Statement of Calibration
Our instruments are inspected and tested in accordance with specifications published
by Electro Industries/GaugeTech. The accuracy and a calibration of our instruments
are traceable to the National Institute of Standards and Technology through
equipment that is calibrated at planned intervals by comparison to certified standards.For optimal performance, EIG recommends that any meter, including those
manufactured by EIG, be verified for accuracy on a yearly interval using NIST traceable accuracy standards.
Disclaimer
The information presented in this publication has been carefully checked for
reliability; however, no responsibility is assumed for inaccuracies. The information
contained in this document is subject to change without notice.
Safety Symbols
In this manual, this symbol indicates that the operator must refer to
an important WARNING or CAUTION in the operating instructions.
Please see Chapter 11 for important safety information regarding
installation and hookup of the meter.
Dans ce manuel, ce symbole indique que l'opérateur doit se référer à un important
AVERTISSEMENT ou une MISE EN GARDE dans les instructions opérationnelles.
Veuillez consulter le chapitre 11 pour des informations importantes relatives à l'installation et branchement du compteur.
The following safety symbols may be used on the meter itself:
Les symboles de sécurité suivante peuvent être utilisés sur le compteur même:
This symbol alerts you to the presence of high voltage, which can
cause dangerous electrical shock.
Ce symbole vous indique la présence d’une haute tension qui peut
provoquer une décharge électrique dangereuse.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
iv
This symbol indicates the field wiring terminal that must be connected
to earth ground before operating the meter, which protects against
electrical shock in case of a fault condition.
Ce symbole indique que la borne de pose des canalisations in-situ qui doit être branchée dans la mise à terre avant de faire fonctionner le compteur qui est protégé
contre une décharge électrique ou un état défectueux.
About Electro Industries/GaugeTech (EIG)
Founded in 1975 by engineer and inventor Dr. Samuel Kagan, Electro Industries/
GaugeTech changed the face of power monitoring forever with its first breakthrough
innovation: an affordable, easy-to-use AC power meter.
Forty years since its founding, Electro Industries/GaugeTech, the leader in power
monitoring and control, continues to revolutionize the industry with the highest quality, cutting edge power monitoring and control technology on the market today. An
ISO 9001:2000 certified company, EIG sets the industry standard for advanced power
quality and reporting, revenue metering and substation data acquisition and control.
EIG products can be found on site at mainly all of today's leading manufacturers,
industrial giants and utilities.
EIG products are primarily designed, manufactured, tested and calibrated at our facility in Westbury, New York.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
v
This page intentionally left blank.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
vi
7DEOHRI&RQWHQWV
Table of Contents
1:Three-Phase Power Measurement
1-1
7KUHH3KDVH6\VWHP&RQILJXUDWLRQV
:\H&RQQHFWLRQ
'HOWD&RQQHFWLRQ
3RZHU(QHUJ\DQG'HPDQG
5HDFWLYH(QHUJ\DQG3RZHU)DFWRU
+DUPRQLF'LVWRUWLRQ
3RZHU4XDOLW\
2: Meter Overview
2-1
7KH1H[XVŠ0XOWLSDUDPHWHU5HYHQXH0HWHU
$FFX0HDVXUH707HFKQRORJ\7KHRU\RI2SHUDWLRQ
$GYDQFHG0HDVXUHPHQW)XQFWLRQDOLW\
$GYDQFHG5HYHQXH%LOOLQJ&DSDELOLW\
&RPPXQLFDWLRQVDQG,2&DSDELOLWLHV
'LVSOD\6FUHHQV
$GGLWLRQDO6ZLWFKHV
1H[XVŠ([WHUQDO,20RGXOHV
2SWLRQDO313131DQG31/('5HPRWH'LVSOD\V
1H[XVŠ0HWHU)RUPV
1H[XVŠ0HWHU$FFXUDF\
1H[XVŠ0HWHU6SHFLILFDWLRQV2YHUYLHZ
1H[XVŠ0HWHU/RJJLQJ6SHFLILFDWLRQV
5
'139/HYHO
3: Operating Instructions
3-1
1DPHSODWH,QIRUPDWLRQ
%DVLF2SHUDWLRQ
/&''LVSOD\,QIRUPDWLRQ
)LQGLQJ<RXU'LVSOD\¶V)LUPZDUH9HUVLRQV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
72&
7DEOHRI&RQWHQWV
1H[XVŠ3URJUDPPDEOH'LVSOD\1DYLJDWLRQ0DS
8VLQJWKH'LVSOD\&RQILJXUDWRU
8VLQJWKH%DVH3URJUDPPDEOH'LVSOD\
3UH3URJUDPPHG'LVSOD\6FUHHQV
4: Performing Meter Testing
4-1
7HVWLQJ7RROV
2
7HVW3XOVH/('
/&''LVSOD\
3
7HVW0RGH
(QWHULQJ7HVW0RGH
4
8VLQJ7HVW0RGH
4
7HVW0RGH3UHVHW$FFXPXODWRUV
([LWLQJ7HVW0RGH
5: Serial Communication Wiring
5-1
&RPPXQLFDWLRQ2YHUYLHZ
&RPPXQLFDWLQJWRWKH0HWHUWKURXJKWKH$16,7\SH,,2SWLFDO3RUW
566HULDO&RPPXQLFDWLRQ
56:LULQJ)XQGDPHQWDOV3RUWDQG3RUW
8VLQJWKH8QLFRP
5-7HOHSKRQH/LQH&RQQHFWLRQ²0HWHUZLWK,13
,QWHUQDO0RGHPZLWK'LDO,Q'LDO2XW2SWLRQ
5-&RQQHFWLRQ²0HWHUZLWK,13%DVH72SWLRQ
0RGHP(WKHUQHW&RQQHFWLRQ²0HWHUZLWK,13
&RPER&DUG2SWLRQ
56&RQQHFWLRQ0HWHUWRWKH
31313131/(''LVSOD\
&RPPXQLFDWLRQ3RUWVRQWKH,20RGXOHV
56&RQQHFWLRQ²0HWHUWR,20RGXOHV
6WHSVWR'HWHUPLQH3RZHU1HHGHG
5HPRWH&RPPXQLFDWLRQ2YHU7HOHSKRQH/LQHV
8VLQJWKH563RUW
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
72&
7DEOHRI&RQWHQWV
3URJUDPPLQJ0RGHPVIRU5HPRWH&RPPXQLFDWLRQ
6HOHFWHG0RGHP6WULQJV
+LJK6SHHG,QSXWV&RQQHFWLRQ
,5,*%&RQQHFWLRQV
7LPH6\QFKURQL]DWLRQ$OWHUQDWLYHV
,13,QWHUQDO0RGHPZLWK'LDO,Q'LDO2XW2SWLRQ
+DUGZDUH2YHUYLHZ
+DUGZDUH&RQQHFWLRQ
'LDO,Q)XQFWLRQ
'LDO2XW)XQFWLRQ
,132QERDUG(WKHUQHW
+DUGZDUH2YHUYLHZ
+DUGZDUH&RQQHFWLRQ
,13(WKHUQHW0RGHP&RPELQDWLRQ
+DUGZDUH2YHUYLHZ
+DUGZDUH&RQQHFWLRQ
)DFWRU\6HWWLQJV
6: Hardware Installation
6-1
0RXQWLQJWKH1H[XVŠ6RFNHW0HWHU
&DEOH&RORU.H\
,QWHUQDO%DWWHU\,QVWDOODWLRQDQG0DLQWHQDQFH
%DWWHU\6DIHW\DQG'LVSRVDO
0RXQWLQJWKH([WHUQDO'LVSOD\V
0RXQWLQJWKH1H[XVŠ([WHUQDO,20RGXOHV
7: Time-of-Use Function
7-1
,QWURGXFWLRQ
7KH1H[XVŠ0HWHU¶V728&DOHQGDU
728)UR]HQDQG$FWLYH5HJLVWHUV
8SGDWLQJ5HWULHYLQJDQG5HSODFLQJ728&DOHQGDUV
'D\OLJKW6DYLQJVDQG'HPDQG
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
72&
7DEOHRI&RQWHQWV
8: Transformer Loss Compensation
8-1
,QWURGXFWLRQ
1H[XVŠ0HWHU
V7UDQVIRUPHU/RVV&RPSHQVDWLRQ
/RVV&RPSHQVDWLRQLQ7KUHH(OHPHQW,QVWDOODWLRQV
7KUHH(OHPHQW/RVV&RPSHQVDWLRQ:RUNVKHHW
9: Using the External Displays
9-1
2YHUYLHZ
1H[XVŠ3131/('([WHUQDO'LVSOD\
'\QDPLF5HDGLQJV0RGH
1DYLJDWLRQ0DSRI'\QDPLF5HDGLQJV0RGH
1H[XVŠ,QIRUPDWLRQ0RGH
1DYLJDWLRQ0DSRI1H[XVŠ,QIRUPDWLRQ0RGH
'LVSOD\)HDWXUHV0RGH
1DYLJDWLRQ0DSRI'LVSOD\)HDWXUHV0RGH
2SWLRQDO31/('([WHUQDO5HPRWH'LVSOD\6SHFLILFDWLRQV
10: External I/O Modules
10-1
+DUGZDUH2YHUYLHZ
3RUW2YHUYLHZ
,20RGXOH,QVWDOODWLRQ
3RZHU6RXUFHIRU,20RGXOHV
8VLQJWKH36,2ZLWK0XOWLSOH,20RGXOHV
6WHSVIRU$WWDFKLQJ0XOWLSOH,20RGXOHV
)DFWRU\6HWWLQJVDQG5HVHW%XWWRQ
$QDORJ7UDQVGXFHU6LJQDO2XWSXW0RGXOHV
2YHUYLHZ
1RUPDO0RGH
$QDORJ,QSXW0RGXOHV
2YHUYLHZ
1RUPDO0RGH
'LJLWDO'U\&RQWDFW5HOD\2XWSXW)RUP&0RGXOH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
72&
7DEOHRI&RQWHQWV
2YHUYLHZ
&RPPXQLFDWLRQ
1RUPDO0RGH
'LJLWDO6ROLG6WDWH3XOVH2XWSXW.<=0RGXOH
2YHUYLHZ
&RPPXQLFDWLRQ
1RUPDO0RGH
'LJLWDO6WDWXV,QSXW0RGXOH
2YHUYLHZ
&RPPXQLFDWLRQ
1RUPDO0RGH
11: Electrical Installation
11-1
Considerations when Installing Meters
11-1
11.2: Blade Configuration for for Forms 9S, 36S, and 45S
11-5
11.3: :LULQJ'LDJUDPV
6
460HWHU0RXQWHGLQ6$$GDSWHr
124
12: Switchboard Meter
12-1
,QWURGXFWLRQ
/DEHOV
6SHFLILFDWLRQVDQG'LPHQVLRQV
,QVWDOODWLRQ
:LULQJ'LDJUDPV
12.6: E137370 S1 to M1 Retrofit Panel
12-23
13: Meter Calculations
13-1
0HDVXUHPHQWVDQG&DOFXODWLRQV
'HPDQG,QWHJUDWRUV
14: EN50160/IEC61000-4-15 Flicker
14-1
2YHUYLHZ
7KHRU\RI2SHUDWLRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
72&
7DEOHRI&RQWHQWV
$7UDQVIRUPHU/RVV&RPSHQVDWLRQ6SUHDGVKHHWDQG([DPSOHV$
$&DOFXODWLQJ9DOXHV$
$([FHO6SUHDGVKHHWZLWK([DPSOH1XPEHUV$
B: Blade Configuration for Forms 9S, 36S and 45S
B-1
%)RUPV
%
%%ODGH&RQILJXUDWLRQ'UDZLQJV
%
Glossary
GL-1
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
72&
7KUHH3KDVH3RZHU0HDVXUHPHQW
1:Three-Phase Power Measurement
7KLVLQWURGXFWLRQWRWKUHHSKDVHSRZHUDQGSRZHUPHDVXUHPHQWLVLQWHQGHGWR
SURYLGHRQO\DEULHIRYHUYLHZRIWKHVXEMHFW7KHSURIHVVLRQDOPHWHUHQJLQHHURUPHWHU
WHFKQLFLDQVKRXOGUHIHUWRPRUHDGYDQFHGGRFXPHQWVVXFKDVWKH((,+DQGERRNIRU
(OHFWULFLW\0HWHULQJDQGWKHDSSOLFDWLRQVWDQGDUGVIRUPRUHLQGHSWKDQGWHFKQLFDO
FRYHUDJHRIWKHVXEMHFW
1.1: Three-Phase System Configurations
7KUHHSKDVHSRZHULVPRVWFRPPRQO\XVHGLQVLWXDWLRQVZKHUHODUJHDPRXQWVRI
SRZHUZLOOEHXVHGEHFDXVHLWLVDPRUHHIIHFWLYHZD\WRWUDQVPLWWKHSRZHUDQG
EHFDXVHLWSURYLGHVDVPRRWKHUGHOLYHU\RISRZHUWRWKHHQGORDG7KHUHDUHWZR
FRPPRQO\XVHGFRQQHFWLRQVIRUWKUHHSKDVHSRZHUDZ\HFRQQHFWLRQRUDGHOWD
FRQQHFWLRQ(DFKFRQQHFWLRQKDVVHYHUDOGLIIHUHQWPDQLIHVWDWLRQVLQDFWXDOXVH
:KHQDWWHPSWLQJWRGHWHUPLQHWKHW\SHRIFRQQHFWLRQLQXVHLWLVDJRRGSUDFWLFHWR
IROORZWKHFLUFXLWEDFNWRWKHWUDQVIRUPHUWKDWLVVHUYLQJWKHFLUFXLW,WLVRIWHQQRW
SRVVLEOHWRFRQFOXVLYHO\GHWHUPLQHWKHFRUUHFWFLUFXLWFRQQHFWLRQVLPSO\E\FRXQWLQJ
WKHZLUHVLQWKHVHUYLFHRUFKHFNLQJYROWDJHV&KHFNLQJWKHWUDQVIRUPHUFRQQHFWLRQ
ZLOOSURYLGHFRQFOXVLYHHYLGHQFHRIWKHFLUFXLWFRQQHFWLRQDQGWKHUHODWLRQVKLSV
EHWZHHQWKHSKDVHYROWDJHVDQGJURXQG
1.1.1: Wye Connection
7KHZ\HFRQQHFWLRQLVVRFDOOHGEHFDXVHZKHQ\RXORRNDWWKHSKDVHUHODWLRQVKLSVDQG
WKHZLQGLQJUHODWLRQVKLSVEHWZHHQWKHSKDVHVLWORRNVOLNHD<)LJXUHGHSLFWVWKH
ZLQGLQJUHODWLRQVKLSVIRUDZ\HFRQQHFWHGVHUYLFH,QDZ\HVHUYLFHWKHQHXWUDORU
FHQWHUSRLQWRIWKHZ\HLVW\SLFDOO\JURXQGHG7KLVOHDGVWRFRPPRQYROWDJHVRI
DQGZKHUHWKHILUVWQXPEHUUHSUHVHQWVWKHSKDVHWRSKDVHYROWDJHDQG
WKHVHFRQGQXPEHUUHSUHVHQWVWKHSKDVHWRJURXQGYROWDJH
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
VC
Phase 2
N
Phase 1
Phase 3
VB
VA
)LJXUH7KUHHSKDVH:\H:LQGLQJ
7KHWKUHHYROWDJHVDUHVHSDUDWHGE\RHOHFWULFDOO\8QGHUEDODQFHGORDGFRQGLWLRQV
WKHFXUUHQWVDUHDOVRVHSDUDWHGE\R+RZHYHUXQEDODQFHGORDGVDQGRWKHU
FRQGLWLRQVFDQFDXVHWKHFXUUHQWVWRGHSDUWIURPWKHLGHDORVHSDUDWLRQ7KUHH
SKDVHYROWDJHVDQGFXUUHQWVDUHXVXDOO\UHSUHVHQWHGZLWKDSKDVRUGLDJUDP$SKDVRU
GLDJUDPIRUWKHW\SLFDOFRQQHFWHGYROWDJHVDQGFXUUHQWVLVVKRZQLQ)LJXUH
VC
IC
N
IA
VB
IB
VA
)LJXUH3KDVRU'LDJUDP6KRZLQJ7KUHHSKDVH9ROWDJHVDQG&XUUHQWV
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
7KHSKDVRUGLDJUDPVKRZVWKHRDQJXODUVHSDUDWLRQEHWZHHQWKHSKDVHYROWDJHV
7KHSKDVHWRSKDVHYROWDJHLQDEDODQFHGWKUHHSKDVHZ\HV\VWHPLVWLPHVWKH
SKDVHWRQHXWUDOYROWDJH7KHFHQWHUSRLQWRIWKHZ\HLVWLHGWRJHWKHUDQGLVW\SLFDOO\
JURXQGHG7DEOHVKRZVWKHFRPPRQYROWDJHVXVHGLQWKH8QLWHG6WDWHVIRUZ\H
FRQQHFWHGV\VWHPV
Phase to Ground Voltage
Phase to Phase Voltage
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
YROWV
7DEOH&RPPRQ3KDVH9ROWDJHVRQ:\H6HUYLFHV
8VXDOO\DZ\HFRQQHFWHGVHUYLFHZLOOKDYHIRXUZLUHVWKUHHZLUHVIRUWKHSKDVHVDQG
RQHIRUWKHQHXWUDO7KHWKUHHSKDVHZLUHVFRQQHFWWRWKHWKUHHSKDVHVDVVKRZQLQ
)LJXUH7KHQHXWUDOZLUHLVW\SLFDOO\WLHGWRWKHJURXQGRUFHQWHUSRLQWRIWKHZ\H
,QPDQ\LQGXVWULDODSSOLFDWLRQVWKHIDFLOLW\ZLOOEHIHGZLWKDIRXUZLUHZ\HVHUYLFHEXW
RQO\WKUHHZLUHVZLOOEHUXQWRLQGLYLGXDOORDGV7KHORDGLVWKHQRIWHQUHIHUUHGWRDVD
GHOWDFRQQHFWHGORDGEXWWKHVHUYLFHWRWKHIDFLOLW\LVVWLOODZ\HVHUYLFHLWFRQWDLQV
IRXUZLUHVLI\RXWUDFHWKHFLUFXLWEDFNWRLWVVRXUFHXVXDOO\DWUDQVIRUPHU,QWKLV
W\SHRIFRQQHFWLRQWKHSKDVHWRJURXQGYROWDJHZLOOEHWKHSKDVHWRJURXQGYROWDJH
LQGLFDWHGLQ7DEOHHYHQWKRXJKDQHXWUDORUJURXQGZLUHLVQRWSK\VLFDOO\SUHVHQWDW
WKHORDG7KHWUDQVIRUPHULVWKHEHVWSODFHWRGHWHUPLQHWKHFLUFXLWFRQQHFWLRQW\SH
EHFDXVHWKLVLVDORFDWLRQZKHUHWKHYROWDJHUHIHUHQFHWRJURXQGFDQEHFRQFOXVLYHO\
LGHQWLILHG
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
1.1.2: Delta Connection
'HOWDFRQQHFWHGVHUYLFHVPD\EHIHGZLWKHLWKHUWKUHHZLUHVRUIRXUZLUHV,QDWKUHH
SKDVHGHOWDVHUYLFHWKHORDGZLQGLQJVDUHFRQQHFWHGIURPSKDVHWRSKDVHUDWKHUWKDQ
IURPSKDVHWRJURXQG)LJXUHVKRZVWKHSK\VLFDOORDGFRQQHFWLRQVIRUDGHOWD
VHUYLFH
VC
Phase 3
VB
Phase 2
Phase 1
VA
)LJXUH7KUHHSKDVH'HOWD:LQGLQJ5HODWLRQVKLS
,QWKLVH[DPSOHRIDGHOWDVHUYLFHWKUHHZLUHVZLOOWUDQVPLWWKHSRZHUWRWKHORDG,QD
WUXHGHOWDVHUYLFHWKHSKDVHWRJURXQGYROWDJHZLOOXVXDOO\QRWEHEDODQFHGEHFDXVH
WKHJURXQGLVQRWDWWKHFHQWHURIWKHGHOWD
)LJXUHVKRZVWKHSKDVRUUHODWLRQVKLSVEHWZHHQYROWDJHDQGFXUUHQWRQDWKUHH
SKDVHGHOWDFLUFXLW
,QPDQ\GHOWDVHUYLFHVRQHFRUQHURIWKHGHOWDLVJURXQGHG7KLVPHDQVWKHSKDVHWR
JURXQGYROWDJHZLOOEH]HURIRURQHSKDVHDQGZLOOEHIXOOSKDVHWRSKDVHYROWDJHIRU
WKHRWKHUWZRSKDVHV7KLVLVGRQHIRUSURWHFWLYHSXUSRVHV
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
VBC
VCA
IC
IA
IB
VAB
)LJXUH3KDVRU'LDJUDP7KUHH3KDVH9ROWDJHVDQG&XUUHQWV'HOWD&RQQHFWHG
$QRWKHUFRPPRQGHOWDFRQQHFWLRQLVWKHIRXUZLUHJURXQGHGGHOWDXVHGIRUOLJKWLQJ
ORDGV,QWKLVFRQQHFWLRQWKHFHQWHUSRLQWRIRQHZLQGLQJLVJURXQGHG2QD
YROWIRXUZLUHJURXQGHGGHOWDVHUYLFHWKHSKDVHWRJURXQGYROWDJHZRXOGEH
YROWVRQWZRSKDVHVDQGYROWVRQWKHWKLUGSKDVH)LJXUHVKRZVWKHSKDVRU
GLDJUDPIRUWKHYROWDJHVLQDWKUHHSKDVHIRXUZLUHGHOWDV\VWHP
VC
VCA
VBC
N
VA
VAB
VB
)LJXUH3KDVRU'LDJUDP6KRZLQJ7KUHHSKDVH)RXU:LUH'HOWD&RQQHFWHG6\VWHP
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
1.1.3: Blondell’s Theorem and Three Phase Measurement
,QDQHQJLQHHUDQGPDWKHPDWLFLDQQDPHG$QGUH(%ORQGHOOVHWIRUWKWKHILUVW
VFLHQWLILFEDVLVIRUSRO\SKDVHPHWHULQJ+LVWKHRUHPVWDWHV
,IHQHUJ\LVVXSSOLHGWRDQ\V\VWHPRIFRQGXFWRUVWKURXJK1ZLUHVWKHWRWDOSRZHULQ
WKHV\VWHPLVJLYHQE\WKHDOJHEUDLFVXPRIWKHUHDGLQJVRI1ZDWWPHWHUVVRDUUDQJHG
WKDWHDFKRIWKH1ZLUHVFRQWDLQVRQHFXUUHQWFRLOWKHFRUUHVSRQGLQJSRWHQWLDOFRLO
EHLQJFRQQHFWHGEHWZHHQWKDWZLUHDQGVRPHFRPPRQSRLQW,IWKLVFRPPRQSRLQWLV
RQRQHRIWKH1ZLUHVWKHPHDVXUHPHQWPD\EHPDGHE\WKHXVHRI1:DWWPHWHUV
7KHWKHRUHPPD\EHVWDWHGPRUHVLPSO\LQPRGHUQODQJXDJH
,QDV\VWHPRI1FRQGXFWRUV1PHWHUHOHPHQWVZLOOPHDVXUHWKHSRZHURUHQHUJ\
WDNHQSURYLGHGWKDWDOOWKHSRWHQWLDOFRLOVKDYHDFRPPRQWLHWRWKHFRQGXFWRULQ
ZKLFKWKHUHLVQRFXUUHQWFRLO
7KUHHSKDVHSRZHUPHDVXUHPHQWLVDFFRPSOLVKHGE\PHDVXULQJWKHWKUHHLQGLYLGXDO
SKDVHVDQGDGGLQJWKHPWRJHWKHUWRREWDLQWKHWRWDOWKUHHSKDVHYDOXH,QROGHUDQD
ORJPHWHUVWKLVPHDVXUHPHQWZDVDFFRPSOLVKHGXVLQJXSWRWKUHHVHSDUDWHHOHPHQWV
(DFKHOHPHQWFRPELQHGWKHVLQJOHSKDVHYROWDJHDQGFXUUHQWWRSURGXFHDWRUTXHRQ
WKHPHWHUGLVN$OOWKUHHHOHPHQWVZHUHDUUDQJHGDURXQGWKHGLVNVRWKDWWKHGLVNZDV
VXEMHFWHGWRWKHFRPELQHGWRUTXHRIWKHWKUHHHOHPHQWV$VDUHVXOWWKHGLVNZRXOG
WXUQDWDKLJKHUVSHHGDQGUHJLVWHUSRZHUVXSSOLHGE\HDFKRIWKHWKUHHZLUHV
$FFRUGLQJWR%ORQGHOO
V7KHRUHPLWZDVSRVVLEOHWRUHGXFHWKHQXPEHURIHOHPHQWV
XQGHUFHUWDLQFRQGLWLRQV)RUH[DPSOHDWKUHHSKDVHWKUHHZLUHGHOWDV\VWHPFRXOG
EHFRUUHFWO\PHDVXUHGZLWKWZRHOHPHQWVWZRSRWHQWLDOFRLOVDQGWZRFXUUHQWFRLOVLI
WKHSRWHQWLDOFRLOVZHUHFRQQHFWHGEHWZHHQWKHWKUHHSKDVHVZLWKRQHSKDVHLQ
FRPPRQ
,QDWKUHHSKDVHIRXUZLUHZ\HV\VWHPLWLVQHFHVVDU\WRXVHWKUHHHOHPHQWV7KUHH
YROWDJHFRLOVDUHFRQQHFWHGEHWZHHQWKHWKUHHSKDVHVDQGWKHFRPPRQQHXWUDOFRQ
GXFWRU$FXUUHQWFRLOLVUHTXLUHGLQHDFKRIWKHWKUHHSKDVHV
,QPRGHUQGLJLWDOPHWHUV%ORQGHOO
V7KHRUHPLVVWLOODSSOLHGWRREWDLQSURSHU
PHWHULQJ7KHGLIIHUHQFHLQPRGHUQPHWHUVLVWKDWWKHGLJLWDOPHWHUPHDVXUHVHDFK
SKDVHYROWDJHDQGFXUUHQWDQGFDOFXODWHVWKHVLQJOHSKDVHSRZHUIRUHDFKSKDVH7KH
PHWHUWKHQVXPVWKHWKUHHSKDVHSRZHUVWRDVLQJOHWKUHHSKDVHUHDGLQJ
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
6RPHGLJLWDOPHWHUVFDOFXODWHWKHLQGLYLGXDOSKDVHSRZHUYDOXHVRQHSKDVHDWDWLPH
7KLVPHDQVWKHPHWHUVDPSOHVWKHYROWDJHDQGFXUUHQWRQRQHSKDVHDQGFDOFXODWHVD
SRZHUYDOXH7KHQLWVDPSOHVWKHVHFRQGSKDVHDQGFDOFXODWHVWKHSRZHUIRUWKH
VHFRQGSKDVH)LQDOO\LWVDPSOHVWKHWKLUGSKDVHDQGFDOFXODWHVWKDWSKDVHSRZHU
$IWHUVDPSOLQJDOOWKUHHSKDVHVWKHPHWHUFRPELQHVWKHWKUHHUHDGLQJVWRFUHDWHWKH
HTXLYDOHQWWKUHHSKDVHSRZHUYDOXH8VLQJPDWKHPDWLFDODYHUDJLQJWHFKQLTXHVWKLV
PHWKRGFDQGHULYHDTXLWHDFFXUDWHPHDVXUHPHQWRIWKUHHSKDVHSRZHU
0RUHDGYDQFHGPHWHUVDFWXDOO\VDPSOHDOOWKUHHSKDVHVRIYROWDJHDQGFXUUHQW
VLPXOWDQHRXVO\DQGFDOFXODWHWKHLQGLYLGXDOSKDVHDQGWKUHHSKDVHSRZHUYDOXHV7KH
DGYDQWDJHRIVLPXOWDQHRXVVDPSOLQJLVWKHUHGXFWLRQRIHUURULQWURGXFHGGXHWRWKH
GLIIHUHQFHLQWLPHZKHQWKHVDPSOHVZHUHWDNHQ
C
B
Phase B
Phase C
Node "n"
Phase A
A
N
)LJXUH7KUHH3KDVH:\H/RDG,OOXVWUDWLQJ.LUFKKRII¶V/DZDQG%ORQGHOO¶V7KHRUHP
%ORQGHOO
V7KHRUHPLVDGHULYDWLRQWKDWUHVXOWVIURP.LUFKKRII
V/DZ.LUFKKRII
V/DZ
VWDWHVWKDWWKHVXPRIWKHFXUUHQWVLQWRDQRGHLV]HUR$QRWKHUZD\RIVWDWLQJWKH
VDPHWKLQJLVWKDWWKHFXUUHQWLQWRDQRGHFRQQHFWLRQSRLQWPXVWHTXDOWKHFXUUHQW
RXWRIWKHQRGH7KHODZFDQEHDSSOLHGWRPHDVXULQJWKUHHSKDVHORDGV)LJXUH
VKRZVDW\SLFDOFRQQHFWLRQRIDWKUHHSKDVHORDGDSSOLHGWRDWKUHHSKDVHIRXUZLUH
VHUYLFH.irFKKRII
V/DZKROGVWKDWWKHVXPRIFXUUHQWV$%&DQG1PXVWHTXDO]HUR
RUWKDWWKHVXPRIFXUUHQWVLQWR1RGHQPXVWHTXDO]HUR
,IZHPHDVXUHWKHFXUUHQWVLQZLUHV$%DQG&ZHWKHQNQRZWKHFXUUHQWLQZLUH1E\
.LUFKKRII
V/DZDQGLWLVQRWQHFHVVDU\WRPHDVXUHLW7KLVIDFWOHDGVXVWRWKH
FRQFOXVLRQRI%ORQGHOO
V7KHRUHPWKDWZHRQO\QHHGWRPHDVXUHWKHSRZHULQWKUHHRI
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
WKHIRXUZLUHVLIWKH\DUHFRQQHFWHGE\DFRPPRQQRGH,QWKHFLUFXLWRI)LJXUHZH
PXVWPHDVXUHWKHSRZHUIORZLQWKUHHZLUHV7KLVZLOOUHTXLUHWKUHHYROWDJHFRLOVDQG
WKUHHFXUUHQWFRLOVDWKUHHHOHPHQWPHWHU6LPLODUILJXUHVDQGFRQFOXVLRQVFRXOGEH
UHDFKHGIRURWKHUFLUFXLWFRQILJXUDWLRQVLQYROYLQJ'HOWDFRQQHFWHGORDGV
1.2: Power, Energy and Demand
,WLVTXLWHFRPPRQWRH[FKDQJHSRZHUHQHUJ\DQGGHPDQGZLWKRXWGLIIHUHQWLDWLQJ
EHWZHHQWKHWKUHH%HFDXVHWKLVSUDFWLFHFDQOHDGWRFRQIXVLRQWKHGLIIHUHQFHV
EHWZHHQWKHVHWKUHHPHDVXUHPHQWVZLOOEHGLVFXVVHG
3RZHULVDQLQVWDQWDQHRXVUHDGLQJ7KHSRZHUUHDGLQJSURYLGHGE\DPHWHULVWKH
SUHVHQWIORZRIZDWWV3RZHULVPHDVXUHGLPPHGLDWHO\MXVWOLNHFXUUHQW,QPDQ\
GLJLWDOPHWHUVWKHSRZHUYDOXHLVDFWXDOO\PHDVXUHGDQGFDOFXODWHGRYHUDRQHVHFRQG
LQWHUYDOEHFDXVHLWWDNHVVRPHDPRXQWRIWLPHWRFDOFXODWHWKH506YDOXHVRIYROWDJH
DQGFXUUHQW%XWWKLVWLPHLQWHUYDOLVNHSWVPDOOWRSUHVHUYHWKHLQVWDQWDQHRXVQDWXUH
RISRZHU
(QHUJ\LVDOZD\VEDVHGRQVRPHWLPHLQFUHPHQWLWLVWKHLQWHJUDWLRQRISRZHURYHUD
GHILQHGWLPHLQFUHPHQW(QHUJ\LVDQLPSRUWDQWYDOXHEHFDXVHDOPRVWDOOHOHFWULFELOOV
DUHEDVHGLQSDUWRQWKHDPRXQWRIHQHUJ\XVHG
7\SLFDOO\HOHFWULFDOHQHUJ\LVPHDVXUHGLQXQLWVRINLORZDWWKRXUVN:K$NLORZDWW
KRXUUHSUHVHQWVDFRQVWDQWORDGRIRQHWKRXVDQGZDWWVRQHNLORZDWWIRURQHKRXU
6WDWHGDQRWKHUZD\LIWKHSRZHUGHOLYHUHGLQVWDQWDQHRXVZDWWVLVPHDVXUHGDV
ZDWWVDQGWKHORDGZDVVHUYHGIRUDRQHKRXUWLPHLQWHUYDOWKHQWKHORDGZRXOG
KDYHDEVRUEHGRQHNLORZDWWKRXURIHQHUJ\$GLIIHUHQWORDGPD\KDYHDFRQVWDQW
SRZHUUHTXLUHPHQWRIZDWWV,IWKHORDGZHUHVHUYHGIRURQHKRXULWZRXOG
DEVRUEIRXUN:K,IWKHORDGZHUHVHUYHGIRUPLQXWHVLWZRXOGDEVRUEóRIWKDW
WRWDORURQHN:K
)LJXUHVKRZVDJUDSKRISRZHUDQGWKHUHVXOWLQJHQHUJ\WKDWZRXOGEHWUDQVPLWWHG
DVDUHVXOWRIWKHLOOXVWUDWHGSRZHUYDOXHV)RUWKLVLOOXVWUDWLRQLWLVDVVXPHGWKDWWKH
SRZHUOHYHOLVKHOGFRQVWDQWIRUHDFKPLQXWHZKHQDPHDVXUHPHQWLVWDNHQ(DFKEDU
LQWKHJUDSKZLOOUHSUHVHQWWKHSRZHUORDGIRUWKHRQHPLQXWHLQFUHPHQWRIWLPH,Q
UHDOOLIHWKHSRZHUYDOXHPRYHVDOPRVWFRQVWDQWO\
7KHGDWDIURP)LJXUHLVUHSURGXFHGLQ7DEOHWRLOOXVWUDWHWKHFDOFXODWLRQRI
HQHUJ\6LQFHWKHWLPHLQFUHPHQWRIWKHPHDVXUHPHQWLVRQHPLQXWHDQGVLQFHZH
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
VSHFLILHGWKDWWKHORDGLVFRQVWDQWRYHUWKDWPLQXWHZHFDQFRQYHUWWKHSRZHUUHDGLQJ
WRDQHTXLYDOHQWFRQVXPHGHQHUJ\UHDGLQJE\PXOWLSO\LQJWKHSRZHUUHDGLQJWLPHV
FRQYHUWLQJWKHWLPHEDVHIURPPLQXWHVWRKRXUV
80
70
kilowat t s
60
50
40
30
20
10
0
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
Time (minutes)
)LJXUH3RZHU8VHRYHU7LPH
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
Time
Interval
(minute)
Power
(kW)
Energy
(kWh)
Accumulated
Energy
(kWh)
7DEOH3RZHUDQG(QHUJ\5HODWLRQVKLSRYHU7LPH
$VLQ7DEOHWKHDFFXPXODWHGHQHUJ\IRUWKHSRZHUORDGSURILOHRI)LJXUHLV
N:K
'HPDQGLVDOVRDWLPHEDVHGYDOXH7KHGHPDQGLVWKHDYHUDJHUDWHRIHQHUJ\XVH
RYHUWLPH7KHDFWXDOODEHOIRUGHPDQGLVNLORZDWWKRXUVKRXUEXWWKLVLVQRUPDOO\
UHGXFHGWRNLORZDWWV7KLVPDNHVLWHDV\WRFRQIXVHGHPDQGZLWKSRZHUEXWGHPDQG
LVQRWDQLQVWDQWDQHRXVYDOXH7RFDOFXODWHGHPDQGLWLVQHFHVVDU\WRDFFXPXODWHWKH
HQHUJ\UHDGLQJVDVLOOXVWUDWHGLQ)LJXUHDQGDGMXVWWKHHQHUJ\UHDGLQJWRDQ
KRXUO\YDOXHWKDWFRQVWLWXWHVWKHGHPDQG
,QWKHH[DPSOHWKHDFFXPXODWHGHQHUJ\LVN:K%XWWKLVPHDVXUHPHQWZDV
PDGHRYHUDPLQXWHLQWHUYDO7RFRQYHUWWKHUHDGLQJWRDGHPDQGYDOXHLWPXVWEH
QRUPDOL]HGWRDPLQXWHLQWHUYDO,IWKHSDWWHUQZHUHUHSHDWHGIRUDQDGGLWLRQDO
WKUHHPLQXWHLQWHUYDOVWKHWRWDOHQHUJ\ZRXOGEHIRXUWLPHVWKHPHDVXUHGYDOXHRU
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
N:K7KHVDPHSURFHVVLVDSSOLHGWRFDOFXODWHWKHPLQXWHGHPDQGYDOXH
7KHGHPDQGYDOXHDVVRFLDWHGZLWKWKHH[DPSOHORDGLVN:KKURUN:G
1RWHWKDWWKHSHDNLQVWDQWDQHRXVYDOXHRISRZHULVN:VLJQLILFDQWO\PRUHWKDQWKH
GHPDQGYDOXH
)LJXUHVKRZVDQRWKHUH[DPSOHRIHQHUJ\DQGGHPDQG,QWKLVFDVHHDFKEDU
UHSUHVHQWVWKHHQHUJ\FRQVXPHGLQDPLQXWHLQWHUYDO7KHHQHUJ\XVHLQHDFK
LQWHUYDOW\SLFDOO\IDOOVEHWZHHQDQGN:K+RZHYHUGXULQJWZRLQWHUYDOVWKH
HQHUJ\ULVHVVKDUSO\DQGSHDNVDWN:KLQLQWHUYDOQXPEHU7KLVSHDNRIXVDJH
ZLOOUHVXOWLQVHWWLQJDKLJKGHPDQGUHDGLQJ)RUHDFKLQWHUYDOVKRZQWKHGHPDQG
YDOXHZRXOGEHIRXUWLPHVWKHLQGLFDWHGHQHUJ\UHDGLQJ6RLQWHUYDOZRXOGKDYHDQ
DVVRFLDWHGGHPDQGRIN:KKU,QWHUYDOZLOOKDYHDGHPDQGYDOXHRIN:K
KU,QWKHGDWDVKRZQWKLVLVWKHSHDNGHPDQGYDOXHDQGZRXOGEHWKHQXPEHUWKDW
ZRXOGVHWWKHGHPDQGFKDUJHRQWKHXWLOLW\ELOO
100
kilowat t-hours
80
60
40
20
0
1
2
3
4
5
6
Intervals (15 mins.)
