Century B-VMH12FV-1-CY 12KBTU MULTI/SINGLE INVERTER FLOOR CONSOLE User Manual
Century B-VMH12FV-1-CY is a 12KBTU split-system air conditioner with both multi and single inverter capabilities. It boasts a user-friendly wired controller with features such as temperature control, fan speed adjustment, timer functions, and swing modes. This unit is designed for both individual and multi-room applications, making it a versatile choice for various residential and commercial settings.
PDF
Document
Advertisement
Advertisement
Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 WIRED CONTROLLER INSTALLATION AND OWNER’S MANUAL Model KJR-120G1/TFBG-E-01 KJR-120G2/TFBG-E-03 517.787.2100 • www.marsdelivers.com Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 ● This manual gives detailed description of the precautions that should be brought to your attention during operation. ● To ensure the correct service of the wired controller, read this manual carefully before using the unit. ● Keep this manual after reading for future reference. Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 1. SAFETY PRECAUTION................................................................................................... 1 2. INSTALLATION ACCESSORY........................................................................................ 2 3. INSTALLATION METHOD..............................................................................................4 4. APPENDIX INSTALL THE WIRE CONTROLLER KIT...............................................15 5. SPECIFICATION..............................................................................................................21 6. WIRED CONTROLLER FEATURES AND FUNCTIONS..........................................22 7. WIRED CONTROLLER DISPLAY.................................................................................23 8. WIRED CONTROLLER BUTTONS..............................................................................24 9. PREPARATORY OPERATION.......................................................................................25 10. OPERATION..................................................................................................................26 11. TIMER FUNCTIONS.....................................................................................................32 12. WEEKLY TIMER.............................................................................................................35 13. SET EXTERNAL STATIC PRESSURE.........................................................................42 14. FAULT ALARM HANDING.........................................................................................43 15.TECHNICAL INDICATION AND REQUIREMENT .................................................43 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 1. SAFETY PRECAUTION Read the safety precautions carefully before installing the unit. Stated below are important safety issues that must be obeyed. WARNING Means improper handling may lead to personal death or severe injury. CAUTION Means improper handling may lead to personal injury or property loss. WARNING Please entrust the distributor or professionals to install the unit. Installation by other persons may lead to imperfect installation, electric shock or fire. Adhere to this installation manual. Imporper installation may lead to electric shock or fire. Reinstallation must be performed by professionals. Do not uninstall the unit randomly. Random uninstalling may lead to abnormal operation, heating or fire of the air condition. NOTE 1 Do not install the unit in a place vulnerable to leakage of flammable gases.Once flammable gases are leaked and left around the wire controller, fire may occure. 2 Do not operate with wet hands or let water enter the wire controller. Otherwise, electric shock may occur. 