7
8
)LJXUH(QHUJ\8VHDQG'HPDQG
$VFDQEHVHHQIURPWKLVH[DPSOHLWLVLPSRUWDQWWRUHFRJQL]HWKHUHODWLRQVKLSV
EHWZHHQSRZHUHQHUJ\DQGGHPDQGLQRUGHUWRFRQWUROORDGVHIIHFWLYHO\RUWRPRQLWRU
XVHFRUUHFWO\
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
1.3: Reactive Energy and Power Factor
7KHUHDOSRZHUDQGHQHUJ\PHDVXUHPHQWVGLVFXVVHGLQWKHSUHYLRXVVHFWLRQUHODWHWR
WKHTXDQWLWLHVWKDWDUHPRVWXVHGLQHOHFWULFDOV\VWHPV%XWLWLVRIWHQQRWVXIILFLHQWWR
RQO\PHDVXUHUHDOSRZHUDQGHQHUJ\5HDFWLYHSRZHULVDFULWLFDOFRPSRQHQWRIWKH
WRWDOSRZHUSLFWXUHEHFDXVHDOPRVWDOOUHDOOLIHDSSOLFDWLRQVKDYHDQLPSDFWRQ
UHDFWLYHSRZHU5HDFWLYHSRZHUDQGSRZHUIDFWRUFRQFHSWVUHODWHWRERWKORDGDQG
JHQHUDWLRQDSSOLFDWLRQV+RZHYHUWKLVGLVFXVVLRQZLOOEHOLPLWHGWRDQDO\VLVRIUHDFWLYH
SRZHUDQGSRZHUIDFWRUDVWKH\UHODWHWRORDGV7RVLPSOLI\WKHGLVFXVVLRQJHQHUDWLRQ
ZLOOQRWEHFRQVLGHUHG
5HDOSRZHUDQGHQHUJ\LVWKHFRPSRQHQWRISRZHUWKDWLVWKHFRPELQDWLRQRIWKH
YROWDJHDQGWKHYDOXHRIFRUUHVSRQGLQJFXUUHQWWKDWLVGLUHFWO\LQSKDVHZLWKWKH
YROWDJH+RZHYHULQDFWXDOSUDFWLFHWKHWRWDOFXUUHQWLVDOPRVWQHYHULQSKDVHZLWKWKH
YROWDJH6LQFHWKHFXUUHQWLVQRWLQSKDVHZLWKWKHYROWDJHLWLVQHFHVVDU\WRFRQVLGHU
ERWKWKHLQSKDVHFRPSRQHQWDQGWKHFRPSRQHQWWKDWLVDWTXDGUDWXUHDQJXODUO\
URWDWHGRRUSHUSHQGLFXODUWRWKHYROWDJH)LJXUHVKRZVDVLQJOHSKDVHYROWDJH
DQGFXUUHQWDQGEUHDNVWKHFXUUHQWLQWRLWVLQSKDVHDQGTXDGUDWXUHFRPSRQHQWV
IR
V
0
IX
I
)LJXUH9ROWDJHDQG&RPSOH[&XUUHQW
7KHYROWDJH9DQGWKHWRWDOFXUUHQW,FDQEHFRPELQHGWRFDOFXODWHWKHDSSDUHQW
SRZHURU9$7KHYROWDJHDQGWKHLQSKDVHFXUUHQW,5DUHFRPELQHGWRSURGXFHWKH
UHDOSRZHURUZDWWV7KHYROWDJHDQGWKHTXDGUDWXUHFXUUHQW,;DUHFRPELQHGWR
FDOFXODWHWKHUHDFWLYHSRZHU
7KHTXDGUDWXUHFXUUHQWPD\EHODJJLQJWKHYROWDJHDVVKRZQLQ)LJXUHRULWPD\
OHDGWKHYROWDJH:KHQWKHTXDGUDWXUHFXUUHQWODJVWKHYROWDJHWKHORDGLVUHTXLULQJ
ERWKUHDOSRZHUZDWWVDQGUHDFWLYHSRZHU9$5V:KHQWKHTXDGUDWXUHFXUUHQW
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
OHDGVWKHYROWDJHWKHORDGLVUHTXLULQJUHDOSRZHUZDWWVEXWLVGHOLYHULQJUHDFWLYH
SRZHU9$5VEDFNLQWRWKHV\VWHPWKDWLV9$5VDUHIORZLQJLQWKHRSSRVLWHGLUHFWLRQ
RIWKHUHDOSRZHUIORZ
5HDFWLYHSRZHU9$5VLVUHTXLUHGLQDOOSRZHUV\VWHPV$Q\HTXLSPHQWWKDWXVHV
PDJQHWL]DWLRQWRRSHUDWHUHTXLUHV9$5V8VXDOO\WKHPDJQLWXGHRI9$5VLVUHODWLYHO\
ORZFRPSDUHGWRWKHUHDOSRZHUTXDQWLWLHV8WLOLWLHVKDYHDQLQWHUHVWLQPDLQWDLQLQJ
9$5UHTXLUHPHQWVDWWKHFXVWRPHUWRDORZYDOXHLQRUGHUWRPD[LPL]HWKHUHWXUQRQ
SODQWLQYHVWHGWRGHOLYHUHQHUJ\:KHQOLQHVDUHFDUU\LQJ9$5VWKH\FDQQRWFDUU\DV
PDQ\ZDWWV6RNHHSLQJWKH9$5FRQWHQWORZDOORZVDOLQHWRFDUU\LWVIXOOFDSDFLW\RI
ZDWWV,QRUGHUWRHQFRXUDJHFXVWRPHUVWRNHHS9$5UHTXLUHPHQWVORZVRPHXWLOLWLHV
LPSRVHDSHQDOW\LIWKH9$5FRQWHQWRIWKHORDGULVHVDERYHDVSHFLILHGYDOXH
$FRPPRQPHWKRGRIPHDVXULQJUHDFWLYHSRZHUUHTXLUHPHQWVLVSRZHUIDFWRU3RZHU
IDFWRUFDQEHGHILQHGLQWZRGLIIHUHQWZD\V7KHPRUHFRPPRQPHWKRGRIFDOFXODWLQJ
SRZHUIDFWRULVWKHUDWLRRIWKHUHDOSRZHUWRWKHDSSDUHQWSRZHU7KLVUHODWLRQVKLSLV
H[SUHVVHGLQWKHIROORZLQJIRUPXOD
7RWDO3) UHDOSRZHUDSSDUHQWSRZHU ZDWWV9$
7KLVIRUPXODFDOFXODWHVDSRZHUIDFWRUTXDQWLW\NQRZQDV7RWDO3RZHU)DFWRU,WLV
FDOOHG7RWDO3)EHFDXVHLWLVEDVHGRQWKHUDWLRVRIWKHSRZHUGHOLYHUHG7KHGHOLYHUHG
SRZHUTXDQWLWLHVZLOOLQFOXGHWKHLPSDFWVRIDQ\H[LVWLQJKDUPRQLFFRQWHQW,IWKHYROW
DJHRUFXUUHQWLQFOXGHVKLJKOHYHOVRIKDUPRQLFGLVWRUWLRQWKHSRZHUYDOXHVZLOOEH
DIIHFWHG%\FDOFXODWLQJSRZHUIDFWRUIURPWKHSRZHUYDOXHVWKHSRZHUIDFWRUZLOO
LQFOXGHWKHLPSDFWRIKDUPRQLFGLVWRUWLRQ,QPDQ\FDVHVWKLVLVWKHSUHIHUUHGPHWKRG
RIFDOFXODWLRQEHFDXVHWKHHQWLUHLPSDFWRIWKHDFWXDOYROWDJHDQGFXUUHQWDUH
LQFOXGHG
$VHFRQGW\SHRISRZHUIDFWRULV'LVSODFHPHQW3RZHU)DFWRU'LVSODFHPHQW3)LVEDVHG
RQWKHDQJXODUUHODWLRQVKLSEHWZHHQWKHYROWDJHDQGFXUUHQW'LVSODFHPHQWSRZHUIDF
WRUGRHVQRWFRQVLGHUWKHPDJQLWXGHVRIYROWDJHFXUUHQWRUSRZHU,WLVVROHO\EDVHG
RQWKHSKDVHDQJOHGLIIHUHQFHV$VDUHVXOWLWGRHVQRWLQFOXGHWKHLPSDFWRIKDUPRQLF
GLVWRUWLRQ'LVSODFHPHQWSRZHUIDFWRULVFDOFXODWHGXVLQJWKHIROORZLQJHTXDWLRQ
'LVSODFHPHQW 3)
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
FRV T
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
ZKHUHTLVWKHDQJOHEHWZHHQWKHYROWDJHDQGWKHFXUUHQWVHH)LJ
,QDSSOLFDWLRQVZKHUHWKHYROWDJHDQGFXUUHQWDUHQRWGLVWRUWHGWKH7RWDO3RZHU)DFWRU
ZLOOHTXDOWKH'LVSODFHPHQW3RZHU)DFWRU%XWLIKDUPRQLFGLVWRUWLRQLVSUHVHQWWKH
WZRSRZHUIDFWRUVZLOOQRWEHHTXDO
1.4: Harmonic Distortion
+DUPRQLFGLVWRUWLRQLVSULPDULO\WKHUHVXOWRIKLJKFRQFHQWUDWLRQVRIQRQOLQHDUORDGV
'HYLFHVVXFKDVFRPSXWHUSRZHUVXSSOLHVYDULDEOHVSHHGGULYHVDQGIOXRUHVFHQWOLJKW
EDOODVWVPDNHFXUUHQWGHPDQGVWKDWGRQRWPDWFKWKHVLQXVRLGDOZDYHIRUPRI$&
HOHFWULFLW\$VDUHVXOWWKHFXUUHQWZDYHIRUPIHHGLQJWKHVHORDGVLVSHULRGLFEXWQRW
VLQXVRLGDO)LJXUHVKRZVDQRUPDOVLQXVRLGDOFXUUHQWZDYHIRUP7KLVH[DPSOH
KDVQRGLVWRUWLRQ
1000
0
Amps
500
Time
– 500
– 1000
)LJXUH1RQGLVWRUWHG&XUUHQW:DYHIRUP
)LJXUHVKRZVDFXUUHQWZDYHIRUPZLWKDVOLJKWDPRXQWRIKDUPRQLFGLVWRUWLRQ
7KHZDYHIRUPLVVWLOOSHULRGLFDQGLVIOXFWXDWLQJDWWKHQRUPDO+]IUHTXHQF\
+RZHYHUWKHZDYHIRUPLVQRWDVPRRWKVLQXVRLGDOIRUPDVVHHQLQ)LJXUH
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
1500
Current (amps)
1000
500
t
0
a
2a
–500
–1000
–1500
)LJXUH'LVWRUWHG&XUUHQW:DYHIRUP
7KHGLVWRUWLRQREVHUYHGLQ)LJXUHFDQEHPRGHOHGDVWKHVXPRIVHYHUDOVLQXVRL
GDOZDYHIRUPVRIIUHTXHQFLHVWKDWDUHPXOWLSOHVRIWKHIXQGDPHQWDO+]IUHTXHQF\
7KLVPRGHOLQJLVSHUIRUPHGE\PDWKHPDWLFDOO\GLVDVVHPEOLQJWKHGLVWRUWHGZDYHIRUP
LQWRDFROOHFWLRQRIKLJKHUIUHTXHQF\ZDYHIRUPV
7KHVHKLJKHUIUHTXHQF\ZDYHIRUPVDUHUHIHUUHGWRDVKDUPRQLFV)LJXUHVKRZV
WKHFRQWHQWRIWKHKDUPRQLFIUHTXHQFLHVWKDWPDNHXSWKHGLVWRUWLRQSRUWLRQRIWKH
ZDYHIRUPLQ)LJXUH
1000
0
Amps
500
Time
3rd harmonic
5th harmonic
– 500
7th harmonic
Total
fundamental
)LJXUH:DYHIRUPVRIWKH+DUPRQLFV
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
7KHZDYHIRUPVVKRZQLQ)LJXUHDUHQRWVPRRWKHGEXWGRSURYLGHDQLQGLFDWLRQRI
WKHLPSDFWRIFRPELQLQJPXOWLSOHKDUPRQLFIUHTXHQFLHVWRJHWKHU
:KHQKDUPRQLFVDUHSUHVHQWLWLVLPSRUWDQWWRUHPHPEHUWKDWWKHVHTXDQWLWLHVDUH
RSHUDWLQJDWKLJKHUIUHTXHQFLHV7KHUHIRUHWKH\GRQRWDOZD\VUHVSRQGLQWKHVDPH
PDQQHUDV+]YDOXHV
,QGXFWLYHDQGFDSDFLWLYHLPSHGDQFHDUHSUHVHQWLQDOOSRZHUV\VWHPV:HDUHDFFXV
WRPHGWRWKLQNLQJDERXWWKHVHLPSHGDQFHVDVWKH\SHUIRUPDW+]+RZHYHUWKHVH
LPSHGDQFHVDUHVXEMHFWWRIUHTXHQF\YDULDWLRQ
;/ MZ/DQG
;& MZ&
$W+]Z EXWDW+]WKKDUPRQLFZ $VIUHTXHQF\FKDQJHV
LPSHGDQFHFKDQJHVDQGV\VWHPLPSHGDQFHFKDUDFWHULVWLFVWKDWDUHQRUPDODW+]
PD\EHKDYHHQWLUHO\GLIIHUHQWO\LQWKHSUHVHQFHRIKLJKHURUGHUKDUPRQLFZDYHIRUPV
7UDGLWLRQDOO\WKHPRVWFRPPRQKDUPRQLFVKDYHEHHQWKHORZRUGHURGGIUHTXHQFLHV
VXFKDVWKHUGWKWKDQGWK+RZHYHUQHZHUQHZOLQHDUORDGVDUHLQWURGXFLQJ
VLJQLILFDQWTXDQWLWLHVRIKLJKHURUGHUKDUPRQLFV
6LQFHPXFKYROWDJHPRQLWRULQJDQGDOPRVWDOOFXUUHQWPRQLWRULQJLVSHUIRUPHGXVLQJ
LQVWUXPHQWWUDQVIRUPHUVWKHKLJKHURUGHUKDUPRQLFVDUHRIWHQQRWYLVLEOH,QVWUXPHQW
WUDQVIRUPHUVDUHGHVLJQHGWRSDVV+]TXDQWLWLHVZLWKKLJKDFFXUDF\7KHVHGHYLFHV
ZKHQGHVLJQHGIRUDFFXUDF\DWORZIUHTXHQF\GRQRWSDVVKLJKIUHTXHQFLHVZLWKKLJK
DFFXUDF\DWIUHTXHQFLHVDERYHDERXW+]WKH\SDVVDOPRVWQRLQIRUPDWLRQ6R
ZKHQLQVWUXPHQWWUDQVIRUPHUVDUHXVHGWKH\HIIHFWLYHO\ILOWHURXWKLJKHUIUHTXHQF\
KDUPRQLFGLVWRUWLRQPDNLQJLWLPSRVVLEOHWRVHH
+RZHYHUZKHQPRQLWRUVFDQEHFRQQHFWHGGLUHFWO\WRWKHPHDVXUHGFLUFXLWVXFKDV
GLUHFWFRQQHFWLRQWRDYROWEXVWKHXVHUPD\RIWHQVHHKLJKHURUGHUKDUPRQLF
GLVWRUWLRQ$QLPSRUWDQWUXOHLQDQ\KDUPRQLFVVWXG\LVWRHYDOXDWHWKHW\SHRIHTXLS
PHQWDQGFRQQHFWLRQVEHIRUHGUDZLQJDFRQFOXVLRQ1RWEHLQJDEOHWRVHHKDUPRQLF
GLVWRUWLRQLVQRWWKHVDPHDVQRWKDYLQJKDUPRQLFGLVWRUWLRQ
,WLVFRPPRQLQDGYDQFHGPHWHUVWRSHUIRUPDIXQFWLRQFRPPRQO\UHIHUUHGWRDV
ZDYHIRUPFDSWXUH:DYHIRUPFDSWXUHLVWKHDELOLW\RIDPHWHUWRFDSWXUHDSUHVHQW
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
SLFWXUHRIWKHYROWDJHRUFXUUHQWZDYHIRUPIRUYLHZLQJDQGKDUPRQLFDQDO\VLV7\SL
FDOO\DZDYHIRUPFDSWXUHZLOOEHRQHRUWZRF\FOHVLQGXUDWLRQDQGFDQEHYLHZHGDV
WKHDFWXDOZDYHIRUPDVDVSHFWUDOYLHZRIWKHKDUPRQLFFRQWHQWRUDWDEXODUYLHZ
VKRZLQJWKHPDJQLWXGHDQGSKDVHVKLIWRIHDFKKDUPRQLFYDOXH'DWDFROOHFWHGZLWK
ZDYHIRUPFDSWXUHLVW\SLFDOO\QRWVDYHGWRPHPRU\:DYHIRUPFDSWXUHLVDUHDOWLPH
GDWDFROOHFWLRQHYHQW
:DYHIRUPFDSWXUHVKRXOGQRWEHFRQIXVHGZLWKZDYHIRUPUHFRUGLQJWKDWLVXVHGWR
UHFRUGPXOWLSOHF\FOHVRIDOOYROWDJHDQGFXUUHQWZDYHIRUPVLQUHVSRQVHWRDWUDQVLHQW
FRQGLWLRQ
1.5: Power Quality
3RZHUTXDOLW\FDQPHDQVHYHUDOGLIIHUHQWWKLQJV7KHWHUPVSRZHUTXDOLW\DQG
SRZHUTXDOLW\SUREOHPKDYHEHHQDSSOLHGWRDOOW\SHVRIFRQGLWLRQV$VLPSOHGHILQL
WLRQRISRZHUTXDOLW\SUREOHPLVDQ\YROWDJHFXUUHQWRUIUHTXHQF\GHYLDWLRQWKDW
UHVXOWVLQPLVRSHUDWLRQRUIDLOXUHRIFXVWRPHUHTXLSPHQWRUV\VWHPV7KHFDXVHVRI
SRZHUTXDOLW\SUREOHPVYDU\ZLGHO\DQGPD\RULJLQDWHLQWKHFXVWRPHUHTXLSPHQWLQ
DQDGMDFHQWFXVWRPHUIDFLOLW\RUZLWKWKHXWLOLW\
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7KUHH3KDVH3RZHU0HDVXUHPHQW
,QKLVERRN3RZHU4XDOLW\3ULPHU%DUU\.HQQHG\SURYLGHGLQIRUPDWLRQRQGLIIHUHQW
W\SHVRISRZHUTXDOLW\SUREOHPV6RPHRIWKDWLQIRUPDWLRQLVVXPPDUL]HGLQ7DEOH
Cause
Disturbance Type
Source
,PSXOVHWUDQVLHQW
7UDQVLHQWYROWDJHGLVWXUEDQFH
VXEF\FOHGXUDWLRQ
/LJKWQLQJ
(OHFWURVWDWLFGLVFKDUJH
/RDGVZLWFKLQJ
&DSDFLWRUVZLWFKLQJ
2VFLOODWRU\
WUDQVLHQWZLWKGHFD\
7UDQVLHQWYROWDJHVXEF\FOH
GXUDWLRQ
/LQHFDEOHVZLWFKLQJ
&DSDFLWRUVZLWFKLQJ
/RDGVZLWFKLQJ
6DJVZHOO
506YROWDJHPXOWLSOHF\FOH
GXUDWLRQ
5HPRWHV\VWHPIDXOWV
,QWHUUXSWLRQV
506YROWDJHPXOWLSOH
VHFRQGVRUORQJHUGXUDWLRQ
6\VWHPSURWHFWLRQ
&LUFXLWEUHDNHUV
)XVHV
0DLQWHQDQFH
8QGHUYROWDJHRYHUYROWDJH
506YROWDJHVWHDG\VWDWH
PXOWLSOHVHFRQGVRUORQJHU
GXUDWLRQ
0RWRUVWDUWLQJ
/RDGYDULDWLRQV
/RDGGURSSLQJ
9ROWDJHIOLFNHU
506YROWDJHVWHDG\VWDWH
UHSHWLWLYHFRQGLWLRQ
,QWHUPLWWHQWORDGV
0RWRUVWDUWLQJ
$UFIXUQDFHV
+DUPRQLFGLVWRUWLRQ
6WHDG\VWDWHFXUUHQWRUYROW
DJHORQJWHUPGXUDWLRQ
1RQOLQHDUORDGV
6\VWHPUHVRQDQFH
7DEOH7\SLFDO3RZHU4XDOLW\3UREOHPVDQG6RXUFHV
,WLVRIWHQDVVXPHGWKDWSRZHUTXDOLW\SUREOHPVRULJLQDWHZLWKWKHXWLOLW\:KLOHLWLV
WUXHWKDWPDn\SRZHUTXDOLW\SUREOHPVFDQRULJLQDWHZLWKWKHXWLOLW\V\VWHPPDQ\
SUREOHPVRULJLQDWHZLWKFXVWRPHUHTXLSPHQW&XVWRPHUFDXVHGSUREOHPVPD\
PDQLIHVWWKHPVHOYHVLQVLGHWKHFXVWRPHUORFDWLRQRUWKH\PD\EHWUDQVSRUWHGE\WKH
XWLOLW\V\VWHPWRDQRWKHUDGMDFHQWFXVWRPHU2IWHQHTXLSPHQWWKDWLVVHQVLWLYHWR
SRZHUTXDOLW\SUREOHPVPD\LQIDFWDOVREHWKHFDXVHRIWKHSUREOHP
,IDSRZHUTXDOLW\SUREOHPLVVXVSHFWHGLWLVJHQHUDOO\ZLVHWRFRQVXOWDSRZHUTXDOLW\
SURIHVVLRQDOIRUDVVLVWDQFHLQGHILQLQJWKHFDXVHDQGSRVVLEOHVROXWLRQVWRWKH
SUREOHP
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2: Meter Overview
2: Meter Overview
2.1: The Nexus® 1262/1272 Multi-parameter Revenue Meter
The Nexus® 1262/1272 transformer-rated, polyphase revenue meter is a unique
collection of metering technologies designed to fulfill advanced metering requirements. It provides high-accuracy power and energy measurements of Voltage,
current and all power values, data logging and power quality recording. The unit
makes the data available through the display, connected systems and historic logs.
2.2: Accu-MeasureTM Technology - Theory of Operation
The advanced metering capability of the Nexus® 1262/1272 device is a result of EIG’s
Accu-MeasureTM Digital Sensing Technology. Accu-MeasureTM technology is a
combination of high-speed sampling, high-resolution measurement and high-speed
calculation. All Voltage and current waveforms are sampled and RMS values calculated continuously every cycle. Values of Voltage, current and power are produced
every three cycles and every second.
Figure 2.1 illustrates the key processes operating within the Nexus® 1262/1272
meter. The meter allows for four types of inputs and can provide outputs to an
integrated display, pulse outputs and several communication ports.
Nexus® 1262/1272 Meter Processing
Voltage and current signals enter the meter and are sampled at up to 256 samples
per cycle. Each sample is resolved to a digital value using 16-bit analog-to-digital
converters. The Nexus® 1272 meter has two 16-bit A/D converters and the Nexus®
1262 meter has one. The first converter, which both meters have, is for the real-time
measurements. The second converter, unique to the 1272, is for the waveform
recorder. The use of two A/D converters ensures that both signals have maximum
resolution, accuracy and integrity. The second converter also isolates energy sampling
and calculations from the waveform fault recording requirements. This provides both
advanced energy and advanced waveform analysis.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-1
2: Meter Overview
4IME
3YNCHRONIZING
,#$$ISPLAY
6OLTAGE)NPUT
#IRCUITRY
3AMPLING
-ULTIPLEXING
AND3IGNAL
#ONDITIONING
#URRENT)NPUT
#IRCUITRY
#HANNEL
3TATUS)NPUTS
2EAL4IME
-EASUREMENTS
0ROCESSING
)20ORT
,%$4EST
0ULSE
+9:/UTPUT
#HANNEL
-EMORY
%THERNETAND
OR-ODEM
7AVEFORM
2ECORDING
0ROCESSING
230ORT
230ORT
Figure 2.1: How the Nexus® 1262/1272 Meter Processes Inputs
The digitized signals are then passed to the appropriate processor. Real-time
measurements are calculated in one processor and made available for meter readings
and historical logs. A separate processor performs waveform recording. Calculated
data and logs are stored in memory for delivery to displays, external systems and
download processes.
The meter includes a time synchronizing input port that accepts an industry standard
IRIG-B signal to synchronize meter time to standard universal time. If there is no
IRIG-B signal, the meter uses an internal 20 ppm crystal or the primary power line
frequency to keep meter time. The Line Frequency Clock Synchronization feature may
be enabled or disabled. If it is not enabled, the internal clock crystal provides time
synchronization. All readings and logs are time stamped to the nearest millisecond.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-2
2: Meter Overview
Eight status channels provide input of status or pulse signals. Status inputs are date/
time stamped to the nearest millisecond and placed in the event log. Pulse inputs are
multiplied by a user-supplied factor and accumulated in reading registers. These
accumulated values can also be totalized. This feature makes the Nexus® 1262/1272
meter a good fit in universal metering applications. Additionally, any one input
channel can be selected to accept an End of Interval pulse from another meter.
Meter set-up parameters and all historical log data are stored in nonvolatile RAM. The
user has multiple log functionality. Data is made available through the onboard
display. Display screens are described in Chapter 3. Several additional communication
channels operate simultaneously, including the optional Ethernet/Modem Combo
Card. External systems can be connected to either of the RS485 ports or the Ethernet/Modem port. Stored data can be downloaded through the RS485 ports, the Ethernet/Modem port or the Optical port.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-3
2: Meter Overview
2.3: Advanced Measurement Functionality
2.3.1: Advanced Revenue Billing Capability
The Nexus® 1262/1272 device is a full four-quadrant power and energy meter with
accuracy of within 0.06% of reading at full load unity PF. Energy measurements
include: kWh Delivered & Received, kVARh Delivered & Received, kVAh, kVARh, kWh
in each quadrant and Total kVAh. The meter measures instantaneous power and
provides multiple, simultaneous demand measurements, including time-stamped
maximum and minimum readings.
Time of Use
The Nexus® meter’s Time of Use functionality offers the following standard
capabilities:
• 8 TOU schedules
• Bidirectional consumption and Demand
• 4 seasons/year
• 20-year calendar
• Prior month and prior season readings for each schedule
• Present month and present season readings for each schedule
• Prior season may also be adjusted for a programmable freeze period
• Total-to-date readings for each month
• Total-to-date readings for each season
• Cumulative and continuous cumulative Demand
Load Aggregation/Universal Metering
Using standard pulse inputs, the Nexus® 1262/1272 meter can count pulses from
external meters and accumulate usage. The pulse inputs can be used to totalize
electrical usage and utility values, such as water or gas use data. Readings include:
• 8 pulse inputs
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-4
2: Meter Overview
• Individual accumulating registers
• 4 totalizing registers
• Totalization with Nexus® meter kWh readings
Multiple Demand Windows
The Nexus® 1262/1272 meter simultaneously monitors four demand structures. The
unit offers:
• Block Window Demand
• Rolling Window Demand
• Thermal Demand
• Predictive Demand
• Interval length from 1 second to over one hour
• Up to 15 sub-intervals
• End of Interval Pulse Output (with optional 4IPO Internal KYZ capability)
• End of Interval Pulse Input
Time-Stamped Max/Min Demands
The unit gathers Time-stamped Max/Min Demands for all power values. Each of the
following values is date/time stamped:
• kW Demand, Delivered & Received, Max/Min
• kVAR Demand, Delivered & Received, Max/Min
• kVAR Coincident with kW Demand
• kVA Demand, Max/Min
• Amps Demand, Max/Min
• Voltage Demand Max/Min
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-5
2: Meter Overview
Transformer Loss Compensation
Transformer Loss Compensation adjusts for both copper and iron losses with a simple
user setup.
2.3.2: Communications and I/O Capabilities
The Nexus® 1262/1272 meter features advanced communication which utilizes
multiple Com ports using open protocols. The meter’s multi-port design allows multiple communication connections simultaneously. The Nexus® 1262/1272 system
provides a direct digital link, allowing selected data to be gathered without affecting
the meter or your data. All of the advanced features of the 1262/1272 are made
available through industry-standard Modbus and DNP 3.0 protocols. No proprietary or
closed protocols are used.
Standard Communications
• ANSI Type 2 Optical port
• 2 RS485 serial ports
• Modbus RTU/ASCII protocol
• DNP 3.0 Level 2 + protocol
• Speeds up to 115200 bps
Optional Communications
The Nexus® 1262/1272 meter allows you to select an additional port for one of the
following uses:
• INP2: Internal 56k Modem with telephone line noise rejection
• INP200: Internal Ethernet TCP/IP (10/100BaseT) with multiple sockets and Modbus
TCP and DNP TCP
• INP202: Combination 56k Modem and Internal Ethernet TCP/IP (10/100BaseT)
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-6
2: Meter Overview
Standard Internal I/O
Extensive I/O capability is available in conjunction with all metering functions:
• IRIG-B Time Synchronizing to GPS to 1 millisecond resolution
• 8 High-Speed Status Inputs for status detect or of load aggregation/universal
metering inputs
• Four KYZ pulse outputs which can be programmed to pulse for any accumulated
reading. One of the pulse outputs can also be set for an End-of-Interval Sync Pulse.
Upgradeable External I/O
The user can select from the following to connect multiple external I/O Modules for
enhanced I/O capability:
• Analog Outputs
• Analog Inputs
• Additional Status Inputs
• KYZ Outputs
• Relay/ Alarm Outputs
Control Options
ElectroLogicTM Relay Control provides user-definable control outputs:
• Action and/or alarm on abnormal condition
• Action on Boolean logic combinations of Inputs or electrical conditions
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-7
2: Meter Overview
2.3.3: Display Screens
The Nexus® 1262/1272 meter features a built-in graphical back-lit FSTN LCD display
with extended temperature Voltage compensation. This allows you to view energy
data and to gather circuit diagnostic data such as Voltage, current, harmonics and
phasor information. The display is easily programmable. See Chapter 3 for details on
the Programmable Display.
2.3.4: Additional Switches
The Nexus® 1262/1272 meter has additional switches & signals that help in using the
unit (see Section 3.2 for more information):
• The Infrared Test Pulse can be set to pulse for +Watt-hour, -Watt-hour, +VAR-hour,
-VAR-hour and VA-hour. The pulse uses time modulation, which allows the pulse to
be accurate during short duration pulse tests. The pulse integration uses industryaccepted reference standards.
• The Mode Switch (magnetic reed switch) uses a magnet to switch operating modes.
• The Test button is used to access Test Mode.
• The Reset button is used to reset Demand.
2.3.5: Nexus® External I/O Modules
A variety of optional analog or digital I/O modules mount externally to the Nexus®
1262/1272 Socket meter. The Nexus® 1262/1272 unit does not supply power to I/O
modules. Use a power supply, such as EIG’s PSIO, to power optional I/O modules. See
Chapter 10 for details on installation and use of the Nexus® External I/O modules.
2.3.6: Optional P40N/P40N+, P41N+ and P43N+ LED Remote
Displays
The Nexus® 1262/1272 Socket meter features a back-lit LCD display built into the
face of the meter. In addition, Electro Industries offers optional external LED displays,
powered by a power supply (such as the PSIO). The P40N+ (and legacy P40N),
P41N+ and P43N+ displays provide easy access to information stored in the meter if
an additional display is required for remote access. See Chapter 9 for further details.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-8
2: Meter Overview
2.4: Nexus® 1262/1272 Meter Forms
• The Nexus® 1262/1272 Socket meter offers three supported S-Based meter forms
based on the rated Voltage and hookup required by the user. Below are the form
specifications.
Table 1: Nexus® 1262/1272 Meter Forms
Form
Hookup
9S
3E Wye or Delta
36S
2 1/2E Wye
45S
2E or 4W Delta
NOTE: See Section 2.6 for Rated Voltages.
• Form 9S can be ordered in an A-Base (Order Form 9A).
• Form 45S replaces Form 5S and may also be used in 4-wire Delta circuits.
• See Chapter 11 for corresponding Wiring diagrams and Appendix B for Blade
configurations.
• The Nexus® 1262/1272 Switchboard meter offers two supported Z-Based forms,
9Z and 36Z. The Switchboard meter comes in an S1 form relay case, but it has an
optional retrofit panel that converts the meter to fit in an M1 form panel cutout (see
Chapter 12 for details on the Switchboard meter).
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-9
2: Meter Overview
2.5: Nexus® 1262/1272 Meter Accuracy
Table 2: Nexus® 1262/1272 Meter Accuracy
Value
Accuracy
Voltage
0.02%
Current
0.05%
Frequency
0.001Hz
W
0.06%
[email protected]
0.06%
[email protected]
0.10%
VAR
0.10%
VA
0.10%
PF
0.10%
2.6: Nexus® 1262/1272 Meter Specifications Overview
Sense Inputs
Current (AC)
• Transformer (CT) rated
• Two or three current inputs depending on Form (Ia, Ib, Ic)
• Class 2 - 1A nominal, burden [email protected]
• Class 10, 20 - 5A nominal, burden [email protected]
• 0.1% of nominal pick-up current
• 120% over-range of Meter Class
• Current surge withstand (at 23o C): 100 Amps for 10 seconds, 300 Amps for 3
seconds, 500 Amps for 1 second
• The current inputs are only to be connected to external current transformers.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-10
2: Meter Overview
Voltage (AC)
• Blade powered unit, standard Voltage (Option S): 480V max Phase to Reference
(Va, Vb, Vc, to VRef), burden total 12V max (including power supply); 600V max
Phase to Phase (Va to Vb, Vb to Vc, Vc to Va)
• Blade powered unit, low Voltage (Option LV): 69V max Phase to Reference (Va, Vb,
Vc, to VRef), burden total 12V max (including power supply); 120V between Va,
Vb, Vc inputs
• Externally powered units (Options SE, DE): 480V max Phase to Reference (Va, Vb,
Vc, to VRef), burden [email protected]; 600V max between Va, Vb, Vc inputs
• Input Impedance: 1Mohm/phase
• 20% over range of rated Voltage
• 2V pickup Voltage
External Power Supply Options
• Standard external (Option SE): (102 to 270) Vac @50/60Hz, 12VAmax
• Low Voltage external (Option DE): (18 to 60)Vdc, Burden 9W max
• Separate power cord
• Switchboard meter is always separately powered (option SE or DE)
Isolation
• All inputs and outputs isolated to 2500 Volts
• Com Ports isolated from each other to 1000 Volts
Sensing
• Accu-MeasureTM Technology
• 16-bit A/D Inputs
• True RMS
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-11
2: Meter Overview
• 8-Channel Sample and Hold
Memory
• All meter setup parameters, measurements and logs contained in nonvolatile RAM
Standard Communications
• LCD display
• ANSI Type 2 Optical port
• Two RS485 serial ports
• Modbus® RTU, Modbus ASCII and DNP 3.0 protocols
• Data Speeds of up to 115200 bps
• Eight High-Speed Input channels
Optional Communications
• INP2: 56k Modem with dial-out capabilities
• INP200: Internal 10/100BaseT Ethernet with Total Web Solutions
• INP202: Ethernet (INP200) / Modem (INP2) Combo card
• Modbus TCP and DNP LAN/WAN
Internal 8-Channel Digital Inputs
• Type: Self-excited, for dry contacts only
• Wetting Voltage: 12Vdc typical
Internal 4-Channel KYZ Outputs
• Type: Form C contacts, pulse or transition based counts
• On Resistance: 23-35:
• Peak Voltage: 350Vdc
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-12
2: Meter Overview
• Continuous Load Current: 120mA
• Peak Load Current: 350mA (10ms)
• Off-State Leakage Current @350Vdc: 1:PA
• Opto Isolation: 3750V rms (60 Hz, 1 min)
Clock Timing
• IRIG-B input for synchronizing to external GPS clock signal - accuracy better than
1msec per month
• Line Frequency Clock Synchronization - accuracy better than 1 second per month
• Internal Clock Crystal - accuracy better than 2 minutes per month
Environmental (Temperature Specifications to Indirect Light)
• Operating Temperature: (-40 to +85)°C
• Display Operating Temperature: (-20 to +60)°C
• Humidity: 95% non-condensing
• Storage Temperature: (-40 to +85)°C
• Raintight Lexan Cover (Socket meter)
NOTE: At temperatures above 60° C the display may turn black. The display should
return to normal once the temperature has cooled. If the meter is exhibiting a heating
issue that causes the display to turn black, try shielding the meter from direct sunlight or otherwise provide some cooling effect to the meter.
Security
• A hardware lock secures meter settings.
• Two 10-character passwords are configurable: one password controls access to
read meter digitally; a separate password controls access to meter programming.
• An additional 8 level password sequence is available by user configuration.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-13
2: Meter Overview
Internal Battery
• Panasonic BR3032 3V Lithium Battery (or equivalent) maintains NVRAM and time
during outages.
Modem Battery
• 3V Lithium Battery with custom leads and velcro mounting maintains Dial-Back
feature during outages. Call factory for replacement battery - the part # is BAT1.
IRIG-B Port Impedance
• 1.8mA @ 5V
Compliance
• ANSI C12.20 Class 0.2 (0.2% Accuracy)
• ANSI C37.90.1 (Surge Withstand)
• ANSI C62.41 (Surge Immunity)
• ANSI C12.18 (Optical Port)
• IEC/CISPR 14-1 (Continuous EM Disturbance)
• IEC801-2 (Electrostatic Discharge)
• IEC801-3 (Radiated EM Immunity)
• IEC801-4 (EFT)
• IEC687 (Voltage Dips and Interruptions)
• IEC60687 (Class 0.2% Accuracy)
• IEC 62053-22 (0.2% Accuracy)
• IEC62052-11 (General Requirements; Mechanical Properties; Climactic Influences)
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-14
2: Meter Overview
2.7: Nexus® 1262/1272 Meter Logging Specifications
Table 3:
Model
Memory
Historical
Log 1*
Historical
Log 2*
CBEMA
/
ITIC**
Event
Log
**
Waveform
Log***
Flicker
Log**
Input
Log
**
Output
Log**
System
Events**
1272
Standard
85 Days
133 Days
512
1024
63
1536
256
1024
1024
1272
Advanced
555 Days
133 Days
512
1024
95
5120
256
1024
1024
1262
Standard
69 Days
32 Days
N/A
512
N/A
N/A
512
1024
1024
1262
Advanced
480 Days
133 Days
N/A
512
N/A
N/A
512
1024
1024
*Assumes logs store 4 scaled energy readings every 15 minutes.
**Number of events recorded (assumes 14 parameters monitored).
***Number of waveform records. Each record may be from 8 to 64 cycles in duration, depending upon
meter setup.
2.8: DNP V3.00 Level 2
Nexus® 1262 and 1272 meters support DNP V3.00 Level 2
DNP Level 2 Features
• Up to 136 measurements (64 Binary Inputs, 32 Binary Counters, 64 Analog Inputs)
can be mapped to DNP Static Points (over 3000) in the customizable DNP Point
Map.
• Up to 16 Relays and 8 Resets can be controlled through DNP Level 2.
• Report-by-Exception Processing (DNP Events) Deadbands can be set on a per-point
basis.
• Available Freeze commands are Freeze, Freeze/No-Ack, Freeze with Time, and
Freeze with Time/No-Ack.
• Freeze with Time commands enable the Nexus® meter to have internal time-driven
Frozen and Frozen Event data. When the meter receives the time and interval, the
data is created.
For complete details, download the appropriate DNP User Manual from our website at
www.electroind.com.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-15
2: Meter Overview
This page intentionally left blank.
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
2-16
2SHUDWLQJ,QVWUXFWLRQV
3: Operating Instructions
3.1: Nameplate Information
7KH1H[XVŠ6RFNHWPHWHUKDVLWVRSHUDWLQJLQIRUPDWLRQUHSUHVHQWHGRQ
WKHQDPHSODWHZKLFKLVORFDWHGRQWKHIDFHRIWKHPHWHUVHHILJXUHEHORZ6HULDO
DQG0RGHOQXPEHUVDUHRQWKH2SWLRQVODEHOVHHQH[WSDJH
*UDSKLFDO/&'
8VHU'HILQHG$UHD
)RUP
)DFWRU
'LDJUDP
0RGH
6ZLWFK
)LJXUH0HWHU6KRZLQJ)DFHSODWH(OHPHQWV
7KHQXPEHUVLQWKHILJXUHUHSUHVHQW
0XOWLSO\E\&RQVWDQW
9ROWDJH7UDQVIRUPHU5DWLR375DWLR
&XUUHQW7UDQVIRUPHU5DWLRVHH*ORVVDU\
3ULPDU\:DWWKRXUFRQVWDQW
&XUUHQWFODVV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
:DWWKRXUWHVWFRQVWDQW
$16,&)RUP1XPEHU
$16,&$FFXUDF\&ODVV
7HVW$PSHUHV
Model: NEXUS 1272-S-SWB2-20-60-SE-INP202
Serial#: 114-0074880532
Memory:
2 Meg
Class:
20
Freq.:
60 Hz
KYZ Out:
Yes
Opt. Comm:
Ethernet/Modem Combo
Power Supply:
Std. Ext 102-275V AC/DC
)LJXUH0HWHU2SWLRQV/DEHO
7KH2SWLRQV/DEHOLVORFDWHGRQWKHRXWVLGHRIWKHLQWHUQDOVKURXG,WLVSULQWHG
VSHFLILFDOO\IRUHDFKPHWHUDQGVKRZVWKHRUGHUHGRSWLRQVWKDWDUHLQFOXGHGLQWKH
PHWHU$QH[DPSOHRIDW\SLFDOODEHOLVVKRZQDERYH%HORZLVDOLVWRIRSWLRQV
DYDLODEOHIRUWKHPHWHU
Memory (1272):
Memory (1262):
66WDQGDUG0RI5$0
66WDQGDUG.RI5$0
$$GYDQFHG0RI5$0
$$GYDQFHG0RI5$0
Communication Options:
,13'LDO2XW2SWLRQ
,13(WKHUQHW%DVH7
,13(WKHUQHW0RGHP&RPELQDWLRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
Case Style:
6:%6ZLWFKERDUG
6666RFNHWPHWHU)RUPV
$6RFNHWPHWHULQ$%DVH
Power Supply:
6(6WG([W9$&'&
66WG%ODGH3RZHUHG
'('&([W9'&
/99$&%ODGH3RZHUHG
EIG Number - Model Number plus Option Numbers ([DPSOHEHORZ
0RGHO0HPRU\)RUP)UHT3RZHU6XSSO\,2&RPPXQLFDWLRQ
$6+]632,13
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
3.2: Basic Operation
,QIUDUHG
7HVW
3XOVH
0RGH0DJQHWLF5HHG
6ZLWFK
$FWLYDWH0RGH
6ZLWFKE\VZLSLQJ
DPDJQHWRQ
PHWHUVLGH
7HVW
%XWWRQ
XQGHUWKHFRYHU
5HVHW
6ZLWFK
2SWLFDO
3RUW
)LJXUH0HWHU6KRZLQJ6ZLWFKHVDQG,QGLFDWRUV
Switches and Indicators
‡7KHUHDUHWZRVZLWFKHVDFFHVVLEOHIURPRXWVLGHWKHPHWHUFRYHU
7KHMode6ZLWFKDOVRFDOOHGD0DJQHWLF5HHG6ZLWFKLVXVHGWRVZLWFKIURP
1RUPDO0RGHWR&LUFXLW'LDJQRVWLF0RGHRU7LPHRI8VH0RGH
7KHReset6ZLWFKLVXVHGWRUHVHW'HPDQG
‡$WKLUGVZLWFKWKHTest%XWWRQLVDFFHVVLEOHRQO\ZKHQWKHFRYHUKDVEHHQ
UHPRYHG7KH7HVW%XWWRQVZLWFKHVWKHPHWHUIURPRQHRIWKHRSHUDWLRQDOPRGHVWR
7HVW0RGHDQGEDFNWR1RUPDO0RGH7KH7HVW%XWWRQLVDOVRXVHGWRDFFHVV'LVSOD\
$GMXVWPHQWV0RGHGXULQJ3RZHUXS0RGH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
Optical Port
7KH2SWLFDOSRUWLVORFDWHGRQWKHORZHUOHIWVLGHRIWKHPHWHUIDFH:LWKWKH2SWLFDO
SRUW\RXFDQSURJUDPWKHPHWHUZLWK&RPPXQLFDWRU(;7VRIWZDUHXVLQJDQ$=RU
$8&RPPXQLFDWLRQ,QWHUIDFHRURWKHU$16,&7\SH,,PDJQHWLFRSWLFDO
FRPPXQLFDWLRQVFRXSOHUDQGDQ56FDEOH$=RUD86%FDEOH$8WRD3&
Test Pulse
$QLQIUDUHG7HVWSXOVHLVORFDWHGRQWKHXSSHUOHIWVLGHRIWKHIDFH(QHUJ\SXOVLQJ
DSSOLFDWLRQVFDQEHFRQILJXUHGXVLQJ&RPPXQLFDWRU(;7VRIWZDUH
Phase Indicator
$3KDVHLQGLFDWRULVORFDWHGRQWKHORZHUULJKWVLGHRIWKHIDFH³$%&´VWD\V
LOOXPLQDWHGLIDOOWKUHHSKDVHVRIvROWDJHDQGFXUUHQWDUHSUHVHQW7KHLQGLFDWRU
EOLQNV$%RU&LIthat phase has voltage but no current, and is blank if that phase
has no voltage or current
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
3.3: LCD Display Information
7KH1H[XVŠPHWHUKDVDJUDSKLFDOEDFNOLW)671/&'SURJUDPPDEOH
GLVSOD\ZLWKH[WHQGHGWHPSHUDWXUH9ROWDJHFRPSHQVDWLRQ7KHGLVSOD\OHWV\RXYLHZ
(QHUJ\GDWDDQGJDWKHUFLUFXLWGLDJQRVWLFGDWDVXFKDV9ROWDJHFXUUHQWKDUPRQLFV
DQGSKDVRULQIRUPDWLRQ
<RXXVH&RPPXQLFDWRU(;7VRIWZDUHWRSURJUDPWKHGLVSOD\7KHGLVSOD\KDVWKUHH
9LHZPRGHVWRZKLFK\RXDVVLJQVFUHHQV7KLVOHWV\RXGHWHUPLQHZKDWGDWDLV
GLVSOD\HGDQGLQZKDWRUGHU9LHZPRGHLVWKHSULPDU\PRGHWKHRWKHUPRGHV
DXWRPDWLFDOO\UHWXUQWR9LHZPRGHDIWHUDXVHUVHWDPRXQWRILQDFWLYLW\6HWWKH
WLPHWKURXJK&RPPXQLFDWRU(;7VHH6HFWLRQLQVWUXFWLRQVIRUWKH0LVFHOODQHRXV
WDE7KHUHLVDOVRD7HVWPRGHDQGD6HOHFW&RPSHQVDWLRQVFUHHQ
Mode Details
‡$FFHVV9LHZPRGHDQG9LHZPRGHE\VZLSLQJWKH0RGH6ZLWFKZLWKDPDJQHW
VHH)LJXUH$FFHVV7HVWPRGHE\UHPRYLQJWKHFRYHU32:(50867%(2))
SRZHULQJXSWKHPHWHUDQGSXVKLQJWKH7HVW%XWWRQDWDQ\WLPH6HHWKH1DYLJDWLRQ
PDSLQ6HFWLRQIRUGLVSOD\PRGHGHWDLOV
‡7HVWPRGHDXWRPDWLFDOO\UHWXUQVWR9LHZPRGHDIWHUDQDPRXQWRIWLPHVLQFHWKH
ODVWXVHUDFWLRQZLWKQRHQHUJ\DFFXPXODWLRQRUDQDPRXQWRIWLPHVLQFHWKHODVW
XVHUDFWLRQSOXVWKH'HPDQGLQWHUYDOZLWKHQHUJ\DFFXPXODWLRQ7KHYDOXHVIRUWKH
DPRXQWRIWLPHVLQFHWKHODVWXVHUDFWLRQDUHVHWWKURXJK&RPPXQLFDWRU(;7VHH
6HFWLRQLQVWUXFWLRQVIRUWKH0LVFHOODQHRXVWDE
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
Display Configurator
$1H[XVŠPHWHUZLWKWKHDSSURSULDWHILUPZDUH8VHU3URJUDPPDEOH/&''LVSOD\5XQ
7LPH)LUPZDUHYHUVLRQ/&''LVSOD\%RRWYHUVLRQ%DVHPHWHU
V&205XQ
7LPHRUKLJKHUSRVW1RYHPEHUJLYHV\RXWKH'LVSOD\&RQILJXUDWRU
ZKLFKOHWV\RXDVVLJQXSWR/&'GLVSOD\VFUHHQVDFURVVWKHWKUHH9LHZPRGHV
7KHVHVFUHHQVFDQEHPDGHRIDQ\FRPELQDWLRQRISUHGHILQHGVFUHHQVVHH6HFWLRQ
SUHGHILQHGVFUHHQVZLWKVRPHFXVWRPL]DWLRQDQGIXOO\FXVWRPL]HGVFUHHQV
ZLWKDQ\RIWKHPHWHU
VPHDVXUHGUHDGLQJVDQGQXPHULFFDOFXODWLRQVVXFKDVVFDOLQJ
7KH'LVSOD\&RQILJXUDWRU¶VIOH[LELOLW\OHWV\RXPDWFKWKHGLVSOD\VFUHHQVWRDQ\
DSSOLFDWLRQQHHGV\RXKDYH5HIHUWR6HFWLRQIRUSURJUDPPLQJGHWDLOV
Base Programmable Display
1H[XVŠPHWHUVZLWKDQ/&''LVSOD\5XQ7LPH)LUPZDUHYHUVLRQRIOHVVWKDQ
SUH1RYHPEHUGRQRWKDYHWKH'LVSOD\&RQILJXUDWRU)RUWKHVHPHWHUV\RXFDQ
DVVLJQXSWRSUHGHILQHGVFUHHQVSHU9LHZPRGH5HIHUWR6HFWLRQIRUSURJUDP
PLQJGHWDLOV
NOTE: 6HH6HFWLRQIRULQVWUXFWLRQVRQILQGLQJ\RXUGLVSOD\¶VILUPZDUHYHUVLRQ
Low Battery
/R%DWW195DP,QWHUQDO%DWWHU\RU/R%DWW0RGHP0RGHP%DWWHU\IODVKHVRQ
WKHVFUHHQHYHU\VHFRQGVZKHQWKH,QWHUQDORU0RGHP%DWWHU\LVUXQQLQJORZ
RUZKHQLWLVQRW³FOLFNHG´LQWRSODFHSURSHUO\6HHLQVWDOODWLRQLQVWUXFWLRQVLQ6HFWLRQ
Test Mode
‡:K7HVW6DPHDVN:KVFUHHQH[FHSWLQ:KLQVWHDGRIN:K
‡9$5K7HVW6DPHDVN9$5VFUHHQH[FHSWLQ9$5K4XDGUDQWV
‡9$K7HVW6DPHDVN9$KVFUHHQH[FHSWLQ9$K4XDGUDQWV
‡:DWW5ROOLQJ'HPDQG7HVW'HOLYHUHGDQG5HFHLYHG
‡:DWW%ORFN'HPDQG7HVW'HOLYHUHGDQG5HFHLYHG
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
Initial Display Screens
7KH1H[XVŠPHWHUVKLSVZLWKLQLWLDOGLVSOD\VFUHHQVZKLFKVFUROORQWKH
GLVSOD\DVVRRQDV\RXSRZHUXSWKHPHWHU7KHLQLWLDOGLVSOD\VFUHHQVDUHDVDPSOLQJ
RIWKHSUHGHILQHGVFUHHQV7\SLFDOLQLWLDOGLVSOD\VFUHHQVLQFOXGH
‡0HWHU'DWDLQFOXGLQJ%RRW5XQ'63%RRW'635XQ6HULDO1XPEHU3URWHFW
(QDEOHG%DXG
‡:K'HOLYHUHG
‡:K5HFHLYHG
‡N9$5KSHU4XDGUDQW
‡N9$KSHU4XDGUDQW
‡5ROOLQJ:'HPDQG'HOLYHUHG
‡5ROOLQJ:'HPDQG5HFHLYHG
‡%ORFN:'HPDQG'HOLYHUHG
‡%ORFN:'HPDQG5HFHLYHG
‡:'HPDQG/DVW5HVHW
‡&XPXODWLYH:'HPDQG
Backlight
7KH%DFNOLJKWFDQQRWEHVHWWRVWD\RQLQGHILQLWHO\,WWXUQVRIIDIWHUDSURJUDPPHG
LQWHUYDORQHKRXULVWKHPD[LPXPVHWWLQJ,IWKHEDFNOLJKWWLPHVRXWDQGLVRIIVZLSH
WKH0RGH6ZLWFKRQFHWRWXUQWKHEDFNOLJKWRQDQGUHGLUHFWWKHVFUHHQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
3.3.1: Finding Your Display’s Firmware Versions
7RILQG\RXU/&'GLVSOD\¶VILUPZDUHYHUVLRQVIROORZWKHVHVWHSV
&RQQHFWWRWKHPHWHUWKRXJK&RPPXQLFDWRU(;7VRIWZDUH
&OLFNWKHProfileLFRQLQWKH7LWOHEDU
&OLFNRevenue and Energy Settings>Display ConfigurationWRRSHQWKH'HYLFH
'LVSOD\3URJUDPDEOH6HWWLQJVVFUHHQVKRZQEHORZ
7KH/&'GLVSOD\¶VILUPZDUHYHUVLRQVDUHVKRZQLQWKHERWWRPOHIWSRUWLRQRIWKH
VFUHHQ,IWKH%RRWYHUVLRQLVRUKLJKHUDQGWKH5XQYHUVLRQLVRUKLJKHU
IROORZWKHLQVWUXFWLRQVLQ6HFWLRQ,IWKH%RRWDQG5XQYHUVLRQVDUHOHVVWKDQ
IROORZWKHLQVWUXFWLRQVLQ6HFWLRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
3.4: Nexus 1262/1272 Programmable Display Navigation Map
5NLESS3CROLLINGIS
3TOPPEDALLSCREENS
ASSIGNEDTOTHEMODE
SCROLLEVERYSECONDS
-/$%
3WIPE-AGNET
OVER-ODE3WITCH
/NCEFOR-ODE
4WICEFOR-ODE
0RESS4EST"UTTON
FROMANY-ODE
3WIPE-AGNET
OVER-ODE3WITCH
/NCEFOR-ODE
4WICEFOR-ODE
-/$% 0RESS4EST"UTTON
FROMANY-ODE
-/$% 3WIPE-AGNET
OVER-ODE3WITCH
/NCEFOR-ODE
4WICEFOR-ODE
0RESS4EST"UTTON
FROMANY-ODE
-ODESANDRETURN
TO-ODEAFTERAUSER
SETAMOUNTOFTIME
0/7%250
-/$%
3TARTUP3CREEN
AND3CROLLING
$EVICE3TATUS
)NFORMATION
3%,%#4#/-0%.3!4)/.
3ELECT4RANSFORMER,OSSAND#404
#OMPENSATION
0RESS4EST"UTTONTOVIEWOPTIONS
INORDER
4RANSFOMER,OSS/NLY"OTH#404
AND4RANSFORMER,OSS.O
#OMPENSATION#404/NLY
%XIT$O.OT%NTER4EST-ODE
0RESSAND(/,$4ESTBUTTONON
THEOPTIONYOUWANT
4%34-/$%
0RESS4EST"UTTON
TOSCROLLTHROUGH
4ESTSCREENS
0RESSAND(/,$4EST
"UTTONTOEXIT4EST
MODEANDRETURNTO
-ODE Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
4EST-ODERETURNS
TO-ODEAFTERAUSER
SETAMOUNTOFTIME
(
2SHUDWLQJ,QVWUXFWLRQV
3.5: Using the Display Configurator
7KH1H[XVŠPHWHUZLWKDSSURSULDWHILUPZDUH8VHU3URJUDPPDEOH/&'
'LVSOD\5XQ7LPH)LUPZDUHYHUVLRQ/&''LVSOD\%RRWYHUVLRQ%DVHPHWHU
V
&205XQ7LPHRUKLJKHUJLYHV\RXWKH'LVSOD\&RQILJXUDWRU7KLVIHDWXUHOHWV
\RXFXVWRPL]HWKHPHWHU
V/&'VFUHHQVWRGLVSOD\DQ\PHDVXUHGUHDGLQJV7KH
'LVSOD\&RQILJXUDWRUIHDWXUHVWKUHH9LHZPRGHVVHH6HFWLRQDQGKDVPHPRU\
IRUXSWRVFUHHQVGLVWULEXWHGKRZHYHU\RXZDQWDPRQJWKHWKUHH9LHZPRGHV
7KHIOH[LELOLW\RIWKH'LVSOD\&RQILJXUDWRUDOORZV\RXWRFXVWRPL]HWKH/&'GLVSOD\IRU
DQ\DSSOLFDWLRQ$GGLWLRQDOIHDWXUHVRIWKH'LVSOD\&RQILJXUDWRUDUHDVIROORZV
‡<RXFDQDGGVFUHHQQXPEHUVDQGRUODEHOVWLWOHV
‡<RXFDQDGGVFDOLQJDQGPXOWLSOLHUIDFWRUVWRWKHVFUHHQGDWD
‡<RXFDQXVHWKHVFUHHQVWRYLHZGDWDIURPSXOVHLQSXWVVXFKDVZDWHUJDVVWHDP
HWF
‡<RXFDQXVHDFRPELQDWLRQRISUHGHILQHGDQGFXVWRPL]HGGLVSOD\V6HH6HFWLRQ
IRUDOLVWRIWKHSUHGHILQHGGLVSOD\V
IMPORTANT!<RXXVHWKH1H[XVŠPHWHU
V0RGEXVPDSWRLGHQWLI\WKH
GDWD\RXZDQWWRGLVSOD\LQDFXVWRPL]HGGLVSOD\VFUHHQ7KH0RGEXVPDSIRUWKH
1H[XVŠPHWHULVFRQWDLQHGLQWKHModus Protocol and Register Map for
Nexus® 1252/1262/1272 Meters7KHPDQXDOFDQEHGRZQORDGHGIURP(,*
V
ZHEVLWHZZZHOHFWURLQGFRPSGIPRGEXVSGI
To access the Display Configurator's programming screens
&RQQHFWWRWKHPHWHUWKURXJK&RPPXQLFDWRU(;7
&OLFNWKHProfileLFRQWRRSHQWKH'HYLFH3URILOHVFUHHQ
&OLFNWKHSOXVVLJQQH[WWR5HYHQXHDQG(QHUJ\6HWWLQJV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
'RXEOHFOLFNDisplay Configuration<RXZLOOVHHWKHVFUHHQVKRZEHORZ7KHILUVW
WDELV0HWHU'LVSOD\0RGH1DPHVZKLFKOHWV\RXDVVLJQODEHOVDQGGHVFULSWLRQVWR
WKHWKUHH9LHZPRGHV
D(QWHUDWKUHHOHWWHUODEHOIRUHDFKRIWKHWKUHH9LHZPRGHV
E(QWHUDGHVFULSWLRQIRUHDFKPRGHXVLQJWKH/LQHDQG/LQH'HVFULSWLRQILHOGV
&OLFNWKH6FUHHQ$VVLJQPHQWVWDE<RXZLOOVHHWKHVFUHHQVKRZQRQWKHQH[WSDJH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
Display screens
available for
assignment
to View modes
Right-click
on a screen
to assign it to
View mode
or to copy it
Buttons that
let you:
Create custom
display screens,
Edit display
screens, or
Remove display
screens from
the available
screens list
View Mode
Columns
Buttons that let you: Change the order of display screens
in a View mode, or Remove display screens from a View mode
8VLQJWKHEXWWRQVRQWKHERWWRPRIWKHVFUHHQ\RXFDQ
‡5HWULHYHGLVSOD\VHWWLQJVIURPWKHFRQQHFWHGPHWHUE\FOLFNLQJRetrieve from
Display.
‡8SGDWHWKHFRQQHFWHGPHWHU
VGLVSOD\VHWWLQJVE\FOLFNLQJUpdate Display7KH
PHWHUUHERRWVDQG\RXVHHDPHVVDJHRQWKH3&VFUHHQ'HYLFH/&''LVSOD\
3URJUDPPDEOH6HWWLQJV8SGDWHG
‡6DYHDQ\FKDQJHV\RXKDYHPDGHWRGLVSOD\VHWWLQJVE\FOLFNLQJSave
‡/RDGDSUHYLRXVO\VDYHG/&'GLVSOD\ILOHE\FOLFNLQJLoadDQGVHOHFWWKHILOH\RX
ZDQWWRORDGLQWRWKLVVFUHHQLWLVDQGVILOH
‡5HWXUQWRWKHSUHYLRXVVFUHHQZLWKRXWVDYLQJDQ\FKDQJHVE\FOLFNLQJCancel
‡9LHZRQOLQHLQVWUXFWLRQVIRUXVLQJWKLVVFUHHQE\FOLFNLQJHelp
7KHOHIWPRVWFROXPQOLVWVDOORIWKH$YDLODEOHGLVSOD\VFUHHQV%HIRUH\RX
YHXVHGWKH
'LVSOD\&RQILJXUDWRU\RXZLOORQO\VHHWKHSUHGHILQHGGLVSOD\VFUHHQVLQWKHOLVW
2QFH\RXKDYHFUHDWHGFXVWRPL]HGVFUHHQV\RXZLOOVHHWKRVHLQWKHOLVWDVZHOO
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
7KHRWKHUWKUHHFROXPQVOLVWWKHGLVSOD\VFUHHQVWKDWDUHDVVLJQHGWRHDFKRIWKH
WKUHH9LHZPRGHV8VHWKHVFUROOEDUVWRGLVSOD\DOORIWKHLWHPVLQWKHFROXPQV
D7RDVVLJQRQHRIWKHVFUHHQVWRD9LHZPRGHRUWRFUHDWHDQHZVFUHHQ
EDVHGRQLWFOLFNRQWKHVFUHHQLQWKHOLVWDQGULJKWFOLFN<RXZLOOVHHWKH
SRSXSPHQXVKRZQEHORZ
‡7RDGGWKHVFUHHQWRRQHRIWKHPRGHVRUWRDOOPRGHVFOLFNRQWKDW
LWHPLQWKHPHQX
‡7RFUHDWHDQHZVFUHHQEDVHGRQWKHVFUHHQFOLFNRQWKHODVWLWHPLQ
WKHPHQXVHH6WHSH
E7RFKDQJHWKHSRVLWLRQRIVFUHHQVLQRQHRIWKH9LHZPRGHVRUWRUHPRYH
WKHVFUHHQIURPWKHPRGHFOLFNRQWKHVFUHHQLQWKH9LHZPRGHFROXPQ
DQGWKHQHLWKHU
‡&OLFNMove UpRUMove DownWRFKDQJHWKHSRVLWLRQRIWKHVFUHHQ
ZLWKLQWKDW9LHZPRGH7KHSRVLWLRQRIWKHVFUHHQVGHWHUPLQHVWKHLU
VFUROOLQJRUGHU
‡&OLFNRemoveWRUHPRYHWKHVFUHHQIURPWKDW9LHZPRGH
F7RFUHDWHDFXVWRPGLVSOD\VFUHHQFOLFNCreateLQWKH$YDLODEOH6FUHHQV
FROXPQ&RQWLQXHWR³Creating a Custom Display Screen´RQWKHQH[W
SDJH
NOTEWR(GLWDFXVWRPVFUHHQFOLFNRQWKHVFUHHQLQWKH$YDLODEOH6FUHHQV
OLVWDQGWKHQFOLFNEdit7KHQXVHWKHLQVWUXFWLRQVLQ³Creating a Custom
Display Screen´RQWKHQH[WSDJHWRPRGLI\WKHVFUHHQ
G7RHGLWDSUHGHILQHGVFUHHQFOLFNRQWKHVFUHHQLQWKH$YDLODEOH6FUHHQV
FROXPQOLVWDQGWKHQFOLFNEdit&RQWLQXHWR³Editing a Pre-defined Display Screen´RQSDJH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
H7RFUHDWHDQHZVFUHHQEDVHGRQDQH[LVWLQJVFUHHQKLJKOLJKWWKHVFUHHQLQ
WKH$YDLODEOH6FUHHQVFROXPQOLVWULJKWFOLFNDQGVHOHFWCreate New
Screen Based on Selected Screen,I\RXDUHPDNLQJDFXVWRPVFUHHQ
IROORZWKHLQVWUXFWLRQVEHORZ,I\RXDUHMXVWFKDQJLQJWKHVFUHHQQXPEHU
RUODEHOIROORZWKHLQVWUXFWLRQVLQ³Editing a Pre-defined Display
Screen´RQSDJH
I7RUHPRYHDVFUHHQIURPWKHOLVWRIDYDLODEOHVFUHHQVFOLFNRQWKHVFUHHQLQ
WKH$YDLODEOH6FUHHQVFROXPQOLVWDQGWKHQFOLFNRemove7KHVFUHHQLVQR
ORQJHUGLVSOD\HGLQWKHOLVWRIDYDLODEOHVFUHHQVDQGFDQQRWEHDVVLJQHGWR
DQ\9LHZPRGH,WLVDOVRUHPRYHGIURPDQ\9LHZPRGHVLWKDVDOUHDG\
EHHQDVVLJQHGWR
&UHDWLQJD&XVWRP'LVSOD\6FUHHQ
$IWHU\RXFOLFNWKHCreateEXWWRQLQWKH$YDLODEOHVFUHHQVOLVW\RXZLOOVHHWKH/&'
6FUHHQ6HOHFWLRQVFUHHQVKRZQEHORZ
Click to create
custom screen
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
&OLFNWKHUser definedEXWWRQLQWKH6FUHHQ7\SHER[7KHVFUHHQFKDQJHVWRDOORZ
\RXWRVHWXSWKHQHZ'LVSOD\VFUHHQ
You can
change
this
number
Select
number
of screen
items OR
1 Demand,1
Timestamp
The fields in
Screen Layout
are determined
by the number
of items you
select
These
fields are
for Modbus
Information
These fields
are for
multiplier
setup
These fields
are for
scaling
setup
<RXFDQFKDQJHWKHQXPEHUVKRZQLQWKH8VHU6FUHHQ1XPEHUILHOG7KLVILHOG
DFFHSWVDQ\QXPEHUXSWRWKUHHGLJLWVLQOHQJWK8VHQXPEHUVEHWZHHQDQGLI
\RXZDQWWKHQXPEHUWRGLVSOD\RQWKH/&'GLVSOD\VFUHHQXVHQXPEHUVEHWZHHQ
DQGLI\RXGRQ
WZDQWWKHQXPEHUWRGLVSOD\NOTE:7KH+DUPRQLFV
3KDVRUVDQG/LQH6HJPHQWVFUHHQVQHYHUGLVSOD\WKHLUQXPEHURQWKH/&'GLVSOD\
VFUHHQ
8VHWKH/D\RXW$UUDQJHPHQWILHOGWRFKRRVHZKDWILHOGV\RXZDQWWKH/&'VFUHHQWR
GLVSOD\&KRRVHHLWKHU
D7KHQXPEHURILWHPV\RXZDQWWKH/&'VFUHHQWRGLVSOD\FOLFNRQHRIWKHItem
EXWWRQV
E'LVSOD\'HPDQGDQG7LPHVWDPSILHOGVFOLFNWKH1 Demand, 1 Timestamp
EXWWRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
$IWHU\RXPDNH\RXUVHOHFWLRQWKHOHIWVLGHRIWKHVFUHHQFKDQJHVWRGLVSOD\HQWU\
ILHOGVIRUWKH,WHPVRU'HPDQGDQG7LPH6WDPSLQIRUPDWLRQ6HHWKHH[DPSOH
VFUHHQVEHORZ
Custom Screen with 3 Item Fields
The information for
these fields comes
from the meter’s
Modbus Register
Map
Display screen
label fields
Item entry
fields
click here to
enter the Modbus
Register containing
the item
This is where you
can specify a
multiplier for your
data
These fields let you
specify Scaling and
data display
Custom Screen with 1 Demand, 1 Timestamp Fields
See screen above
for explanation of
the fields on the
right side of the
screen
Display screen
label fields
Demand field
Timestamp
Status field
(does not display
on the LCD screen)
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
7KHWRSILHOGLQWKH6FUHHQ/D\RXWVHFWLRQLVIRUWKHGLVSOD\VFUHHQODEHO7LWOH
'HSHQGLQJRQWKHQXPEHURILWHPV\RXVHOHFW\RXZLOOKDYHEHWZHHQWROLQHVIRU
DVFUHHQODEHO
‡,I\RXVHOHFWHGLWHPVRU'HPDQG7LPHVWDPS\RXZLOOKDYH
WZRHQWU\OLQHV
‡,I\RXVHOHFWHGLWHPV\RXZLOOKDYHRQHHQWU\OLQH
‡,I\RXVHOHFWHGLWHPV\RXZLOOQRWKDYHDQ\HQWU\ILHOGVIRUDGLV
SOD\VFUHHQODEHOWKHUHZRQ
WEHURRPRQWKHVFUHHQIRUDODEHO
7KH,WHPHQWU\ILHOGVDOORZ\RXWRVSHFLI\WKHGDWD\RXZDQWWRGLVSOD\RQWKH/&'
VFUHHQ<RXFDQDOVRHQWHUDSUHIL[RSWLRQDOIRUHDFKOLQHLWHPDQGDVXIIL[
RSWLRQDOIRUDOORIWKHLWHPVRQWKHGLVSOD\VFUHHQ
Example$VFUHHQFRQWDLQLQJSKDVHWRSKDVH9ROWDJHVPLJKWKDYHDVLQJOHWLWOH
9ROWV33OLQHVRIGDWDZLWKSUHIL[HV9DE9EF9FDDQGWKHVDPHVXIIL[09
RQDOOOLQHV
7KH'HPDQG7LPHVWDPSHQWU\ILHOGVDOORZ\RXWRVSHFLI\WKH'HPDQGWKH
WLPHVWDPSDQGDQRSWLRQDOVWDWXVUHJLVWHU7KHVWDWXVUHJLVWHULVQRWGLVSOD\HGRQ
WKH/&'VFUHHQ
7RHQWHUDQLWHP
D&OLFNRQWKH,WHPODEHOER[)LHOGVWKDWRSHQXQGHUQHDWKWKHLWHPDOORZ\RX
WRHQWHUWKHVWDUWLQJYDOXHRIWKH0RGEXV5HJLVWHUFRQWDLQLQJWKHGDWDIRU
WKHLWHP8VHWKH'HFLPDOYDOXHRIWKHUHJLVWHU6HHWKHVFUHHQEHORZ
5HIHUWRWKHNexusŠ 1252/1262/1272 Meter Modbus ManualIRUWKH
PHWHU
V0RGEXV5HJLVWHU0DS7KHPDQXDOFDQEHGRZQORDGHGIURP
(,*
VZHEVLWHZZZHOHFWURLQGFRPSGIPRGEXVSGI
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
IMPORTANT! All of the data items you select must be the same Modbus
typeIRUH[DPSOH)7KH0RGEXVW\SHLVOLVWHGLQWKH0RGEXVPDS6HHWKH
([DPSOHEHORZ
Example:
7RVHOHFW&\FOH3KDVH$19ROWDJHILQGWKHVWDUWLQJUHJLVWHUIRUWKHILHOGLQWKH
0RGEXVPDQXDO6HHWKHILJXUHEHORZ
1 Cycle Block
00090-00093
9
00094-00095
10
0
50
1 cycle Block Time Stamp
12/31/9999 23:59:59:99
1 cycle Phase A-N Voltage
+65536 V1 / D V
2
$ECIMAL3TARTINGREGISTER)TEMYOUARESELECTING
IS
10 msec
1/65536 V
2
sec
F3
R
F5
R
-ODBUS4YPEIS&
E&OLFNUpdateWRVDYHWKHLWHP
VVWDUWLQJUHJLVWHUDGGUHVV
F(QWHUDQ\DGGLWLRQDOLWHPVLQWKHVDPHZD\
G:KHQ\RXILQLVKHQWHULQJLWHPVXVHWKHHQWU\ILHOGVLQWKHULJKWSRUWLRQRI
WKHVFUHHQWRHQWHUGHWDLOVIRUWKHLWHPV
0RGEXVW\SHDQGWRHQWHUVFDOLQJ
PXOWLSOLHUDQGGDWDGLVSOD\VHWWLQJV7KH0RGEXVW\SHLQIRUPDWLRQLVIRXQG
LQ&KDSWHURIWKHNexus® 1252/1262/1272 Meter Modbus Manual6HH
WKHIROORZLQJH[DPSOH
Example:
7KHLWHPLQWKHH[DPSOHDERYHZDV0RGEXVW\SH)$Q\DGGLWLRQDOLWHPVPXVWEHWKH
VDPH0RGEXVW\SH7\SHLVGHVFULEHGLQ&KDSWHUSDJHRIWKH
0HWHU
V0RGEXVPDQXDODVVKRZQLQWKHH[FHUSWWKDWIROORZV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
8VHWKH0RGEXVW\SHLQIRUPDWLRQDVVKRZQEHORZ
3.5: Type F5 Secondary 1 Cycle RMS Voltage or Current
Length: 2 Registers (4 bytes)
Range: +1,048,576 V2 / 0 V2 or +65536 I2 / 0 I2(1262 or 1272)
Unit: 1/4906 V2 secondary or 1/65536 A2 secondary (1262 or 1272)
These registers together are a four-byte unsigned integer. Conversion into
secondary voltage or current involves multiplying by the appropriate scale and
taking the square root of that value.
Depending on the unit and hardware, the range and unit of voltage reading
differs. For a Nexus® 1262/72 meter, the range goes to +1,048,576 V2 with a
unit of 1/4096 V2.
,QWKHH[DPSOHDERYH\RXZRXOGILQGWKHQXPEHURIUHJLVWHUVSHULWHPWKHIDFWWKDW
WKHGDWDLVXQVLJQHGDQGVFDOLQJLQIRUPDWLRQIURPWKH0RGEXVW\SHLQIRUPDWLRQ
7KHILHOGVRQWKHOHIWXQGHUQHDWKWKH0XOWLSO\E\ILHOGVOHW\RXVHWXSKRZWKHGDWD
ZLOOEHGLVSOD\HGIRUH[DPSOHVSHFLI\LQJLIWKHGDWDLVDQXPEHURUVRPHRWKHUYDOXH
ZKHWKHU\RXZDQWWKHVLJQWRGLVSOD\IRUVLJQHGGDWDZKHWKHU\RXZDQWWKHGDWD
VFDOHGWKHQXPEHURIGLJLWVDQGGHFLPDOSODFHVLQWKHILHOG&OLFNWKHSXOOGRZQ
PHQXVWRVHHDOWHUQDWHFKRLFHVIRUWKHILHOGV7KHHQWULHV\RXPDNHDIIHFWDOORIWKH
LWHPVRQWKHVFUHHQ7KHWDEOHWKDWIROORZVVKRZVWKHILHOGVDQGWKHYDOLGHQWULHVIRU
WKHP
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
Table 1:
Entry fields
Possible entries
5HJLVWHUVSHULWHP
5HJLVWHUFRQWHQWV
%LQDU\%&'7H[W6FDOHG(QHUJ\
'DWD
6LJQHG8QVLJQHG
'LYLGHFRQWHQWVE\
0XOWLSO\E\
8VHUPXOWLSOLHUHQWHULQEODQNILHOG37
5DWLR&75DWLR
'DWDIRUPDW
1XPEHU7H[W3RZHUIDFWRU7LPH'DWH
7LPH'DWH6WDWXVLQGLFDWRU
1XPHULFDOVLJQ
$XWR)RUFHGQHJDWLYH)RUFHGSRVLWLYH
6KRZVLJQ
1R<HV
6FDOH
$XWR1RQHNLORN0HJD0*LJD*
7RWDOGLJLWV
'LJLWVWRWKHULJKWRIWKHGHFLPDOSODFH
2QFH\RXILQLVKPDNLQJ\RXUHQWULHVFOLFNOKWRUHWXUQWRWKH6FUHHQ$VVLJQPHQWV
WDE7KHQHZVFUHHQLVQRZOLVWHGLQWKHOHIWPRVWFROXPQ&OLFNRQLWDQGWKHQ
ULJKWFOLFNWRDVVLJQLWWRRQHRUDOORIWKH9LHZPRGHV
:KHQ\RXILQLVKSURJUDPPLQJWKH/&'GLVSOD\FOLFN
‡SaveWRVDYHWKH/&'3URJUDPPDEOH6HWWLQJVWRDQGVILOH
‡UploadWRXSORDGWKH/&'3URJUDPPDEOH6HWWLQJVWRWKHFRQQHFWHG
PHWHU
‡CancelWRH[LWWKHVFUHHQwithout saving any changes
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
(GLWLQJD3UHGHILQHG'LVSOD\6FUHHQ
<RXKDYHWKHIROORZLQJRSWLRQVIRUHGLWLQJSUHGHILQHGVFUHHQV
‡<RXFDQHGLWWKHVFUHHQQXPEHU
‡<RXFDQHGLWWKHVFUHHQODEHOWLWOH
‡<RXFDQFUHDWHDQHZVFUHHQEDVHGRQWKHSUHGHILQHGVFUHHQEXW\RXZLOOVWLOORQO\
EHDEOHWRFKDQJHWKHVFUHHQQXPEHUDQGRUODEHO
NOTE:6RPHRIWKHSUHGHILQHGVFUHHQVFDQQRWEHFXVWRPL]HGDVGHVFULEHGDERYH
7KHWDEOHEHORZOLVWVWKHVHSUHGHILQHGVFUHHQVDQGWHOOVZKDWFDQEHFKDQJHGLQ
WKHP
Table 2:
Pre-defined LCD
Screen Number
(Default Value)
Description
Editing Options
3KDVRUV
1RQH
9$53))UHTXHQF\
7LWOH
+DUPRQLFV
7LWOH
6HJPHQWFKHFN
1RQH
2SWLFDO3RUW6HWWLQJV
7LWOH
&RPP3RUWV
7LWOH
1H[XV6WDWXV
7LWOH
)LUPZDUH9HUVLRQV
7LWOH
1H[XV,QIR
7LWOH
5ROOLQJ%ORFN'HPDQG
7LWOH
728(QHUJ\
7LWOH
728'HPDQG
7LWOH
7289$5K
7LWOH
:KHQ\RXFOLFNEditDIWHUVHOHFWLQJDSUHGHILQHGVFUHHQLQWKH$YDLODEOHVFUHHQV
OLVWRUULJKWFOLFNWRVHOHFWCreate a new screen based on selected screen\RX
VHHWKH/&'6FUHHQ6HOHFWLRQVFUHHQ6HHWKHH[DPSOHVFUHHQWKDWIROORZV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
7KHEXWWRQDWWKHWRSRIWKHVFUHHQUHIOHFWVWKHW\SHRIVFUHHQ\RXDUHHGLWLQJRU
FRS\LQJHLWKHU3UHGHILQHGRU3UHGHILQHGZLWKFXVWRPODEHOLQJ
‡<RXFDQRQO\FKDQJHWKHVFUHHQQXPEHUIRUDSUHGHILQHGVFUHHQVHHH[DPSOH
VFUHHQRQWKHSUHYLRXVSDJHEXWLI\RXDUHFUHDWLQJDQHZVFUHHQEDVHGRQD
SUHGHILQHGVFUHHQ\RXFDQVHOHFWWKHSUHGHILQHGZLWKFXVWRPODEHOLQJEXWWRQ
WRFKDQJHWKHWLWOHDVZHOODVWKHQXPEHURIWKHVFUHHQ5HIHUWRWKHWDEOHRQWKH
SUHYLRXVSDJHIRUHGLWLQJOLPLWDWLRQV
‡)RUDSUHGHILQHGVFUHHQZLWKFXVWRPODEHOLQJ\RXFDQFKDQJHWKHVFUHHQQXP
EHUDQGDOVRWKHVFUHHQODEHO6HHWKHH[DPSOHVFUHHQWKDWIROORZV5HIHUWRWKH
WDEOHRQWKHSUHYLRXVSDJHIRUHGLWLQJOLPLWDWLRQV
NOTES:
‡7KH6FUHHQQXPEHUILHOGLVDWKUHHGLJLWQXPHULFILHOG8VHQXPEHUV
EHWZHHQDQGWRGLVSOD\WKHQXPEHURQWKH/&'GLVSOD\VFUHHQ
XVHQXPEHUVEHWZHHQDQGWRQRWGLVSOD\WKHQXPEHURQ
WKH/&'GLVSOD\VFUHHQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
‡7KH+DUPRQLFV3KDVRUVDQG/LQH6HJPHQWVFUHHQVQHYHUGLVSOD\
WKHLUQXPEHURQWKH/&'GLVSOD\VFUHHQ
‡'HSHQGLQJRQWKHSUHGHILQHGVFUHHQ\RXKDYHEHWZHHQOLQHV
IRUVFUHHQODEHOHQWU\6FUHHQODEHOVFDQEHXSWRFKDUDFWHUVSHU
OLQH
%HORZLVDQH[DPSOHRID3UHGHILQHGZLWKFXVWRPODEHOLQJVFUHHQ
You can change the
screen number
You can
enter a
screen label
$IWHU\RXPDNH\RXUHQWULHVFOLFNOK<RXWKHQUHWXUQWRWKHSUHYLRXVVFUHHQ
6FUHHQ$VVLJQPHQWVWDE
:KHQ\RXILQLVKSURJUDPPLQJWKH/&'GLVSOD\FOLFN
‡SaveWRVDYHWKH/&'3URJUDPPDEOH6HWWLQJVWRDQGVILOH
‡UploadWRXSORDGWKH/&'3URJUDPPDEOH6HWWLQJVWRWKHFRQQHFWHGPHWHU
‡CancelWRH[LWWKHVFUHHQwithout saving any changes
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
Power and Energy Display Tab
&OLFNWKH3RZHUDQG(QHUJ\'LVSOD\WDE<RXZLOOVHHWKHVFUHHQVKRZQEHORZ
(QWHUVHWWLQJVIRU3RZHUDQG(QHUJ\
‡1XPEHURI'LJLWV3ULPDU\3RZHU
‡'HFLPDO3RLQW/RFDWLRQ3ULPDU\3RZHU
‡'LVSOD\/HDGLQJ=HURHVFKHFNLIGHVLUHG
‡(QHUJ\'LVSOD\
D6HOHFWWKH0XOWLSO\E\&RQVWDQWYDOXH
E&OLFNWKHFKHFNER[QH[WWR³$SSO\WRWKH'HPDQG5HJLVWHUVDVZHOO´LI
DSSOLFDEOH
$SUHYLHZDSSHDUVDWWKHERWWRPRIWKHVFUHHQ
NOTES:
‡6HWWLQJVRQWKLVVFUHHQFRQWUROWKHGLVSOD\RI(QHUJ\UHODWHGQXPEHUV%HFDUHIXO
WRPDWFKWKHYDOXHVRQWKHGLVSOD\ZLWKWKRVHLQWKHKLVWRULFDOORJV7KHVH
VHWWLQJVDSSO\WR9$KRXUV:DWWKRXUV9$5KRXUVDQG9$5KRXUV
HDFKTXDGUDQWLQWKHPHWHU
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
‡7KH1XPEHURI'LJLWVVHWWLQJFRQWUROVWKHGLVSOD\DQGVWRUDJHRIDOOGLJLWV
GLVSOD\HGRQWKHVFUHHQDQGLWVHWVWKH5HJLVWHU5ROORYHUIRUDOO(QHUJ\W\SH
UHJLVWHUV
Miscellaneous Tab
&OLFNWKH0LVFHOODQHRXVWDE<RXZLOOVHHWKHVFUHHQVKRZQEHORZ
(QWHUVHWWLQJVLQWKH0LVFHOODQHRXVVFUHHQ
D6FUHHQ6HWWLQJV
‡%DFN/LJKW/HYHO2IIWR%ULJKWHVW
‡%DFN/LJKW7LPH%DFN/LJKWVKXWVRIIPLQVHFPLQVHF
‡&RQWUDVW+LJKHVWWR/RZHVW
‡6FUROO6WRS(QDEOHGRU'LVDEOHG
‡3KDVRU5RWDWLRQ&ORFNZLVHRU&RXQWHUFORFNZLVH
‡'HPDQG6KRZQ&XPXODWLYHRU&RQWLQXRXV&XPXODWLYH
‡7LPHRI8VH'HPDQG%ORFN5ROOLQJRU&XPXODWLYH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
‡'DWH)RUPDW0RQWK'D\<HDURU'D\0RQWK<HDU
E2SWLFDO3RUWVHWWLQJV
‡%DXG5DWHRU
‡2SWLFDO5HFHLYH1RQ,QYHUWHGRU,QYHUWHG
F8VHU,QDFWLYLW\7LPH2XWVQXPEHURIPLQXWHVVLQFHODVWXVHUDFWLRQZKHQ
0RGHUHYHUWVWR9LHZ0RGH6HWWLQJVDUHWRPLQXWHVZLWKPLQXWH
LQWHUYDOV
‡/HDYH7HVW0RGH$IWHUB0LQXWHV
‡/HDYH9LHZ0RGH$IWHUB0LQXWHV
‡/HDYH9LHZ0RGH$IWHUB0LQXWHV
When you have finished programming the Device Display Programmable
Settings Screen
8VH%XWWRQVDVGHVFULEHGEHORZ
‡Update Display&OLFNWRVHQGWKHQHZVHWWLQJVWRWKHGLVSOD\$IWHUVHWWLQJV
KDYHEHHQXSGDWHG9LHZ0RGHLVGLVSOD\HG
‡Retrieve from Display&OLFNWRUHWULHYHH[LVWLQJVHWWLQJV
‡Cancel&OLFNWRUHWXUQWRWKH&RPPXQLFDWRU(;70DLQVFUHHQZLWKRXWXSGDWLQJ
RUVDYLQJQHZVHWWLQJV
‡Save&OLFNWRVDYHQHZVHWWLQJVWRDILOH
:KHQ\RXILQLVKPDNLQJDQ\FKDQJHVFOLFNUpdate DisplayWRVHQGWKHQHZ
VHWWLQJVWRWKHGLVSOD\3RSXSZLQGRZVWHOO\RXWKDWWKHFKDQJHVKDYHEHHQPDGH
DQGWKHQ\RXUHWXUQWRWKH&RPPXQLFDWRU(;70DLQVFUHHQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
3.6: Using the Base Programmable Display
7KH%DVH3URJUDPPDEOH'LVSOD\SUH1RYHPEHUKDVWKHVDPHWKUHHFRQILJX
UDEOH9LHZPRGHVDVWKH'LVSOD\&RQILJXUDWRUDQGWKHWKUHHPRGHVDUHGLVSOD\HGLQ
DXWRVHTXHQFHLQWKHVDPHZD\8VLQJ&RPPXQLFDWRU(;7\RXFDQDVVLJQXSWRRI
WKHSUHGHILQHGGLVSOD\VFUHHQVWRHDFKPRGHDQ\RIWKHDYDLODEOHVFUHHQVFDQEH
XVHGLQDQ\PRGH6HH6HFWLRQIRUDOLVWRIWKHSUHGHILQHGVFUHHQV<RXFDQDOVR
DVVLJQDWKUHHGLJLWODEHODQGGHVFULSWLRQWRWKH9LHZPRGHVDQGFRQILJXUHWKHSRZHU
DQG(QHUJ\GLVSOD\DQGVFUHHQWLPHRXWVWKHVDPHZD\DVIRUWKH'LVSOD\&RQILJXUD
WRU
Programming the Base Programmable Display
&RQQHFWWRWKHPHWHUWKURXJK&RPPXQLFDWRU(;7
&OLFNWKHProfileLFRQWRRSHQWKH'HYLFH3URILOHVFUHHQ
&OLFNWKHSOXVVLJQQH[WWR5HYHQXHDQG(QHUJ\6HWWLQJV
'RXEOHFOLFNDisplay Configuration<RXZLOOVHHWKH0HWHU'LVSOD\0RGH1DPHV
VFUHHQ)RUWKLVVFUHHQDQGDOORIWKHVFUHHQVLQWKH'HYLFH'LVSOD\3URJUDPPDEOH
6HWWLQJVexcept forWKH6FUHHQ$VVLJQPHQWVVFUHHQIROORZWKHGLUHFWLRQVJLYHQLQ
6HFWLRQ)RUWKH6FUHHQ$VVLJQPHQWVVFUHHQIROORZWKHGLUHFWLRQVJLYHQKHUH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
&OLFNWKH6FUHHQ$VVLJQPHQWVWDE<RXZLOOVHHWKHVFUHHQVKRZQEHORZ
<RXU/DEHOIRUHDFKPRGHDSSHDUVDWWKHWRSRIHDFKFROXPQ(QWHUXSWR
VFUHHQVIRUHDFK9LHZPRGHLQWKH
IROORZLQJZD\
D'RXEOHFOLFNRQRQHRIWKHVHW
WLQJVRQWKHVFUHHQ<RXZLOOVHHWKH
VFUHHQVKRZQRQWKHULJKW
E6HOHFW*URXSDQG,WHPIURPWKH
SXOOGRZQPHQXVDQGFOLFNOKWR
UHWXUQWRWKH6FUHHQ$VVLJQPHQWV
VFUHHQ
NOTE:,I\RXVHOHFW7LPHRI8VHDV
WKH*URXSWKHVFUHHQFKDQJHVWR
DOORZDQ,WHPVHOHFWLRQDQGDGGL
WLRQDOVHOHFWLRQVIRU7283HULRG
DQG7285HJLVWHU6HHWKHVFUHHQ
RQWKHULJKW
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
3.6.1: Pre-Defined Display Screens
7KH1H[XVŠSUHGHILQHGGLVSOD\VFUHHQVKDYHIHDWXUHVWKDWPDNHWKHPYHU\XVHU
IULHQGO\
‡0DQ\RIWKHVFUHHQVKDYHODUJHGLJLWV´
‡7KHUHDUHPDQ\VFUHHQVWRFKRRVHIURP
‡7KH3ROOLQJ,QGLFDWRULQWKHULJKWFRUQHURIWKH6WDWXV/LQHSURYLGHVWZRIXQFWLRQV
$EOLQNLQJLQGLFDWRUVKRZVWKDWWKHGLVSOD\LVUHFHLYLQJGDWDIURPWKHPHWHU
3RZHU)ORZLVGLVSOD\HGE\GLIIHUHQWVKDSHGLFRQV
D:KHQQRSRZHULVIORZLQJDVROLGEORFNLVGLVSOD\HG
E$QDQLPDWHGDUURZSRLQWLQJ5,*+7LQGLFDWHVSRVLWLYHSRZHUIORZ
F$QDQLPDWHGDUURZSRLQWLQJ/()7LQGLFDWHVQHJDWLYHSRZHUIORZ
%HORZLVDOLVWRIDYDLODEOHVFUHHQVZLWKVRPHH[DPSOHILJXUHV
Screen Number
Screen Name
:K'HOLYHUHG
:K5HFHLYHG
9$5K
9$5K
9$K
5ROOLQJ:'HPDQG'HO
5ROOLQJ:'HPDQG5HF
%ORFN:'HPDQG'HO
%ORFN:'HPDQG5HF
:'HPDQG/DVW5HVHW
3KDVHWR1HXWUDO9ROWDJH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
kWh
DEL 43089263
REC 71323159
06/16/2011 3:50:44 Norm ABC
'RF#
ROLLING
W DEMAND
DEL
502.3
3:07:2003 2:07:09
06/16/2011 3:50:44 Norm ABC
(
2SHUDWLQJ,QVWUXFWLRQV
3KDVH&XUUHQW
3KDVRUV
9$53))UHTXHQF\
9D9DE+DUPRQLFV
9E9EF+DUPRQLFV
9F9FD+DUPRQLFV
,D+DUPRQLFV
,E+DUPRQLFV
,F+DUPRQLFV
7RWDOL]HU
7RWDOL]HU
7RWDOL]HU
7RWDOL]HU
7RWDOL]HU'HPDQG
7RWDOL]HU'HPDQG
7RWDOL]HU'HPDQG
7RWDOL]HU'HPDQG
&XPXODWLYH'HPDQG'HO5HF
3KDVHWR3KDVH9ROWDJH
:
9$5
3)
9$
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
la HARMONICS
THD
003.67
06/18/2011 12:22:44 CDM ABC
VC IC
IB
'RF#
A
VA B
(
C
VB IA
30.02 LG
16.03 LG
17.01 LG
ABC
2SHUDWLQJ,QVWUXFWLRQV
)UHTXHQF\
6HJPHQW&KHFN
4
0HWHU1DPH
2SWLFDO3RUW
&RP3RUW6HWWLQJV
1H[XV6WDWXV
)LUPZDUH9HUVLRQV
1H[XV,QIR
$YHUDJH3)5HFHLYHG
$YHUDJH3)'HOLYHUHG
9$5KSHU4XDGUDQW
9$KSHU4XDGUDQW
:KSHU4XDGUDQW
4K
&XPXODWLYH'HPDQG
5ROOLQJ:LQGRZ'HPDQG
%ORFN:LQGRZ'HPDQG
3RZHU)DFWRUSHU3KDVH
3RZHU)DFWRUSHU4XDGUDQW
728:K5HF
7289$K4
7289$5K4
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
7289$K4
7289$5K4
728:K'HO
7289$K4
7289$5K4
7289$K4
7289$5K4
728:'HPDQG5HF
728:'HPDQG'HO
7289$5'HPDQG
7289$5'HPDQG
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
2SHUDWLQJ,QVWUXFWLRQV
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
4: Performing Meter Testing
4: Performing Meter Testing
The information contained within this chapter is intended to be an aid to
qualified metering personnel. It is not intended to replace the extensive
training necessary to install or remove meters from service. Any work on or near
energized meters, meter sockets or other metering equipment presents the danger of
electrical shock, personal injury or death. All work on these products must be performed by qualified industrial electricians and metering specialists ONLY. All work
must be done in accordance with local utility safety practices and/or the procedures
outlined in the current edition of the Handbook for Electricity Metering. The handbook
is available from the Edison Electric Institute, 701 Pennsylvania Avenue N.W., Washington D.C. 20004-2696.
Les informations contenues dans ce chapitre sont destinées à assister au personnel de
relevé qualifié. Il n'est pas destiné à remplacer la formation approfondie nécessaire
pour installer ou retirer les compteurs de leur fonction. Toute intervention sur ou à
proximité de compteurs sous tension, socles de compteur ou autres équipements de
mesure présente un risque de choc électrique, de blessures ou la mort. Toute intervention avec ces produits doit être effectuée UNIQUEMENT par des électriciens
industriels qualifiés et des spécialistes de relevé. Toute intervention doit être faite en
conformité avec les pratiques de sécurité des services publics locaux et/ou les procédures décrites dans la présente édition du Manuel de relevé d'électricité. Le manuel
est disponible à partir de la Edison Electric Institute, 701 Pennsylvania Avenue NW,
Washington DC 20004-2696.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-1
4: Performing Meter Testing
4.1: Testing Tools
The Nexus® 1262 and 1272 meters are equipped with a light-emitting diode (LED) for
calibration and a liquid crystal display with test screens. These two standard features
provide user interface and equipment interface points for meter testing.
Infrared
Test Pulse
Test Button
Under Cover
Figure 4.1: Meter Test Pulse and Test Button Location
4.1.1: Test Pulse LED
The Test Pulse LED is located in the upper left-hand portion of the meter face as
shown in Figure 4.1. The Test Pulse LED continuously emits calibration pulses (infrared light). This LED can be used for a variety of pulses including individual quadrants
for Watt-hour, VA-hour, VAR-hour and Watt Demand pulses. Each calibration pulse is
equal to the value assigned to Kt (Watt-hours per pulse) in the meter’s Device Profile.
The millisecond duration of each output pulse is also programmable in the meter’s
Device Profile.
To program the Test Pulse LED:
1. From the Device Profile menu in Communicator EXT, click Revenue and Energy
Settings>Internal KYZ to configure the following settings:
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-2
4: Performing Meter Testing
a. Assigned Channel - choose from settings.
b. Watt-hour per Pulse - enter the value in the secondary.
c. Pulse Width - set from 5ms to 635ms.
d. Mode - select to enable or disable.
e. Form - select between Form A and Form C.
2. Click OK and then click Update Device to send the new settings to the meter.
NOTE: The unit for the calibration pulses is Watt-hours. The initial value of each pulse
(Kt) is 1.800 secondary Watt-hours per pulse.
4.1.2: LCD Display
In Test Mode, the LCD display provides user access to accumulated real, reactive and
apparent energy as well as Block Demand for real power. There are eight screens in
Test Mode: Wh - Del, Wh - Rec, VARh - Q1 & Q2, VARh - Q3 & Q4, VAh - Q1 & Q4,
VAh - Q2 & Q3, Watt Demand Test Rolling and Watt Demand Test Block. See Section
4.2.2 for more detail.
The LCD display also includes three phase Voltage indicators. These indicators are
labeled A, B and C to represent the presence of Voltage on the labeled phase.
If Voltage is not present on one phase, its indicator is not displayed. These indicators
also show whether current is flowing on the phase. If no current is flowing on a phase,
the indicator blinks; when current is flowing, the indicator shows a continuously
illuminated digit. The indicator also shows phase sequence.
4.2: Test Mode
Test Mode allows the meter to be tested without disturbing billing data or setting a
new maximum Demand. Test Mode performs the same function as setting the pointers back on an electromechanical meter after testing.
While operating in Test Mode, the meter uses the same measurement and calculation
processes that are used in Normal Mode. The only difference is that the billing
numbers stored in the meter are not updated with the real-time reading. This
preserves the billing numbers while testing is performed.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-3
4: Performing Meter Testing
4.2.1: Entering Test Mode
To enter Test Mode, you must bypass the meter’s security system. In most instances,
this requires you to remove power from the meter, break the meter seal and remove
the Lexan cover, and then repower the meter.
4.2.2: Using Test Mode
The same selected measurement profile quantities (data accumulations) that are
calculated during normal operation are calculated in Test Mode. Display quantities
(Watt-hour, VAR-hour, Volt-Ampere-hour and Block Demand quantities) are displayed
in units rather than kilo-units; i.e. the data is displayed as Wh, VARh, VAh and Watts
rather than kWh, kVARh, kVAh and kW. The same Demand values calculated during
normal operation are also calculated in Test Mode. The display formats in Test Mode
are changed to provide greater resolution during test operations.
The display does not scroll while in Test Mode. Each item remains displayed until the
Test Button is pressed, which causes the next Test Mode screen to display.
The following table shows the display screens available in Test Mode, the data
displayed on each screen and the pulse source for each screen.
Table 1:
Test Mode Displayed Data and Pulse Source
Test Mode
Displayed Data
Pulse Source
Wh - Del
Delivered Wh Energy
kWh, Del
Wh - Rec
Received Wh Energy
kWh, Rec
VARh - Q1 and Q2
VARh in Quadrant1
VARh in Quadrant 2
kVARhr, Del
VARh - Q 3 and Q4
VARh in Quadrant 3
VARh in Quadrant 4
kVARhr, Rec
VAh - Q1 and Q4
VAh in Quadrant 1
VAh in Quadrant 4
kVAhr, Q1
VAh - Q2 and Q3
VAh in Quadrant 2
VAh in Quadrant 3
kVAhr, Q3
Watt Demand Rolling
Watt Rolling Demand
Delivered
kWH, Del
Watt Demand
Watt Block Demand
Delivered
kWh, Del
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-4
4: Performing Meter Testing
Test Mode Details
The Reset Button (R) is next to the Test Button (T). Initiate a Test Mode Reset by
pressing and releasing the Reset Button while in Test Mode. A Test Mode Reset causes
all test quantities to be reset to zero and a new block interval to be started. The item
displayed when the reset occurred remains in the display but the value is initialized.
While in Test Mode, the Test Pulse LED pulses at the rate programmed for the meter.
The value of the pulse is set in the meter’s Device Profile (see Section 4.1.1). The
meter quantity assigned to the Test Pulse LED changes as the user moves from one
test screen to another. The assigned values are defined in the Pulse Source column of
the table above.
Individual quadrant tests for VAR-hours can be completed by proper test design. To
test strictly VAR-hours, limit the test parameters to one quadrant during testing.
In the event of a power outage, data for Test Mode Energy, Demand and Power Factor
is not saved. Upon power up, the meter returns to Normal Mode. The test data is lost
and all registers are restored to their pretest values.
While in Test Mode, the IR Port and Communications Port 1 are available for
communication with the meter.
In Test Mode, you can preset the values of the energy readings that will be restored to
the meter when Test Mode is exited, using Communicator EXT (see following section
4.2.3).
4.2.3: Test Mode Preset Accumulators
There are two reasons to use the Preset Accumulators screens:
1. A monitor in Test Mode is out of service and is therefore not monitoring accumulations. The New Value field can be used to adjust for the values not monitored while
in Test Mode.
2. When replacing an old meter that has accumulations with a new meter that has no
accumulations, the New Value field can be set to the value of the existing accumulations.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-5
4: Performing Meter Testing
Setting Test Mode Preset Accumulators
1. From Communicator EXT’s Main screen, select Tools>Test Mode>Preset
Accumulators. You will see the screen shown below.
2. Click Tabs at the top of the screens to access the individual screens.
• Each screen has a Current Value, New Value and Preset Box for each accumulator.
• A new meter has zeros for Current Values.
3. Settings can be preset for the following sets of values:
• Primary Energy
• Secondary Energy
• Primary Energy (Quadrants)
• Secondary Energy (Quadrants)
• Internal Input Accumulators
• KYZ Output Accumulators
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-6
4: Performing Meter Testing
• Q Hours
• I & V Squared T Accumulators
• Cumulative Demand (Secondary)
• Uncompensated Energy
Examples of some of the screens are shown below.
4. Click the Preset Boxes for the values you want to set.
5. Click Set to save your entries or Cancel to exit the screen without saving any
changes.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-7
4: Performing Meter Testing
4.2.4: Exiting Test Mode
Exit Test Mode in one of the following three ways:
• Press and hold the Test Button for more than 3 seconds.
• Use the Test Mode Time-out Timer, if no load is present.
• Use the Extended Test Mode Time-out Timer, if load is present.
These options are explained further in the following sections.
Exiting Test Mode Details:
Test Mode Button
Pressing the Test Mode Button for more than three seconds ends Test Mode and
returns the meter to Normal Mode.
Test Mode Time-out Timer
The Test Mode Time-out Timer has two modes of operation, depending on whether
the meter sees measurable load.
If the meter does not recognize measurable load:
The meter watches for user interaction by monitoring activity on the Test Button and
the Reset Button. If neither button is pushed within the programmed Exit Delay time,
the meter exits Test Mode and returns to Normal Mode. Each time the Test or Reset
Button is pressed, the meter starts the Exit Delay Timer again. The Exit Delay time is
programmed in the meter’s Device Profile in the Device Display Programmable Settings screen, Miscellaneous tab (see Section 3.6).
If the Meter recognizes measurable load:
The meter watches the Test and Reset Buttons for activity, using an extended time
limit consisting of the Exit Delay time plus the programmed Block Interval Time. This
insures that the meter completes a full block Demand test without interruption.
After exiting Test Mode:
All Test Mode data is lost when you exit Test Mode. Upon exiting Test Mode, a new
(possibly partial) Demand interval and subinterval begin. The past subinterval as well
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-8
4: Performing Meter Testing
as the current subinterval are zeroed. Upon returning to Normal operating mode, a
TOU meter or Demand meter with load profiling completes the time remaining in the
current partial subinterval so that subsequent subintervals are synchronized with the
hourly boundary.
Maximum Demand values for each Demand integration type are not modified while in
Test Mode. The previously recorded maximums are restored when you exit Test Mode.
If you choose to reset Demand data during testing operations, you can complete this
action when you exit Test Mode by pressing the Reset Button after the meter returns
to Normal Mode.