3 The wiring should adapt to the wire controller current. Otherwise, electric leakage or heating may occur and result in fire. 4 The specified cables shall be applied in the wiring. No external force may be applied to the terminal. Otherwise, wire cut and heating may occur and result in fire. 1 1 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 2. INSTALLATION ACCESSORY Select the installation location Don’t install at the place where cover with heavy oil, vapor or sulfureted gas, otherwise, this product would be deformed that would lead to system malfunction. Preparation before installation 1. Please confirm that all the following parts you have been supply. No. Name Qty. 1 Wire controller 1 2 Installation and owner’s manual Screws 3 ST3.9X25 (For Mounting on the Wall) Wall plugs 3 For Mounting on the Wall Screws Plastic screw bars Battery 2 6 7 2 1 M4X25 (For Mounting on switch box) For fixing on switch box 8 The connection cable 1 3 4 5 Remarks 1 (Optional) 2. Prepare the following assemblies on the site. No. Name Specification Qty.(embeded (only for reference) into wall) 1 Switch box 1 2 Wiring Tube(Insulating Sleeve and Tightening Screw) 1 2 2 Remarks Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 2. INSTALLATION ACCESSORY WIRED CONTROLLER INSTALLATION PRECAUTION 1. This manual provides the wired controller installation method. Refer to the wiring diagram in this installation manual to wire the wired controller with the indoor unit. 2. The wired controller works in a low voltage loop circuit. Do not connect directly to 208/230V and 460V. Do not wire this kind of wire into a loop. Wiring clearance between the configured tubes should range 11.81−19.69 inches (30−50 cm) or above. 3. The shielded wire of the wired controller must be properly grounded. 4. Upon finish the wire controller connection, do not employed tramegger to detect the insulation. 3 3 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. INSTALLATION METHOD 1.Wired Remote Controller Dimensions 120mm (4.7”) 18.5mm (0.7”) 46mm (1.8”) 123mm (4.8”) 83.5mm (3.3”) 62mm (2.4”) Fig 3-1 2.Wiring Connection Diagram red black yellow brown Wire controller ----------------------------------------------------------------------------------------------------------------------------------------4-Core Shield Cable, the length is decided by installation Fig 3-2 4 4 Insert of the mainboard CN40 red black yellow brown Indoor unit mainboard Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. INSTALLATION METHOD 3.Wiring figure Mainboard 4-core shielding wire The connection cable CN40 Fig 3-3(A) Model :KJR-120G2/TFBG-E-03(12V) Applicable to Light Commercial air conditioner Adaptor board Display board The connection cable D The connection cable A CN40 X Y E 5V/12V CN1 Red White Yellow Brown 4-core shielding wire on the controller Model :KJR-120G2/TFBG-E-03(12V) Applicable to split-type air conditioner Fig 3-3(A) Connect the female joint of the wires group from the mainboard with the male joint of the connective wires group. (See Fig.3-3(A)) Connect the other side of the connective wires group with the male joint of the wires group leads from the wire controller.(See Fig.3-3(A)) 5 5 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. INSTALLATION METHOD Display board Adapter board The connection cable CN101 Fig 3-3(B) 4-core shielding wire Model B:KJR-120G1/TFBG-E-01(5V) Applicable to Light Commercial air conditioner Adaptor board Display board The connection cable D The connection cable A CN40 X Y E 5V/12V CN1 Red White Yellow Brown 4-core shielding wire on the controller Model B:KJR-120G1/TFBG-E-01(5V) Applicable to split-type air conditioner Fig 3-3(B) Install the Adapter Board and the Display Board on the High Wall (See the Appendix for instructions). Connect the female joint of the wires group from the adapter board with the male joint of theconnective wires group. Next, connect the other side of the adapter board with the displayboard. (See Fig.3-3(B)) Connect the other side of the connective wires group with the male joint of the wires group leads from the wire controller. (See Fig.3-3(B)) 6 6 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. INSTALLATION METHOD 4.Wire controller upper part Remove Insert a flat screwdriver into the slots in the lower part of the wire controller (2 places). Remove the upper part of the wire controller (Fig.3-4) NOTE: The PCB is mounted in the upper part of the wired controller. Be careful not to damage the board with the screwdriver. Slots Fig 3-4 5. Fasten the wire controller back plate For surface mounting, fasten the back plate on the wall with the 3 screws (ST3.9x25) and plugs. (Fig.3-5) Back plate Screws (ST3.9×25) Fig 3-5 7 7 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. Installation method BATTERY WARNING WARNING: Contains coin battery. WARNING INGESTION HAZARD: This product contains a button cell or coin battery. BATTERY WARNING: KEEP OUT OF REACH OF CHILDREN; If the battery compartment (if applicable) does not close securely, stop using the product and keep it away from children; If you think batteries might have been swallowed or placed inside any part of the body, seek immediate medical attention. 