NOTE: Normal billing and historical log data accumulation is suspended during Test
Mode operation. Upon exiting Test Mode, accumulation of billing and historical log
quantities does either of the following:
• Resumes from the values in place when Test Mode was entered
• Continues from the Test Mode Preset values (see Section 4.2.4)
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4-9
4: Performing Meter Testing
This page intentionally left blank.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
4 - 10
6HULDO&RPPXQLFDWLRQ:LULQJ
5: Serial Communication Wiring
5.1: Communication Overview
7KHILJXUHEHORZVKRZVVHULDOFRPPXQLFDWLRQRSWLRQV
Optical Port to RS232
Communication Interface
(e.g., A7Z)
-ETER
Optical Port
RS232
50 Feet
-ETER
RS485
RS232
4000 Feet
50 Feet
RS485/232
Converter
(Unicom 2500)
-ETER
RS485
RS232
4000 Feet
50 Feet
4ELEPHONE,INE
&IBER/PTIC,INKOR
2ADIO,INK
RS485/232
Converter
(Modem Manager)
)LJXUH6HULDO&RPPXQLFDWLRQ
56FRPPXQLFDWLRQLVXVHGWRFRQQHFWDVLQJOH1H[XVŠPHWHUZLWK
DQRWKHUGHYLFHVXFKDVDFRPSXWHU578RU3/&7KHOLQNLVYLDEOHIRUXSWRIHHW
PDQGLVDYDLODEOHRQO\WKURXJKWKHPHWHU¶V2SWLFDOSRUWZLWKDFRPPXQLFDWLRQ
LQWHUIDFH2SWLFDOSRUWWR56FRQYHUWHUVHHILJXUHVDQG
56FRPPXQLFDWLRQDOORZVPXOWLSOHPHWHUVWRFRPPXQLFDWHZLWKDQRWKHUGHYLFHDW
DORFDORUUHPRWHVLWH7KH,2PRGXOHVDQGH[WHUQDOGLVSOD\VXVH56WRFRPPXQL
FDWHZLWKWKHPHWHU$OO56OLQNVDUHYLDEOHIRUXSWRIHHWP7KH
1H[XVŠ6RFNHWPHWHU¶V3RUWVDQGDUHWZRZLUH56FRQQHFWLRQVXSWR
EDXG2SWLRQDO&RPPXQLFDWLRQ&RQQHFWLRQVIRU,13,QWHUQDO0RGHPZLWK'LDO,Q
'LDO2XW,13%DVH7FRQQHFWLRQRU,13&RPELQDWLRQ0RGHPDQG
(WKHUQHWDUHFDEOHVZLWKDSSURSULDWHFRQQHFWRUVVHH&KDSWHUDQG)LJXUH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
Optical
Port
)LJXUH2SWLFDO3RUW/RFDWLRQ
5.2: Communicating to the Meter through the ANSI Type II Optical
Port
7KH2SWLFDOSRUWDOORZVWKH1H[XVŠPHWHUWRFRPPXQLFDWHZLWKRQHRWKHU
GHYLFHHJD3&/RFDWHGRQWKHOHIWVLGHRIWKHPHWHU
VIDFHLWSURYLGHVFRPPXQLFD
WLRQZLWKWKHPHWHUWKURXJKDQ$16,&7\SH,,0DJQHWLF2SWLFDO&RPPXQL
FDWLRQV&RXSOHUVXFKDVHLWKHU
‡$Q$=&RPPXQLFDWLRQ,QWHUIDFHFRQQHFWHGWRWKH56SRUWRIWKH3&
‡$Q$8&RPPXQLFDWLRQ,QWHUIDFHFRQQHFWHGWRWKH86%SRUWRIWKH3&
<RXFDQRUGHUWKH$=RU$8IURP(,*¶VZHEVWRUHZZZHOHFWURLQGFRPVWRUH6HOHFW
WKH&RPPXQLFDWLRQV3URGXFWVFDWHJRU\IURPWKHOHIWVLGHRIWKHZHESDJH
6HH)LJXUH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
)LJXUH$=7RSDQG$8%RWWRP&RPPXQLFDWLRQ,QWHUIDFHV
A7Z Instructions:
2QHHQGRIWKHPDJQHWLFLQWHUIDFHVLPSO\VQDSVRQWRWKHRSWLFDOSRUWWKHPDJQHW
NHHSVLWLQSODFH7KHRWKHUHQGLVDQ56FRQQHFWLRQ,QVHUWWKDWHQGLQWRDSLQ
VHULDOSRUWRQDFRPSXWHURURWKHUGHYLFH7KH$=UHTXLUHVQRSRZHUVXSSO\$OO
SRZHULVUHFHLYHGIURPWKHKRVWFRPSXWHUVHULDOSRUWXVLQJWUDQVPLWWHUDQGUHFHLYHU
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
FLUFXLWVZLWKLQWKHSUREH7KH56VWDQGDUGOLPLWVWKHFDEOHOHQJWKWRIHHW
P
A9U Instructions:
<RXQHHGWRGRZQORDGDQGLQVWDOOWKHGULYHUIRUWKH$8IURP(,*¶VZHEVLWH
ZZZHOHFWURLQGFRP$=B$8KWPO2QFHWKHGULYHULVLQVWDOOHGDWWDFKWKH$8¶V
PDJQHWLFLQWHUIDFHRQWRWKHPHWHU¶V2SWLFDOSRUWDQGDWWDFKWKH$8¶V86%FRQQHFWLRQ
LQWR\RXU3&
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
5.3: RS485 Serial Communication
56FRPPXQLFDWLRQDOORZVPXOWLSOHGHYLFHVWRFRPPXQLFDWHRQDEXV7KHPHWHU¶V
3RUWDQG3RUWDUH56WHUPLQDOVYLDEOHIRUDGLVWDQFHRIXSWRIHHW
PHWHUV
5.3.1: RS485 Wiring Fundamentals - (Port 1 and Port 4)
%HORZLVDGHWDLOHGYLHZRIDZLUH56FRQQHFWLRQ
From other RS485 device
Connect :
•
(−) to (−)
•
(+) to (+)
•
Shield(SH) to Shield(SH)
-
-
+
SH
+
SH
Nexus
1262/1272
RS485 Port
)LJXUH56&RQQHFWLRQ'HWDLO
‡ S6KLHOG7KLVLVQRWDQHDUWKJURXQGFRQQHFWLRQ<RXPXVWDOVRFRQQHFWWKH
VKLHOGWRHDUWKJURXQGDWRQHSRLQW'RQRWFRQQHFWWKHVKLHOGWRJURXQGDWPXOWLSOH
SRLQWVLWZLOOLQWHUIHUHZLWKFRPPXQLFDWLRQ
‡ +/- 7ZRZLUH56FRPPXQLFDWLRQWHUPLQDOV&RQQHFWWKHWHUPLQDORIWKH
PHWHUSRUWWRWKHWHUPLQDORIWKHGHYLFH&RQQHFWWKHWHUPLQDORIWKHPHWHUSRUW
WRWKHWHUPLQDORIWKHGHYLFH
NOTES on RS485 Connections:
‡8VHDVKLHOGHGWZLVWHGSDLUFDEOH$:*PPRUODUJHUJURXQGLQJWKH
VKLHOGDWRQHHQGRQO\
‡(VWDEOLVKSRLQWWRSRLQWFRQILJXUDWLRQVIRUHDFKGHYLFHRQD56EXV&RQQHFW
WHUPLQDOVWRWHUPLQDOVFRQQHFWWHUPLQDOVWRWHUPLQDOV
‡3URWHFWFDEOHVIURPVRXUFHVRIHOHFWULFDOQRLVH
‡$YRLGERWK³VWDU´DQG³WHH´FRQQHFWLRQVVHH)LJXUH
‡1RPRUHWKDQWZRFDEOHVVKRXOGEHFRQQHFWHGDWDQ\RQHSRLQWRQDQ56
QHWZRUNZKHWKHUWKHFRQQHFWLRQVDUHIRUGHYLFHVFRQYHUWHUVRUWHUPLQDOVWULSV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
‡,QFOXGHDOOVHJPHQWVZKHQFDOFXODWLQJWKHWRWDOFDEOHOHQJWKRIDQHWZRUN,I\RXDUH
QRWXVLQJDQ56UHSHDWHUWKHPD[LPXPOHQJWKIRUFDEOHFRQQHFWLQJDOOGHYLFHV
LVIHHWPHWHUV
‡)RUDQ56'DLV\&KDLQFRQQHFWLRQLQZKLFK\RXOLQNPXOWLSOHGHYLFHVLQDVHULHV
FRQQHFWVKLHOGWR560DVWHUDQGLQGLYLGXDOGHYLFHVDVVKRZQLQ)LJXUH<RX
PD\DOVRFRQQHFWWKHVKLHOGWRHDUWKJURXQGDWRQHSRLQW
‡7KH1H[XVŠPHWHUPD\EHVKLSSHGZLWKFRQQHFWRUVRQWKHHQGVRI
FDEOHVRUWKH\PD\EHVKLSSHGDVSLJWDLOVQRFRQQHFWRUV,QWKLVFDVHDJHQHULF
WHUPLQDOEORFNLVVKLSSHGZLWKWKHPHWHU7KHWHUPLQDOEORFNKDVXSWRFRQQHF
WRUVDQGFDQEHFXWLQWRVPDOOHUVHFWLRQVZLWKDXWLOLW\NQLIH3OHDVHUHIHUWRWKH
&DEOH&RORU.H\RQSDJHVWRLI\RXDUHXVLQJSLJWDLOVRULI\RXKDYHDQ\
TXHVWLRQDERXWZKLFKFRQQHFWRULVZKLFK
‡7HUPLQDWLRQ5HVLVWRUV57DUHJHQHUDOO\XVHGRQERWKHQGVRIORQJHUOHQJWKWUDQV
PLVVLRQOLQHV7KHYDOXHRIWKH7HUPLQDWLRQ5HVLVWRUVLVGHWHUPLQHGE\WKHHOHFWULFDO
SDUDPHWHUVRIWKHFDEOH7HUPLQDWLRQ5HVLVWRUVDUHRQO\QHHGHGZLWKUXQVW\SLFDOO\
PRUHWKDQIHHWDVWKHPHWHUKDVVRPHOHYHORIWHUPLQDWLRQLQWHUQDOO\DQGXVX
DOO\UHVLVWRUVDUHQRWQHHGHG
‡)RULQIRUPDWLRQRQFRQQHFWLQJWKHPHWHUWRDPRGHPVHH6HFWLRQ
)LJXUHVKRZVDUHSUHVHQWDWLRQRIDQ56'DLV\&KDLQFRQQHFWLRQ<RXFDQ
FRQQHFWXSWRVODYHVLQD'DLV\&KDLQ
Master device
Last Slave device N
RT
SH
+
RT
-
Slave device 1
Slave device 2
SH
SH
+
-
Twisted pair, shielded (SH) cable
+
-
Twisted pair, shielded (SH) cable
SH
+
-
Twisted pair, shielded (SH) cable
Earth Connection, preferably at
single location
)LJXUH56'DLV\&KDLQ&RQQHFWLRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
Slave device 1
SH
+
-
Long stub results “T” connection that can cause
interference problem!
Master device
Last Slave device N
RT
RT
Slave device 2
SH +
-
SH
Twisted pair, shielded (SH) cable
+
-
SH
Twisted pair, shielded (SH) cable
+
-
Twisted pair, shielded (SH) cable
Earth Connection, preferably at
single location
Twisted pair, shielded (SH) cable
Twisted pair, shielded (SH) cable
Slave device 1
Slave device 2
SH +
-
-
Master device
SH
+
SH
+
-
+ SH
“STAR” connection can cause interference
problem!
-
SH
+
-
Slave device 3
Slave device 4
Twisted pair, shielded (SH) cable
Twisted pair, shielded (SH) cable
)LJXUH,QFRUUHFW³7¶DQG³6WDU´7RSRORJLHV
5.3.2: Using the Unicom 2500
7KH8QLFRPSURYLGHV5656FRQYHUVLRQ,QGRLQJVRLWDOORZVWKH
1H[XVŠPHWHUWRFRPPXQLFDWHZLWKD3&RURWKHUGHYLFH6HHWKHUnicom 2500
Installation and Operation ManualIRUDGGLWLRQDOLQIRUPDWLRQ<RXFDQRUGHUWKH
8QLFRPIURP(,*¶VZHEVWRUHZZZHOHFWURLQGFRPVWRUH6HOHFWWKH&RPPXQL
FDWLRQV3URGXFWVFDWHJRU\IURPWKHOHIWVLGHRIWKHZHESDJH
)LJXUHLOOXVWUDWHVWKH8QLFRPFRQQHFWLRQVIRU56
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
RS232 Port
PC
UNICOM 2500
TX(-) RX(-) TX(+) RX(+) SH
Jumpers:
Short TX(-) to RX(-) becomes (-) signal
Short TX(+) to RX(+) becomes (+) signal
SH
SH
(+)
(+)
Meter’s RS485 Port
(-)
(-)
)LJXUH0HWHU&RQQHFWHGWRD3&8VLQJ8QLFRP
7KH8QLFRPFDQEHFRQILJXUHGIRUHLWKHU
ZLUHRUZLUH56FRQQHFWLRQV6LQFHWKH
1H[XVŠPHWHUXVHVDZLUHFRQQHFWLRQ\RX
6HWVZLWFK
6HWWKH
WR'&(
%DXGUDWH
QHHGWRDGGMXPSHUZLUHVWRFRQYHUWWKH8QLFRP
%
$#
WRWKHZLUHFRQILJXUDWLRQ
$4
%
K
5$
"!
$VVKRZQLQ)LJXUH\RXFRQQHFWWKH5;
V
K
($
K
&$
K
DQG7;WHUPLQDOVZLWKDMXPSHUZLUHWRPDNH
WKHWHUPLQDODQGFRQQHFWWKH5;DQG
7;WHUPLQDOVZLWKDMXPSHUZLUHWRPDNHWKH
WHUPLQDO6HHWKHILJXUHRQWKHULJKWIRUWKH
6HWVZLWFK
WR)'
8QLFRP¶VVHWWLQJV7KH8QLFRP¶V%DXGUDWH
PXVWPDWFKWKH%DXGUDWHRIWKHPHWHU¶V56SRUW\RXVHWWKH%DXGUDWHE\WXUQ
LQJWKHVFUHZWRSRLQWDWWKHUDWH\RXZDQW
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
5.3.3: RJ11 (Telephone Line) Connection—Meter with INP2 (Internal
Modem with Dial In/Dial Out) Option
8VH5-6WDQGDUG7HOHSKRQH/LQHWRFRQQHFWZLWKWKHPHWHU7KH5-OLQHLV
FRQQHFWHGWR&DEOHIURPWKHEDFNRIDPHWHUZLWKWKH,QWHUQDO0RGHP2SWLRQ7KH
5-FRQQHFWRULVVXSSOLHGZLWKWKHPHWHU
7KHOHQJWKRIWKHFRQQHFWLRQXVLQJ5-LQWRWKHPHWHULVYLUWXDOO\XQOLPLWHG7R
FRQQHFWZLWKRWKHUPHWHUVLQHLWKHUORFDORUUHPRWHORFDWLRQV\RX0867XVH&DEOH
)RUPRUHLQIRUPDWLRQRQWKHPHWHUZLWKWKH,132SWLRQVHH6HFWLRQ
5.3.4: RJ45 Connection—Meter with INP200 (10/100BaseT) Option
7KH,132SWLRQFRQIRUPVWRWKH,(((%DVH7VSHFLILFDWLRQXVLQJ
XQVKLHOGHGWZLVWHGSDLU873ZLULQJ7KLVDOORZV\RXWRXVHLQH[SHQVLYH5-
FRQQHFWRUVDQG&$7RUEHWWHUFDEOLQJ7KH5-FRQQHFWRULVVXSSOLHGZLWKWKHPHWHU
&DEOH
8VLQJWKLV/$1FRQQHFWLRQDOORZVPXOWLSOH3&¶VWRDFFHVVWKHPHWHUFRQFXUUHQWO\7KH
5-OLQHLVLQVHUWHGLQWRWKH5-FRQQHFWRURQ&DEOHFRPLQJIURPWKHERWWRPRID
PHWHUZLWKWKH(WKHUQHW2SWLRQ7KHFRQQHFWLRQXVLQJ5-LQWRWKHPHWHUFRQQHFWV
WKHPHWHUWRDQHWZRUNXVLQJ0RGEXV7&3SURWRFRORYHU(WKHUQHW
)RUPRUHLQIRUPDWLRQRQDPHWHUZLWKWKH,132QERDUG(WKHUQHW%DVH7
VHH6HFWLRQ
5.3.5: Modem/Ethernet Connection—Meter with INP202 (Combo
Card) Option
7KH,13LVDQH[WHQVLRQRI,13,WKDVDOOWKHIHDWXUHVRI,13SOXVDEXLOWLQ
0RGHP0RGHPDQG(WKHUQHWFDSDELOLWLHVFDQEHXVHGVLPXOWDQHRXVO\
7KHFRPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKHPRGHPLV0RGEXV$6&,,7KH
&RPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKH56(WKHUQHW0RGHP*DWHZD\LV0RGEXV
578,13FRQYHUWVDOOLQFRPLQJPRGHP0RGEXV$6&,,UHTXHVWVWR0RGEXV578IRU
LQWHUQDODQGJDWHZD\FRPPXQLFDWLRQ,WWKHQFRQYHUWVDOOUHVSRQVH0RGEXV578
PHVVDJHVLQWR0RGEXV$6&,,SURWRFROEHIRUHLWVHQGVWKHUHVSRQVHVWRWKHPRGHP
6RPHRIWKHIL[HGSDUDPHWHUVIRUWKH(WKHUQHW0RGHP*DWHZD\DUH'DWD%LWV(YHQ
3DULW\6WRS%LW7KH(WKHUQHW0RGHP¶V*DWHZD\¶V%DXG5DWHDQG'HOD\7LPHDUH
FRQILJXUDEOH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
)RUPRUHLQIRUPDWLRQRQDPHWHUZLWKWKH,130RGHP(WKHUQHW&RPER&DUGVHH
6HFWLRQ
5.3.6: RS485 Connection - Meter to the P40N/P40N+/P41N+/P43N+
LED Display
&RQQHFWWKHFRPPXQLFDWLRQZLUHVRIWKHVXSSOLHG56FDEOHWRWKHPHWHU¶V3RUWRU
3RUW6HWWKHSRUW¶V%DXG5DWHWR$GGUHVVWR3URWRFROWR0RGEXV578DQG
0RGHWR6ODYHXVLQJWKHFRPPXQLFDWLRQVRIWZDUH,QVHUWWKHRWKHUHQGRIWKH
FRPPXQLFDWLRQZLUHVLQWRWKHEDFNRIWKHILUVW/(''LVSOD\
7KH1H[XVŠPHWHU¶VSRZHUVXSSO\GRHVQRWVXSSO\SRZHUWRH[WHUQDO
GLVSOD\V<RXPXVWXVHDSRZHUVRXUFHVXFKDVWKH(,*3%96HH6HFWLRQ
IRU36,2GHWDLOV
56FRPPXQLFDWLRQLVYLDEOHIRUXSWRIHHWPHWHUV%HVXUHWRGRWKH
IROORZLQJ
&RQQHFWWKHVKLHOGWRWKHVKLHOG6WHUPLQDORQWKH'LVSOD\SRUW7KH6WHUPLQDO
RQWKHPHWHULVXVHGWRUHIHUHQFHWKHPHWHU¶VSRUWWRWKHVDPHSRWHQWLDODVWKH
VRXUFH,WLVQRWDQHDUWKJURXQGFRQQHFWLRQ<RXPD\DOVRFRQQHFWWKHVKLHOGWR
HDUWKJURXQGDWRQHSRLQW
3URYLGHWHUPLQDWLRQUHVLVWRUVDWHDFKHQGIRUORQJHUUXQVW\SLFDOO\¶RUPRUH
FRQQHFWHGWRWKHDQGOLQHV57LVDSSUR[LPDWHO\2KPV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
NOTE:7KH31DQGOHJDF\31FRQQHFWWKHVDPHZD\WKURXJKWKHSRUWRQWKH
EDFNRIWKHGLVSOD\7KHRQO\GLIIHUHQFHLVLQWKHSRUWODEHOLQJ
+
-
S
- V+
+
V
RS-485
- SH - +
RT *
+ External Power
Source
PB1 or other
P40N+ LED Display, Back View
V+
V S
B (-)
A (+)
RT *
* See RT Note on page 5-5.
**
P40N LED Display, Back View
S
+
-
**Please refer to Cable Color
Key, page 6-4,
and second bullet, page 5-5.
1262/1272 Port 4
)LJXUH31DQG/HJDF\31([WHUQDO'LVSOD\56&RQQHFWLRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
5.3.7: Communication Ports on the I/O Modules
Female RS485
Side Port
I/O Port
(Size and Pin
Configuration Vary)
Male RS485
Side Port
)LJXUH,20RGXOH&RPPXQLFDWLRQ3RUWV
Female RS485 Side PortXVHWRFRQQHFWWRDQRWKHUPRGXOH¶VPDOH56VLGHSRUW
Male RS485 Side PortXVHWRFRQQHFWWRWKHPHWHU¶V3RUWVHHIROORZLQJVHFWLRQ
RUWRFRQQHFWWRDQRWKHUPRGXOH¶VIHPDOH56VLGHSRUWVHH6HFWLRQ
I/O PortXVHIRUIXQFWLRQVVSHFLILFWRWKHW\SHRIPRGXOHVL]HDQGSLQFRQILJXUDWLRQ
YDULHVGHSHQGLQJRQW\SHRIPRGXOH)RUPRUHGHWDLOUHIHUWR&KDSWHU
5.3.8: RS485 Connection—Meter to I/O Modules
$Q56FDEOHKDUQHVVLVVXSSOLHGZLWKWKHSXUFKDVHRI0%,2PRXQWLQJEUDFNHWV
:LUHRQHHQGRIWKHFDEOHWRWKHPHWHU¶V3RUW
,QVHUWWKHRWKHUHQGRIWKHFDEOHLQWRWKHFRPPXQLFDWLRQSLQVRIWKH,2PRGXOH¶V
PDOH56VLGHSRUWVHH)LJXUH6HH6HFWLRQIRUGHWDLOVRQXVLQJ
PXOWLSOH,2PRGXOHV
7KH1H[XVŠPHWHU¶VSRZHUVXSSO\GRHVQRWVXSSO\SRZHUWRWKH,2
PRGXOHV<RXPXVWXVHDSRZHUVRXUFHVXFKDVWKH(,*36,2RU3%96HH
6HFWLRQIRU36,2GHWDLOV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
56FRPPXQLFDWLRQLVYLDEOHIRUXSWRIHHWPHWHUV)ROORZWKHZLULQJ
VKRZQLQ)LJXUHDQGEHVXUHWR
&RQQHFWWKHDQGWHUPLQDOVRQWKHPHWHUWRWKHDQGWHUPLQDOVRIWKHIHPDOH
56SRUW&RQQHFWWKHVKLHOGWRWKHVKLHOG6WHUPLQDO7KH6WHUPLQDORQWKH
PHWHULVXVHGWRUHIHUHQFHWKHPHWHU¶VSRUWWRWKHVDPHSRWHQWLDODVWKHVRXUFH,W
LVQRWDQHDUWKJURXQGFRQQHFWLRQ<RXPD\DOVRFRQQHFWWKHVKLHOGWRHDUWKJURXQG
DWRQHSRLQW
3URYLGHWHUPLQDWLRQUHVLVWRUVDWHDFKHQGIRUORQJHUUXQVW\SLFDOO\PRUHWKDQ
¶FRQQHFWHGWRWKHDQGOLQHV57LVDSSUR[LPDWHO\2KPV
NOTES:
‡7KHPHWHUKDVVRPHOHYHORIWHUPLQDWLRQLQWHUQDOO\DQGXVXDOO\UHVLVWRUVDUHQRW
QHHGHG
‡5HIHUWRWKH&DEOH&RORU.H\RQSDJHVWR
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
Male Side Port
on I/O Module
-
-
+ + G
RT=
120 Ohms
RT=
120 Ohms
Meter’s Port 4
S
+
-
)LJXUH0HWHUDQG,20RGXOH&RQQHFWLRQV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
5.3.9: Steps to Determine Power Needed
6LQFHWKH1H[XVŠPHWHU¶VSRZHUVXSSO\GRHVQRWVXSSO\SRZHUWRWKH,2
PRGXOHV\RXQHHGWRXVHDSRZHUVRXUFHVXFKDV(,*¶V36,2ZKLFKLVGHVLJQHGIRU
XVHZLWKWKH,2PRGXOHV)ROORZWKHVHVWHSVWRGHWHUPLQHKRZPDQ\36,2XQLWV\RX
QHHG
$OO,2PRGXOHVDUHVKLSSHGSUHSURJUDPPHGZLWKDEDXGUDWHRIDQG
LQGLYLGXDODGGUHVVHV5HIHUWRWKHIROORZLQJWDEOHWRGHWHUPLQHWKH9$5DWLQJVIRU
WKH,2PRGXOHV
I/O Module Factory Settings and VA Ratings
Model#
Module
Address
VA Rating
P$21
P$$QDORJ
2XWSXWV
9$
P$21
P$$QDORJ
2XWSXWV
9$
P$21
P$$QDORJ
2XWSXWV
9$
P$21
P$$QDORJ
2XWSXWV
9$
$,
P$$QDORJ
,QSXWV
9$
$,
P$$QDORJ
,QSXWV
9$
$,
9'&$QDORJ
,QSXWV
9$
$,
9'&$QDORJ
,QSXWV
9$
52
/DWFKLQJ5HOD\
2XWSXWV
9$
32
.<=3XOVH2XWSXWV
9$
',
6WDWXV,QSXWV
:HW'U\
9$
$GGWRJHWKHUWKH9$5DWLQJVIRUWKH,2PRGXOHVLQXVHWRGHWHUPLQHWRWDOSRZHU
QHHGHG
(DFK36,2VXSSOLHV9$#9'&)RUGHWDLOVRQWKH36,2VHHVHFWLRQV
DQG
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
NOTE:)RURU9'&DSSOLFDWLRQV(,*UHFRPPHQGVWKH3%SRZHUVXSSO\
Example order number3%'923%
,I\RXDUHXVLQJD36,2IRU9$&'&LQSXWRU3%\RXUPD[LPXP9$LV
5.3.10: Remote Communication Over Telephone Lines Using the
RS485 Port
8VHPRGHPVGHGLFDWHGRUGLDOXSZKHQGHYLFHVDUHDWJUHDWGLVWDQFHV(,*
UHFRPPHQGVXVLQJ56ZLULQJZLWKD0RGHP0DQDJHU
PC at office
Originate Modem
Telephone Line
Remote Modem
Null Modem Adapter
(Not required if Modem Manager is used)
Nexus® 1262/1272 Meter
RS232 to RS485
Converter
(Modem Manager
Recommended)
)LJXUH5HPRWH56&RQQHFWLRQV
8VH3RUWRU3RUWIRU56FRPPXQLFDWLRQ7KHOLQNXVLQJ56LVYLDEOHIRUXSWR
IHHWPHWHUV
8VH&RPPXQLFDWRU(;7VRIWZDUHWRVHWWKHSRUW¶VEDXGUDWHWRWKHDSSURSULDWHVSHHG
IRU\RXUKDUGZDUHDQGRUQHWZRUNDQGHQDEOH0RGEXV$6&,,SURWRFRO6HHWKH
Communicator EXT User ManualIRULQVWUXFWLRQV5HPHPEHU0RGEXV578ZLOOQRW
IXQFWLRQSURSHUO\ZLWKPRGHPFRPPXQLFDWLRQ<RXmustFKDQJHWKHSURWRFROWR
0RGEXV$6&,,
<RXPXVWXVHDQ56WR56FRQYHUWHUDQGD1XOO0RGHP(,*UHFRPPHQGV
XVLQJLWV0RGHP0DQDJHU7KLVFRQYHUWHUKDVDEXLOWLQQXOOPRGHPDQGDOVRSURYLGHV
OLQHGDWDEXIIHULQJPDNLQJWKHWHOHSKRQHOLQHFRPPXQLFDWLRQUHOLDEOHPRVWFRPPHU
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
FLDOPRGHPVGRQRW)RUWKLVUHDVRQ(,*UHFRPPHQGVWKH0RGHP0DQDJHUWR
DOOHYLDWHDQ\FRPPXQLFDWLRQOLQHHUURUVWKDWPLJKWRFFXU8VLQJWKH0RGHP0DQDJHU
DOVRHOLPLQDWHVWKHQHHGWRSURJUDPGHIDXOWVHWWLQJVLQWRWKHPRGHPZKLFKPDNHV
LQVWDOODWLRQVLPSOHU
5.3.11: Programming Modems for Remote Communication
<RXPXVWSURJUDPDPRGHPEHIRUHLWFDQFRPPXQLFDWHSURSHUO\ZLWKPRVW56RU
56EDVHGGHYLFHV7KLVWDVNLVRIWHQTXLWHFRPSOLFDWHGEHFDXVHPRGHPVFDQEH
XQSUHGLFWDEOHZKHQFRPPXQLFDWLQJZLWKUHPRWHGHYLFHV
,I\RXDUHQRWXVLQJ(,*¶V0RGHP0DQDJHU\RXPXVWVHWWKHIROORZLQJVWULQJVWR
FRPPXQLFDWHZLWKWKHUHPRWH1H[XVŠPHWHUV&RQVXOW\RXUPRGHP¶VPDQXDOIRU
WKHSURSHUVWULQJVHWWLQJVRUVHH6HFWLRQIRUDOLVWRIVHOHFWHGPRGHPVWULQJV
NOTE: 8VHD0RGHP0DQDJHU7KHSURGXFWZDVGHVLJQHGWRPDNHWKLVWDVN³SOXJDQG
SOD\´:HKLJKO\UHFRPPHQGLWIRUDOOVHULDOPRGHPVROXWLRQV
Modem Connected to a Computer (the Originate Modem)
‡5HVWRUHPRGHPWRIDFWRU\VHWWLQJV7KLVHUDVHVDOOSUHYLRXVO\SURJUDPPHGVHWWLQJV
‡6HWPRGHPWRGLVSOD\5HVXOW&RGHV7KHFRPSXWHUZLOOXVHWKHUHVXOWFRGHV
‡6HWPRGHPWR9HUEDO5HVXOW&RGHV7KHFRPSXWHUZLOOXVHWKHYHUEDOUHVXOWFRGHV
‡6HWPRGHPWRXVH'756LJQDO7KLVLVQHFHVVDU\IRUWKHFRPSXWHUWRHQVXUH
FRQQHFWLRQZLWKWKHRULJLQDWHPRGHP
‡6HWPRGHPWRHQDEOH)ORZ&RQWURO7KLVLVQHFHVVDU\WRFRPPXQLFDWHZLWKWKH
UHPRWHPRGHPFRQQHFWHGWRWKH1H[XVŠPHWHU
‡,QVWUXFWPRGHPWRZULWHWKHQHZVHWWLQJVWRDFWLYDWHSURILOH7KLVSODFHVWKHVH
VHWWLQJVLQWRQRQYRODWLOHPHPRU\WKHVHWWLQJVZLOOWDNHHIIHFWDIWHUWKHPRGHP
SRZHUVXS
Modem Connected to the Nexus® Meter (the Remote Modem)
‡5HVWRUHPRGHPWRIDFWRU\VHWWLQJV7KLVHUDVHVDOOSUHYLRXVO\SURJUDPPHGVHWWLQJV
‡6HWPRGHPWRDXWRDQVZHURQnULQJV7KLVVHWVWKHUHPRWHPRGHPWRDQVZHUWKH
FDOODIWHUnULQJV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
‡6HWPRGHPWRLJQRUH'756LJQDO7KLVLVQHFHVVDU\IRUWKH1H[XVŠPHWHUWRLQVXUH
FRQQHFWLRQZLWKWKHRULJLQDWHPRGHP
‡6HWPRGHPWRGLVDEOH)ORZ&RQWURO7KH1H[XVŠPHWHU¶V56FRPPXQLFDWLRQ
GRHVQRWVXSSRUWWKLVIHDWXUH
‡,QVWUXFWPRGHPWRZULWHWKHQHZVHWWLQJVWRDFWLYDWHSURILOH7KLVSODFHVWKHVH
VHWWLQJVLQWRQRQYRODWLOHPHPRU\WKHVHWWLQJZLOOWDNHHIIHFWDIWHUWKHPRGHP
SRZHUVXS
‡:KHQSURJUDPPLQJWKHUHPRWHPRGHPZLWKDWHUPLQDOSURJUDPPDNHVXUHWKH
EDXGUDWHRIWKHWHUPLQDOSURJUDPPDWFKHVWKH1H[XVŠPHWHU¶VEDXGUDWH
5.3.12: Selected Modem Strings
Table 1:
Modem
String/Setting
&DUGLQDOPRGHP
$7)().16 =RRP)D[PRGHP9);
9%,6.
$7).6 :<
=RRP)D[PRGHP.[
'XDO0RGH
$7).&6 :
<
865RERWLFV6SRUWVWHU
)D[PRGHP
',3VZLWFKVHWWLQJ
$7)1:<IRU
EDXG
8S8S'RZQ'RZQ8S8S
8S'RZQ
865RERWLFV6SRUWVWHU.
)D[PRGHP
',3VZLWFKVHWWLQJ
$7):<
8S8S'RZQ'RZQ8S8S
8S'RZQ
5.3.13: High Speed Inputs Connection
7KH1H[XVŠPHWHU¶VEXLOWLQ+LJK6SHHG,QSXWVFDQEHXVHGLQWZRZD\V
‡$WWDFKLQJVWDWXVFRQWDFWVIURPUHOD\VEUHDNHUVRURWKHUGHYLFHVIRUVWDWXVRUZDYH
IRUPLQLWLDWLRQ
‡$WWDFKLQJWKH.<=SXOVHRXWSXWVIURPRWKHUPHWHUVIRUSXOVHFRXQWLQJDQGWRWDOL]LQJ
(YHQWKRXJKWKHVHLQSXWVDUHFDSDEOHRIEHLQJXVHGDVKLJKVSHHGGLJLWDOIDXOWUHFRUG
LQJLQSXWVWKH\VHUYHDGXDOSXUSRVHDV.<=FRXQWHUVDQGWRWDOL]HUV7KHIXQFWLRQLQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
XVHLVSURJUDPPDEOHLQWKHPHWHUDQGLVFRQILJXUHGYLD&RPPXQLFDWRU(;75HIHUWR
WKHCommunicator EXT User ManualIRULQVWUXFWLRQVRQSURJUDPPLQJWKHVHIHDWXUHV
7KH+LJK6SHHG,QSXWVFDQEHXVHGWRVHQVHGU\FRQWDFWFORVXUHVRQO\7KHPHWHU
LQWHUQDOO\JHQHUDWHVWKHZHWWLQJ9ROWDJHIRUWKHFRQWDFWV7KHZHWWLQJ9ROWDJHLV9
'&
)LJXUH+LJK6SHHG,QSXWV&RQQHFWLRQ
5.3.14: IRIG-B Connections
,5,*%LVDVWDQGDUGWLPHFRGHIRUPDWWKDWV\QFKURQL]HVHYHQWWLPHVWDPSLQJWR
ZLWKLQPLOOLVHFRQG$Q,5,*%VLJQDOJHQHUDWLQJGHYLFHFRQQHFWHGWRWKH*36
VDWHOOLWHV\VWHPV\QFKURQL]HV1H[XVŠPHWHUVORFDWHGDWGLIIHUHQW
JHRJUDSKLFORFDWLRQV1H[XVŠPHWHUVXVHDQXQPRGXODWHGVLJQDOIURPDVDWHOOLWH
FRQWUROOHGFORFNVXFKDV$UELWHU%)RUGHWDLOVRQLQVWDOODWLRQUHIHUWRWKH8VHU¶V
0DQXDOIRUWKHVDWHOOLWHFRQWUROOHGFORFNLQXVH%HORZDUHLQVWDOODWLRQVWHSVDQGWLSV
WKDWZLOOKHOS\RX
Connection:
&RQQHFWWKHWHUPLQDORIWKH1H[XVŠPHWHUWRWKHWHUPLQDORIWKHVLJQDO
JHQHUDWLQJGHYLFHFRQQHFWWKHWHUPLQDORIWKH1H[XVŠPHWHUWRWKHWHUPLQDO
RIWKHVLJQDOJHQHUDWLQJGHYLFH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
Installation
6HW7LPH6HWWLQJVIRUWKHPHWHUEHLQJLQVWDOOHG
)URPWKH&RPPXQLFDWRU(;7'HYLFH3URILOHPHQX
D&OLFNGeneral Settings>Time Settings>one of the Time Settings
linesWRRSHQWKH7LPH6HWWLQJVVFUHHQ
E6HWWKH7LPH=RQHDQG'D\OLJKW6DYLQJV6HOHFWAutoDSTRUEnableDQG
VHWGDWHV
F&OLFNUpdate Device ProfileWRVDYHWKHQHZVHWWLQJV6HH&KDSWHURI
WKHCommunicator EXT User’s Manual IRUGHWDLOV
%HIRUHFRQQHFWLRQFKHFNWKDWWKHGDWHRQWKHPHWHUFORFNLVFRUUHFWRU
ZLWKLQ0RQWKVRIWKHDFWXDOGDWH7KLVSURYLGHVWKHULJKW\HDUIRUWKH
FORFN*36GRHVQRWVXSSO\WKH\HDU
&RQQHFWWKHWHUPLQDORIWKH1H[XVŠPHWHUWRWKHWHUPLQDORIWKH
VLJQDOJHQHUDWLQJGHYLFHFRQQHFWWKHWHUPLQDORIWKH1H[XVŠPHWHUWR
WKHWHUPLQDORIWKHVLJQDOJHQHUDWLQJGHYLFH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
Troubleshooting Tip
7KHPRVWFRPPRQVRXUFHRISUREOHPVLVDUHYHUVDORIWKHWZRZLUHV,I\RXKDYHD
SUREOHPWU\UHYHUVLQJWKHZLUHV
GP
S
Sa
tel
lite
Co
nn
ec
tio
n
IRIG-B Port
+
+
-
-
IRIG-B Time
Signal
Generating
Device
)LJXUH,5,*%&RPPXQLFDWLRQ
NOTE: 3OHDVHPDNHVXUHWKDWWKHVHOHFWHGFORFNFDQGULYHWKHDPRXQWRIZLUHGORDGV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
5.3.15: Time Synchronization Alternatives
6HHWKHCommunicator EXT User ManualIRUGHWDLOV
IRIG-B
‡$OO1H[XVŠPHWHUVDUHHTXLSSHGWRXVH,5,*%IRUWLPHV\QFKURQL]D
WLRQ
‡,I,5,*%LVFRQQHFWHGWKLVIRUPRIWLPHV\QFKURQL]DWLRQWDNHVSUHFHGHQFHRYHUWKH
LQWHUQDOFORFN,IWKH*366LJQDOLVORVWWKHLQWHUQDOFORFNWDNHVRYHUWLPHNHHSLQJ
DWWKHSUHFLVHPRPHQWWKHVLJQDOLVORVW
Line Frequency Clock Synchronization
‡$OO1H[XVŠPHWHUVDUHHTXLSSHGZLWK/LQH)UHTXHQF\&ORFN6\QFKURQL]DWLRQZKLFK
PD\EHHQDEOHGRUGLVDEOHGIRUXVHLQVWHDGRI,5,*%,I/LQH)UHTXHQF\&ORFN
6\QFKURQL]DWLRQLVHQDEOHGDQGSRZHULVORVWWKHLQWHUQDOFORFNWDNHVRYHUDWWKH
SUHFLVHPRPHQWSRZHULVORVW
Internal Clock Crystal
‡$OO1H[XVŠPHWHUVDUHHTXLSSHGZLWKLQWHUQDOFORFNVFU\VWDOVZKLFKDUHDFFXUDWHWR
SSPDQGZKLFKFDQEHXVHGLI,5,*%LVQRWFRQQHFWHGDQGRU/LQH)UHTXHQF\
&ORFN6\QFKURQL]DWLRQLVQRWHQDEOHG
DNP Time Synchronization
‡8VLQJ&RPPXQLFDWRU(;7\RXFDQVHWWKHPHWHUWRUHTXHVWWLPHV\QFKURQL]DWLRQ
IURPWKH'130DVWHU5HTXHVWVFDQEHPDGHIURPRQFHSHUPLQXWHWRRQFHSHUGD\
6HHWKHNexus® 1252/1262/1272/1500 DNP User Manual IRULQVWUXFWLRQV<RXFDQ
GRZQORDGWKHPDQXDOIURP(,*¶VZHEVLWH
ZZZHOHFWURLQGFRPSGI'13YB/HYHOSGI
Other Time Setting Tools
‡Tools>Set Device Time)RUPDQXDORU3&WLPHVHWWLQJ
‡Script & Scheduler7LPHVWDPSVUHWULHYHGORJVDQGGDWD
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
‡MV90&DQV\QFKURQL]HWLPHRQUHWULHYDOVLQWKHIRUPRIDWLPHVWDPS5HIHUWRWKH
Communicator EXT User Manual++)&RQYHUWHULQVWUXFWLRQVIRUPRUH09
GHWDLOV
5.4: INP2 Internal Modem with Dial-In/Dial-Out Option
7KH,13,QWHUQDO0RGHPRSWLRQJLYHVWKH1H[XVŠPHWHU5-FRQQHFWLRQ
DVZHOODV'LDO,Q'LDO2XWUHPRWHFRPPXQLFDWLRQ
5.4.1: Hardware Overview
7KH,132SWLRQIRUWKH1H[XVŠPHWHUSURYLGHVDGLUHFWFRQQHFWLRQWRD
VWDQGDUGWHOHSKRQHOLQH1RDGGLWLRQDOKDUGZDUHLVUHTXLUHGWRHVWDEOLVKDFRPPXQLFD
WLRQFRQQHFWLRQEHWZHHQWKHPHWHUDQGDUHPRWHFRPSXWHU
7KHPRGHPRSHUDWHVDWXSWRNEDXG7KHLQWHUQDOFRQQHFWLRQEHWZHHQWKHPRGHP
DQGWKHPHWHULQFOXGHVDPHPRU\EXIIHU7KLVHQDEOHVWKHPRGHPWRFRQQHFWWRWKH
SKRQHOLQHDWDQ\VSHHGDQGWRFKDQJHVSHHGGXULQJWKHFRPPXQLFDWLRQFRQQHFWLRQWR
WKHUHPRWH3&7KHEXIIHUEHWZHHQWKHPHWHUDQGWKHPRGHPDOORZVWKHPHWHUWR
FRPPXQLFDWHLQWRWKHPRGHPDWDFRQVWDQWVSHHGZKLOHWKHPRGHPWHOHSKRQHOLQH
VSHHGFDQYDU\7KLVHOLPLQDWHVWKHV\QFKURQL]LQJSUREOHPVWKDWDUHFRPPRQZLWK
RWKHUGHYLFHV,WDOVRLQFUHDVHVWKHHIIHFWLYHWKURXJKSXWRIWKHFRPPXQLFDWLRQ
FKDQQHO7KLVLQWXUQGHFUHDVHVFRQQHFWLRQWLPHDQGFRQQHFWLRQFRVWV
7KHPRGHPVXSSRUWVERWKLQFRPLQJFDOOVIURPDUHPRWHFRPSXWHUDQGDXWRPDWLF
GLDORXWFDOOVZKHQDGHILQHGHYHQWPXVWEHDXWRPDWLFDOO\UHSRUWHG
5.4.2: Hardware Connection
:KHQWKH,132SWLRQLVRUGHUHGWKHUHDUHWZR5-MDFNVWKDWSLJWDLOIURPWKHEDFN
RIWKHPHWHU/LQHFRQQHFWLRQIRUWKHRXWVLGHOLQH3KRQHFRQQHFWLRQIRU\RXU
SKRQH$VWDQGDUGWHOHSKRQH5-SOXJFRQQHFWVWKHPHWHUWRDVWDQGDUG3671
3XEOLF6ZLWFKHG7HOHSKRQH1HWZRUN7KHSKRQHMDFNLVWKHRYHUULGHRIWKHPRGHP
IXQFWLRQZKHQWKHSKRQHLVLQXVH
:LWKWKHGHYLFHFRQILJXUHGZLWKWKH,132SWLRQWKHPHWHUKDVGLDOLQFDSDELOLW\DQG
SURYLGHVUHPRWHDFFHVVWRRWKHU0RGEXVEDVHGVHULDOGHYLFHVYLDWKHPHWHU¶V56
*DWHZD\RYHU\RXUSKRQHOLQH7KHPHWHUZLOOUHFRJQL]HDQGUHVSRQGWRD0RGEXV
$GGUHVVRI:LWKDQ\RWKHUDGGUHVVWKHFRPPDQGSDVVHVWKURXJKWKHJDWHZD\DQG
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
EHFRPHVDYLUWXDOFRQQHFWLRQEHWZHHQWKH5HPRWH0RGEXV0DVWHUDQGDQ\0RGEXV
6ODYHFRQQHFWHGWRWKH56*DWHZD\
5.4.3: Dial-In Function
7KHPRGHPFRQWLQXRXVO\PRQLWRUVWKHWHOHSKRQHOLQHWRGHWHFWDQLQFRPLQJFDOO
:KHQDQLQFRPLQJFDOOLVGHWHFWHGWKHPRGHPZDLWVDXVHUVHWQXPEHURIULQJVDQG
WKHQDQVZHUVWKHFDOO
7KHPRGHPFDQEHSURJUDPPHGWRFKHFNIRUDSDVVZRUGRQDQLQFRPLQJFDOO,IWKH
FRUUHFWSDVVZRUGLVQRWSURYLGHGWKHPRGHPKDQJVXSRQWKHLQFRPLQJFDOO,IVHY
HUDOXQVXFFHVVIXOLQFRPLQJFDOODWWHPSWVDUHUHFHLYHGLQDVHWWLPHSHULRGWKHPRGHP
ORFNVRXWIXWXUHLQFRPLQJFDOOVIRUDXVHUVHWQXPEHURIKRXUV
:KHQDQLQFRPLQJFDOOLVVXFFHVVIXOO\FRQQHFWHGWKHFRQWURORIFRPPXQLFDWLRQVLV
SDVVHGWRWKHFDOOLQJVRIWZDUHSURJUDP7KHPRGHPUHVSRQGVWRFRPSXWHUFRPPDQGV
WRGRZQORDGGDWDRURWKHUDFWLRQVDXWKRUL]HGE\WKHPHWHUSDVVZRUGV
5HIHUWRWKHCommunicator EXT User ManualIRULQVWUXFWLRQVRQSURJUDPPLQJWKH
PRGHP
5.4.4: Dial-Out Function
7KH'LDO2XW)XQFWLRQ,13LVLQWHQGHGWRDOORZWKHPHWHUWRDXWRPDWLFDOO\UHSRUW
FHUWDLQFRQGLWLRQVZLWKRXWXVHULQWHUYHQWLRQ7KHPRGHPLVQRUPDOO\SROOLQJWKHPHWHU
WRGHWHUPLQHLIDQ\DEQRUPDORUUHSRUWDEOHFRQGLWLRQVH[LVW7KHPRGHPFKHFNVWKH
IROORZLQJPHWHUFRQGLWLRQVDQGSURJUDPPHGHYHQWVVHWLQ&RPPXQLFDWRU(;7WR
GHWHUPLQHLIDFDOOVKRXOGEHSODFHG
‡$UHDQ\PHWHUVHWSRLQWOLPLWVH[FHHGHG"
‡+DVWKHVWDWXVRIKLJKVSHHGLQSXWVFKDQJHG"
‡+DVDZDYHIRUPEHHQUHFRUGHG"
‡+DVDSRZHUTXDOLW\HYHQWEHHQUHFRUGHG"
‡+DVDFRQWURORXWSXWFKDQJHG"
‡+DVWKHPHWHUH[SHULHQFHGDORVVRIFRQWUROSRZHU"
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
‡,VHLWKHUKLVWRU\ORJDSSURDFKLQJDIXOOFRQGLWLRQ"
‡,VWKHHYHQWORJDSSURDFKLQJDIXOOFRQGLWLRQ"
‡,VDQ\RWKHUORJDSSURDFKLQJDIXOOFRQGLWLRQ"
‡+DVWKHPRGHPSDVVZRUGIDLOHG"
‡+DVFRPPXQLFDWLRQZLWKWKHPHWHUIDLOHG"
,IDQ\RIWKHPRQLWRUHGHYHQWVH[LVWWKHPRGHPDXWRPDWLFDOO\LQLWLDWHVDFDOOWRD
VSHFLILHGORFDWLRQWRPDNHDUHSRUWRUSHUIRUPVRPHRWKHUIXQFWLRQ)RUORJIXOO
FRQGLWLRQVWKHPHWHUDXWRPDWLFDOO\GRZQORDGVWKHORJVWKDWDUHQHDULQJWKHIXOO
VWDWH7KHPRGHPFDQEHSURJUDPPHGWRFDOOWZRGLIIHUHQWQXPEHUVWRPDNHWKH
UHTXLUHGUHSRUWV3ULPDU\DQG%DFNXS
7KHPRGHPFDQEHSURJUDPPHGZLWKDQ$6&,,VWULQJIRULGHQWLILFDWLRQSXUSRVHV,I
WKLVVWULQJLQSUHVHQWWKHPRGHPSOD\VWKHVWULQJWRWKHKRVWFRPSXWHUXSRQ
FRQQHFWLRQWRLGHQWLI\WKHPHWHUWRWKHKRVWVRIWZDUH5HIHUWRWKHCommunicator EXT
User ManualIRUSURJUDPPLQJGHWDLOV
7KHPRGHPLQFOXGHVDFRQQHFWLRQIRUDQH[WHUQDO9/LWKLXP%DWWHU\ZLWKFXVWRP
OHDGVDQGYHOFURPRXQWLQJWRSRZHUWKHPRGHPLIWKHPHWHUORVHVFRQWUROSRZHU
8VLQJWKHEDWWHU\WKHPRGHPLVDEOHWRFRPSOHWHDUHSRUWLQJFDOOHYHQLISRZHUWRWKH
PHWHUKDVEHHQGLVFRQQHFWHG7KLVIHDWXUHDOORZVWKHPHWHUWRUHSRUWSRZHURXWDJH
FRQGLWLRQV8QGHUQRUPDOFRQGLWLRQVWKHEDWWHU\VKRXOGSURYLGHLQH[FHVVRI\HDUV
RIVHUYLFHGXULQJVWRUDJHFRQGLWLRQVGLVFRQQHFWHGIURPWHUPLQDOVRUZKHQSURSHUO\
LQVWDOOHGLQDQHQHUJL]HGPHWHU7KHEDWWHU\VKRXOGSURYLGHPRUHWKDQRQH\HDURI
VHUYLFHGXULQJRXWDJHFRQGLWLRQVRQEDWWHU\EDFNXS$/2:%$77(5<LQGLFDWRU
DSSHDUVRQWKHGLVSOD\VFUHHQZKHQEDWWHU\SRZHULVORZ&DOOWKHIDFWRU\IRUD
UHSODFHPHQWEDWWHU\
5HSODFHPHQWRIWKHEDWWHU\LVVLPSOH:KHQRUGHUHGWKHEDWWHU\LVDWWDFKHGWRD
FDEOHZKLFKSLJWDLOVIURPWKHEDFNRIWKHPHWHUZLWKDFRQQHFWRUVHHIROORZLQJ127(
)LJXUHDQG7DEOH
Installation steps:
5HPRYHWKHROGEDWWHU\E\GLVFRQQHFWLQJLWDWWKHFRQQHFWRU
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
,QVWDOOWKHQHZEDWWHU\E\VQDSSLQJLWLQWRWKHFRQQHFWRU
3HHODQGVWLFNWKHYHOFURDGKHVLYHVRPHZKHUHRXWVLGHWKHPHWHURUXVHWKHROG
DGKHVLYHWRIDVWHQWKHEDWWHU\LQSODFH
NOTE&XVWRPOHDGVDQG9HOFURPRXQWLQJDUHQRWLQFOXGHGLQVRPHHDUOLHUYHUVLRQVRI
WKH6ZLWFKERDUG0HWHU&DOOWKH(,*IDFWRU\IRULQVWDOODWLRQUHSODFHPHQWSDUW
%$77
5.5: INP200 Onboard Ethernet
7KH%DVH7(WKHUQHWRSWLRQ,13LVDIXOO\FXVWRPL]DEOHZHEVHUYHUWKDW
XVHV;0/WRSURYLGHDFFHVVWRUHDOWLPHGDWDYLDWKH,QWHUQHW(,*¶VQDPHIRUWKLV
G\QDPLFV\VWHPLV7RWDO:HE6ROXWLRQV7KHV\VWHPLQFRUSRUDWHVDKLJKO\SURJUDPPD
EOHQHWZRUNFDUGZLWKEXLOWLQPHPRU\WKDWLVLQVWDOOHGLQPHWHUVZLWKWKH,13
RSWLRQ(DFKFDUGFDQEHSURJUDPPHGWRSHUIRUPH[WHQVLYHPRQLWRULQJIXQFWLRQV7KH
%DVH7RSWLRQLVPXFKIDVWHUWKDQWKH%DVH7RSWLRQZKLFKGRHVQRWRIIHU7RWDO
:HE6ROXWLRQV
5.5.1: Hardware Overview
$1H[XVŠPHWHUZLWKWKH%DVH7(WKHUQHW2SWLRQ,13KDVDOO
WKHFRPSRQHQWVRIWKHVWDQGDUG1H[XVŠPHWHUSOXVWKHFDSDELOLW\RIFRQQHFWLRQWRD
QHWZRUNWKURXJKDQ(WKHUQHW/$1RUWKURXJKWKH,QWHUQHWYLD0RGEXV7&3'13
:$1/$1+7736073)73DQGRU'+&3
7KH,QWHUQDO1HWZRUN2SWLRQRIWKH1H[XVŠPHWHULVDQH[WUHPHO\YHUVDWLOHFRPPXQL
FDWLRQWRRO,W
‡$GKHUHVWR,((((WKHUQHWVWDQGDUGXVLQJ7&3,3
‡8WLOL]HVVLPSOHDQGLQH[SHQVLYH%DVH7ZLULQJDQGFRQQHFWLRQV
‡3OXJVULJKWLQWR\RXUQHWZRUNXVLQJWKHEXLOWLQ5-MDFN
‡,VSURJUDPPDEOHWRDQ\,3DGGUHVVVXEQHWPDVNDQGJDWHZD\UHTXLUHPHQWV
‡&RPPXQLFDWHVXVLQJWKHLQGXVWU\VWDQGDUG0RGEXV7&3SURWRFRORU'13:$1/$1
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
5.5.2: Hardware Connection
8VHVWDQGDUG5-%DVH7FDEOHWRFRQQHFWZLWKWKH1H[XVŠPHWHU7KH5-
OLQHLVLQVHUWHGLQWRWKH5-SRUWFRPLQJIURPWKHEDFNRIWKHPHWHUZLWKWKH,13
(WKHUQHW2SWLRQVHH)LJXUH
Configure the Network settings using the following steps:
8VLQJ3RUW3RUW56FRQQHFWLRQRUWKHRSWLFDOSRUWFRQQHFWD3&WRWKH
PHWHU$Q5656FRQYHUWHUPD\EHUHTXLUHGHJ(OHFWUR,QGXVWULHV
8QLFRP
'RXEOHFOLFNRQ&RPPXQLFDWRU(;76RIWZDUHWRRSHQLW
&OLFNWKHQuick ConnectRUConnection ManagerLFRQLQWKHLFRQWRROEDU
&OLFNWKHSerial PortEXWWRQ0DNHVXUHGDWDPDWFKHVWKHPHWHUWKHQFOLFN
Connect
Set the Network using the following steps:
)URPWKH'HYLFH3URILOHPHQXFOLFNGeneral Settings>Communications!DQG
WKHQFOLFNRQRQHRIWKHOLVWHGSRUWV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
<RXZLOOVHHWKH'HYLFH3URILOH&RPPXQLFDWLRQV6HWWLQJVVFUHHQ
,QWKH1HWZRUN6HWWLQJVVHFWLRQPLGGOHRIWKHVFUHHQHQWHUWKHIROORZLQJGDWD
SURYLGHGE\\RXU6\VWHPV$GPLQLVWUDWRU
,3$GGUHVV([DPSOH
6XEQHW0DVN([DPSOH
'HIDXOW*DWHZD\([DPSOH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
&OLFNWKHAdvanced SettingsEXWWRQWRIXUWKHUFRQILJXUHWKH1HWZRUNFRQQHFWLRQ
7KH$GYDQFHG1HWZRUN2SWLRQ6HWWLQJVVFUHHQRSHQV
7KHWDEVDWWKHWRSRIWKHVFUHHQOHW\RXQDYLJDWHEHWZHHQVHWWLQJV'HSHQGLQJRQ
\RXUPHWHU¶VFRQILJXUDWLRQ\RXPD\QRWQHHGWRSURJUDPDOORIWKHVHWWLQJVVKRZQ
KHUH
D7KHILUVWWDELV6HUYLFHV6HFXULW\VKRZQDERYH&OLFNWKHRSWLRQVWRHQDEOH
WKHPIRUWKH1HWZRUNRSWLRQHJWRHQDEOHWKH:HEVHUYHUFOLFNWKHER[QH[W
WRWKDWRSWLRQ
E&OLFNDQ\RIWKHRWKHUWDEVWRFRQILJXUHPRUHRSWLRQVVHH&KDSWHULQWKH
Communicator EXT User ManualIRUGHWDLOHGLQVWUXFWLRQV
‡)73&OLHQWFRQILJXUHWKH)73VHUYHUVHWWLQJV
‡*(3URWRFRO(*'FRQILJXUH*(¶V(*'SURWRFROLIWKHPHWHU¶VILUPZDUH
VXSSRUWVWKLV
‡$ODUP(PDLOFRQILJXUHWKHDODUPHPDLOQRWLILFDWLRQVHWWLQJV
‡&RPSXWHU1DPH'16VHWDQDPH'16VHUYHUV
‡'+&3HQDEOH'+&3IXQFWLRQDOLW\
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
‡)LUPZDUH8SGDWHXSGDWHWKH1HWZRUNFDUG¶VILUPZDUH
‡'13IRU/$1:$1FRQILJXUHWKHVHWWLQJVIRU'13/$1:$1'13RYHU
WKH(WKHUQHW
F&OLFNOKWRVDYH\RXUVHWWLQJVDQGFORVHWKH$GYDQFHG1HWZRUN2SWLRQ6HWWLQJV
VFUHHQ
&OLFNOKWRVDYH\RXUFRPPXQLFDWLRQVHWWLQJVDQGFORVHWKH&RPPXQLFDWLRQV
6HWWLQJVVFUHHQ
&OLFNUpdate DeviceWRVHQGWKHQHZSURILOHWRWKHPHWHU
$IWHUWKH1HWZRUNSDUDPHWHUVDUHVHW&RPPXQLFDWRU(;7FRQQHFWVWRWKHPHWHUYLD
WKH1HWZRUNXVLQJD'HYLFH$GGUHVVRI³´DQGWKHDVVLJQHG,3$GGUHVV)ROORZWKHVH
VWHSV
'RXEOHFOLFNRQWKH&RPPXQLFDWRU(;7LFRQWRRSHQWKHVRIWZDUH
&OLFNWKHConnect LFRQLQWKHLFRQWRROEDU
<RXZLOOVHHWKH&RQQHFWVFUHHQ&OLFNWKHNetworkEXWWRQDWWKHWRSRIWKHVFUHHQ
7KHVFUHHQZLOOFKDQJHWRRQHUHTXHVWLQJWKHIROORZLQJLQIRUPDWLRQ
'HYLFH$GGUHVV
+RVW,3$GGUHVVSHU\RXUQHWZRUNDGPLQLVWUDWRU
([DPSOH
1HWZRUN3RUW
3URWRFRO0RGEXV7&3
NOTE: 6HH6HFWLRQIRUWKHIDFWRU\VHWWLQJV
&OLFNWKHConnectEXWWRQDWWKHERWWRPRIWKHVFUHHQ&RPPXQLFDWRU(;7FRQQHFWV
WRWKHPHWHUYLDWKH1HWZRUN
NOTES
‡&RPPXQLFDWRU(;7DOZD\VFRPPXQLFDWHVYLD0RGEXV7&3ZKLFKLVWKHGHIDXOWSUR
WRFROIRU1H[XVŠPHWHUV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
‡6HHWKHCommunicator EXT User Manual IRUPRUHGHWDLOVRQWKH1HWZRUNRSWLRQ
DQGWKH:HEVHUYHU7RWDO:HE6ROXWLRQV
5.6: INP202 Ethernet/Modem Combination
7KH,132SWLRQLVDQH[WHQVLRQRI,13,WKDVDOOWKHIHDWXUHVRI,13SOXVD
EXLOWLQPRGHP7KHFRPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKHPRGHPLV0RGEXV
$6&,,7KHFRPPXQLFDWLRQSURWRFROVXSSRUWHGE\WKH56(WKHUQHW0RGHP
*DWHZD\LV0RGEXV578
,13FRQYHUWVDOOLQFRPLQJ0RGHP0RGEXV$6&,,UHTXHVWVWR0RGEXV578IRU
LQWHUQDODQGJDWHZD\FRPPXQLFDWLRQ,WWKHQFRQYHUWVDOOUHVSRQVH0RGEXV578
PHVVDJHVLQWR0RGEXV$6&,,DQGVHQGVWKHUHVSRQVHVWRWKHPRGHP
5.6.1: Hardware Overview
7KH1H[XVŠPHWHUZLWKWKH,132SWLRQKDVDOOWKHFRPSRQHQWVRIDQ
,131H[XVŠPHWHUSOXVDEXLOWLQPRGHP,WKDVWKHFDSDELOLW\RIFRQQHFWLQJWRD
QHWZRUNWKURXJKDQ(WKHUQHW/$1DQGZLWKRWKHUGHYLFHVYLDPRGHP
5.6.2: Hardware Connection
7KHUHDUHWKUHHFDEOHVWRFRQQHFWIRUWKH,132SWLRQ$Q56*DWHZD\FDEOHDQ
5-(WKHUQHWFDEOHDQGDQ5-0RGHPFDEOHDUHLQVHUWHGLQWRWKHFDEOHVFRPLQJ
IURPWKHEDFNRIWKH1H[XVŠPHWHUZLWKWKH,13(WKHUQHW0RGHP2SWLRQ5HIHU
WR)LJXUHIRUGHWDLOVRQFDEOHV
Make the software connection using the following steps:
8VLQJ3RUWRU3RUW56FRQQHFWLRQFRQQHFWD3&WRWKHPHWHU$Q56
56FRQYHUWHUPD\EHUHTXLUHGHJ(OHFWUR,QGXVWULHV¶8QLFRP
'RXEOHFOLFNRQ&RPPXQLFDWRU(;76RIWZDUHWRRSHQLW
&OLFNWKHQuick ConnectRUWKHConnection ManagerLFRQLQWKHLFRQWRROEDU
&OLFNWKHSerial PortEXWWRQ0DNHVXUHGDWDPDWFKHVWKHPHWHUWKHQFOLFN
Connect
Set the Network using the following steps:
5HIHUWR6HFWLRQRIWKHCommunicator EXT User Manual IRUPRUHGHWDLOV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
)URPWKH'HYLFH3URILOHPHQXFOLFNGeneral Settings>Communications!DQG
WKHQFOLFNRQRQHRIWKHOLVWHGSRUWV
<RXZLOOVHHWKH'HYLFH3URILOH&RPPXQLFDWLRQV6HWWLQJVVFUHHQ,QWKH1HWZRUN
6HWWLQJVVHFWLRQHQWHUGDWDSURYLGHGE\\RXUV\VWHPVPDQDJHU
,3$GGUHVV([DPSOH
6XEQHW0DVN([DPSOH
'HIDXOW*DWHZD\([DPSOH
&RPSXWHU1DPH1(7:25.([DPSOH
$IWHUWKH1HWZRUNSDUDPHWHUVDUHVHW&RPPXQLFDWRU(;7FRQQHFWVWRWKHPHWHUYLD
WKH1HWZRUNXVLQJD'HYLFH$GGUHVVRI³´DQGWKHDVVLJQHG,3$GGUHVV)ROORZWKHVH
VWHSV
'RXEOHFOLFNRQWKH&RPPXQLFDWRU(;7LFRQWRRSHQWKHVRIWZDUH
&OLFNWKHConnect LFRQLQWKHLFRQWRROEDU
<RXZLOOVHHWKH&RQQHFWVFUHHQ&OLFNWKHNetworkEXWWRQDWWKHWRSRIWKHVFUHHQ
7KHVFUHHQZLOOFKDQJHWRRQHUHTXHVWLQJWKHIROORZLQJLQIRUPDWLRQ
'HYLFH$GGUHVV
+RVW,3$GGUHVVSHU\RXUQHWZRUNDGPLQLVWUDWRU
([DPSOH
1HWZRUN3RUW
3URWRFRO0RGEXV7&3
NOTE: 6HH6HFWLRQIRUWKHIDFWRU\VHWWLQJV
&OLFNWKHConnectEXWWRQDWWKHERWWRPRIWKHVFUHHQ&RPPXQLFDWRU(;7FRQQHFWV
WRWKHPHWHUYLDWKH1HWZRUN
)RUWKH0RGHPFRQQHFWLRQIROORZWKHLQVWUXFWLRQVLQ6HFWLRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
5.7: Factory Settings
<RXFDQXVH&RPPXQLFDWRU(;7WRFRQQHFWWRDPHWHUZLWKWKH,13,13RSWLRQ
IRUWKHILUVWWLPHRUDWDQ\WLPHXQWLOWKHVHWWLQJVDUHFKDQJHGXVLQJWKHIROORZLQJ
IDFWRU\VHWWLQJV
'HYLFH$GGUHVV
,3$GGUHVV
1HWZRUN3RUW
3URWRFRO0RGEXV7&3
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6HULDO&RPPXQLFDWLRQ:LULQJ
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
6: Hardware Installation
6: Hardware Installation
6.1: Mounting the Nexus® Socket Meter
The Nexus® 1262/1272 Socket meter is designed to mount into a standard meter
socket. Follow the Installation Summary below or follow the installation instructions
on the meter socket to ensure that the unit is installed securely. See Dimension
figures below and on the following pages.
NOTE: For Switchboard Meter dimensions and related information, see Chapter 12.
6.96"
17.68cm
4.57"
11.61cm
6.2"
15.75cm
6.96"
17.68cm
Front View
Side View
Figure 6.1: Socket Meter Mounting Dimensions
Installation Summary
• Examine the labels to verify that the meter you are installing is, in fact, the correct
form factor and service type. Make sure that the socket and meter current class
ratings are compatible.
• Make sure that all communication and auxiliary power wiring is accessible in case
disconnection is required for any reason.
• Before applying power to the meter, install batteries if not installed at the factory
and check the connections if they are installed. The meter has two batteries: an
Internal battery which is used to maintain non-volatile readings and the real-time
clock, and the Dial-out Modem battery, which is used by the INP2 option to dial out
on an outage.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-1
6: Hardware Installation
WARNING! POWER MUST BE OFF TO INSTALL THE INTERNAL BATTERY!
AVERTISSEMENT! POUR INSTALLER LA BATTERIE DE LA BORNE, IL FAUT
ÉTENDRE L'ALIMENTATION ÉLECTRIQUE!
• To install the Internal Battery, remove the Internal Shroud and place
the battery into the battery compartment with the + facing UP.
Replace the Internal Shroud. See Section 6.2.
• To install the Modem Battery, with the Outer Shroud on the meter,
locate the battery cable at the back of the meter and insert the cable
connector into the cable. Use the velcro (peel and stick) to attach the
battery somewhere outside of the meter. See Section 5.4.4.
• Measure the enclosure to make sure it accommodates the meter. (If it is standard
size, that won’t be necessary.)
• Make sure that any communications wiring from the back of the meter is fed
through the appropriate openings in your socket to allow for clean connections with
external devices.
• Insert the meter into the socket, making sure that the unit blades are firmly within
the jaws of the socket.
• Connect external devices to the appropriate communications wiring. See following
Figure 6.2 and Table 6.1, Cable Color Key, for communications wiring details. RJ11
and RJ45 connectors are supplied.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-2
6: Hardware Installation
• Make sure the meter is functioning properly by running it through a test circuit.
• The Nexus® Socket meter has its own display built into the face of the meter.
However, you may want to install additional displays in remote locations. See
Section 6.3 for installation procedures for the Nexus® P40N/P40N+/P41N+/P43N+
displays. The displays are connected to the meter via the RS485 cable supplied
with the 1262/1272 (see Figure 6.2, below). See Chapter 5 for detailed wiring
instructions.
Modem/Ethernet Combo:
Cable 4=RS485
Cable 5=RJ11 Modem
Cable 6=RJ45 Ethernet
Modem:
Cable 4=RS485
Cable 5=RJ11 Modem
Cable 7=Battery
Ethernet:
Cable 6=RJ45
Ethernet
Cable 8:
Optional
Aux Power
Cable 1: Port 1,
Port 4, IRIG-B
Optional Communication Cables
Cable 3: Optional
Cable 2: to High-Speed
Inputs
KYZ Cable
Figure 6.2: Socket Meter Rear View Showing Cables
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-3
6: Hardware Installation
0.87"
2.21cm
10.4"
26.42cm
IA
High
Va IB Vb IC Vc
High
High
IC
Low
IB
Low
Vn IA
Low
6.84"
17.37cm
Figure 6.3: Socket Meter Mounted in A-Base Front View
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-4
6: Hardware Installation
4.57”
11.61cm
2.02”
5.13cm
6.60”
16.76cm
Figure 6.4: Socket Meter in A-Base Side View
6.1.1: Cable Color Key
Table 1: Cable Color Key
Cable
Cable 1
Signal Name
Color
Port 1 Wiring (RS485)
SHIELD
Black
Tx/Rx+
Brown
Tx/Rx-
Red
Port 4 Wiring (RS485)
SHIELD
Orange
Tx/Rx+
Yellow
Tx/Rx-
Green
IRIG-B
Electro Industries/GaugeTech
Electro Industries/GaugeTech
+
Blue
-
Purple
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-5
6: Hardware Installation
Table 1: Cable Color Key
Cable
Cable 2
Cable 3
Cable 4
Cable 5
Signal Name
High-Speed Inputs
Input 8
Black
Input 7
Brown
Input 6
Red
Input 5
Orange
Input 4
Yellow
Input 3
Green
Input 2
Blue
Input 1
Gray
Common
Purple
Optional KYZ Output
Normally Closed 1
Black
Common
Brown
Normally Open 1
Red
Normally Closed 2
Orange
Common
Yellow
Normally Open 2
Green
Normally Closed 3
Blue
Common
Purple
Normally Open 3
Gray
Normally Closed 4
Light Green
Common
Pink
Normally Open 4
White
RS485
SHIELD
Blue
Tx/Rx+
Green
Tx/Rx-
Red
RJ11 Modem
Label Attached
Electro Industries/GaugeTech
Electro Industries/GaugeTech
Color
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
Blue
E151701
6-6
6: Hardware Installation
Table 1: Cable Color Key
Cable
Signal Name
Cable 6
Color
RJ45 Ethernet
Label Attached
Cable 7
Blue
Battery
Label Attached
Cable 8
Black
Aux Power - DE
Positive
Red
Neutral/Negative
Black
Aux Power - SE
Std. Ext.
Black
Std. Ext.
Black
Table 6.1: Cable Color Key
IMPORTANT NOTE! The Cable colors shown here are subject to change without notice. Refer to the CABLE LABELS for color code verification.
6.2: Internal Battery Installation and Maintenance
CAUTION! - BATTERY INSTALLATION OR REPLACEMENT MUST BE DONE
WITH POWER OFF!
ATTENTION! - L'INSTALLATION OU LE REMPLACEMENT DE LA PILE DOIT
ÊTRE FAIT SANS ALIMENTATION!
Depending on its age, the Nexus® 1262/1272 meter could be equipped with either of
two types of batteries:
• Older meters are equipped with 3V Lithium cell BR2032.
• Meters shipped after February, 2010 are equipped with 3V Lithium cell
Panasonic BR3032.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-7
6: Hardware Installation
Examine the specific meter and be sure to install the correct battery.
Figure 6.5: Meter without Internal Shroud
The Internal battery maintains NVRAM and time during outages. It is located on one
of the vertical panels inside the Internal Shroud (see Figure 6.5). Under normal
conditions, the battery should provide in excess of 10 years of service during storage
conditions (disconnected from terminals) or when properly installed in an energized
meter. The battery should provide more than one year of service during outage
conditions (time on battery backup). A LOW BATTERY indicator on the display screen
tells you when replacement is needed.
Follow these steps to install the battery:
1. Before replacing the battery, download all memory files to your computer, as data
may be lost.
2. Remove power from the meter.
3. Remove the external meter cover and the internal shroud.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-8
6: Hardware Installation
4. Remove the old battery with a screwdriver or similar tool.
5. Place the new battery in the battery holder.
IMPORTANT! You must insert the replacement battery into the holder correctly.
Otherwise proper contact will not be achieved and the meter may lose log memory
and time functions.
Figure 6.6: Battery Holder Detail
a. Make sure the + on the battery is facing UP and toward you.
b. Insert the RIGHT SIDE of the battery UNDER the 2 clips on the right side of the
holder while gently pushing the battery against the INSIDE RIGHT WALL of the
battery holder (Side A in Figure 6.6).
c. Gently push the LEFT SIDE of the battery in until it snaps into place (Side B in
Figure 6.6).
6. Replace the internal shroud and the external meter cover.
7. Power up the meter.
8. Reset meter time using Communicator software, unless IRIG-B is connected. (If
IRIG-B is connected, time is synchronized automatically.)
NOTE: Replacement of the Modem Battery is explained in Section 5.4.4.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6-9
6: Hardware Installation
6.2.1: Battery Safety and Disposal
Dispose of batteries in accordance with local, state and federal hazardous waste
regulations. For disposal outside the United States, follow your country’s disposal
guidelines.
6.3: Mounting the Optional External Displays
The Nexus® 1262/1272 meter has its own LCD Display on the meter face. The
optional Nexus® LED Displays: P40N+, P41N+ and P43N+ (as well as the legacy
P40N) may be used where additional displays are desired. The dimensions of the
P40N and P40N+ are different - see the figures on the next page. The display mounts
using a standard ANSI C39.1 drill plan. Secure the four mounting studs to the back of
the panel with the supplied hardware. See Chapter 9 for details on the external
displays.
Six feet of RS485 communication/power cable harness is supplied. Allow for at least a
1.25-inch (3.17cm) diameter hole in the mounting panel for the cable harness. See
Chapter 5 for wiring details.
The display is powered by an external power source, such as the PSIO, which supplies
12 VDC.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6 - 10
6: Hardware Installation
4.38” Sq.
(11.12 cm)
NOTE: The P40N is not intended for
new applications.
.75”
1.438” Sq. (1.91
(3.65 cm) cm)
P40N Front Dimensions
P40N Side Dimensions
Legacy P40N Dimensions
P40N+ Front and Side Dimensions
Figure 6.6: P40N/P40N+ Mounting Dimensions
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6 - 11
6: Hardware Installation
3.375”/8.572cm
1.688”/
4.287cm
4x 0.200”/
0.508cm
3.375”/
8.572cm
04.00”/10.16cm
Figure 6.7: P40N/P40N+ ANSI Mounting
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6 - 12
6: Hardware Installation
6.4: Mounting the Nexus® External I/O Modules
Connect multiple I/O modules by inserting male RS485 side ports into female side
ports, then screw each module into the next, using a flathead screwdriver. Work from
left to right.
Secure the mounting brackets to both ends of a group of I/O modules or both sides of
an individual module, using the screws supplied (#440 pan-head screws). Next,
secure the brackets to a flat surface using a #8 screw with a lock washer.
5.629”/14.30cm
3X 1.301”/3.305cm
Mounting Bracket
1.125”/2.858cm
.090”/.229cm
Mounting Bracket
4.188”/10.638cm
Figure 6.8: I/O Modules Mounting Diagram, Overhead View
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6 - 13
6: Hardware Installation
Mounting Brackets (MBIO)
Female RS485
Side Port
I/O Port
(Size and Pin
Configuration Vary)
Male RS485
Side Port
Figure 6.9: Single I/O Module with Mounting Brackets
IMPORTANT! The Nexus® 1262/1272 meter does not supply power to the I/O modules. You must use an external power supply, such as the EIG PSIO (12V Output).
Figure 6.11 shows mounting with the PSIO.
Mounting Bracket
Mounting Bracket
6.879”/13.088cm
/N
0OWER)N
.
,
3.437”/8.729cm
$!.'%2
0OWER3UPPLY
03)/
2.200”/5.588cm
-AX0OWER6!
)NPUT6OLTAGE6$#
1.100”/2.54cm
6!#$#
/UTPUT6OLTAGE6$#
%LECTRO)NDUSTRIES'AUGE4ECH
WWWELECTROINDCOM
.618”/1.570cm
1.301”/3.305cm
Figure 6.10: I/O Modules Mounting Dimensions, Front View
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6 - 14
6: Hardware Installation
1.73”/4.4cm
Figure 6.11: I/O Modules with PSIO Power Supply
Refer to Figure 6.12 and Section 5.3.8 for PSIO and I/O Module wiring instructions.
Auxiliary Power
(PSIO) is supplied
through pins 3 and 4
Connection though
SHIELD, + and - to
meter’s Port 4
072
072
3HIELD
Figure 6.12: I/O Module Wiring Detail
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6 - 15
6: Hardware Installation
This page intentionally left blank.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
6 - 16
7LPHRI8VH)XQFWLRQ
7: Time-of-Use Function
7.1: Introduction
$7LPHRI8VH728XVDJHVWUXFWXUHWDNHVLQWRDFFRXQWWKHTXDQWLW\RIHQHUJ\XVHG
DQGWKHWLPHDWZKLFKLWZDVFRQVXPHG7KH1H[XVŠPHWHU¶V728
IXQFWLRQDYDLODEOHZLWKWKH&RPPXQLFDWRU(;7VRIWZDUHLVGHVLJQHGWRDFFRPPRGDWH
DYDULHW\RISURJUDPPDEOHUDWHVWUXFWXUHV7KH728IXQFWLRQDFFXPXODWHVGDWDEDVHG
RQWKHWLPHVFKHPHSURJUDPPHGLQWRWKH1H[XVŠPHWHU
6HHWKHCommunicator EXT User ManualIRUGHWDLOVRQSURJUDPPLQJWKH1H[XVŠ
PHWHU¶V728FDOHQGDUDQGUHWULHYLQJ728GDWD
7.2: The Nexus® Meter’s TOU Calendar
$1H[XVŠPHWHU¶V728FDOHQGDUVHWVWKHSDUDPHWHUVIRU728GDWDDFFXPXODWLRQ<RX
PD\VWRUHXSWRWZHQW\FDOHQGDUVLQWKH1H[XVŠ0HWHUDQGDQXQOLPLWHGDPRXQWRI
FDOHQGDUILOHVRQ\RXUFRPSXWHU
7KH728FDOHQGDUSURILOHDOORZV\RXWRDVVLJQDSURJUDPPDEOHXVDJHVFKHGXOH²HJ
³:HHNGD\´³:HHNHQG´³+ROLGD\´²WRHDFKGD\RIWKHFDOHQGDU\HDU<RXPD\FUHDWH
XSWRGLIIHUHQW728VFKHGXOHV
(DFK728VFKHGXOHGLYLGHVWKHKRXUGD\LQWRILIWHHQPLQXWHLQWHUYDOVIURP
WR<RXPD\DSSO\RQHRIHLJKWGLIIHUHQWSURJUDPPDEOHUHJLV
WHUV²HJ³3HDN´³2II3HDN´³6KRXOGHU3HDN´²WRHDFKILIWHHQPLQXWHLQWHUYDO
7KH1H[XVŠPHWHUVWRUHV
‡$FFXPXODWLRQVRQDVHDVRQDOEDVLVXSWRIRXUVHDVRQVSHU\HDU
‡$FFXPXODWLRQVRQDPRQWKO\EDVLV
6HDVRQDODQGPRQWKO\DFFXPXODWLRQVPD\VSDQRQH\HDULQWRWKHQH[W(DFKVHDVRQ
DQGPRQWKLVGHILQHGE\DSURJUDPPDEOHVWDUWELOOLQJGDWHZKLFKLVDOVRWKHHQGGDWH
RIWKHSULRUVHDVRQRUPRQWK
$VHDVRQHQGVDWPLGQLJKWRIWKHGD\EHIRUHWKHVWDUWRIWKHQH[WVHDVRQ
$PRQWKHQGVDWPLGQLJKWRIWKHPRQWK¶VELOOLQJGD\
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7LPHRI8VH)XQFWLRQ
,IWKH\HDUHQGVDQGWKHUHLVQRQHZFDOHQGDU728DFFXPXODWLRQVZLOOVWRS,ID
FDOHQGDULVSUHVHQWIRUWKHIROORZLQJ\HDU728DFFXPXODWLRQVFRQWLQXHXQWLOWKHQH[W
PRQWKO\ELOOGDWHRUQH[WVWDUWRIVHDVRQLVUHDFKHG$FFXPXODWLRQFDQVSDQLQWRWKH
IROORZLQJ\HDU
,IQRIROORZLQJ\HDULVSUHVHQWWKHODVWDFFXPXODWLRQIRUWKH\HDUZLOOHQGRQ
7.3: TOU Frozen and Active Registers
7KH1H[XVŠPHWHUVWRUHVDFFXPXODWLRQVIRUWKHSULRUWLPHSHULRGV:KHQWKHHQGRID
ELOOLQJSHULRGLVUHDFKHGWKH$FWLYHSHULRGRIWLPHEHFRPHVVWRUHGDV)UR]HQ7KH
UHJLVWHUVDUHWKHQFOHDUHGDQGDFFXPXODWLRQVUHVXPHXVLQJWKHQH[WVHWRI728
VFKHGXOHVDQGUHJLVWHUDVVLJQPHQWVIURPWKHVWRUHGFDOHQGDU
)UR]HQDQG$FWLYH$FFXPXODWLRQVDUHDOZD\VDYDLODEOH
7.4: Updating, Retrieving and Replacing TOU Calendars
&RPPXQLFDWRU(;7VRIWZDUHUHWULHYHV728FDOHQGDUVIURPWKH1H[XVŠPHWHURUIURP
WKHFRPSXWHU¶VKDUGGULYHIRUUHYLHZDQGHGLW
8SWRDPD[LPXPRIWZHQW\\HDUO\FDOHQGDUVFDQEHVWRUHGLQWKH1H[XVŠPHWHUDW
DQ\JLYHQWLPH<RXPD\UHWULHYHWKHPRQHDWDWLPHDQHZFDOHQGDUFDQEHVWRUHG
ZKLOHDFXUUHQWFDOHQGDULVLQXVH
$FFXPXODWLRQVGRQRWVWRSGXULQJFDOHQGDUXSGDWHV,IDFDOHQGDULVUHSODFHGZKLOHLQ
XVHWKHDFFXPXODWLRQVIRUWKHFXUUHQWSHULRGZLOOFRQWLQXHXQWLOWKHVHWHQGGDWH$W
WKDWSRLQWWKHFXUUHQWWLPHZLOOEHFRPHWKHQHZVWDUWWLPHDQGWKHVHWWLQJVRIWKH
QHZFDOHQGDUZLOOEHXVHG
5HVHWWKHFXUUHQWDFFXPXODWLRQVLI\RXUHSODFHDFDOHQGDULQXVH$UHVHWFOHDUVRQO\
WKHFXUUHQWDFFXPXODWLRQUHJLVWHUV7KLVFDXVHVWKHFXUUHQWDFFXPXODWLRQVWRXVHWKH
SUHVHQWGDWHDVWKHVWDUWDQGDFFXPXODWHWRWKHQH[WQHZHQGGDWHZKLFKZLOOEH
WDNHQIURPWKHQHZFDOHQGDU2QFHVWRUHGSULRUDFFXPXODWLRQVDUHDOZD\VDYDLODEOH
DQGFDQQRWEHUHVHW6HHWKHCommunicator EXT User ManualIRULQVWUXFWLRQVRQ
UHVHWWLQJ728DFFXPXODWLRQV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7LPHRI8VH)XQFWLRQ
$WWKHHQGRIDGHILQHGSHULRGFXUUHQWDFFXPXODWLRQVDUHVWRUHGWKHUHJLVWHUVDUH
FOHDUHGDQGDFFXPXODWLRQVIRUWKHQH[WSHULRGEHJLQ:KHQWKH\HDUERXQGDU\LV
FURVVHGWKHVHFRQGFDOHQGDULISUHVHQWLVXVHG7RUHWDLQFRQWLQXLW\\RXKDYHXSWR
RQH\HDUWRUHSODFHWKHROGFDOHQGDUZLWKRQHIRUWKHIROORZLQJ\HDU
7.5: Daylight Savings and Demand
7RXVH'D\OLJKW6DYLQJV7LPH\RXPXVWHQDEOHLWLQWKH1H[XVŠPHWHU¶V'HYLFH
3URILOH7LPH6HWWLQJV&OLFN$XWR'67ZKLFKVHWV'D\OLJKW6DYLQJV7LPHDXWRPDWLFDOO\
IRUWKH8QLWHG6WDWHV21/<<RXFDQDOVRVHOHFW8VHU'HILQHGDQGHQWHUWKHGHVLUHG
GDWHVIRU'D\OLJKW6DYLQJV7LPH6HH&KDSWHULQWKHCommunicator EXT User
ManualIRUGHWDLOV
‡7RVHW'HPDQG,QWHUYDOVIURPWKH'HYLFH3URILOHVHOHFWRevenue & Energy
Settings > Demand Integration IntervalsDQGVHWWKHGHVLUHGLQWHUYDOV&OLFN
OK
‡7RVHW&XPXODWLYH'HPDQG7\SHIURPWKH'HYLFH3URILOHFOLFNRevenue & Energy
Settings > Cumulative Demand TypeDQGVHOHFW%ORFNRU5ROOLQJ:LQGRZ&OLFN
OK
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7LPHRI8VH)XQFWLRQ
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
8: Transformer Line Loss Compensation
8.1: Introduction
7KH(GLVRQ(OHFWULF,QVWLWXWH
V+DQGERRNIRU(OHFWULFLW\0HWHULQJ1LQWK(GLWLRQGHILQHV
/RVV&RPSHQVDWLRQDV
$PHDQVIRUFRUUHFWLQJWKHUHDGLQJRIDPHWHUZKHQWKHPHWHULQJSRLQWDQGSRLQWRI
VHUYLFHDUHSK\VLFDOO\VHSDUDWHGUHVXOWLQJLQPHDVXUDEOHORVVHVLQFOXGLQJ,5ORVVHV
LQFRQGXFWRUVDQGWUDQVIRUPHUVDQGLURQFRUHORVVHV7KHVHORVVHVPD\EHDGGHGWRRU
VXEWUDFWHGIURPWKHPHWHUUHJLVWUDWLRQ
/RVVFRPSHQVDWLRQPD\EHXVHGLQDQ\LQVWDQFHZKHUHWKHSK\VLFDOORFDWLRQRIWKH
PHWHUGRHVQRWPDWFKWKHHOHFWULFDOORFDWLRQZKHUHFKDQJHRIRZQHUVKLSRFFXUV0RVW
RIWHQWKLVDSSHDUVZKHQPHWHUVDUHFRQQHFWHGRQWKHORZ9ROWDJHVLGHRISRZHUWUDQV
IRUPHUVZKHQWKHDFWXDORZQHUVKLSFKDQJHRFFXUVRQWKHKLJKVLGHRIWKHWUDQV
IRUPHU7KLVFRQGLWLRQLVLOOXVWUDWHGLQ)LJXUH
Ownership Change
M
)LJXUH/RZ9ROWDJH0HWHULQJ,QVWDOODWLRQ5HTXLULQJ/RVV&RPSHQVDWLRQ
,WLVJHQHUDOO\OHVVH[SHQVLYHWRLQVWDOOPHWHULQJHTXLSPHQWRQWKHORZ9ROWDJHVLGHRI
DWUDQVIRUPHUDQGLQVRPHFRQGLWLRQVRWKHUOLPLWDWLRQVPD\DOVRLPSRVHWKHUHTXLUH
PHQWRIORZVLGHPHWHULQJHYHQWKRXJKWKHDFWXDORZQHUVKLSFKDQJHRFFXUVRQWKH
KLJK9ROWDJHVLGH
7KHQHHGIRUORVVFRPSHQVDWHGPHWHULQJPD\DOVRH[LVWZKHQWKHRZQHUVKLSFKDQJHV
VHYHUDOPLOHVDORQJDWUDQVPLVVLRQOLQHZKHUHLWLVVLPSO\LPSUDFWLFDOWRLQVWDOOPHWHU
LQJHTXLSPHQW2ZQHUVKLSPD\FKDQJHDWWKHPLGZD\SRLQWRIDWUDQVPLVVLRQOLQH
ZKHUHWKHUHDUHQRVXEVWDWLRQIDFLOLWLHV,QWKLVFDVHSRZHUPHWHULQJPXVWDJDLQEH
FRPSHQVDWHG7KLVFRQGLWLRQLVVKRZQLQ)LJXUH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
M
Point of Ownership
Change
)LJXUH-RLQW2ZQHUVKLS/LQH0HHWLQJ5HTXLULQJ/RVV&RPSHQVDWLRQ
$VLQJOHPHWHUFDQQRWPHDVXUHWKHORVVHVLQDWUDQVIRUPHURUWUDQVPLVVLRQOLQH
GLUHFWO\,WFDQKRZHYHULQFOXGHFRPSXWDWLRQDOFRUUHFWLRQVWRFDOFXODWHWKHORVVHV
DQGDGGRUVXEWUDFWWKRVHORVVHVWRWKHSRZHUIORZPHDVXUHGDWWKHPHWHUORFDWLRQ
7KLVLVWKHPHWKRGXVHGIRUORVVFRPSHQVDWLRQLQWKH1H[XVŠPHWHU5HIHUWR$SSHQ
GL[$LQWKLVPDQXDODQG$SSHQGL[%RIWKHCommunicator EXT User ManualIRU
GHWDLOHGH[SODQDWLRQDQGLQVWUXFWLRQVIRUXVLQJWKH7UDQVIRUPHU/LQH/RVV&RPSHQVD
WLRQIHDWXUHRIWKH1H[XVŠPHWHU
7KHFRPSXWDWLRQDOFRUUHFWLRQVXVHGIRUWUDQVIRUPHUDQGWUDQVPLVVLRQOLQHORVVFRP
SHQVDWLRQDUHVLPLODU,QERWKFDVHVQRORDGORVVHVDQGIXOOORDGORVVHVDUHHYDOXDWHG
DQGDFRUUHFWLRQIDFWRUIRUHDFKORVVOHYHOLVFDOFXODWHG+RZHYHUWKHFDOFXODWLRQRI
WKHFRUUHFWLRQIDFWRUVWKDWPXVWEHSURJUDPPHGLQWRWKHPHWHUGLIIHUIRUWKHWZRGLI
IHUHQWDSSOLFDWLRQV)RUWKLVUHDVRQWKHWZRPHWKRGRORJLHVZLOOEHWUHDWHGVHSDUDWHO\
LQWKLVFKDSWHU
,QWKH1H[XVŠPHWHU/RVV&RPSHQVDWLRQLVDWHFKQLTXHWKDWFRPSXWDWLRQDOO\
DFFRXQWVIRUDFWLYHDQGUHDFWLYHSRZHUORVVHV7KHPHWHUFDOFXODWLRQVDUHEDVHGRQ
WKHIRUPXODVEHORZ7KHVHHTXDWLRQVGHVFULEHWKHDPRXQWRIDFWLYH:DWWVDQGUHDF
WLYH9$5VSRZHUORVWGXHWRERWKLURQDQGFRSSHUHIIHFWVUHIOHFWHGWRWKHVHFRQGDU\
RIWKHLQVWUXPHQWWUDQVIRUPHUV
7RWDO6HFRQGDU\:DWW/RVV
0HDVXUHG9ROWDJH&DOSRLQW9ROWDJH[/:)(0HDVXUHG&XUUHQW&DO
3RLQW&XUUHQW[/:&8[)XOOVFDOH6HFRQGDU\9$
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
7RWDO6HFRQGDU\9$5/RVV
0HDVXUHG9ROWDJH&DOSRLQW9ROWDJH[/9)(0HDVXUHG&XUUHQW&DO
3RLQW&XUUHQW[/9&8[)XOOVFDOH6HFRQGDU\9$
7KH9DOXHVIRU/:)(/:&8/9)(DQG/9&8DUHGHULYHGIURPWKHWUDQV
IRUPHUDQGPHWHULQIRUPDWLRQDVGHPRQVWUDWHGLQWKHIROORZLQJVHFWLRQV
7KHFDOFXODWHGORVVFRPSHQVDWLRQYDOXHVDUHDGGHGWRRUVXEWUDFWHGIURPWKHPHD
VXUHG:DWWVDQG9$5V7KHVHOHFWLRQRIDGGLQJRUVXEWUDFWLQJORVVHVLVPDGHWKURXJK
WKHPHWHU
VSURILOHZKHQSURJUDPPLQJWKHPHWHUVHHWKHIROORZLQJVHFWLRQIRU
LQVWUXFWLRQV7KHPHWHUXVHVWKHFRPELQDWLRQRIWKHDGGVXEWUDFWVHWWLQJDQGWKH
GLUHFWLRQDOGHILQLWLRQRISRZHUIORZDOVRLQWKHSURILOHWRGHWHUPLQHKRZWRKDQGOHWKH
ORVVHV/RVVHVZLOOEHDGGHGWRRUVXEWUDFWHGIURPGHSHQGLQJRQZKHWKHUDGGRU
VXEWUDFWLVVHOHFWHGWKH5HFHLYHG3RZHUIORZ)RUH[DPSOHLIORVVHVDUHVHWWR$GG
WRDQGUHFHLYHGSRZHUHTXDOVN:DQGORVVHVDUHHTXDOWRN:WKHQWKHWRWDO
PHWHUHGYDOXHZLWKORVVFRPSHQVDWLRQZRXOGEHN:IRUWKHVHVDPHVHWWLQJVLI
WKHPHWHUPHDVXUHGN:RIGHOLYHUHGSRZHUWKHWRWDOPHWHUHGYDOXHZLWKORVV
FRPSHQVDWLRQZRXOGEHN:
6LQFHWUDQVIRUPHUORVVFRPSHQVDWLRQLVWKHPRUHFRPPRQORVVFRPSHQVDWLRQPHWKRG
WKHPHWHUKDVEHHQGHVLJQHGIRUWKLVDSSOLFDWLRQ/LQHORVVFRPSHQVDWLRQLVFDOFXODWHG
LQWKHPHWHUXVLQJWKHVDPHWHUPVEXWWKHSHUFHQWYDOXHVDUHFDOFXODWHGE\DGLIIHUHQW
PHWKRGRORJ\
1H[XVŠPHWHUWUDQVIRUPHUORVVFRPSHQVDWLRQ
‡3HUIRUPVFDOFXODWLRQVRQHDFKSKDVHRIWKHPHWHUIRUHYHU\PHDVXUHPHQWWDNHQ
XQEDODQFHGORDGVDUHKDQGOHGDFFXUDWHO\
‡&DOFXODWHVQXPHULFDOO\HOLPLQDWLQJWKHHQYLURQPHQWDOHIIHFWVWKDWFDXVHLQDFFXUD
FLHVLQHOHFWURPHFKDQLFDOFRPSHQVDWRUV
‡3HUIRUPVELGLUHFWLRQDOORVVFRPSHQVDWLRQ
‡5HTXLUHVQRDGGLWLRQDOZLULQJWKHFRPSHQVDWLRQRFFXUVLQWHUQDOO\
‡,PSRVHVQRDGGLWLRQDOHOHFWULFDOEXUGHQZKHQSHUIRUPLQJORVVFRPSHQVDWLRQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
/RVV&RPSHQVDWLRQLVDSSOLHGWRVHFRQGSHUSKDVH:DWW9$5UHDGLQJVDQGEHFDXVH
RIWKDWDIIHFWVDOOVXEVHTXHQWUHDGLQJVEDVHGRQVHFRQGSHUSKDVH:DWW9$5UHDG
LQJV7KLVPHWKRGUHVXOWVLQORVVFRPSHQVDWLRQEHLQJDSSOLHGWRWKHIROORZLQJTXDQWL
WLHV
‡7RWDO3RZHU
‡'HPDQGVSHUSKDVHDQGWRWDO7KHUPDO%ORFN)L[HG:LQGRZ5ROOLQJ6OLGLQJ
:LQGRZDQG3UHGLFWLYH:LQGRZ
‡0D[LPXPDQGPLQLPXP'HPDQGV
‡(QHUJ\DFFXPXODWLRQV
‡.<=RXWSXWRI(QHUJ\DFFXPXODWLRQV
NOTE/RVV&RPSHQVDWLRQLVGLVDEOHGZKHQWKHPHWHULVSODFHGLQ7HVW0RGH
8.2: Nexus® 1262/1272 Meter's Transformer Loss Compensation
7KH1H[XVŠPHWHUSURYLGHVFRPSHQVDWLRQIRUDFWLYHDQGUHDFWLYHSRZHUTXDQWLWLHVE\
SHUIRUPLQJQXPHULFDOFDOFXODWLRQV7KHIDFWRUVXVHGLQWKHVHFDOFXODWLRQVDUHGHULYHG
HLWKHU
‡%\FOLFNLQJWKH7/&&DOFXODWRUEXWWRQRQWKH7UDQVIRUPHU/RVVVFUHHQRIWKH'HYLFH
3URILOHWRRSHQWKH(,*/RVV&RPSHQVDWLRQ&DOFXODWRULQ0LFURVRIW([FHO
‡%\ILJXULQJWKHYDOXHVIURPWKHZRUNVKHHWVKRZQKHUHDQGLQ$SSHQGL[%RIWKH
Communicator EXT User Manual
(LWKHUZD\\RXHQWHUWKHGHULYHGYDOXHVLQWRWKH&RPPXQLFDWRU(;7VRIWZDUH
WKURXJKWKH'HYLFH3URILOH7UDQVIRUPHUDQG/LQH/RVV&RPSHQVDWLRQVFUHHQ
7KH&RPPXQLFDWRU(;7VRIWZDUHDOORZV\RXWRHQDEOHWUDQVIRUPHUORVVFRPSHQVDWLRQ
IRUORVVHVGXHWRFRSSHUDQGLURQLQGLYLGXDOO\RUVLPXOWDQHRXVO\/RVVHVFDQHLWKHUEH
DGGHGWRRUVXEWUDFWHGIURPPHDVXUHGUHDGLQJV5HIHUWR$SSHQGL[%LQWKHCommunicator EXT User ManualIRULQVWUXFWLRQV
/RVVFRPSHQVDWLRQYDOXHVPXVWEHFDOFXODWHGEDVHGRQWKHPHWHULQVWDOODWLRQ$VD
UHVXOWWUDQVIRUPHUORVVYDOXHVPXVWEHQRUPDOL]HGWRWKHPHWHUE\FRQYHUWLQJWKH
EDVH9ROWDJHDQGFXUUHQWDQGWDNLQJLQWRDFFRXQWWKHQXPEHURIHOHPHQWVXVHGLQWKH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
PHWHULQJLQVWDOODWLRQ)RUWKUHHHOHPHQWPHWHUVWKHLQVWDOODWLRQPXVWEHQRUPDOL]HG
WRWKHSKDVHWRQHXWUDO9ROWDJHDQGWKHSKDVHFXUUHQWLQWZRHOHPHQWPHWHUVWKH
LQVWDOODWLRQPXVWEHQRUPDOL]HGWRWKHSKDVHWRSKDVH9ROWDJHDQGWKHSKDVHFXUUHQW
7KLVSURFHVVLVGHVFULEHGLQWKHIROORZLQJVHFWLRQV
8.2.1: Loss Compensation in Three Element Installations
/RVVFRPSHQVDWLRQLVEDVHGRQWKHORVVDQGLPSHGDQFHYDOXHVSURYLGHGRQWKHWUDQV
IRUPHUPDQXIDFWXUHU
VWHVWUHSRUW$W\SLFDOWHVWUHSRUWZLOOLQFOXGHDWOHDVWWKHIROORZ
LQJLQIRUPDWLRQ
‡0DQXIDFWXUHU
‡8QLWVHULDOQXPEHU
‡7UDQVIRUPHU09$UDWLQJ6HOI&RROHG
‡7HVW9ROWDJH
‡1RORDGORVVZDWWV
‡/RDGORVVZDWWVRUIXOOORDGORVVZDWWV
‡([FLWLQJFXUUHQW#9ROWDJH
‡,PSHGDQFH
7KHWUDQVIRUPHU09$UDWLQJLVJHQHUDOO\WKHORZHVW09$UDWLQJWKHVHOIFRROHGRU2$
UDWLQJRIWKHWUDQVIRUPHUZLQGLQJ7KHWHVW9ROWDJHLVJHQHUDOO\WKHQRPLQDO9ROWDJH
RIWKHVHFRQGDU\RUORZ9ROWDJHZLQGLQJ)RUWKUHHSKDVHWUDQVIRUPHUVWKHVHYDOXHV
ZLOOW\SLFDOO\EHWKHWKUHHSKDVHUDWLQJDQGWKHSKDVHWRSKDVH9ROWDJH$OORIWKHWHVW
PHDVXUHPHQWVDUHEDVHGRQWKHVHWZRQXPEHUV3DUWRIWKHSURFHVVRIFDOFXODWLQJWKH
ORVVFRPSHQVDWLRQSHUFHQWDJHVLVFRQYHUWLQJWKHWUDQVIRUPHUORVVYDOXHVEDVHGRQWKH
WUDQVIRUPHUUDWLQJVWRWKHEDVHXVHGE\WKHPHWHU
&RUUHFWFDOFXODWLRQRIORVVFRPSHQVDWLRQDOVRUHTXLUHVNQRZOHGJHRIWKHPHWHU
LQVWDOODWLRQ,QRUGHUWRFDOFXODWHWKHORVVFRPSHQVDWLRQVHWWLQJV\RXZLOOQHHGWKH
IROORZLQJLQIRUPDWLRQUHJDUGLQJWKHPHWHUDQGWKHLQVWDOODWLRQ
‡1XPEHURIPHWHUHOHPHQWV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
‡3RWHQWLDOWUDQVIRUPHUUDWLR375
‡&XUUHQWWUDQVIRUPHUUDWLR&75
‡0HWHUEDVH9ROWDJH
‡0HWHUEDVHFXUUHQW
7KLVVHFWLRQLVOLPLWHGWRDSSOLFDWLRQRI1H[XVŠPHWHUVWRWKUHHHOHPHQWPHWHULQJ
LQVWDOODWLRQV$VDUHVXOWZHNQRZWKDW
‡1XPEHURIPHWHULQJHOHPHQWV ‡0HWHUEDVH9ROWDJH 9ROWV
‡0HWHUEDVHFXUUHQW $PSV
8.2.1.1: Three-Element Loss Compensation Worksheet
Table 1:
&RPSDQ\
6WDWLRQ
1DPH
'DWH
7UI%DQN
1R
7UI0DQI
7UI6HULDO
1R
&DOFXODWLRQ
E\
7UDQVIRUPHU'DWDIURP7UDQVIRUPHU0DQXIDFWXUHU
V7HVW6KHHW
Table 2:
Winding
Voltage
MVA
Connection
+9+LJK
¨<
;9/RZ
¨<
<97HUWLDU\
¨<
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
Table 3:
Value
Watts Loss
3KDVH
3KDVH
3KDVHN:
1R/RDG/RVV
/RDG/RVV
(QWHU3KDVHRU3KDVHYDOXHV,I3KDVHYDOXHVDUHHQWHUHGFDOFXODWH3KDVH
YDOXHVE\GLYLGLQJ3KDVHYDOXHVE\WKUHH&RQYHUW3KDVH/RVV:DWWVWR3KDVH
N:E\GLYLGLQJ3KDVH/RVV:DWWVE\
Table 4:
Value
3-Phase MVA
1-Phase MVA
1-Phase kVA
6HOI&RROHG5DWLQJ
(QWHU3KDVHRU3KDVHYDOXHV,I3KDVHYDOXHVDUHHQWHUHGFDOFXODWH3KDVH
YDOXHVE\GLYLGLQJ3KDVHYDOXHVE\WKUHH&RQYHUW3KDVH6HOI&RROHG09$WR
3KDVHN9$E\PXOWLSO\LQJE\
Table 5:
([FLWLQJ&XUUHQW
,PSHGDQFH
Table 6:
9DOXH
3KDVHWR3KDVH
3KDVHWR1HXWUDO
7HVW9ROWDJH9ROWV
)XOO/RDG&XUUHQW$PSV
7HVW9ROWDJHLVJHQHUDOO\3KDVHWR3KDVHIRUWKUHHSKDVHWUDQVIRUPHUV&DOFXODWH
3KDVHWR1HXWUDO9ROWDJHE\GLYLGLQJ3KDVHWR3KDVH9ROWDJHE\WKHVTXDUHURRWRI
&DOFXODWH)XOO/RDG&XUUHQWE\GLYLGLQJWKH3KDVHN:6HOI&RROHG5DWLQJE\WKH
3KDVHWR1HXWUDO9ROWDJHDQGPXOWLSO\LQJE\
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
Meter/Installation Data
Table 7:
,QVWUXPHQW7UDQVIRUPHUV
1XPHUDWRU
'HQRPLQDWRU
0XOWLSOLHU
3RWHQWLDO7UDQVIRUPHUV
&XUUHQW7UDQVIRUPHUV
3RZHU0XOWLSOLHU>370XOWLSOLHU[&[email protected]
(QWHUWKH1XPHUDWRUDQG'HQRPLQDWRUIRUHDFKLQVWUXPHQWWUDQVIRUPHU)RUH[DPSOH
D37ZLWKDUDWLRRIKDVDQXPHUDWRURUDGHQRPLQDWRURUDQGD
PXOWLSOLHURI Table 8:
0HWHU6HFRQGDU\9ROWDJH9ROWV
0HWHU6HFRQGDU\&XUUHQW$PSV
Base Conversion Factors
Table 9:
4XDQWLW\
7UDQV
IRUPHU
0XOWLSOLHU
7UI,76HF
0HWHU%DVH
9ROWDJH
&XUUHQW
0HWHU7UI
)RU7UDQVIRUPHU9ROWDJHHQWHUWKH3KDVHWR1HXWUDOYDOXHRI7HVW9ROWDJHSUHYLRXVO\
FDOFXODWHG)RU7UDQVIRUPHU&XUUHQWHQWHUWKH)XOO/RDG&XUUHQWSUHYLRXVO\FDOFX
ODWHG)RU0XOWLSOLHUVHQWHUWKH37DQG&7PXOWLSOLHUVSUHYLRXVO\FDOFXODWHG
7UI,76HFRQGDU\LVWKH%DVH9DOXHRI9ROWDJHDQG&XUUHQWDWWKH,QVWUXPHQW7UDQV
IRUPHU6HFRQGDU\RIWKH3RZHU7UDQVIRUPHU7KHVHQXPEHUVDUHREWDLQHGE\GLYLGLQJ
WKH7UDQVIRUPHU9ROWDJHDQG&XUUHQWE\WKHLUUHVSHFWLYH0XOWLSOLHUV7KH0HWHU7UI
YDOXHVIRU9ROWDJHDQG&XUUHQWDUHREWDLQHGE\GLYLGLQJWKH0HWHU%DVHYDOXHVE\WKH
7UI,76HFRQGDU\YDOXHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
/RDG/RVVDW7UDQVIRUPHU
No-Load Loss Watts (kW) 3KDVHN:1R/RDG/RVV BBBBBBBBBBBBBB
No-Load Loss VA (kVA)
([FLWLQJ&XUUHQW3KDVHN9$6HOI&RROHG5DWLQJ
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBN9$
No-Load Loss VAR (kVAR) 64571R/RDG/RVVN9$1R/RDG/RVVN: 6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
6457BBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBB
Full-Load Loss Watts (kW) 3KDVH.Z/RDG/RVV BBBBBBBBBBBBBB
Full-Load Loss VA (kVA) ,PSHGDQFH3KDVHN9$6HOI&RROHG5DWLQJ
BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBN9$
Full-Load Loss VAR (kVAR) 6457)XOO/RDG/RVVN9$)XOO/RDG/RVVN:
6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
6457BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