8 8 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. Installation method BATTERY WARNING KEEP OUT OF REACH OF CHILDREN. Swallowing can lead to chemical burns, perforation of soft tissue, and death. Severe burns can occur within 2 hours of ingestion. Seek medical attention immediately. WARNING INGESTION HAZARD: This product contains a button cell or coin battery. DEATH or serious injury can occur if ingested. A swallowed button cell or coin battery can cause Internal Chemical Burns in as little as 2 hours. KEEP new and used batteries OUT OF REACH of CHILDREN. Seek immediate medical attention if a battery is suspected to be swallowed or inserted inside any part of the body. 99 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. Installation method WARNING Remove and immediately recycle or dispose of used batteries according to local regulations and keep away from children. Do NOT dispose of batteries in household trash or incinerate. Even used batteries may cause severe injury or death. Call a local poison control center for treatment information. Non-rechargeable batteries are not to be recharged. Do not force discharge, recharge, disassemble, heat above (-20-70℃) or incinerate. Doing so may result in injury due to venting, leakage or explosion resulting in chemical burs. Ensure the batteries are installed correctly according to polarity (+ and -). Do not mix old and new batteries, different brands or types of batteries, such as alkaline, carbon-zinc, or rechargeable batteries. Remove and immediately recycle or dispose of batteries from equipment not used for an extended period of time according to local regulations. 10 10 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. Installation method Always completely secure the battery compartment. If the battery compartment does not close securely, stop using the product, remove the batteries, and keep them away from children. Battery type: CR2032 Battery power supply: 3.0V 11 11 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. INSTALLATION METHOD For switch box mounting, fasten the back plate on the switch box with 2 screws (M4x25) and fasten it on the wall with 1 screw (ST3.9x25). (Fig.3-6) Back plate Switch box Screw (ST3.9×25) Screws (M4×25) Fig 3-6 NOTE: Place on a flat surface. Be careful not to distort the wire controller’s back plate by over−tightening the mounting screws. 6. Battery installation Fig 3-7 Place the battery in the unit and ensure the positive side of the battery is in accordance with the polarity markings.(See Fig.3-7) Set the correct time before operating. Batteries in the wired controller can maintain the correct time during a power failure. When the power is restored and the displayed time is not correct, replace the battery. 12 12 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. INSTALLATION METHOD 7. Wire the indoor unit There are three methods: 1 from the rear; 2 from the bottom; 3 from the top; 3 1 1 PCB PCB 1 2 PCB 4. Notch the part for the wiring to pass through with a nipper tool. 13 13 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 3. INSTALLATION METHOD NOTE: DO NOT allow water to enter the remote control. Use the trap and putty to seal the wires. Putty Trap Putty Trap Putty Trap Fig 3-8 8. Reattach the wire controller’s upper part While adjusting and mounting the upper case, avoid clamping the wiring during installation. (Fig 3-9) IMPORTANT: All the pictures in this manual are for illustration purposes only. Your wire controller may differ slightly. Fig 3-9 14 14 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 4. APPENDIX INSTALL THE WIRE CONTROLLER KIT 1. Open the front panel. 2. Disconnect the wire from the main controller board. 15 15 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 4. APPENDIX INSTALL THE WIRE CONTROLLER KIT 3. Identify the components. From left to right, the wired controller, convert board and the display board. 4. Identify connections on the Display Board. CN201 is the display board connection to the main board wire (on the display board). 16 16 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 4. APPENDIX INSTALL THE WIRE CONTROLLER KIT CN101 is the display board connection to the convert board wire (on the display board). 5. Uninstall the display board from the front panel. Keep the display board holder. 17 17 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 4. APPENDIX INSTALL THE WIRE CONTROLLER KIT 6. Carefully bend and break off the rectangular section (upper left section with two diagonal holes) from the display board. NOTE: Break off the upper left hand rectangle (section with the two holes marked with a red rectangle). 7. Replace the old display board (for the New Display board provided) and secure with the clips. To uninstall the clips, push the clips inward. NOTE: There are 4 clips just above the numeric display (88) which run the length of the holder. 18 18 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 4. APPENDIX INSTALL THE WIRE CONTROLLER KIT 8. Before assembling mounting back on the Front Panel, remove the display board’s screen cover. 9. Connect the Wires to the Adaptor Board. a. Connect the wire coming from the Display board to the Convert Board (this connection consists of 5 wires). 19 19 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 4. APPENDIX INSTALL THE WIRE CONTROLLER KIT b. Connect the wire coming from the Wired Remote Controller to the Convert Board (this connection consists of 4 wires). 10. Once the ports are connected, install the cover. 11. Mount the new display board and convert board to the Front Panel. 12. Connect the wired remote controller to the display board and the convert board. 13. Connect the wire from the main controller board (see Fig 3-2). 20 20 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 5. SPECIFICATION Input voltage DC 5V/DC 12V Ambient temperature 23~110℉(-5~43℃) Ambient humidity RH40%~RH90% Wiring specifications Wiring type Shielded vinyl cord or cable Size Total length 0.029 in-0.74mm (0.75-1.25mm2 ) <66 ft (20m) 21 21 <164 ft (50m) Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 6. FEATURE AND FUNCTION OF THE WIRED CONTROLLER Feature: Swing Timer Day off/Del Confirm Back/Turbo ℃ Copy/ Follow me ℉ Mode - LCD display. Malfunction code display: displays the error code (helpful for servicing) 4-way wire layout design. Room temperature display. Weekly Timer + Fan speed (Lock) MODEL: KJR-120G2/TFBG-E-03(12V) Swing Timer Day off/Del Confirm Back/Turbo ℃ Copy/ Follow me ℉ Mode - + Fan speed (Lock) MODEL: KJR-120G1/TFBG-E-01(5V) 22 22 ---- ---- Function: -------Mode: choose Auto-Cool-Dry- -------Heat -Fan Fan speed: Auto-Low-Med-High Swing(on some models) Timer ON/OFF Temp setting Weekly Timer Follow me Child Lock LCD Display Clock Faceplate function (on some models) Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 7. WIRED CONTROLLER DISPLAY 1 2 3 4 5 6 7 8 9 10 11 12 13 15 1. Operation mode indicator 2. Fan speed indicator 3. Left-right swing indicator 4. Up-down swing indicator 5. Faceplate function indicator 6. Main unit and secondary unit indicator 7. Follow me function indicator 14 8. Turbo/Auxiliary Heat function indicator 9. °C / °F indicator 10. Temperature display 11. Lock indicator 12. Room temperature indicator 13. Clock display 14. On/Off timer 15. Timer display 23 23 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 8. WIRED CONTROLLER BUTTONS 5 6 7 3 Swing Day off/Del Timer Confirm Back/Turbo Copy/ Follow me Mode - + Fan speed 6. Timer 7. Day Off/Del 8. Copy/Follow me 9. Back/Turbo 10. Confirm 24 24 2 3 4 (Lock) 1. Mode 2. Power 3. Adjust 4. Fan Speed 5. Swing 8 9 10 1 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 9. PREPARATORY OPERATION Set the current day and time 1 2 3 4 Press TIMER for 3s or more. The timer displays flashes. Timer Press + or − to set the date. The selected date flashes. - + Date setting is complete and the time setting is ready after pressing TIMER or if nothing is pressed in 10 seconds. Timer - + Press + or − to set the current time. Press repeatedly to adjust the current time in 1 minute increments. Press and hold to adjust the current time. ex.Monday AM 11:20 5 Timer The setting is complete after pressing TIMER or if no button is pressed for 10 seconds. 