6457BBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBB
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
1RUPDOL]H/RVVHVWR0HWHU%DVH
Table 10:
4XDQWLW\
9DOXH
DW7UI
%DVH
07)DFWRU
07)DFWRU
9DOXH
([S
1R/RDG
/RVVN:
9
́2
1R/RDG
/RVVN9$5
9
́4
/RDG/RVV
N:
́2
/RDG/RVV
N9$5
́2
07)DFWRU
Z([S
9DOXH
DW
0HWHU
%DVH
(QWHU9DOXHDW7UDQVIRUPHU%DVHIRUHDFKTXDQWLW\IURPFDOFXODWLRQVDERYH(QWHU
0HWHU7UI)DFWRUYDOXHIURP%DVH&RQYHUVLRQ)DFWRUFDOFXODWLRQVDERYH&DOFXODWH07
)DFWRUZLWK([SRQHQWE\UDLVLQJWKH07)DFWRUWRWKHSRZHULQGLFDWHGLQWKH([SRU
([SRQHQWFROXPQ
&DOFXODWHWKH9DOXHDW0HWHU%DVHE\PXOWLSO\LQJWKH07)DFWRUZ([SWLPHVWKH
9DOXHDW7UI%DVH
/RVV:DWWV3HUFHQWDJH9DOXHV
Meter Base kVA 370XOWLSOLHU&70XOWLSOLHU
BBBBBBBBBBBBBBBBBBBBBBB
BBBBBBBBBBBBBBBB
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
&DOFXODWH/RDG/RVV9DOXHV
Table 11:
4XDQWLW\
9DOXHDW
0HWHU%DVH
0HWHU%DVH
N9$
/RVVDW
0HWHU%DVH
4XDQWLW\
1R/RDG
/RVVN:
/RVV
:DWWV)(
1R/RDG
/RVVN9$5
/RVV
9$5V)(
/RDG/RVV
N:
/RVV
:DWWV&8
/RDG/RVV
N9$5
/RVV
9$5V&8
(QWHU9DOXHDW0HWHU%DVHIURP1RUPDOL]H/RVVHVVHFWLRQ(QWHU0HWHU%DVHN9$
IURPSUHYLRXVFDOFXODWLRQ&DOFXODWH/RVVDW0HWHU%DVHE\GLYLGLQJ9DOXHDW
0HWHU%DVHE\0HWHU%DVHN9$DQGPXOWLSO\LQJE\
(QWHUFDOFXODWHG/RVV:DWWVYDOXHVLQWRWKH1H[XVŠPHWHUXVLQJ&RPPXQLFDWRU
(;7VRIWZDUH5HIHUWR$SSHQGL[%RIWKHCommunicator EXT User ManualIRU
LQVWUXFWLRQV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
9: Using the External Displays
9.1: Overview
7KH1H[XVŠ6RFNHWPHWHUVKDYHDEDFNOLW/&'GLVSOD\EXLOWLQWRWKH
PHWHU,QDGGLWLRQ(OHFWUR,QGXVWULHVRIIHUVDQRSWLRQDOH[WHUQDOGLVSOD\SRZHUHGE\
DQDGGLWLRQDOSRZHUVXSSO\VXFKDVWKH36,27KH31DQGWKHOHJDF\31LV
DQ/('GLVSOD\WKDWSURYLGHVHDV\WRXVHDFFHVVWRWKHLQIRUPDWLRQVWRUHGLQWKH
1H[XVŠPHWHU
3OXJWKH1H[XVŠH[WHUQDOGLVSOD\LQWRWKH3RUWRU3RUWZLULQJFRQQHFWLRQXVLQJWKH
56FDEOHVXSSOLHGVHH&KDSWHUIRUZLULQJGHWDLOV7KHGLVSOD\RSHUDWHVDW
EDXG7RXVHWKHGLVSOD\RQDQRWKHUSRUWFRQILJXUHWKDWSRUWWRRSHUDWHDWEDXG
XVLQJ&RPPXQLFDWRU(;7VRIWZDUHVHHWKHCommunicator EXT User Manual IRU
LQVWUXFWLRQV
9.2: Nexus® P40N/P40N+ LED External Display
7KH1H[XVŠ3131/('H[WHUQDOGLVSOD\KDVWKUHHPRGHV
‡'\QDPLF5HDGLQJV0RGHVHFWLRQVDQG
‡1H[XVŠ,QIRUPDWLRQ0RGHVHFWLRQVDQG
‡'LVSOD\)HDWXUHV0RGHVHFWLRQVDQG
(DFK0RGHLVGLYLGHGLQWR*URXSV0RVW*URXSVDUHIXUWKHUEURNHQGRZQLQWR
5HDGLQJV
‡8VHWKH02'(EXWWRQWRVFUROOEHWZHHQ0RGHV
‡8VHWKH83'2:1DUURZVWRVFUROOIURP*URXSWR*URXSZLWKLQHDFK0RGH
‡8VHWKH/()75,*+7DUURZVWRVFUROOIURP5HDGLQJWR5HDGLQJZLWKLQHDFK*URXS
8VH&RPPXQLFDWRU(;7VRIWZDUHWR)ODVK8SGDWHWKH3131H[WHUQDOGLVSOD\
6HHWKHCommunicator EXT User ManualIRULQVWUXFWLRQV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
7KH1H[XVŠ31/('H[WHUQDOGLVSOD\KDVD86%SRUWRQWKHIURQWIRUGLUHFWGDWD
GRZQORDGV<RXFDQFRQQHFWWRWKH86%SRUWZLWK&RPPXQLFDWRU(;7WRSROODQGFRQ
ILJXUHWKHPHWHUDWWDFKHGWRWKHGLVSOD\7RXVHWKH86%IROORZWKHVHLQVWUXFWLRQV
8VHWKH1H[XVŠ6HULHV3URGXFW&'VKLSSHGZLWK\RXUPHWHUWRLQVWDOOWKH
&RPPXQLFDWRU(;7VRIWZDUHDQGWKHGULYHUIRUWKH3186%SRUW
D,QVHUWWKH&'LQWR\RXU3&
V&'GULYH7KHVFUHHQVKRZQEHORZRSHQVLQ\RXU
%URZVHU
E&OLFNWKHNexus® Technical DocumentsEXWWRQ7KHIROORZLQJVFUHHQRSHQVLQ
\RXU%URZVHU
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
F7RLQVWDOO&RPPXQLFDWRU(;7VRIWZDUHDQGWKHGULYHUIRUWKH31
L&OLFNRQWKHCommunicator EXT 3.0EXWWRQDQGFOLFNRun LQWKH
ZLQGRZWKDWRSHQV7KHVRIWZDUHLVLQVWDOOHG
LL&OLFNRQWKHUSB DriverEXWWRQFOLFNRun LQWKHZLQGRZWKDWRSHQV
7KH31GULYHULVLQVWDOOHG
&RQQHFWWKH86%FDEOHIURP
\RXU3&WRWKHSRUWXVLQJD
86$$0DOHWR86%%0DOH
FDEOHDWWDFKWKH86%$
FRQQHFWRUWRWKH3&DQG
DWWDFKWKH86%%FRQQHFWRU
WRWKH3186%SRUW6HH
)LJXUH
)LJXUH86%%0DOH&RQQHFWRUDQG3186%3RUW
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
2QFHWKH86%FDEOHLVFRQQHFWHGWRWKH31WKHGLVSOD\FOHDUVDQGWKHPHVVDJH
³86%LQ8VH´VFUROOVDWWKHERWWRPRIWKHGLVSOD\$GGLWLRQDOO\WKH86%/('LFRQ
OLJKWVXSZKHQWKH86%FRQQHFWLRQLVEHLQJXVHG
<RXFRQQHFWWRWKH86%SRUWXVLQJ&RPPXQLFDWRU(;7VRIWZDUHWKHVDPHZD\\RX
FRQQHFWWRDPHWHUZLWKWKHVRIWZDUH)ROORZWKHVHLQVWUXFWLRQV
'HWHUPLQHZKLFKSRUWWKH3&
V86%LVXVLQJ
D2Q\RXU3&FOLFNStart>Settings>Control Panel
E'RXEOHFOLFNWKHSystemIROGHU
F&OLFNWKHHardwareWDE<RXZLOOVHHWKHVFUHHQEHORZ
G&OLFNWKHDevice ManagerEXWWRQ<RXZLOOVHHDOLVWRIWKHFRPSXWHU
VKDUGZDUH
GHYLFHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
H&OLFNWKHSOXVVLJQQH[WWR3RUWV&20/377KH&20SRUWVDUHGLVSOD\HG1RWH
WKH&20QXPEHUIRUWKH86%6HULDO3RUW7KLVLVWKHQXPEHU\RXZLOOXVHWR
FRQQHFWWRWKH31WKURXJK&RPPXQLFDWRU(;76HHWKHILJXUHEHORZ
2SHQ&RPPXQLFDWRU(;7VRIWZDUHDQGFOLFNWKHConnectLFRQLQWKH,FRQEDU6HH
WKHVFUHHQVKRZQEHORZ
&OLFNWKHSerial PortEXWWRQLILW¶VQRWDOUHDG\VHOHFWHG
6HWWKH%DXG5DWHWR,WXVHVEHFDXVHLWVKDUHVDQH[LVWLQJ&RPSRUW
IRUGLVSOD\HGUHDGLQJV
&OLFNWKHAvailable PortsEXWWRQDQGVHOHFWWKH86%&203RUWQXPEHUIURPWKH
GURSGRZQOLVW
3URWRFROVKRXOGEH0RGEXV578
)ORZ&RQWUROVKRXOGEH1RQH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
(FKR0RGHVKRXOGEH1R(FKR
&OLFNConnect7KHVRIWZDUHFRQQHFWVWRWKHPHWHUWKURXJKWKH315HIHUWR
WKHCommunicator EXT User's ManualIRUSURJUDPPLQJLQVWUXFWLRQV&OLFN
Help>ContentsIURPWKH&RPPXQLFDWRU(;77LWOH%DUWRYLHZWKHPDQXDORQOLQH
9.3: Dynamic Readings Mode
7KH([WHUQDO'LVSOD\SXWVLWVHOILQWKH'\QDPLF5HDGLQJV0RGHXSRQSRZHUXS8VH
WKH02'(EXWWRQWRDFFHVVWKH'\QDPLF5HDGLQJVIURPRWKHU0RGHV8VHWKH83
'2:1DUURZVWRQDYLJDWHIURP*URXSWR*URXSZLWKLQWKLV0RGH6HH6HFWLRQIRU
D1DYLJDWLRQPDSRIWKH'\QDPLF5HDGLQJV0RGH
Group 1: Phase to Neutral Voltages8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKH
IROORZLQJUHDGLQJVLQRUGHU
‡9ROWV$1%1&1
‡0D[LPXP9ROWV$1%1&1
‡0LQLPXP9ROWV$1%1&1
‡9ROWV$1%1&17+'
‡9ROWV$1%1&10D[LPXP7+'
‡9ROWV$1%1&10LQLPXP7+'
Group 2: Phase to Phase Voltages8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZ
LQJUHDGLQJVLQRUGHU
‡9ROWV$%%&&$
‡0LQLPXP9ROWV$%%&&$
‡0D[LPXP9ROWV$%%&&$
Group 3: Current8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJVLQ
RUGHU
‡&XUUHQW$%&
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
‡0D[LPXP&XUUHQW
‡0LQLPXP&XUUHQW
‡&XUUHQW7+'
‡&XUUHQW0D[LPXP7+'
‡&XUUHQW0LQLPXP7+'
‡&XUUHQW&DOFXODWHG10HDVXUHG1
‡0D[LPXP&XUUHQW&DOFXODWHG10HDVXUHG1
Group 4: Watt/VAR8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJVLQ
RUGHU
‡N:DWWN9$5
‡0D[LPXPN:DWWN9$5&R,QN9$5
‡0D[LPXPN:DWWN9$5&R,QN9$5
‡%ORFN)L[HG:LQGRZ$YHUDJH0D[LPXPN:DWWN9$5&R,QN9$5
‡3UHGLFWLYH5ROOLQJ6OLGLQJ:LQGRZ0D[LPXPN:DWWN9$5&R,QN9$5
Group 5:VA/PF/Frequency8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG
LQJVLQRUGHU
‡N9$3)ODJ+]
‡0D[LPXPN9$+]
‡0LQLPXPN9$+]
‡0D[LPXP4XDGUDQW7RWDO3)
‡0LQLPXP4XDGUDQW7RWDO3)
‡0D[LPXP4XDGUDQW7RWDO3)
‡0LQLPXP4XDGUDQW7RWDO3)
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
‡0D[LPXP4XDGUDQW7RWDO3)
‡0LQLPXP4XDGUDQW7RWDO3)
‡0D[LPXP4XDGUDQW7RWDO3)
‡0LQLPXP4XDGUDQW7RWDO3)
Group 6: Delivered Energy8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG
LQJVLQRUGHU
‡N:DWWKU4XDGUDQW4XDGUDQW3ULPDU\
‡N9$5KU4XDGUDQW3ULPDU\
‡N9$5KU4XDGUDQW3ULPDU\
Group 7: Received Energy8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG
LQJVLQRUGHU
‡N:DWWKU4XDGUDQW4XDGUDQW3ULPDU\
‡N9$5KU4XDGUDQW3ULPDU\
‡N9$5KU4XDGUDQW3ULPDU\
Group 8: Accumulations8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDG
LQJVLQRUGHU
‡N,W$
‡N,W%
‡N,W&
‡N9W$
‡N9W%
‡N9W&
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
Group 9: Phase Angles8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJV
LQRUGHU
‡3KDVH$QJOH9DQEQFQ
‡3KDVH$QJOH,DEF
‡3KDVH$QJOH9DEEFFD
‡3KDVH6HTXHQFH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
9.4: Navigation Map of Dynamic Readings Mode
‡8VH/HIW5LJKWDUURZNH\VWRQDYLJDWH5HDGLQJV
‡8VH8S'RZQDUURZVWRVFUROOEHWZHHQJURXSV
5HDGLQJV
*
U
R
X
S
V
1 Second Volts
AN,BN,CN
Maximum Volts
AN,BN,CN
Minimum Volts
AN,BN,CN
%THD Volts
AN,BN,CN
1 Second Volts
AB,BC,CA
Minimum Volts
AB,BC,CA
Maximum Volts
AB,BC,CA
Return to
First
Reading
1 Second
IA,IB,IC
Maximum
IA,IB,IC
1 Second
kWatt, kVAR
+Max kWatt,
+kVAR,CoIn
kVAR
1 Second
kVA, PF
lag,
Frequency
Max
kVA,
Freq
Positive
kWatthour
Q1+Q4
Min
kVA,
Freq
Minimum
IA,IB,IC
%THD
IA,IB,IC
-Max kWatt,
-kVAR,CoIn
kVAR
Block WinAvg Max
+kWatt,
+kVAR,CoIn kVAR
Max Q1,
Total PF
Positive
kVARhr
Q1
Min Q1,
Total PF
Max Q2,
Total PF
Negative
kVARhr
Q4
Return to
First
Reading
Negative
kWatthr
Q2+Q3
Positive
kVARhr
Q2
Negative
kVARhr
Q3
Return to
First
Reading
2
kI t A
2
kI t B
2
kI t C
2
kV t A
Phase Angles V
AN,BN,CN
Phase Angles I
A,B,C
Max %THD
IA,IB,IC
Phase Angles V
AB,BC,CA
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Max %THD
Volts
AN,BN,CN
Min %THD
Volts
AN,BN,CN
Min %THD
IA,IB,IC
1 Second
INc,INm
Pred Roll Win Avg
+kWatt,
+kVAR,CoIn kVAR
Min Q2,
Total PF
Max Q3,
Total PF
2
kV t B
Phase
Sequence
'RF#
Return to
First
Reading
Return to
First
Reading
Return to
First
Reading
Min Q3,
Total PF
2
kV t C
Min Q4,
Total PF
Min Q4,
Total PF
Return to
First
Reading
Return to
First
Reading
Return to First
Reading
(
8VLQJWKH([WHUQDO'LVSOD\V
9.5: Nexus® Information Mode
8VHWKH02'(EXWWRQWRDFFHVVWKH1H[XVŠ,QIRUPDWLRQ0RGHIURPRWKHU0RGHV8VH
WKH83'2:1DUURZVWRQDYLJDWHIURP*URXSWR*URXSZLWKLQWKLV0RGH6HH6HFWLRQ
IRUD1DYLJDWLRQPDSRIWKH1H[XVŠ,QIRUPDWLRQ0RGH
Group 1: Device Time
0HWHU7LPH
Group 2: Communication Settings8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZ
LQJUHDGLQJVLQRUGHU
‡&RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO
‡&RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO
‡&RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO
‡&RPPXQLFDWLRQ6HWWLQJV3RUW%DXG$GGU3URWRFRO
Group 3: PT/CT Ratios8VHWKH/HIW5LJKWDUURZVWRDFFHVVWKHIROORZLQJUHDGLQJV
LQRUGHU
‡375DWLR
‡&75DWLR
Group 4: External Display Units
3ULPDU\6HFRQGDU\
6HOHFWHLWKHU3ULPDU\RU6HFRQGDU\XQLWVIRUWKH([WHUQDO'LVSOD\XVLQJWKH&RPPXQL
FDWRU(;7VRIWZDUHVHHWKHCommunicator EXT User Manual
‡:KHQ3ULPDU\LVVHOHFWHGWKH'LVSOD\VKRZVDOOUHDGLQJVLQ3ULPDU\XQLWVEDVHGRQ
WKHXVHUSURJUDPPHG37DQG&75DWLRV
‡:KHQ6HFRQGDU\LVVHOHFWHGWKH'LVSOD\VKRZVDOOUHDGLQJVLQ6HFRQGDU\XQLWV
Group 5: Firmware Versions and Serial Numbers8VHWKH/HIW5LJKWDUURZVWR
DFFHVVWKHIROORZLQJUHDGLQJVLQRUGHU
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
‡5XQ7LPH([WHUQDO'LVSOD\5XQ7LPH'635XQ7LPH&RPP
‡%RRW([WHUQDO'LVSOD\%RRW'63%RRW&RPP
‡6HULDO1XPEHU([WHUQDO'LVSOD\6HULDO1XPEHU1H[XVŠ0RQLWRU
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
9.6: Navigation Map of NexusŠ Information Mode
‡8VH/HIW5LJKWDUURZNH\VWRQDYLJDWH5HDGLQJV
8VH8S'RZQDUURZVWRVFUROOEHWZHHQJURXSV
5HDGLQJV
*
U
R
X
S
V
Meter Time
Comm
Settings
Port 1
Comm
Settings
Port 2
PT Ratio
CT Ratio
Return
To
First Reading
Boot
Display,
DSP, Comm
Serial #
Display, Serial
# Monitor
Comm
Settings
Port 3
Return
To
First Reading
Comm
Settings
Port 4
Display
Primary/Secondary
Run-time
Display,
DSP, Comm
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Return
To
First
Reading
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
9.7: Display Features Mode
8VHWKH0RGHEXWWRQWRDFFHVVWKH'LVSOD\)HDWXUHV0RGHIURPRWKHUPRGHV8VHWKH
8S'RZQDUURZVWRQDYLJDWHIURPJURXSWRJURXSZLWKLQWKLVPRGH6HH6HFWLRQ
IRUD1DYLJDWLRQPDSRIWKH'LVSOD\)HDWXUHVPRGH
Group 1: Reset Max/Min
3UHVVEnterWRUHVHWWKH0D[DQG0LQYDOXHV
NOTE,IWKH3DVVZRUG3URWHFWLRQIHDWXUHKDVEHHQHQDEOHGWKURXJK&RPPXQLFDWRU
(;7VRIWZDUH\RXZLOOQHHGWRHQWHUDSDVVZRUGWRUHVHWWKH0D[0LQUHDGLQJV)ROORZ
WKLVSURFHGXUH
3UHVVEnter
(QWHUWKHSDVVZRUGRQHFKDUDFWHUDWDWLPHE\SUHVVLQJWKH8SRU'RZQDUURZV
(DFKSDVVZRUGFKDUDFWHUEHJLQVDVDQ$3UHVVWKH8SDUURZWRLQFUHPHQWWKH
FKDUDFWHUIURP$=DQGWKHQIURP3UHVVWKH'RZQDUURZWRGHFUHPHQWWKH
FKDUDFWHUIURP$WRDQGWKHQIURP=$
3UHVVSetWRHQWHUHDFKFKDUDFWHULQWKHSDVVZRUG
:KHQWKHHQWLUHSDVVZRUGLVVKRZQRQWKH'LVSOD\VFUHHQSUHVVEnter
2QFHWKHSDVVZRUGLVHQWHUHGFRUUHFWO\SUHVVEnterDJDLQWRUHVHWWKH0D[0LQ
YDOXHV
Group 2: Reset Energy
3UHVVEnterWRUHVHWWKH(QHUJ\UHDGLQJV
NOTE,IWKH3DVVZRUG3URWHFWLRQIHDWXUHKDVEHHQHQDEOHGWKURXJK&RPPXQLFDWRU
(;7VRIWZDUH\RXZLOOQHHGWRHQWHUDSDVVZRUGWRUHVHWWKH(QHUJ\UHDGLQJV)ROORZ
VWHSVDERYH7KHQSUHVVEnterDJDLQWRUHVHWHQHUJ\
Group 3: Display Baud Rate/Address
Group 4: Display Communication Protocol
Group 5: EIG Use Only
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
Group 6: EIG Use Only
Group 7: Lamp Test
3UHVVEnterWRFRQGXFWDQ/('WHVW
Group 8: Display Scroll ON/OFF
3UHVVEnterWRWXUQWKHVFUROOIHDWXUHRQRURII:KHQWKHVFUROOIHDWXUHLVRQWKH
31H[WHUQDOGLVSOD\VFUROOVWKURXJKWKHILUVWUHDGLQJRIHDFKJURXSLQWKH'\QDPLF
5HDGLQJVPRGH,IDEXWWRQLVSUHVVHGGXULQJWKHVFUROOVFUROOLQJSDXVHVIRURQH
PLQXWH
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
9.8: Navigation Map of Display Features Mode
8VH8S'RZQDUURZVWRVFUROOEHWZHHQJURXSV
*
U
R
X
S
V
Reset Max/Min
Reset Energy
Baud
Rate/Address
Communication
Protocol
Lamp Test
Display Scroll
On/Off
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
9.9: Optional P40N+ LED External Remote Display Specifications
Specification
P40N+/P41N+/P43N+ Displays
0D[LPXP,QSXW9ROWDJH
9'&
0LQLPXP,QSXW9ROWDJH
9'&
0D[LPXP3RZHU&RQVXPSWLRQ
:
1RPLQDO3RZHU&RQVXPSWLRQ
$SSUR[LPDWHO\:
2SHUDWLQJ7HPSHUDWXUH5DQJH
WRR&WRR)
2YHUDOO'LPHQVLRQV+[:['
[[LQFKHV[[
FP
7KHOHJDF\31GLPHQVLRQVDUH[[LQFKHV[[FP
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
8VLQJWKH([WHUQDO'LVSOD\V
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
10: External I/O Modules
10: External I/O Modules
10.1: Hardware Overview
All Nexus® External I/O modules have the following components:
• Female RS485 Side Port: use to connect to another module’s male RS485 side port.
• Male RS485 Side Port: use to connect to the Nexus® 1250/1252 Meter’s Port 3 or 4
or to another module’s female RS485 side port. See Section 5.3.8 for wiring detail.
• I/O Port: used for functions specific to the type of module; size and pin configuration vary depending on type of module.
• Reset Button: Press and hold for three seconds to reset the module’s baud rate to
57600 and its address to 247 for 30 seconds.
• LEDs: when flashing, signal that the module is functioning.
• Mounting Brackets (MBIO): used to secure one or more modules to a flat surface.
Comes with 2 DIN rail mounting clips.
Mounting Brackets (MBIO)
Female RS485
Side Port
I/O Port
LEDs
(Size and Pin
Configuration Vary)
Male RS485
Side Port
Reset Button
Figure 10.1: I/O Module Components
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 1
10: External I/O Modules
10.1.1: Port Overview
All Electro Industries I/O Modules have ports through which they interface with other
devices. The port configurations are variations of the four types shown below.
Four Analog Outputs
Eight Analog Outputs
(0-1mA and 4-20mA)
(0-1mA and 4-20mA)
0-1mA
Analog Output
Module
0-1mA
Analog Input
Module
COM
COM
OUT 1
OUT 1
OUT 2
OUT 2
OUT 3
OUT 3
OUT 4
OUT 4
OUT 5
OUT 6
OUT 7
OUT 8
RESET
RESET
Eight Analog Inputs
Four Relay Outputs or
(0-1mA, 0-20mA,
Four KYZ Pulse Outputs
0-5Vdc, 0-10Vdc) or
Eight Status Inputs
NO
0-1mA
Analog Input
Module
C
1
NO
COM
INPUT 1
INPUT 2
INPUT 3
INPUT 4
INPUT 5
INPUT 6
NO
K
Y
Z
C
2
NO
O
U
T
P
U
T
S
NO
C
3
NO
NO
INPUT 7
C
INPUT 8
RESET
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
4
NO
RESET
Doc#
E151701
10 - 2
10: External I/O Modules
10.2: I/O Module Installation
See Section 5.3.8 for wiring instructions for the external I/O Modules, and Section 6.4
for hardware installation instructions.
10.2.1: Power Source for I/O Modules
The Nexus® 1262/1272 does not supply power to the I/O Modules. You must use an
external power source, such as the EIG PSIO (12V). Refer to Section 5.3.9 to
determine power needed.
Figure 10.2: PSIO Power Supply Side View, Showing Male RS485 Port
TX
CT
On
RX
0-1mA
Analog Input
Module
Power In
COM
N(-)
INPUT 1
INPUT 2
INPUT 3
INPUT 4
!
L(+)
DANGER
PowerPSIO
Supply
Max Power: 12 VA
Input Voltage: 12-60V DC
90-240V AC/DC
Output Voltage: 12V DC
RESET
ElectroIndustries/GaugeTech
www.electroind.com
Figure 10.3: Power Flow from PSIO to I/O Module
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 3
10: External I/O Modules
On
Power In
N(-)
!
L(+)
DANGER
PowerPSIO
Supply
Max Power: 12 VA
Input Voltage: 12-60V DC
90-240V AC/DC
Output Voltage: 12V DC
ElectroIndustries/GaugeTech
www.electroind.com
POWER +
POWER -
Figure 10.4: PSIO Side and Top Labels (Labels are Red and White)
10.3: Using the PSIO with Multiple I/O Modules
Mounting
bracket
Female
RS485
side Port
0-1mA
Analog Input
Module
CT
RX
TX
RX
TX
0-1mA
Analog Output
Module
CT
CT
TX
Female
RS485
Side Port
Communication
ONLY
(A+, B- and
Shield)
RX
LEDs
On
0-1mA
Analog Input
Module
COM
COM
COM
OUT 1
INPUT 1
INPUT 1
OUT 2
INPUT 2
INPUT 2
Power In
N(-)
!
DANGER
OUT 3
INPUT 3
INPUT 3
OUT 4
INPUT 4
INPUT 4
INPUT 5
INPUT 5
Max Power: 12 VA
INPUT 6
INPUT 6
Input Voltage: 12-60V DC
INPUT 7
INPUT 7
INPUT 8
INPUT 8
RESET
RESET
Control
Power
L(+)
PowerPSIO
Supply
90-240V AC/DC
Output Voltage: 12V DC
RESET
ElectroIndustries/GaugeTech
www.electroind.com
Reset Button
Mounting Bracket
I/O Port (Size and pin configuration vary)
Figure 10.5: PSIO Used with Multiple I/O Modules
NOTE: As shown, the PSIO must be to the right of I/O Modules when viewing the side
label.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 4
10: External I/O Modules
10.3.1: Steps for Attaching Multiple I/O Modules
1. Each I/O module in a group must be assigned a unique address. See the
Communicator EXT User Manual for details on configuring and programming the
I/O Modules.
2. Determine how many power sources (such as the PSIO) are needed for the number
of modules in use. See Sections 5.3.9 for details.
3. I/O modules can be mounted using either of two methods. The first method is
using the mounting brackets provided, to attach directly to a panel. The second
method is to attach the Din Rail clips to the mounting brackets to connect the I/O
modules to a DIN rail mounting system.
4. Starting with the left module and using a slotted screwdriver, fasten the first I/O
module to the left mounting bracket of the MBIO mounting brackets kit. The left
mounting bracket is the one with the PEM. Fasten the internal screw tightly into the
left mounting bracket.
5. Slide the female RS485 port into the male RS485 side port to connect the next
I/O module to the left module. Fasten together enough to grab but do not tighten,
yet.
6. Combine the modules together, one by one.
7. Attach the PSIO (power supply) to the right of the group of I/O Modules it is
supplying with power.
NOTE: The PB1 can also be used as a Low Voltage Power Supply. It must be mounted
separately. The PB1 should be ordered with a 12V output for this application.
8. Once you have combined all the I/O modules and power supplies together for the
group, fasten tightly. This final tightening will lock the whole group together as a
unit.
9. Attach the right Mounting Bracket to the right side of the group using the small
Phillips head screws provided.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 5
10: External I/O Modules
10. If not mounting on a DIN rail, mount the group of modules on a secure, flat
surface. This procedure will insure that all modules stay connected securely.
11.The MBIO mounting brackets kit comes with 2 DIN rail mounting clips and an 8mm
screw and lock washer for each clip. The clips let you easily mount the
connected I/O modules (or a single I/O module between two brackets) on a DIN
rail. See the figure below.
8 mm screw
Lock washer
I/O Mounting Bracket
DIN Rail Clip
DIN rail
Figure 10.6: Mounting the Brackets on a DIN Rail
To use the DIN rail mounting clips:
a. From the front of either bracket, insert the screw into the lock washer and
through the hole, and screw it into the clip using an appropriate screwdriver.
Note that the clip should be positioned as shown above, with the indented side
facing the back.
b. Repeat step a for the second bracket.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 6
10: External I/O Modules
c. Hook the bottom of the clips around the bottom of the DIN rail and then push the
top of the clips forward so that they fit over the top of the DIN rail. See the figure below.
2.Fit this over
the DIN rail
1.Hook these
under the DIN rail
Figure 10.7: Detail of DIN Rail Mounting Clip
10.4: Factory Settings and Reset Button
Factory Settings:
All Nexus® I/O Modules are shipped with a preset address and a baud rate of 57600.
See following sections for I/O Module addresses.
Reset Button:
If there is a communication problem or if you are unsure of a module’s address and
baud rate, press and hold the RESET button for 3 seconds; the module will reset to a
default address of 247 at 57600 baud rate for 30-seconds. This enables you to
interrogate the I/O using the Communicator EXT software; see the Modbus
Communicating I/O Modules User Manual.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 7
10: External I/O Modules
10.5: Analog Transducer Signal Output Modules
Table 1:
Analog Transducer Signal Output Module Specifications
Model Numbers
1mAON4: 4-channel analog output 0±1mA
1mAON8: 8-channel analog output 0±1mA
20mAON4: 4-channel analog output 4-20mA
20mAON8: 8-channel analog output 4-20mA
Accuracy
0.1% of Full Scale
Scaling
Programmable
Communication
RS485, Modbus RTU
Programmable Baud Rates: 4800, 9600, 19200,
38400, 57600
Power Requirement
12-20VDC @50-200mA
Operating Temperature
(-20 to +70)o C/(-4 to +158)o F
Maximum Load Impedance
0±1mA: 10k Ohms; 4-20mA: 500 Ohms
Factory Settings
Modbus Address: 1mAON4: 128; 1mAON8: 128;
20mAON4: 132; 20mAON8: 132
Baud Rate: 57600
Transmit Delay Time: 0
Default Settings (Reset Button)
Modbus Address: 247
Baud Rate: 57600
Transmit Delay Time: 20msec
10.5.1: Overview
The Analog Transducer Signal Output Modules (0±1mA or 4–20mA) are available in
either a 4- or 8-channel configuration. Maximum registers per request, read or write,
is 17 registers.
All outputs share a single common point. This is also an isolated connection (from
ground).
The Modbus Map for the Analog Output Module (and operating details) can be found in
the Modbus Communicating I/O Modules Manual.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 8
10: External I/O Modules
10.5.2: Normal Mode
Normal Mode is the same for the 0-1mA and the 4-20mA Analog Output Modules
except for the number of processes performed by the modules.
Both devices:
1. Accept new values through communication.
2. Output current loops scaled from previously accepted values.
The 0-1mA module includes one more process in its Normal Mode:
3. Read and average the A/D and adjust values for Process 2 above.
The device will operate with the following default parameters:
Address:
247 (F7H)
Baud Rate:
57600 Baud
Transmit Delay Time:
20 msec
Normal Operation is prevented by a number of occurrences. See Section 10.4 for
details.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 9
10: External I/O Modules
10.6: Analog Input Modules
Table 2:
Analog Input Module Specifications
Model Numbers
8AI1: 8-channel analog input 0±1mA
8AI2: 8-channel analog input 0±20mA
8AI3: 8-channel analog input 0±5VDC
8AI4: 8-channel analog input 0±10VDC
Accuracy
0.25% of Full Scale
Scaling
Programmable
Communication
RS485, Modbus RTU
Programmable Baud Rates: 4800, 9600, 19200,
38400, 57600
Power Requirement
12-20VDC @50-200mA
Operating Temperature
(-20 to +70)o C/(-4 to +158)o F
Maximum Load Impedance
0±1mA: 10k Ohms; 4-20mA: 500 Ohms
Factory Settings
Modbus Address: 8AI1: 136; 8AI2: 140; 8AI3: 144;
8AI4: 148
Baud Rate: 57600
Transmit Delay Time: 0
Default Settings (Reset Button)
Modbus Address: 247
Baud Rate: 57600
Transmit Delay Time: 20msec
10.6.1: Overview
The Analog Input Modules (0±1mA, 0±20mA, 0±5Vdc and 0±10Vdc) are available in
8-channel format. Maximum registers per request, read or write, is 17 registers.
All inputs share a single common point. This is also an isolated connection (from
ground).
The Modbus Map for the Analog Output Module (and operating details) can be found in
the Modbus Communicating I/O Modules Manual.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 10
10: External I/O Modules
10.6.2: Normal Mode
In Normal Mode, the Input Module:
1. Reads and averages the A/D and adjusts values for process 2.
2. Calculates the percentage of Input Value.
NOTE: The percentage value of the Input is stored in Input Value Registers (Registers
04097-04104).
The device will operate with the following default parameters:
Address:
247 (F7H)
Baud Rate:
57600 Baud
Transmit Delay Time:
20 msec
Normal Operation is prevented by a number of occurrences. See Section 10.4 for
details.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 11
10: External I/O Modules
10.7: Digital Dry Contact Relay Output (Form C) Module
Digital Dry Contact Relay Output Module Specifications
Model Number
4RO1: 4 latching relay outputs
Contact Type
Changeover (SPDT)
Relay Type
Mechanically latching
Communication
RS485, Modbus RTU
Programmable Baud Rates: 4800, 9600, 19200,
38400, 57600
Power Requirement
2.0W max @ 12-20VDC
Operating Temperature
(-20 to +70)o C/(-4 to +158)o F
Switching Voltage
AC 250V / DC 30V
Switching Power
1250VA / 150W
Switching Current
5A
Mechanical Life
5 x 107 switching operations
Electrical Life
105 switching operations at rated current
Factory Settings
Modbus Address: 156
Baud Rate: 57600
Transmit Delay Time: 0
Default Settings (Reset Button)
Modbus Address: 247
Baud Rate: 57600
Transmit Delay Time: 20msec
10.7.1: Overview
The Relay Output Module consists of four Latching Relay Outputs. In Normal Mode,
the device accepts commands to control the relays. Relay output modules are triggered by limits programmed with the Communicator EXT software. See the Communicator EXT User Manual for details on programming limits.
The Modbus Map for the Analog Output Module (and operating details) can be found in
the Modbus Communicating I/O Modules Manual.
Each latching relay will hold its state in the event of a power loss.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 12
10: External I/O Modules
10.7.2: Communication
Maximum registers per request, read or write, is 4 registers.
The device will operate with the following default parameters:
Address:
247 (F7H)
Baud Rate:
57600 Baud
Transmit Delay Time:
20 msec
Some situations will cause the device to operate with the above Default Parameters.
See Section 10.4 for details of Default Mode.
10.7.3: Normal Mode
Normal Mode consists of one process: the device accepts new commands to control
the relays.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 13
10: External I/O Modules
10.8: Digital Solid State Pulse Output (KYZ) Module
Digital Solid State Pulse Output Module Specifications
Model Number
4PO1
Communication
RS485, Modbus RTU
Programmable Baud Rates: 4800, 9600, 19200,
38400, 57600
Power Requirement
12-20VDC @50-200mA
Operating Temperature
(-20 to +70)o C/(-4 to +158)o F
Voltage Rating
Up to 300VDC
Commands Accepted
Read and Write with at least 4 registers of data per
command
Memory
256 Byte IC EEPROM for storage of programmable settings and non-volatile memory
Factory Settings
Modbus Address: 160
Baud Rate: 57600
Transmit Delay Time: 0
Default Settings (Reset Button)
Modbus Address: 247
Baud Rate: 57600
Transmit Delay Time: 20msec
10.8.1: Overview
The KYZ Pulse Output Modules have 4 KYZ Pulse Outputs and accept Read and Write
Commands with at least 4 registers of data per command. Digital Solid State Pulse
Output (KYZ) Modules are user programmed to reflect VAR-hours, WATT-hours, or VAhours. See the Modbus Communicating I/O Modules User Manual for details on programming the module.
The Modbus Map for the KYZ Pulse Output Module (and operating details) can be
found in the Modbus Communicating I/O Modules Manual.
NC = Normally Closed; NO = Normally Open; C = Common.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 14
10: External I/O Modules
10.8.2: Communication
Maximum registers per request, read or write, is 4 registers.
The device will operate with the following Default Mode Parameters. See Section 10.4
for details.
Address:
247 (F7H)
Baud Rate:
57600 Baud
Transmit Delay Time:
20 msec
10.8.3: Normal Mode
Energy readings are given to the device frequently. The device generates a pulse at
each channel after a certain energy increase.
Normal Operation consists of three processes:
1. The first process accepts writes to registers 04097 - 04112. Writes can be up to
four registers long and should end on the fourth register of a group (register
04100, or registers 04103-04112 or registers 04109-04112). These writes can be
interpreted as two-byte, four-byte, six-byte or eight-byte energy readings. The
reception of the first value for a given channel provides the initial value for that
channel. Subsequent writes will increment the Residual for that channel by the difference of the old value and the new value. The previous value is then replaced
with the new value. Attempting to write a value greater than the programmed Rollover Value for a given channel is completely ignored and no registers are modified.
If the difference is greater than half of the programmed Rollover Value for a given
channel, the write does not increment the Residual but does update the Last Value.
Overflow of the Residual is not prevented.
2. The second process occurs in the main loop and attempts to decrement the Residual by the Programmed Energy/Pulse Value. If the Residual is greater than the Programmed Energy/Pulse Value and the Pending Pulses Value for that channel has not
reached the maximum limit, then Residual is decremented appropriately and the
Pending Pulses is increased by two, signifying two more transitions and one more
pulse.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 15
10: External I/O Modules
3. The third process runs from a timer which counts off pulse widths from the Programmable Minimum Pulse Width Values. If there are Pulses Pending for a channel
and the delay has passed, then the Pulses Pending is decremented for that channel
and the Output Relay is toggled.
Operation Indicator (0000H = OK, 1000H = Problem):
Bit 1:1 = EEPROM Failure
Bit 2:1 = Checksum for Communications Settings bad
Bit 3:1 = Checksum for Programmable Settings bad
Bit 4:1 = 1 or mor Communications Settings are invalid
Bit 5:1 = 1 or more Programmable Settings are invalid
Bit 6:1 = 1 or more Programmable Settings have been modified
Bit 7:1 = Forced Default by Reset Value
Bit 15:1 = Normal Operation of the device is disabled
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 16
10: External I/O Modules
10.9: Digital Status Input Module
Digital Status Input Module Specifications
Model Number
8DI1
Communication
RS485, Modbus RTU
Programmable Baud Rates: 4800, 9600, 19200,
38400, 57600
Power Requirement
12-20VDC @50-200mA
Operating Temperature
(-20 to +70)o C/(-4 to +158)o F
Voltage Rating
Up to 300VDC
Detection
Wet/Dry, Auto-detect
Memory
256 Byte I2C EEPROM for storage of programmable
settings and non-volatile memory
Factory Settings
Modbus Address: 164
Baud Rate: 57600
Transmit Delay Time: 0
Default Settings (Reset Button)
Modbus Address: 247
Baud Rate: 57600
Transmit Delay Time: 20msec
10.9.1: Overview
The Digital Status Input Module is used either for additional status detect or for accumulating pulses from external equipment, such as power meters, water meters, etc.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 17
10: External I/O Modules
10.9.2: Communication
Maximum registers per request, read or write, is 4 registers.
The device will operate with the following Default Mode Parameters. See Section 10.4
for details.
Address:
247 (F7H)
Baud Rate:
57600 Baud
Transmit Delay Time:
20 msec
10.9.3: Normal Mode
The device polls the inputs at 100Hz (once every 10 msec), debouncing the inputs
and incrementing the Transition Accumulators for each channel as appropriate.
The inputs are represented by Channel 1 in the LSB through Channel 8 in the MSB of
the low order byte of the register.
The Modbus Map for the Digital Status Input Modules (and operating details) can be
found in the Modbus Communicating I/O Modules Manual.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
10 - 18
11: Electrical Installation
11: Electrical Installation
The Nexus® 1262/1272 Socket meter supported forms and their wiring configurations are shown in this chapter. The forms are based on the rated Voltage and hookup
required for your application. (Custom forms and configurations are also available
from EIG.)
11.1: Considerations When Installing Meters
Installation of the Nexus® 1262/1272 meter must be performed only by
qualified personnel who follow standard safety precautions during all
procedures. Those personnel should have appropriate training and
experience with high voltage devices. Appropriate safety gloves, safety
glasses and protective clothing are recommended.
During normal operation of the Nexus® meter, dangerous voltages flow through
many parts of the unit, including: Terminals and any connected CTs (Current Transformers) and PTs (Potential Transformers), all I/O Modules and their circuits. All
Primary and Secondary circuits can, at times, produce lethal voltages and
currents. Avoid contact with any current-carrying surfaces.
Do not use the meter or any I/O device for primary protection or in an
energy-limiting capacity. The meter can only be used as secondary protection.
Do not use the meter for applications where failure of the meter may cause harm or
death.
Do not use the meter for any application where there may be a risk of fire.
All meter terminals should be inaccessible after installation.
Do not apply more than the maximum voltage the meter or any attached device can
withstand. Refer to meter and/or device labels and to the Specifications for all devices
before applying voltages. Do not HIPOT/Dielectric test any Outputs, Inputs or Communications terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-1
11: Electrical Installation
EIG requires the use of Fuses for voltage leads and power supply, and shorting blocks
to prevent hazardous voltage conditions or damage to CTs, if the meter needs to be
removed from service. One side of the CT must be grounded.
NOTE: The current inputs are only to be connected to external current transformers
provided by the installer. The CTs shall be Approved or Certified and rated for the
current of the meter used.
NOTE: IF THE EQUIPMENT IS USED IN A MANNER NOT SPECIFIED BY
THE MANUFACTURER, THE PROTECTION PROVIDED BY THE
EQUIPMENT MAY BE IMPAIRED.
NOTE: THERE IS NO REQUIRED PREVENTIVE MAINTENANCE OR
INSPECTION NECESSARY FOR SAFETY. HOWEVER, ANY REPAIR OR
MAINTENANCE SHOULD BE PERFORMED BY THE FACTORY.
DISCONNECT DEVICE: The following part is considered the
equipment disconnect device.
A SWITCH OR CIRCUIT-BREAKER SHALL BE INCLUDED IN THE END-USE EQUIPMENT
OR BUILDING INSTALLATION. THE SWITCH SHALL BE IN CLOSE PROXIMITY TO THE
EQUIPMENT AND WITHIN EASY REACH OF THE OPERATOR. THE SWITCH SHALL BE
MARKED AS THE DISCONNECTING DEVICE FOR THE EQUIPMENT.
L’installation des compteurs de Nexus 1262/1272 doit être effectuée
seulement par un personnel qualifié qui suit les normes relatives aux précautions de
sécurité pendant toute la procédure. Le personnel doit avoir la formation appropriée
et l'expérience avec les appareils de haute tension. Des gants de sécurité, des verres
et des vêtements de protection appropriés sont recommandés.
AVERTISSEMENT! Pendant le fonctionnement normal du compteur Nexus 1262/
1272 des tensions dangereuses suivant de nombreuses pièces, notamment, les
bornes et tous les transformateurs de courant branchés, les transformateurs de tension, toutes les sorties, les entrées et leurs circuits. Tous les circuits secondaires
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-2
11: Electrical Installation
et primaires peuvent parfois produire des tensions de létal et des courants.
Évitez le contact avec les surfaces sous tensions. Avant de faire un travail
dans le compteur, assurez-vous d'éteindre l'alimentation et de mettre tous
les circuits branchés hors tension.
Ne pas utiliser les compteurs ou sorties d'appareil pour une protection primaire ou capacité de limite d'énergie. Le compteur peut seulement être utilisé comme une protection secondaire.
Ne pas utiliser le compteur pour application dans laquelle une panne de compteur
peut causer la mort ou des blessures graves.
Ne pas utiliser le compteur ou pour toute application dans laquelle un risque
d'incendie est susceptible.
Toutes les bornes de compteur doivent être inaccessibles après l'installation.
Ne pas appliquer plus que la tension maximale que le compteur ou appareil relatif
peut résister. Référez-vous au compteur ou aux étiquettes de l'appareil et les spécifications de tous les appareils avant d'appliquer les tensions. Ne pas faire de test
HIPOT/diélectrique, une sortie, une entrée ou un terminal de réseau.
EIG nécessite l'utilisation de les fusibles pour les fils de tension et alimentations électriques, ainsi que des coupe-circuits pour prévenir les tensions dangereuses ou
endommagements de transformateur de courant si l'unité Nexus 1262/1272 doit être
enlevée du service. Un côté du transformateur de courant doit être mis à terre.
NOTE: Les entrées actuelles doivent seulement être branchées dans le transformateur externe actuel par l'installateur. Le transformateur de courant doit être approuvé
ou certifié et déterminé pour le compteur actuel utilisé.
IMPORTANT! SI L'ÉQUIPEMENT EST UTILISÉ D'UNE FAÇON NON
SPÉCIFIÉE PAR LE FABRICANT, LA PROTECTION FOURNIE PAR L'ÉQUIPEMENT PEUT
ÊTRE ENDOMMAGÉE.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-3
11: Electrical Installation
NOTE: Il N'Y A AUCUNE MAINTENANCE REQUISE POUR LA PRÉVENTION OU INSPECTION NÉCESSAIRE POUR LA SÉCURITÉ. CEPENDANT, TOUTE RÉPARATION OU MAINTENANCE DEVRAIT ÊTRE RÉALISÉE PAR LE FABRICANT.
DÉBRANCHEMENT DE L'APPAREIL : la partie suivante est considérée
l'appareil de débranchement de l'équipement. UN INTERRUPTEUR OU UN DISJONCTEUR DEVRAIT ÊTRE INCLUS DANS L'UTILISATION FINALE DE L'ÉQUIPEMENT
OU L'INSTALLATION. L'INTERRUPTEUR DOIT ÊTRE DANS UNE PROXIMITÉ PROCHE DE
L'ÉQUIPEMENT ET A LA PORTÉE DE L'OPÉRATEUR. L'INTERRUPTEUR DOIT AVOIR LA
MENTION DÉBRANCHEMENT DE L'APPAREIL POUR L'ÉQUIPEMENT.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-4
11: Electrical Installation
11.2: Blade Configuration for Forms 9S, 36S, and 45S
Detailed drawings of the Blade configurations are shown below and on the next page.
There are two configurations because the 9S and the 36S are the same.
NOTE: The forms referred to in this chapter comply with ANSI forms 9S, 36S and
45S.
Figure 11.1: Form 9S & 36S Base with Knock Out Holes
Figure 11.2: Form 45S Base with Knock Out Holes
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-5
11: Electrical Installation
11.3: Wiring Diagrams
Choose from the supported meter forms based on the rated Voltage and hookup
required for your application. Corresponding wiring diagrams appear on the following
pages. If the connection diagram you need is not listed, contact EIG for a custom connection diagram. Form 9S mounted in an A/S Adapter is shown in Figure 11.19.
NOTE: Form 45S replaces Form 5S and may also be used in 4-wire circuits.
Form
9S
36S
45S
9S in S/A
Description
Figure#
Wye, no PTs, 3 CTs
11.3
Wye, 3 PTs, 3 CTs
11.4
4-Wire Delta, no PTs, 3 CTs
11.5
4-Wire Delta, 3 PTs, 3 CTs
11.6
4-Wire Delta, no PTs, 2 CTs
11.7
4-Wire Delta, 2 PTs, 2 CTs
11.8
3-Wire Delta, no PTs, 2 CTs
11.9
3-Wire Delta, 2 PTs, 2 CTs
11.10
2.5 EL Wye, no PTs, 3 CTs
11.11
2.5 EL Wye, 2 PTs, 3 CTs
11.12
Wye, no PTs, 3 CTs
11.13
Wye, 2 PTs, 3 CTs
11.14
3-wire Delta, no PTs, 2 CTs
11.15
3-wire Delta, 2 PTs, 2 CTs
11.16
4-wire Delta, no PTs, 2 CTs
11.17
4-wire Delta, 2 PTs, 2 CTs
11.18
Form 9S Mounted in S/A Adapter
(showing connectors)
11.19
Table 11.1: Nexus® 1262/1272 Meter Forms
REMARQUE pour Tous les schémas de câblage:
• Les connexions de garde pour les transformateurs sont omises dans les schémas et
ne sont pas nécessaires afin que le compteur fonctionne correctement. Toutefois,
nous vous recommandons fortement ces connexions pour réduire les risques de
choc.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-6
11: Electrical Installation
• Les commutateurs de court-circuit (blocs) pour le côté secondaire des transformateurs de courant ne sont également pas représentés. Pour éviter les chocs électriques, nous vous recommandons d'utiliser ces commutateurs de court-circuit
(blocs). Assurez-vous que les côtés secondaires des transformateurs de courant
sont court-circuités avant de les déconnecter des bornes d'entrée de courant du
compteur.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-7
11: Electrical Installation
FORM: 9S (TRANSFORMER RATED)
SERVICE: WYE, 4WIRE
NO PTs, 3 CTs
3
N
LINE
1
2
LOAD
Figure 11.3: Form 9S Wye, no PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-8
11: Electrical Installation
FORM: 9S (TRANSFORMER RATED)
SERVICE: WYE, 4WIRE
3 PTs, 3 CTs
3
N
LINE
1
2
LOAD
Figure 11.4: Form 9S Wye, 3 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-9
11: Electrical Installation
3
FORM: 9S (TRANSFORMER RATED)
SERVICE: DELTA, 4WIRE
NO PTs, 3 CTs
LINE
2
N
1
LOAD
Figure 11.5: Form 9S 4-Wire Delta, no PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-10
11: Electrical Installation
3
FORM: 9S (TRANSFORMER RATED)
SERVICE: DELTA, 4WIRE
3 PTs, 3 CTs
LINE
2
N
1
LOAD
Figure 11.6: Form 9S 4-Wire Delta, 3 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-11
11: Electrical Installation
FORM: 9S (TRANSFORMER RATED)
SERVICE: DELTA, 4WIRE
NO PTs, 2 CTs
3
LINE
2
N
1
LOAD
Figure 11.7: Form 9S 4-Wire Delta no PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-12
11: Electrical Installation
3
FORM: 9S (TRANSFORMER RATED)
SERVICE: DELTA, 4WIRE
2 PTs, 2 CTs
LINE
2
N
1
LOAD
Figure 11.8: Form 9S 4-Wire Delta, 2 PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-13
11: Electrical Installation
FORM: 9S (TRANSFORMER RATED)
SERVICE: DELTA, 3WIRE
NO PTs, 2 CTs
3
LINE
2
1
LOAD
Figure 11.9: Form 9S 3-Wire Delta, no PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-14
11: Electrical Installation
3
FORM: 9S (TRANSFORMER RATED)
SERVICE: DELTA, 3WIRE
2 PTs, 2 CTs
LINE
1
2
LOAD
Figure 11.10: Form 9S 3-Wire Delta, 2 PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-15
11: Electrical Installation
FORM: 36S (TRANSFORMER RATED)
SERVICE: WYE, 4WIRE
NO PTs, 3 CTs
3
N
LINE
1
2
LOAD
Figure 11.11: Form 36S 2.5 Element Wye, no PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-16
11: Electrical Installation
FORM: 36S (TRANSFORMER RATED)
SERVICE: WYE, 4WIRE
2 PTs, 3 CTs
3
N
LINE
1
2
LOAD
Figure 11.12: Form 36S 2.5 Element Wye, 2 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-17
11: Electrical Installation
FORM: 45S (TRANSFORMER RATED)
SERVICE: WYE, 4WIRE
NO PTs, 3 CTs
3
N
LINE
1
2
LOAD
Figure 11.13: Form 45S Wye, no PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-18
11: Electrical Installation
FORM: 45S (TRANSFORMER RATED)
SERVICE: WYE, 4WIRE
2 PTs, 3 CTs
3
N
LINE
1
2
LOAD
Figure 11.14: Form 45S Wye, 2 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-19
11: Electrical Installation
FORM: 45S (TRANSFORMER RATED)
SERVICE: DELTA, 3WIRE
NO PTs, 2 CTs
3
LINE
1
2
LOAD
Figure 11.15: Form 45S 3-Wire Delta, no PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-20
11: Electrical Installation
FORM: 45S (TRANSFORMER RATED)
SERVICE: DELTA, 3WIRE
2 PTs, 2 CTs
3
LINE
1
2
LOAD
Figure 11.16: Form 45S 3-Wire Delta, 2 PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-21
11: Electrical Installation
FORM: 45S (TRANSFORMER RATED)
SERVICE: DELTA, 4WIRE
NO PTs, 2 CTs
3
LINE
2
N
1
LOAD
Figure 11.17: Form 45S 4-Wire Delta, no PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-22
11: Electrical Installation
FORM: 45S (TRANSFORMER RATED)
SERVICE: DELTA, 4WIRE
2 PTs, 2 CTs
3
LINE
2
N
1
LOAD
Figure 11.18: Form 45S 4-Wire Delta, 2 PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-23
11: Electrical Installation
11.3: 9S Meter Mounted in S/A Adapter
Any of the 9S Forms can be mounted in an S/A Adapter, such as the one shown below.
The socket meter is “pushed” into the S/A Adapter until the meter “snaps” into place.
The blades on the back of the socket meter make the proper connection. See Figures
11.1 to 11.8 for the 9S wiring diagrams.
Figure 11.19: Form 9S mounted in an S/A Adapter (front removed)
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
11-24
12: Switchboard Meter
12: Switchboard Meter
12.1: Introduction
9.25" (235 mm)
6.85" (174 mm)
Figure 12.1: Switchboard Meter Dimensions, Front
This chapter gives you a brief overview of the Nexus® 1262/1272 Switchboard
option. The Switchboard meter gives you all the features of the Socket meter in a
compact case. Easy installation or disconnection is the primary benefit of choosing
this option. The Switchboard system lets you install or “rack out” the meter in two
easy steps. Minimal manual wiring is required to connect or disconnect the meter.
The Switchboard meter comes in an S1 form relay case, but it has an optional retrofit
panel that converts the meter to fit in an M1 form panel cutout. See Section 12.6 for
details.
The Switchboard meter operates in the same way as the Socket meter.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-1
12: Switchboard Meter
There are a few differences between the two meter options:
• The labels on the face and the shroud of the meter will be slightly different,
depending on options selected (see Section 12.2 for label detail)
• The wiring Forms are 9Z and 36Z and the wiring is different (see Section 12.5)
• Dimensions are different (see Section 12.3)
• Installation is different (and even easier!) (see Section 12.4)
CAUTION! The Power Supply Input on the Switchboard unit is configured
differently. Please check wiring carefully.
ATTENTION! L'entrée d'alimentation de l'unité du tableau est configurée différemment. Veuillez vérifier le câblage avec soin.
12.2: Labels
The labels on the Switchboard meter are similar to those on the Socket meter. Forms
are 9Z and 36Z and there may be some additional items, depending upon the options
selected. See Chapter 3 for a description of the components on the front and shroud
labels.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-2
12: Switchboard Meter
Figure 12.2: Switchboard Meter, Front View
Mfg. Date:
2/2/2011
Serial#:
40/83003
Model: NEXUS 1262S-SWB-20-60HZ-4IPO-INP2
Memory:
4 Meg:
Options:
Freq.:
50Hz
KYZ Out: NO
Opt. Comm:
Power Supply:
NONE
No Optional Com
56-82.8V AC
Notes:
Figure 12.3: Sample of Switchboard Options Label
12.3: Specifications and Dimensions
The Switchboard meter specifications are the same as those of the Socket meter,
except for meter dimensions. The Switchboard meter is essentially the Socket meter
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-3
12: Switchboard Meter
in an oblong case. The dimensions are given in figures 12.1 (Front View), 12.4 (Back
View) and 12.5 (Side View). See Chapter 2 for meter specifications.
6.13" (15.57cm)
2.31"
(5.86 cm)
Y K Z
CH1
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
|
L N PE
Power In
Network Phone Line
Vc
Ia - Hi
Ib - Hi
+
+
+
9.0" (22.86cm)
(-) (+)
| SCOM1
|
K Z
K Z
| Y CH3
| Y CH4
8.5" (21.59cm)
4.38" (11.12cm)
(-) (+)
IRIG-B
K Z
| Y CH2
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
0.19" (.48cm)
0.50" (1.27cm)
5.60" (14.22cm)
6.58" (16.71cm)
Figure 12.4: Switchboard Meter Dimensions, Back
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-4
12: Switchboard Meter
6.25" (15.88cm)
8.5" (21.6 cm)
2.0"
5.08cm
7.0" (17.78cm)
9.0" (22.86cm)
Figure 12.5: Switchboard Meter Dimensions, Side
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-5
12: Switchboard Meter
0.188”
(0.477cm)
6.125”
(15.557cm)
5.750”
(14.605cm)
+.010”/.025cm/ - .001”/.0025cm
R0.10 TYP
2.296” (5.831cm)
4X 0.250”
(0.635cm)
8.625” (21.907cm)
4.375” (11.112cm)
Figure 12.6: Switchboard Meter Cutout
IMPORTANT! Check drill holes for the mounting screw you are using, to insure that
the mounting screw fits the box tightly enough to hold the box in place. You can use a
washer for a slightly smaller mounting screw.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-6
12: Switchboard Meter
12.4: Installation
The Switchboard meter provides easy installation and removal from installation.
IMPORTANT! Before installing the meter, check the battery connections (see
Sections 6.2 and 5.4.4).
1. Insert the case into a prepared mounting hole. Secure with mounting screws.
2. Slide the meter into the case and secure it by sliding the chassis levers until they
snap into place. Connectors for the following are located on the back of the meter.
The connectors automatically plug into the available connectors on the mounting
board (see Figure 12.8).
• Pulse Outputs - Four Channels
• Status Inputs
• Phone
• Line/Network
• Power In
• COM4, COM1
• IRIG-B
• Modem Gateway RS485
3. Position the Switchboard case front against the four screw holes and secure it by
turning the four built-in screws in each of the corners. See Figure 12.7.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-7
12: Switchboard Meter
Built-in
Screws
Figure 12.7: Switchboard Case Front Showing 4 Screw Holes
Figure 12.8: Switchboard Meter Back Showing Connectors
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-8
12: Switchboard Meter
12.5: Wiring Diagrams
The wiring of the Switchboard meter is similar to that of the Socket meter.
Table 1:
Form
9Z
36Z
Description
Figure#
Wye, no PTs, 3 CTs
12.9
Wye, 3 PTs, 3 CTs
12.10
4-Wire Delta, no PTs, 3 CTs
12.11
4-Wire Delta, 3 PTs, 3 CTs
12.12
3-Wire Delta, no PTs, 2 CTs
12.13
3-Wire Delta, 2 PTs, 2 CTs
12.14
3-Wire Delta, no PTs, 2 CTs
12.15
3-Wire Delta, 2 PTs, 2 CTs
12.16
3-Wire Delta, 2 PTs, 3 CTs
12.19
3-Wire Delta, no PTs, 3 CTs
12.20
2.5 EL Wye, no PTs, 3 CTs
12.17
2.5 EL Wye, 2 PTs, 3 CTs
12.18
Table 12.1: Switchboard Meter Configurations
The meter snaps into place and is secured with levers and screws. All input and
output connections are made automatically as the meter is installed. (Refer to Section
12.4 and Figure 12.8.)
Wiring options are shown in Figures 12.9 through 12.20.
NOTE: For special requirements, contact our service department.
CAUTION! All wiring should be done by a licensed professional. Actual installation
procedures, materials, equipment and connections must conform to applicable codes
and standards. See Section 11.1 for important safety considerations.
ATTENTION! Tout travail de câblage doit être effectué par un professionnel agréé.
Les procédures, matériaux, équipements et connexions d'installation actuels doivent
être conformes aux codes et aux normes applicables. Pour voir d'importantes exigences de sécurité, vous référer à Section 11.1.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-9
12: Switchboard Meter
REMARQUE pour Tous les schémas de câblage:
• Les connexions de garde pour les transformateurs sont omises dans les schémas et
ne sont pas nécessaires afin que le compteur fonctionne correctement. Toutefois,
nous vous recommandons fortement ces connexions pour réduire les risques de
choc.
• Les commutateurs de court-circuit (blocs) pour le côté secondaire des transformateurs de courant ne sont également pas représentés. Pour éviter les chocs électriques, nous vous recommandons d'utiliser ces commutateurs de court-circuit
(blocs). Assurez-vous que les côtés secondaires des transformateurs de courant
sont court-circuités avant de les déconnecter des bornes d'entrée de courant du
compteur.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-10
12: Switchboard Meter
SERVICE: WYE, 4WIRE
NO PTs, 3 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
N
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
1
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
LOAD
Figure 12.9: 9Z Transformer Rated Wye, no PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-11
12: Switchboard Meter
SERVICE: WYE, 4WIRE
3 PTs, 3 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
N
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
1
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
LOAD
Figure 12.10: 9Z Transformer Rated Wye, 3 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-12
12: Switchboard Meter
SERVICE: DELTA, 4WIRE
NO PTs, 3 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
N
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
1
LINE
LOAD
Figure 12.11: 9Z Transformer Rated 4-Wire Delta, no PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-13
12: Switchboard Meter
SERVICE: DELTA, 4WIRE
3 PTs, 3 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
N
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
1
LINE
LOAD
Figure 12.12: 9Z Transformer Rated 4-Wire Delta, 3 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-14
12: Switchboard Meter
SERVICE: DELTA, 4WIRE
NO PTs, 2 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
N
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
1
LINE
LOAD
Figure 12.13: 9Z Transformer Rated 3-Wire Delta, no PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-15
12: Switchboard Meter
SERVICE: DELTA, 4WIRE
2 PTs, 2 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
N
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
1
LINE
LOAD
Figure 12.14: 9Z Transformer Rated 3-Wire Delta, 2 PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-16
12: Switchboard Meter
SERVICE: DELTA, 3WIRE
NO PTs, 2 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
Network Phone Line
1
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
LOAD
Figure 12.15: 9Z Transformer Rated 3-Wire Delta, no PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-17
12: Switchboard Meter
SERVICE: DELTA, 3WIRE
2 PTs, 2 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
Network Phone Line
1
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
LOAD
Figure 12.16: 9Z Transformer Rated 3-Wire Delta, 2 PTs, 2 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-18
12: Switchboard Meter
SERVICE: 2.5 EL WYE,
NO PTs, 3 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
N
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
1
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
LOAD
Figure 12.17: 36Z 2.5 Element Wye, no PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-19
12: Switchboard Meter
SERVICE: 2.5 EL WYE
2 PTs, 3 CTs
3
Y K Z
CH1
(-) (+)
IRIG-B
K Z
| Y CH2
(-) (+)
| SCOM1
|
K Z
K Z
| Y CH3
| Y CH4
S (-) (+)
COM4
|
|
S (1) (+)
Gateway
N
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
1
Network Phone Line
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
N
3
2
1
I3
I2
I1
V1
V3
N
LOAD
Figure 12.18: 36Z 2.5 Element Wye, 2 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-20
12: Switchboard Meter
SERVICE: DELTA, 3WIRE
2 PTs, 3 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
Network Phone Line
1
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
!
1!
1
1
8
8!
8
LOAD
Figure 12.19: Delta, 3-Wire, 2 PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-21
12: Switchboard Meter
SERVICE: DELTA, 3WIRE
NO PTs, 3 CTs
3
Y K Z
CH1
K Z Y K Z Y K Z
| Y CH2
| CH3 | CH4 |
(-) (+) S (-) (+)
|
IRIG-B COM1
|
S (-) (+)
COM4
|
S (1) (+)
Gateway
8 7 6 5 4 3 2 1 C
HIGH SPEED
L N PE
Power In
Network Phone Line
1
2
Vc
Ia - Hi
+
Ib - Hi
+
+
Caution: Power Supply Input
on new units is configured
differently.
Please check wiring carefully.
Va
Ic - Hi
+
+
Vn
Lo
Lo
Lo
Vb
+
+
+
+
+
LINE
!
1!
1
1
8
8
8!
LOAD
Figure 12.20: Delta, 3-wire, No PTs, 3 CTs
• The protective ground connections for the transformers are omitted in the diagrams and are not required
for the meter to work properly. However, we strongly recommend those connections to reduce shock
hazard.
• Shorting switches (blocks) for the current transformers’ secondary side are also not shown. To prevent
electrical shock we recommended you use such shorting switches (blocks). Make sure the CTs’ secondary are shorted before disconnecting them from the meter’s current input terminals.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-22
12: Switchboard Meter
12.6: E137370 Retrofit Panel - S1 to M1 Case Retrofit
The E137370 M1 retrofit panel will convert any S1 (GE) relay case meter (or relay) to
fit in the dimensions of a large case M1 format. Using this conversion panel, a user
can mount a Nexus® 1262/1272 S1 form switchboard meter to fill the cutout of an
existing M1 case.
The E137370 can be ordered as an accessory option.
To use the panel:
1. Attach the switchboard meter to the retrofit panel, using the built-in switchboard
screws (see Figure 12.7).
2. Place the switchboard meter with retrofit panel into the space for the M1 case and
attach the retrofit panel using screws in all four corner holes.
1262/1272 Switchboard Meter
Retrofit Panel
Panel with M1 Cutout
Figure 12.21: Attaching the Panel and Inserting the Meter
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-23
12: Switchboard Meter
7.25
6.125
5.563
.844
.188
.375
4X Ø.250
3.767
R.10 TYP
2.296
4X Ø.250
82° x Ø .375
5.750+.010
-.001
.750
8.625
15.750
16.50
4.375
.0935
Side Dimensions
Front Dimensions
(in inches)
12. 22: E137370 Retrofit Panel Dimensions
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
Doc#
E151701
12-24
0HWHU&DOFXODWLRQV
13: Meter Calculations
13.1: Measurements and Calculations
7KH1H[XVŠ0HWHUPHDVXUHVPDQ\GLIIHUHQWSRZHUSDUDPHWHUV)ROORZLQJ
LVDOLVWRIWKHIRUPXODVXVHGWRSHUIRUPFDOFXODWLRQVZLWKVDPSOHVIRU:\HDQG'HOWD
VHUYLFHV
6DPSOHVIRU:\HYDYEYFLDLELFLQ
6DPSOHVIRU'HOWDYDEYEFYFDLDLELF
5RRW0HDQ6TXDUH506RI3KDVH9ROWDJHV1 QXPEHURIVDPSOHV
)RU:\H[ DEF
N
¦v
VRMS x
2
x (t )
t 1
N
5RRW0HDQ6TXDUH506RI/LQH&XUUHQWV1 QXPEHURIVDPSOHV
)RU:\H[ DEFQ
)RU'HOWD[ DEF
N
¦i
I RMS x
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
2
x (t )
t 1
N
'RF#
(
0HWHU&DOFXODWLRQV
5RRW0HDQ6TXDUH506RI/LQH9ROWDJHV1 QXPEHURIVDPSOHV
)RU:\H[\ DERUEFRUFD
N
¦ (v
x( t )
v y( t ) ) 2
t 1
VRMS xy
N
)RU'HOWD[\ DEEFFD
N
¦v
2
xy ( t )
t 1
VRMS xy
N
3RZHU:DWWVSHUSKDVH1 QXPEHURIVDPSOHV
)RU:\H[ DEF
N
¦v
WX
x (t )
x ix ( t )
t 1
N
$SSDUHQW3RZHU9$SHUSKDVH
)RU:\H[ DEF
VAx
Electro Industries/GaugeTech
Electro Industries/GaugeTech
VRMS X x I RMS X
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
0HWHU&DOFXODWLRQV
5HDFWLYH3RZHU9$5SHUSKDVH
)RU:\H[ DEF
VAx2 W x2
VAR x
4SHU3KDVH
)RU:\H[ DEF
Q
3VAR X W
X
2
X
$FWLYH3RZHU:DWWV7RWDO1 QXPEHURIVDPSOHV
)RU:\H
Wa Wb Wc
WT
)RU'HOWD
N
¦ v
ab ( t )
WT
x ia (t ) vbc (t ) x ic ( t ) t 1
N
5HDFWLYH3RZHU9$57RWDO1 QXPEHURIVDPSOHV
)RU:\H
VART
Electro Industries/GaugeTech
Electro Industries/GaugeTech
VARa VARb VARc
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
0HWHU&DOFXODWLRQV
)RU'HOWD
VART = (VRMSab
⎤
⎡ N
vab (t ) • ia (t ) ⎥
∑
⎢
2
⎥
• I RMSa ) − ⎢ t =1
N
⎥
⎢
⎥⎦
⎢⎣
2
+
(VRMSbc
⎤
⎡ N
vbc (t ) • ic (t ) ⎥
∑
⎢
2
⎥
• I RMSc ) − ⎢ t =1
N
⎥
⎢
⎥⎦
⎢⎣
2
$SSDUHQW3RZHU9$7RWDO
)RU:\H
VAT
VAa VAb VAc
)RU'HOWD
VAT
WT2 VART2
QT
Qa Qb Qc
7RWDO4
)RU:\H
)RU'HOWD
QT
Electro Industries/GaugeTech
Electro Industries/GaugeTech
3VART WT
2
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
0HWHU&DOFXODWLRQV
7RWDO(QHUJLHV
[\ :7:K7RU9$579$5K7RU9$79$K7RU474K7
¦x
y
3600sec.
3RZHU)DFWRU3)
)RU:\H[ DEF7
)RU'HOWD[ 7
P Fx
Wx
V Ax
7RWDO$YHUDJH3RZHU)DFWRU
[ 4XDGUDQWVSRVLWLYH:K4XDGUDQWVQHJDWLYH:K
PFT _ Avg x
Whx
VAhx
3KDVH$QJOHV
[ DEF
‘x cos1 PFx Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
0HWHU&DOFXODWLRQV
7RWDO+DUPRQLF'LVWRUWLRQ7+'
)RU:\H[ YDYEYFLDLELF
)RU'HOWD[ LDLELFYDEYEFYFD
¦ RMS 127
2
xh
h 2
THD
RMS x1
.)DFWRU
[ LDLELF
127
¦ h x RMS
xh
¦ RMS
h 1
127
KFactor
2
2
xh
h 1
9ROWDJH,PEDODQFH1 QXPEHURIVDPSOHV
¦ v
a
vb vc N
N
RMSva RMSvb RMSvc
Imb v
&XUUHQW,PEDODQFH
Imb
Electro Industries/GaugeTech
Electro Industries/GaugeTech
RMS
I
RMS
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
IA
I CalcN
RMS I RMS I
B
'RF#
C
(
0HWHU&DOFXODWLRQV
13.2: Demand Integrators
3RZHUXWLOLWLHVWDNHLQWRDFFRXQWERWKHQHUJ\FRQVXPSWLRQDQGSHDNGHPDQGZKHQ
ELOOLQJFXVWRPHUV3HDNGHPDQGH[SUHVVHGLQNLORZDWWVN:LVWKHKLJKHVWOHYHORI