25 25 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 10. OPERATION To start/stop operation Press the Power button. To set the operation mode Operation mode setting Press MODE to set the operation mode. (Heat function is invalid for cool only type unit) Mode Room temperature setting - + Press + or − to set the room temperature. Indoor Setting Temperature Range: 62~86℉(17~30℃)/62~88℉(17~31℃(depending on models)). Lower Raise 26 26 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 10. OPERATION Fan speed setting Press FAN SPEED to set the fan speed NOTE: This function is unavailable in the AUTO or DRY modes. Fan speed (Lock) Room temperature sensor selection Press FOLLOW ME to select whether the room temperature is detected at the indoor unit or at the wired controller. Copy/ Follow me Indoor Unit NOTE: When the FOLLOW ME function indication appears, the room temperature is detected at the wire remote controller. 27 27 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 10. OPERATION Child lock function Press LOCK for 3 seconds to activate the CHILD LOCK feature and lock all buttons on the wired controller. Press again for 3 seconds to deactivate. Fan speed (Lock) NOTE: When the child lock function is activated, the lock image appears. keypad tone setting Timer Swing Press SWING and TIMER simultaneously for 3 seconds to disable the keypad tone. Press the buttons again for 3 seconds to enable the keypad tone. °C & °F scale selection (on some models) Back/Turbo ℃ Copy/ Follow me ℉ Press BACK and COPY simultaneously for 3 seconds to alternate the temperature display between the ℉&℃ scale. 28 28 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 10. OPERATION Turbo/Auxiliary Heat function (on some models) • Press TURBO to activate/deactivate the Turbo/Auxiliary Back/Turbo Heat function. The turbo function sets the unit to reach the user’s present temperature in the shortest amount of time possible. • When the user presses TURBO in the COOL mode, the unit sets to the highest fan speed setting to jump−start the cooling process. • When the user presses TURBO in the HEAT mode, for units with AUX. HEAT, the AUX. HEAT activates and jump−starts the heating process. Lift panel function (only for some cassette specific panel) Mode 1.When the unit is off, Press the Mode button long to activate the lift panel function.The mark will flash. The F2 mark appears when the panel is adjusted. 2. Press the button + and - to control the lift and drop of the panel. Pressing the + button can stop the panel,while it is dropping. Pressing the - button can stop the panel,while it is lifting. 29 29 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 10. OPERATION Swing function (For the unit with left & right auto swing function only) 1 Up-Down swing Swing Press the Swing button to start up-down swing function. Press it again to stop. When the Up-Down swing function is activated,the mark appears. 2 Left-Right swing Swing Press the Swing button long to start Left-Right swing function. Press it again to stop. When the Left-Right swing function is activated, the 30 30 mark appears. Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 10. OPERATION Swing function (For the unit without left & right auto swing function models) Up-Down airflow direction and swing Swing Use SWING to adjust the up and down airflow direction. 1.Every time the user presses SWING, the louver swings six degrees. 2.Press and hold SWING for 2 seconds, it changes to the UP−DOWN SWING mode. Press SWING again to stop. When the Up-Down swing function is activated,the mark appears. (Not applicable to all the models) The operation can refer to the following instructions for the unit with four Up-Down louvers can be operated individually. 1.Press the Swing button to activate the Up-Down Swing adjusting louver function. The mark will flash.(Not applicable to all the models) 2.Pressing the button “+” or“-” can select the movement of four louvers.Each time you push the button,the wire controller select in a sequence that goes from:(the icon + -0 means the four louvers move at the same time.) -0 -1 -2 -3 -4 3. And then use Swing button to adjust the Up-Down airflow direction of the selected louver. 31 31 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 11. TIMER FUNCTIONS WEEKLY timer Use to set the operating times for each day of the week. On timer Use to start the air conditioner operation. The timer operates and the air conditioner operation starts after the time has passed. Off timer Use to stop the air conditioner operation. The timer operates and the air conditioner operation stops after the time has passed. On and Off timer Use to start and stop the air conditioner operation. The timer operates and the air conditioner operation starts and stops after the time has passed. 32 32 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 11. TIMER FUNCTIONS To set the On or Off TIMER 1 Press Timer to select the Timer or . No display 2 Confirm 3 - Press Confirm and the Clock display flashes + ex.Off timer set at PM 6:00 Press + or − to set the time. After the time is set, the timer starts or stops automatically. 4 Confirm Press Confirm again to finish the settings. 33 33 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 11. TIMER FUNCTIONS To set the On and Off TIMER 1 Press Timer to select the Timer 2 Confirm . Press Confirm and the Clock display flashes. 3 Confirm - + Press the button + or - to set the On timer and then press Confirm. 4 5 - Confirm + Press + or - to set the Off timer. Press Confirm to finish the setting. 34 34 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 12. WEEKLY TIMER 1 Weekly timer setting Confirm Timer Press Timer to select the and press Confirm. 2 Day of the week setting Confirm - + Press + or − to select the day of the week and then press CONFIRM. 3 ON timer setting of timer setting 1 Confirm - + Press + and − to select the setting time. The setting time, mode, temperature and fan speed appear on the LCD. Press CONFIRM to enter the setting time process. 35 35 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 12. WEEKLY TIMER IMPORTANT: Up to 8 scheduled events can be set on one day. Various events can be scheduled in either MODE, TEMPERATURE and FAN speeds. 4 Time setting Confirm - + ex.Tuesday time scale 1 Press + and − to set the time then press CONFIRM. 5 Operation mode setting Confirm - + Press + and − to set the operation mode then press CONFIRM. 6 Room temperature setting Confirm - + Press + and − to set the room temperature then press CONFIRM. NOTE: This setting is unavailable in the FAN or OFF modes. 36 36 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 12. WEEKLY TIMER 7 Fan speed setting Confirm - + Press + and − to set the fan speed then press CONFIRM. NOTE: This setting is unavailable in the AUTO, DRY or OFF modes. 8 Different scheduled events can be set by repeating steps 3 through 7. 9 Additional days, in a one week period, can be set by repeating steps 3 through 8. NOTE: The weekly timer setting can be returned to the previous step by pressing BACK. The current setting is restored. The controller will not save the weekly timer settings if there is no operation within 30 seconds. 37 37 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 12. WEEKLY TIMER WEEKLY timer operation To start Press Timer to select the starts automatically. Timer , and then the timer ex. To cancel Press Power to cancel the timer mode. The timer mode can also be canceled by changing the timer mode using Timer. Timer To set the DAY OFF (for a holiday) 1 Confirm 2 - After setting the weekly timer, press CONFIRM. + Press + or − to select the day of the week. 38 38 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 12. WEEKLY TIMER 3 Press DAY OFF to create an off day. Day off/Del The mark is hidden ex.The DAY OFF is set for Wednesday Set the DAY OFF for other days by repeating the steps 2 and 3. 4 5 Back/Turbo Press BACK to revert to the weekly timer. ● To cancel, follow the same procedures used for setup. ● NOTE: The DAY OFF setting is cancelled automatically after the set day has passed. Copy out the setting in one day into the other day. ● A scheduled event, made once, can be copied to another day of the week. The scheduled events of the selected day of the week will be copied. The effective use of the copy mode ensures the ease of reservation making. 1 Confirm 2 - In the weekly timer, press CONFIRM. + Press + or − to select the day to copy from. 39 39 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 12. WEEKLY TIMER 3 4 5 The Press COPY, the letters CY appear on the LCD. Copy/ Follow me - + Copy/ Follow me Press + or − to select the day to copy to. Press COPY to confirm. mark flashes quickly ex. Copy the setting of Monday to Wednesday 6 Other days can be copied by repeating steps 4 and 5. 7 Confirm Press CONFIRM to confirm the settings. 8 Back/Turbo Press BACK to revert to the weekly timer. 40 40 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 12. WEEKLY TIMER Delete the time scale in one day. 1 During the weekly timer setting, press CONFIRM. Confirm 2 3 Confirm - + - + Press + and − to select the day of the week and then press CONFIRM. Day off/Del Press + and − to select the setting time want to delete. The setting time, mode, temperature and fan speed appear on the LCD. The setting time, mode, temperature and fan speed can be deleted by pressing the DEL (day off ). ex. Delet the time scale 1 in saturday 41 41 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 13. SET EXTERNAL STATIC PRESSURE Using the wire controller to set external static pressure (some air conditioners) . • You can use the unit’s automatic airflow adjustment function to set external static pressure. • Automatic airflow adjustment is the volume of blow-off air that has been automatically adjusted to the quantity rated. 1. Make sure the test run is done with a dry coil. If the coil is not dry, run the unit for 2 hours in FAN ONLY mode to dry the coil. 2. Check that both power supply wiring and duct installation have been completed Check that any closing dampers are open. Check that the air filter is properly attached to the air suction side passage of the unit. 3. Set the parameters for automatic airflow adjustment. When the air conditioning unit is off, perform the following steps: - Press“Copy” long. - Press “+” or “-” to select the AF. - Press “Confirm”. The air conditioning ON will flash during when the unit will then start the fan for airflow fan is on during automatic automatic adjustment. airflow adjustment. DO NOT adjust the dampers when automatic airflow adjustment is active. After 3 to 6 minutes, the air conditioning unit stops operating once automatic airflow adjustment has finished. Using the wire controller to set airflow rate (some air conditioners) . When the air conditioning unit is off, perform the following steps: - Press“Copy” long. - Press “+” or “-” to select the SP. - Press “Confirm” to set the airflow. 0 means a stable airflow volume, 1 to 4 means an increase in airflow volume. - Press “Back” to finish the setting. 42 42 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 14. FAULT ALARM HANDING If the system does not properly operate except in the aforementioned cases or the aforementioned malfunctions are evident, investigate the system according to the following procedures. NO. MALFUNCTION AND PROTECTION DEFINITION DISPLAY DIGITAL TUBE 1 Communication error between wired controller and indoor unit F0 2 The faceplate is abnormal F1 Please check the indoor unit’s error display and review the owner’s manual if other error codes appear. 15.TECHNICAL INDICATION AND REQUIREMENT EMC and EMI comply with the CE certification requirements. 43 43 Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 Page Intentionally Left Blank Wired Controller IOM - KJR-120G1/TFBG-E-01 & KJR-120G2/TFBG-E-03 'XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV'HWHUPLQLQJWKH DSSOLFDWLRQDQGVXLWDELOLW\IRUXVHRIDQ\SURGXFWLVWKHUHVSRQVLELOLW\RIWKHLQVWDOOHU $GGLWLRQDOO\WKHLQVWDOOHULVUHVSRQVLEOHIRUYHULI\LQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW SULRUWREHJLQQLQJDQ\LQVWDOODWLRQSUHSDUDWLRQV ,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULO\JUDQWHGIRUWKHOLIHRIDSURGXFW 7KHUHIRUHLWLVWKHUHVSRQVLELOLW\RIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV :HOOZRUWK$YH-DFNVRQ0,3KZZZKHDWFRQWUROOHUFRP 2/2024 ">
/

Download
Just a friendly reminder. You can view the document right here. But most importantly, our AI has already read it. It can explain complex things in simple terms, answer your questions in any language, and help you quickly navigate even the longest or most compilcated documents.
Advertisement
Key features
- 12KBTU capacity
- Multi/Single inverter
- Wired controller
- Temperature control
- Fan speed adjustment
- Timer functions
- Swing modes
Frequently asked questions
Press the '+' or '-' button on the controller to adjust the desired temperature. The temperature range is from 62~86℉(17~30℃) or 62~88℉(17~31℃), depending on your model.
Yes, you can set On, Off, or On and Off timers using the controller. You can also set weekly timers for specific days and times.
Press and hold the 'Lock' button for 3 seconds to activate the child lock. To deactivate, press and hold the 'Lock' button again for 3 seconds.