GHPDQGUHFRUGHGGXULQJDVHWSHULRGRIWLPHFDOOHGWKHLQWHUYDO7KH1H[XVŠ
VXSSRUWVWKHIROORZLQJPRVWSRSXODUFRQYHQWLRQVIRUDYHUDJLQJGHPDQGDQG
SHDNGHPDQG%ORFN:LQGRZ'HPDQG5ROOLQJ:LQGRZ'HPDQG7KHUPDO'HPDQG
DQG3UHGLFWLYH:LQGRZ'HPDQG<RXFDQSURJUDPDQGDFFHVVDOOFRQYHQWLRQV
FRQFXUUHQWO\ZLWKWKH&RPPXQLFDWRU(;7VRIWZDUHVHHWKHCommunicator EXT User
Manual
Block (Fixed) Window Demand:
7KLVFRQYHQWLRQUHFRUGVWKHDYHUDJHDULWKPHWLFPHDQGHPDQGIRUFRQVHFXWLYHWLPH
LQWHUYDOVXVXDOO\PLQXWHV
([DPSOH$W\SLFDOVHWWLQJRIPLQXWHVSURGXFHVDQDYHUDJHYDOXHHYHU\PLQXWHV
DWHWFIRUSRZHUUHDGLQJRYHUWKHSUHYLRXVILIWHHQPLQXWH
LQWHUYDOHWF
Rolling (Sliding) Window Demand:
5ROOLQJ:LQGRZ'HPDQGIXQFWLRQVOLNHPXOWLSOHRYHUODSSLQJ%ORFN:LQGRZ'HPDQGV
7KHSURJUDPPDEOHVHWWLQJVSURYLGHGDUHWKHQXPEHUDQGOHQJWKRIGHPDQGVXELQWHU
YDOV$WHYHU\VXELQWHUYDODQDYHUDJHDULWKPHWLFPHDQRISRZHUUHDGLQJVRYHUWKH
VXELQWHUYDOLVLQWHUQDOO\FDOFXODWHG7KLVQHZVXELQWHUYDODYHUDJHLVWKHQDYHUDJHG
DULWKPHWLFPHDQZLWKDVPDQ\SUHYLRXVVXELQWHUYDODYHUDJHVDVSURJUDPPHGWR
SURGXFHWKH5ROOLQJ:LQGRZ'HPDQG
([DPSOH:LWKVHWWLQJVRIILYHPLQXWHVXELQWHUYDOVVXELQWHUYDODYHUDJHVDUHFRP
SXWHGHYHU\PLQXWHVHWFIRUSRZHUUHDGLQJVRYHUWKHSUHYL
RXVILYHPLQXWHLQWHUYDO
HWF)XUWKHUHYHU\PLQXWHVWKHVXELQWHUYDODYHUDJHVDUHDYHUDJHGLQJURXSVRI
HWFWRSURGXFHDILIWHHQ[PLQXWHDYHUDJHHYHU\
PLQXWHVUROOLQJVOLGLQJHYHU\PLQXWHVHWF
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
0HWHU&DOFXODWLRQV
Thermal Demand:
7UDGLWLRQDODQDORJ:DWWKRXU:KPHWHUVXVHKHDWVHQVLWLYHHOHPHQWVWRPHDVXUH
WHPSHUDWXUHULVHVSURGXFHGE\DQLQFUHDVHLQFXUUHQWIORZLQJWKURXJKWKHPHWHU$
SRLQWHUPRYHVLQSURSRUWLRQWRWKHWHPSHUDWXUHFKDQJHSURYLGLQJDUHFRUGRI
GHPDQG7KHSRLQWHUUHPDLQVDWSHDNOHYHOXQWLODVXEVHTXHQWLQFUHDVHLQGHPDQG
PRYHVLWDJDLQRUXQWLOLWLVPDQXDOO\UHVHW7KH1H[XVŠPLPLFVWUDGL
WLRQDOPHWHUVWRSURYLGH7KHUPDO'HPDQGUHDGLQJV
(DFKVHFRQGDVDQHZSRZHUOHYHOLVFRPSXWHGDUHFXUUHQFHUHODWLRQIRUPXODLV
DSSOLHG7KLVIRUPXODUHFRPSXWHVWKHWKHUPDOGHPDQGE\DYHUDJLQJDVPDOOSRUWLRQRI
WKHQHZSRZHUYDOXHZLWKDODUJHSRUWLRQRIWKHSUHYLRXVWKHUPDOGHPDQGYDOXH7KH
SURSRUWLRQLQJRIQHZWRSUHYLRXVLVSURJUDPPDEOHVHWE\DQDYHUDJLQJLQWHUYDO7KH
DYHUDJLQJLQWHUYDOUHSUHVHQWVDFKDQJHLQWKHUPDOGHPDQGWRDVWHSFKDQJHLQ
SRZHU
Predictive Window Demand:
3UHGLFWLYH:LQGRZ'HPDQGHQDEOHVWKHXVHUWRIRUHFDVWDYHUDJHGHPDQGIRUIXWXUH
WLPHLQWHUYDOV7KH1H[XVŠXVHVWKHGHOWDUDWHRIFKDQJHRID5ROOLQJ:LQGRZ
'HPDQGLQWHUYDOWRSUHGLFWDYHUDJHGHPDQGIRUDQDSSURDFKLQJWLPHSHULRG7KHXVHU
FDQVHWDUHOD\RUDODUPWRVLJQDOZKHQWKH3UHGLFWLYH:LQGRZUHDFKHVDVSHFLILFOHYHO
WKHUHE\DYRLGLQJXQDFFHSWDEOHGHPDQGOHYHOV7KH1H[XVŠFDOFXODWHV
3UHGLFWLYH:LQGRZ'HPDQGXVLQJWKHIROORZLQJIRUPXOD
([DPSOH8VLQJWKHSUHYLRXVVHWWLQJVRIILYHPLQXWHLQWHUYDOVDQGDQHZVHWWLQJRI
SUHGLFWLRQIDFWRUWKHZRUNLQJRIWKH3UHGLFWLYH:LQGRZ'HPDQGFRXOGEH
GHVFULEHGDVIROORZV
$WZHKDYHWKHDYHUDJHRIWKHVXELQWHUYDOVIURP
DQG,QILYHPLQXWHVZHZLOOKDYHDQDYHUDJHRIWKHVXELQWHU
YDOVDQGZKLFKZHNQRZDQGZKLFKZHGR
QRW\HWNQRZ$VDJXHVVZHZLOOXVHWKHODVWVXELQWHUYDODVDQ
DSSUR[LPDWLRQIRUWKHQH[WVXELQWHUYDO$VDIXUWKHUUHILQHPHQWZH
ZLOODVVXPHWKDWWKHQH[WVXELQWHUYDOPLJKWKDYHDKLJKHUDYHUDJHWKDQWKH
ODVWVXELQWHUYDO$VZHSURJUHVVLQWRWKHVXELQWHUYDOIRUH[DPSOHXSWRWKH
3UHGLFWLYH:LQGRZ'HPDQGZLOOEHWKHDYHUDJHRIWKHILUVWWZRVXELQWHUYDOV
WKHDFWXDOYDOXHVRIWKHFXUUHQWVXELQWHUYDODQG
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
0HWHU&DOFXODWLRQV
WKHSUHGLFWLRQIRUWKHUHPDLQGHURIWKHVXELQWHUYDORIWKHRIWKH
VXELQWHUYDO
RI6XELQWHUYDOV Q
6XELQWHUYDO/HQJWK /HQ
3DUWLDO6XELQWHUYDO/HQJWK &QW
3UHGLFWLRQ)DFWRU 3FW
Table 1:
6XEQ
6XE
6XE
3DUWLDO
3UHGLFW
/HQ
/HQ
/HQ
&QW
/HQ
Len 1
¦Value
i
Sub
i 0
Len
Cnt 1
¦Value
i
Partial
i 0
Cnt
n2
º
ª
Valuei »
¦
«
ª ª ª Len Cnt º
ºº
» u «1 « «
« Partial i 0
u Pct » »
»
n
» ¬ ¬ ¬ Len ¼
«
¼¼
»¼
«¬
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
0HWHU&DOFXODWLRQV
º
ª n2
« ¦ Subi Sub Sub » ª ª Len Cnt º
º
0
n 1
» u ««
u Pct »
«i 0
»
2 x(n 1) » ¬ ¬ Len ¼
« n 1
¼
»¼
«¬
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
14: EN50160/IEC61000-4-15 Flicker
14.1: Overview
)OLFNHULVWKHVHQVDWLRQH[SHULHQFHGE\WKHKXPDQYLVXDOV\VWHPZKHQVXEMHFWHGWR
FKDQJHVLQWKHLOOXPLQDWLRQLQWHQVLW\RIOLJKWVRXUFHV7KHSULPDU\HIIHFWVRI)OLFNHUDUH
KHDGDFKHVDQGLUULWDELOLW\VRPHWLPHV)OLFNHUFDQWULJJHUHSLOHSWLFILWV
,(&DQGIRUPHU,(&GHVFULEHWKHPHWKRGVXVHGWRGHWHUPLQH)OLFNHU
VHYHULW\6LQFHWKLVSKHQRPHQRQLVVWULFWO\UHODWHGWRWKHVHQVLWLYLW\DQGUHDFWLRQRI
LQGLYLGXDOVLWFDQRQO\EHVWXGLHGRQDVWDWLVWLFDOEDVLVE\VHWWLQJXSVXLWDEOHH[SHUL
PHQWVDPRQJSHRSOH
14.2: Theory of Operation
)OLFNHUFDQEHFDXVHGE\YROWDJHYDULDWLRQVZKLFKLQWXUQDUHFDXVHGE\YDULDEOH
ORDGVVXFKDVDUFIXUQDFHVODVHUSULQWHUVDQGPLFURZDYHRYHQV,QRUGHUWRPRGHO
WKHH\HEUDLQFKDQJHZKLFKLVDFRPSOH[SK\VLRORJLFDOSURFHVVWKHVLJQDOIURPWKH
SRZHUQHWZRUNKDVWREHSURFHVVHGZKLOHFRQIRUPLQJZLWK)LJXUHVKRZQRQ
SDJH
‡%ORFNFRQVLVWVRIVFDOLQJFLUFXLWU\DQGDQDXWRPDWLFJDLQFRQWUROIXQFWLRQWKDWQRU
PDOL]HVLQSXW9ROWDJHVWR%ORFNVDQG)RUWKHVSHFLILHG+]RSHUDWLRQWKH
9ROWDJHVWDQGDUGLV9506
‡%ORFNUHFRYHUVWKH9ROWDJHIOXFWXDWLRQE\VTXDULQJWKHLQSXW9ROWDJHVFDOHGWRWKH
UHIHUHQFHOHYHO7KLVVLPXODWHVWKHEHKDYLRURIDODPS
‡%ORFNLVFRPSRVHGRIDFDVFDGHRIWZRILOWHUVDQGDPHDVXULQJUDQJHVHOHFWRU,Q
WKLVLPSOHPHQWDWLRQDORJFODVVLILHUFRYHUVWKHIXOOVFDOHLQXVHVRWKHJDLQVHOHFWLRQ
LVDXWRPDWLFDQGQRWVKRZQKHUH7KHILUVWILOWHUHOLPLQDWHVWKH'&FRPSRQHQWDQG
WKHGRXEOHPDLQVIUHTXHQF\FRPSRQHQWVRIWKHGHPRGXODWHGRXWSXW7KHFRQILJXUD
WLRQFRQVLVWVRID+]/RZ+LJK3DVVILOWHUDQGD3ROH%XWWHUZRUWK/RZ3DVV
ILOWHUORFDWHGDW+]7KHVHFRQGILOWHULVDZHLJKWLQJILOWHUWKDWVLPXODWHVWKH
UHVSRQVHRIWKHKXPDQYLVXDOV\VWHPWRVLQXVRLGDO9ROWDJHIOXFWXDWLRQVRIDFRLOHG
ILODPHQWJDVILOOHGODPS:97KHILOWHULPSOHPHQWDWLRQRIWKLVIXQFWLRQ
LVDVVSHFLILHGLQ,(&
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
‡%ORFNLVFRPSRVHGRIDVTXDULQJPXOWLSOLHUDQGD/RZ3DVVILOWHU7KH+XPDQ
)OLFNHU6HQVDWLRQYLDODPSH\HDQGEUDLQLVVLPXODWHGE\WKHFRPELQHGQRQOLQHDU
UHVSRQVHRI%ORFNVDQG
‡%ORFNSHUIRUPVDQRQOLQHVWDWLVWLFDOFXPXODWLYHSUREDELOLW\DQDO\VLVRIWKHIOLFNHU
OHYHO%ORFNDOORZVGLUHFWFDOFXODWLRQRIWKHHYDOXDWLRQSDUDPHWHUV3VWDQG3OW
)OLFNHULVFRPSXWHGXVLQJWKHWKUHHSKDVHWRQHXWUDO9ROWDJHVLQ:\HFRQILJXUDWLRQV
DQGWKHWKUHHSKDVHWRSKDVH9ROWDJHVZKHQLQ'HOWD(YDOXDWLRQRFFXUVLQWKHIROORZ
LQJIRUPV,QVWDQWDQHRXV6KRUW7HUPRU/RQJ7HUP
‡,QVWDQWDQHRXV)OLFNHU(YDOXDWLRQ$QRXWSXWRIIURP%ORFNFRUUHVSRQGVWR
WKH5HIHUHQFH+XPDQ)OLFNHU3HUFHSWLELOLW\7KUHVKROGIRURIWKHSRSXODWLRQ
7KLVYDOXHLVPHDVXUHGLQ3HUFHSWLELOLW\8QLWV38DQGLVODEHOHG3LQVW7KLVLVDUHDO
WLPHYDOXHDQGLWLVFRQWLQXRXVO\XSGDWHG
‡6KRUW7HUP)OLFNHU(YDOXDWLRQ$QRXWSXWRIIURP%ORFNFRUUHVSRQGLQJWRWKH
3VWYDOXHFRUUHVSRQGVWRWKHFRQYHQWLRQDOWKUHVKROGRILUULWDELOLW\SHU,(&
,QRUGHUWRHYDOXDWHIOLFNHUVHYHULW\WZRSDUDPHWHUVKDYHEHHQGHILQHGRQHIRU
WKHVKRUWWHUPFDOOHG3VWGHILQHGLQWKLVVHFWLRQDQGRQHIRUWKHORQJWHUPFDOOHG
3OWGHILQHGLQWKHQH[WVHFWLRQ
7KHVWDQGDUGPHDVXUHPHQWWLPHIRU3VWLVPLQXWHV3VWLVGHULYHGIURPWKHWLPH
DWOHYHOVWDWLVWLFVREWDLQHGIURPWKHOHYHOFODVVLILHULQ%ORFNRIWKHIOLFNHUPHWHU
7KHIROORZLQJIRUPXODLVXVHG
Pst
0.0314 P0.1 0.0525 P1s 0.0657 P3 s 0.28 P10 s 0.08 P50 s
ZKHUHWKHSHUFHQWLOHV33333DUHWKHIOLFNHUOHYHOV
H[FHHGHGIRUDQGRIWKHWLPHGXULQJWKHREVHUYDWLRQSHULRG7KH
VXIIL[6LQWKHIRUPXODLQGLFDWHVWKDWWKHVPRRWKHGYDOXHVKRXOGEHXVHG7KH
VPRRWKHGYDOXHVDUHREWDLQHGXVLQJWKHIROORZLQJIRUPXODV
3V 333
3V 333
3V 33333
3V 333
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
7KHVHFRQGPHPRU\WLPHFRQVWDQWLQWKHIOLFNHUPHWHUHQVXUHVWKDW3FDQQRW
FKDQJHDEUXSWO\DQGQRVPRRWKLQJLVQHHGHGIRUWKLVSHUFHQWLOH
‡/RQJ7HUP)OLFNHU(YDOXDWLRQ7KHPLQXWHSHULRGRQZKLFKWKHVKRUWWHUPIOLFNHU
VHYHULW\LVEDVHGLVVXLWDEOHIRUVKRUWGXW\F\FOHGLVWXUEDQFHV)RUIOLFNHUVRXUFHV
ZLWKORQJDQGYDULDEOHGXW\F\FOHVHJDUFIXUQDFHVLWLVQHFHVVDU\WRSURYLGHFUL
WHULDIRUORQJWHUPDVVHVVPHQW)RUWKLVSXUSRVHWKHORQJWHUP3OWLVGHULYHGIURP
WKHVKRUWWHUPYDOXHVRYHUDQDSSURSULDWHSHULRG%\GHILQLWLRQWKLVLVVKRUW
WHUPYDOXHVRIPLQXWHVHDFKRYHUDSHULRGRIKRXUV7KHIROORZLQJIRUPXODLV
XVHG
N
Plt
3
¦P
3
sti
i 1
N
ZKHUH3VWLL DUHFRQVHFXWLYHUHDGLQJVRIWKHVKRUWWHUPVHYHULW\3VW
14.2.1: Summary:
Flicker &KDQJHVLQWKHLOOXPLQDWLRQRIOLJKWVRXUFHVGXHWRF\FOLFDO9ROWDJH
YDULDWLRQV
Pinst ,QVWDQWDQHRXVIOLFNHUYDOXHVLQ3HUFHSWLELOLW\8QLWV38
Pst 9DOXHEDVHGRQPLQXWHDQDO\VLV
Plt 9DOXHEDVHGRQ3VWYDOXHV
Measurement Procedure:
2ULJLQDO6LJQDOZLWKDPSOLWXGHYDULDWLRQV
6TXDUHGHPRGXODWRU
:HLJKWHGILOWHU
/RZSDVVILOWHUVWRUGHU
6WDWLVWLFDOFRPSXWLQJ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
Data available:
‡3VW3VW0D[3VW0LQYDOXHVIRUORQJWHUPUHFRUGLQJ
‡3OW3OW0D[3OW0LQYDOXHVIRUORQJWHUPUHFRUGLQJ
Simulation Of Eye Brain Response
Block 1
Block 2
Block 3
Voltage
Detector
and Gain
Control
Square
Law
Demodulator
Input
Voltage
Adaptor
High Pass
Filter
(DC
Removal)
Low
Pass Filter
(Carrier
Removal
Weighting
Filter
Block 4
Squaring
Multiplier
1st
Order
Sliding
Mean
Filter
Block 5
A/D
Converter
Sampling
Rate
>50Hz
Minimum
64 level
Classifier
Output
Interface
Programming of short and
long observation periods
Output Recording
Instantaneous Flicker in
Perceptibility Units
(Pinst)
Output and Data Display
Pst Max/Min Pst
Plt Max/Min Plt
)LJXUH6LPXODWLRQRI(\H%UDLQ5HVSRQVH
14.3: Flicker Setup
<RXPXVWVHWXSVHYHUDOSDUDPHWHUVWRSURSHUO\FRQILJXUH)OLFNHU
6HOHFWWKHProfileLFRQIURP&RPPXQLFDWRU(;7
V,FRQEDU
)URPWKH'HYLFH3URILOHVFUHHQGRXEOHFOLFNPower Quality and Alarm
Settings>EN50160/IEC61000-4-30 Flicker<RXZLOOVHHWKHVFUHHQVKRZQ
EHORZ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
‡6HOHFWWKH)UHTXHQF\RIRSHUDWLRQ+]LVWKHDSSURYHGIUHTXHQF\DFFRUGLQJ
WR)OLFNHUVWDQGDUGV$+]LPSOHPHQWDWLRQLVDYDLODEOHDQGFDQEHVHOHFWHG
5HPHPEHUWKH9ROWDJHLVQRUPDOL]HG)RU+]WKHQRUPDOL]HG9ROWDJHLV
9DQGIRU+]WKHQRUPDOL]HG9ROWDJHLV9
‡6HOHFWD6KRUW7HUP7HVW7LPH367WLPHUDQJHIURPWRPLQXWHV7KH
VWDQGDUGPHDVXUHPHQWSHULRGLVQRPLQDOO\PLQXWHV
‡6HOHFWD/RQJ7HUP7HVW7LPH3/7WLPHUDQJHIURPWRPLQXWHV7KH
VWDQGDUGPHDVXUHPHQWLVQRPLQDOO\3VWSHULRGVPLQXWHV3OWWLPH
PXVWDOZD\VEHHTXDOWRRUJUHDWWKDQDQGDPXOWLSOHRI3VWWLPH7KLVLV
UHIOHFWHGLQWKHDYDLODEOHVHOHFWLRQV
&OLFNOKZKHQ\RXDUHILQLVKHG
14.4: Flicker Polling Screen
)URPWKH&RPPXQLFDWRU(;77LWOHEDUVHOHFWReal-Time Poll>Power Quality and
Alarms>Flicker<RXZLOOVHHWKHVFUHHQVKRZQEHORZ
Main screen
7KLVVHFWLRQGHVFULEHVWKH0DLQ6FUHHQIXQFWLRQV7KHVHIXQFWLRQVDUHIRXQGRQWKH
OHIWVLGHRIWKHVFUHHQ
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
7LPH
‡6WDUW5HVHWLVWKHWLPHZKHQ)OLFNHUZDVVWDUWHGRUUHVHW$5HVHWRI)OLFNHUFDXVHV
WKH0D[0LQYDOXHVWREHFOHDUHGDQGUHVWDUWVWKH)OLFNHU3VWDQG3OWWLPHUV$6WDUW
RI)OLFNHULVDOVRHTXLYDOHQWWRD5HVHWLQWKDWWKH367DQG3/7DUHUHVWDUWHGDQGWKH
0D[0LQ9DOXHVDUHFOHDUHG
‡6WRSFRUUHVSRQGVWRWKHWLPHZKHQ)OLFNHULVWXUQHGRII
‡&XUUHQWLVWKHFXUUHQWFORFNWLPH
‡1H[W3VWLVWKHFRXQWGRZQWLPHWRZKHQWKHQH[W3VWYDOXHLVDYDLODEOH
‡1H[W3OWLVWKHFRXQWGRZQWLPHWRZKHQWKHQH[W3OWYDOXHLVDYDLODEOH
6WDWXV
‡,QGLFDWHVWKHFXUUHQWVWDWXV$FWLYH 2Q6WRSSHG 2II
)UHTXHQF\
‡%DVHLVWKHRSHUDWLQJIUHTXHQF\RU+]VHOHFWHGLQWKH(1)OLFNHU
VFUHHQVHH6HFWLRQ
‡&XUUHQWLVWKHUHDOWLPHIUHTXHQF\PHDVXUHPHQWRIWKHDSSOLHG9ROWDJH
%DVH9ROWDJH
‡7KHQRUPDOL]HG9ROWDJHIRUWKHVHOHFWHGIUHTXHQF\9IRU+]RU9IRU
+]
)OLFNHU0RQLWRULQJ
‡&OLFNLQJRQStopFDXVHV)OLFNHUWRVWRSEHLQJSURFHVVHGDQGIUHH]HVDOOWKHFXUUHQW
YDOXHV6WRS7LPHLVUHFRUGHGDQGWKHFXUUHQW0D[0LQYDOXHVDUHFOHDUHG
‡&OLFNLQJRQStart VWDUWV)OLFNHUSURFHVVLQJ6WDUW7LPHLVUHFRUGHG
‡&OLFNLQJRQReset FDXVHVWKH0D[0LQYDOXHVWREHFOHDUHGDQGUHVWDUWVWKH)OLFNHU
3VWDQG3OWWLPHUV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
8VHWKHWDEVDWWKHWRSRIWKHVFUHHQWRQDYLJDWHWRWKH,QVWDQWDQHRXV6KRUW7HUP
DQG/RQJ7HUP5HDGLQJVYLHZVVKRZQRQWKHULJKWVLGHRIWKHVFUHHQ
Instantaneous Readings:
NOTE:7KH,QVWDQWDQHRXVYLHZLVWKHGHIDXOWRIWKLVVFUHHQ6HHWKHVFUHHQSLFWXUHG
RQWKHSUHYLRXVSDJH,I\RXDUHLQWKH6KRUWRU/RQJ7HUPYLHZVFOLFNRQWKH,QVWDQ
WDQHRXVWDEWRGLVSOD\WKLVYLHZ
‡7KH38YDOXHV3LQVWIRU9ROWDJH,QSXWV9D9EDQG9FDUHGLVSOD\HGKHUHDQGDUH
FRQWLQXRXVO\XSGDWHG7KHFRUUHVSRQGLQJ&XUUHQW9ROWDJHYDOXHVIRUHDFKFKDQQHO
DUHGLVSOD\HGIRUUHIHUHQFH
Short Term Readings:
&OLFNRQWKH6KRUW7HUPWDEWRDFFHVVDVFUHHQFRQWDLQLQJWKUHHJURXSVRI3VWUHDGLQJV
VKRZQEHORZ
3VW5HDGLQJV'LVSOD\HG
‡&XUUHQW3VWYDOXHVIRU9D9EDQG9FDQGWKHWLPHRIFRPSXWDWLRQ
‡&XUUHQW3VW0D[YDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKH
ODVWUHVHW
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
‡&XUUHQW3VW0LQYDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKHODVW
UHVHW
Long Term Readings:
&OLFNRQWKH/RQJ7HUPWDEWRDFFHVVDVFUHHQFRQWDLQLQJWKUHHJURXSVRI3OW
UHDGLQJVVKRZQEHORZ
3OW5HDGLQJV'LVSOD\HG
‡&XUUHQW3OWYDOXHVIRU9D9EDQG9FDQGWKHWLPHRIFRPSXWDWLRQ
‡&XUUHQW3OW0D[YDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKHODVW
UHVHW
‡&XUUHQW3OW0LQYDOXHVIRU9D9EDQG9FVLQFHWKHODVWUHVHWDQGWKHWLPHRIWKHODVW
UHVHW
&OLFNOKWRH[LWWKH(1,(&)OLFNHU3ROOLQJVFUHHQFOLFNPrintWR
SULQWDOORIWKH5HDGLQJVYLHZV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
14.5: Logging
7KH1H[XVŠPHWHULVFDSDEOHRIORJJLQJ)OLFNHUYDOXHVLQDQLQGHSHQGHQW
ORJ:KHQ)OLFNHULVRQHQWULHVDUHPDGHLQWRWKHORJLQDFFRUGDQFHZLWKWKHWLPHV
WKDWDVVRFLDWHGYDOXHVRFFXU3VW3VW0D[3VW0LQ3OW3OW0D[3OW0LQ6WDUW5HVHW
DQG6WRSWLPHVDUHDOOUHFRUGHG$OOYDOXHVFDQEHGRZQORDGHGWRWKH/RJ9LHZHU
ZKHUHWKH\DUHDYDLODEOHIRUJUDSKLQJRUH[SRUWWRDQRWKHUSURJUDPVXFKDV([FHO$OO
)OLFNHUYDOXHVDUHSUHGHILQHGDQGFDQQRWEHFKDQJHG5HIHUWR&KDSWHURIWKH
Communicator EXT User ManualIRUDGGLWLRQDOLQVWUXFWLRQVFRQFHUQLQJWKH)OLFNHUORJ
14.6: Polling through a Communication Port
7KH3LQVW3VW3VW0D[3VW0LQ3OW3OW0D[3OW0LQYDOXHVFDQEHSROOHGWKURXJKWKH
&RPPXQLFDWLRQV3RUW5HIHUWRWKH1H[XVŠPHWHUV
0RGEXVDQG'13
0DSSLQJPDQXDOVIRUUHJLVWHUDVVLJQPHQWVDQGGDWDGHILQLWLRQV
14.7: Log Viewer
2SHQ/RJ9LHZHUE\VHOHFWLQJWKHOpen LogsLFRQIURP&RPPXQLFDWRU(;7
V,FRQ
EDU
8VLQJWKHPHQXVDWWKHWRSRIWKHVFUHHQVHOHFWDPHWHUWLPHUDQJHVDQGYDOXHVWR
DFFHVV
&OLFNWKHFlickerLFRQ
7KHYDOXHVDQGWKHDVVRFLDWHGWLPHVWDPSVZKHQWKHYDOXHVRFFXUUHGDUHGLVSOD\HG
LQDJULGER[8VHWKHEXWWRQVDWWKHERWWRPRIWKHVFUHHQWRFUHDWHDJUDSKRUH[SRUW
WKHGDWDWRDQRWKHUSURJUDP
‡*UDSKHGYDOXHVLQFOXGH3VWDQG3OW9D9EDQG9F
‡'LVSOD\HGYDOXHVLQFOXGH3VWDQG3OW0D[DQG0LQIRU9D9EDQG9F
NOTE0D[DQG0LQYDOXHVDUHRQO\GLVSOD\HGWKH\FDQQRWEHJUDSKHG+RZHYHU
0D[DQG0LQYDOXHVDUHDYDLODEOHIRUH[SRUW
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
(1,(&)OLFNHU
14.8: Performance Notes
3VWDQG3OWDYHUDJHWLPHDUHV\QFKURQL]HGWRWKHFORFNHJIRUDPLQXWHDYHUDJH
WKHWLPHVZLOORFFXUDWHWF7KHDFWXDOWLPHRIWKHILUVWDYHUDJHFDQEHOHVV
WKDQWKHVHOHFWHGSHULRGWRDOORZIRULQLWLDOFORFNV\QFKURQL]DWLRQ
,IWKHZURQJIUHTXHQF\LVFKRVHQHJ+]VHOHFWLRQIRUDV\VWHPRSHUDWLQJDW
+])OLFNHUZLOOVWLOORSHUDWHEXWWKHFRPSXWHGYDOXHVZLOOQRWEHYDOLG7KHUHIRUH
\RXVKRXOGVHOHFWWKHIUHTXHQF\VHWWLQJZLWKFDUH
8VHUVHWWLQJVDUHVWRUHG,I)OLFNHULVRQDQGSRZHULVUHPRYHGIURPWKHPHWHU)OLFNHU
ZLOOVWLOOEHRQZKHQSRZHUUHWXUQV7KLVFDQFDXVHJDSVLQWKHORJJHGGDWD
7KH0D[DQG0LQYDOXHVDUHVWRUHGDQGDUHQRWORVWLIWKHXQLWLVSRZHUHGGRZQ
)OLFNHUPHHWVWKHUHTXLUHPHQWVRI,(&DQGIRUPHU,(&5HIHUWRWKRVH
VSHFLILFDWLRQVIRUPRUHGHWDLOVLIQHHGHG0HWHUVZLWKWKH)OLFNHURSWLRQDOVRPHHWWKH
,(&FRQIRUPDQFHVWDQGDUGVIRU)OLFNHU5HIHUWRFKDSWHUVDQGLQWKH
Communicator EXT User ManualIRUDGGLWLRQDOLQIRUPDWLRQ
2SHUDWLRQLVDW9IRU+]DQG9IRU+]DVSHUVSHFLILFDWLRQ,IWKHLQSXW
9ROWDJHLVGLIIHUHQWWKHV\VWHPZLOOQRUPDOL]HLWWR9RU9IRUFRPSXWDWLRQDO
SXUSRVHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
$7/&6SUHDGVKHHWDQG([DPSOHV
A: Transformer Line Loss Compensation Spreadsheet and Examples
A.1: Calculating Values
7UDQVIRUPHU/RVV&RPSHQVDWLRQLVGLVFXVVHGLQ&KDSWHU9DOXHVIRUWKUHHHOHPHQW
LQVWDOODWLRQVFDQEHFDOFXODWHGLQWZRZD\V
Through an Excel Spreadsheet:
&OLFNWKHTLC CalculatorEXWWRQRQWKH7UDQVIRUPHU/RVVVFUHHQRIWKHPHWHU¶V
'HYLFH3URILOH7KH7/&&DOFXODWRUEXWWRQDFWLYDWHVDQ([FHO6SUHDGVKHHWEXW21/<
LI\RXKDYH06([FHOLQVWDOOHGRQ\RXUFRPSXWHU$FRS\RIWKH([FHO6SUHDGVKHHWLV
VKRZQRQWKHIROORZLQJSDJHVZLWKH[DPSOHQXPEHUV
(QWHUWKHUHTXLUHGGDWDLQWRWKH([FHO6SUHDGVKHHW7KH([FHOSURJUDPZLOOFDOFX
ODWHWKHYDOXHVQHHGHGIRUWKH7UDQVIRUPHU/RVVVFUHHQRIWKH'HYLFH3URILOH
(QWHUWKHYDOXHVLQWRWKH'HYLFH3URILOH
Manually:
8VHWKHZRUNVKHHWIRXQGLQ&KDSWHU³7KUHH(OHPHQW/RVV&RPSHQVDWLRQ:RUN
VKHHW´WRFDOFXODWHWKHYDOXHVE\KDQG5HIHUWRWKH1RWHVXQGHUHDFKVHFWLRQ
(QWHUYDOXHVEDVHGRQWKHWUDQVIRUPHUPDQXIDFWXUHU¶VWHVWUHSRUW7KHZRUNVKHHWLV
SURJUHVVLYHDQGQRWHVXQGHUHDFKVHFWLRQZLOOJXLGH\RXWRWKHQH[WVHFWLRQ
(QWHUWKHYDOXHVLQWRWKH'HYLFH3URILOH
A.2: Excel Spreadsheet with Example Numbers
,I\RXKDYH06([FHOLQVWDOOHGLQ\RXUFRPSXWHUXVHWKHTLC CalculatorEXWWRQRQ
WKH7UDQVIRUPHU/RVVVFUHHQRIWKH'HYLFH3URILOH5HIHUWRWKHVSUHDGVKHHWFRSLHV
ZLWKH[DPSOHQXPEHUVIRXQGRQWKHIROORZLQJSDJHV
IMPORTANT! Refer to Appendix B of the Communicator EXT User Manual for
additional instructions and information on the Transformer Line Loss
application.
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
$
$7/&6SUHDGVKHHWDQG([DPSOHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
$
$7/&6SUHDGVKHHWDQG([DPSOHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
$
$7/&6SUHDGVKHHWDQG([DPSOHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
$
$7/&6SUHDGVKHHWDQG([DPSOHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
$
$7/&6SUHDGVKHHWDQG([DPSOHV
7KLVSDJHLQWHQWLRQDOO\OHIWEODQN
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
$
%%ODGH&RQILJXUDWLRQIRU)RUPV666
B: Blade Configuration for Forms 9S, 36S and
45S
B.1: 1262/1272 Forms
)RXUVXSSRUWHGIRUPVIRUWKH1H[XVŠ6RFNHWPHWHUVZLWKWKHLUZLULQJ
FRQILJXUDWLRQVDUHVKRZQLQ&KDSWHU7KRVHIRUPVDUHEDVHGRQWKHUDWHG9ROWDJH
DQGKRRNXSUHTXLUHGIRU\RXUDSSOLFDWLRQ&XVWRPIRUPVDQGFRQILJXUDWLRQVDUHDOVR
DYDLODEOHIURP(,*
7KHWKUHHVXSSRUWHGIRUPVZLWKZLULQJFRQILJXUDWLRQVIRUWKH1H[XVŠ
6RFNHWPHWHUVDUHOLVWHGEHORZ
9S
‡:\HQR37VRU37V&7V
‡:LUH'HOWDQR37VRU37V&7V
‡(/:\HQR37VRU37V&7V
‡:LUH'HOWDQR37VRU37V&7V
‡:LUH'HOWDQR37VRU37V&7V
36S
‡(/:\HQR37VRU37V&7V
45S
‡:\HQR37VRU37V&7V
‡:LUH'HOWDQR37VRU37V&7V
‡:LUH'HOWDQR37VRU37V&7V
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
%
%%ODGH&RQILJXUDWLRQIRU)RUPV666
B.2: Blade Configuration Drawings
'HWDLOHGGUDZLQJVRIWKH%ODGHFRQILJXUDWLRQVDUHRIIHUHGEHORZ7KHUHDUHWZR
FRQILJXUDWLRQVEHFDXVHWKH6DQGWKH6DUHWKHVDPH7KHUHLVDGUDZLQJVKRZLQJ
WKHNQRFNRXWKROHVIRUHDFKFRQILJXUDWLRQ
NOTE:7KHIRUPVUHIHUUHGWRLQWKLVDSSHQGL[FRPSO\ZLWK$16,IRUPV66DQG
6
)LJXUH%)RUP66%DVHZLWK.QRFN2XW+ROHV
)LJXUH%)RUP6%DVHZLWK.QRFN2XW+ROHV
Electro Industries/GaugeTech
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions
The Leader In Power Monitoring and Smart Grid Solutions
'RF#
(
%
*ORVVDU\
Glossary
6HFRQG9DOXHV
7KHVHYDOXHVDUHWKH506YDOXHVRIWKHLQGLFDWHG
TXDQWLW\DVFDOFXODWHGDIWHUDSSUR[LPDWHO\
PLOOLVHFRQGVF\FOHVRIVDPSOLQJ
6HFRQG9DOXHV
7KHVHYDOXHVDUHWKH506YDOXHVRIWKHLQGLFDWHG
TXDQWLW\DVFDOFXODWHGDIWHURQHVHFRQG
F\FOHVRIVDPSOLQJ
$ODUP
$QHYHQWRUFRQGLWLRQLQDPHWHUWKDWFDQFDXVHD
WULJJHURUFDOOEDFNWRRFFXU
$QQXQFLDWRU
$VKRUWODEHOWKDWLGHQWLILHVSDUWLFXODUTXDQWLWLHVRU
YDOXHVGLVSOD\HGIRUH[DPSOHN:K
$YHUDJH&XUUHQW
:KHQDSSOLHGWRFXUUHQWYDOXHV$PSVWKH
DYHUDJHLVDFDOFXODWHGYDOXHWKDWFRUUHVSRQGVWR
WKHWKHUPDODYHUDJHRYHUDVSHFLILHGWLPH
LQWHUYDO
7KHLQWHUYDOLVVSHFLILHGE\WKHXVHULQWKHPHWHU
SURILOH7KHLQWHUYDOLVW\SLFDOO\PLQXWHV
6R$YHUDJH$PSVLVWKHWKHUPDODYHUDJHRI$PSV
RYHUWKHSUHYLRXVPLQXWHLQWHUYDO7KHWKHUPDO
DYHUDJHULVHVWRRIWKHDFWXDOYDOXHLQHDFK
WLPHLQWHUYDO)RUH[DPSOHLIDFRQVWDQW$PS
ORDGLVDSSOLHGWKHWKHUPDODYHUDJHZLOOLQGLFDWH
DPSVDIWHURQHWLPHLQWHUYDODPSVDIWHU
WZRWLPHLQWHUYDOVDQGDPSVDIWHUWKUHHWLPH
LQWHUYDOV
$YHUDJH,QSXW3XOVH
:KHQDSSOLHGWR,QSXW3XOVH$FFXPXODWLRQVWKH
$FFXPXODWLRQV
³$YHUDJH´UHIHUVWRWKHEORFNIL[HGZLQGRZ
DYHUDJHYDOXHRIWKHLQSXWSXOVHV
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
$YHUDJH3RZHU
:KHQDSSOLHGWRSRZHUYDOXHV:DWWV9$5V9$
WKHDYHUDJHLVDFDOFXODWHGYDOXHWKDWFRUUHVSRQGV
WRWKHWKHUPDODYHUDJHRYHUDVSHFLILHGWLPH
LQWHUYDO
7KHLQWHUYDOLVVSHFLILHGE\WKHXVHULQWKHPHWHU
SURILOH7KHLQWHUYDOLVW\SLFDOO\PLQXWHV
6RWKH$YHUDJH:DWWVLVWKHWKHUPDODYHUDJHRI
:DWWVRYHUWKHSUHYLRXVPLQXWHLQWHUYDO7KH
WKHUPDODYHUDJHULVHVWRRIWKHDFWXDOYDOXH
LQHDFKWLPHLQWHUYDO)RUH[DPSOHLIDFRQVWDQW
N:ORDGLVDSSOLHGWKHWKHUPDODYHUDJHZLOO
LQGLFDWHN:DIWHURQHWLPHLQWHUYDON:DIWHU
WZRWLPHLQWHUYDOVDQGN:DIWHUWKUHHWLPH
LQWHUYDOV
%LW
$XQLWRIFRPSXWHULQIRUPDWLRQHTXLYDOHQWWRWKH
UHVXOWRIDFKRLFHEHWZHHQWZRDOWHUQDWLYHV<HV
1R2Q2IIIRUH[DPSOH
2UWKHSK\VLFDOUHSUHVHQWDWLRQRIDELWE\DQ
HOHFWULFDOSXOVHZKRVHSUHVHQFHRUDEVHQFH
LQGLFDWHVGDWD
%LQDU\
5HODWLQJWRDV\VWHPRIQXPEHUVKDYLQJDVLWV
EDVHGLJLWVDQG
%ORFN:LQGRZ$YJ
3RZHU
7KH%ORFN)L[HG:LQGRZ$YHUDJHLVWKHDYHUDJH
SRZHUFDOFXODWHGRYHUDXVHUVHWWLPHLQWHUYDO
W\SLFDOO\PLQXWHV7KLVFDOFXODWHGDYHUDJH
FRUUHVSRQGVWRWKHGHPDQGFDOFXODWLRQV
SHUIRUPHGE\PRVWHOHFWULFXWLOLWLHVLQPRQLWRULQJ
XVHUSRZHUGHPDQG6HH5ROOLQJ:LQGRZ
$YHUDJH
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
%\WH
$JURXSRIELQDU\GLJLWVSURFHVVHGDVDXQLWE\D
FRPSXWHURUGHYLFHDQGXVHGHVSHFLDOO\WR
UHSUHVHQWDQDOSKDQXPHULFFKDUDFWHU
&%(0$&XUYH
$9ROWDJHTXDOLW\FXUYHHVWDEOLVKHGRULJLQDOO\E\
WKH&RPSXWHU%XVLQHVV(TXLSPHQW0DQXIDFWXUHUV
$VVRFLDWLRQ7KH&%(0$&XUYHGHILQHV9ROWDJH
GLVWXUEDQFHVWKDWFRXOGFDXVHPDOIXQFWLRQRU
GDPDJHLQPLFURSURFHVVRUGHYLFHV
7KHFXUYHLVFKDUDFWHUL]HGE\9ROWDJHPDJQLWXGH
DQGWKHGXUDWLRQZKLFKWKH9ROWDJHLVRXWVLGHRI
WROHUDQFH6HH,7,&&XUYH
&KDQQHO
7KHVWRUDJHRIDVLQJOHYDOXHLQHDFKLQWHUYDOLQD
ORDGSURILOH
&ROG/RDG3LFNXS
7KLVYDOXHLVWKHGHOD\IURPWKHWLPHFRQWURO
SRZHULVUHVWRUHGWRWKHWLPHZKHQWKHXVHUZDQWV
WRUHVXPHGHPDQGDFFXPXODWLRQ
&5&)LHOG
&\FOLF5HGXQGDQF\&KHFN)LHOG0RGEXV
FRPPXQLFDWLRQLVDQHUURUFKHFNVXP
FDOFXODWLRQWKDWHQDEOHVD6ODYHGHYLFHWR
GHWHUPLQHLIDUHTXHVWSDFNHWIURPD0DVWHU
GHYLFHKDVEHHQFRUUXSWHGGXULQJWUDQVPLVVLRQ,I
WKHFDOFXODWHGYDOXHGRHVQRWPDWFKWKHYDOXHLQ
WKHUHTXHVWSDFNHWWKH6ODYHLJQRUHVWKHUHTXHVW
&7&XUUHQW5DWLR
$&XUUHQW7UDQVIRUPHU5DWLRLVXVHGWRVFDOHWKH
YDOXHRIWKHFXUUHQWIURPDVHFRQGDU\YDOXHXSWR
WKHSULPDU\VLGHRIDQLQVWUXPHQWWUDQVIRUPHU
&XPXODWLYH'HPDQG
7KHVXPRIWKHSUHYLRXVELOOLQJSHULRGPD[LPXP
GHPDQGUHDGLQJVDWWKHWLPHRIELOOLQJSHULRG
UHVHW7KHPD[LPXPGHPDQGIRUWKHPRVWUHFHQW
ELOOLQJSHULRGLVDGGHGWRWKHSUHYLRXVO\
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
DFFXPXODWHGWRWDORIWKHPD[LPXPGHPDQGV
'HPDQG
7KHDYHUDJHYDOXHRISRZHURUDVLPLODUTXDQWLW\
RYHUDVSHFLILHGSHULRGRIWLPH
'HPDQG,QWHUYDO
$VSHFLILHGWLPHRYHUZKLFKGHPDQGLVFDOFXODWHG
'LVSOD\
8VHUFRQILJXUDEOHYLVXDOLQGLFDWLRQRIGDWDLQD
PHWHU
'13
$UREXVWQRQSURSULHWDU\SURWRFROEDVHGRQ
H[LVWLQJRSHQVWDQGDUGV'13LVXVHGWR
RSHUDWHEHWZHHQYDULRXVV\VWHPVLQHOHFWULFDQG
RWKHUXWLOLW\LQGXVWULHVDQG6&$'$QHWZRUNV
((3520
1RQYRODWLOHPHPRU\(OHFWULFDOO\(UDVDEOH
3URJUDPPDEOH5HDG2QO\0HPRU\WKDWUHWDLQVLWV
GDWDGXULQJDSRZHURXWDJHZLWKRXWQHHGIRUD
EDWWHU\$OVRUHIHUVWRPHWHU¶V)/$6+PHPRU\
(QHUJ\5HJLVWHU
3URJUDPPDEOHUHFRUGWKDWPRQLWRUVDQ\HQHUJ\
TXDQWLW\([DPSOH:DWWKRXUV9$5KRXUV
9$KRXUV
(WKHUQHW
$W\SHRI/$1QHWZRUNFRQQHFWLRQWKDWFRQQHFWV
WZRRUPRUHGHYLFHVRQDFRPPRQFRPPXQL
FDWLRQVEDFNERQH$Q(WKHUQHW/$1FRQVLVWVRIDW
OHDVWRQHKXEGHYLFHWKHQHWZRUNEDFNERQHZLWK
PXOWLSOHGHYLFHVFRQQHFWHGWRLWLQDVWDUFRQILJX
UDWLRQ7KHPRVWFRPPRQYHUVLRQVRI(WKHUQHWLQ
XVHDUH%DVH7DQG%DVH7DVGHILQHGLQ
,(((VWDQGDUGV+RZHYHUVHYHUDORWKHU
YHUVLRQVRI(WKHUQHWDUHDOVRDYDLODEOH
)OLFNHU
)OLFNHULVWKHVHQVDWLRQWKDWLVH[SHULHQFHGE\WKH
KXPDQYLVXDOV\VWHPZKHQLWLVVXEMHFWHGWR
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
FKDQJHVRFFXUULQJLQWKHLOOXPLQDWLRQLQWHQVLW\RI
OLJKWVRXUFHV,(&DQGIRUPHU,(&
GHVFULEHWKHPHWKRGVXVHGWRGHWHUPLQH
)OLFNHUVHYHULW\
+DUPRQLFV
0HDVXULQJYDOXHVRIWKHIXQGDPHQWDOFXUUHQWDQG
9ROWDJHDQGSHUFHQWRIWKHIXQGDPHQWDO
+HDUWEHDW3XOVH
(QHUJ\LQGLFDWRURQWKHIDFHRIWKH1H[XVŠ
PHWHUSXOVHVDUHJHQHUDWHGSHUWKH
SURJUDPPHG.HYDOXH
,77KUHVKROG
'DWDZLOOQRWDFFXPXODWHXQWLOFXUUHQWUHDFKHV
SURJUDPPHGOHYHO
,QWHJHU
$Q\RIWKHQDWXUDOQXPEHUVWKHQHJDWLYHVRI
WKRVHQXPEHUVRU]HUR
,QWHUQDO0RGHP
$QRSWLRQDOPRGHPZLWKLQWKHPHWHU¶VHQFORVXUH
WKDWFRQQHFWVWRWKH5-WHOHSKRQHFRQQHFWRU
,QYDOLG5HJLVWHU
,QWKH1H[XVŠPHWHU¶V0RGEXV0DSWKHUHDUH
JDSVEHWZHHQ5HJLVWHUV)RUH[DPSOHWKHQH[W
5HJLVWHUDIWHULV$Q\XQPDSSHG
5HJLVWHUVWRUHVQRLQIRUPDWLRQDQGLVVDLGWREH
LQYDOLG
,7,&&XUYH
$QXSGDWHGYHUVLRQRIWKH&%(0$&XUYHWKDW
UHIOHFWVIXUWKHUVWXG\LQWRWKHSHUIRUPDQFHRI
PLFURSURFHVVRUGHYLFHV7KHFXUYHFRQVLVWVRID
VHULHVRIVWHSVEXWVWLOOGHILQHVFRPELQDWLRQVRI
9ROWDJHPDJQLWXGHDQGGXUDWLRQWKDWZLOOFDXVH
PDOIXQFWLRQRUGDPDJH
.H
Electro Industries/GaugeTech
N:KSHUSXOVHLHWKHHQHUJ\
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
N:K
.LORZDWWKRXUVN:[GHPDQGLQWHUYDOLQKRXUV
.<=2XWSXW
2XWSXWZKHUHWKHUDWHRIFKDQJHVEHWZHHQDQG
UHIOHFWVWKHPDJQLWXGHRIDPHWHUHGTXDQWLW\
/&'
/LTXLG&U\VWDO'LVSOD\
/('
/LJKW(PLWWLQJ'LRGH
0D[LPXP'HPDQG
7KHODUJHVWGHPDQGFDOFXODWHGGXULQJDQ\LQWHUYDO
RYHUDELOOLQJSHULRG
0RGEXV$6&,,
$OWHUQDWHYHUVLRQRIWKH0RGEXVSURWRFROWKDW
XWLOL]HVDGLIIHUHQWGDWDWUDQVIHUIRUPDW7KLV
YHUVLRQLVQRWGHSHQGHQWXSRQVWULFWWLPLQJDVLV
WKH578YHUVLRQ7KLVLVWKHEHVWFKRLFHIRU
WHOHFRPPXQLFDWLRQVDSSOLFDWLRQVYLDPRGHPV
0RGEXV578
7KHPRVWFRPPRQIRUPRI0RGEXVSURWRFRO
0RGEXV578LVDQRSHQSURWRFROVSRNHQE\PDQ\
ILHOGGHYLFHVWRHQDEOHGHYLFHVIURPPXOWLSOH
YHQGRUVWRFRPPXQLFDWHLQDFRPPRQODQJXDJH
'DWDLVWUDQVPLWWHGLQDWLPHGELQDU\IRUPDW
SURYLGLQJLQFUHDVHGWKURXJKSXWDQGWKHUHIRUH
LQFUHDVHGSHUIRUPDQFH
1HWZRUN
$FRPPXQLFDWLRQVFRQQHFWLRQEHWZHHQWZRRU
PRUHGHYLFHVWRHQDEOHWKRVHGHYLFHVWRVHQGWR
DQGUHFHLYHGDWDIURPRQHDQRWKHU,QPRVW
DSSOLFDWLRQVWKHQHWZRUNLVHLWKHUDVHULDOW\SHRU
D/$1W\SH
195$0
1RQYRODWLOH5DQGRP$FFHVV0HPRU\DEOHWR
NHHSWKHVWRUHGYDOXHVLQPHPRU\HYHQGXULQJ
WKHORVVRIFLUFXLWRUFRQWUROSRZHU+LJKVSHHG
195$0LVXVHGLQWKH1H[XVŠPHWHUWRJDWKHU
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
PHDVXUHGLQIRUPDWLRQDQGWRLQVXUHWKDWQR
LQIRUPDWLRQLVORVW
2SWLFDO3RUW
$SRUWWKDWIDFLOLWDWHVLQIUDUHGFRPPXQLFDWLRQZLWK
DPHWHU8VLQJDQ$16,&7\SH,,PDJQHWLF
RSWLFDOFRPPXQLFDWLRQVFRXSOHUDQGDQ56
FDEOHIURPWKHFRXSOHUWRD3&WKHPHWHUFDQEH
SURJUDPPHGZLWK&RPPXQLFDWRU(;7VRIWZDUH
3DFNHW
$VKRUWIL[HGOHQJWKVHFWLRQRIGDWDWKDWLV
WUDQVPLWWHGDVDXQLW([DPSOHDVHULDOVWULQJRI
ELWE\WHV
3HUFHQW7+'
3HUFHQW7RWDO+DUPRQLF'LVWRUWLRQ6HH7+'
3URWRFRO
$ODQJXDJHWKDWLVVSRNHQEHWZHHQWZRRUPRUH
GHYLFHVFRQQHFWHGRQDQHWZRUN
375DWLR
3RWHQWLDO7UDQVIRUPHU5DWLRXVHGWRVFDOHWKH
YDOXHRIWKH9ROWDJHWRWKHSULPDU\VLGHRIDQ
LQVWUXPHQWWUDQVIRUPHU$OVRUHIHUUHGWRDV97
5DWLR
3XOVH
7KHFORVLQJDQGRSHQLQJRIWKHFLUFXLWRIDWZR
ZLUHSXOVHV\VWHPRUWKHDOWHUQDWHFORVLQJDQG
RSHQLQJRIRQHVLGHDQGWKHQWKHRWKHURIDWKUHH
ZLUHV\VWHPZKLFKLVHTXDOWRWZRSXOVHV
45HDGLQJV
4LVWKHTXDQWLW\REWDLQHGE\ODJJLQJWKHDSSOLHG
9ROWDJHWRDZDWWPHWHUE\GHJUHHV9DOXHVDUH
GLVSOD\HGRQWKH8QFRPSHQVDWHG3RZHUDQG4
5HDGLQJVVFUHHQ
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
4XDGUDQW
3URJUDPPDEOH9DOXHVDQG
)DFWRUVRQWKH1H[XVŠ
PHWHU
:DWWDQG9$5IORZLVW\SLFDOO\UHSUHVHQWHGXVLQJ
DQ;<FRRUGLQDWHV\VWHP7KHIRXUFRUQHUVRIWKH
;<SODQHDUHUHIHUUHGWRDVTXDGUDQWV0RVW
SRZHUDSSOLFDWLRQVODEHOWKHULJKWKDQGFRUQHUDV
WKHILUVWTXDGUDQWDQGQXPEHUWKHUHPDLQLQJ
TXDGUDQWVLQDFRXQWHUFORFNZLVHURWDWLRQ)ROORZ
LQJDUHWKHSRVLWLRQVRIWKHTXDGUDQWV
VWXSSHUULJKWQGXSSHUOHIWUGORZHUOHIW
DQGWKORZHUULJKW
3RZHUIORZLVJHQHUDOO\SRVLWLYHLQTXDGUDQWV
DQG
9$5IORZLVSRVLWLYHLQTXDGUDQWVDQG
7KHPRVWFRPPRQORDGFRQGLWLRQVDUH
4XDGUDQWSRZHUIORZSRVLWLYH9$5IORZ
SRVLWLYHLQGXFWLYHORDGODJJLQJRUSRVLWLYH
SRZHUIDFWRU
4XDGUDQWSRZHUIORZQHJDWLYH9$5IORZ
SRVLWLYHFDSDFLWLYHORDGOHDGLQJRUQHJDWLYH
SRZHUIDFWRU
5HJLVWHU
$QHQWU\RUUHFRUGWKDWVWRUHVDVPDOODPRXQWRI
GDWD
5HJLVWHU5ROORYHU
$SRLQWDWZKLFKD5HJLVWHUUHDFKHVLWVPD[LPXP
YDOXHDQGUROOVRYHUWR]HUR
5HVHW
/RJVDUHFOHDUHGRUQHZRUGHIDXOWYDOXHVDUH
VHQWWRFRXQWHUVRUWLPHUV
5ROOLQJ:LQGRZ
7KH5ROOLQJ6OLGLQJ:LQGRZ$YHUDJHLVWKH
$YHUDJH3RZHU
DYHUDJHSRZHUFDOFXODWHGRYHUDXVHUVHWWLPH
LQWHUYDOWKDWLVGHULYHGIURPDVSHFLILHGQXPEHURI
VXELQWHUYDOVHDFKRIDVSHFLILHGWLPH)RU
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
H[DPSOHWKHDYHUDJHLVFDOFXODWHGRYHUD
PLQXWHLQWHUYDOE\FDOFXODWLQJWKHVXPRIWKH
DYHUDJHRIWKUHHFRQVHFXWLYHPLQXWHLQWHUYDOV
7KLVGHPDQGFDOFXODWLRQPHWKRGRORJ\KDVEHHQ
DGRSWHGE\VHYHUDOXWLOLWLHVWRSUHYHQWFXVWRPHU
PDQLSXODWLRQRIN:GHPDQGE\VLPSO\VSUHDGLQJ
SHDNGHPDQGDFURVVWZRLQWHUYDOV
56
$W\SHRIVHULDOQHWZRUNFRQQHFWLRQWKDWFRQQHFWV
WZRGHYLFHVWRHQDEOHFRPPXQLFDWLRQEHWZHHQ
WKHGHYLFHV$Q56FRQQHFWLRQFRQQHFWVRQO\
WZRSRLQWV'LVWDQFHEHWZHHQGHYLFHVLVW\SLFDOO\
OLPLWHGWRIDLUO\VKRUWUXQV
&XUUHQWVWDQGDUGVUHFRPPHQGDPD[LPXPRI
IHHWEXWVRPHXVHUVKDYHKDGVXFFHVVZLWKUXQV
XSWRIHHW
&RPPXQLFDWLRQVVSHHGLVW\SLFDOO\LQWKHUDQJHRI
ELWVSHUVHFRQGWRELWVSHUVHFRQG
56FRQQHFWLRQFDQEHDFFRPSOLVKHGXVLQJ3RUW
RIWKH1H[XVŠPHWHU
56
$W\SHRIVHULDOQHWZRUNFRQQHFWLRQWKDWFRQQHFWV
WZRRUPRUHGHYLFHVWRHQDEOHFRPPXQLFDWLRQ
EHWZHHQWKHGHYLFHV$Q56FRQQHFWLRQDOORZV
PXOWLGURSFRPPXQLFDWLRQIURPRQHWRPDQ\
SRLQWV
'LVWDQFHEHWZHHQGHYLFHVLVW\SLFDOO\OLPLWHGWR
DURXQGWRZLUHIHHW
&RPPXQLFDWLRQVVSHHGLVW\SLFDOO\LQWKHUDQJHRI
ELWVSHUVHFRQGWRELWVSHUVHFRQG
6DJ
$9ROWDJHTXDOLW\HYHQWGXULQJZKLFKWKH506
9ROWDJHLVORZHUWKDQQRUPDOIRUDSHULRGRIWLPH
W\SLFDOO\IURPF\FOHWRPLQXWH
Electro Industries/GaugeTech
The Leader In Power Monitoring and Smart Grid Solutions'RF#
(
*/
*ORVVDU\
6HFRQGDU\5DWHG
$Q\5HJLVWHURUSXOVHRXWSXWWKDWGRHVQRWXVH
DQ\&7RU37975DWLR
6HULDO3RUW
7KHW\SHRISRUWXVHGWRGLUHFWO\LQWHUIDFHZLWKD
GHYLFHXVLQJWKH56VWDQGDUG
6ZHOO
$9ROWDJHTXDOLW\HYHQWGXULQJZKLFKWKH506
9ROWDJHLVKLJKHUWKDQQRUPDOIRUDSHULRGRIWLPH
W\SLFDOO\IURPF\FOHWRPLQXWH
7''
7KH7RWDO'HPDQG'LVWRUWLRQRIWKHFXUUHQW
ZDYHIRUP7KHUDWLRRIWKHURRWVXPVTXDUHYDOXH
RIWKHKDUPRQLFFXUUHQWWRWKHPD[LPXPGHPDQG
ORDGFXUUHQW6HHHTXDWLRQEHORZ
NOTE7KH7''GLVSOD\HGLQWKH+DUPRQLFV
VFUHHQLVFDOFXODWHGE\&RPPXQLFDWRU(;7
VRIWZDUHXVLQJWKH0D[$YHUDJH'HPDQG
1TDD
7+'
I 22 I 32 I 42 I 52 ...x100%
IL
7RWDO+DUPRQLF'LVWRUWLRQLVWKHFRPELQHGHIIHFW
RIDOOKDUPRQLFVPHDVXUHGLQD9ROWDJHRUFXUUHQW
7KH7+'QXPEHULVH[SUHVVHGDVDSHUFHQWRIWKH
IXQGDPHQWDO)RUH[DPSOHD7+'LQGLFDWHV
WKDWWKHPDJQLWXGHRIDOOKDUPRQLFGLVWRUWLRQ
PHDVXUHGHTXDOVRIWKHPDJQLWXGHRIWKH
IXQGDPHQWDO+]TXDQWLW\7KH7+'GLVSOD\HG
LVFDOFXODWHGE\\RXU1H[XVŠPHWHU
7LPH6WDPS
$VWRUHGUHSUHVHQWDWLRQRIWKHWLPHRIDQHYHQW
7LPH6WDPSFDQLQFOXGH\HDUPRQWKGD\KRXU
PLQXWHVHFRQGDQG'D\OLJKW6DYLQJV7LPH
LQGLFDWLRQ
Electro Industries/GaugeTech
'RF#
The Leader In Power Monitoring and Smart Grid Solutions
(
*/
*ORVVDU\
728
7LPHRI8VH
8QFRPSHQVDWHG
3RZHU
9$:DWWDQG9$5UHDGLQJVQRWDGMXVWHGE\
7UDQVIRUPHU/RVV&RPSHQVDWLRQ
977KUHVKROG
'DWDZLOOVWRSDFFXPXODWLQJZKHQ9ROWDJHIDOOV
EHORZSURJUDPPHGOHYHO
9ROWDJH,PEDODQFH
7KHUDWLRRIWKH9ROWDJHRQDSKDVHWRWKHDYHUDJH
9ROWDJHRQDOOSKDVHV
9ROWDJH4XDOLW\(YHQW
$QLQVWDQFHRIDEQRUPDO9ROWDJHRQDSKDVH7KH
HYHQWVWKHPHWHUWUDFNVLQFOXGHVDJVVZHOOV
LQWHUUXSWLRQVDQGLPEDODQFHV
975DWLR
7KH9ROWDJH7UDQVIRUPHU5DWLRLVXVHGWRVFDOHWKH
YDOXHRIWKH9ROWDJHWRWKHSULPDU\VLGHRIDQ
LQVWUXPHQWWUDQVIRUPHU$OVRUHIHUUHGWRDV37
5DWLR
9ROWDJH9DE
9DE9EF9FDDUHDOO3KDVHWR3KDVH9ROWDJH
PHDVXUHPHQWV7KHVH9ROWDJHVDUHPHDVXUHG
EHWZHHQWKHWKUHHSKDVH9ROWDJHLQSXWVWRWKH
PHWHU
9ROWDJH9DQ
9DQ9EQ9FQDUHDOO3KDVHWR1HXWUDO9ROWDJHV
DSSOLHGWRWKHPRQLWRU7KHVH9ROWDJHVDUH
PHDVXUHGEHWZHHQWKHSKDVH9ROWDJHLQSXWVDQG
9QLQSXWWRWKHPHWHU7HFKQRORJLFDOO\WKHVH
9ROWDJHVFDQEH³PHDVXUHG´HYHQZKHQWKHPHWHU
LVLQD'HOWDFRQILJXUDWLRQDQGWKHUHLVQRFRQQHF
WLRQWRWKH9QLQSXW+RZHYHULQWKLVFRQILJX
UDWLRQWKHVH9ROWDJHVKDYHOLPLWHGPHDQLQJDQG
DUHW\SLFDOO\QRWUHSRUWHG
Electro Industries/GaugeTech
'RF#
The Leader In Power Monitoring and Smart Grid Solutions
(
*/
*ORVVDU\
9ROWDJH9DX[
7KLVLVWKHIRXUWK9ROWDJHLQSXWPHDVXUHGIURP
EHWZHHQWKH9DX[DQG9UHILQSXWV7KLVLQSXWFDQ
EHVFDOHGWRDQ\YDOXH+RZHYHUWKHDFWXDOLQSXW
9ROWDJHWRWKHPHWHUVKRXOGEHRIWKHVDPH
PDJQLWXGHDVWKH9ROWDJHVDSSOLHGWRWKH9D9E
DQG9FWHUPLQDOV
Electro Industries/GaugeTech
'RF#
The Leader In Power Monitoring and Smart Grid Solutions
(
*/
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement