Untitled - Capitol Building Supply, Inc.

Carlos Olave
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
8429 Euclid Avenue
Manassas Park, VA 20111
PHONE (703) 631-6633
Bill Lang
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
7595 Capitol Way
Marshall, VA 20115
PHONE (540) 364-1202
Tom Gardner
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
7622 Backlick Rd.
PHONE (703) 644-6970
Steve Reynolds
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
431 Mill Street, N.E.
Vienna, VA 22180
PHONE (703) 281-5151
Ben Mickey
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
195 Lenoir Drive
Winchester, VA 22603
PHONE (540) 662-9142
Jamie Bisbee
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
6813 Quad Ave.
Baltimore, MD 21237
PHONE (410) 284-2800
David Garcia
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
12340 Conway Road
Beltsville, MD 20705
PHONE (301) 937-6366
Zach Cecil
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
4501 46TH Street
Bladensburg, MD 20710-1009
PHONE (240) 764-1236
Wil Jovel
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
Gary Marshall
Showroom Manager
Gaithersburg, MD 20879
PHONE (301) 921-9207
CAPITOL BUILDING SUPPLY, INC.
700 East First St.
Hagerstown, MD 21740
PHONE (800) 760-3890 or (301) 739-3090
Ian McClure
Showroom Manager
CAPITOL BUILDING SUPPLY, INC.
113 Potomac Avenue, SW
Washington, DC 20024
PHONE (202) 554-9190
This is a stock item in most locations.
Capitol Building Supply, Inc.
*
1-800-459-5151
Store Hours: M-F 7am-5pm Sat 7am-12pm
Visit us at CBSI.net
Maintenance, Repair & Operations - 1
Striking Tools
PRY BARS AND PULLERS
PRY BARS
‡'28%/((1'('
Spring steel for strength and duUDELOLW\ H[WUD ZLGH SU\LQJ HQG IRU
OHYHUDJH DQG SU\ VXUIDFH SRLQWHG
EHYHOHG HQG IRU SHQHWUDWLRQ DQG
QDLOSXOOLQJPXOWLSOHQDLOSXOOHUVIRU
ÀH[LELOLW\DQGQDLOUHPRYDO
Our No.
Lgth
In
No.
Shf
Pk
Unit
STANLEY TOOLS
681-2838
':+7
($
076-0686
':+7
($
SAFETY KNIVES
UTILITY KNIVES
‡6(/)5(75$&7,1*
‡5(75$&7$%/(
+HDY\ GXW\ VDIHW\ NQLIH IHDWXUHV
D VSULQJ DFWLYDWHG EODGH WKDW VHOI
retracts the instant the blade loses
contact with the cutting surface,
handle and blade slide are gently
FXUYHGIRUFRPIRUWD¿QJHUJURRYHRQWKHEDFNWRKHOS
secure grip when cutting, durable rounded metal tip that
IXQFWLRQV DV D WDSH VOLWWHU VFUHZGULYHU VWDSOHUHPRYHU
DQGPRUH)RUULJKWRUOHIWKDQGHGXVH8VHGIRUFXWWLQJ
corrugate, boxes, plastic strapping, shrink-wrap, rubber,
OHDWKHU SRVWHU ERDUG DQG PRUH 5HSODFHPHQW EODGHV
6.%6.8¶VDQG
Standard grip, optimized cutting
angle, slide assembly with three
positions, magnetic nose, captured
screw and inside storage for up to
¿YHEODGHV,QFOXGHVRQH,UZLQ
EOXHEODGHRU
Our No.
Cut
Depth mm
No.
Shf
Pk
Shf
Pk
No.
Unit
IRWIN INDUSTRIAL
462-7626
&'
Unit
UTILITY KNIVES
OLFA-NORTH AMERICA
016-3766
Our No.
($
‡5(75$&7$%/(
Cutting & Shaping
KNIFE - UTILITY
SAFETY KNIVES
UTILITY KNIVES
‡6(/)5(75$&7,1*
‡)2/',1*
‡³60$57('*(´
Features a spring retractable blade
that automatically retracts the
instant the blade loses contact
with the cutting surface, powerful return spring, stainless steel
blade channel, ergonomic grip, and can be used right or
OHIWKDQGHG 8VHV 6.% UHSODFHPHQW EODGHV 6.8 ¶V
DQG
%ODGH H[WHQGV DV NQLIH LV RSHQHG
EODGH UHOHDVH EXWWRQ IRU TXLFN
blade changes, locking design folds
IRUVWRUDJH6XSHUVWURQJFXWDZD\
DOXPLQXPKDQGOH
Our No.
No.
Shf
Pk
Unit
Our No.
AMERICAN SAFETY RAZOR
763-3019
UTLITY KNIVES
Shf
Pk
Unit
($
5HWUDFWDEOH EODGH WKDW RIIHUV D
YDULDEOH FXW GHSWK 7KH UDSLG ORDG
blade change has an easy access
EXWWRQ IRU TXLFN EODGH FKDQJH ,W
KDV D IROGLQJ IHDWXUH IRU TXLFN DQG HDV\ RQHKDQGHG
RSHQLQJFORVLQJDQGEODGHVWRUDJHIRUFRQYHQLHQWDFFHVV
WR QHZ EODGHV ,W KDV D UXJJHG PHWDO ERG\ IRU ORQJ
WRROOLIH
Shf
Pk
No.
Unit
STANLEY TOOLS
':+7/
‡5(75$&7$%/(
‡³63(('3$.´
(UJRQRPLFQRQVOLSJULSTXLFNDQG
HDV\ EODGH UHSODFHPHQW ,QFOXGHV
WHQ EODGH UHSODFHPHQW FDUWULGJH 8VH ZLWK UHSODFHPHQWEODGHFDUWULGJHV
Our No.
No.
Shf
Pk
($
‡5(75$&7$%/(
Switchblade self retracting utility
knife allows blade exposure only
ZKHQ EXWWRQ LV SUHVVHG IRUZDUG
2UDQJH ¿QLVK GLH FDVW ]LQF DOOR\
FRQVWUXFWLRQ KHDY\ GXW\ URXQGHG WLS EODGH LQFOXGHG
5RXQGHGWLSEODGHH[SRVXUH´SRLQWHGWLSEODGHH[SRVXUH´
Our No.
No.
Shf
Pk
Unit
($
+HDY\GXW\ ,QFOXGHV 'HOULQ VOLGHU
'RXEOHRYHUODSGLHFDVWNQLIHZLWK
EODGHV 8QLYHUVDO EODGH V\VWHP
DQ\EODGHPDGHZLOO¿W
Our No.
No.
5.
($
‡5(75$&7$%/(
‡$872/2$'
‡³785%2352´
Our No.
No.
Lgth
In
Shf
Pk
Unit
OLYMPIA TOOLS INTERNATIONAL
716-3025
($
Shf
Pk
‡5(75$&7$%/(
‡³785%2.1,)(;´
No.
Color
Shf
Pk
Unit
OLYMPIA TOOLS INTERNATIONAL
Unit
($
160-4289
&DPR
($
357-4928
5HG
($
772-5575
%OXH
($
842-5431
Gold
($
HYDE TOOLS
798-7696
UTILITY KNIVES
Our No.
ALLWAY TOOLS INC
502-3759
383-6814
5REXVWFRPSRVLWLRQZLWKTXDOLW\UHWUDFWLRQPHFKDQLVP)RUDGGLWLRQDO
safety, the open and close security
button releases and locks the blade
LQ SODFH &RPIRUWDEOH DQG HUJRQRPLF GHVLJQ ZLWK KDQJ
KROHLQFDVLQJWDLO
UTILITY KNIVES
‡6(/)5(75$&7,1*
‡6:,7&+%/$'(
Unit
IRWIN INDUSTRIAL
UTILITY KNIVES
($
UTILITY KNIVES
Shf
Pk
No.
Unit
ACME UNITED CORPORATION
722-1336
Our No.
Quick blade change button,
smooth slide mechanism, anti-slip
grip, carabineer hook, cast alumiQXP KDQGOH WKXPE LQGHQW FRPSDFW VL]H ZLWK EODGH
VWRUDJHLQKDQGOH
UTILITY KNIVES
‡)2/',1*
‡5(75$&7$%/(
540-8737
Cut
Depth mm
OLFA-NORTH AMERICA
($
220-5896
Our No.
No.
Smooth, three position slide exSRVHVYDULDEOHEODGHOHQJWKVVFUHZ
permanently captured in casing to
SUHYHQWORVVIHDWXUHVLQVLGHVWRUDJHIRUXSWREODGHV
LQFOXGHVWKUHHXQEUHDNDEOHEOXHEODGHV
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
Cutting & Shaping
UTILITY KNIVES
No.
‡61$32))
‡5(75$&7$%/(
Lgth
In
Shf
Pk
Unit
STANLEY TOOLS
658-7737
‡61$32))
‡08/7,%/$'($872/2$'
UTILITY KNIVES
,QWHUORFNLQJQRVHWRKROGEODGHVHcurely, three position, retractable
EODGH EODGH VWRUDJH LQ KDQGOH
,QFOXGHV WKUHH KHDY\ GXW\
EODGHVXVHUHSODFHPHQWEODGHV
Our No.
UTILITY KNIVES
KNIFE - SNAP OFF
‡5(75$&7$%/(
‡³&/$66,&´
&'
PP PXOWLEODGH NQLIH RIIHUV FRQtinuous blade change with its auWRPDWLF EODGH ORDG IHDWXUH KROGV
XS WR ¿YH PP VQDSRII EODGHV
WRVWRUHFXWWLQJVHJPHQWVSHUORDGDXWRPDWLFEODGH
ORFN HDV\ WRROIUHH EODGH FKDQJH IRU FRQYHQLHQFH LQFOXGHV8OWUD6KDUSEODFNEODGHV
5HWUDFWDEOHNQLIHIRUOOLJKWGXW\FXWWLQJ DQG WULPPLQJ %ODGH VHFWLRQV
VQDSVRIISURYLGLQJWKHXVHUZLWKD
IUHVKVKDUSFXWWLQJSRLQW,QFOXGHV
RQHTXLFNSRLQWEODGH
Our No.
No.
Blade
Type
Shf
Pk
Unit
SW
($
STANLEY TOOLS
043-9943X
3
Our No.
No.
Ht
mm
Shf
Pk
Unit
OLFA-NORTH AMERICA
459-1814
($
UTILITY KNIVES
‡5(75$&7$%/(
‡³48,&.&+$1*(´
Our No.
No.
Lgth
In
Shf
Pk
Unit
STANLEY TOOLS
647-9760
UTILITY KNIVES
UTILITY KNIVES
&KDQJHEODGHVTXLFNO\ZLWKVFUHZGULYHU WKUHH SRVLWLRQ UHWUDFWDEOH
blade slide, swing out blade storage magazine and integrated string
FXWWHUHYHQZKHQEODGHLVUHWUDFWHG,QFOXGHVWKUHH
EODGHV8VHUHSODFHPHQWEODGHVRU
/LJKWGXW\ UHWUDFWDEOH NQLIH ZLWK
4XLFN3RLQW VQDSRII EODGHV %ODGH
VHFWLRQV VQDS RII SURYLGLQJ IUHVK
VKDUSFXWWLQJSRLQWV5HPRYDEOHEODGHVQDSSHULQFOXGHG
LQFDSRINQLIHDQGSRFNHWFOLSLQFOXGHVRQHEODGH
Our No.
&'
‡61$32))
‡58%%(5*5,3
‡),%(5*/$66(1)25&('
‡61$32))
‡5(75$&7$%/(
‡³48,&.32,17´
No.
Blade
Type
Shf
Pk
Unit
STANLEY TOOLS
378-5409
SW
($
‡5(75$&7$%/(
‡³,167$17&+$1*(´
Lgth
In
Shf
Pk
Unit
STANLEY TOOLS
642-6662
No.
Handle
Lgth. In
Shf
Pk
Unit
($
Ht
mm
Shf
Pk
Unit
OLFA-NORTH AMERICA
($
Shf
Pk
Unit
($
No.
‡61$32))
‡58%%(5*5,3
‡),%(5*/$66(1)25&('
+HDY\GXW\FXWWHUIHDWXUHVFKHPLcal resistant, anti slip cushion-grip,
¿EHUJODVV KDQGOH KHDY\ JDXJH
stainless steel blade channel holds blade tight, autoORFNEODGHVOLGHYHUVDWLOHPHWDOSLFNRSHQVSDLQWFDQV
URSHORRSFXWVGU\ZDOOURR¿QJOLQROHXPLQVXODWLRQYLQ\O RU DFHWDWHV LQFOXGHV 8OWUD6KDUS EODFN FDUERQ WRRO
VWHHOVQDSRIIEODGHV8VHVUHSODFHPHQWEODGHV/%/%%
DQG /+ 6.8 ¶V DQG
No.
Ht
mm
Shf
Pk
Unit
OLFA-NORTH AMERICA
228-2572
$OO PHWDO ERG\ WKDW LV KHDY\GXW\
DQG UXVW UHVLVWDQW D QDUURZ ERG\
IRUPDQHXYHUDELOLW\DQGHDV\VWRUDJH 7KLV SURGXFW DOVR KDV DQ LQtegrated blade snapper for easy
EODGHVQDSSLQJDQGDULEEHGKDQGOHIRUJULSDQGFRQWURO
Our No.
UTILITY KNIVES
Our No.
‡61$32))
STANLEY TOOLS
Our No.
UTILITY KNIVES
%ODGH ZLSHU UHPRYHV H[FHVV GLUW
and protects knife, blade clamp
eliminates blade wobble, push
button blade change without tools
DQGSRSXSEODGHGLVSHQVHU(UJRQRPLFVRIWWRXFKSDQHOVJULSVDOORZEHWWHUFRQWURO,QFOXGHVWZR)DW0D[
EODGHV
677-5795
0DGHZLWKVWDLQOHVVVWHHODQGKLJK
LPSDFW SRO\PHU FRPSRQHQWV 6HOI
locking slider mechanism, snap off
EODGHVSURYLGHIUHVKVKDUSFXWWLQJ
SRLQWV UHPRYDEOH EODGH VQDSSHUDQGDKDQJKROHIRUVWRUDJHRUODQ\DUG(UJRQRPLF
KDQGOHDQGKLJKYLVVSDUHEODGHKROGHU,QFOXGHVWZR
KHDY\GXW\EODGHV
642-6563
‡5(75$&7$%/(
‡³)$70$;´
No.
‡61$32))
STANLEY TOOLS
($
UTILITY KNIVES
Our No.
No.
UTILITY KNIVES
&DVW PHWDO FRUH ZLWK ELPDWHULDO
soft panels for a sure grip with
FXUYHGKDQGOHDQGDSDGGHGWKXPE
UHVW 3XVK EXWWRQ EODGH FKDQJH
swing out blade storage, large hang hole, integrated
VWULQJ FXWWHU DQG UHWUDFWDEOH VOLGH ,QFOXGHV WKUHH
KHDY\ GXW\ EODGHV 8VH UHSODFHPHQW EODGHV RU
No.
Our No.
692-1118
UTILITY KNIVES
Our No.
([WUDKHDY\GXW\FXWWHUZLWKFXVKLRQJULS ¿EHUJODVV KDQGOH KHDY\
gauge stainless steel blade channel
KROGV EODGH WLJKW UDWFKHW ZKHHO EODGH ORFN URSH ORRS
cuts insulation board, rope, carpet, rubber, drywall and
URR¿QJLQFOXGHV8OWUD6KDUSEODFNFDUERQWRROVWHHOVQDS
RIIEODGHV5HSODFHPHQWEODGH+%6.8¶V
DQG
Blade
Type
Shf
Pk
Unit
STANLEY TOOLS
860-2625
':+7
PP
($
987-2540
':+7
PP
($
459-1780
':+7
PP
($
($
UTILITY KNIVES
‡61$32))
‡58%%(5*5,3
‡),%(5*/$66(1)25&('
Standard duty multipurpose knife
features an auto lock, cushionJULS ¿EHUJODVV KDQGOH KHDY\
gauge stainless steel blade channel that holds blade
tight and a pocket clip that includes a blade snapper,
chemical resistant handle for easy cleaning, and easy
WRROIUHH EODGH FKDQJH FXWV ZDOOSDSHU OLQROHXP URSH
DQGOHDWKHULQFOXGHV8OWUD6KDUSEODFNFDUERQWRROVWHHO
VQDSRIIEODGHVUHSODFHPHQWEODGHV$%DQG$%%6.8
¶VDQG
Our No.
No.
Ht
mm
Shf
Pk
Unit
OLFA-NORTH AMERICA
123-8328
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
Maintenance, Repair & Operations - UTILITY KNIVES
UTILITY KNIVES
UTILITY KNIVES
‡61$32))
‡$%6+$1'/(
‡61$32))
‡58%%(5*5,3,16(7
)HDWXUHV D GXUDEOH $%6 SODVWLF
handle and a one-touch blade
VOLGH ORFN FXWV VW\URIRDP FRUUXJDWH FDUGERDUG SDSHU EODGHV
PDGHIURPKLJKTXDOLW\FDUERQWRROVWHHOIRUVKDUSQHVV
DQGVXSHULRUHGJHUHWHQWLRQ/RQJODVWLQJGXUDEOHVQDS
RII EODGH 8VHV UHSODFHPHQW EODGHV /% /%% 6.8 ¶V
Features a ratchet wheel blade lock
WRSUHYHQWVOLSSLQJUXEEHUJULSLQVHWURSHORRSKHDY\JDXJHVWDLQless steel blade channel that holds
EODGHWLJKW6QDSRIIEODGHPDGHIURPKLJKTXDOLW\FDUERQWRROVWHHOIRUVKDUSQHVVDQGHGJHUHWHQWLRQ8VHGIRU
FXWWLQJWKURXJKGLI¿FXOWPDWHULDOVVXFKDVGU\ZDOOLQVXODWLRQERDUGURSHVRG5HSODFHPHQWEODGH+%6.8¶V
DQG
‡',63/$<3,(&(6
‡3/$67,&%8&.(7
‡352027,21$/&877(5
Our No.
No.
Ht
mm
Shf
Pk
Unit
OLFA-NORTH AMERICA
531-4679
Our No.
No.
Ht
mm
Shf
Pk
Unit
3RVLWLYH ORFN VQDS RII FXWWLQJ WRRO
ZLWK SRFNHW FOLSEODGH VQDSSHU
HDFK FXWWHU LQFOXGHV DQ $% %ODGH
3UHORDGHG EXFNHW 5HSODFHPHQW EODGHV $% DQG $%%
6.8¶VDQG
Our No.
No.
Shf
Pk
Unit
1
',63
OLFA-NORTH AMERICA
319-6706
OLFA-NORTH AMERICA
($
252-9519
($
Measuring & Marking
TAPE MEASURES / TAPE RULES
UTILITY KNIVES
‡61$32))
‡67$,1/(6667((/
Features an adjustable metal cutWLQJJXLGHEXLOWLQVWDSOHUHPRYHU
UDWFKHW ZKHHO EODGH ORFN KHDY\
duty stainless steel blade channel that holds blade tight,
DQGDVWXUG\ÀDWFXWWLQJEDVHIRUVWDELOLW\DQGDSHUIHFW
GHJUHHHGJHFXWVGURSFHLOLQJWLOHVFDUGERDUGFRUSODVWIRDPERDUGJDWRUERDUG8VHVUHSODFHPHQWEODGHV
/%/%%6.8¶V
Our No.
No.
Ht
mm
Shf
Pk
Unit
&RQYHQLHQW SRFNHW VL]HG FDUWRQ
FXWWHUZLWKVOLGLQJVWHHOEODGHFRYHU
DQG VHJPHQWHG EODGHV 6LPLODU LQ
DSSHDUDQFH WR UD]RU NQLYHV ZLWK
WKH DGGHG IHDWXUH RI D VHJPHQW
VQDSEODGH,QFOXGHV&7%FDUERQWRROVWHHOEODGHV
8VHV&7%UHSODFHPHQWEODGHV6.8
Shf
Pk
Unit
&'
OLFA-NORTH AMERICA
650-8493
No.
Ht
mm
Shf
Pk
Unit
($
Features a ratchet wheel blade
ORFN DQG D KHDY\ JDXJH VWDLQOHVV
steel blade channel that holds
EODGH WLJKW %ODGHV DUH PDGH IURP KLJK TXDOLW\ FDUERQ
WRROVWHHO$QWLVOLSDOORYHUUXEEHUJULSKDQGOHVSURYLGH
SUHPLXPFRPIRUWPD[LPXPSHUIRUPDQFH7KHDFHWRQH
resistant, elastomer handle with a poly-acetate locking
PHFKDQLVPPDNHVLWDQRI¿FLDODFHWRQHUHVLVWDQWFXWWHU
(DV\ WRROIUHH EODGH FKDQJH 8VHV UHSODFHPHQW EODGHV
/%/%%DQG/+6.8¶V
DQG
No.
Ht
mm
Shf
Pk
UTILITY KNIVES
‡61$32))
‡58%%(5*5,3,16(7
Features a ratchet wheel blade
lock, an anti-slip rubber grip inset
DQG D KHDY\ JDXJH VWDLQOHVV VWHHO
blade channel that holds blade
WLJKW,QFOXGHVKLJKHVWJUDGHFDUERQWRROVWHHOVQDSRII
EODGHIRUDQHZVKDUSHGJHZLWKHDFKVQDSFXWVGU\ZDOO
URR¿QJOLQROHXPLQVXODWLRQYLQ\ORUDFHWDWHVHDV\WRRO
IUHHEODGHFKDQJH8VHGWRFXWSDSHUFDUGERDUGURR¿QJ
GU\ZDOOYLQ\ORUDFHWDWHV8VHVUHSODFHPHQWEODGHV/%
/%% DQG /+ 6.8 ¶V DQG
Our No.
No.
Ht
mm
Shf
Pk
Unit
OLFA-NORTH AMERICA
215-3278
($
‡',63/$<3,(&(6
‡3/$67,&%8&.(7
‡&877(5
&XWWHUVIHDWXUHDVOLGHORFNSRFNHW
clip and built-in blade snapper with
PHWDO KDQGOH 'LVSOD\ FRQWDLQV
FXWWHUV5HSODFHPHQWEODGHV$%DQG$%%6.8
¶VDQG
Our No.
No.
Shf
Pk
Unit
1
',63
OLFA-NORTH AMERICA
No.
Blade
W InxL Ft
Shf
Pk
Unit
988-9726
[
($
‡%,0$7(5,$/&$6(
‡)5$&7,21$/5($'
‡0$*1(7,&7,3
‡³/(9(5/2&.´
'XUDEOH ELPDWHULDO FDVH ZLWK EHOW
FOLS 6HOI ORFNLQJ EODGH ZLWK IUDFtional read blade graphics, magnetic end hook and Tru=HURKRRNIRUDFFXUDF\
Our No.
No.
Blade W In
xL Ft
Shf
Pk
Unit
STANLEY TOOLS
154-3925
[
($
TAPE RULES
UTILITY KNIVES
141-1545
Our No.
Unit
OLFA-NORTH AMERICA
574-2358
'XUDEOH ELPDWHULDO FDVH ZLWK VOLS
UHVLVWDQW UXEEHU RYHU PROG ZLWK
EHOW FOLS RQ EDFN RI FDVH $LU/RFN
rubber slide lock, multi-catch hook,Tru-Zero hook with
QDLOKHDGVORW$FFXUDWHLQWHULRUDQGH[WHULRUPHDVXULQJ
with large, easy to read blade graphics, nail slot for meaVXULQJUDGLXV¶EODGHVWDQGRXW
TAPE RULES
‡61$32))
‡&216758&7,21
‡58%%(5*5,3
Our No.
‡%,0$7(5,$/&$6(
‡(1*/,6+6&$/(
‡³0$;´
STANLEY TOOLS
UTILITY KNIVES
‡%2;&877(5
No.
Our No.
198-6819
($
UTILITY KNIVES
Our No.
Features automatic blade lock,
built in pocket clip/blade snapper
and a stainless steel blade channel
WKDW KROGV EODGH WLJKW (DV\ WRRO
IUHHEODGHFKDQJHZLWKKLJKTXDOLW\VQDSRIIEODGHV)RU
ULJKW DQG OHIW KDQGHG XVH 8VHG LQ PRLVW HQYLURQPHQWV
ZKHUH UXVW LV D FRQFHUQ 5HSODFHPHQW EODGHV $% DQG
$%%6.8¶VDQG
OLFA-NORTH AMERICA
OLFA-NORTH AMERICA
427-6622
TAPE RULES
UTILITY KNIVES
‡61$32))
‡%2;&877(5
‡'(*5((&877,1*%$6(
‡$%6&$6(
‡0(75,&(1*/,6+
‡³0$;´
+LJKLPSDFW\HOORZ$%6LQHDV\WR
see with cushion grip for a comfortable, slip resistant hold and an
DOOUXEEHUSDWHQWHG$LU/RFNVOLGH7KUHHULYHWFRUURVLRQ
UHVLVWDQW WUXH ]HUR KRRN PRYHV DFFXUDWHO\ WR DOORZ IRU
SUHFLVH LQVLGHRXWVLGH PHDVXUHPHQWV 0\ODU SRO\HVWHU
¿OPH[WHQGVOLIHRIHQWLUHEODGHZLWKHDV\WRUHDGKLJK
FRQWUDVW EODGH ZLWK ´ DQG ´ VWXG PDUNLQJV DQG
0HWULF(QJOLVKEODGHPDUNLQJV
Our No.
No.
Blade
W InxL Ft
Shf
Pk
Unit
STANLEY TOOLS
634-6217
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
[
($
- Maintenance, Repair & Operations
TAPE RULES
TAPE RULES
TAPE RULES
‡$%6&$6(
‡32:(55(7851
‡³)$70$;´
‡$%6&$6(
‡³32:(5/2&.´
‡0(7$/&$6(
‡³32:(5/2&.´
0HWDOOLF$%6FDVHKDVDZHDUSODWH
that protects case from cuts and
QLFNV %ODGH$UPRU FRDWLQJ RQ WKH
¿UVW ´ PD[LPL]HV GXUDELOLW\ RI
KRRNHQG0\ODUSRO\HVWHU¿OPH[WHQGVOLIHRIHQWLUHEODGH
DQG LPSURYHV PHDVXUHPHQW YLVLELOLW\ )RUZDUG EODGH
ORFN GHVLJQ VLPSOL¿HV ORFNLQJ DQG XQORFNLQJ WKH EODGH
ZLGH EODGH IRU HDV\ UHDGDELOLW\ 7KUHHULYHW FRUURVLRQ
UHVLVWDQW KRRN PRYHV IRU DFFXUDWH LQVLGHRXWVLGH PHDVXUHPHQWV´DQG´VWXGFHQWHUPDUNLQJVVLPSOLI\
IUDPLQJMREV¶WDSHVWDQGRXW
(DV\ UHDGDELOLW\ ¶ VWDQGRXW VHFXUH EODGH ORFN ZRQ¶W FUHHS 6SHcial Tru-Zero hook does doubleGXW\DVDSLYRWIRUGUDZLQJFLUFOHV
DQG DUFV (QWLUH EODGH FRDWHG ZLWK 0\ODU SRO\HVWHU ¿OP
for added durability, heat-treated spring stands up to reSHDWHGXVH´DQG´VWXGFHQWHUPDUNLQJV7KUHH
ULYHWFRUURVLRQUHVLVWDQWKRRNPRYHVIRUDFFXUDWHLQVLGH
RXWVLGHPHDVXUHPHQWV
:LGH EODGH IRU HDV\ UHDGDELOLW\
ZLWK %ODGH$UPRU FRDWLQJ RQ WKH
¿UVW ´ WKDW PD[LPL]HV GXUDELOLW\
RI KRRN HQGP\ODU SRO\HVWHU ¿OPH[WHQGV OLIH RI HQWLUH
EODGHDQG¶WDSHVWDQGRXW+LJKLPSDFW$%6FDVHZLWK
UXEEHU RYHU PROG LV MREVLWH WRXJK WRS IRUZDUG EODGH
ORFN´DQG´VWXGFHQWHUPDUNLQJVVLPSOLI\IUDPLQJ
MREV &XVKLRQ JULS SURYLGHV FRPIRUWDEOH VOLSUHVLVWDQW
KROGDQGKRRNJUDEVRQVLGHWRSRUERWWRPIRUYHUVDWLOLW\
Our No.
No.
Blade
W InxL Ft
Shf
Pk
Unit
STANLEY TOOLS
612-3012
[
&'
775-8733
[
&'
818-4400
[
&'
Our No.
No.
Blade
W InxL Ft
Shf
Pk
Unit
STANLEY TOOLS
467-1459
[
&'
TAPE RULES
‡$%6&$6(
‡+,*+9,6,%,/,7<
:HOO VXLWHG IRU DOO W\SHV RI OD\RXW
DQGPHDVXULQJZRUN7KH¶EODGH
standout makes it easy to take
those long measurements without
WKHQHHGRIDQH[WUDVHWRIKDQGV
7KH EODGH LWVHOI LV FRYHUHG ZLWK D
SURWHFWLYH0\ODUFRDWLQJWKDWKHOSVLWUHVLVWFKLSSLQJDQG
FUDFNLQJ
+LJK LPSDFW KLJKYLVLELOLW\ \HOORZ
case stands, High-contrast blade
IRUHDV\UHDGDELOLW\ZLWKD¶VWDQGRXW
Our No.
No.
Wdth In x
Lgth Ft
Shf
Pk
Unit
No.
Blade
W InxL Ft
Shf
Pk
Unit
[
&'
[
($
047-8321
':+7/
[
($
244-1764
':+7/
[
($
[
&'
[
&'
672-0825
[
&'
(QWLUH EODGH FRDWHG ZLWK 0\ODU
SRO\HVWHU ¿OP IRU GXUDELOLW\ +HDW
treated spring stands up to repeatHGXVDJHSRVLWLYHEODGHORFNZRQ¶W
FUHHS JUDGXDWHG LQ WKV RI DQ
LQFK6SHFLDO7UX=HURKRRNGRHVGRXEOHGXW\DVDSLYRW
IRUGUDZLQJFLUFOHVDQGDUFV%HOWFOLSRQEDFNRIFDVH
Our No.
‡58%%(56+(//&$6(
‡32:(55(7851
Wdth In x
Lgth Ft
Shf
Pk
Unit
STANLEY TOOLS
377-8511
':+7/
[
($
107-1646
':+7/
[
($
173-6917
':+7/
[
($
Blade
W InxL Ft
No.
Shf
Pk
Unit
[
&'
Safety & Organization
HEAD PROTECTION
(DV\WRUHDGEODGH7UXH]HURQRQ
VOLS WULSOH ULYHWHG HQG KRRN ZLWK
KHDY\GXW\ VSULQJ (DV\ WR KROG
UXEEHUVKHOOKRXVLQJ
IHHW RI EODGH VWDQGRXW IRU LQFUHDVHGXVHUUHDFKH[WUDODUJHHQG
hook grabs construction material
IURP DOO VLGHV 0 7KHUPRSODVWLF¿OPKHOSVWRSURWHFWEODGHIURP
GDPDJH P\ODU EODGH FRDWLQJ IRU
ORQJHUEODGHOLIHGXRGXURPHWHUEODGHORFNIRUGXUDELOLW\
DQG FRPIRUW ZLGH EODGH DQG ODUJH QXPEHUV PDNH WKH
WDSHHDV\WRUHDGKHDWWUHDWHGVSULQJIRUEODGHGXUDELOity and smooth rewind and belt clip for easy attachment
DQGVWRUDJH
No.
658-8826
TAPE RULES
TAPE RULES
Our No.
614-5502
646-1032
':+7/
Unit
STANLEY TOOLS
STANLEY TOOLS
STANLEY TOOLS
684-8006
Shf
Pk
‡0(7$/&$6(
STANLEY TOOLS
621-0140
Blade
W In.xL Ft.
No.
TAPE RULES
TAPE RULES
Our No.
Our No.
SAFETY HATS
No.
349-2287
-/:/
[
&'
314-6065
-/:/
[
&'
Our No.
Shf
Pk
‡&$3%5,0
‡³6(175<,,,´
Blade
W InxL Ft
Unit
MINTCRAFT
8QLYHUVDOVORWVDFFRPPRGDWHKHDUing, welding and face shield accesVRULHV&RPIRUWDEOHVL[SRLQWQ\ORQ
VXVSHQVLRQZLWKµ&RROPD[&0¶WHUU\
FORWKVZHDWEDQG
Our No.
424-3648
&KURPHFDVHZLWKRYHUPROGKROGV
XS WR KHDY\ XVH FXVKLRQ JULS IRU
FRPIRUWDEOH VOLSUHVLVWDQW KROG
%ODGH$UPRU FRDWLQJ RQ WKH ¿UVW
´PD[LPL]HVGXUDELOLW\RIKRRNHQG+LJKYLVLELOLW\0\ODU
SRO\HVWHU¿OPH[WHQGVOLIHRIHQWLUHEODGHDQGLPSURYHV
PHDVXUHPHQW YLVLELOLW\ :LGH EODGH IRU HDV\ UHDGDELOLW\
DQGD¶WDSHVWDQGRXW7RSIRUZDUGEODGHORFNPDNHV
locking and unlocking a cinch,hook grabs on side, top or
ERWWRPIRUYHUVDWLOLW\´VWXGFHQWHUPDUNLQJVVLPSOLI\
IUDPLQJMREV
Unit
Blade
W InxL Ft
Shf
Pk
[
<HOORZ
($
SAFETY HATS
‡&$3%5,0
‡+(//5$,6(5
‡³6&´
Unit
Smooth dome design with low
SUR¿OH GHVLUHG PRVW E\ LQGXVWU\
SURIHVVLRQDOV 'HVLJQHG WR ZLWKVWDQGWHPSHUDWXUHYDULDQFHVKXPLGLW\DQGH[SRVXUHWR
89OLJKWIRUORQJODVWLQJZHDU0HHWV$16,=7\SH
&ODVV&*DQG(
($
Our No.
STANLEY TOOLS
800-1810
Shf
Pk
6 Pt. Pinlock System
‡0(7$/&$6(
‡³)$70$;;75(0(´
No.
Color
JACKSON SAFETY
TAPE RULES
Our No.
No.
Shf
Pk
No.
Unit
JACKSON SAFETY
4 Pt. Ratchet Suspension
466-3175
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
Maintenance, Repair & Operations - SAFETY HATS
REPLACEMENT
SUSPENSION UNITS
‡&$3%5,0
‡$0(5,&$1($*/(
&RPIRUWDEOH SRLQW ZHEEHG VXVpension system with pinlock adjustment that includes a perforated
YLQ\O VZHDWEDQG DQG DGMXVWDEOH
Q\ORQFURZQVWUDSV+DUGKDWVROGVHSDUDWHO\
Shf
Pk
No.
Unit
JACKSON SAFETY
909-9342
Fits
Hat Size
Shf
Pk
Unit
1
($
SAFETY HAT LINERS
Shf
Pk
Our No.
Unit
No.
895-4570
($
72%(',6&2
Our No.
No.
Shf
Pk
Unit
POULAN
090-6164
1 UHVSLUDWRU IHDWXUHV WKH 0
FRRO ÀRZ H[KDODWLRQ YDOYH FRPfortable foam face seal, adjustable
straps, and lightweight construcWLRQ5HVSLUDWRUVDUHLQGLYLGXDOO\SDFNDJHG1,26+VKLJKHVWUDWHG¿OWUDWLRQHI¿FLHQF\LQDPDLQWHQDQFHIUHHUHVSLUDWRUDQGSURYLGHVDPLQLPXP¿OWHUHI¿FLHQF\RI
SHUFHQWDJDLQVWQRQRLOEDVHGSDUWLFOHV
No.
Shf
Pk
Unit
($
3M
($
872-7273
REPLACEMENT
SUSPENSION UNITS
RESPIRATORS
‡/($'3$,17
,PSURYHG UDWFKHW KHDGJHDU SURYLGHV RYHU DGMXVWPHQWV IRU
FRPIRUWDEOH ¿W ZLWKRXW UHPRYLQJ
KHDGJHDU 2QH SLHFH VRIW DQG
GXUDEOH Q\ORQ KHDGEDQG ZLWK ZRYHQ Q\ORQ FURZQ KHDG
VWUDSV DEVRUEHQW FORWK VZHDWEDQG DQG WZR FURZQ
KHLJKW DGMXVWPHQWV )LUP VHFXUH ¿W PDNHV WKH KHDG
KXJJHUYDOXDEOHLQFDSVFDUU\LQJPRXQWHGDFFHVVRULHV
1UHVSLUDWRUKHOSVUHGXFHH[SRsure to airborne particles that do
QRW FRQWDLQ RLO $GMXVWDEOH VWUDSV
for easy custom strap tension for
VHFXUH FRPIRUWDEOH ¿W DQG LV UHFRPPHQGHG IRU SURIHVVLRQDO OHDG SDLQW UHPRYDO 126+
DSSURYHG
No.
Shf
Pk
Unit
JACKSON SAFETY
579-7923
Our No.
No.
Shf
Pk
Unit
3M
101-5627
Our No.
No.
Shf
Pk
Unit
MSA SAFETY WORKS
388-3899
1
($
RESPIRATOR
FILTER CARTRIDGES
‡3$,173(67,&,'(
‡³+($'+8**(5´
Our No.
RESPIRATORS
Soft blue material is both lightZHLJKW DQG PROGHG LQ D XQLTXH
nosebridge style helps the respiraWRU ¿W XVHUV EHWWHU LQ WKH QRVH DUHD DQG DGDSWV EHWWHU
WR XVHUV¶ IDFHV $SSURYHG E\ 1,26+ XQGHU WKH QHZ &)5UHVSLUDWRUFHUWL¿FDWLRQUHJXODWLRQVWKH3¿OWHU
FODVVDVZHOODVIRUDPPRQLDRUJDQLFYDSRUVFKORULQH
hydrogen chloride, chlorine dioxide, sulfur dioxide, hyGURJHQ VXO¿GH IRU HVFDSH RQO\ IRUPDOGHK\GH K\GURJHQÀXRULGHDQGPHWK\ODPLQHJDVHV
‡3$57,&8/$7(
‡/($'3$,17
Our No.
($
($
RESPIRATORS
3URIRUHVWKHOPHWV\VWHP,QFOXGHV
89SURWHFWHGKDUGKDWDGMXVWDEOH
point suspension, hearing protectors, face screen, rain and neck
SURWHFWRU QHZ KLJK YLVLELOLW\ RUDQJHFRORUIRULPSURYHGVDIHW\PHHWV$16,=
FODVV *(& VWDQGDUGV $9$,/$%/( 72 5(*,67(5('
+8649$51$'($/(5621/<
Safety & Organization
‡+(/0(76<67(0
‡08/7,385326(
‡+$/)0$6.
RESPIRATORY PROTECTION
SAFETY HATS
Unit
Unit
4 pt. Ratchet Suspension
328-5608
Shf
Pk
Shf
Pk
MSA SAFETY WORKS
284-0437
JACKSON SAFETY
No.
MSA SAFETY WORKS
8QLYHUVDOVL]HDOORZVLWWR¿WLQVLGH
DQ\KDUGKDW6RIWWZRSO\OLQHUIRU
H[WUDZDUPWK)ODPHUHVLVWDQWVKHOO
PDWHULDO$GMXVWDEOHKRRNDQGORRS
FKLQVWUDS+RRNDQGORRSVWUDSVVHFXUHOLQHUWRKDUGKDWVXVSHQVLRQ
Smooth dome design with low
SUR¿OHGHVLJQHGWRZLWKVWDQGWHPSHUDWXUH YDULDQFHV KXPLGLW\ DQG
89OLJKW0HHWV$16,=7\SH
&ODVV&*DQG(
)HDWXULQJVXSHULRUDFWLYDWHGFDUERQ
cartridges and large surface area
SUH¿OWHUV ZKLFK DUH GHVLJQHG DV
small, collapsed conically shaped
¿OWHUV6RIWEOXHPDWHULDOLVERWKOLJKWZHLJKWDQGPROGHG
LQDXQLTXHQRVHEULGJHVW\OHKHOSVWKHUHVSLUDWRU¿WXVHUVEHWWHULQWKHQRVHDUHDDQGDGDSWVEHWWHUWRXVHUV¶
IDFHV$SSURYHGE\1,26+XQGHUWKH1,26+&)5
UHVSLUDWRUFHUWL¿FDWLRQUHJXODWLRQVDSSURYHGWRWKH5
29FDWHJRU\5¿OWHUVDUHDWOHDVWSHUFHQWHI¿FLHQW
against oil based contaminants, and resist degradation
IRUDWOHDVWDQKRXUVKLIW7KH29FODVVL¿FDWLRQPHDQV
WKDWWKHUHVSLUDWRULVDOVRDSSURYHGIRURUJDQLFYDSRUV
Our No.
‡:,17(5
‡&$3%5,0
‡,1)(512
No.
No.
($
SAFETY HATS
Our No.
Our No.
MSA SAFETY WORKS
4 pt. Ratchet Suspension
294-2555
‡3$,173(67,&,'(
‡+$/)0$6.
‡³67$=21´
Smooth dome design with low
SUR¿OHGHVLJQHGWRZLWKVWDQGWHPSHUDWXUH YDULDQFHV KXPLGLW\ DQG
89OLJKW0HHWV$16,=7\SH
&ODVV&*DQG(
Our No.
RESPIRATORS
3$$5
/RQJ OLIH SUH¿OWHUV IHDWXUHV GHHS
circular pleats which extend the
DPRXQWRI¿OWHUORDGLQJRQWKH¿Oters, allowing respirator users to continue their spraying jobs or projects without the need to continually stop
WR UHSODFH WKH SUH¿OWHU $SSURYHG E\ 1,26+ XQGHU WKH
1,26+&)5UHVSLUDWRUFHUWL¿FDWLRQUHJXODWLRQVDSSURYHGWRWKH529FDWHJRU\5¿OWHUVDUHDWOHDVW
SHUFHQWHI¿FLHQWDJDLQVWRLOEDVHGFRQWDPLQDQWVDQG
UHVLVW GHJUDGDWLRQ IRU DW OHDVW DQ KRXU VKLIW 7KH 29
FODVVL¿FDWLRQPHDQVWKDWWKHUHVSLUDWRULVDOVRDSSURYHG
IRURUJDQLFYDSRUV)RUXVHZLWK
Our No.
No.
Shf
Pk
Unit
3.
MSA SAFETY WORKS
294-9485
($
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
FACESHIELD COVERS
RESPIRATOR
FILTER CARTRIDGES
DUST MASK
RESPIRATORS
‡08/7,385326(
‡+$50)8/'867
These cartridges include integral
KLJK HI¿FLHQF\ SHUFHQW
DJDLQVWPLFURQSDUWLFOHV¿OWHUV
DQGDQLPSUHJQDWHGEHGRIVSHFLDODFWLYDWHGFDUERQWKDW
KHOSVDEVRUEPDQ\W\SHVRIJDVHV$SSURYHGE\1,26+
XQGHUWKH1,26+&)5UHVSLUDWRUFHUWL¿FDWLRQUHJXODWLRQVDSSURYHGWRWKH3¿OWHUFODVVDVZHOODVIRU
DPPRQLD RUJDQLF YDSRUV FKORULQH K\GURJHQ FKORULGH
FKORULQH GLR[LGH VXOIXU GLR[LGH K\GURJHQ VXO¿GH IRU
HVFDSHRQO\IRUPDOGHK\GHK\GURJHQÀXRULGHDQGPHWK\ODPLQHJDVHV
%XLOWLQ FDUERQ ¿OWHU UHPRYHV QXLVDQFHOHYHORGRUV)RDPLQQHUVHDO
LPSURYHV FRPIRUW 3DWHQWHG QRVH
EULGJHLPSURYHVFRPIRUWDQG¿W(OHFWURVWDWLF¿OWHUPHGLD
WUDSV GXVW ZKLOH PDLQWDLQLQJ ORZ EUHDWKLQJ UHVLVWDQFH
/DWH[IUHH DQG K\SRDOOHUJHQLF IRU XVHUV ZLWK VHQVLWLYH
VNLQ1,26+DSSURYHG1&ODVV
Our No.
Shf
Pk
No.
Unit
Our No.
‡',6326$%/(
Shf
Pk
No.
Shf
Pk
Unit
3.
MSA SAFETY WORKS
Our No.
251-1962
Unit
1
0/
%;
Shf
Pk
Unit
MSA SAFETY WORKS
($
No.
153-7745
Unit
Shf
Pk
Unit
3.
DUST MASKS
&'
Our No.
0ROGDEOH PHWDO QRVHEDQG UHGXFHV
IRJJLQJ LQ JODVVHV /DWH[IUHH DQG
hypoallergenic for users with sensiWLYHVNLQ+HDY\GXW\HODVWLFVWUDSV
KHOSNHHSPDVNVHFXUH/LJKWJUHHQFRORUKLJKOLJKWVODZQ
DQGJDUGHQDSSOLFDWLRQV7KLVSURGXFWPHHWVQRJRYHUQPHQWVWDQGDUGV7KLVSURGXFWLVQRWDUHVSLUDWRUDQGZLOO
QRWSURWHFWWKHOXQJV8VHGLQDSSOLDWLRQVVXFKDVPRZLQJWULPPLQJJDUGHQLQJVZHHSLQJRUGXVWLQJ
Shf
Pk
Unit
MSA SAFETY WORKS
No.
Shf
Pk
Unit
&'
MSA SAFETY WORKS
SAFETY GLASSES
‡12172;,&
No.
3URWHFWVWKHZHDUHUIURPERWKKLJK
impact and from chemical splashHV LQGLUHFW YHQWLQJ DOORZV WKH
DLU WR PRYH WKURXJK WKH JRJJOHV
helping to keep the wearer more
FRPIRUWDEOH ZKLOH WKH YHQWV KHOS SUHYHQW OLTXLGV IURP
JHWWLQJ GLUHFWO\ WR WKH H\HV *RJJOHV FDQ EH ZRUQ RYHU
SUHVFULSWLRQJODVVHV7KHHODVWLFJRJJOHEDQGKHOSVFXVWRPL]HWKH¿WRIWKHVHJRJJOHVWRWKHXVHUV¶KHDG8VHG
in applications such as power tool work, sawing/drilling
PHWDO RU ZRRG KDPPHULQJ RYHUKHDG ZRUN DSSO\LQJ
SHVWLFLGHVRUPL[LQJOLTXLGFKHPLFDOV0HHWVWKHKLJKLPSDFW UHTXLUHPHQWV RI WKH $PHULFDQ 1DWLRQDO 6WDQGDUGV
,QVWLWXWH¶V$16,=VWDQGDUG
315-3236
166-3665
Shf
Pk
‡63/$6+5(6,67$17
,PSURYHV WKH XVHU¶V FRPIRUW OHYHO
EHFDXVH WKH ORZSUR¿OH H[KDODWLRQ
YDOYH UHGXFHV KHDW EXLOG XS QHDU
WKH IDFH +HOSV WR SURWHFW IURP H[SRVXUHV WR KDUPIXO
particulates, such as those created during the sanding or
VDZLQJRIZRRGLQVWDOOLQJ¿EHUJODVVLQVXODWLRQRUVDQGLQJ GU\ZDOO $SSURYHG E\ 1,26+ DV DQ 1 UHVSLUDWRU
PHHWLQJ WKH 1,26+ &)5 UHVSLUDWRU FHUWL¿FDWLRQ
UHJXODWLRQVWHVWHGWRDSHUFHQW¿OWHUHI¿FLHQF\OHYHO
Our No.
No.
SAFETY GOGGLES
DUST MASKS
2 Pak
/RZ SUR¿OH H[KDODWLRQ YDOYH UHGXFHVKHDWEXLOGXSQHDUWKHIDFH
helps protect from exposures to
harmful particulates, such as those created during the
VDQGLQJ RU VDZLQJ RI ZRRG LQVWDOOLQJ ¿EHUJODVV LQVXODWLRQRUVDQGLQJGU\ZDOO$SSURYHGE\1,26+DVDQ1
UHVSLUDWRUPHHWLQJWKH1,26+&)5UHVSLUDWRUFHUWL¿FDWLRQ UHJXODWLRQV WHVWHG WR D SHUFHQW ¿OWHU HI¿FLHQF\OHYHO
Our No.
MSA SAFETY WORKS
‡+$50)8/'867
‡67$1'$5'
762-5759
‡+$50)8/'867
Shf
Pk
Size
MSA SAFETY WORKS
DUST MASK
RESPIRATORS
214-2271
No.
JACKSON SAFETY
Our No.
No.
EYE PROTECTION
)LWV RYHU PRVW SUHVFULSWLRQ H\HZHDU 3OLDEOH VRIW IUDPH LPSURYHV
FRPIRUW 9HQWLODWHG GHVLJQ KHOSV
NHHS XVHU FRROHU 7KH LPSDFWUHVLVWDQWJRJJOHVIHDWXUHGLUHFWYHQWHGKROHVLQWKHLUERG\
WKDWKHOSUHGXFHKHDWEXLOGXS0HHWV$PHULFDQ1DWLRQDO
6WDQGDUGV,QVWLWXWH¶V$16,=VWDQGDUG
$GMXVWDEOHPHWDOQRVHSLHFH/LJKWZHLJKW ¿EHU IRU FRPIRUW )RU 1RQ
7R[LF+D]DUG1R1,26+DSSURYDO
7KHVH XQLTXH ORQJOLIH SUH¿OWHUV
DUH GHVLJQHG E\ 06$ IRU UHVSLUDWRU XVHUV 7KHLU H[FOXVLYH µ+DZOH\¶
design features deep circular pleats which extend the
DPRXQWRI¿OWHUORDGLQJRQWKH¿OWHUVDOORZLQJUHVSLUDWRU
users to continue their spraying jobs or projects without
WKHQHHGWRFRQWLQXDOO\VWRSWRUHSODFHWKHSUH¿OWHU)RU
8VH:LWK5HSODFHPHQW&DUWULGJHVZKLFK¿W
RQDOO06$6DIHW\:RUNVWZLQFDUWULGJHUHVSLUDWRUV7KLV
UHVSLUDWRU LV DSSURYHG E\ 1,26+ XQGHU WKH 1,26+ &)5 UHVSLUDWRU FHUWL¿FDWLRQ UHJXODWLRQV 7KLV 3DLQW 3HVWLFLGHUHVSLUDWRULVDSSURYHGWRWKH529FDWHJRU\
$SSOLFDWLRQV 3DLQWLQJVSUD\ SDLQWLQJ H[FHSW XUHWKDQH
SDLQWV6WULSSLQJSDLQWODFTXHU$SSO\LQJSHVWLFLGHIHUWLOL]HU
Our No.
3.
‡,03$&75(6,67$17
‡9(17,/$7('
3.
‡5(3/$&(0(17
SAFETY GOGGLES
PRE FILTER
CARTRIDGES
062-1219
Unit
3&%5(
($
DUST MASKS
No.
Shf
Pk
Safety & Organization
‡12172;,&
‡',6326$%/(
Our No.
460-1738
With Odor Filter
626-2307
No.
3M
MSA SAFETY WORKS
Package of 2
Our No.
Unit
MSA SAFETY WORKS
075-9530
8VHG RQ WKH VHULHV IXOO UHVSLUDWRUV 7KH FRYHU ZLOO NHHS IDFH
shield clean, scratch free and help
SURWHFWWKHIXOOIDFHSLHFHOHQVSHHO
DZD\DIWHUHDFKXVH
‡³81,63(&,,´
/RZFRVW ZUDSDURXQG SURWHFWLRQ
with one-piece, polycarbonate
OHQV&(DSSURYHG
Our No.
Lens
Finish
No.
Shf
Pk
Unit
($
JACKSON SAFETY
Clear Frame - Clear Lens
816-5508
3.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Hardcoat
Maintenance, Repair & Operations - SAFETY GLASSES
SAFETY GLASSES
‡1(0,65;
/DUJHU OHQV IRU PRUH FRPSOHWH
ZUDS DURXQG SURWHFWLRQ 3UHFLVH
placement of inserts allows for
GLVWRUWLRQIUHH IRUZDUG YLVLRQ DQG
LQFUHDVHG VDIHW\ ZKHQ ZHDULQJ
(QKDQFHG QRVH SLHFH GHVLJQ ZLWK LQWHJUDWHG ULGJHV WR
FKDQQHO DZD\ VZHDW 0HHWV &6$ ,QFOXGHV )UHH QHFN
FRUG
Our No.
No.
Lens Color
Power
Shf
Pk
Unit
JACKSON SAFETY
399-6659
&OHDU?
($
988-8769
&OHDU?
($
233-5693
&OHDU?
($
138-5319
&OHDU?
($
762-9819
&OHDU?
($
No.
Lens
Color
Shf
Pk
Unit
&'
Black Frame
Tinted
&OHDU
0DGH ZLWK SHUFHQW YLUJLQ PDWHULDOV ZKLFK LPSURYHV WKH FODUity of the material, as well as the
VWUHQJWK )HDWXUHV LQGLUHFWO\ YHQWed side temples to help keep the
XVHUV FRRO ¿W RYHU PRVW SUHVFULSWLRQ H\HZHDU WR SURWHFW IURP LPSDFW 8VHG LQ DSSOLFDtions such as power tool work sawing/drilling in metal
RU ZRRGKDPPHULQJSDLQWLQJRU RYHUKHDGZRUN 0HHW
WKHKLJKLPSDFWUHTXLUHPHQWVRIWKH$PHULFDQ1DWLRQDO
6WDQGDUGV,QVWLWXWH¶V$16,=VWDQGDUG
Our No.
No.
740-3280
Our No.
&'
($
SAFETY GLASSES
($
‡:5$3$5281'
SAFETY GLASSES
‡³$5&7,&´
6W\OLVK FDW¶VH\H ORRN 7XII6WXII
scratch-resistant lens featuring
built-in side impact protection and
DYDLODEOH ZLWK FOHDU RU JUD\ WLQWHG
OHQVIUDPH %XLOWLQ VLGH LPSDFW
&RPSOLHV ZLWK DOO DSSOLFDEOH WHVW UHTXLUHPHQWV RI $16,
=
Lens
Frame
Shf
Pk
Unit
9HQWKROHVRQWKHEURZJXDUGKHOS
keep the user comfortable as does
WKH DGMXVWDEOH WHPSOH OHQJWK 7KH
anti fog lens helps ensure that the
ZHDUHU ZLOO KDYH DQ XQREVWUXFWHG
YLHZ ZKHQ ZRUNLQJ LQ DSSOLFDWLRQV VXFK DV SRZHU WRRO
work sawing/drilling in metal or wood, hammering or
RYHUKHDGZRUN0HHWVWKHKLJKLPSDFWUHTXLUHPHQWVRI
WKH$PHULFDQ1DWLRQDO6WDQGDUGV,QVWLWXWH¶V$16,=
VWDQGDUG
Our No.
No.
Lens
Frame
Shf
Pk Unit
MSA SAFETY WORKS
‡³(66(17,$/(852´
/LJKW ZHLJKW IUDPHV 0D[LPXP
89SURWHFWLRQDQGDQWLIRJOHQVHV
SURWHFWVDJDLQVWSURMHFWLOHVGXVW
$SSOLFDWLRQV 3RZHU WRRO ZRUN
6DZLQJGULOOLQJ PHWDO RU ZRRG
+DPPHULQJ2YHUKHDGZRUN
618-5672
Frame
Lens
Color
Shf
Pk Unit
Grey
%URQ]H
207-9507
&OHDU
Teal
&'
,QGRRU2XWGRRU
&'
5XEEHUEURZDQGQRVHEULGJHDQG
translucent polycarbonate materials combine for user comfort and
SURWHFWLRQ 5DWFKHW DGMXVWDEOH
WHPSOHV IRU FXVWRP ¿W $QWLIRJ
OHQV IRU XQREVWUXFWHG YLVLRQ DQWLVFUDWFK OHQV FRDWLQJ
Soft, dual-shot temple ends for a comfortable secure
¿W 0HHWV $PHULFDQ 1DWLRQDO 6WDQGDUGV ,QVWLWXWH¶V $16,
=VWDQGDUG
No.
Lens
Color
Shf
Pk
Unit
&OHDU
&'
MSA SAFETY WORKS
‡,1'225287'225
SAFETY GLASSES
2YHUFDVW GD\ RU SRRUO\ OLJKWHG
area, these glasses help brighten
XSWKHDUHDDWOHDVWDVIDUDVZKDW
\RX VHH LV FRQFHUQHG \RXU YLVXDODFXLW\LVLPSURYHGE\ZHDULQJ
DPEHU OHQVHV ZLWK WKHLU DQWLIRJ DQWL89 OHQVHV WKHVH
JODVVHVKHOSNHHSWKHZHDUHU¶VYLVLRQXQREVWUXFWHG$QG
the rubber-tipped, ratchet adjustable straight-temples
LPSURYHVW\OH¿WDQGFRPIRUW0HHWV$PHULFDQ1DWLRQDO
6WDQGDUGV,QVWLWXWH¶V$16,=VWDQGDUG
‡&217285('
Our No.
No.
Lens
Color
Frame
Color
$PEHU
%ODFN
Shf
Pk Unit
MSA SAFETY WORKS
($
Unit
SAFETY GLASSES
SAFETY GLASSES
MSA SAFETY WORKS
Shf
Pk
‡,1'225
522-1635
($
Lens
Color
SAFETY GLASSES
Our No.
MSA SAFETY WORKS
No.
MSA SAFETY WORKS
No.
‡,1'225287'225
Our No.
SAFETY GLASSES
&OHDU
&OHDU
Gray
($
&OHDU
MSA SAFETY WORKS
&OHDU
Shf
Pk Unit
'=
281-2980
Gray
Frame
'=
($
Lens
039-3652
Unit
Glasses are tinted enough to take
WKH HGJH RII D EULJKW GD\ 7KHVH
JODVVHVKDYHDOLJKWJROGPLUURU¿Qish on clear lenses, which makes
them a great choice for bright, but
RYHUFDVW GD\V WRR 7KHLU GXDOVKRW FRPELQDWLRQ UXEEHU
DQGSODVWLFWHPSOHVDOVRKHOSLPSURYHFRPIRUWZKLOHUHGXFLQJVOLSSDJHRQWKHQRVH)HDWXULQJDVSHFLDO89
OHQV DGGLWLYH WKH OHQV EORFNV RI KDUPIXO 89
UDGLDWLRQ0HHWV$PHULFDQ1DWLRQDO6WDQGDUGV,QVWLWXWH¶V
$16,=VWDQGDUG
039-3645
&OHDU
Shf
Pk
Anti-Fog Lens
580-5379
Lens
Color
SAFETY GLASSES
Shf
Pk Unit
674-7547
No.
&'
Black Frame
No.
Our No.
MSA SAFETY WORKS
WOLF PEAK INTERNATIONAL
Our No.
Soft tip temples, padded nose
EULGJH DQG OLJKWZHLJKW ,QGXVWULDO
SURWHFWLYHH\HZHDULVGHVLJQHGIRU
protection against impact hazards
DQGRUÀ\LQJSDUWLFOHVGXVWVSDUNVDQGJODUH(\HZHDU
SURYLGHV H[FHOOHQW VLGH DQG IURQWLPSDFW SURWHFWLRQ
ZKLOHVWLOOEHLQJFRPIRUWDEOHWRZHDU6LJKWJXDUG,QGXVWULDO 3URWHFWLYH (\HZHDU PHHWV $16, = KLJK LPSDFW
VWDQGDUGV
869-5322
Sleek wrap around frame for no
VLGHGLVWRUWLRQGXUDEOHOLJKWZHLJKW
Q\ORQ WHPSOHV VFUDWFK UHVLVWDQW
hard coat and fog resistant polycarERQDWHOHQVSURWHFWLRQIURP89$89%89&UD\V
$16, = FRPSOLDQW %DOOLVWLF 0,/B35) FRPSOLDQW
Our No.
No.
MSA SAFETY WORKS
107-8187
‡%,)2&$/
‡³=25*(6(5,(6´
Bifocal
Strength
‡$5&7,&(/,7(
‡³6,*+7*8$5'´
Clear Frame
SAFETY GLASSES
Lens
Color
Our No.
036-3341
Black Frame
SAFETY GLASSES
/LJKWZHLJKWJODVVHVZUDSFORVHO\WR
WKHKHDGDQGÀH[WR¿WERWKODUJH
DQGVPDOOKHDGVL]HVZHOO$QDQWL
scratch lens coating reduces lens
DEUDVLRQ GXULQJ QRUPDO XVDJH
0HHWV $PHULFDQ 1DWLRQDO 6WDQGDUGV,QVWLWXWH¶V$16,=VWDQGDUG
459-3299
&'
:UDSDURXQGOHQVFRQWRXUVWRIDFH
IRUJUHDW¿W6RIWFRPIRUWDEOHGXDO
shot plastic/rubber temples for
UHWHQWLRQ 6RIW UXEEHU QRVH SDGV
UHGXFHV VOLSSDJH RQ IDFH 8VHG LQ
power tool work, sawing, drilling and for protection from
À\LQJFKLSVDQGGHEULV
Our No.
No.
Lens
Color
Shf
Pk
Unit
MSA SAFETY WORKS
262-6026
&OHDU
&'
464-1247
Gray
&'
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
SAFETY GLASSES
SAFETY GLASSES
PROTECTION KITS
‡18(92:5$3
‡.$=%(.6(5,(6
‡32/$5,=('
‡3,(&(6
:LGHZUDS VW\OH VDIHW\ VXQJODVVes offer additional side protecWLRQ ZLWKRXW FRPSURPLVLQJ VW\OH
Tinted glasses offer anti-fog and
PD[LPXP89SURWHFWLRQDVZHOODV
GHIHQVHDJDLQVWYLVLEOHJODUHZLWKRXWFRORUGHJUDGDWLRQ
6DIHW\JODVVHVPHHWWKH,PSDFW3URWHFWRUUHTXLUHPHQWV
RI$16,,6($=DQG26+$H\HSURWHFWLRQVWDQGDUGV
Our No.
No.
Lens
Color
Frame
Color
Shf
Pk Unit
MSA SAFETY WORKS
487-0838
+LJKO\ ÀH[LEOH EODFN VRIW WRXFK
Q\ORQ IUDPH HGJH ÀH[ WHPSOHV
PHJRO QRVH SLHFH IRU LPSURYHG
comfort and grip, fog and scratch
UHVLVWDQW OHQVHV EORFNV SHUFHQW RI 89$89%89&
UD\V$16,=FRPSOLDQWEDOOLVWLF0,/35)
FRPSOLDQWIRUXVHLQLQGRRURXWGRRUJHQHUDOLQGXVWU\DSSOLFDWLRQV
Our No.
Lens
Type
No.
Shf
Pk
Unit
WOLF PEAK INTERNATIONAL
Gray
%ODFN
($
691-3172
76.
Smoke
966-2750
76.*
6LOYHU0LUURU
($
848-9684
76.$3
%OXH0LUURU
($
($
*RJJOHV ¿W RYHU PRVW SUHVFULStion eyewear, comfortable foam
HDU SOXJV ¿W ZLGH UDQJH RI HDU
FDQDO VL]HV 5HVSLUDWRU\ SURWHFWLRQ
LV 1,26+ DSSURYHG WR &)5 1FODVVHDUSOXJVDUHWHVWHGLQDFFRUGDQFHZLWK$16,
67KHVHVDIHW\JRJJOHVPHHWWKHKLJKLPSDFW
UHTXLUHPHQWVRIWKH$PHULFDQ1DWLRQDO6WDQGDUGV,QVWLWXWH¶V $16, = VWDQGDUG 8VHG LQ DSSOLFDWLRQV
VXFK DV VDQGLQJVDZLQJ ¿EHUJODVV LQVWDOODWLRQ SRZHU
WRROVRUPRZLQJWULPPLQJODZQ
Our No.
No.
Shf
Pk
Unit
MSA SAFETY WORKS
033-6271
&'
SAFETY GLASSES
‡*/$5(*21(6(5,(6
3RODUL]HGWLQWHGOHQVHVKHOSUHGXFH
JODUH UHÀHFWHG RII RI VKLQ\ VXUIDFes such as snow, water sand and
SDYHPHQW 7KHVH VDIHW\ JODVVHV
DOVR RIIHU SHUFHQW 89 SURWHFWLRQ 89 6W\OLVK WLJKWZUDS GHVLJQ DQG VRIW
UXEEHUQRVHEULGJH6DIHW\JODVVHVPHHWWKH,PSDFW3URWHFWRUUHTXLUHPHQWVRI$16,,6($=DQG26+$
H\HSURWHFWLRQVWDQGDUGV
Our No.
No.
Lens
Color
Frame
Color
%URZQ
%URZQ
Shf
Pk Unit
MSA SAFETY WORKS
075-9118
‡:,7+9,625
‡=25*(6(5,(6
‡0$*1,),(5
3URYLGHV SURWHFWLRQ IURP
89$ 89% DQG 89& UD\V ZUDS
around lens that eliminate side disWRUWLRQ KLJK YHORFLW\ LPSDFW UHVLVWDQW´VWHHOEDOODWIWV$16,KLJKPDVVLPSDFW
UHVLVWDQWR]SURMHFWLOHIURP´GURSXVHLQFORXG\
FRQGLWLRQVLQGRRURUORZOLJKW
Our No.
($
FACESHIELDS
SAFETY GLASSES
No.
Lens
Type
Shf
Pk
Unit
Our No.
WOLF PEAK INTERNATIONAL
No.
Shf
Pk
Unit
MSA SAFETY WORKS
Black Frame
SAFETY GLASSES
High-impact polycarbonate clear
YLVRU WKDW LV HDVLO\ DWWDFKHG DQG
ÀLSV XS 5DWFKHW VXVSHQVLRQ NQRE
adjusts the size of the frame suspension to the user head for a cusWRP¿W$VRIWSDGGHGEURZSDGKHOSVDEVRUESHUVSLUDWLRQIRUDGGHGFRPIRUW)DFHVKLHOGDQGKHDGJHDUPHHWV
DOODSSOLFDEOHKLJKLPSDFWUHTXLUHPHQWVRI$PHULFDQ1DWLRQDO 6WDQGDUG ,QVWLWXWH $16, = 8VH UHSODFHPHQW
YLVRU
039-4049
'=
&OHDU
($
039-4056
'=
Smoke
($
895-9751
($
‡)($7+(5),76(5,(6
$ ÀDQJHG QRVHEULGJH DQG UXEEHU
tipped temples help keep these
OLJKWZHLJKW VDIHW\ JODVVHV VHFXUH
The grey tinted lenses are the
most popular lens tint for outdoor
XVH PD[LPXP 89 SURWHFWLRQ 6DIHW\ JODVVHV PHHW WKH
,PSDFW3URWHFWRUUHTXLUHPHQWVRI$16,,6($=
DQG26+$H\HSURWHFWLRQVWDQGDUGV$SSOLFDWLRQVKRPH
ZHDWKHUL]LQJFDUSHQWU\RXWGRRUDFWLYLWLHVVXFKDVODQGVFDSLQJ
Our No.
No.
Lens
Color
Frame
Color
Shf
Pk Unit
Grey
%ODFN
MSA SAFETY WORKS
069-5460
($
FACE SHIELD
REPLACEMENT VISOR
SAFETY GLASSES
‡%5$=($86(5,(6
0DGH ZLWK OLJKWZHLJKW ÀH[LEOH
IUDPHV WKDW ZRQ¶W SLQFK \RXU HDUV
RU QRVH WKH OHQVHV DUH FRDWHG WR
UHVLVW VFUDWFKLQJ SURYLGHV 89 SURWHFWLRQ DQG DUH FRPSOLDQW
ZLWK WKH $16, KLJKHVW VWDQGDUGV GHVLJQHG IRU QRUPDO
OLJKWFRQGLWLRQVKDYHSDVVHGWKHKLJKPDVVLPSDFWDQG
KLJKYHORFLW\LPSDFWRUPLOLWDU\EDOODVWLFUDWLQJWHVWVWKH
skull style features a winged skull in charcoal gray on
ERWKHDUSLHFHV
Our No.
No.
Lens\Type
Shf
Pk
Unit
WOLF PEAK INTERNATIONAL
SAFETY GLASSES
848-9718
+LJKO\ ÀH[LEOH EODFN Q\ORQ IUDPH
soft megol temple tips for imSURYHGFRPIRUWVLOYHUPHWDOSLHFH
EORFNV SHUFHQW RI 89$89%
89&UD\V$16,]FRPSOLDQWEDOOLVWLF0,/35)FRPSOLDQWIRUXVHLQ
VDIHW\DQGRXWGRRUUHFUHDWLRQDSSOLFDWLRQV
SAFETY GLASSES
Our No.
No.
Lens
Type
Shf
Pk
Unit
WOLF PEAK INTERNATIONAL
644-9433
65$5
&OHDU$QWL5HÀFW
($
203-2381
65
Smoke
($
794-1917
65
6LOYHU0LUURU
($
Smoke
;%6
($
718-6422
&'
Shf
Pk
Unit
($
High-impact polycarbonate clear
YLVRUXVHZLWK
Lens\Type
Shf
Pk
Unit
($
708-0344
White Frame
;%
Unit
REPLACEMENT VISORS
WOLF PEAK INTERNATIONAL
848-9700
Shf
Pk
No.
MSA SAFETY WORKS
0DGH ZLWK OLJKWZHLJKW ÀH[LEOH
IUDPHV WKDW ZRQ¶W SLQFK \RXU HDUV
RU QRVH OHQVHV DUH VFUDWFK DQG
fog-resistant to create a greater
ZHDUDQGFRPSOLHVZLWK$16,=
VWDQGDUGVSURYLGHV89$89%89&SURWHFWLRQSURYLGLQJDGGLWLRQDOVDIHW\IUDPHVFDQEHZRUQDOOGD\ZLWK
WKHVWUDLJKWQRSLQFKWHPSOHVDQGWHPSOHYHQWVWRVWD\
FRRO
No.
No.
MSA SAFETY WORKS
Our No.
‡%5$=($86(5,(6
Our No.
Our No.
‡)$&(6+,(/'
Black Skull Frame
‡5(&/866(5,(6
High impact polycarbonate clear
UHSODFHPHQW YLVRU IRU WKDWLVHDVLO\DWWDFKHG
Smoke
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - Safety & Organization
HEARING PROTECTION
EAR PLUGS
‡&25'('5(86$%/(
‡³6,/(1&,2´
0ROGHG ZLWK VRIW VLOLFRQH UXEEHU
IRU DOO GD\ FRPIRUW 7ULSOH ÀDQJHG
design creates three barriers of
QRLVH EORFNV )LUP VWHP DQG WDSHUHG VKDSH RIIHU DQ HDV\ QR WRXFK LQVHUWLRQ ,QWHUQDO
DLU FXVKLRQ FUHDWHV D QRLVHEORFNLQJ SRFNHW :DVKDEOH
DQGUHXVDEOH1RLVH5HGXFWLRQ5DWLQJGHFLEHOV
Our No.
No.
Shf
Pk
Unit
JACKSON SAFETY
005-3298
1
HEARING PROTECTORS
HEARING PROTECTORS
‡5$',2',*,7$/,1387
‡,1'8675,$/*5$'(
03 FRQQHFWLYLW\ VWHUHR LQSXW
MDFNZLWKSDWFKFRUGIRU03V&'
players or scanners, easy-to-read
/&'GLVSOD\IRUSUHFLVHWXQLQJDQG
PHPRU\SUHVHWIRUXSWR$0)0
VWDWLRQV DQWHQQD ZLWK KLJK UHFHSWLRQ VHQVLWLYLW\ FRPfortable gel foam ear cushions, adjustable padded stainOHVV VWHHO KHDGEDQG 6SHFV 155 G% KRXUV RI
RSHUDWLQJWLPH,QFOXGHV$$EDWWHULHV
'LHOHFWULF GHVLJQ IRU XVH DURXQG
HOHFWULFDO KD]DUGV ([WUHPHO\ VRIW
HDU SDGV LPSURYH FRPIRUW 1RLVH
5HGXFWLRQ 5DWLQJ 155 RI 7HVWHG LQ DFFRUGDQFH ZLWK $16,
68VHGLQDSSOLFDWLRQVVXFKDVPRZLQJWULPPLQJ ODZQ SRZHU WRRO XVH WUDI¿F DQG RI¿FH QRLVH RU
VOHHSLQJLQQRLV\URRPV
Our No.
No.
Shf
Pk
Unit
3M
553-6867
Our No.
7ULSOH ÀDQJHVW\OH HDUSOXJV ZLWK
FRUG :DVKDEOH FRPHV ZLWK D UHXVDEOH VWRUDJH FRQWDLQHU 0HHWV
$16,6155)RU8VH
,Q 6ZLPPLQJ 2SHUDWLQJ +HDY\
0DFKLQHU\3RZHU7RROV7DUJHW3UDFWLFH6OHHSLQJ
Our No.
No.
Shf
Pk
Unit
($
3M
585-2371
FIRST AID
‡',*,7$/5$',203
FIRST AID KITS
7KH 03$0)0 VWHUHR KHDULQJ
protector ear muffs balance comfort, protection and the ability to
OLVWHQ WR WKH UDGLR RU 03 SOD\HU
)HDWXUHV LQFOXGHV QRLVH UHGXFWLRQ
UDWLQJRIG%PHHWV$16,6DQG&6$=
&ODVV % UHWDLQV G% VDIH QRLVH FXWRII HYHQ ZLWK
03 SOD\HU LQ XVH DXWRPDWLF UDGLR VKXWRII ZKHQ 03
LV FRQQHFWHG IUHH DX[LOLDU\ FRUG DQG KHDY\GXW\ $$
EDWWHULHV
‡$//385326(
‡3,(&(
Our No.
No.
Shf
Pk
Unit
MSA SAFETY WORKS
922-4023
1
($
EAR PLUGS
‡58%%(5
0DGHIURPDVRIWUXEEHUPDWHULDO
these plugs are easily cleaned and
UHXVHG1HFNFRUGFDQEHUHPRYHG
replaced easily to accommodate
users who prefer to use the plugs
ZLWKRXW WKH FRUG 7KHVH SOXJV FRPH ZLWK D FRQYHQLHQW
carrying case for storage or the case can be attached
GLUHFWO\WRQRLVHJHQHUDWLQJGHYLFHVHJWKHKDQGOHRID
ODZQPRZHUHWFWRKHOSNHHSWKHSOXJVFOHDQDQGUHDG\
IRUWKHLUQH[WXVH7HVWHGLQDFFRUGDQFHZLWK$16,6
Our No.
No.
Shf
Pk
Unit
($
HEARING PROTECTORS
‡29(57+(+($'
/LJKWZHLJKWÀH[LEOHSDGGHGKHDGEDQG ZLWK SUHVVXUH DGMXVWPHQW
)RUXVHZLWKRXWDKDUGKDW6DIHW\
UDWLQJLVG%$155$9$,/$%/(
72 5(*,67(5(' +8649$51$
'($/(5621/<
Our No.
No.
3HUIHFWIRUXVHLQWKHKRPHDXWR
VSRUWV $PSOH URRP IRU SHUVRQDO
PHGLFDWLRQV %H UHDG\ IRU DOO SRtential emergencies at home, in
WKHFDURXWGRRUVRURQWKHZDWHU6XSSOLHVDUHHDV\WR
¿QGLQRXUQHZO\GHVLJQHGRUJDQL]HUFDVH.LW,QFOXGHV
´[´$GKHVLYHSODVWLFEDQGDJHV´[´$GKHVLYHSODVWLFEDQGDJHV.QXFNOHIDEULFEDQGDJH
)LQJHUWLSIDEULFEDQGDJH´[´(OERZNQHHSODVWLF
EDQGDJHV´[´3DWFKSODVWLFEDQGDJHV
´[´-XQLRUSODVWLFEDQGDJHV%XWWHUÀ\ZRXQG
FORVXUHV´[´*DX]HGUHVVLQJSDGV´[´*DX]H
GUHVVLQJSDGV´[´7UDXPDSDG$VSLULQWDEOHWV
,EXSURIHQWDEOHWV([WUDVWUHQJWKQRQDVSLULQWDEOHWV$OFRKROFOHDQVLQJSDGV$QWLVHSWLFFOHDQVLQJZLSHVVWLQJIUHH$QWLELRWLFRLQWPHQWSDFNV
´[\G)LUVWDLGWDSHUROO´[´,QVWDQWFROGFRPSUHVV 6WHULOH H\H SDG ´[´ )LQJHU VSOLQW
´&RWWRQWLSSHGDSSOLFDWRUV0HGLXPVDIHW\
SLQ([DPTXDOLW\YLQ\OJORYHV´7ZHH]HUVSODVWLFSJ)LUVWDLGJXLGH.LW'LPHQVLRQV´[
´[´
Our No.
Shf
Pk
Unit
894-4050
POULAN
721-5841
($
HEARING PROTECTORS
‡)2/'$%/(
EAR PLUGS
‡)2$0
'LVSOD\ FRQWDLQV SDLU IRDP
HDU SOXJV 6RIW ORZ HDU SUHVVXUH
SOXJVDUHFRPIRUWDEOHIRUDYDULHW\
RI DFWLYLWLHV )RDP UROOV HDVLO\ IRU
insertion and once inserted, gently
H[SDQGVWR¿WHDUFDQDOIRUPRUHFRPIRUWZKLOHSURYLGLQJ
SURWHFWLRQ
Our No.
No.
Shf
Pk
Unit
MSA SAFETY WORKS
805-8026
Soft padded ear cushions for user
FRPIRUW$GMXVWDEOHKHDGEDQGVL]H
accommodates wide range of head
VL]HV+LJK1RLVH5HGXFWLRQ5DWLQJ
155 KHOSV SURWHFW KHDULQJ
)ROGVWRFRPSDFWVL]HWRVWRUHHDVLO\5HFORVDEOHSDFNDJLQJSURWHFWVGXULQJVWRUDJH7KHVHIROGDEOHHDUPXIIVDUH
WHVWHGLQDFFRUGDQFHZLWK$16,6
Our No.
No.
Shf
Pk
Unit
MSA SAFETY WORKS
463-2402
No.
O.A.
Size In.
Shf
Pk
Unit
[[
($
FIRST AID ONLY
MSA SAFETY WORKS
360-7298
($
Safety & Organization
HEARING PROTECTORS
‡&25'('5(86$%/(
($
%;
EARPLUGS
Unit
MSA SAFETY WORKS
352-1200
Shf
Pk
No.
($
',63
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
)$2
- Maintenance, Repair & Operations
FIRST AID KITS
FIRST AID KITS
FIRST AID KITS
‡*(1(5$/385326(
‡3,(&(6
‡&200(5&,$/)/((7
9(+,&/(6
‡3,(&(6
‡67$1'$5'%86,1(66
‡:,7+0(',&$7,216
%HUHDG\IRUDOOSRWHQWLDOHPHUJHQcies at home, in the car, outdoors
RURQWKHZDWHU7KLVQHZJHQHUDWLRQRIKDUGNLWLVGHYHORSHGWRVDYH
WLPHDQGIUXVWUDWLRQLQWKHPLGVWRIHPHUJHQF\VLWXDWLRQV
6XSSOLHVDUHHDV\WR¿QGLQRXUQHZO\GHVLJQHGRUJDQL]HU
FDVH.LWFRQWDLQV´[´$GKHVLYHSODVWLFEDQGDJHV´[´)DEULFEDQGDJHV´[´)DEULFEDQGDJHV.QXFNOHIDEULFEDQGDJHV)LQJHUWLSIDEULF
EDQGDJHV´[´(OERZNQHHSODVWLFEDQGDJH
´[´-XQLRUSODVWLFEDQGDJHV%XWWHUÀ\ZRXQG
FORVXUHV ´ 6SRW SODVWLF EDQGDJHV ´[´
*DX]H GUHVVLQJ SDGV ´[´ *DX]H GUHVVLQJ SDGV
´[´7UDXPDSDG$VSLULQWDEOHWV,EXSURIHQ
WDEOHWV([WUDVWUHQJWKQRQDVSLULQWDEOHWV¶$OFRKRO
FOHDQVLQJ SDGV $QWLVHSWLF FOHDQVLQJ ZLSHV VWLQJ
IUHH$QWLELRWLFRLQWPHQWSDFNV´[\G)LUVW
DLGWDSHUROO´[´,QVWDQWFROGFRPSUHVV%XUQ
UHOLHISDFNJP6WHULOHH\HSDG(PHUJHQF\
EODQNHW´&RWWRQWLSSHGDSSOLFDWRUV´[´
)LQJHUVSOLQW([DPTXDOLW\YLQ\OJORYHV´7ZHH]HUVSODVWLFSJ)LUVWDLGJXLGH.LW'LPHQVLRQV
´[´[´
Our No.
Shf
Pk
No.
Unit
FIRST AID ONLY
'HVLJQHGIRUÀHHWDQGFRPPHUFLDO
YHKLFOHV ,WV KDUG PHWDO FDVH ZLWK
JDVNHW KROGV TXDOLW\ EUDQG SURGXFWVWKDWDUHHDVLO\DFFHVVLEOHLQDQHPHUJHQF\7KLVNLW
PHHWV IHGHUDO 26+$ UHFRPPHQGDWLRQV DQG RIIHUV HDV\
UH¿OOLQJZLWKWKHKHOSRIDIXOOFRORUUHRUGHULQJVFKHPDWLF
5H¿OOVDUHFRORUFRGHGIRUHDVHRILGHQWL¿FDWLRQ.LWFRQDWLQV$´[´$GKHVLYHSODVWLFEDQGDJHV
E[ $ .QXFNOH ODUJH ¿QJHUWLS IDEULF EDQGDJHV´[´*DX]HGUHVVLQJSDGVSNV´
&RQIRUPLQJJDX]HUROOEDQGDJH´7ULDQJXODUVOLQJ
EDQGDJH Z VDIHW\ SLQV ,EXSURIHQ WDEOHWV SNV%$QWLVHSWLFFOHDQVLQJZLSHVVWLQJIUHH
E[7ULSOHDQWLELRWLFRLQWPHQWSDFNV$1
%XUQUHOLHISDFNVE[´[\G)LUVWDLGWDSHUROO
%´[´,QVWDQWFROGFRPSUHVVE[6WHULOH
H\HSDGV01,$(\HZDVKR]$1
([DP TXDOLW\ YLQ\O JORYHV SUE[ ´ 6FLVVRUV
QLFNHOSODWHG´7ZHH]HUVSODVWLF)LUVWDLGJXLGH
.LW'LPHQVLRQV[´[´
Our No.
No.
Shf
Pk
Unit
FIRST AID ONLY
324-3672
1
8)$2
($
)$2
1
Our No.
No.
Shf
Pk
Unit
FIRST AID ONLY
OSHA COMPLIANCE
189-9939
,GHDO IRU EXVLQHVVHV RI¿FHV DQG
ZRUN VLWHV SODVWLF FDELQHW KDV
swing out door and easy to carry
KDQGOH &DELQHW GHVLJQ HOLPLQDWHV
GLVRUJDQL]HGDQGPLVVLQJVXSSOLHV&OHDUO\ODEHOHGFRPpartments create a cabinet that is easy to use and reVWRFN .LW LQFOXGHV WUDXPD SDG ´ [ ´ JDX]H
GUHVVLQJSDG´[´SDGVSNJDX]HGUHVVLQJ
SDG ´ [ ´ SDGV SN VFLVVRUV VWDLQOHVV
VWHHOWZHH]HUV´SDWFKSODVWLFEDQGDJHV´[
´ E[ IDEULF EDQGDJHV ´ [ ´ E[ SODVWLFEDQGDJHV´[´E[¿QJHUWLSIDEULFEDQGDJHV E[ NQXFNOH IDEULF EDQGDJHV E[ DOFRKRO FOHDQVLQJ SDGV E[ DQWLVHSWLF FOHDQVLQJ
ZLSHVVWLQJIUHHE[FRQIRUPLQJJDX]HUROO´
FRQIRUPLQJ JDX]H UROO ´ EXWWHUÀ\ ZRXQG FORVXUHVE[¿UVWDLGWDSH´[\GWULDQJXODU
VOLQJEDQGDJH´[´[´FSUIDFHVKLHOGDQG
YLQ\OJORYHVVKLHOGDQGSURIJORYHVH[DPTXDOLW\
YLQ\OJORYHVSDLUV¿UVWDLGEXUQFUHDPE[
DQWLELRWLFRLQWPHQWE[H[WUDVWUHQJWKQRQDVSLULQ
WDEOHWVE[SNLEXSURIHQWDEOHWVE[SN
DVSLULQWDEOHWVE[SN¿UVWDLGJXLGH26+$
FRPSOLDQFH
019-7707
($
)$(
1
($
FIRST AID KITS
‡$//385326(
‡3,(&(6
FIRST AID KITS
‡$872
‡3,(&(6
%HUHDG\IRUDOOSRWHQWLDOHPHUJHQFLHV ZKHQ RQ WKH URDG 2XU QHZ
JHQHUDWLRQRIKDUGNLWLVGHYHORSHG
WRVDYHWLPHDQGIUXVWUDWLRQLQWKH
PLGVWRIHPHUJHQF\VLWXDWLRQV.LWLQFOXGHV´[´
$GKHVLYH SODVWLF EDQGDJHV ´[´ )DEULF EDQGDJHV.QXFNOHIDEULFEDQGDJHV)LQJHUWLSIDEULF
EDQGDJHV´[´3DWFKSODVWLFEDQGDJH
´[´-XQLRUSODVWLFEDQGDJHV%XWWHUÀ\ZRXQG
FORVXUHV´[´*DX]HGUHVVLQJSDGV´[´*DX]H
GUHVVLQJ SDGV ´[´ 7UDXPD SDG ´ &RQIRUPLQJJDX]HUROOEDQGDJH,EXSURIHQWDEOHWV([WUD
VWUHQJWKQRQDVSLULQWDEOHWV0RWLRQVLFNQHVVWDEOHWV
$OFRKRO FOHDQVLQJ SDGV $QWLVHSWLF FOHDQVLQJ
ZLSHVVWLQJIUHH,QVHFWVWLQJUHOLHISDGV)LUVW
DLGEXUQFUHDPSDFNV´[\G)LUVWDLGWDSHUROO
´[´ ,QVWDQW FROG FRPSUHVV ´[´ )LQJHU
VSOLQW´&RWWRQWLSSHGDSSOLFDWRUV0HGLXP
VDIHW\SLQV(PHUJHQF\EODQNHW/LJKWVWLFN
&DOO SROLFH EDQQHU $FFLGHQW UHSRUW IRUP ([DP
TXDOLW\YLQ\OJORYHVSJ)LUVWDLGJXLGH.LW'LPHQVLRQV´[´[´
Our No.
No.
Shf
Pk
Unit
FIRST AID ONLY
260-1425
)$2
1
($
%H UHDG\ IRU DOO SRWHQWLDO HPHUgencies at home, in the car, outGRRUV RU RQ WKH ZDWHU 2XU QHZ
JHQHUDWLRQRIVRIWNLWLVGHYHORSHG
WRVDYHWLPHDQGIUXVWUDWLRQLQWKHPLGVWRIHPHUJHQF\
VLWXDWLRQV 6XSSOLHV DUH HDV\ WR ¿QG LQ SDWHQW SHQGLQJ
FOHDUSRFNHWSDJHV(GXFDWLRQDOFDUGVLQIRUPLQJWKHFRQVXPHU RQ WKH XVH RI VSHFL¿F FRQWHQWV DUH LQFOXGHG LQ
WKLVNLW.LWFRQWDLQV´[´$GKHVLYHSODVWLFEDQGDJHV´[´)DEULFEDQGDJHV´[´$GKHVLYH SODVWLF EDQGDJHV ´[´ )DEULF EDQGDJHV .QXFNOHIDEULFEDQGDJHV)LQJHUWLSIDEULFEDQGDJHV
´[´(OERZNQHHSODVWLFEDQGDJHV´[
´ -XQLRU SODVWLF EDQGDJHV ´[´ 3DWFK
SODVWLFEDQGDJH%XWWHUÀ\ZRXQGFORVXUHV´[´
*DX]HGUHVVLQJSDGV´[´*DX]HGUHVVLQJSDGV
´[´ *DX]H GUHVVLQJ SDGV ´[´ 7UDXPD SDG ´ &RQIRUPLQJ JDX]H UROO EDQGDJH $VSLULQ WDEOHWV
,EXSURIHQWDEOHWV([WUDVWUHQJWKQRQDVSLULQWDEOHWV$OFRKROFOHDQVLQJSDGV$QWLVHSWLFFOHDQVLQJZLSHVVWLQJIUHH$QWLELRWLFRLQWPHQWSDFNV
)LUVWDLGEXUQFUHDPSDFNV,QVHFWVWLQJUHOLHISDGV
´[\G)LUVWDLGWDSHUROO´[´,QVWDQWFROG
FRPSUHVV%XUQUHOLHISDFNJP6WHULOHH\H
SDG(PHUJHQF\EODQNHW´[´0ROHVNLQVTXDUHV
7KHUPRPHWHU RQH WLPH XVH ´ &RWWRQ WLSSHG
DSSOLFDWRUV´[´)LQJHUVSOLQW([DPTXDOLW\YLQ\OJORYHV´6FLVVRUVQLFNHOSODWHG´
7ZHH]HUVSODVWLFSJ)LUVWDLGJXLGH.LW'LPHQVLRQV´[´[´
Our No.
No.
Shf
Pk
Unit
FIRST AID ONLY
651-9268
)$2
1
($
FIRST AID KITS
‡0(',80:25.3/$&(
‡3,(&(6
This general business kit is ideal for
EXVLQHVVHVRI¿FHVDQGZRUNVLWHV
0HWDO FDELQHW KDV VZLQJ RXW GRRU
DQG HDV\ WR FDUU\ KDQGOH &DELQHW
GHVLJQ HOLPLQDWHV GLVRUJDQL]HG DQG PLVVLQJ VXSSOLHV
&OHDUO\ODEHOHGFRPSDUWPHQWV.LWLQFOXGHV´[´
IDEULFEDQGDJHNQXFNOHIDEULFEDQGDJH¿QJHUWLS
IDEULFEDQGDJH´[´SODVWLFEDQGDJH´
WULDQJXODUVOLQJEDQGDJH´JDX]HUROOEDQGDJH
´JDX]HUROOEDQGDJH´[\G¿UVWDLGWDSH
´ [ ´ JDX]H GUHVVLQJ SDGV ´ [ ´ WUDXPD SDG
DQWLVHSWLFFOHDQVLQJZLSHVWLQJIUHHDQWLELRWLF
RLQWPHQW¿UVWDLGEXUQFUHDP´VWDLQOHVVVWHHO
WZHH]HUV VODQWHG ¿UVW DLG JXLGH H[DP TXDOLW\
YLQ\OJORYHVVFLVVRUV26+$FRPSOLDQFH
Our No.
No.
Shf
Pk
Unit
FIRST AID ONLY
205-6729
)$(
1
($
FIRST AID KITS
‡3,(&(0,1,
%HUHDG\IRUDOOSRWHQWLDOHPHUJHQcies at home, in the car, outdoors or
RQWKHZDWHU)URPFXWVDQGVWLQJV
to minor aches and pains, this kit
SUHSDUHV\RXIRUWKRVHVPDOOHYHU\GD\HPHUJHQFLHV)LWVHDVLO\LQWRDSXUVHSRFNHWVFKRRO
EDJ RU JORYH FRPSDUWPHQW .LW ,QFOXGHV PLQL HD DQWLELRWLF RLQWPHQW SDFN DQWLVHSWLF FOHDQVLQJ ZLSHV
VWLQJIUHH´[´IDEULFEDQGDJHV´[´
MXQLRU DGKHVLYH SODVWLF EDQGDJHV ´[´ DGKHVLYH
SODVWLFEDQGDJHVSODVWLFFDVH´[´[´26+$
FRPSOLDQFH
Our No.
No.
Shf
Pk
Unit
1
',63
FIRST AID ONLY
366-3663
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
)$275$<
Maintenance, Repair & Operations - 11
Safety & Organization
FIRST AID KITS
Shf
Pk
No.
Unit
MSA SAFETY WORKS
052-4223
($
FIRST AID KIT REFILLS
5H¿OO EULFN IRU XQLW XQLWL]HG
¿UVW DLG NLWV $1 $1
,QFOXGHV $1 ´[´ $GKHVLYH SODVWLF EDQGDJHV E[
$1 ´[´ *DX]H GUHVVLQJ SDGV E[ $1 ´[´
7UDXPD SDG E[ $1 ´ 7ULDQJXODU VOLQJ
EDQGDJHZVDIHW\SLQVE[$1%=.DQWLVHSWLFWRZHOHWWHVE[$1)LUVWDLGEXUQFUHDP
SDFNV E[ $1 ´[ \G )LUVW DLG WDSH
UROO E[ $$QWLELRWLFRLQWPHQW SDFNV E[
$1([DPTXDOLW\YLQ\OJORYHVE[DQG)LUVW
DLGJXLGH
Our No.
No.
Shf
Pk
Unit
FIRST AID ONLY
003-6020
($
‡*(1(5$/%86,1(66
&$%,1(76
5H¿OOIRU6PDUW&RPSOLDQFHJHQHUDO
EXVLQHVV FDELQHWV 5&
)$( )$(
,QFOXGHV )$( IDEULF
EDQGDJH´[´ER[)$(SODVWLFEDQGDJH
´[´ER[)$(¿QJHUWLSIDEULFEDQGDJH
ER[)$(NQXFNOHIDEULFEDQGDJHER[
)$(JDX]HGUHVVLQJSDG´[´EJ)$(
DOFRKROFOHDQVLQJSDGER[)$(%=.
DQWLVHSWLF WRZHOHWWHV ER[ )$( ¿UVW DLG
EXUQFUHDPER[)$(DQWLELRWLFRLQWPHQW
ER[ )$( ¿UVW DLG WDSH ´[\G ER[
DQG)$(H[DPTXDOLW\YLQ\OJORYHVER[
No.
Shf
Pk
Unit
FIRST AID ONLY
139-1432
1
($
‡5()/(&7,9(
‡³+,*+9,=´
5HÀHFWLYHVWULSHVSURYLGHLQFUHDVHG
YLVLELOLW\ KRRN DQG ORRS FORVXUHV
NHHSYHVWFORVHGHODVWLFVLGHVWUDSV
DXWRPDWLFDOO\DGMXVWWRXVHU¶VZDLVW
VL]HRQHVL]H¿WVDOO8VHGLQDSSOLFDWLRQVVXFKDVZRUNing on/near roads, construction sites, school crossing
JXDUGV MRJJLQJZDONLQJF\FOLQJ IRU UHWURUHÀHFWLYLW\ E\
KHDGOLJKWVGXULQJHYHQLQJXVH
Our No.
Vest
Size
No.
Vest
Color
Shf
Pk
Unit
MSA SAFETY WORKS
Orange Stripe
698-0056
Standard
/LPH
5HJXODU XQOLQHG JUDLQ OHDWKHU
Gunn-cut design with keystone
thumb and adjustable back strap
ZLWKEXFNOHDQGVHOIKHPPHGRSHQFXII,GHDOIRUPDWHULDOKDQGOLQJOXPEHUDSSOLFDWLRQVDQGDOOW\SHVRIGULYLQJ
Our No.
No.
Size
Shf
Pk
Unit
BOSS MFG CO
392-4297
6
Small
35
945-3473
0
0HGLXP
35
266-8499
/
/DUJH
35
899-1036
-
;/DUJH
35
($
GLOVES
‡63/,7&2:+,'(81/,1('
‡:$7(55(6,67$17
/($7+(5'5,9(56
SAFETY VESTS
‡5()/(&7,9(
(ODVWLFVLGHVWUDSVDUHXWLOL]HGWRDFcommodate a wide range of waist
VL]HV 7KH KRRN DQG ORRS FORVXUH
KHOSV NHHS WKH YHVW FORVHG *RRG
for daylight applications, bright
orange color that helps you stand out from the normal
EDFNJURXQGVFHQHU\8VHGLQDSSOLFDWLRQVVXFKDVZRUNing on/near roads, construction sites, school crossing
JXDUGVMRJJLQJZDONLQJF\FOLQJRUKXQWLQJ
Our No.
No.
Vest
Size
Vest
Color
Shf
Pk
Unit
Standard
2UDQJH
($
7RXJK XQOLQHG VSOLW OHDWKHU .H\stone thumb and buckle, and strap
IDVWHQHU6SHFLDOO\WDQQHGIRUZDWHU
UHVLVWDQFH ,GHDO IRU PDWHULDO KDQGOLQJ OXPEHU DSSOLFDWLRQVDQGDOOW\SHVRIGULYLQJ
Our No.
No.
Size
Shf
Pk
Unit
/DUJH
35
BOSS MFG CO
460-3536
/
MSA SAFETY WORKS
435-7182
GLOVES - LEATHER
8QOLQHG SUHPLXP JUDLQ GHHUVNLQ GULYHU ZLWK NH\VWRQH WKXPE
shirred elastic back, and self
KHPPHGRSHQFXII'ULHVVRIWDIWHU
UHSHDWHG ZHWWLQJV ,GHDO IRU PDWHULDO KDQGOLQJ OXPEHU
DSSOLFDWLRQVDQGDOOW\SHVRIGULYLQJ
GLOVES
‡3,*6.,1/($7+(53$/0
‡/,1('
Our No.
No.
Size
In
Shf
Pk
Unit
/DUJH
35
BOSS MFG CO
713-4448
/
‡*5$,1&2:+,'(
81/,1('
‡/($7+(5'5,9(56
7RSJUDGH XQOLQHG JUDLQ OHDWKHU
Gunn-cut design, shirred elastic
EDFN DQG NH\VWRQH WKXPE ,GHDO
for material handling, lumber applications, and all types
RIGULYLQJ
No.
Our No.
;
Shf
Pk
Size
Unit
BOSS MFG CO
591-6663
0
0HGLXP
35
914-1086
/
/DUJH
35
GLOVES
‡63$1'(;
‡+,9,6
Size
Shf
Pk
Unit
;;/DUJH
35
Our No.
No.
Size
Shf
Pk
Unit
CAT GLOVE & RAINWEAR
647-1783
&$7/
/DUJH
35
199-7824
&$7-
Jumbo
35
BOSS MFG CO
843-9572
No.
Fluorescent green Spandex back
IRUH[FHSWLRQDO¿WFRPIRUWDQGYLVibility with synthetic palm, padded
LQKLJKZHDUDUHDV5HÀHFWLYHWDSH
RQNQXFNOHDQG¿QJHUWLSVIRUDGGHGYLVLELOLW\LQORZOLJKW
VLWXDWLRQV$GMXVWDEOHZULVWVWUDSIRUVHFXUH¿W
GLOVES
Our No.
GLOVES
‡'((56.,181/,1('
‡/($7+(5'5,9(56
Safety & Organization
Grain pigskin leather palm, fully
OLQHG OHDWKHU LQGH[ ¿QJHU OHDWKHU
¿QJHU WLSV OHDWKHU NQXFNOH VWUDS
and pull, striped cotton back, continuous thumb, gunn-cut design, safety cuff, shirred elasWLFEDFN
FIRST AID KIT REFILLS
Our No.
‡*5$,1&2:+,'(
81/,1('
‡/($7+(5'5,9(56
SAFETY VESTS
,QFOXGHGLQWKHNLWLVD¿UVWDLGPDQual, major wound bandage and inVWDQWFROGSDFNLQD8QLTXHVW\OLVK
DWWUDFWLYHWUDQVOXFHQWFDUU\LQJFDVH
ZLWKGLVSHQVHUWUD\WKDWKHOSVNHHSFRQWHQWVRUJDQL]HG
7KH NLW¶V VOLGLQJ ORFN DOORZV LW WR EH KXQJ IURP KRRNV
.LWFRQWDLQV$GKHVLYH%DQGDJHV´[´
$GKHVLYH%DQGDJHV´[´6WHULOH6SRQJH'UHVVLQJV
´[´LQRQHSDFN6WHULOH6SRQJH'UHVVLQJV´
[´LQRQHSDFN6WHULOH7UDXPD3DG´[´
$OFRKRO3UHS3DGV$QWLVHSWLF7RZHOHWWHV3URYLGRQH,RGLQH3DGV6WLQJ5HOLHI3DGVIRULQVHFWELWHV
$GKHVLYH7DSH5ROO´[\DUGV)LQJHU6SOLQWV
$QWLEDFWHULDO7UHDWPHQW%XUQ&UHDPJUDPV
,QVWDQW&KHPLFDO&ROG3DFN3URWHFWLYH1DWXUDO
%DUULHU *ORYHV 7ZHH]HUV ´ &RWWRQ 7LS $SSOLFDWRUV6FLVVRUV*DX]H5ROO´[PHWHUV
(\H 3DG 1RQ$VSLULQ 7DEOHWV $QWDFLG
7DEOHWV,EXSURIHQ7DEOHWV7ULDQJXODU%DQGDJH
(\H:DVKR]DQG6DIHW\3LQV
Our No.
GLOVES
SAFETY VESTS
‡3,(&(6
‡67$1'$5'
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
GLOVES
GLOVES
GLOVES
‡63$1'(;
‡3$''('3$/0
‡6<17+(7,&/($7+(5
‡6,1*/(/($7+(53$/0
‡63/,7/($7+(5
Synthetic palm, padded in high
wear areas for increased protecWLRQ \HOORZ 6SDQGH[ EDFN IRU
VXSHUE ¿W DQG FRPIRUW ZLWK PHVK
XSSHUIRUDGGHGYHQWLODWLRQLQKLJKWHPSHUDWXUHV$GMXVWDEOHZULVWVWUDSIRUDVHFXUH¿W
Our No.
No.
Shf
Pk
Size
(ODVWLF ZULVW FXIIV ZLWK KRRN DQG
ORRS FORVXUH 6WUHWFK IDEULF IRU
ÀH[LELOLW\ DQG ¿W 6\QWKHWLF OHDWKHU
palms with textured palm pads and
¿QJHUWLSVIRUH[WUDZHDUDQGGXUDELOLW\0DFKLQHZDVKDEOH
Our No.
Unit
No.
Shf
Pk
Size
Select shoulder split leather palm,
gunn-cut design, striped cotton
EDFN OHDWKHU LQGH[ ¿QJHU ¿QJHU
WLSVDQGNQLWZULVW,GHDOIRUPHWDO
fabricating, plant maintenance, lumber, or any applicaWLRQZKHUHVHYHUHZHDULVSUHVHQW
Unit
Our No.
DIAMONDBACK
CAT GLOVE & RAINWEAR
&$7/
/DUJH
35
812-2848
%/70
0HGLXP
35
991-2643
&$7-
Jumbo
35
933-0598
%/7/
/DUJH
35
933-1943
%/7;/
;/DUJH
35
‡.1,7%$&.
‡/$7(;3$/0),1*(56
No.
0HQ¶VFRZVSOLWSDOPFOXWHFXWFRORU
VWULSHG FRWWRQ EDFN JORYHV .QLW
ZULVWWRNHHSRXWGLUW
Our No.
Shf
Pk
No.
Size
Shf
Pk
Unit
DIAMONDBACK
935-4358
Unit
&$7/
/DUJH
35
319-8785
&$7-
Jumbo
35
*9+&/
‡/$',(6¶63/,7&2:+,'(
‡/($7+(5'5,9(56
81/,1('
'XUDEOH VXHGH OHDWKHU LQ IDVKLRQDEOH FRORUV *XQQFXW GHVLJQ ZLWK
keystone thumb and shirred elasWLFEDFN$VVRUWHG&RORUV2SDO0RRQVWRQH%OXH7RSD]
,GHDOIRUPDWHULDOKDQGOLQJOXPEHUDSSOLFDWLRQVDQGDOO
W\SHVRIGULYLQJ
No.
Shf
Pk
Unit
35
Our No.
No.
Size
Shf
Pk
,GHDO IRU PHWDO IDEULFDWLQJ SODQW
maintanance, lumber, or any appliFDWLRQ ZKHUH VHYHUH ZHDU LV SUHVHQW6XHGHOHDWKHUSDOPOHDWKHULQGH[¿QJHUDQG¿QJHU
tips, grey stretchable lycra back, keystone thumb, fourFKHWWH ¿QJHUV HODVWLF FXII ZLWK DGMXVWDEOH VHOIJULSSLQJ
ZULVW IDVWHQHU $VVRUWHG &RORUV 2SDO 0RRQVWRQH %OXH
7RSD]
Unit
BOSS MFG CO
/
/DUJH
35
Shf
Pk
Unit
0HGLXP
35
/DUJH
35
6SOLWOHDWKHUSDOPLQGH[¿QJHU¿Qger tips, thumb, pull and knuckle
VWUDS *XQQFXW GHVLJQ ZLWK ZLQJ
thumb, shirred elastic back, and
UXEEHUL]HGFRWWRQVDIHW\FXII,GHDO
for metal fabricating, plant maintenance, lumber, or any
DSSOLFDWLRQZKHUHVHYHUHZHDULVSUHVHQW
Our No.
No.
Size
Shf
Pk
Unit
157-8848
/DUJH
35
535-7025
;
;;/DUJH
35
945-1519
.
&KLOG\UV
35
Size
Shf
Pk
Unit
/DUJH
35
‡3,*6.13$/0
‡,168/$7('
Grain pigskin leather palm, inGH[ ¿QJHU ¿QJHU WLSV DQG NQXFNOH
strap, insulated, wing thumb, knit
ZULVWVWULSHGFRWWRQEDFN
Our No.
No.
Size
In
Shf
Pk
Unit
/DUJH
35
BOSS MFG CO
059-6213
BOSS MFG CO
004-2549
Size
No.
Unit
GLOVES
Split leather palm, leather index
¿QJHU OHDWKHU ¿QJHU WLSV OHDWKHU
knuckle strap and pull, striped cotton back, wing thumb, gunn-cut
GHVLJQUXEEHUL]HGJDXQWOHWFXII,GHDOIRUPHWDOIDEULFDWing, plant maintenance, lumber, or any application where
VHYHUHZHDULVSUHVHQW
Our No.
Shf
Pk
BOSS MFG CO
‡63/,7/($7+(581/,1('
‡6,1*/(/($7+(53$/0
‡/$',(6¶/($7+(5
‡6,1*/(/($7+(53$/0
‡³%266*8$5'´
Size
‡63/,7/($7+(53$/0
GLOVES
GLOVES
No.
GLOVES
3UHPLXP VSOLW OHDWKHU SDOP LQGH[
¿QJHU¿QJHUWLSVWKXPESXOODQG
NQXFNOH VWUDS &RQWLQXRXV WKXPE
GHVLJQ6WULSHGFRWWRQEDFNZLWKUXEEHUL]HGVDIHW\FXII
,GHDOIRUPHWDOIDEULFDWLQJSODQWPDLQWDQDQFHOXPEHURU
DQ\DSSOLFDWLRQZKHUHVHYHUHZHDULVSUHVHQW
361-3700
BOSS MFG CO
BOSS MFG CO
35
35
‡63/,7/($7+(581/,1('
‡6,1*/(/($7+(53$/0
‡³67$//,21´
GLOVES
Our No.
328-5855
GLOVES
398-0125
BOSS MFG CO
Carded-One Size Fits All
202-8785
No.
Select split leather palm, leather inGH[ ¿QJHU OHDWKHU ¿QJHU WLSV DQG
OHDWKHU WKXPE DQG NQXFNOH VWUDS
:LQJ WKXPE GHVLJQ ZLWK VKLUUHG
HODVWLF EDFN DQG VWULSHG FRWWRQ EDFN ZLWK VDIHW\ FXII
,GHDO IRU PHWDO IDEULFDWLQJ SODQW PDLQWHQDQFH OXPEHU
RUDQ\DSSOLFDWLRQZKHUHVHYHUHZHDULVSUHVHQW
‡0(1¶6/($7+(53$/0
CAT GLOVE & RAINWEAR
Our No.
539-2782
‡6,1*/(/($7+(53$/0
‡63/,7/($7+(5
GLOVES
3RO\ FRWWRQ EUHDWKDEOH NQLW JORYH
with double coated yellow and
EODFNODWH[SDOPDQG¿QJHUVKHOSV
protect against cuts, abrasions and
SXQFWXUHV $GMXVWDEOH ZULVW VWUDS SURYLGHV D VHFXUH ¿W
ZKLOH WH[WXUHG ODWH[ SDOP DQG ¿QJHU SURYLGHV H[FHOOHQW
JULS
807-4189
Unit
GLOVES
GLOVES
Our No.
Shf
Pk
BOSS MFG CO
Color Safety Orange
713-4968
Our No.
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
/
Maintenance, Repair & Operations - GLOVES
GLOVES
GLOVES
‡/$',(6¶*5$,13,*6.,1
‡6,1*/(/($7+(53$/0
‡6<17+(7,&/($7+(5
‡³%$&.&28175<´
3HDUO JUH\ JUDLQ SLJVNLQ OHDWKHU
SDOP OHDWKHU LQGH[ ¿QJHU ¿Qger tips, and knuckle strap with
D EUHDWKDEOH FRWWRQ EDFN 6KLUUHG
HODVWLFZULVWDQGVDIHW\FXII$VVRUWHG&RORUV%OXH(PHUDOG*UHHQ1DY\,GHDOIRUPHWDOIDEULFDWLQJSODQWPDLQWDQDQFH OXPEHU RU DQ\ DSSOLFDWLRQ ZKHUH VHYHUH ZHDU
LVSUHVHQW
&ODULQR V\QWKHWLF OHDWKHU LV WRXJK
soft and comfortable to wear, reVLVWVVKULQNLQJDQGKDUGHQLQJ3DGGHG NQXFNOHV SURYLGH SURWHFWLRQ
against bumps, wing closing strap for perfect adjustPHQWV VWUHWFK VSDQGH[ IRU ÀH[LELOLW\ DQG ¿W O\FUD VLGH
SDQHOVIRULPSURYHGGH[WHULW\SDGGHGSDOPDQG¿QJHUV
IRUPRUHFRPIRUWHODVWLFZULVWFXIINHHSVGHEULVRXW8VH
IRU FDPSLQJ KXQWLQJ ¿VKLQJ FDUSHQWU\ DXWRPRWLYH
UDQFKLQJEDVLFXWLOLW\
‡),1*(5/(66
‡+($9<'87<
‡³352)5$0(5´
Our No.
Size
In
No.
Shf
Pk
Unit
BOSS MFG CO
615-1740
/DUJH
Our No.
35
No.
Size
Shf
Pk
6SOLWOHDWKHUSDOPLQGH[¿QJHUDQG
¿QJHUWLSV 6SDQGH[ EDFN DQG NH\VWRQH WKXPE IRU ÀH[LELOLW\ (ODVWLF
cuff with adjustable hook and loop
FORVXUHIRUWKHSHUIHFW¿W'RXEOHVWLWFKHGLQKLJKZHDU
DUHDVIRUORQJHUJORYHOLIH
No.
Size
Unit
BOSS MFG CO
100-4068
/
/DUJH
35
689-6989
;
;/DUJH
35
GLOVES
377-5590
00
0
35
657-4701
0/
/
35
001-2922
0;
;/
35
Shf
Pk
Unit
DIAMONDBACK
Carded-One Size Fits All
934-9507
*9/
‡*5$,13,*6.,1
‡6,1*/(/($7+(53$/0
‡0(&+$1,&¶6
352)(66,21$/6(5,(6
‡³%266*8$5'´
5HYHUVH JUDLQ SLJVNLQ SDOP
VWUHWFKDEOH VSDQGH[ EDFN IRXUFKHWWH ¿QJHUV ZLWK YHQW
KROHV(ODVWLFFXIIZLWKDGMXVWDEOHVHOIJULSSLQJZULVWIDVWHQHU 'HVLJQHG IRU D WLJKW ¿W ZLWK XOWUD ÀH[LELOLW\ 0DFKLQH ZDVKDEOH OLQH GU\ ,GHDO IRU PHWDO IDEULFDWLQJ
plant maintenance, lumber, or any application where
VHYHUHZHDULVSUHVHQW
No.
Shf
Pk
Size
&ODULQRV\QWKHWLFWOHDWKHULVWRXJK
soft and comfortable to wear, resists shrinking, stretching and
hardening, Thinsulate insulation for
ZDUPWK ZLWKRXW EXON SDGGHG NQXFNOHV SURYLGH SURWHFtion against bumps, wing closing strap for perfect adjustPHQWVDQGHDV\RQHDV\RIIVWUHWFKVSDQGH[IRUÀH[LELOLW\¿WSDGGHGSDOPIRUPRUHFRPIRUWO\FUDVLGHSDQHOV
IRULPSURYHGGH[WHULW\HODVWLFZULVWFXIINHHSVGHEULVRXW
8VH IRU FROG VWRUDJH VQRZ UHPRYDO FROG ZHDWKHU FRQVWUXFWLRQKXQWLQJ¿VKLQJDQGFDPSLQJ
No.
Size
Shf
Pk
Unit
941-1109
0//
/
35
044-1253
0/;
;/
35
Size
Shf
Pk
Unit
CUSTOM LEATHERCRAFT
037-6376
;
;/DUJH
35
Unit
GLOVES
‡6<17+(7,&/($7+(5
‡³75$'(60$1´
&ODULQR V\QWKHWLF OHDWKHU SDOPV
tough, soft and comfortable to
wear, resists shrinking, stretcing and hardening with textured
grip palm pads for better grip, extra wear and durabilLW\)OH[6SRWWKXPEGHVLJQIRUEHWWHUÀH[LELOLW\)OH[LEOH
1HRSUHQHZULVWFXIINHHSVGHEULVRXW:LQJFORVLQJZULVW
VWUDSIRUSHUIHFWDGMXVWPHQWVDQGHDV\RQHDV\RII
Our No.
No.
Size
In
Shf
Pk
Unit
CUSTOM LEATHERCRAFT
902-8150
/
/DUJH
35
GLOVES
‡6<17+(7,&/($7+(5
‡³75$'(60$1;75$
&29(5$*(´
GLOVES
&ODULQR V\QWKHWLF OHDWKHU LV WRXJK
soft and comfortable to wear, resists shrinking, stretching and
KDUGHQLQJ[WUDFRYHUDJHUHLQIRUFHGSDOP:LQJFORVLQJ
strap for perfect adjustments, easy on/off, and lycra side
SDQHOV IRU LPSURYHG GH[WHULW\ DQG VWUHWFK VSDQGH[ IRU
ÀH[LELOLW\DQG¿W
‡6<17+(7,&/($7+(5
‡³:,/'(51(66´
Our No.
Synthetic leather is tough, soft and
comfortable to wear, resists shrinkLQJVWUHWFKLQJDQGKDUGHQLLQJ+,325$38PHPEUDQHOLQHUSURWHFWV
from outside dampness but allows body moisture out,
SDGGHGNQXFNOHVSURYLGHSURWHFWLRQDJDLQVWEXPSVZLQJ
closing strap for perfect adjustments, lycra side panels
IRU LPSURYHG GH[WHULW\ 6XUH *ULS WH[WXUHG SDOP SDGV
DQG ¿QJHUWLSV IRU EHWWHU JULS DQG GXUDELOLW\ WHUU\ FORWK
WRUHPRYHVZHDWRUGHEULVIURPIDFH8VHIRUZHWFRQGLWLRQVFDPSLQJFROGZHDWKHUKXQWLQJ¿VKLQJFROGVWRUDJHVQRZUHPRYDO
35
GLOVES
Our No.
‡6<17+(7,&/($7+(5
‡³7,0%(5/,1(´
CUSTOM LEATHERCRAFT
6WULSHG FRWWRQ EDFN DQG FDQYDV
lined safety cuff, shirred wrist,
continuous thumb, padded and
OHDWKHU SDOP IRU FRPIRUW HYHQ RQ
WRXJKMREV
No.
GLOVES
Our No.
‡:25.0(1¶6
‡/($7+(563/,73$/0
Our No.
No.
Unit
‡0(1¶6/($7+(53$/0
‡³%266*8$5'´
Our No.
Our No.
CUSTOM LEATHERCRAFT
GLOVES
Shf
Pk
'HVLJQHG IRU FDUSHQWU\ IDUPLQJ
URR¿QJ DVVHPEO\ DQG PDWHULDO
KDQGOLQJ&ODULRQV\QWKHWLFOHDWKHU
wing closing, stretch spandex, textured grip palm pads,
QHRSUHQHNQXFNOHWHUU\FORWKKDOI¿QJHUGHVLJQ
Our No.
No.
Size
Shf
Pk
Unit
CUSTOM LEATHERCRAFT
282-5859
00
0
35
650-0995
0/
/
35
678-7220
0;
;/
35
No.
Size
In
Shf
Pk
Unit
CUSTOM LEATHERCRAFT
089-5573
0
0HGLXP
35
759-6935
/
/DUJH
35
503-9888
;
;/DUJH
35
GLOVES
‡6<17+(7,&/($7+(5
‡³:25.5,*+7:,17(5´
Synthetic leather is tough, soft and
comfortable to wear, resists shrinking, stretching and hardening and
wing closing strap for perfect adMXVWPHQWVDQGHDV\RQRII&ROGZHDWKHULQVXODWLRQZLWK
O\FUD VLGH SDQHOV IRU LPSURYHG GH[WHULW\ DQG FRQFHDOHG
LQVLGHVWLWFKLQJSUHYHQWVVQDJJLQJ
Our No.
No.
Size
In
Shf
Pk
Unit
CUSTOM LEATHERCRAFT
BOSS MFG CO
Unlined
412-5308
0
0HGLXP
35
885-6486
/
/DUJH
35
079-2358
//
/DUJH
35
485-8619
/;
;/DUJH
35
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
GLOVES
GLOVES
GLOVES
‡6<17+(7,&/($7+(5
‡³:25.5,*+7
;75$&29(5$*(´
‡/($7+(53$/0
‡675,1*.1,7
‡39&5,%%,1*
Synthetic leather is tough, soft and
comfortable to wear, resists shrinkLQJ VWUHWFKLQJ DQG KDUGHQLQJ
;WUD&RYHUDJH UHLQIRUFHG SDOP ZLWK VWUHWFK VSDQGH[ IRU
ÀH[LELOLW\DQG¿WO\FUDVLGHSDQHOVIRULPSURYHGGH[WHULW\
DQGFRQFHDOHGLQVLGHVWLWFKLQJSUHYHQWVVQDJJLQJ
Our No.
No.
Size
In
Shf
Pk
Unit
Top grain reinforced leather palm,
VKLUUHGHODVWLF%UHDWKULWHLVYHQWHG
in back to reduce fatigue and also
DOORZV IRU FRRO FRPIRUWDEOH XVH
([WHQGHG VSOLW OHDWKHU FXII ZLWK D
YHOFUR FORVXUH DQG IXOO ZUDS WKXPE +XVTYDUQD ORJR
$9$,/$%/( 72 5(*,67(5(' +8649$51$ '($/(56
21/<
Our No.
No.
Size
In
)LWV$OO
Shf
Pk
Unit
2UDQJH VSXQ DFU\OLFSRO\ NQLW UHYHUVLEOH 39& ULEELQJ RQ SDOP DQG
EDFNULEEHGNQLWZULVW
Our No.
No.
Size
Shf
Pk
Unit
/DUJH
35
Shf
Pk
Unit
35
Shf
Pk
Unit
BOSS MFG CO
008-2859
POULAN
CUSTOM LEATHERCRAFT
269-5880
249-5869
0
0HGLXP
35
923-0889
/
/DUJH
35
GLOVES
615-3886
;
;/DUJH
35
‡675,1*.1,75(9(56,%/(
‡:,7+39&'276
($
GLOVES
GLOVES
‡6<17+(7,&/($7+(5
‡³:25.5,*+7´
Synthetic leather is tough, soft and
comfortable to wear, resists shrinking, stretching and hardening with
wing closing strap for perfect adMXVWPHQWV DQG HDV\ RQRII &RQFHDOHG LQVLGH VWLWFKLQJ
VWUHWFK VSDQGH[ IRU ÀH[LELOLW\ DQG ¿W /\FUD VLGH SDQHOV
IRULPSURYHGGH[WHULW\DQGHODVWLFZULVWFXIINHHSVGHEULV
RXW
Our No.
No.
Size
In
Shf
Pk
0
0HGLXP
35
144-9446
/
/DUJH
35
466-9842
;
;/DUJH
35
‡6<17+(7,&/($7+(5
‡+,9,6,%,/,7<
Shf
Pk
454-1363X
0
0HGLXP
35
527-5011X
/
/DUJH
35
910-9778X
;
;/DUJH
35
Shf
Pk
Unit
)LWV$OO
35
6LQJOHSDOPR]SRO\HVWHUFRWWRQ
ÀDQQHO1DY\EOXHNQLWZULVWFOXWH
FXWGHVLJQ
Striped split leather palm, index
¿QJHU DQG ¿QJHUWLSV FRWWRQ EDFN
IRUYHQWLODWLRQDQGFRPIRUW
Our No.
No.
Size
Shf
Pk
Size
In
Unit
)LWV$OO
35
125-9175
/DUJH
35
519-8999
%
Small
35
BOSS MFG CO
823-2878
GLOVES
‡0(1¶6&27721
‡:,7+3/$67,&'276
Safety & Organization
R] SHUFHQW FRWWRQ FDQYDV
ZLWKSODVWLFGRWVRQSDOPLQGH[¿QJHU DQG WKXPE &OXWHFXW GHVLJQ
QDWXUDONQLWZULVW
GLOVES - CLOTH
Our No.
No.
337-4345
Shf
Pk
Size
No.
Size
In
Shf
Pk
Unit
/DUJH
35
Size
Shf
Pk
Unit
/DUJH
35
BOSS MFG CO
Unit
GLOVES
‡&27721
‡:,7+3/$67,&'276
White
Unit
No.
BOSS MFG CO
BOSS MFG CO
725-9054
:
/DGLHV
35
503-9706
:
0HQ
35
R] SHUFHQW FRWWRQ FDQYDV
ZLWKSODVWLFGRWVRQSDOPLQGH[¿QJHU DQG WKXPE &OXWHFXW GHVLJQ
QDWXUDONQLWZULVW
Our No.
CUSTOM LEATHERCRAFT
/DUJH
‡/$',(6*$5'(1
‡63/,7/($7+(53$/0
Our No.
Shf
Pk
‡&27721
‡6,1*/(3$/0
%OHDFKHGZKLWHSHUFHQWSRO\HVWHU SHUFHQW FRWWRQ VWULQJ NQLW
.QLWZULVW
3DGGHG V\QWKHWLF SDOP WH[WXUHG
¿QJHUWLS SDGV HODVWLF FXII ZLWK
VWUDS
301-3943
GLOVES
‡675,1*.1,7
‡5(9(56,%/(
‡6<17+(7,&3$/0
‡³:25.5,*+7´
Size
In
White
Size
GLOVES
GLOVES
No.
009-2338
Unit
CUSTOM LEATHERCRAFT
Size
BOSS MFG CO
Our No.
6RIWJORYHVWKDWDUHFRPIRUWDEOHWR
wear, resist shrinking and hardenLQJ 5HG SDOP SDGV UHLQIRUFH NH\
wear points, tacky palm for nonVOLSJULSSDGGHGNQXFNOHVDQGUHÀHFWLYHORJRDOORZVIRU
KLJKYLVLELOLW\
Our No.
No.
No.
BOSS MFG CO
good abrasion resistance, safety cuff and shirred elastic
ZULVW$VVRUWHGFRORUV
GLOVES
Size
In
Our No.
Our No.
GLOVES
964-1341
No.
6SOLWOHDWKHUSDOPLQGH[¿QJHUDQG
¿QJHUWLSV FRWWRQ EDFN IRU YHQWLODtion and comfort, rubberized safety
FXIIVKLUUHGHODVWLFZULVW3ULQWHGLQ
DVVRUWHGFRORUV
Unit
CUSTOM LEATHERCRAFT
Our No.
5HYHUVLEOH FRWWRQSRO\HVWHU EOHQG
VWULQJ NQLW ZLWK 39& GRWV RQ ERWK
VLGHV5LEEHGNQLWZULVW
‡/$',(6*$5'(1
‡63/,7/($7+(53$/0
No.
742-6547
0
0HGLXP
35
BOSS MFG CO
992-4101
/
/DUJH
35
751-1462
398-3608
;
;ODUJH
35
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - GLOVES
GLOVES
GLOVES
‡&/87(&87
‡&2772139&'277('
‡-(56(<
‡:25.
‡%52:1-(56(<
*HQHUDO SXUSRVH JORYH PDGH RI
poly/cotton blend with a clute-cut
and knit wrist that seals out dirt
DQGSURYLGHVDVHFXUH¿W
%ODFN FOXWH FXW 6WUDLJKW WKXPE
DQGNQLWZULVW
Our No.
Shf
Pk
No.
Unit
DIAMONDBACK
No.
*939'
35
/DUJH
%URZQ
35
%
Small
%URZQ
35
‡-(56(<
Shf
Pk
No.
Unit
DIAMONDBACK
Carded - One Size Fits All
535-9005
Our No.
Size
For Ages
Shf
Pk
Unit
35
Unit
/DUJH
35
Our No.
Size
In
Shf
Pk
Unit
/DUJH
35
Size
Shf
Pk
Unit
/DUJH
35
8QOLQHGGXUDEOHSRO\FRWWRQMHUVH\
ZLWK 39& GRWWHG SDOP 3URYLGHV
tactility and grip, extra long knit
ZULVW SURYLGHV H[WHQGHG ZULVW SURWHFWLRQ ZKLOH ORFNLQJ
RXW GLUW DQG GHEULV FOXWH FXW ZLWK FRQWLQXRXV WKXPE
8VHG IRU JHQHUDO SXUSRVH DQG RXWGRRU UHFUHDWLRQDO DSSOLFDWLRQV
Our No.
No.
Size
Pattern
Shf
Pk Unit
BOSS MFG CO
3ULQWHG NQLW IHDWXUHV D 38 FRDWHG
SDOP WKDW ZLOO SURYLGH SURWHFWLRQ
from nicks, scrapes, cuts and
128-1880
02/
/DUJH
2DN
35
471-9456
02/
/DUJH
Timber
35
GLOVES
‡-(56(<
5LEEHG FXII WUHH SDWWHUQ FDPRXÀDJH
123-2396
Unit
/DUJH
35
Safety & Organization
GLOVES - RUBBER / VINYL
GLOVES
Unit
35
No.
Size
Shf
Pk
Unit
CAT GLOVE & RAINWEAR
059-3434
&$7/
/DUJH
35
322-0191
&$7-
Jumbo
35
GLOVES
‡1</21
‡1,75,/(
&RDWHGZLWKIRDPFHOOQLWULOHVSHFLIically engineered to capture moisWXUH DQG SURYLGH DQ H[FHSWLRQDO
JULSLQZHWHQYLURQPHQWV([FHOOHQW
protection from cuts and punctures while maintaining
VXSHULRUGH[WHULW\DQGÀH[LELOLW\)RUP¿WWLQJQ\ORQVKHOO
ZLWKRSHQEDFNIRUFRPIRUWDQGEUHDWKDELOLW\$GMXVWDEOH
ZULVWWRDVVXUHDVHFXUH¿W
No.
Size
Shf
Pk
Unit
CAT GLOVE & RAINWEAR
Our No.
Shf
Pk
Our No.
Our No.
DEUDVLRQVZKLOHPDLQWDLQLQJKLJKOHYHOVRIGH[WHULW\NQLW
wrist helps to seal out dirt and loose debris while assurLQJDVHFXUHDQGFRPIRUWDEOH¿W$VVRUWHGFRORUV
No.
Shf
Pk
3RO\ FRWWRQ NQLW EDFN ZLWK IXOO\
FRDWHG ODWH[ SDOP NQLW ZULVW IRU
VQXJ¿W&DW'LHVHO3RZHULPSULQWHGRQEDFNRIHDFKKDQG
‡/$',(6*$5'(1
Our No.
Size
CLIP STRIP ITEM
657-0725
GLOVES
BOSS MFG CO
No.
SPONTEX INC
‡-(56(<
‡*(1(5$/385326(
‡&$02
BOSS MFG CO
Shf
Pk
GLOVES
&RWWRQMHUVH\ZLWKVXUHJULSPDWFKing dots on palm, thumb, and index
¿QJHU.QLWZULVWLQPDWFKLQJFRORU
$VVRUWHGFRORUV
629-6289
35
‡.1,7%$&.
‡/$7(;3$/0
‡/$',(6¶*$5'(1
‡-(56(<:,7+39&0,1,
'276
No.
&/
No.
+HDY\GXW\ XVH SDLQWYDUQLVK UHPRYHUV SRO\XUHWKDQH IXUQLWXUH
UH¿QLVKLQJ VWDLQV DQG VKHOODFV
surface prep, thinners/turpentine
DQG OLQVHHG RLO 5XEEHU FRDWLQJ
SURWHFWVDJDLQVWVHYHUDOUH¿QLVKLQJFKHPLFDOVDQGUHVLVWV
DEUDVLRQV(PERVVHGSDOPJULSRIIHUVJRRGJULSGU\RU
ZHW)ORFNHGFRWWRQOLQLQJDOORZVJORYHWRHDVLO\VOLSRQ
RII3URYLGHVJUHDWHUFRPIRUW$EVRUEVSHUVSLUDWLRQ´
*DXQWOHWFXIISURWHFWVIRUHDUP
BOSS MFG CO
817-5218
GLOVES
Our No.
Size
8QOLQHG FRWWRQ MHUVH\ ZLWK SODVWLF
dots on palm, thumb, and index
¿QJHU &OXWHFXW GHVLJQ ZLWK NQLW
ZULVW
BOSS MFG CO
285-2689
No.
‡-(56(<81/,1('
‡:,7+3/$67,&'276
&RORUIXOSHUFHQWFRWWRQMHUVH\
&OXWHFXWGHVLJQZLWKNQLWZULVW$VVRUWHG&RORUV5HG%OXH*UHHQ
*9/
‡³675,3167$,1´
GLOVES
‡&+,/'5(1¶6
‡-(56(<
Carded - One Size Fits All
934-9457X
STRIPPING GLOVES
35
GLOVES
Unit
Clip Strips
BOSS MFG CO
*9
No.
Our No.
Shf
Pk
No.
GLOVES - RUBBER / VINYL
R] JUHHQ FDPRXÀDJH MHUVH\
&OXWHFXWGHVLJQZLWKNQLWZULVW
&OXWH FXW VWUDLJKW WKXPE DQG NQLW
ZULVW IRU FRPIRUW DQG D EHWWHU ¿W
R]SHUFHQWFRWWRQ
Our No.
DIAMONDBACK
GLOVES
Our No.
Unit
544-7529
‡:25.
‡&277212=
934-6495X
Shf
Pk
Color
222-4079
GLOVES
Our No.
Size
BOSS MFG CO
Carded - One Size Fits All
933-5803X
Our No.
&OXWH FXW VWUDLJKW WKXPE DQG NQLW
ZULVW IRU FRPIRUW DQG D EHWWHU ¿W
R]EOHQGFRWWRQDQGSRO\HVWHU
No.
Size
Shf
Pk
Unit
)LWV$OO
35
508-1229
&$7/
/DUJH
35
865-7496
&$7-
Jumbo
35
DIAMONDBACK
950-9712
/*1
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
GLOVES
GLOVES
GLOVES
‡675,1*.1,7
‡81/,1('
‡³)/(;,*5,3´
‡0(1¶6675,1*.1,7
‡$7/$6$66(0%/<*5,3
‡,1'8675,$/
‡³$7/$6),7´
%ODFN Q\ORQ NQLW ZLWK QLWULOH SDOP
DQG¿QJHUV1\ORQNQLWZULVW
Superior durability, dexterity and
¿W 7KH WRXJK ODWH[ SDOP FRDWLQJ
with a seamless liner and open
EDFN PDNH WKHVH ZRUN JORYHV WKH
PRVW IXQFWLRQDO DQG YHUVDWLOH JORYHV RQ WKH PDUNHW FXWSRO\FRWWRQVWULQJNQLWVHDPOHVVOLQHUSURYLGHVVQXJ
¿W DQG NHHSV KDQGV FRRO DQG FRPIRUWDEOH 2SHQ EDFN
IRU SHUVSLUDWLRQIUHH ZHDU 3DWHQWHG GLSSLQJ SURFHVV DOORZV JORYH WR UHPDLQ ÀH[LEOH UHGXFLQJ KDQG IDWLJXH
&RQIRUPV WR FRQWRXUV RI KDQG IRU PD[LPXP GH[WHULW\
6SHFLDOO\ IRUPXODWHG ODWH[ SDOP SURYLGHV H[FHOOHQW ZHW
JULSDVZHOODVDEUDVLRQDQGSXQFWXUHUHVLVWDQFH
String knit polyester/cotton blend
with blue latex coated palm and
NQLWZULVW
Our No.
No.
Size
Shf
Pk
Unit
Small
35
BOSS MFG CO
849-2589
6
111-1210
0
0HGLXP
35
724-3892
/
/DUJH
35
035-9273
;
;/DUJH
35
Our No.
No.
Size
Shf
Pk
Unit
35
BOSS MFG CO
407-2518
0
0HGLXP
740-2126
/
/DUJH
35
071-9856
;
;/DUJH
35
Our No.
‡/$',(6¶
‡675,1*.1,7
1\ORQ NQLW ZLWK QLWULOH SDOP DQG
¿QJHUV 1\ORQ NQLW ZULVW $VVRUWHG
FRORUV<HOORZ0LQWDQG%OXH
Our No.
No.
Shf
Pk
Unit
BOSS MFG CO
836-9647
0
0HGLXP
35
048-0327
/
/DUJH
35
GLOVES
Our No.
No.
&6
Small
35
153-8321
&0
0HGLXP
35
&KHPLFDO DQG SXQFWXUH UHVLVWDQW
8QOLQHGIRUVXSHULRUGH[WHULW\3URWHFWVKDQGVIURPKDUVKFKHPLFDOV
146-1326
&/
/DUJH
35
639-5008
&;/
;/DUJH
35
Size
In
No.
Shf
Pk
Unit
SPONTEX INC
Color Green-Carded
711-4630
Small
35
711-4663
0HGLXP
35
711-4697
/DUJH
35
Size
Shf
Pk
Unit
BOSS MFG CO
340-7178
/
/DUJH
35
622-4562
;
;/DUJH
35
No.
Size
Shf
Pk
Unit
BOSS MFG CO
302-9865
*6
Small
35
578-2032
*0
0HGLXP
35
GLOVES
‡/$',(6¶675,1*.1,7
‡$7/$6$66(0%/<*5,3
GLOVES
‡:25.
‡³$7/$67+(50$),7´
1\ORQ NQLW ZLWK QLWULOH SDOP DQG
¿QJHUV 1\ORQ NQLW ZULVW $VVRUWHG
FRORUV<HOORZ*UHHQ%OXH
Our No.
No.
Size
Shf
Pk
Unit
BOSS MFG CO
263-4772
$6
Small
35
434-6821
$0
0HGLXP
35
'XUDEOH FRPIRUWDEOH ZRUN JORYH
The thick poly cotton/acrylic liner
cushions and keeps hands warm
ZKLOH DOORZLQJ PD[LPXP ÀH[LELOLW\
DQG FRPIRUW 6SHFLDOO\ WH[WXUHG SDOP SURYLGHV D JUHDW
JULS DQG WKH HUJRQRPLF GHVLJQ UHGXFHV KDQG IDWLJXH
0DFKLQHZDVKDEOHZLOOQRWVKULQN
Our No.
No.
‡:25.
‡³$7/$65(*5,3´
5HLQIRUFHG FRDWLQJ LQ WKXPE DUHD
Featuring excellent wet/slippery
JULS1DWXUDO UXEEHU LQKLELWV OLTXLG
SHQHWUDWLRQ 3UHYHQWV JORYH EORZ
RXW IRU ORQJHU ZHDU WLPH&RORU FRGHG RYHUHGJH DOORZV
IRUHDV\VRUWLQJDIWHUODXQGHULQJ
No.
Size
Shf
Pk
Unit
ATLAS GLOVE CONSUMER
([WUD WH[WXUHG UXEEHU FRDWLQJ IRU
more protection and a solid grip,
SUHFXUYHG VHDPOHVV ¿QJHUWLSV IRU
FRPIRUW DQG ORQJHU ZHDU $EVRUEHQW LQWHUORFN FRWWRQ OLQLQJ .QLW ZULVW NHHSV RXW PXG
DQGGLUW
Our No.
GLOVES
Our No.
‡/$',(6*$5'(1
‡³',57',**(5´
6WUHWFKDEOHEUHDWKDEOHEDFN3RO\
cotton-brushed lining for extra
ZDUPWK 3RO\HVWHUFRWWRQ EOHQG
ZLWKODWH[FRDWHGSDOPIRUÀH[LELOLW\
DQGEHWWHU¿W.QLWZULVWVHDOVRXWGLUW
Unit
954-3836
GLOVES
‡675,1*.1,7/,1('
‡³7+(503/86´
Shf
Pk
‡*$5'(181/,1('
‡³*$5'1<$5'´
Our No.
Size
Size
ATLAS GLOVE CONSUMER
GLOVES
GLOVES
No.
Size
Shf
Pk
Unit
611-5729
&6
Small
35
467-8041
&0
0HGLXP
35
872-0245
&/
/DUJH
35
650-0276
&;/
;/DUJH
35
GLOVES
‡:25.
‡³$7/$61,75,/(728*+´
Tough and durable lightweight
JORYHVZLWKH[FHOOHQWSHUIRUPDQFH
FRPIRUW DQG YHUVDWLOLW\ 7KH ÀH[ible nitrile coating is tougher than
UXEEHU SURWHFWLQJ SDOPV DQG ¿QJHUWLSV IURP WKH ULJRUV
RIHYHU\GD\ZRUN6HDPOHVVOLJKWZHLJKWEODFNQ\ORQNQLW
OLQHU LQFUHDVHV FRPIRUW ZKLOH LW UHSHOV GLUW DQG VWDLQV
'DUNSDOPDQGORQJHUFXII0DFKLQHZDVKDEOH
Our No.
&,6
Small
35
841-3601
&,0
0HGLXP
35
408-7524
&,/
/DUJH
35
255-1539
&,;/
;/DUJH
35
Size
Shf
Pk
Unit
ATLAS GLOVE CONSUMER
923-5227
17%%.6
Small
35
761-6329
17%%.0
0HGLXP
35
144-9701
17%%./
/DUJH
35
993-3656
17%%.;/
;/DUJH
35
ATLAS GLOVE CONSUMER
357-6881
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - GLOVES
GLOVES
GLOVES
‡&+(0,&$//$7(;/,1('
‡³'8%$55<´
‡*(1(5$/385326(
‡1,75,/(&2$7('
‡³08''<0$7(´
‡1216/,3*5,3
‡³3527(&725´
+HDY\ZHLJKWÀRFNOLQHGRUDQJHODWH[JD´OHQJWK5ROOHGFXII
URXJKJULS
Our No.
No.
Size
Shf
Pk
Unit
/DUJH
35
BOSS MFG CO
059-2402
/
8QOLQHG FRDWHG ZLWK IRDP FHOO
QLWULOH VSHFL¿FDOO\ HQJLQHHUHG WR
FDSWXUH PRLVWXUH DQG SURYLGH DQ
H[FHSWLRQDOJULSLQZHWHQYLURQPHQWV)RDPQLWULOHLVFXW
and puncture resistant while maintaining dexterity and
ÀH[LELOLW\VWUHWFKDEOHQ\ORQVKHOOLVIRUP¿WWLQJZLWKDQ
RSHQEDFNIRUFRPIRUWDQGEUHDWKDELOLW\
Our No.
No.
Size
Shf
Pk Unit
Color
BOSS MFG CO
GLOVES
‡&+(0,&$/
‡39&&2$7('
)XOO\ FRDWHG \HOORZ 39& VLQJOH
dipped, jersey lined, smooth grip,
NQLWZULVW
Our No.
No.
Unit
Jersey Lined
/DUJH
Small
3LQN
35
832-0277
30
0HGLXP
3LQN
35
No.
Size
Shf
Pk
/DUJH
Unit
BOSS MFG CO
504-1686
GLOVES
35
Fully coated black neoprene, premium, smooth grip, interlock lined,
NQLWZULVW
No.
GLOVES
‡&+(0,&$/
‡58%%(5&2$7('
Size
Shf
Pk
/DUJH
Unit
BOSS MFG CO
430-8664
35
5XEEHU FRDWHG SDOP WKXPE DQG
¿QJHUV RQ FRWWRQ ÀDQQHO VKHOO
(ODVWLF VWUDS RQ EDFN DQG VDIHW\
FXII
Our No.
GLOVES
988-4891
No.
Size
Unit
/DUJH
35
Size
Shf
Pk
Unit
/DUJH
35
GLOVES
2QH VL]H ¿WV DOO KHDY\ GXW\ QHRSUHQH JORYH UHVLVWV FKHPLFDOV
abrasions,
cuts,
sunlight,and
R]RQH 1RQVOLS JULS ZLWK SHUFHQWFRWWRQÀRFNOLQLQJDQG´HOERZOHQJWKFXII
No.
Shf
Pk
Unit
SPONTEX INC
‡&+(0,&$/
‡39&&2$7('
‡6833257(',168/$7('
Color Black-Carded
500-2472
)XOO\ FRDWHG JUHHQ 39& GRXEOH
dipped, jersey lined, rough sandy
JULS´OHQJWK
No.
Size
Small
35
862-1591
0HGLXP
35
358-1584
/DUJH
35
3XUH QHRSUHQH H[WHULRU ZLWK percent cotton jersey liner for
maximum perspiration absorbing
comfort, non-slip grip, extremely
ÀH[LEOHDQGLVGXUDEOHDQGPDFKLQH
ZDVKDEOH *ORYHV SURWHFW DJDLQVW FKHPLFDOV SXQFWXUHV
KRWZDWHUDQGDEUDVLYHV
Our No.
/DUJH
Shf
Pk
Unit
Small
($
564-2319
0HGLXP
($
504-5422
/DUJH
($
Shf
Pk
Unit
+HDY\GXW\ ODWH[ ZLWK FRWWRQ NQLW
OLQLQJ,QVXODWHVIURPKRWDQGFROG
WHPSHUDWXUHV&KHPLFDOUHVLVWDQW
No.
Size
35
809-5267
/DUJH
35
181-7717
;/DUJH
35
GLOVES
‡&2$7('3$/0
‡58%%(5/$7(;
:RUNJORYHVJULSSHUVUXEEHUODWH[
FRDWHGSDOPZLWKFRWWRQNQLW
OLQHU.QLWZULVWWRNHHSWKHGLUWRXW
No.
Size
Shf
Pk
Unit
DIAMONDBACK
Shf
Pk
Unit
35
784-6173
*96+2:$0
0HGLXP
35
207-6230
*96+2:$/
/DUJH
35
Jersey Lined
Size
In
290-5412
Our No.
BOSS MFG CO
140-4409
No.
Color Blue-Carded
‡1(235(1(
‡³7(&+1,&´
Our No.
Our No.
SPONTEX INC
GLOVES
BOSS MFG CO
Color Blue-Carded
621-3284
Our No.
)XOO\ FRDWHG EODFN QHRSUHQH 3UHPLXPVPRRWKJULSLQWHUORFNOLQHG
´OHQJWK
885-3020
Unit
SPONTEX INC
‡/$7(;
‡³&/($11&+(0´
Shf
Pk
‡&+(0,&$/
‡1(235(1(&2$7('
No.
Shf
Pk
GLOVES
BOSS MFG CO
Our No.
Size
In
SPONTEX INC
‡&+(0,&$/
‡1(235(1(&2$7('
Our No.
No.
‡1(235(1(
35
Our No.
Our No.
GLOVES
‡&+(0,&$/
‡39&&2$7('
)XOO\ FRDWHG ÀXRUHVFHQW RUDQJH
39& 6LQJOH GLSSHG IRDP LQVXODWHGURXJKJULSNQLWZULVW
BOSS MFG CO
574-4982
36
GLOVES
Shf
Pk
Size
993-6303
Superior resistance to household
FKHPLFDOV (PERVVHG VDIH QRQVOLS JULS &RWWRQ ÀRFN OLQLQJ $QDWRPLFDOO\VKDSHGKDQGDQG¿QJHUV
(DV\RQDQGRII([WUDSURWHFWLRQIRULQGRRUDQGRXWGRRU
KHDY\GXW\WDVNV
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
GLOVES
GLOVES
GLOVES
‡/$7(;/,1('
‡³+$1'&$5(´
‡',6326$%/(/$7(;
‡9,1</',6326$%/(
‡:,7+',63(16(5
‡³78)352´
'LVSRVDEOH ODWH[ JORYHV 6HDPOHVV
DQGUHYHUVLEOHZLWKUROOHGFXII
/DWH[ ZLWK FRWWRQ ÀRFN OLQLQJ 5Hsistant to most household chemiFDOV DQG GLOXWHG DFLGV 3HUIHFW ¿W
IRUFRPIRUW
Our No.
No.
Size
In
Shf
Pk
Unit
SPONTEX INC
Our No.
Shf
Pk
No.
Unit
BOSS MFG CO
Our No.
One Size Fits All
Color Yellow-Carded
846-0230
Small
35
846-0164
0HGLXP
35
846-0107
/DUJH
35
786-3806
%$*
GLOVES
REFINISHING GLOVES
‡&+(0,&$/5(6,67$17
‡³78)352´
/DWH[ ÀRFN OLQHG JORYHV WKDW DUH
reusable and waterproof protection
0HGLXPZHLJKWJORYHVDUHPDGHRI
ÀRFNOLQHGKLJKTXDOLW\ODWH[IRUXVH
GXULQJKHDY\GXW\UH¿QLVKLQJDQGFOHDQLQJMREV
Our No.
No.
Size
Color
Shf
Pk
626-7082
;/DUJH
2UDQJH
35
Size
Color
)LWV$OO
:KLWH
434-3133
GLOVES
'LVSRVDEOH EOXH QLWULOH PLO
´OHQJWKOLJKWO\SRZGHUHG
No.
%;
‡',6326$%/(
‡1,75,/(
Shf
Pk
Size
Shf
Pk Unit
TRIMACO
Seamless for better wear and tacWLOLW\UHVLVWDQWWRPDQ\OLTXLGVDQG
FOHDQVHUV ([FHOOHQW GH[WHULW\ DQG
WDFWLOH VHQVLWLYLW\ 5ROOHG FXII IRU
HDV\ UHPRYDO :KLWH OLJKWO\ SRZGHUHG
Unit
Our No.
No.
Size
Shf
Pk
Unit
%;
BOSS MFG CO
BOSS MFG CO
TRIMACO
No.
‡',6326$%/(/$7(;
Our No.
Unit
3URWHFW\RXUVHOIIURPKDUVKFKHPLFDOV DQG LUULWDQWV 9LQ\O JORYHV RIfer lightweight protection and are
JUHDW IRU WKRVH ZLWK ODWH[ DOOHUJLHV OLJKWO\ SRZGHUHG
UHXVDEOHDQGHFRQRPLFDO)LWVHLWKHUKDQG
266-7491
8/6
Small
%;
006-9989
8/0
0HGLXP
%;
917-6488
8//
/DUJH
%;
978-4356
8/;
;/DUJH
%;
100 Gloves Per Dispenser Box
452-1944
8+/
/DUJH
GLOVES DISPLAY
GLOVES
3URWHFW\RXUVHOIIURPKDUVKFKHPLFDOV DQG LUULWDQWV 9LQ\O JORYHV RIfer lightweight protection and are
JUHDWIRUWKRVHZLWKODWH[DOOHUJLHVOLJKWO\SRZGHUHGUHXVDEOHDQGHFRQRPLFDO2QHVL]H¿WVDOODQGHLWKHUKDQG
No.
Size
Color
Shf
Pk
Unit
)LWV$OO
:KLWH
3.
3URWHFW\RXUVHOIIURPKDUVKFKHPLFDOVDQGLUULWDQWV9LQ\OJORYHVRIIHU
lightweight protection and are great for those with latex
DOOHUJLHV /LJKWO\ SRZGHUHG DQG UHXVDEOH WKHVH JORYHV
DUH LGHDO IRU SDLQWLQJ JDUGHQLQJ FOHDQLQJ DXWRPRWLYH
DQGRWKHUKRXVHKROGFKRUHV
Our No.
No.
Shf
Pk
Unit
3.
SPONTEX INC
TRIMACO
632-9114
/LJKWO\ SRZGHUHG IRU HDV\ RQ DQG
RII 2QH VL]H ¿WV DOO )LWV HLWKHU
KDQG$SSOLFDWLRQV*HQHUDO&OHDQLQJ3HW0HVVHV$XWRPRWLYH3DLQWLQJ:RRGZRUNLQJ+DLU&RORULQJ
*DUGHQLQJ
GLOVES
‡&+(0,&$/5(6,67$17
‡9,1</
‡³78)352´
Our No.
‡/$7(;',6326$%/(
‡9,1</$//385326(
‡&+(0,&$/5(6,67$17
‡+($9<'87<
‡³78)352´
599-0767X
Our No.
Our No.
No.
Size
Color
Shf
Pk
)LWV$OO
Green
Unit
3.
TRIMACO
272-6818
No.
($
Shf
Pk
‡29(5%227%8&./(
Unit
One Size Fits All
Green
WORK BOOTS
SPONTEX INC
175-5115X
;/DUJH
BOOTS - OVERSHOE
5ROOHGFXIIWRSUHYHQWGULSV/LJKWO\
SRZGHUHG IRU HDV\ RQRII 5HVHDODEOHSDFNDJH
Our No.
Safety & Organization
‡9,1</',6326$%/(
3URWHFW\RXUVHOIIURPKDUVKFKHPLFDOV DQG LUULWDQWV 9LQ\O JORYHV RIfer lightweight protection and are
JUHDWIRUWKRVHZLWKODWH[DOOHUJLHV/LJKWO\SRZGHUHGDQG
UHXVDEOHWKHVHJORYHVDUHLGHDOIRUSDLQWLQJJDUGHQLQJ
FOHDQLQJDXWRPRWLYHDQGRWKHUKRXVHKROGFKRUHV
Shf
Pk Unit
Color
6.5 Mil - Green - Bulk
GLOVES
‡&+(0,&$/5(6,67$17
‡9,1</+($9<'87<
‡³78)352´
Size
TRIMACO
030-5078X
GLOVES
No.
3.
&RQVWUXFWHG RI GXUDEOH R]RQH
DQG ZDWHU UHVLVWDQW UXEEHU 5XJJHGULEEHGQRQVOLSRXWVROHZRQ¶W
WUDFNPXGDQGGLUWLQVLGH1HWOLQLQJ ÀH[LEOH KDQG OD\HUHG ORQJ
ODVWLQJIDVWHQHUV&RORU%ODFN
Our No.
No.
Size
In
Shf
Pk
Unit
NORCROSS SAFETY
499-4141
7
35
499-4166
7
35
499-4174
7
35
499-4182
7
11
35
499-4190
7
35
499-4208
7
35
499-4216
7
35
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - OVER-SHOE BOOTS
TOOL BOXES
TOOL BOXES
$GMXVWDEOHFXII)LWVRYHUVKRHV
‡0(7$/0(&+$1,&6
‡:,7+722/75$<
‡3/$67,&
Our No.
No.
Shf
Pk
Size
Unit
5HG ZLWK ÀDW OLG PHWDO WRRO WUD\
PDGHRIKHDY\JXDJHPHWDO6WXUdy handle and a steel latch mechaQLVP WKDW VHFXUHV WKH WRROER[
0HWDO ULGJH SURWHFWV OLG KLQJH 2YHUDOO GLPHQVLRQV ´
/[´:[´+
DIAMONDBACK
Our No.
Yellow
Unit
HOMAK MFG. CO., INC.
094-3134
5%&
35
187-9469
5%&
35
841-0326
5%&
35
002-2335
5%&
35
313-3113
5%&
11
35
TOOL BOXES
337-3438
5%&
35
‡'5$:(567((/
951-2146
5%&
35
330-6115
5%&
35
914-8719
5%&
35
318-0015
5%&
35
5HG DOO PHWDO FRQVWUXFWLRQ 0HWDO
ULGJH SURWHFWV OLG KLQJH 'RXEOH
ZDOO FRQVWUXFWLRQ 6OLS SURRI PDWV
in drawers, and ball bearing glides
RQGUDZHUV7RROER[LVVHFXUHGE\
a double latch system and also includes a top storage
DUHD'UDZHUV'LPHQVLRQV´/[´:[+´
434-1590
Safety & Organization
Our No.
MECHANICS TOOL BOXES
TOOL BOXES
O.A.
LxWxH In
No.
Shf
Pk
Unit
Our No.
No.
Unit
416-0420
1
5'
($
1
[[
HOMAK MFG. CO., INC.
‡0(7$/0(&+$1,&6
‡:,7+722/75$<
‡+,3522)/,'
586-7114
5HGKHDY\JXDJHPHWDOZLWKPHWDO
tool tray, sturdy handle and a steel
latch mechanism that secures the
WRROER[0HWDOULGJHSURWHFWVOLGKLQJH
Our No.
No.
Shf
Pk
66
Unit
($
[[
1
Unit
5'
($
Our No.
Shf
Pk
No.
Unit
HOMAK MFG. CO., INC.
TOOL BOXES
023-7412
5'
($
‡3/$67,&0(&+$1,&6
‡%(9(/('/,'
No.
($
'XUDEOH WRRO ER[ ZLWK LQWHJUDWHG
organizer for small parts and conQHFWRUVH[WUDZLGHFDUU\LQJKDQGOH
makes it easy to transport the box
DURXQG WKH MREVLWH KHDY\ GXW\
UHVLQGHVLJQVWDQGVXSWRWKHWRXJKHVWGDLO\DEXVHWRS
RUJDQL]HU GHWDFKHV IURP WRRO ER[ IRU DGGHG YHUVDWLOLW\
FRUURVLRQUHVLVWDQWODWFKHVNHHS\RXUYDOXDEOHWRROVVDIH
DQGVHFXUHLQWKHER[SHUIHFWVWRUDJHVROXWLRQIRUPHFKDQLFVHOHFWULFLDQVPDLQWHQDQFHZRUNHUVHWF
Our No.
No.
Lgth
In
Shf
Pk
Unit
STANLEY TOOLS
925-4715
':67
($
2QHKDQGHG RSHUDWLRQ ODWFK WKDW
allows for opening when the other
KDQGLVRFFXSLHGLQWHJUDWHGZDWHU
seal to help protect from water and
GXVWVRIWJULSKDQGOHIRUHDV\JULS
DQGFDUU\LQJ9JURRYHRQOLGVXLWDEOHIRUKROGLQJSLSHV
DQGOXPEHUZKLOHEHLQJZRUNHGRQ
Our No.
No.
Lgth
In
Shf
Pk
Unit
STANLEY TOOLS
195-0518
,PSDFWUHVLVWDQW SODVWLF ZLWK OLG
KLQJHJXDUG5HPRYDEOHSODVWLFOLG
storage compartments for small
KDUGZDUHLQWHUQDOSODVWLFWUD\
Our No.
':67
‡0(7$/±21(728&+
5HG SRUWDEOH WRROER[ 2YHUDOO GLPHQVLRQV´/[´:[´+
HOMAK MFG. CO., INC.
849-1441
Unit
TOOL BOXES
‡67((/3/$67,&
Shf
Pk
Shf
Pk
‡5(029$%/(25*$1,=(5
TOOL BOXES
OA
Size In
Lgth
In
TOOL BOXES
No.
TOOL BOXES
No.
($
3DLQWHG UHG VWDLQOHVV VWHHO ERG\
with black, plastic-reinforced corQHUV )XOOOHQJWK DOXPLQXP KDQGOH
IRU VWXUG\ EDODQFHG JULS 6HFXUHG
ZLWK GRXEOHFODVS V\VWHP /LIWRXW SODVWLF WUD\ DQG UHPRYDEOH VWRUDJH ELQV LQFOXGHG2YHUDOO GLPHQVLRQV
´/[´:[´+
Our No.
($
STANLEY TOOLS
751-4011
5'
‡67((/3/$67,&
‡:,7+75$<
HOMAK MFG. CO., INC.
Top case with integrated carry hanGOHIRUSRZHUWRROVDQGVPDOOSDUWV
long metal carry handle for easy
JULS DQG FDUU\LQJ WKH WRWH KHDY\
GXW\GHVLJQDQGGXUDEOHVWUXFWXUH
front push-button for easy detachLQJDWWDFKLQJ RI WKH FDVH WR WKH WRWH XQLW KHDY\GXW\
DQWLUXVWPHWDOODWFKHVRQWRSFDVH
Our No.
TOOL BOXES
Shf
Pk
TOOL BOXES
‡0(7$/0(&+$1,&6
‡+,3522)
5HGKHDY\JXDJHPHWDOZLWKVWXUG\
handle and a steel latch mechaQLVPWKDWVHFXUHVWKHWRROER[0HWDO ULGJH SURWHFWV OLG KLQJH 2YHUDOO
GLPHQVLRQV´/[´:[´+
Unit
($
HOMAK MFG. CO., INC.
872-3397
Shf
Pk
No.
19-1/2” L x 10-1/2” W x 9-1/2” H
018-2188X
1
5'
Our No.
MINTCRAFT
Shf
Pk
No.
%XLOWLQ RUJQL]DWLRQ FRPSDUWPHQWV
FRQYHQLHQWOLIWRXWFDUU\WUD\
TOOL BOXES
‡3/$67,&
OA
Size In
Shf
Pk
Unit
HOMAK MFG. CO., INC.
%XLOWLQ RUJDQL]DWLRQ FRPSDUWPHQWV FRQYHQLHQW OLIW RXW FDUU\
WUD\
253-5243
%.
[[
($
704-8416
%.
[[
($
Our No.
395-1878
%.
[[
($
MINTCRAFT
No.
Size In.
LxWxH
[[
Shf
Pk
Unit
($
Display
018-2592X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
':67
($
- Maintenance, Repair & Operations
Safety & Organization
STORAGE/PARTS CABINETS
TOOL CHEST
‡'5$:(56
‡67((/
‡³63((':$<´
6ROLG VWHHO KHDY\GXW\ FRQVWUXFWLRQ XQLW LV HTXLSSHG ZLWK RI
the most commonly used tools and
DFFHVVRULHVLQFXVWRPIRUPHGWRROVSHFL¿FRUJDQL]HUVIRU
XOWLPDWHVWRUDJHDQGTXLFNDFFHVVWRRONLWLQFOXGHV+H[
.H\ZUHQFKHVR]&ODZ+DPPHU¶0HDVXULQJWDSH
´ /RQJ QRVH SOLHUV ´ 7RUSHGR OHYHO 7ZLVW GULOOV 0DVRQU\ ELWV :RRG ZRUNLQJ GULOOV ´ $GMXVWDEOH ZUHQFK
6FUHZGULYHUV 0DJQHWLF %LW KROGHU 5DWFKHW ZUHQFKHV
´ ´ DQG ´ ´ 6SDUN SOXJ VRFNHWV ([WHQVLRQ EDUV 'ULYH VRFNHWV ´ ´ DQG ´ 6FUHZGULYHU ELWV PP DQG PP PP =LQF $OOR\ .QLIH
´*URRYH-RLQWSOLHUVDQG´/RFN*ULSSOLHUV%DOOEHDUings keep the drawers operating smoothly and minimizes
ZHDUDQGWHDU
Our No.
No.
Shf
Pk
Unit
NORTH AMERICAN TOOL IND
120-4593
1
($
STORAGE CABINETS
STORAGE BOXES
‡'5$:(53/$67,&
‡3/$67,&
0DQXIDFWXUHG IURP KHDY\ GXW\
UXJJHG SODVWLF &DELQHW FRQWDLQV VPDOOGUDZHUVDQGODUJHGUDZHUV
&OHDU GXUDEOH SODVWLF DOORZV HDV\
YLVLELOLW\ RI WKH LWHPV EHLQJ VWRUHG
LQWKHGUDZHU´:['[´+
2UJDQL]HV VPDOO KDUGZDUH /LG
VHFXUHG ZLWK WZR SODVWLF ODWFKHV
&OHDUOLGIRUHDV\VHOHFWLRQ3HUPDQHQW FRPSDUWPHQWV ZLWK DGMXVWDEOHUHPRYDEOHGLYLGHUV
Our No.
Shf
Pk
No.
Unit
HOMAK MFG. CO., INC.
555-1965
‡'5$:(56
‡67((/
Shf
Pk
Our No.
Shf
Pk
No.
Unit
HOMAK MFG. CO., INC.
Unit
325-5411
($
1
5'
Our No.
&OHDU GXUDEOH SODVWLF DOORZV HDV\
YLVLELOLW\ RI WKH LWHPV EHLQJ VWRUHG
LQ WKH GUDZHU 0DQXIDFWXUHG RI D
KHDY\ GXW\ SODVWLF IRU GXUDELOLW\
DQGVWUHQJWKZLWKVPDOOGUDZHU
DQGODUJHGUDZHUV´:;´';´+
Shf
Pk
No.
208-8771
Our No.
Unit
MINTCRAFT
1
-/
[[
Shf
Pk
Unit
1
($
($
017-6289X
No.
Size In.
LxWxH
[[
Shf
Pk
Unit
Display of 6
+$
($
Safety & Organization
JOBSITE TOOL BOXES
TOOL CHEST
*UHDWIRUFOHDQLQJXSFOXWWHUGXUDEOHSODVWLFPDWHULDOHDVLO\VWDFNHG
Our No.
No.
‡&2175$&725
‡³-2%6,7(´
WxDxH
In
Shf
Pk
Unit
HOMAK MFG. CO., INC.
198-4301
S
+$
[[
1
($
995-5618
S
+$
[[
1
($
Unit
NORTH AMERICAN TOOL IND
859-5589
Size
In
HOMAK MFG. CO., INC.
‡3/$67,&
,QWHUQDO ORFNLQJ V\VWHP IRU H[WUD
VHFXULW\ EDOO EHDULQJ VOLGHV IRU
HDFKGUDZHUGXUDEOHSRZGHUFRDWLQJ ¿QLVK VLGH KRRNV IRU FRQYHQLHQWKDQJLQJRIWRROVWRSFKHVWLV
SDFNHGLQWKHUROOHUFDELQHWFRPHVLQUHGEOXHEODFNRU
JUHHQ'UDZHUPPERG\PPRYHUDOOGLPHQVLRQV 7RS ´: [ ´' [ ´+ %RWWRP
´:['[´+
No.
No.
($
COMBO TOOL CHEST/
CABINET
Our No.
($
5HPRYDEOH GLYLGHUV WR FXVWRP]H
FRPSDUWPHQWVL]HV
STORAGE BINS
Shf
Pk
STORAGE BOXES
‡'5$:(563/$67,&
290-1957
[[
MINTCRAFT
+$
Our No.
+$
+HDY\GXW\ ZHDWKHU GHQW UHVLVWDQW DOXPLQXP FRQVWUXFWLRQ 5HLQforced frame and corners for added
VWUHQJWK 3DGGHG GLYLGHUV DQG UHPRYDEOHSRFNHWWRROKROGHU$SSOLFDWLRQV ,GHDO IRU WRROV KREELHV DQG FUDIWV FDPHUDV
DQGPRUH.H\HG/RFNV)RU6HFXULW\
0DQXIDFWXUHGRIDKHDY\GXW\SODVWLFIRUGXUDELOLW\DQGVWUHQJWK&OHDU
GXUDEOHSODVWLFDOORZVHDV\YLVLELOLW\
of the items being stored in the
GUDZHU2YHUDOOGLPHQVLRQV´
:[´'[´+
STORAGE CABINETS
5HG DOOVWHHO FRQVWUXFWLRQ +RPHRZQHU¶VFRPERIHDWXUHVDGUDZHU
WRS FKHVW DQG GUDZHU UROOLQJ
FDELQHWZLWKIULFWLRQJOLGHV)RXUZKHHOV[LQFKFDVWHUV
ZLWK ]LQF ¿QLVK $ ORFNLQJ WRS FRPSDUWPHQW LV VHFXUHG
ZLWKDWXEXODUORFNLQJPHFKDQLVP+XJHERWWRPÀLSXS
SDQHOFDELQHWVIRUODUJHULWHPV/RFNLQJFDVWHUZKHHOVIRU
VDIHW\ 2YHUDOO GLPHQVLRQV ´/[´:[´+
ZHLJKVOEVR]V
Unit
‡$/80,180
‡'5$:(563/$67,&
204-1291
Shf
Pk
STORAGE CASES
HOMAK MFG. CO., INC.
COMBO TOOL CHEST/
CABINET
Size
In
($
STORAGE CABINETS
No.
No.
HOMAK MFG. CO., INC.
006-1242
+$
Our No.
Our No.
($
STORAGE BIN SETS
Our No.
‡3/$67,&
No.
L x Hx
Width In.
Usable
Cu. Ft.
Shf
Pk Unit
WxDxH
In
Shf
Bins Pk Unit
686-1447
[[
1 ($
190-8789
[[ 1 ($
949-0616
[[
1 ($
271-2420
[[
1 ($
HOMAK MFG. CO., INC.
897-4305 +$
No.
DELTA CONSOLIDATED
2UDQJH ELQ DOORZV HDV\ ¿QGLQJ RI
SDUWV,QFOXGHVPRXQWLQJEDUV
Our No.
(DV\ OLIW H[WHQGHG HGJH OLG 7DOO
GHHS KDQGOH UHFHVVHV %ROW FXWWHU
free locking system protects padORFNV LQVLGH JDXJH VWHHO KRXVLQJV IURP FXWWLQJ WRROV DQG SU\ EDUV 3DGORFNV QRW LQFOXGHGFDQQRWEHSULHGRUSXOOHGRXW+HDY\GXW\KLQJH
LVVWDNHGDQGZHOGHGWRSUHYHQWWKHKLQJHSLQIURPEHLQJ
GULYHQRXWWREUHDNLQ+HDY\GXW\´VWHHOORFNLQJDUP
KROGVWKHOLGRSHQ(DV\DFFHVV´WDOOFDVWHUEROVWHUV
IRUDGGLQJRSWLRQDOFDVWHUVQRWLQFOXGHG
[[ 3.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - Chemicals,Cleaners & Cleaning
Implements
TOOL BOXES
‡3,(&(:,7+67587
Our No.
No.
Shf
Pk
Unit
1
6(7
VULCAN
770-9892
PRESSURE
WASHER ACCESSORIES
MISC HAND TOOLS
6ROLG JDXJH VWHHO ´ DQG ´
ER[HVJDXJHVWHHO´ER[0,*
welded seams for extra durabilLW\ 7DPSHU SURRI ORFNV NHHS WRROV
VDIH 5HFHVVHG LQGXVWULDO VWUHQJWK
KDQGOHV +HDY\GXW\ ORFNLQJ KLQJH SURYLGHV H[WUD OLG
VWUHQJWK /DUJH DQG PHGLXP ER[HV DUH SUHGULOOHG IRU
FDVWHUV6.8'XUDEOHSRZGHUFRDW¿QLVKIRU
UXVWUHVLVWDQFHDQGVFUDWFKHV
<7/
‡+286(6,',1*
‡&21&(175$7(
GRABBING TOOL
‡527$7$%/(+($'
‡³1,)7<1$%%(53/86´
8VHWRSLFNXSLWHPVZLWKRXWEHQGing or touching and to reach high
VKHOYHV ZLWKRXW VWUDLQ %XLOW LQ
PDJQHW+HDGURWDWHVDQG
GHJUHHV
Our No.
Lgth
In
No.
Shf
Pk
Unit
Our No.
UNGER INDUSTRIAL
573-5147
5HPRYHVGLUWJUHDVHRLODQGPLOGHZ VWDLQV &RQWDLQV ³6325(;´
DGGLWLYHZKLFKUHPRYHVWRXJKVWDLQVIURPPLOGHZPROG
DOJDHIXQJXVDQGPRVV)RUH[WHULRUVLGLQJURR¿QJRIDOO
types, gutters, stucco, brick and cement block, masonry,
ZDONZD\V DQG ZDOOV &RYHUV XS WR VT IW :DWHU
%DVHG%LRGHJUDGDEOH1RQÀDPPDEOH1RQWR[LF1RQ
DEUDVLYH
&'
Six large compartments for orgaQL]LQJ DQG VWRZLQJ VPDOO SDUWV
SRFNHWVRXWVLGHIRUDYDULHW\RI
WRROV DQG DFFHVVRULHV (DV\ORFN
pushbutton-release drawstring sysWHP6RIWERWWRPSDQHOSUHYHQWVWLSSLQJDQGVSLOOLQJ´
URXQG[´KLJK
Shf
Pk
Unit
($
CUSTOM LEATHERCRAFT
‡³*5$%%(5´
([WHQG \RXU UHDFK VDIHO\ ZLWKRXW
bending, straining or climbing a
ODGGHU (DVLO\ UHDFK DQG KROG VHcurely out of reach objects, up high
RU GRZQ ORZ 5XEEHU FRDWHG ZLGH
jaws easily pick up small, delicate objects without crushLQJXSWROEV0DGHRIDOXPLQXPDQGIHDWXUHVUXEEHU
RYHUPROGHGVWHHO¿QJHUV
Our No.
No.
Lgth
In
Shf
Pk
Unit
($
UNGER INDUSTRIAL
679-8508
Hobby & Stationary Tools
‡32&.(76
‡1</21
&RQWDLQV RLO JUDEEHU D XQLTXH DGGLWLYH ZKLFK SHQHWUDWHV WKH VXUIDFH WR GLVVROYH WRXJK
VWDLQV IURP JUHDVH RLO DOJDH PLOGHZ DQG GLUW ,GHDO
IRU XVH RQ SDWLRV FRQFUHWH EULFN PDVRQU\ GULYHZD\V
VLGHZDONV JDUDJH DQG EDVHPHQW ÀRRUV DQG PRUH 3URmotes the adhesion of paint, stains, sealers, and other
FRDWLQJV &RYHUDJH XS WR VT IW (DUWKIULHQGO\
:DWHUEDVHG%LRGHJUDGDEOH1RQÀDPPDEOH1RQ7R[LF
1RQ$EUDVLYH
No.
Size
Shf
Pk
Unit
362-6496
'*
Gallon
*$/
POWER WASHER CLEANSERS /ACC
'HVLJQHG WR ¿W VWDQGDUG ¿YH JDOORQ EXFNHW RXWVLGH SRFNHWV LQVLGHSRFNHWV
PRESSURE WASHER
ACCESSORIES
Shf
Pk
No.
Unit
MINTCRAFT
1
-/
($
Garden Tools
GRABBING TOOL
Our No.
No.
‡³1,)7<1$%%(5´
LUNDMARK WAX CO.
([FHOOHQW IRU JUDEELQJ LWHPV KLJK
DQG ORZ 0DGH RI DOXPLQXP DQG
IHDWXUHVUXEEHURYHUPROGHGVWHHO
,GHDO IRU LQGRRU DQG RXWGRRU XVH
7KH SRZHUIXO JHDUGULYHQ FODZV
JULSVPDOODQGRGGVKDSHGREMHFWV
071-4337
No.
PRESSURE WASHER
ACCESSORIES
‡08/7,385326(&/($1(5
'(*5($6(5
‡352)(66,21$/
&21&(175$7(
‡(;7(16,21+26(
8VH WR UHPRYH VWXEERUQ JUHDVH
RLO DQG PLOGHZ VWDLQV 8VH RQ SRUFKHV SRRO DUHDV SDWLR IXUQLWXUH H[WHULRU VLGLQJ ZRRG DOXPLQXP YLQ\O
DQGURR¿QJDVSKDOWVKLQJOHV¿EHUJODVVVKLQJOHVFHGDU
WLOHERDWVUHFUHDWLRQDOYHKLFOHVHQJLQHVWRROVPDFKLQH
SDUWVPDVRQU\DQGPDQ\RWKHUVXUIDFHV
MISC HAND TOOLS
Our No.
*$/
SUPREME CHEMICALS
BUCKET POCKETS
866-9541
‡&21&5(7('5,9(:$<
‡&21&(175$7(
‡³.58'.877(5´
Our No.
Our No.
Gallon
+6
PRESSURE
WASHER ACCESSORIES
TOTAL REACH TOOL
‡32&.(7'5$:675,1*
895-1766
Unit
MISC HAND TOOLS
BUCKET BAGS
No.
Shf
Pk
Clamps & Fastening Tools
BUCKET ORGANIZER
Our No.
Size
SUPREME CHEMICALS
079-8835X
Safety & Organization
No.
*
Size
Gallon
Shf
Pk
Unit
*$/
&RQQHFWVGLUHFWO\WRWKHKLJKSUHVsure water outlet and to an existing high pressure hose on the other
HQG ([WHQGV ZRUNLQJ UDQJH )LWV
PRVW.DUFKHUHOHFWULFSUHVVXUHZDVKHUVXSWR36,
Our No.
No.
Lgth
Ft
Shf
Pk
Unit
KARCHER NORTH AMERICA I
419-3645
1
($
PRESSURE WASHER
ACCESSORIES
‡7:,'($5($685)$&(
&/($1(5
PRESSURE WASHER
ACCESSORIES
O.A.
Lgth. In.
Shf
Pk
Unit
‡'5,9(:$<&21&5(7(
‡&21&(175$7(
8VHWRUHPRYHVWXEERUQJUHDVHRLO
DQGPLOGHZVWDLQV8VHRQFRQFUHWH
VXUIDFHVJDUDJHÀRRUVGULYHZD\V
EULFNDQGZDONZD\V
UNGER INDUSTRIAL
979-2532
($
241-6485
($
Our No.
No.
Size
For cleaning surfaces such as paWLRV GHFNV DQG GULYHZD\V ZLWKRXW
VSODVKEDFN &OHDQV ´ ZLGH DUHD
JHQWO\DVLWKRYHUV(OLPLQDWHVVWUHDNVE\NHHSLQJLWVWZR
QR]]OHVDWD¿[HGKHLJKWIURPWKHVXUIDFH:RUNVZLWK
.DUFKHUJDVROLQHSUHVVXUHZDVKHUVUDWHG36,
Our No.
Shf
Pk
Unit
*$/
LUNDMARK WAX CO.
205-2439
*
Shf
Pk
Unit
KARCHER NORTH AMERICA I
419-3652
Gallon
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
1
($
- Maintenance, Repair & Operations
PRESSURE WASHER
ACCESSORIES
PRESSURE WASHER
ACCESSORIES
‡81,9(56$/:$6+%586+
.,7
‡527$7,1*:$6+%586+
,QFOXGHVDVRIWEULVWOHZDVKEUXVK
a rotating wash brush and a set of
¿YH DGDSWHUV &DQ EH XVHG ZLWK
PRVW SUHVVXUH ZDVKHUV ZLWK D ZDWHU ÀRZ RI *30
RUOHVV
Our No.
No.
Shf
Pk
Unit
KARCHER NORTH AMERICA I
419-3637
1
EXTENSION POLES
8VH RQ DXWRPRELOH ERDW KRXVH
siding, shutters, windows and
RWKHUÀDWVXUIDFHV:DWHUSUHVVXUH
from the pressure washer cause
the inner brushes to gently spin, making it easier to
UHPRYH VWXEERUQ GLUW DQG GHEULV 'HVLJQHG IRU .DUFKHU
HOHFWULFSUHVVXUHZDVKHUV
Our No.
Shf
Pk
No.
Unit
KARCHER NORTH AMERICA I
($
989-5459
1
($
‡/,*+7:(,*+7
‡),%(5*/$66$/80,180
‡³48,&.),7´
2QHEXWWRQ TXLFN UHOHDVH OHYHU
VHFXUHO\ORFNVSROHDW´LQWHUYDOV
5LJLG WHOHVFRSLQJ DQRGL]HG DOXPLQXP FRPSRQHQWV RIIHU VXSHULRU VWUHQJWK )LEHUJODVV
SROH DQG UXEEHUL]HG FRPIRUW JULS KDQGOH KHOS SUHYHQW
SDLQWLQJIDWLJXH8VHZLWK3XUG\&DJHOHVVRU352(;75$
UROOHUIUDPHVIHDWXULQJ-LII\ORFTXLFNUHOHDVH¿WWLQJ$GG
a QuickFit adaptor for use with standard threaded roller
IUDPHV
Our No.
Adjust
Lgth Ft
No.
Shf
Pk
Unit
PURDY CORPORATION
PRESSURE WASHER
ACCESSORIES
Applicators & Painting Aids
EXTENSION POLES
‡7'(&.$1''5,9(:$<
&/($1(5
No.
Shf
Pk
Unit
KARCHER NORTH AMERICA I
989-5467
1
($
‡9$5,232:(5635$<
:$1'
6HUYHV DV D UHSODFHPHQW RU XSJUDGH IRU H[LVWLQJ 9DULR SRZHU
VSUD\ ZDQGV 'LDO LQ WKH GHVLUHG
DPRXQWRISUHVVXUHRQWKHZDQG3HUPLWVLQ¿QLWHO\YDULDEOHSUHVVXUHDGMXVWPHQW
No.
Shf
Pk
1
($
($
020-1681
7+.6
WR
($
No.
Shf
Pk
$GGWR4XLFN)LWSROHVIRUXVHZLWK
VWDQGDUGWKUHDGHGUROOHUIUDPHV
Unit
684-3577
53(
WR
($
684-3726
Our No.
53(
WR
($
PURDY CORPORATION
684-3767
53(
WR
($
567-5962
684-3775
53(
WR
($
‡$/80,180
($
8VHWRDGDSWWKUHDGHGWRROVWRWKH
ZRRVWHU TXLFN RQ DQG RII V\VWHP
:RUNV RQO\ ZLWK 6KHUORFN *7 RU
6KHUORFN *7 FRQYHUWLEOH SROHV
0DGH RI GXUDEOH ¿EHUJODVVUHLQIRUFHGQ\ORQ
7KUHDGHGIRUH[WHQVLRQSROHXVH
Adjust
Lgth Ft
,+.6
Unit
EXTENSION POLE
ADAPTERS
EXTENSION POLES
No.
Shf
Pk
No.
Shf
Pk
Unit
Our No.
Shf
Pk
No.
Unit
WOOSTER BRUSH
684-3809
53(
WR
($
684-3817
53(
WR
($
684-3858
53(
WR
($
719-1364
5
($
‡$/80,180
Shf
Pk
Unit
KARCHER NORTH AMERICA I
WR
EXTENSION POLES
6HUYHV DV D UHSODFHPHQW RU XSJUDGH IURP H[LVWLQJ 'LUW%ODVWHU
VSUD\ ZDQGV 8VHV WHFKQRORJ\ WR
LQFUHDVHWKHHIIHFWLYHSUHVVXUHRIHOHFWULFSUHVVXUHZDVKHUE\XSWRSHUFHQW)RUDUHDVZKHUHLQWHQVHFOHDQLQJ
LVQHHGHG
989-5483
Our No.
Adjust
Lgth Ft
LINZER PRODUCTS
‡',57%/$67(5635$<
:$1'
No.
WR
EXTENSION POLE
ADAPTERS
7KUHDGHGIRUH[WHQVLRQSROHXVH
Our No.
($
PRESSURE WASHER
ACCESSORIES
Our No.
‡$/80,180
‡³352(9(5/2.´
Unit
KARCHER NORTH AMERICA I
989-5475
,+.6
LINZER PRODUCTS
PRESSURE WASHER
ACCESSORIES
Our No.
7,+6
151-3118
EXTENSION POLES
For cleaning surfaces such as paWLRV GHFNV DQG GULYHZD\V ZLWKRXW
VSODVKEDFN &OHDQV ´ ZLGH DUHD
JHQWO\DVLWKRYHUV(OLPLQDWHVVWUHDNVE\NHHSLQJLWVWZR
QR]]OHV DW D ¿[HG KHLJKW IURP WKH VXUIDFH :RUNV ZLWK
.DUFKHUHOHFWULFSUHVVXUHZDVKHUV
Our No.
466-6483
1
($
EXTENSION POLES
Telescopic pole with spin table lock
V\VWHP $PHULFDQ WKUHDGLQJ KHDG
ZUDSSHGZLWKPHWDO
‡6(&7,21$/80,180
),%(5*/$66
‡+($9<'87<
‡³$/80,*/$66´
6PRRWK¿EHUJODVVKDQGOHZLWKUXEber hand grip and anodized alumiQXP VOLGHU 'LH FDVW PHWDO XQLYHUVDO WKUHDGHG HQG ¿WV
PRVW VWDQGDUG WKUHDGHG WRROV /RNWKUHDG RQ WKUHDGHG
HQGSUHYHQWVUROOHUIUDPHVDQGWRROVIURPORRVHQLQJGXULQJXVH([WHUQDOFKXFNDQGFROOHWORFNLQJGHYLFH7KUHH
VHFWLRQ SROHV RIIHU FRPSDFW VL]H SOXV H[WHQGHG OHQJWK
&RPSUHVVLRQ PHFKDQLVP ORFNV DW DQ\ H[WHQGHG OHQJWK
&RDUVH WKUHDGV SURYLGH TXLFN ORFN DQG XQORFN DQG SUHYHQW RYHUWLJKWHQLQJ 6SHFL¿FDWLRQV ´ GLDPHWHU
URXQG¿EHUJODVVKDQGOHDQG´DQG´GLDPHWHUURXQG
DOXPLQXPVOLGHUV
Our No.
No.
Adjust
Lgth Ft
Shf
Pk
No.
Adjust
Lgth Ft
Shf
Pk
Unit
102-2029
$/
WR
($
102-2771
$/
WR
($
104-6606
$/
WR
($
106-2520
$/
WR
($
Our No.
MINTCRAFT
Unit
MR LONGARM
084-4860
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - EXTENSION POLES
EXTENSION POLES
DROP CLOTHS
‡$/80,180
‡&200(5,&$/*5$'(
‡³7(/(3/86´
‡),%(5*/$66
‡3/$67,&0(',80+($9<
'87<
‡³-,))<&29(5´
µ7HOH3OXV¶ LV D ÀH[LEOH PRGXODU
V\VWHP 7KH WXEHV KDYH VHFtion units, with additional extension modules which enables you to assemble poles with
H[WHQGHG OHQJWKV IURP IW WR IW 7KH SROHV PDGH
of drawn anodized aluminum, are light weight and can
EH KDQGOHG HDVLO\ DQG VDIHO\ HYHQ ZKHQ DVVHPEOHG WR
SURYLGHDPD[LPXPUHDFK:LWKHUJRWHFORFNLQJFRQHIRU
XVHZLWK8QJHUSURGXFWV
Our No.
Extends
To Ft.
No.
Shf
Pk
Unit
UNGER INDUSTRIAL
Five 6’ Sections
124-1769
7,6
7)
Our No.
Adjust
Lgth Ft
No.
Shf
Pk
Unit
MINTCRAFT
Our No.
014-4857
(3$
WR
($
015-6356
(3$
WR
($
016-2586
(3$
WR
($
017-4409
(3$
WR
($
018-3228
(3$
WR
($
EXTENSION POLES
‡&$19$6+($9<'87<
‡³683(578))48,&.
'523´
)HDWXUHV RXWHU ORFNLQJ FDPV 7KH
FRQHLV¿[HGZLWKDQ$&0(WKUHDG
and has push button locking mechanism to secure and attach cleanLQJWRROV
Shf
Pk
Unit
UNGER INDUSTRIAL
828-1065
($
3UHPLXP FRQWUDFWRU JUDGH H[WUD
KHDY\6XSHUDEVRUEHQWDQGNHHSV
SDLQW IURP WUDFNLQJ 7KHVH IXOO
SDQHO GURSV DUH PDGH IURP KLJKTXDOLW\ FDQYDV +HPV
and seams are doubled-stitched, and all are full piece, no
UHPQDQWV:DVKDEOHDQGUHXVDEOHR]
Our No.
No.
Size
Ft
Shf
Pk
Unit
[
($
TRIMACO
200-1089
EXTENSION POLES
‡$/80,180),%(5*/$66
‡³6+(5/2&.´
Hexagonal aluminum inner pole
SUHYHQWV WZLVWLQJ 5XJJHG ¿EHUJODVV RXWHU SROH $GMXVWV LQ ´ LQFUHPHQWV /RFNVVHFXUHO\LQSODFH
8QLYHUVDO]LQFGLHFDVWWKUHDGHGWLS
Our No.
No.
Adjust
Lgth Ft
DROP CLOTHS
Unit
WOOSTER BRUSH
558-3950
5
WR
($
EXTENSION POLES
No.
Adjust
Lgth Ft
095-9635
Shf
Pk
No.
Size
Ft
Shf
Pk
Unit
[
($
081-1224
5
WR
($
539-4747
5
WR
($
591-7737
5
WR
($
629-6602
5
WR
($
714-2474
5
WR
($
[
($
Size
Ft
No.
Shf
Pk
Unit
($
WARP BROTHERS
1 Mil - Polybagged
897-8942X
-&60
[
DROP CLOTHS
‡3/$67,&+($9<'87<
‡³-,))<&29(5´
Size
Ft
No.
Shf
Pk
Unit
($
1 Mil - Polybagged
659-7579X
-&
[
DROP CLOTHS
‡3/$67,&+($9<'87<
‡³-,))<&29(5´
'LDPRQG SDWWHUQ HPERVVLQJ JLYHV
ÀH[LELOLW\ 'UDSHV HDVLO\ DQG JULSV
VXUIDFHV3DLQWGRHVQRWUXQRIIDV
TXLFNO\8QIROGVHDVLO\
Our No.
Size
Ft
No.
Shf
Pk
Unit
($
Shf
Pk
Unit
($
WARP BROTHERS
DROP CLOTHS
1 Mil - Embossed - Polybagged
‡3/$67,&0(',80'87<
‡³-,))<&29(5´
659-7512X
(&
[
3URWHFWV DJDLQVW GXVW DQG SDLQW
VSODWWHUV8QIROGVHDVLO\
Unit
WOOSTER BRUSH
8
WARP BROTHERS
TRIMACO
%D\RQHW *ULS 7LS KROGV :RRVWHU
WRROV LQ SODFH 5 FRQYHUVLRQ
tip stores in the end of the grip to
PDNHDOOWKUHDGHGWRROV*7FRPSDWLEOH,QVWDQWO\FKDQJH
WRROV ZLWK RQH SXVK RQ WKH ¿EHUJODVVUHLQIRUFHG Q\ORQ
OHYHU+H[DJRQDODOXPLQXPLQQHUSROHSUHYHQWVWZLVWLQJ
5XJJHG¿EHUJODVVRXWHUSROH(DVLO\DGMXVWLQLQLQFUHments with a touch of the thumb, then locks securely
LQSODFH
Our No.
Our No.
%LRGHJUDGDEOH 3ODVWLF 'URS &ORWK
QRW RQO\ KHOSV SURWHFW ÀRRUV DQG
furniture from damage, it also
KHOSVSURWHFWWKHHQYLURQPHQW&RQWDLQVDXQLTXHSODVWLF
that, when discarded in soil, will biodegrade into nonWR[LFVXEVWDQFHVDVGHVFULEHGLQ$670',WRIIHUVWKHVDPHSHUIRUPDQFHDVFRQYHQWLRQDOPLOSODVWLF
GURSFORWKVDQGLWVXQLTXHJUHHQWLQWKHOSVVKRZSDLQW
VSODWWHUV
Our No.
‡$/80,180),%(5*/$66
‡³6+(5/2&.*7
&219(57,%/(´
Our No.
0.6 Mil - Polybagged - Shelf Pack
884-9184X
For bigger jobs, almost twice the
FRYHUDJH 5HVLVWV WHDUV DQG SXQFWXUHVVWD\VLQSODFH8QIROGVHDVLO\
‡3/$67,&%,2'(*5$'$%/(
‡³(&2'523´
Shf
Pk
Unit
WARP BROTHERS
)RU FRYHULQJ DSSOLDQFHV EXLOGLQJ
PDWHULDOV IDUP HTXLSPHQW IXUQLture, garden tools, lumber, machinHU\ DQG SURWHFWV GXULQJ SDLQWLQJ
8QIROGVHDVLO\
DROP CLOTHS
‡$/80,1806(&7,21
Lgth
Ft
Shf
Pk
‡3/$67,&+($9<'87<
‡³-,))<&29(5´
DROP CLOTHS
No.
Size
Ft
No.
DROP CLOTHS
($
Applicators & Painting Aids
Our No.
)RU FRYHULQJ DSSOLDQFHV EXLOGLQJ
PDWHULDOV IDUP HTXLSPHQW IXUQLture, garden tools, lumber, machinHU\DQGSURWHFWVGXULQJSDLQWLQJ8QIROGVHDVLO\
Our No.
No.
Size
Ft
Shf
Pk
DROP CLOTHS
Unit
WARP BROTHERS
0.4 Mil - Polybagged - Shelf Pack
659-7470X
3&
[
($
‡3/$67,&(;75$+($9<
'87<
‡³-,))<&29(5´
Tougher, stronger, more puncture
UHVLVWDQW +DQG\ IRU FDPSHUV 8QIROGVHDVLO\
Our No.
Size
Ft
No.
WARP BROTHERS
2 Mil - Polybagged
659-7447X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
-&
[
- Maintenance, Repair & Operations
DROP CLOTHS
DROP CLOTHS
DROP CLOTHS
‡3/$67,&683(5+($9<
'87<
‡³-,))<&29(5´
‡)$%5,&'28%/(/$<(5
‡352)(66,21$/
‡³6&2776´
‡/,*+7:(,*+7&$19$6
‡87,/,7<:(,*+7
‡³683(578))´
3RSXODU IRU RXWGRRU XVH 8QIROGV
HDVLO\&DQEHXVHGIRUWDUS
3URWHFWVFDUSHWVÀRRUVDQGIXUQLWXUH5HXVDEOH0DGHRIDEVRUEHQW
+\GURNQLWIDEULFOD\HUSURWHFWLRQ
/HDNUHVLVWDQWSRO\EDFNLQJ
)RU OLJKW SDLQWLQJ SURMHFWV +HOSV
NHHS SDLQW IURP WUDFNLQJ &DQ
EH XVHG WR WUDS GXVW DQG GHEULV
:DVKDEOHDQGUHXVDEOH2]
Our No.
Size
Ft
No.
Shf
Pk
Unit
WARP BROTHERS
Our No.
4 Mil - Polybagged
683-7371
-&
[
No.
Size
Ft
Shf
Pk
Unit
KIMBERLY CLARK
($
Our No.
No.
Size
Ft
Shf
Pk
Unit
TRIMACO
051-4786
[
($
605-1304
[
($
078-5006
[
($
605-1288
[
($
605-1296
[
($
DROP CLOTHS
DROP CLOTHS
‡0(',80+($9<'87<
‡³-,))<&29(5´
7KHDOOSXUSRVHFRYHUPD\EHXVHG
on the ground, protects againist
UDLQ DQG FDQ EH XVHG DV D FRYHU
IRUZRRGSLOH
Our No.
Size
Ft
No.
Shf
Pk
Unit
WARP BROTHERS
-&
[
DROP CLOTHS
$EVRUEHQW SDSHU ZLWK OHDNSURRI
SODVWLFEDFNLQJIRUH[WUDSURWHFWLRQ
For painting, cleaning, wallpaperLQJDQGUHPRYDOVWRUDJHRURWKHUMREDSSOLFDWLRQV
3UHPLXP FRQWUDFWRU JUDGH KHDY\
ZHLJKW FDQYDV LV LGHDO IRU SDLQWing and cleaning, wallpapering and
UHPRYDO OHDI FROOHFWLRQ DV ZHOO DV
DEVRUELQJVSLOOVR]FDQYDV
Our No.
.8 Mil- Polybagged
019-2799
‡3$3(532/<'28%/(
/$<(5('
‡³75,0$&2´
DROP CLOTHS
Shf
Pk
Unit
[
($
‡'832176217$5$&2$7('
‡³21(78))´
3URWHFWVIURPGXVWDQGSDLQWVSODWWHU 0LOGHZSURRI :DWHUSURRI 2QH
SLHFHFRQVWUXFWLRQPLOWKLFN
Size
Ft
Wt
Shf
Pk Unit
PRIMROSE PLASTICS
)RUSDLQWLQJSODVWHULQJVWDLQLQJ
&ORWKVLGHDEVRUEVZKLOHWKHFRDWHG
VLGHSURYLGHVPD[LPXPSURWHFWLRQ
DJDLQVWOHDNDJH
No.
855-8611
[
($
118-8812
[
($
907-3693
[
($
Our No.
[
0HGLXP
($
TRIMACO
084-3615X
7$
[
/LJKW
($
Shf
Pk
Unit
‡+($9<.5$)73$3(5
‡%,2'(*5$'$%/(
‡³(&2'523´
Size
Ft
Shf
Pk
Unit
TRIMACO
[
‡121:29(132/<%$&.
‡+($9<:(,*+7
‡³'28%/(*8$5'´
$EVRUEHQWWRSOD\HUFRPELQHGZLWK
D OHDN UHVLVWDQW ERWWRP OD\HU 8VH
when painting, plastering, staining
DQGZKHUHYHUOHDNVSLOOSURWHFWLRQLVUHTXLUHG
988-2721
[
($
252-9006
[
($
364-3384
[
($
656-1773
[
($
‡%87</58%%(5&2$7('
'5$3(5<
‡+($9<:(,*+7
‡08/7,&2/25('
‡³58%%(5'8&.,(´
%XW\OEDFNHG GUDSHU\ IDEULF 3URYLGHVSURWHFWLRQDJDLQVWSDLQWVSODVKHVDQGVSLOOV:DVKDEOHDQGUHXVDEOH
No.
Size
Ft
697-6062
[
052-4744
[
($
284-3928
[
($
Shf
Pk
Unit
No.
Shf
Pk
Unit
‡&$19$6
‡³%87</,,´
367-4173
[
($
/HDNSURRI SRO\ EDFNLQJ WKDW SUHYHQWVSDLQWIURPOHDNLQJWKURXJK
044-9512
[
($
TRIMACO
($
Shf
Pk
Unit
($
DROP CLOTHS
Size
Ft
Our No.
Embossed - Bagged
981-2611
Unit
TRIMACO
TRIMACO
DROP CLOTHS
$EVRUEHQW SDSHU IRU SDLQWLQJ
cleaning, wallpapering and rePRYDO VWRUDJH RU RWKHU MRE DSSOLFDWLRQV (PERVVHG IRU
QRVOLSVDIHW\SHUFHQWELRGHJUDGDEOH
No.
Shf
Pk
Our No.
DROP CLOTHS
Our No.
Size
Ft
DROP CLOTHS
Size
Ft
223-5687X
No.
Our No.
DROP CLOTHS
‡3/$67,&
No.
Size
Ft
TRIMACO
($
981-2413
Our No.
No.
‡&$19$6
‡³683(578))´
No.
Size
Ft
855-8637
[
($
855-8652
[
($
855-8645
[
($
Our No.
TRIMACO
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - DROP CLOTHS
PAINT PAILS
PAINT PAILS
‡35(7$3('
‡³($6<0$6.7$3(
'5$3(´
‡5,1*)5((
‡3/$67,&
‡3/$67,&,1'8675,$/
‡:+,7(
6ROYHQW UHVLVWDQW &DQ EH XVHG IRU
cleaning brushes and mixing paint
ZLWKRWKHUFRORUV
8VHG IRU SDLQWV FRDWLQJV YDUnishes, water sealants, concrete
patching compounds, asphalt coatings, printing inks, soaps and deWHUJHQWV 'HVLJQHG ZLWK UHLQIRUFHG VDWXUQ ULQJV DURXQG
WKHWRSWRSUHYHQWULPGLVWRUWLRQZKHQFDUULHG8QLIRUP
wall thickness for stacking strength,
3URWHFWV VXUIDFHV IURP RYHUVSUD\
VSODWWHUV DQG VSLOOV 3ODVWLF FOLQJV
WRSURWHFWIURPRYHUVSUD\RUVSLOOV
7DSHSURYLGHVUD]RUVKDUSHGJHV1RUHVLGXH
Our No.
Our No.
No.
No.
Size
In x Ft
Shf
Pk
Unit
ENCORE PLASTICS
[
($
590-3927X
Cap
Qt
Unit
($
Blue
TRIMACO
684-1670
Shf
Pk
Our No.
No.
Cap
Gal
Shf
Pk
Unit
ENCORE PLASTICS
PAIL ONLY
627-6083X
1
($
DROP CLOTHS
PAINT PAILS
935-2261
($
‡³7$3('5$3(´
‡3/$67,&
615-5816
($
3URWHFWLRQ IRU XVH LQ DUHDV ZKHUH
VWUDLJKWOLQHVDUHQHHG7DSHLVDSplied along one edge of high-denVLW\PDVNLQJ¿OP7DSHFDQEHOHIW
RQ WKH VXUIDFH IRU XS WR GD\V
DQGNHHSLWVDGKHVLRQ:RUNVDORQHRUZLWKHDV\PDVN¶V
403UR2UJLOO6.8DQG40
6ROYHQW UHVLVWDQW &DQ EH XVHG IRU
cleaning brushes and mixing paint
ZLWKRWKHUFRORUV
Shf
Pk
Unit
($
No.
Size
Ft
341-3010
[
($
278-0385
[
($
Our No.
Shf
Pk
Unit
TRIMACO
Our No.
No.
PAINT PAILS
Cap
Qt
Shf
Pk
Unit
‡5(&<&/('3/$67,&
‡³(&260$57´
($
0DGHIURPUHF\FOHGSODVWLFVROYHQW
resistant, ringfree for easy recyFOLQJXQLIRUPZDOOWKLFNQHVV
ENCORE PLASTICS
070-5137X
.5 Mil
PAINT PAILS
PAINT PAILS - PLASTIC
‡3/$67,&
‡³+$1'<3$,173$,/´
3ODVWLF SDLQW SDLO ZLWK DGMXVWDEOH
strap and magnetic paint brush
KROGHU %UXVK VFUDSHU DURXQG WKH
ULP RI WKH SDLO DOORZV UHPRYDO RI
H[FHVVSDLQWRIIEUXVK
No.
Our No.
Size
Qt
Shf
Pk
Unit
($
ENCORE PLASTICS
Shf
Pk
Size
No.
PAIL ONLY
Unit
211-7349X
Quart
PAINT PAILS
($
‡3/$67,&
‡5,1*)5((:,5(+$1'/(
‡0,;10($685(
PAINT PAILS
*UDGXDWLRQ DUH SURYLGHG LQ ERWK
RXQFH DQG PHWULF PHDVXUHPHQWV
0HDVXUHPHQWV JR XS WR R]
JDO DQG /LWHUV 6ROYHQW UHVLVWDQW )RU XVH ZLWK
DOO SDLQWV SDVWHV DQG DGKHVLYHV )ODW ERWWRP IRU HDV\
PL[LQJ
‡3/$67,&87,/,7<
‡352027,21$/
8VH WR PL[ D JDOORQ RI SDLQW ZLWK
RWKHU FRORUV 5LQJIUHH GHVLJQ 6ROYHQWUHVLVWDQW
Our No.
No.
Cap
Qt
Shf
Pk
Our No.
Unit
ENCORE PLASTICS
($
No.
Cap
Qt
Shf
Pk
Unit
($
ENCORE PLASTICS
456-9661
Silver
683-4972
PAINT PAILS
0DGHIURPUHF\FOHGSODVWLFVROYHQW
resistant, great for boxing or mixLQJSDLQWFRORUV8QLIRUPZDOOWKLFNQHVVWDSHUHGGHVLJQIRUHDV\VHSDUDWLRQ)LWVSDLQWSDLO
OLGVNX
No.
Cap
Shf
Pk
Unit
ENCORE PLASTICS
White
&7
‡5(&<&/('3/$67,&
‡³(&260$57´
Our No.
BERCOM
228-2143
Cap
Qt
10 Quart
864-2647
*UDGXDWLRQ DUH SURYLGHG LQ ERWK
RXQFH DQG PHWULF PHDVXUHPHQWV
0HDVXUHPHQWVJRXSWRR]TWDQG/LWHUV 6ROYHQW UHVLVWDQW )RU XVH ZLWK DOO SDLQWV SDVWHV
DQGDGKHVLYHV)ODWERWWRPIRUHDV\PL[LQJ/LGDYDLODEOH
6.8
PAINT PAILS
No.
ENCORE PLASTICS
‡3/$67,&
‡635,1*)250
‡:,5(+$1'/(
‡³0,;10($685(´
Applicators & Painting Aids
Our No.
Our No.
780-2879
4XDUW
($
092-7038
*DOORQ
($
PAINT PAILS
‡3/$67,&,1'8675,$/
8VHG IRU SDLQWV FRDWLQJV YDUnishes, water sealants, concrete
patching
compounds,
asphalt
coatings, printing inks, soaps and
GHWHUJHQWV 'HVLJQHG ZLWK UHLQIRUFHGVDWXUQULQJVDURXQGWKHWRSWRSUHYHQWULPGLVWRUWLRQ ZKHQ FDUULHG 8QLIRUP ZDOO WKLFNQHVV IRU VWDFNLQJ
VWUHQJWK$YDLODEOHZLWKSODVWLFKDQGOH/LGDYDLODEOH6NX
Our No.
No.
Cap
Gal
Shf
Pk
Unit
($
ENCORE PLASTICS
PAIL ONLY
.70 Mil
640-9445
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
PAINT PAILS
PAINT PAILS
PAINT PAIL LIDS
‡3/$67,&87,/,7<
‡9$5,(7<3$&.
‡75$16/8&(17
‡+'3(,1'8675,$/
‡*$6.(7('
‡³7($5675,3´
6ROYHQW UHVLVWDQW &DQ EH XVHG WR
clean brushes or mix a gallon of
SDLQWZLWKRWKHUFRORUV
Our No.
Cap
Gal
No.
Shf
Pk
Unit
ENCORE PLASTICS
PAIL ONLY
Our No.
3-1/2 Gallon
810-5132
1
8VHG IRU SDLQWV FRDWLQJV YDUnishes, water sealants, concrete
patching
compounds,
asphalt
coatings, printing inks, soaps and
GHWHUJHQWV 'HVLJQHG ZLWK UHLQIRUFHGVDWXUQULQJVDURXQGWKHWRSWRSUHYHQWULPGLVWRUWLRQ ZKHQ FDUULHG 8QLIRUP ZDOO WKLFNQHVV IRU VWDFNLQJ
VWUHQJWK0DGHZLWK+'3(+LJKGHQVLW\SRO\HWK\OHQH
Cap
Gal
No.
Size
Mil
Shf
Pk
Unit
($
Shf
Pk
Unit
ENCORE PLASTICS
PAIL ONLY
1
+LJKTXDOLW\ SRO\HWK\OHQH :LUH
handle and spring form steel ring
DURXQG WKH ULP IRU H[WUD VXSSRUW
$FFXUDWHO\ FDOLEUDWHG IRU VWDQGDUG
PHDVXUHV
249-7634X
Our No.
Cap
Qt
No.
PAINT PAILS
No.
799-4007X
Shf
Pk
Shf
Pk
Unit
ENCORE PLASTICS
PAIL ONLY
5 Gallons
325-0222
Forest Green
1
($
($
‡+$1'+(/'
‡³3(/,&$1´
ENCORE PLASTICS
738-5479
%XLOWLQ ´ ZLGH UROO RII DUHD
/HGJH DW WRS FDWFKHV H[FHVV SDLQW
DQG UHWXUQV LW WR SDLO 0DJQHW LQVLGHKROGVDEUXVKIHUUXOH6HFXULW\
strap automatically expands to allow room for larger
KDQGV6LGHLQGHQWVSURYLGHEHWWHUJULSDQGFRQWURO6RIW
IHHO HODVWRPHU DGGV PRUH FRPIRUW 'XUDEOH RQHSLHFH
SRO\SURS\OHQH FRQVWUXFWLRQ UHVLVWV VROYHQW DQG SDLQW
EXLOGXS´[´[´
Cap
Qt
Shf
Pk
Unit
WOOSTER BRUSH
‡&$02
529-2792
1
($
Shf
Pk
Unit
Transforms your pail into an upright container, easy opening lid,
VSLQRIIWRRSHQDQGFORVH
Our No.
No.
Unit
‡*$00$6($/
PAINT PAILS
Our No.
PAINT PAILS
Shf
Pk
PAINT PAIL LIDS
‡,1'8675,$/3/$67,&
‡&$02)/$*(
)LOOZLWKLFHDQGEHYHUDJHVWRWDNH
FDPSLQJ ¿VKLQJ RU KXQWLQJ 6WRUH
VPDOO JDUGHQ WRROV 8VH IRU HDV\
VWRUDJH
Size
Gal
Unit
ENCORE PLASTICS
($
859-4483X
Color
($
ENCORE PLASTICS
Red
No.
PAINT PAIL LIDS
Our No.
PAIL ONLY
Our No.
Unit
ENCORE PLASTICS
8VHIRUFRYHULQJVNX
‡$//385326(+($9<
'87<
6ROYHQW UHVLVWDQW &DQ EH XVHG WR
clean brushes or mix a gallon of
SDLQWZLWKRWKHUFRORUV
706-6665
Shf
Pk
‡3/$67,&
‡:+,7(
‡³35<2))´
PAINT PAILS
‡3/$67,&9$5,(7<3$&.
‡75$16/8&(17
Cap
Gal
No.
PAIL ONLY
($
PAINT PAILS
No.
Our No.
ENCORE PLASTICS
507-2012
Our No.
8VHGWRFRYHUJDOORQSDLOV
1
($
&DQ EH XVHG IRU FDPSLQJ ¿VKLQJ
RUKXQWLQJ
No.
Size
Gal
($
PAINT PAIL LIDS
‡5(&<&/('3/$67,&
‡³(&260$57´
0DGHIURPUHF\FOHGSODVWLFIRUGU\
lightweight products, simple on
DQGRIIGHVLJQ)LWVSDLQWSDLOVNX
Our No.
No.
Shf
Pk
Unit
($
ENCORE PLASTICS
Green
PAINT PAIL LIDS
Our No.
No.
Color
Shf
Pk
Unit
ENCORE PLASTICS
.70 Mil - 5 Gallon Capacity
150-6757
5HDOWUHH
928-8333
)LVKRXÀDJH
($
760-8375
0RVV\2DN
($
($
527-8494X
‡*$6.(7('
‡³7($5675,3´
6HFXUH DQG WDPSHUUHVLVWDQW 3URYLGHV SURWHFWLRQ RI WKH FRQWHQWV
through transportation and hanGOLQJ&RYHUFDQEHHDVLO\UHPRYHG
ZLWKRXWFXWWLQJWRROV8VHIRUFRYHULQJVNX
Our No.
No.
Size
Gal
Shf
Pk
Unit
($
ENCORE PLASTICS
White
711-1388X
PAINT PAIL LIDS
‡61$321
For dry, lightweight products reTXLULQJ FRQVWDQW DFFHVV 1RQJDVNHW FRYHU LV HDVLO\ UHPRYHG DQG
UHVHDOHG
Our No.
No.
Shf
Pk
Unit
($
ENCORE PLASTICS
603-5067
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - PAINT PAIL LIDS
PAINT PAIL LINERS
PAINT PAILS
‡61$321121*$6.(7('
‡3/$67,&:,7+52//(5
*5,'
‡³352/,1¶5´
‡0(7$/'28%/(5,%%('
)RUJDOORQDQGJDOORQEXFNHWV
(DVLO\UHPRYHGDQGUHVHDOHG&RRUGLQDWHVZLWKWKH&DPRXÀDJHJDOORQEXFNHWV2UJLOO6.8
DQG
Our No.
No.
Color
Shf
Pk
Unit
Our No.
ENCORE PLASTICS
616-2168
%
7XUQVDQ\JDOORQSDLOLQWRDUROOHU
WRWH &RQYHQLHQW UROOHU IUDPH KDQdle holder allows easy ladder hookXS(OLPLQDWHVPHVV\JUDWHV+ROGVJDOORQVRISDLQW
%ODFN
No.
Shf
Pk
Unit
($
304-1274
‡:,7+6(1,255,(.(63287
‡7($5675,3
PAINT PAIL LINERS
8VH WR SURYLGH SURWHFWLRQ RI FRQtents through handling, storage
DQG WUDQVSRUWDWLRQ 6HFXUH DQG
WDPSHUUHVLVWDQW
.HHSV SDLOV FOHDQ DQG UHXVDEOH
IRU TXLFN DQG HDV\ FRORU FKDQJHV
1HDWO\GLVFDUGVIRUHDV\FRVWHIIHFWLYH FOHDQXS 6HDPOHVV GHVLJQHG
RI WKLFN DQG HYHQO\ FRQVWUXFWHG
ZDOOV DQG KHDY\ FRQWRXUHG ERWWRP WR KHOS SURWHFW
DJDLQVW OHDNV DQG VSLOODJH &DQ EH XVHG ZLWK OLTXLGV
SDVWHVRUSRZGHUVRIYDU\LQJGHQVLW\RUYLVFRVLW\
No.
Cap
Qt
Shf
Pk
Unit
($
ENCORE PLASTICS
‡3/$67,&
‡³3$,1762/87,216´
‡3/$67,&
Fits Size
Tub
Shf
Pk
Unit
*DO
($
ENCORE PLASTICS
353-2470
No.
PAINT PAILS
PAINT PAIL LIDS
Our No.
Our No.
342-0106X
ENCORE PLASTICS
($
5XVW UHVLVWDQW SHUPDQHQWO\ HPbossed for accurate measures in
SLQWVDQGTXDUWV8VHDVDQHVWIRU
GLVSRVDEOHTXDUWSDSHUEXFNHW
Our No.
No.
Size
Shf
Pk
Unit
,QFOXGHV VLGH EUXVK KROGHUV IRU
VWRUDJHGXULQJSDXVHVEDFNUDPS
and roller holder for use with paint
UROOHUV
Our No.
No.
Cap
Gal
Color
Shf
Pk Unit
UNITED PLASTICS
701-0226X
31
1
<HOORZ
($
953-7440X
31
%OXH
($
ENCORE PLASTICS
PAINT PAIL SEATS
‡3/$67,&
8VH RQ D ¿YH RU VL[ JDOORQ SDLO WR
PDNHDVHDW
Our No.
No.
Fits Size
Tub
Shf
Pk
Unit
Black
*DO
($
($
*DOORQ
($
628-8526
PAINT PAIL SPOUT
*DOORQ
($
‡3/$67,&
‡³(=3285´
8VH WR FRQQHFW WR D VFUHZ WRS RU
WLQW SOXJ OLG RI DQ\ JDOORQ SDLO
to make paint pouring easier and
QHDWHU$LUWLJKWFDS
‡3/$67,&:,7+52//(5
*5,'
‡³352/,1¶5-5´
Our No.
Our No.
No.
878-7129X
:LWK JUDGXDWLRQV LQ ERWK RXQFH
DQGPHWULFPHDVXUHPHQWV6ROYHQW
resistant and safe for use with all
SDLQWVSDVWHVDQGDGKHVLYHV&RQWDLQHUERWWRPLVÀDWIRUHDV\PL[LQJ
No.
Size
Qt.
Shf
Pk
Unit
223-7519X
1
($
777-8681X
($
043-0090X
($
348-6776X
Shf
Pk
Unit
($
PAINT PAIL
LINERS
‡³3(/,&$1´
)RU TXLFN FRORU FKDQJHV 'LVSRVDEOH IRU LQVWDQW FOHDQXS 0DGH RI
FOHDU VROYHQWUHVLVWDQW 3(7 UHF\FOHGSODVWLF'HVLJQHGWR¿W%XFNHW1R2UJLOO6.8
Our No.
($
Stains & Wood Finishes
DECK CLEANER
No.
Shf
Pk
Unit
3.
8VHWRFOHDQEULJKWHQDQGUHPRYH
mold, mildew, and algae from
ZRRGVLGLQJGHFNVDQGIHQFHV)RU
exterior use on wood decking, sidLQJ VKDNHV DQG RXWGRRU IXUQLWXUH &DQ EH GLOXWHG DW D
UDWLRRIDQGZLOOFRYHUEHWZHHQDQGVT
IWSHUJDOORQ
Our No.
379-7495
001-1205X
3UHYHQWV DFFLGHQWDO VSLOOV NHHSV
the contents clean and guards
DJDLQVWVNLPPLQJ
Shf
Pk
Unit
ENCORE PLASTICS
Natural
602-2099
3LQWRU4XDUW
($
602-2107
4XDUW
($
602-2115
4XDUW
($
No.
Size
Shf
Pk
Unit
*$/
DUMOND CHEMICALS
‡5(6($/$%/(
‡³0,;10($685(´
Fits Size
Tub
PAINT STRIPPERS/REMOVERS
WOOSTER BRUSH
PAINT CONTAINER
LIDS
No.
Unit
‡&21&(175$7('
‡³3((/$:$<´
ENCORE PLASTICS
Our No.
Shf
Pk
ENCORE PLASTICS
ENCORE PLASTICS
‡',6326$%/(3/$67,&
‡³0,;10($685(´
No.
4XDUW
7XUQVPRVWTXDUWSDLOVLQWRDUROOHU WRWH 'HVLJQHG IRU WULP UROOHUV
(OLPLQDWHV PHVV\ JUDWHV 'LVSRVDEOHIRUTXLFNFOHDQXS
CONTAINERS
Our No.
988-0089X
PAINT PAIL LINERS
ENCORE PLASTICS
220-1754
906-0898
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Gallon
- Maintenance, Repair & Operations
DECK/FENCE
BRIGHTENER/
NEUTRALIZER
‡&21&(175$7(
)RU XQ¿QLVKHG H[WHULRU GHFNV VLGLQJ DQG IHQFLQJ 6DIH IRU DOO FRDWLQJVDQGWUHDWHG OXPEHU 5HPRYHV
WDQQLQDQGUXVWVWDLQVDQGHOLPLQDWHVWKH³PLOOJOD]H´RQ
QHZSODQHGOXPEHUDQGVLGLQJ5HGXFHVWKHS+OHYHOVRI
WKH3HHO$ZD\'HFN6WULSSHUDQG5HVWRUHU&DQEHGLOXWHG
DWDUDWLRRIDQGZLOOFRYHUEHWZHHQDQG
VTIWSHUJDOORQ
Our No.
No.
Shf
Pk
Size
Unit
DUMOND CHEMICALS
291-1568X
No.
Size
Shf
Pk
4.6
Quart
48$57
PAINT STRIPPER
‡635$<$%/(
‡³./($1675,3($6<
3$,17´
)DVW DFWLQJ QRQÀDPPDEOH ZDWHU
ZDVKDEOH IRUPXOD 6SUD\ UHPRYHU
LQWRFRUQHUVDQGFUHYLFHV5HPRYHV
PXOWLSOHOD\HUVRISDLQWHSR[\DQGSRO\XUHWKDQH6WULSV
ZRRGPHWDODQGPDVRQU\
Shf
Pk
Size
*$/
Gallon
Quart
48$57
WOOD STRIPPER
‡2,/%$6('
‡³352%/(062/9(5´
)RUPXODWHG WR UHPRYH RLOEDVHG
¿QLVKHV IURP DOO ZRRG VXUIDFHV
such as cedar, redwood, pine, cySUHVV ¿U DQG SUHVVXUHWUHDWHG
ZRRG%LRGHJUDGDEOH5HTXLUHVQHXWUDOL]DWLRQZLWK&DERW
SUREOHPVROYHUZRRGEULJKWHQHU)RUXVHRQZRRG
decks, siding, fences, railings, steps and outdoor furniWXUH2QHJDOORQRIZRRGVWULSSHUZLOOVWULSVT
IWRIZHDWKHUHGRLO¿QLVK
No.
Size
Gallon
No.
Shf
Pk
Unit
*$/
VALSPAR
Our No.
Size
Gallon
Quart
48$57
812-1279
Gallon
($
083-8912
*DOORQ
1
3$,/
($
Unit
*$/
872-7588
646-5405X
Size
Shf
Pk
Quart
48$57
Gallon
*$/
No.
Unit
OLD MASTERS
Size
Shf
Pk
Unit
*$/
DUMOND CHEMICALS
Gallon
‡+($9<'87<
‡³3((/$:$<´
(QYLURQPHQWDOO\ VDIH PHWKRG IRU
UHPRYLQJ XS WR SOXV FRDWV RI
paint in a single application from
PRVW VXUIDFHV 6XLWHG IRU WKH UHPRYDORIOHDGEDVHGSDLQWDQGUHVWRUDWLRQRIROGKLVWRULFDO
EXLOGLQJV 6SUHDG RU VSUD\ RYHU VXUIDFH WR EH VWULSSHG
&RYHUVDSSUR[LPDWHO\VTIWSHUJDOORQ
Our No.
2]
)RUPXODWHG WR UHPRYH YDUQLVK
paint, enamel, polyurethane, lacTXHUDQGVKHOODFIURPZRRGPHWDO
or masonry without harming the
RULJLQDOVXUIDFHLGHDOIRUERWKGLSSLQJDQGEUXVKLQJDSSOLFDWLRQV
)RU UHPRYLQJ RLO DQG ZDWHU EDVHG
VWDLQV FOHDU ¿QLVKHV ZHDWKHUHG
ODWH[DQGYDUQLVK8QGLOXWHGFRYHUV
EHWZHHQVTIWSHUJDOORQ
&DQEHGLOXWHGDWDUDWLRQRIDQGZLOOFRYHUEHWZHHQ
VTIWSHUJDOORQ%LRGHJUDGDEOH
‡/,48,'
‡³70´
Our No.
681-5161X
Unit
385-1763
‡5($'<7286(
‡³3((/$:$<´
No.
Shf
Pk
Size
PAINT REMOVER
Shf
Pk
DECK STRIPPER
Our No.
No.
DUMOND CHEMICALS
257-4044
DUMOND CHEMICALS
805-7770
)RUUHPRYLQJPXOWLSOHOD\HUVRIDUFKLWHFWXUDO DQG LQGXVWULDO FRDWLQJV
Safe for the user, the substrate and
WKH HQYLURQPHQW %LRGHJUDGDEOH )RU WKH VDIH UHPRYDO
RIOHDGEDVHGSDLQW&DQEHXVHGIRULQWULFDWHFDUYHGRU
PROGHGVXUIDFHVDQGIRUUHPRYLQJPDULQHSDLQWVZLWKRXW
GDPDPJLQJWKHJHWFRDW)RUPXODWHGWRUHPDLQZHWDQG
HIIHFWLYHRYHUH[WHQGHGSHULRGRIWLPHDQGGRHVQRWUHTXLUHWKHXVHRI3HHO$ZD\3DSHU6WULSVXSWROD\HUV
Aerosol
PAINT REMOVER
With Spray Bottle
925-6645X
)/'
Unit
WM BARR
Our No.
Unit
Unit
WM BARR
4.6
Shf
Pk
FLOOD COMPANY
Our No.
:LOOQRWVWDLQZRRGRUUDLVHJUDLQ
Strips paint, polyurethane, and epoxy from wood, metal
DQGPDVRQU\7KLFNEUXVKDEOHSDVWHQRQÀDPPDEOH
689-5585X
Size
For cleaning and restoring exterior,
natural, gray and weathered wood
VXUIDFHV &DQ EH GLOXWHG DW D UDWLR RI DQG ZLOO FRYHU EHWZHHQ
DQGVTIWSHUJDOORQ%LRGHJUDGDEOH
‡6(0,3$67(0$;,080
675(1*7+
‡35(0,80*5$'(
352)(66,21$/
‡³./($1675,3´
No.
No.
‡&21&(175$7(
‡³3((/$:$<´
PAINT STRIPPER
Our No.
Our No.
DECK RESTORER
Solvents, Patch & Repair
897-7142X
‡:$7(5%$6('
‡,17(5,25(;7(5,25
‡³60$57675,3´
Strips latex, oil, semi-transparent
and solid color stains from exterior
ZRRG VXUIDFHV 3UHSDUHV ZRRG RU
FRPSRVLWH VXUIDFHV IRU VWDLQLQJ
&DQ EH XVHG IXOO VWUHQJWK RU GLOXWHGIRUPXOWLSOHXVHV5HGXFHVPLOOJOD]HIRXQGLQQHZ
ZRRG(OLPLQDWHVJUDGHVWDPSVRQZRRGDQGLVHIIHFWLYH
LQUHPRYLQJVWDLQVWKDWDUHWRXJKWRJHWULGRIVXFKDV
JUHDVH&RYHUVWRVTIWSHUJDOORQ
*$/
PAINT STRIPPERS/REMOVERS
Our No.
PAINT REMOVER
‡(;7(5,25
204-7157X
Gallon
WOOD STRIPPER
No.
Size
Gal
Shf
Pk
Unit
DUMOND CHEMICALS
437-9681X
1
1
($
402-4659
1
1
3$,/
PAINT REMOVER
‡6(0,3$67(
‡³70´
3HQHWUDWHV DQG GLVVROYHV SDLQW
HQDPHO YDUQLVK ODFTXHU VKHOODF
SRO\XUHWKDQH DQG VWDLQ 6HPL
SDVWHFRQVLVWHQF\LVLGHDOIRUYHUWLFDO DSSOLFDWLRQV 70 FRQWDLQV QR EHQ]RO DQG ZLOO QRW
harm wood, plaster, metal, glass or brush bristles and
UHPRYHVVWDLQIURPZRRGE\UHDSSOLFDWLRQ
Our No.
No.
Size
Shf
Pk
Unit
OLD MASTERS
579-9713
Quart
48$57
454-7642X
Gallon
*$/
PAINT REMOVER
‡+($9<'87<
‡³70´
5HPRYHV SDLQW PDULQH DON\G
HQDPHO ODFTXHU YDUQLVK SRO\XUHthane, shellacs, resin emulsion,
water-based paint, rubber base
SDLQWVSDUWHSR[\DQGPDQ\RWKHUV\QWKHWLF¿QLVKHV
ZLOOQRWDIIHFWJOXHRURWKHUDGKHVLYHVDQGZLOOQRWLQWHUIHUHZLWKUH¿QLVKLQJ
Our No.
No.
Size
Shf
Pk
Unit
OLD MASTERS
615-5212X
Gallon
*$/
330-3286
Quart
48$57
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - PAINT REMOVER
PAINT/SEALER
REMOVER
‡,17(5,25(;7(5,25
‡³./($1675,3´
1RQÀDPPDEOH :RUNV IDVWHU WR
HDVLO\VWULSPRVW¿QLVKHVIURPPRVW
VXUIDFHV %XEEOHV DQG GLVVROYHV
WKH ROG ¿QLVK IURP ÀDW DQG YHUWLcal surfaces plus reaches into hard-to-strip corners and
FUHYLFHV7KHZDWHUVROXEOHIRUPXODDOORZVWKHROG¿QLVK
WREHVFUDSHGRUZDVKHGRII
Our No.
No.
Size
Oz
Shf
Pk
Unit
(65
No.
Size
Shf
Pk
Unit
1
3$,/
*$/
SANSHER CORP
Aerosol Can
287-4196X
‡³.58'.877(5´
5HPRYHV FRQFUHWH FRDWLQJV DQG
SDYHU VHDOHUV DXWRPRWLYH PDULQH
DQGDLUFUDIWW\SHSDLQWVDQGDUFKLWHFWXUDOFRDWLQJV&XWV
DQG GLVVROYHV OLNH D OLTXLG UHPRYHU /LIWV DQG VWD\V ZHW
OLNHDVHPLMHOO)RUSURIHVVLRQDOXVHRQO\:DWHURUVROYHQWZDVK1RQÀDPPDEOH
Our No.
WM BARR
GRAFFITI
REMOVER
‡&2175$&725*5$'(
‡635$<$%/(
‡³'$'¶6($6<635$<´
&$1
974-3469
597-8515X
:RUNVRQFRQFUHWHEULFNDQGVWUHHW
VLJQV 5HPRYHV DHURVRO SDLQW
HQDPHO ODFTXHUV DQG PRUH IURP
PRVWKDUGVRIWDQGSRURXVVXUIDFHV:DWHUEDVHG%LRGHJUDGDEOH 1RQ)ODPPDEOH 1R XQSOHDVDQW RGRU (QYLURQPHQWDOO\IULHQGO\
Our No.
Shf
Pk
Unit
SUPREME CHEMICALS
573-9610X
*DOORQ
Size
Oz
No.
*5
($
With Spray Bottle
Gallon
PAINT REMOVER
WASH
PAINT REMOVER
‡/,48,'352)(66,21$/
*5$'(
‡³./($1675,3´
6SHFLDOO\ IRUPXODWHG IRU DQWLTXHV
FDUYHG VXUIDFHV DQG FUHYLFHV
4XLFNO\ UHPRYHV YDUQLVK ODFTXHU
DQGVKHOODF1RWLQWHQGHGIRUGLSWDQNXVH)ODPPDEOH
Our No.
No.
Size
Shf
Pk
4..
Quart
Unit
WM BARR
837-7913X
48$57
‡:$7(5%$6('
‡³´
5HPRYHV DHURVRO SDLQW HQDPHO
VHPLKLJKJORVV RLO ODFTXHUV
acrylic, acrylic/super/water-based
enamels, primers, urethane enamels, speed-e-enamels,
sealers, primers, stain killers, permanent markers and
KLJKOLJKWHUV RQ KDUGVRIW VXUIDFHV )RU VWXFFR VWRQH
/H[DQ WLOH 3OH[LJODV VWDLQOHVV VWHHO PHWDOVDOOR\V DQG
FDUV%LRGHJUDGDEOH
Our No.
Size
Oz
No.
PAINT/VARNISH
REMOVER
MOTSENBOCKER’S LIFT OFF
‡,1'225
‡³./($1675,3*5((1´
272-1165
No.
Size
Shf
Pk
4.*5
Quart
Unit
WM BARR
895-5858X
48$57
Shf
Pk
Unit
MOTSENBOCKER’S LIFT OFF
916-3304
,+.6
($
GRAFFITI REMOVER
($
($
Our No.
No.
Size
Oz
Shf
Pk
Unit
WM BARR
675-1366X
7,+6
($
WASTE PAINT
HARDENER
‡³.58'.877(5´
Our No.
‡:$7(5%$6('
‡³:$7&+'2*/,)7$:$<´
No.
Size
Oz
305-2511X
Shf
Pk
Unit
($
GRAFFITI REMOVER
Size
Gallon
Unit
3+
($
SUPER GLUE
SUPER GLUE
%RQGVLQVWDQWO\GULHVFOHDU$JHQeral purpose cyanoacrylate adKHVLYH WKDW SURYLGHV D VXSHUIDVW
strong and permanent bond to alPRVW DOO QRQSRURXV VXUIDFHV 8VH
on rubber, metal, glass, ceramic,
MHZHOU\PRVWSODVWLFVDQG¿QJHUQDLOV
No.
Size
Grams
Shf
Pk
Unit
623-4991
6
&'
640-0337
6
&'
Shf
Pk
Unit
*$/
DUMOND CHEMICALS
353-9178
Shf
Pk
DEVCON
'HVLJQHG WR UHPRYH KHDY\ JUDI¿WL
IURP DOO ³SRURXV´ VXUIDFHV 1RQ
GULS IRUPXOD FOLQJV WR WKH VXUIDFH
%LRGHJUDGDEOH &RYHUV DSSUR[LPDWHO\ VT IW SHU JDOORQ GHSHQGLQJ XSRQ SRURVLW\RUVXUIDFH
No.
Size
Oz
Adhesives & Caulk
Our No.
‡:$7(5%$6('
‡³:$7&+'2*:,3(287´
Our No.
No.
SUPREME CHEMICALS
8VHWRUHPRYHPRVWW\SHVRIJUDI¿WLDQGPDQ\VWDLQVIURPPDVRQU\
concrete, glass, terrazzo, metal
DQG RWKHU VXUIDFHV %LRGHJUDGDEOH
DQG HQYLURQPHQWDOO\ VDIH &RYHUV DSSUR[LPDWHO\ VTIWSHUFDQ
393-5160
)RU VROYHQW DQG ZDWHUEDVHG
SDLQWVYDUQLVKHVDQGODFTXHUV8VH
to strip most coatings from wood,
IXUQLWXUH DOO PHWDO ¿QLVKHV DQG
VWRQH %LRGHJUDGDEOH (3$ &RPSOLDQW ORZ92& *UHHQ
&URVV&HUWL¿HG1RQÀDPPDEOH
188-4832
Aerosol
‡:$7(5%$6('
Size
Oz
DUMOND CHEMICALS
PAINT/VARNISH
REMOVER
No.
Unit
5HPRYHV UHVLGXHV DQG ORRVHQHG
paint from wood, metal and maVRQU\VXUIDFHV3UHSDUHVVWULSSHGVXUIDFHVIURP¿QLVKLQJ
)UHVKRUDQJHVFHQW
)RU ODWH[ SDLQW VSLOOV DQG GLVSRVDO
+DUGHQVRIDJDOORQSDLQW
Our No.
Our No.
Shf
Pk
Trigger Bottle
&RQWDLQVDKLJKOHYHORIUHQHZDEOH
UHVRXUFHV DQG UHF\FOHG DFWLYH LQJUHGLHQWV,WFRQWDLQVQRPHWK\OHQHFKORULGHSHWUROHXP
GLVWLOODWHVFDXVWLFRUDFHWRQH,WLVORZRGRUDQGELRGHJUDGDEOH,WLVVDIHIRULQGRRUXVHDQGVWD\VZHWDQGDFWLYHXSWRKRXUV:RUNVLQPLQXWHV8VHRQZRRG
PHWDODQGPDVRQU\
Our No.
‡/,48,'
‡³&,75,675,3´
SPRAY PAINT
GRAFFITI REMOVER
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
SUPER GLUE
INSTANT ADHESIVE
INSTANT ADHESIVE
‡8/75$*(/
‡³/2&7,7(´
‡78%(&2/25&+$1*(
‡³.5$=<*/8(´
‡12581*(/
‡³.5$=<*/8(´
5XEEHUWRXJKHQHGVXSHUJOXHSURYLGHV D ERQG WKDW UHVLVWV LPSDFW
VKRFNYLEUDWLRQDQGH[WUHPHWHPSHUDWXUHV ,GHDO IRU ERQGV VXEMHFW
WR GDLO\ XVH DQG KDUVK FRQGLWLRQV 2XWGRRU VDIH DQG
JLYHV PRUH WLPH WR DOLJQ SLHFHV EHIRUH WKH JOXH WDNHV
KROG6LGHVTXHH]HDSSOLFDWRUIRUPD[LPXPFRQWURODQG
DLUWLJKWVWRUDJH'ULHVFOHDUDQGVHWVZLWKRXWFODPSLQJ
5HVLVWDQWWRPRLVWXUHDQGIUHH]LQJWHPSHUDWXUHV
*RHVRQSXUSOHGULHVFOHDU%RQGV
to wood, metal, ceramics, pottery,
UXEEHUYLQ\OOHDWKHUDQGSODVWLF
&RQYHQLHQW JHO DOORZV UHSRVLWLRQLQJ 6SUHDGV HDVLO\ )LOOV JDSV RQ
less than perfectly mated surfacHV %RQGV SODVWLFV PHWDO UXEEHU
JODVVFHUDPLFVLQVHFRQGV
Our No.
Size
Grams
No.
Shf
Pk
No.
Shf
Pk
Unit
6
&'
No.
Size
Grams
Shf
Pk
Unit
6
&'
DEVCON
INSTANT ADHESIVE
‡$//385326(
‡³.5$=<*/8(´
Size
Grams
Shf
Pk
Unit
&'
‡72*26,1*/(6
‡³.5$=<*/8(´
Unit
&'
ELMER’S PRODUCTS
No.
Size
Grams
Shf
Pk
.*5
Unit
.*5
&'
Our No.
695-3251
Unit
1
&'
Size
Grams
Shf
Pk
Unit
.*5
&'
No.
INSTANT ADHESIVE
‡:22'/($7+(5
‡³.5$=<*/8(´
Size
Grams
Shf
Pk
Unit
&'
ELMER’S PRODUCTS
783-7388X
.*05
6WURQJORQJODVWLQJERQG6SHFLDOO\
formulated to bond porous wood,
OHDWKHU DQG YLQ\O VXUIDFHV %RQGV
EDOVD ZRRG LQ OHVV WKDQ VHFRQGV 2QH GURS DSSOLFDWRU WLS IRU PRUH FRQWURO &RQYHQLHQWDQGSURWHFWLYHOHDNSURRIDLUWLJKWFDVH
Our No.
INSTANT ADHESIVE
139-5680
.UD]\ JOXH ZLWK SODVWLF SULPHU
%RQGV PHWDO ZRRG UXEEHU JODVV
ceramic, and other tough to bond
VXUIDFHV3DFNDJHGLQDVWD\IUHVK
FRQWDLQHU
No.
.*5
Shf
Pk
Unit
.*5
&'
STRAPPING
Size
Grams
Shf
Pk
Unit
&'
‡$//385326(3(1
‡³.5$=<*/8(´
%RQGV SODVWLFV PHWDO ZRRG UXEEHU JODVV DQG FHUDPLFV (DV\ WR
KROGDSSOLFDWRU6SHFLDOSHQWLSIRU
VLQJOHGURS SUHFLVLRQ FRQWURO 1R
GULSSLQJQRFORJJLQJQRPHVV&RQYHQLHQWDQGSURWHFWLYHOHDNSURRIDLUWLJKWFDS
.*5
Size
Grams
Adhesives & Caulk
INSTANT ADHESIVE
No.
No.
ELMER’S PRODUCTS
‡3/$67,&6
‡³.5$=<*/8(´
484-1482
Shf
Pk
No.
‡$'9$1&(')2508/$
‡³.5$=<*/8(´
Size
Grams
Shf
Pk
Unit
&'
ELMER’S PRODUCTS
Size
Grams
)RU HYHU\GD\ KRXVHKROG UHSDLUV
DQGSURMHFWV1RPL[LQJQRPHVV
2QH GURS DSSOLFDWLRQ )RU SODVWLF
PHWDOUXEEHUJODVVFHUDPLF&RQYHQLHQWDQGSURWHFWLYH
OHDNSURRI DLUWLJKW FDVH 6DPH VWURQJ .UD]\ *OXH ERQG
EXWZLOOQRWERQGVNLQLQVWDQWO\
STRAPPING TAPE
‡),%(5*/$665(,1)25&('
‡35(0,80*5$'(
$Q H[WUD VWURQJ SUHVVXUH VHQVLWLYH
tape for sealing, securing, unitizLQJEXQGOLQJSDFNDJLQJDQG
RWKHU XVHV +DV DQ DJJUHVVLYH
DGKHVLYH ZKLFK SURYLGHV LQVWDQW JULSSLQJ DQG IDQWDVWLF
VWUHQJWK 6XSHULRU WHDU UHVLVWDQFH DQG LPSDFW VWUHQJWK
DQGZLOOKDQGOHWKHYHU\WRXJKHVWRIKROGLQJSUREOHPV
&RPSOLHV ZLWK 86 3RVWDO DQG 836 VWDQGDUGV IRU SDFNDJHFORVXUH
Our No.
No.
Size
In x Yd
Shf
Pk
Unit
($
INTERTAPE POLYMER CORP
657-4263
[
657-4339
[
($
657-4362
[
($
657-4404
[
($
657-4578
[
($
ELMER’S PRODUCTS
.*&/6
Shf
Pk
‡$//385326(
‡³.5$=<*/8(6.,1
*8$5'´
INSTANT ADHESIVE
Our No.
%RQGVSODVWLFPHWDOZRRGUXEEHU
DQGJODVV&RQWDLQVDSDFNRIWZR
HDFKWXEHSHUIHFWIRURQHXVHRQO\
&RPHVRQDFOLSVWULS
371-4342X
Size
Grams
ELMER’S PRODUCTS
757-2571X
INSTANT ADHESIVE
No.
No.
INSTANT ADHESIVE
ELMER’S PRODUCTS
ELMER’S PRODUCTS
Our No.
&'
Our No.
Our No.
2QHGURSDSSOLFDWRU1RPL[LQJQR
PHVV )RU SODVWLFV PHWDO UXEEHU
JODVV ZRRG /HDNSURRI DLUWLJKW
stay fresh container with stand-up
EDVH
.*5
&RQWDLQV SUHFLVLRQ WLS DSSOLFDWRU
%RQGV PHWDO ZRRG UXEEHU JODVV
FHUDPLFDQGRWKHUVXUIDFHV
$ IDVWVHWWLQJ F\DQRDFU\ODWH JHO
DGKHVLYH WKDW SURYLGHV D VWURQJ
and permanent bond to almost
DOOSRURXVVXUIDFHV%RQGVPHWDOV
SODVWLFVFHUDPLFUXEEHUDQGPRUH&DQEHXVHGIRU9HUWLFDODSSOLFDWLRQV
081-2826X
695-3244
960-5049
Size
Grams
No.
.*5
Our No.
ELMER’S PRODUCTS
‡12'5,3)2508/$
‡³683(5'83(5´
Our No.
252-4189
Our No.
SUPER GLUE GEL
627-9376
Unit
ELMER’S PRODUCTS
*RHVRQSXUSOHGULHVFOHDU%RQGV
to wood, metal, ceramics, pottery,
UXEEHUYLQ\OOHDWKHUDQGSODVWLF
DEVCON
Our No.
Shf
Pk
‡%586+&2/25&+$1*(
‡³.5$=<*/8(´
$ IDVWVHWWLQJ DGKHVLYH WKDW SURYLGHV D VWURQJ DQG SHUPDQHQW
bond to almost all non-porous surIDFHV8VHRQKDUGSODVWLFVPHWDO
rubber, glass, china, ceramic, fabULFOHDWKHUYLQ\ODQGZRRG
627-8816
Size
Grams
INSTANT ADHESIVE
($
SUPER GLUE II
Our No.
No.
Unit
HENKEL CONSUMER ADHESIVES
006-0814X
Our No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - STRAPPING TAPE
PACKAGING TAPE
CARTON SEALING TAPE
‡³6&27&+´
‡:,7+',63(16(5
High-tensile strength, reinforced
ZLWK FRQWLQXRXV ¿ODPHQWV %DQGV
UHSDLUV VHDOV DQG UHLQIRUFHV
0HHWV 86 3RVWDO 6HUYLFH UHJXODWLRQV
General purpose for light duty sealLQJ DSSOLFDWLRQV 0HHWV 86 SRVWDO
UHJXODWLRQVIRUVWDQGDUGSDFNDJHV
‡35(0,803$3(5
‡6(/)$'+(6,9(
Our No.
No.
Size
In
Shf
Pk
Unit
[
Shf
Pk
Color
Unit
BUNDLING/WRAPPING
FILM
‡³)/$77:,1(´
Ties tighter than twine without a
NQRW 6WLFNV WR LWVHOI DQG QRW \RXU
VWXII 1R VWLFN\ DGKHVLYH UHVLGXH
8VH IRU EXQGOLQJ ZUDSSLQJ W\LQJ
DQGFRPSDFWLQJ8QLTXHGLVSHQVHUZLWKHYHU\UROO
No.
Size
In x Yd
Shf
Pk
Our No.
7.6
3''&
&OHDU
($
NIFTY PRODUCTS
693-9441
‡32/<3523</(1(),/0
Our No.
No.
Shf
Pk
Color
Unit
2” x 55 Yard - Shrink-Wrapped
ST11
[
52//
446-5928
&/
&OHDU
52//
659-6803
67
[
52//
446-5894
77
Tan
52//
PACKAGING TAPE
Our No.
No.
Wdth In x
Lgth Ft
Shf
Pk
Unit
Unit
3M
&OHDU
No.
Color
Shf
Pk
Unit
($
Shf
Pk
Unit
($
Shf
Pk
Unit
3.
Shf
Pk
Unit
2” x 55 Yard
Tan
+HDY\ GXW\ ZLWK DQ DJJUHVVLYH
DGKHVLYH0HHWVRUH[FHHGVSRVWDO
UHJXODWLRQV)RUORQJWHUPVWRUDJH
PLO
Our No.
2” X 800”
386-4634
($
‡35(0,80),/0
‡³3526725(3/86´
Shf
Pk
Color
CARTON SEALING TAPE
)RUXVHIRUWKHKHDYLHVWSDFNDJHV
'LVSHQVHUHQVXUHVWKHWDSHZLOOQRW
fall back on the roll and the tape
KDVDQHDV\XQZLQG,GHDOIRUVHDOLQJ SDFNDJHV 0HHWV 86 SRVWDO
UHJXODWLRQVIRUVWDQGDUGSDFNDJHV
No.
Unit
INTERTAPE POLYMER CORP
057-4996
Our No.
Shf
Pk
+DVH[FHSWLRQDOVWUHQJWKDQGÀH[ibility with excellent adhesion to a
ZLGH YDULHW\ RI VXUIDFHV %HVW IRU
carton sealing, bundling and securLQJORRVHREMHFWVGXULQJVKLSPHQW
7HPSHUDWXUHWHDUDQGLPSDFWUHVLVWDQW6WLFNVZLWKRXW
ZDWHU&RPSOLHVZLWK863RVWDODQG836VWDQGDUGVIRU
SDFNDJHFORVXUH0LO
Our No.
659-6811
5HSODFHV VWRUDJH ER[HV WDSH
WZLQH VWUDSSLQJ DQG VWUHWFK ¿OP
:UDSV VNLQ WLJKW 1R DGKHVLYH
UHVLGXH1RXQZLQGLQJRUIULFWLRQRQKDQGGXULQJDSSOLFDWLRQ3URWHFWVDJDLQVWWDUQLVKUXVWZHDWKHULQVHFWVDQG
VFUDWFKHV8VHIRUPRYLQJVWRUDJHJLUWKLQJDQGSDOOHWL]LQJ6TXHH]HLWGLVSHQVHULQFOXGHG
[
CARTON SEALING TAPE
Roll
‡³$/02677$3(´
‡32/<3523</(1(),/0
683(5675(1*7+
‡³6&27&+´
3M
BUNDLING/
WRAPPING/
PALLETIZING FILM
Size
In x Yd
PACKAGING TAPE
6\QWKHWLFUXEEHUDGKHVLYHRQSRO\SURS\OHQH¿OPEDFNLQJPHHWV86
3RVWDOUHJXODWLRQV
Unit
No.
INTERTAPE POLYMER CORP
1.88” x 54.6 Yard - Shrink Wrapped
($
211-8164
Our No.
No.
3M
3M
499-0883
Our No.
.UDIW SDSHU WDSH ZLWK DJJUHVVLYH
DGKHVLYH KDV JRRG PRLVWXUH DQG
WHDU UHVLVWDQW SURSHUWLHV (DV\ WR
ZULWHRQ0HHWV836DQG863RVWDO
UHJXODWLRQVIRUSDFNDJHVHDOLQJ
No.
Size
In x Yd
INTERTAPE POLYMER CORP
Clear
($
NIFTY PRODUCTS
571-9190
;
Roll
659-6829
67
[
52//
670-4563
67
[
52//
PACKAGING
PACKAGING/MAILING
TAPE
‡32/<683(567521*
‡³6&27&+´
Our No.
Super strong poly tape meets or
H[FHHGV SDFNDJHVHDOLQJ UHTXLUHPHQWV 0HHWV 86 3RVWDO 6HUYLFH
UHJXODWLRQV
No.
Type
Tan
Color
Unit
‡32/<3523</(1(),/0
0HHWV836DQG863RVWDOUHJXODWLRQVIRUSDFNDJHVHDOLQJ0LO
Our No.
No.
353-8246
Shf
Pk
'&3.
&OHDU
1.9” x 55 Yard
Unit
52//
7ZRUROOVRIWDSHLQFOXGHG$GMXVWDEOHWHQVLRQFRQWURO+LGGHQEODGH
PDNHVWKLVVDIHDQGHDV\WRXVH
For carton sealing and label proWHFWLRQ0HHWV836DQG86SRVWDO
UHJXODWLRQIRUSDFNDJHVHDOLQJ
No.
Size
In x Yd
Shf
Pk
Our No.
Unit
INTERTAPE POLYMER CORP
550-7033
[
&OHDU
CARTON SEALING TAPE
DISPENSER
‡683(5&/($5
‡48,&.),1'('*(
Our No.
($
CARTON SEALING TAPE
Color
INTERTAPE POLYMER CORP
604-3269
1.89” x 54.6 Yard
2” x 800” - Carded
No.
Shf
Pk
CARTON SEALING TAPE
3M
3M
419-2589
‡*(1(5$/385326(
For box sealing, splicing, recouperage and other packaging applicaWLRQV +DV D FRQIRUPDEOH EDFNLQJ
DQGDFRQVLVWHQWSUHVVXUHVHQVLWLYH
KRWPHOWDGKHVLYHV\VWHP$GKHUHV
LQVWDQWO\ WR D YDULHW\ RI VXUIDFHV (GJH WHDU DQG VSOLW
UHVLVWDQFH &RPSOLHV ZLWK WKH HQYLURQPHQWDO FRQVLGHUDWLRQVRI$670'
Adhesives & Caulk
Our No.
SEALING TAPE
No.
Size
In x Yd
INTERTAPE POLYMER CORP
693-9607
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
[
($
- Maintenance, Repair & Operations
Adhesives & Caulk
DUCT
DUCT TAPE
‡³'8&.´
High performance strength and adhesion characteristics are excellent
for coordinating repairs, color-coding materials and crafting applicaWLRQV7HDUVHDVLO\E\KDQGZLWKRXW
FXUOLQJDQGFRQIRUPVWRXQHYHQVXUIDFHV
Our No.
No.
Color
Gold
‡352)(66,21$/*5$'(
‡³6&27&+728*+´
$JJUHVVLYH DGKHVLYH 6WURQJ GXUDEOHZHDWKHUSURRI)RULQGRRURU
RXWGRRUXVH
For hanging poly and jobsite reSDLUV
No.
Color
Shf
Pk
Unit
INTERTAPE POLYMER CORP
Shf
Pk
($
1.88” x 15 Yards
Our No.
No.
Size
In x Yd
Shf
Pk
Unit
&$
[
52//
3M
1.88” x 20 Yard
Unit
1.88” x 10 Yards
DUCT TAPE
‡&2/25('
‡³'8&7$3(´
Our No.
SHURTECH BRANDS, LLC
195-8420
DUCT TAPE
520-3799
568-4980
5('
5HG
($
135-7185
%/8
%OXH
($
614-6369
<(/
<HOORZ
($
184-4497
*51
Green
($
501-6845
%51
%URZQ
($
247-6570
,VODQG/LPH
($
443-9790
:+7
:KLWH
($
680-7283
%OD]LQJ2UDQJH
($
966-8104
%.7
%ODFN
($
195-8354
&KURPH
($
247-6612
3XUSOH
($
245-6044
$TXD
($
325-6799
(OHFWULF%OXH
($
DUCT TAPE
‡³'8&.´
5HDOLVWLFFDPRXÀDJHSDWWHUQ
1.88” x 20 Yards
Our No.
Shf
Pk
Unit
No.
Shf
Pk
Unit
3
[
($
1.87” x 60 Yard
902-0751
&:
:KLWH
($
864-1581
&%.
%ODFN
($
111-9015
&5
5HG
($
‡87,/,7<
For general, all-purpose use
in packaging, wrapping, sealing, binding, bundling and genHUDO PDLQWHQDQFH *RRG WHQVLOH
VWUHQJWKDQGHYHQWHDULQFURVVDQG
PDFKLQHGLUHFWLRQVPLO
No.
Size
In x Yd
($
[
($
‡³'8&.´
High performance strength and adhesion characteristics are excellent
for coordinating repairs, materials
DQG FUDIWLQJ DSSOLFDWLRQV 7HDUV
easily by hand without curling and
FRQIRUPVWRXQHYHQVXUIDFHV
No.
Print
Shf
Pk
Unit
1.88” x 10 Yards
195-8388
&KHFNHU
($
109-9480
&RVPLF7LH'\H
($
)RUDLUFRQGLWLRQLQJDQGYHQWLODWLRQ
V\VWHPV GHJUHHV )DKUHQKHLW
PD[ SHUIRUPDQFH 0HHWV 8/
+8' DQG %2&$ FRGHV 6HDOV RXW
moisture or air leakage in ducts
109-9472
'LJLWDO&DPR
($
195-8404
'UDJRQ
($
109-9464
+RW5RG
($
195-8370
3LQN=HEUD
($
195-8396
Skulls
($
195-8412
Splatter
($
No.
Size
In x Yd
Shf
Pk
Unit
3M
Unit
‡$&9(17,/$7,1*
‡³6&27&+´
Our No.
Shf
Pk
Unit
SHURTECH BRANDS, LLC
DUCT TAPE
DUCT TAPE
Shf
Pk
DUCT TAPE
Our No.
Size
In x Yd
3M
Our No.
Color
266-8937X
INTERTAPE POLYMER CORP
3URYLGHV PD[LPXP DOO ZHDWKHU
strength, without the messy cleanXS ,GHDO IRU ERWK SHUPDQHQW DQG
WHPSRUDU\DSSOLFDWLRQV89UHVLVWDQWZDWHUSURRIEDFNLQJ
QRUHVLGXHUHPRYDOIRUXSWRPRQWKVIURPPRVWRSDTXH
VXUIDFHV0HHWV8/
857-8064
No.
Size
In x Yd
&DPRXÀDJH
For patching, repairing, reinforcing
RUVHDOLQJ$GKHUHVWRPRVWVXUIDFHV 6WURQJ GXUDEOH ZHDWKHUSURRI
)RULQGRRUVRURXWGRRUV
‡125(6,'8($//:($7+(5
‡,1'225287'225
‡³6&27&+´
No.
SHURTECH BRANDS, LLC
‡&2/25('
DUCT TAPE
Our No.
Our No.
DUCT TAPE
493-8130
$
[
52//
109-9449
6SRWWHG/HRSDUG
($
493-8163
$
[
52//
325-6807
7RWDOO\7LH'\H
($
493-8171
$
[
52//
195-8362
Zig-Zag Zebra
($
INTERTAPE POLYMER CORP
991-0357
[
DUCT TAPE
DUCT TAPE
‡³'8&.;)$&725´
‡08/7,86(
‡0,'*5$'(
‡³6&27&+´
High performance strength and adKHVLRQ FKDUDFWHULVWLFV )RU UHSDLUV
color-coding, fashion, crafting and
LPDJLQDWLYH SURMHFWV 7HDUV HDVLO\
by hand without curling and conIRUPVWRXQHYHQVXUIDFHV
For repairs in and around the
KRXVHVKRSDQGMREVLWH
Our No.
No.
Size
In x Yd
Shf
Pk
Unit
Our No.
3M
784-0549
7.6
&
[
($
No.
Color
Shf
Pk
Unit
SHURTECH BRANDS, LLC
1.88” x 15 Yards
247-6620
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Funky Flamingo
($
Maintenance, Repair & Operations - DUCT TAPE
REFLECTIVE TAPE
ANTI-SLIP TAPE
‡+20(6+23
‡³6&27&+´
‡³6&27&+/,7(´
‡,1'225287'225
0,1(5$/&2$7('
‡+($9<'87<
‡³6$)(7<:$/.´
9LVLELOLW\LGHQWL¿FDWLRQ WDSH IRU HQKDQFHGQLJKWWLPHUHÀHFWLYHEULJKWQHVV 8VH RQ PDLOER[HV FDPSHUV
WUDFWRUVRUELNHJHDU
8VH IRU KRXVHKROG UHSDLUV ER[
VHDOLQJ DQG EXQGOLQJ +ROG ZHOO
HYHQ RQ FXUYHG VXUIDFHV 7HDUV
easily, yet super strong to hold seFXUHO\RQFOHDQGU\VXUIDFHV
Our No.
No.
Size
In
601-3338
[
52//
601-3346
[
52//
Our No.
No.
Size
In x Yd
Shf
Pk
Unit
3M
$
[
($
3M
695-3947
Shf
Pk
Unit
Red
Silver
DUCT TAPE
‡08/7,385326(
‡³'8&.´
High performance strength and
DGKHVLRQ FKDUDFWHULVWLFV ([FHOOHQW
for coordinating repairs, color -coding materials, fashion, crafting and
LPDJLQDWLYHSURMHFWV7HDUVHDVLO\E\KDQGZLWKRXWFXUOLQJ
DQGFRQIRUPVWRXQHYHQVXUIDFHV
Our No.
No.
Shf
Pk
Color
Unit
SHURTECH BRANDS, LLC
1.88” x 5 Yard - Carded
756-5633X
&'%/$&.
%ODFN
($
895-7763X
&':+,7(
:KLWH
($
601-3312
[
52//
601-3320
[
52//
REFLECTIVE TAPE
STRIPS
‡+,*+9,6,%,/,7<
‡³6&27&+/,7(´
No.
Size
In
[
Shf
Pk
Unit
3.
3M
601-3304
Adhesives & Caulk
TRANSPARENT
Adhesives & Caulk
TRANSPARENT TAPE
ANTI-SLIP & SAFETY TAPE
‡3$&.',63/$<
‡³6&27&+0$*,&´
)RU RI¿FHV KRPH RI¿FHV DQG
VFKRROV:ULWHRQLWZLWKSHQSHQFLO
RUPDUNHU0DWWH¿QLVK
Our No.
Shf
Pk
No.
Unit
3M
757-9519X
/&'
3.
031-8576
[
($
616-2655
($
[
616-2663
($
[
($
Black - Bulk Roll
‡,1'225287'225121
0,1(5$/
‡0(',80'87<5(6,/,(17
‡³6$)(7<:$/.´
Soft, rubberized, texture surface
for a resilient non-mineral, slip
resistant material designed for barefoot applications in
pool and spa areas, or in strips by/in tubs and showHUV8VHIRUERDWGRFNVGHFNVUHFUHDWLRQDOHTXLSPHQW
VWDLUVHQWU\ZD\VOREELHVHWF/RZSUR¿OHWRUHGXFHWULS
KD]DUG (DV\WRXVH SUHVVXUHVHQVLWLYH DGKHVLYH ZLWK
UHPRYDEOHSURWHFWLYHOLQHUDSSOLHVOLNHWDSH2SHQVWRFN
IRU6DIHW\:DONGLVSOD\V&XWWRGHVLUHGOHQJWK
Our No.
No.
Size
In x Ft
Shf
Pk
Unit
($
684-6877
[
($
684-6901
[
($
Black - Bulk Roll
'XUDEOHIRUORQJOLIHLQKHDY\WUDI¿F DUHDV (DV\ WR DSSO\ VLPSO\
FXW WR VL]H ZLWK VFLVVRUV 6WURQJ
DGKHVLYHUHVLVWVFUDFNLQJDQGSHHOLQJ 5HPRYH RU UHSODFH ZLWKRXW VXUIDFH GDPDJH 8VHV
include skateboards, steps, ramps, walkways, trailers,
UHFUHDWLRQDO DQG ZRUN YHKLFOHV DQ\ZKHUH VDIHU IRRWLQJ
LVGHVLUHG
No.
Size
In
[
Shf
Pk
Unit
($
HOME/RECREATION
TREADS
‡,1'225287'225
‡³6$)(7<:$/.´
+HOSV SUHYHQW VOLSV DQG IDOOV
6WURQJ DGKHVLYH UHVLVWV FUDFNLQJ
DQG SHHOLQJ &RPIRUWDEOH IRU EDUH
IHHW(DVLO\FXWWRVL]HZLWKVFLVVRUV8VHVLQFOXGHVWHSV
VWHSODGGHUVSOD\JURXQGHTXLSPHQWWUDLOHUVERDWVZDWHUVNLVZRUNVKRSVDQ\ZKHUHVDIHUIRRWLQJLVGHVLUHG
Our No.
No.
Size
In
Gray - Bulk Roll
684-8600
[
($
685-0275
[
($
685-0440
[
($
ANTI-SLIP TAPE
Black - Carded
[
[
696-2567
Unit
6HOIVWLFNLQJ DGKHVLYH RQ ERWK
VLGHV)RUFUDIWVPRXQWLQJVHDOLQJ
RUGHFRUDWLQJ
3M
616-2598
684-6810
Our No.
Shf
Pk
Unit
3M
‡287'225
‡³6$)(7<:$/.´
3M
Size
In
Shf
Pk
3M
‡³6&27&+´
No.
Size
In x Ft
STEP/LADDER TREADS
DOUBLE STICK TAPE
Our No.
No.
Our No.
ANTI-SLIP TAPE
$OWHUQDWLQJ UHG DQG ZKLWH VLOYHU
ZLWK VHDOHG HGJHV IRU LPSURYHG
YLVLELOLW\ 0HHWV 1+76$¶V PLQLPXP
VSHFL¿FDWLRQV &HUWL¿HG WR PHHW '27 VWDQGDUG IRU FRQVSLFXLW\)0966
Our No.
3ODVWLF ¿OP ZLWK PLQHUDOFRDWHG
highly durable, color-fast surface
IRU XVH RQ VPRRWK ÀDW VXUIDFHV VXFK DV VWHSV ODZQ
PRZHUVRUWUDFWRUVUHFUHDWLRQDOHTXLSPHQWERDWVHWF
/RZSUR¿OHWRUHGXFHWULSKD]DUG(DV\WRXVHSUHVVXUH
VHQVLWLYH DGKHVLYH ZLWK UHPRYDEOH SURWHFWLYH OLQHU DSSOLHVOLNHWDSH2SHQVWRFNIRU6DIHW\:DONGLVSOD\V&XW
WRGHVLUHGOHQJWK
Shf
Pk
‡,1'225287'225121
0,1(5$/
‡/,*+7'87<5(6,/,(17
‡³6$)(7<:$/.´
6RIW UXEEHUL]HG ¿QH WH[WXUH VXUface for a resilient non-mineral, slip
resistant material designed for safety and comfort in light
WUDI¿FEDUHIRRWDUHDV8VHIRULQGRRUVWDLUVUHFUHDWLRQDO HTXLSPHQW WRRO KDQGOHV SRRO VWHSV GLYLQJ ERDUGV
boats, trailers, tubs and showers, highchairs, strollers,
HWF/RZSUR¿OHWRUHGXFHWULSKD]DUG(DV\WRXVHSUHVVXUHVHQVLWLYHDGKHVLYHZLWKUHPRYDEOHSURWHFWLYHOLQHU
DSSOLHV OLNH WDSH 2SHQ VWRFN IRU 6DIHW\:DON GLVSOD\V
&XWWRGHVLUHGOHQJWK
Our No.
Unit
No.
Size
In x Ft
[
Unit
3M
3M
Clear - Bulk Roll
Gray - Carded
696-2724
Shf
Pk
[
696-2757
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
- Maintenance, Repair & Operations
ANTI-SLIP TAPE
ANTI-SLIP TAPE
CUSHION WRAP
‡6$)(7<*5,7
‡,17(5,25(;7(5,25
‡6(/)$'+(6,9(
‡³*$725*5,3´
‡75$&7,2167(3675,3
‡,17(5,25
‡62)77(;785('9,1</
‡6(/)$'+(6,9(
‡%$55,(56($/('
+HOSVSURYLGHH[WUDWUDFWLRQZKHUH
slippery surface conditions may ocFXU RQ ÀRRUV VWHSV DQG HTXLSPHQW 0HHWV 1)6, $
³+LJK 7UDFWLRQ´ 26+$ DQG :DWHUSURRIFRQVWUXFWLRQRLODQGFKHPLFDOUHVLVWDQW
Helps to reduce the risk of slips,
WULSV DQG IDOOV 0HHWV 1)6, $
³+LJK 7UDFWLRQ´ 26+$ DQG :DWHUSURRIFRQVWUXFWLRQRLODQGFKHPLFDOUHVLVWDQW
Our No.
No.
Size
In x Ft
Shf
Pk
Unit
INCOM MANUFACTURING GRO
Our No.
Size
In
No.
Shf
Pk
Unit
INCOM MANUFACTURING GRO
Roll - Black
462-0357
5(
[
($
560-7288
5(
[
($
342-5980
5(
[
($
5(%/
[
MOVERS QUILT/PAD
‡$//:($7+(5
Helps to reduce the risk of slips,
WULSV DQG IDOOV 0HHWV 1)6, $
³+LJK7UDFWLRQ´26+$DQG
:DWHUSURRIFRQVWUXFWLRQRLODQGFKHPLFDOUHVLVWDQW
Shf
Pk
Unit
'XUDEOH TXLOWHG GHVLJQ SURWHFWV
furniture, appliances and more
IURP VFUDWFKHV QLFNV DQG GHQWV
)RU PRYLQJ DQG VWRUDJH DXWRPRWLYHKRPHDQGUHFUHDWLRQDOXVH$OO
ZHDWKHU SDG ZLOO QRW PLOGHZ LI ZHW &RQVWUXFWHG IURP
SHUFHQWSRO\:DWHUDQGVWDLQUHVLVWDQW:DVKZLWK
JDUGHQKRVHDQGDLUGU\&RQWDLQVSDG
Our No.
743-6686
Black - Carded
[
Size
Ft
No.
Shf
Pk
Unit
63
,+
[
($
($
Adhesives & Caulk
ANTI-SLIP TAPE
POSTAL WRAPPING
PAPER
‡6$)(7<*5,7
‡,17(5,25(;7(5,25
‡6(/)$'+(6,9(
‡³*$725*5,7´
‡.5$)7
Helps to reduce the risk of slips,
WULSV DQG IDOOV 0HHWV 1)6, $
³+LJK 7UDFWLRQ´ 26+$ DQG :DWHUSURRIFRQVWUXFWLRQRLODQGFKHPLFDOUHVLVWDQW
Our No.
No.
Shf
Pk Unit
Color
705-3416
5(
[
770-3408
5(
[
%ODFN
($
615-2755
5(
[
%ODFN
($
143-1717
5(
[
%ODFN
($
807-9675
5(
[
%ODFN
($
<OOZ%OFN
Our No.
No.
Size
Ft. x Yd.
Shf
Pk
Unit
‡67$1'$5'52//
‡³3$&.(521(´
Features a polyethylene air retention layer barrier to retain a full air
EXEEOH )RU OLJKWHU ZHLJKW LWHPV
XVH´EXEEOHVDQGIRUKHDYLHU
VKLSPHQWVXVH´EXEEOHV3HUIRUDWHGHYHU\´IRU
WHDULQJ
Our No.
[
($
WRAPPING PAPER
‡1(:635,17
‡³029(5,7(3$&.5,7(´
:UDS GLVKHV JODVVHV KDUGZDUH
parts, light bulbs, lamp shades,
H[SHQVLYH ERRNV DQG RWKHU IUDJLOH
LWHPV 8VH ZLWK 'LVK*ODVV SDUWLWLRQNLWDQGGLVKSDFNER[WRSUHYHQWEUHDNDJH&UXPSOHV
HDVLO\ IRU SDFNLQJ LQ FDUWRQV )LOOV LQ YRLGV WR SURWHFW
LWHPVGXULQJVKLSSLQJ
Our No.
Helps to reduce the risk of slips,
WULSV DQG IDOOV 0HHWV 1)6, $
³+LJK7UDFWLRQ´26+$DQG
:DWHUSURRIFRQVWUXFWLRQRLODQGFKHPLFDOUHVLVWDQW
Size
In
Size
In. x Ft.
Shf
Pk Unit
ALLBOXES DIRECT
Cut-Away Display Box
645-3138X
7,+6
66
[
($
806-9734X
7,+6
66
[
($
BUBBLE PACKS
Features a polyethylene air retention layer barrier to retain a full air
EXEEOH )RU OLJKWHU ZHLJKW LWHPV
XVH´EXEEOHVDQGIRUKHDYLHU
VKLSPHQWVXVH´EXEEOHV3HUIRUDWHGHYHU\´IRUWHDULQJ
No.
Dia
In
Size
In. x Ft.
Shf
Pk Unit
024-3626
7,+6
66
[
1
($
548-3946
7,+6
66
[
1
($
BUBBLE PACKS
Shf
Pk
Unit
($
Shf
Pk
No.
Features a polyethylene air retention layer barrier to retain a full air
EXEEOH )RU OLJKWHU ZHLJKW LWHPV
XVH´EXEEOHVDQGIRUKHDYLHU
VKLSPHQWVXVH´EXEEOHV3HUIRUDWHGHYHU\´IRUWHDULQJ
Our No.
Unit
140 Sheets
7,+6
66
1
Dia
In
Size
In. x Ft.
Shf
Pk Unit
Dispensing Box
246-0038
ALLBOXES DIRECT
152-6011
No.
ALLBOXES DIRECT
($
INCOM MANUFACTURING GRO
Black - Pack of 4
[
Dia
In
No.
‡³3$&.(521(´
‡6$)(7<*5,7675,3
‡,17(5,25(;7(5,25
‡6(/)$'+(6,9(
5(%/
($
3M
($
ANTI-SLIP TAPE
203-8875
ALLBOXES DIRECT
Roll
No.
[
Our No.
VTIWRYHUDOO0HHWV863RVWDOUHJXODWLRQV
695-6031
INCOM MANUFACTURING GRO
Our No.
‡³3$&.(521(´
MAILING/PACK/MOVING SUPPLIES
Size
In x Ft
Unit
ALLBOXES DIRECT
INCOM MANUFACTURING GRO
5(%/
Shf
Pk
($
Cabinet/Drawer Hardware & Casters
‡6$)(7<*5,7675,3
‡,17(5,25(;7(5,25
‡6(/)$'+(6,9(
026-0729
Size
In x Ft
BUBBLE PACKS
ANTI-SLIP TAPE
No.
No.
3M
695-5975
MAILING/PACK/MOVING SUPPLIES
Our No.
Our No.
Black
306-0282
Size
In
&XVKLRQ SURWHFWLRQ IRU YDOXDEOH
and delicate items during mailing,
VKLSSLQJ DQG VWRUDJH 1\ORQ EDUrier adds strength and helps retain
DLU /LJKWZHLJKW QHDW FOHDQ DQG
QRQVFUDWFKLQJ
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7,+6
66
[
1
($
Maintenance, Repair & Operations - BUBBLE PACK BAGS
PROTECTION KIT
‡³3$&.(521(´
‡',6+:$5(
‡³',6+*8$5'3$&.5,7(´
*XDUGV DJDLQVW VKRFN YLEUDWLRQ
and rough handling during shipSLQJ DQG PRYLQJ )RU SURWHFWLQJ
and securing large plates, picture
IUDPHV SODTXHV FROOHFWDEOHV DQG
PRUH´3HHODQGVHDOWDSHIRUFORVLQJ%XEEOHRQWKH
RXWVLGHSURYLGHVH[WUDSURWHFWLRQ&RQWDLQVEDJV
Our No.
No.
Size
In
Shf
Pk
Unit
ALLBOXES DIRECT
393-4304X
7,+6
66
[
302-3892X
7,+6
66
[
($
524-6624X
7,+6
66
[
($
($
CLEANER AND
BRIGHTENER
&RUUXJDWHGGLYLGHUVDQGKLJKFOLQJ
ribbed lined pouches keep dishes
¿UPO\ LQ SODFH GXULQJ WUDQVLW DQG
VWRUDJH *XDUG DJDLQVW VKRFN YLEUDWLRQ DQG URXJK KDQGOLQJ 'HVLJQHG WR ¿W LQ SRSXODU
FXELF IW ERRN FDUWRQ &RUUXJDWHG GLYLGHUV SHUPLW
GLVKZDUHWREHSDFNHGRQHGJHIRUEUHDNUHVLVWDQFH5HXVDEOH.DQJDURRULEEHGIRDPSRXFKHVDUHFUXVKSURRI.LW
FRQWDLQV´[´3ODWH3RXFKHV´[´6DODG
%RZO3RXFKHV´[´6DXFHU3RXFKHVDQG&HOOGLYLGHUNLW
Our No.
Shf
Pk
No.
Unit
7,+
66
($
BUBBLE MAILER
No.
‡32/<(7+</(1(
‡³6$)(*8$5'3$&.5,7(´
Size
In
Shf
Pk Unit
3URWHFWVVRIDVXSWR´ORQJGXULQJ PRYLQJ DQG VWRUDJH DJDLQVW
dirt, soil, mildew and water damDJH :DWHUSURRI 2QHSLHFH FRQVWUXFWLRQ5HVLVWVWHDUV
Our No.
ALLBOXES DIRECT
686-4110X
7,.
66
[
($
938-8364X
7,+6
66
[
($
393-2563
Shf
Pk Unit
7,+6
66
[
($
Size
Lb.
1
Shf
Pk
Unit
ZINSSER
317-4992
7.6
($
HOUSE/DECK CLEANER
453-9482X
,+6
66
[[
($
796-6088X
7,+6
66
[[
($
[[
No.
Type
Size
Oz
No.
Shf
Pk
Unit
SPRAY & FORGET
330-3708
6)+'2=
($
‡³-20$;´
Size
In
Shf
Pk Unit
ALLBOXES DIRECT
2 Mil
($
Our No.
HOUSE WASH &
MILDEW STAIN
REMOVER
3URWHFWV DJDLQVW GLUW GXVW DQG LQVHFWV'HIHQGVDJDLQVWPLOGHZDQG
ZDWHUGDPDJH1RWHDULQJ1RKDVVOH)LWVVWDQGDUGPDWWUHVVDQGER[
VSULQJ$OVRFRYHUV ODZQIXUQLWXUH
ELF\FOHVJULOOV&KULVWPDVWUHHVDQGPRUH
Our No.
ALLBOXES DIRECT
63
Unit
‡³3$&.5,7(´
0DGH IURP SUHPLHUJUDGH OLQHUERDUG )HDWXUH WKH (= /RDG ÀDS
that locks the lid open during packLQJ 8WLOL]H D JOXH IRUPXODWHG WR
retard moisture, mildew and withVWDQGKLJKKXPLGLW\FRQGLWLRQV
058-7865X
Shf
Pk
MATTRESS COVER
‡³029(5728*+3$&.5,7(´
Size
In
Size
In
No.
ALLBOXES DIRECT
MOVING BOXES
No.
No.
)RUPXODWHG WR UHPRYH JUHHQ DQG
black stains caused by algae, mildew, moss, mold and lichen, on all
types of siding, wood and composLWH GHFNLQJ EULFN VWXFFR ÀRZHU
pots, patio furniture, pool surrounds and other exterior
VXUIDFHV (FRIULHQGO\ %LRGHJUDGDEOH 1RQFRUURVLYH
QRQFDXVWLFDQGQRQDFLGLF7UHDWVWRVTXDUH
IHHW
SOFA COVER
3RO\ RXWHU VKHOO SURYLGHV ZDWHUWLJKWSURWHFWLRQ/LQHGZLWKDLUWLJKW
EXEEOHV IRU FXVKLRQLQJ SURWHFWLRQ
7DPSHUUHVLVWDQWVHFXULW\VHDO$Gdress with ballpoint or permanent
PDUNHU
Our No.
Our No.
‡&21&(175$7(
‡³3$&.(521(´
No.
2[\JHQ DFWLYDWHG IRDP DFWLRQ IRUPXOD GHHS FOHDQV GLUW\ ZHDWKHUHG VXUIDFHV 5HPRYHV
WRXJKPROGPLOGHZDQGDOJDHVWDLQVDQGRGRUV&OHDQV
GHFNVIHQFHVRXWGRRUIXUQLWXUHIDEULFVDQGPRUH
ALLBOXES DIRECT
143-0800
Our No.
‡(;7(5,2508/7,
385326(
‡&21&(175$7(
‡³-20$;´
796-6096
66
Twin/Full
[[
($
392-7878
66
.LQJ4XHHQ [[
($
+RXVH :DVK DQG 0LOGHZ 6WDLQ
5HPRYHU LV D FOHDQHU DQG PLOGHZ
VWDLQ UHPRYHU FRQFHQWUDWH IRU WKH
RXWVLGH RI \RXU KRPH %OHDFK EDVHG FOHDQHU UHPRYHV
GLUW DOJDH DQG PLOGHZ VWDLQV IURP YLQ\O VLGLQJ ZRRG
DOXPLQXP PDVRQU\ VWXFFR EULFN DQG RWKHU SUHYLRXVO\
SDLQWHGH[WHULRUVXUIDFHV(DV\UHDG\WRXVHOLJKWZHLJKW
KRVHDSSOLFDWLRQLGHDOIRUDQQXDOKRXVHFOHDQLQJ-XVWDWtach to a garden hose, turn on the water and spray on
WKHVXUIDFH/HWVLWIRU¿YHWRWHQPLQXWHVDQGIROORZXS
ZLWKDTXLFNULQVH&OHDQVXSWRVTIW
Our No.
No.
Size
Shf
Pk
Quart
Unit
RUST-OLEUM
MOVING BOXES
Stains & Wood Finishes
‡',6+(6
‡³029(5728*+3$&.5,7(´
8VH WR SDFN DQG VWRUH GLVKHV
glasses and other fragile items
VDIHO\ 0DGH IURP SUHPLHUJUDGH
OLQHUERDUG )HDWXUH WKH (= /RDG
ÀDSWKDWORFNVWKHOLGRSHQGXULQJSDFNLQJ8WLOL]HVDJOXH
formulated to retard moisture, mildew and withstand
KLJKKXPLGLW\FRQGLWLRQV'LYLGHUVDUHQRWLQFOXGHG
Our No.
No.
Size
In
Shf
Pk
Unit
[[
($
ALLBOXES DIRECT
392-7860X
,+.
66
871-3638
($
MOLD & MILDEW CLEANERS
WOOD CLEANER
MILDEW CLEANER
‡5($'<7286(
)RUPXODWHG WR UHPRYH PLOGHZ
stains, mold, algae, dirt and other
foreign matter from all painted,
VWDLQHG XQ¿QLVKHG RU ZHDWKHUHG
ZRRG VXUIDFHV 8VH IRU URXWLQH
cleaning and for properly preparing all surfaces prior to
VWDLQLQJ RU SDLQWLQJ 8VH RQ H[WHULRU ZRRG GHFNV VLGing, fences, railings, steps, and most exterior surfaces
LQFOXGLQJ DOXPLQXP YLQ\O SODVWLF DQG PDVRQU\ &RYHUV
DSSUR[LPDWHO\VTIWSHUJDOORQ
No.
Size
Gal
943-5629X
1
943-5611X
Our No.
Shf
Pk
Unit
*$/
*$/
CABOT
‡,17(5,255($'<7286(
‡³3(50$:$6+´
'LVLQIHFWDQWIXQJLFLGHEDFWHULFLGH
mildewcide and mildewstat all in
RQH1RQEOHDFKIRUPXOD(3$UHJistered to kill mold, mildew, bacteULDDQGRGRUVRQZDOOVÀRRUVDQGRWKHUKDUGQRQSRURXV
LQWHULRUVXUIDFHV
Our No.
No.
Size
Oz
Shf
Pk
Unit
ZINSSER
143-9769
Pump Sprayer
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
- Maintenance, Repair & Operations
MILDEW CLEANER
MOLD & MILDEW
REMOVER
‡,17(5,255($'<7286(
‡'((367$,1
&21&(175$7('
‡³02/'(;´
&OHDQV GLVLQIHFWV DQG GHRGRUL]HV
)RUPXODWHG ZLWK 'X3RQW 7HFKQROogy to kill mold, mildew and bacteria on hard, non-porous interior
VXUIDFHV1RQEOHDFKIRUPXOD.LOOV
DQGHOLPLQDWHVWRXJKRGRUV
Our No.
Shf
Pk
No.
Size
Unit
291-7193
2]
($
308-3888
Gallon
($
ZINSSER
MILDEW CLEANER
‡683(5&21&(175$7('
1RULQVH FOHDQHU WKDW UHPRYHV
green and black algae, mildew,
fungus, and lichen stains from
roofs, siding, decks, brick, stucco,
DQG RWKHU H[WHULRU VXUIDFHV (FR
IULHQGO\ELRGHJUDGDEOHQRQFRUURVLYHSURGXFWGRHVQRW
UHTXLUHSRZHUZDVKLQJDQGRUEUXVKLQJWHFKQLTXHV
Our No.
No.
Size
Shf
Pk
Unit
*$/
SPRAY & FORGET
840-7389
SF1G-J
‡+26((1'635$<(5
‡)25522)6
6SUD\V XS WR IHHW ELREORFNHU
and built in sprayer, no mixing reTXLUHG HFRQRPLFDO FOHDQV XS WR
VT IW 5HPRYHV DQG SUHYHQWVPRVVOLFKHQDQGDOJDHVWDLQVRQDVSKDOWVKLQJOH
PHWDO WLOH DQG VKDNH URRIV 1R ULQVLQJ UHTXLUHG HFR
IULHQGO\
No.
$ FRQFHQWUDWHG PXOWLVXUIDFH
FOHDQHU WKDW LV SDFNHG ZLWK 2[\JHQ3RZHU WKDW JHWV ULG RI PROG DQG PLOGHZ VWDLQV ,W
ZDVIRUPXODWHGWRTXLFNO\UHPRYHVWXEERUQHPEHGGHG
PLOGHZ VWDLQV WKDW WRXJK PROG DQG PLOGHZ FDQ OHDYH
EHKLQGDIWHUFOHDQLQJ'RHVQRWFRQWDLQKDUPIXOEOHDFK
DPPRQLD RU RWKHU KDUVK FKHPLFDOV ,W LV QRQWR[LF KDV
little odor, and will not harm plants or fabrics like tradiWLRQDOFOHDQHUV8VHRQ3DWLR)XUQLWXUH$ZQLQJV6KRZHU
&XUWDLQV :DOOV 7LOH *URXW 3ODVWLF 3UHYLRXVO\ SDLQWHG
VXUIDFHV %DVHPHQWV :LQGRZ IUDPHV 6HDOHG :RRG
7DUSV7HQWV6KLQJOHV5RRIV6LGLQJ$VSKDOW&RQFUHWH
)RXQGDWLRQV %ULFN 0DVRQU\ :DONZD\V DQG 5HWDLQLQJ
:DOOV&RYHUVVTIW
Our No.
6)65&4
Size
Shf
Pk
Quart
Size
Oz
Shf
Pk
($
Size
Oz
No.
Shf
Pk
Unit
($
Size
Shf
Pk
Unit
Quart
($
SAKRETE OF NORTH AMERICA
058-1991
MURIATIC ACID
GHJUHH %DXPH )RU 3K DGMXVWPHQW DQG DFLG ZDVKHV $OVR XVHG
IRU EULFN DQG PRUWDU FOHDQ XS
%RWWOHV DUH LQGLYLGXDOO\ EDJJHG LQ
SODVWLF EDJ SHUFHQW DFWLYH
&KORULGH
Our No.
No.
SUNBELT CHEMMICALS
190-6809X
/
ROOF CLEANER
)RU FOHDQLQJ DQG UHPRYLQJ PROG
and mildew on tile, asphalt, slate
DQG RWKHU QRQSRURXV URRIV 5HPRYHV EODFN VWUHDNV GLUW DQG
PLOGHZ VWDLQV IURP URRI VKLQJOHV
&RQWDLQVDPLOGHZFLGH&KOR5HOHDVHEOHDFKDFWLYDWRUDQG
GHWHUJHQWV:KHQPL[HGZLWKZDWHURQHJDOORQPDNHV
JDOORQVHQRXJKIRUDVTIWURRI
Our No.
Shf
Pk
Size
Unit
ZINSSER
219-0494
MURIATIC ACID
‡³./($1675,3*5((1´
SHUFHQWORZHUIXPHVWKDQVWDQGDUG 0XULDWLF $FLG DQG LV VDIHU WR
XVH DQG VWRUH (WFKHV FRQFUHWH
brightens, masonry and concrete,
ORZHUV SK LQ VZLPPLQJ SRROV UHPRYHV H[FHVV PRUWDU
IURPEULFNV
Our No.
Gallon
($
Paint & Primers
Size
*.*0
Gallon
No.
Size
Oz
=8&21
*$/
PUTTY KNIVES
PUTTY KNIVES
‡$//67((/
Our No.
No.
Shf
Pk
Unit
ALLWAY TOOLS INC
*$/
578-8674
7)
592-1077
76
ACUITY SPECIALTY PRODUCTS
029-0619
Unit
Knives, Scrapers & Abrasives
Formulated for fast, powerful
FOHDQLQJ RI FRQFUHWH VXUIDFHV 5HPRYHVRLOJUHDVHDQGGLUW&DQEHXVHGZLWKSUHVVXUH
ZDVKHUV0DNHVXSWRJDOORQV
Our No.
Shf
Pk
WM BARR
825-0979X
CONCRETE CLEANERS
No.
Blade
Wdth In
Type
Shf
Pk
Unit
Flexible
($
Stiff
($
Carded
DRIVEWAY CLEANER
Trigger Spray
No.
Unit
SPRAY & FORGET
6)30&6
‡'5,9(:$<0$6215<
‡&21&(175$7(
352)(66,21$/675(1*7+
‡³=(3´
3UHPL[HG UHDG\ WR XVH H[WHULRU
DOJDH PLOGHZ DQG PROG UHPRYHU
that you simply spray on and you
GRQRWKDYHWRULQVHRII9HU\HFR
IULHQGO\ DQG QRQFRUURVLYH &RQWDLQV QR EOHDFK O\H RU
FKORULQH8VHRQSDWLRVFROXPQVEULFNVLGLQJYLQ\OVLGLQJZRRGGHFNVVWXFFRDQGRWKHUH[WHULRUVXUIDFHV
307-4945
Our No.
CONCRETE CLEANER
($
MILDEW CLEANER
No.
Unit
Hose End Sprayer
586-5001X
Unit
‡(;7(5,25
Our No.
Shf
Pk
ENVIROCARE CORP
SPRAY & FORGET
469-4170
Size
Oz
No.
8VHWRUHPRYHFXUHGFHPHQWFRQcrete, mortar or stucco from most
VXUIDFHV 6DIH HQYLURQPHQWDOO\
IULHQGO\ OLTXLG DOWHUQDWLYH WR DJJUHVVLYHDFLGFRQFUHWHUHPRYHUV
‡&21&(175$7(
Gallon
MILDEW CLEANER
Our No.
CONCRETE MORTAR
DISSOLVER
($
‡,1'8675,$/675(1*7+
&21&(175$7(
‡%,2'(*5$'$%/(
‡³&/($15,7(3853/(
32:(5´
PUTTY KNIVES
‡3/$67,&
‡³.,&´
&OHDQVGLUWRLODQGJUHDVHVWDLQVRQ
FRQWDFW)RUFRQFUHWHGULYHZD\VSDUWVDQGHTXLSPHQW
1RQ)ODPPDEOH
Our No.
No.
Size
Shf
Pk
Unit
*$/
AIKEN CHEMICAL COMPANY,
638-2931
3
Gallon
+HDY\GXW\ KLJK LPSDFW VW\UHQH
(DV\WRXVHDQGUHF\FODEOH8VHWR
¿OOQDLOKROHVJRXJHVHWF)LWVHDVLO\LQWRVPDOOFDQVRI¿OOHU
Our No.
No.
Blade
Wdth In
Shf
Pk
Unit
($
HOMAX CORPORATION
Yellow
697-8787
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - PUTTY KNIVES
PUTTY KNIVES
BENT PUTTY KNIVES
‡352)(66,21$/
‡³%/$&.6,/9(5´
‡67$1'$5'
‡67$1'$5'
Full tang blade construction, heattreated, precision ground, mirror
¿QLVKHG KLJKFDUERQ VWHHO EODGH
/DFTXHUFRDWHG1\ORQKDQGOHZLWK
EUDVVULYHW
)XOOWDQJEODGHFRQVWUXFWLRQ+HDW
treated, precision ground, mirror
¿QLVKHG KLJKFDUERQ VWHHO EODGH
/DFTXHUFRDWHG1\ORQKDQGOHZLWK
EUDVVULYHW
Full tang, high-carbon steel blade,
LQGLYLGXDOO\ JURXQG SROLVKHG PLUURU¿QLVKHGDQGFOHDUFRDWHGUXQV
from working edge to end of nylon
3URMHFWLRQ,QWHUORFN KDQGOH ZLWK KDQJ KROH 8VHV )OR
/RFNIDVWHQHUVZLWK¿VKKRRNWKUHDGIRUDVWURQJHUEODGH
WRKDQGOHKROGWKDQFRQYHQWLRQDOULYHWV
Our No.
No.
Blade
Wdth In
Type
Shf
Pk
Unit
HYDE TOOLS
Our No.
Blade
Wdth In
No.
Type
Shf
Pk
Unit
MINTCRAFT
Our No.
No.
Shf
Pk
Unit
MINTCRAFT
Nylon Handle - Labeled
933-0762
Blade
Wdth In
Stiff
Nylon Handle - Labeled
($
140-4391
($
Labeled
701-2271
Flexible
($
‡³9$/8(6(5,(6´
Stamped carbon steel blade, hardHQHG IRU GXUDELOLW\ (UJRQRPLF
VKDSHIRUFRPIRUWDEOHJULS
Our No.
No.
Type
JOINT KNIVES
‡+20(2:1(5
‡67$,1/(6667((/
‡³35267$,1/(66´
Half tang construction, heat-treated, sand polished and chrome plated, high-carbon steel blade with
SODVWLFLQMHFWLRQKDQGOH
PUTTY KNIVES
Blade
Wdth In
PUTTY KNIVES
Our No.
Shf
Pk
Blade
Wdth In
No.
Type
Shf
Pk
Unit
MINTCRAFT
Unit
HYDE TOOLS
Labeled
656-1542
Flexible
($
656-1674
Stiff
($
Our No.
Plastic Handle - Labeled
358-3911
Flexible
($
115-4756
Stiff
($
PUTTY KNIVES
PUTTY KNIVES
‡³35267$,1/(66´
6WDLQOHVV VWHHO EODGH UHVLVWV UXVW
'RXEOH KROORZJURXQG ÀH[ EODGHV
IRU ÀH[SRLQW DQG ORQJHU OLIH 'LIIHUHQWLDWHG RYHUPROG KDQGOHV IRU
VFUDSLQJ DQG VSUHDGLQJ )XOO GXrable alloy Hammer Head end for setting nails and poVLWLRQLQJERDUGV
Our No.
No.
Blade
Wdth In
Type
Shf
Pk
Unit
Our No.
681-5955
Stiff
($
090-9572
Flexible
($
681-5906
Stiff
($
Blade
Wdth In
No.
Type
Shf
Pk Unit
MINTCRAFT
Shf
Pk
Unit
HYDE TOOLS
Labeled
681-5963
Flexible
($
Our No.
No.
Blade
Wdth In
Type
Shf
Pk
Unit
HYDE TOOLS
Rosewood Handle - Labeled
756-8439
5
Flexible
($
605-8796
5
Stiff
($
Labeled
656-2615
Flexible
($
Knives, Scrapers & Abrasives
WALL & MOLDING SCRAPERS
PUTTY KNIVES
‡+,*+&$5%2167((/
JOINT KNIVES
‡+,*+&$5%2167((/
1R VOLS UXEEHUL]HG FXVKLRQ JULS
KDQGOH1DLOVHWKDPPHUKHDGHQG
‡352)(66,21$/+$00(5
(1'
Full tang blade construction, highFDUERQVWHHOPLUURU¿QLVKHGEODGH
(UJRHQJLQHHUHG VRIWJULS KDQGOH
absorbs shock and reduces worker
IDWLJXH%UDVVULYHWKROGVEODGHPRUHVHFXUHO\LQVLGHKDQGOH0HWDOHQGIRUVHWWLQJQDLOV
Type
Type
+DUGHQHGIRUGXUDELOLW\(UJRQRPLF
VKDSHIRUFRPIRUWDEOHJULS
PUTTY KNIVES
No.
Blade
Wdth In
‡67$03('&$5%2167((/
‡³9$/8(6(5,(6´
1RVOLSJULS1DLOVHWHQG
Our No.
No.
JOINT KNIVES
Full tang blade construction, highFDUERQVWHHOPLUURU¿QLVKHGEODGH
5RVHZRRG KDQGOH PLOOHG DQG FRQWRXUHG E\ FRPSXWHU %UDVV ULYHW
holds blade more securely inside
KDQGOH
HYDE TOOLS
Blade
Wdth In
6WDLQOHVV VWHHO EODGH UHVLVWV UXVW
'RXEOH KROORZJURXQG ÀH[ EODGHV
IRU ÀH[SRLQW DQG ORQJHU OLIH 'LIIHUHQWLDWHG RYHUPROG KDQGOHV IRU
VFUDSLQJDQGVSUHDGLQJ)XOOGXUDEOHDOOR\+DPPHU+HDG
HQGIRUVHWWLQJQDLOVDQGSRVLWLRQLQJERDUGV
Shf
Pk
Our No.
No.
Blade
Wdth In
Type
Shf
Pk Unit
PURDY CORPORATION
710-0613
Flexible
($
723-0378
Flexible
($
Our No.
‡+,*+&$5%2167((/
671-0917
Flexible
($
409-5048
&KLVHO
($
1RVOLSJULS1DLOVHWHQG
Our No.
No.
Blade
Wdth In
Type
Stiff
Shf
Pk Unit
PURDY CORPORATION
545-0127
Shf
Pk Unit
Labeled
219-9008 CHISEL PUTTY KNIVES
Labeled
Blade
Wdth In Type
PURDY CORPORATION
Unit
MINTCRAFT
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
)OH[LEOH$QJOHG
($
- Maintenance, Repair & Operations
BENT SCRAPER
WALL SCRAPERS
SCRAPERS
‡(;7(1'$%/(
‡+20(2:1(5
,QFOXGHV VFUHZ RXW KDPPHU HQG
6RIWJULS
Half tang construction, heat-treated, sand polished, and chrome
SODWHG KLJKFDUERQ VWHHO EODGH
3ODVWLF LQMHFWLRQ KDQGOH ZLWK ODUJH
ORRSIRUKDQJVWRUDJH
‡67$,1/(6667((/
‡³35267$,1/(66´
Our No.
No.
Blade
Wdth In
Shf
Pk
Unit
ALLWAY TOOLS INC
Our No.
%6
Shf
Pk Unit
Type
MINTCRAFT
Carded
304-7560
Blade
Wdth In
No.
Our No.
Plastic Handle - Labeled
($
6WDLQOHVV VWHHO EODGH UHVLVWV UXVW
'RXEOH KROORZJURXQG ÀH[ EODGHV
IRU ÀH[SRLQW DQG ORQJHU OLIH 'LIIHUHQWLDWHG RYHUPROG KDQGOHV IRU
VFUDSLQJDQGVSUHDGLQJ)XOOGXUDEOHDOOR\+DPPHU+HDG
HQGIRUVHWWLQJQDLOVDQGSRVLWLRQLQJERDUGV
959-3807
/
Flexible
($
957-7628
/
Stiff
($
No.
Blade
Wdth In
Type
Shf
Pk
Stiff
Unit
HYDE TOOLS
Labeled
574-0931
($
WALL SCRAPERS
‡$//67((/
CHISEL WALL
SCRAPERS
SCRAPERS
‡781*67(1&$5%,'(
‡+$00(5+($'.12%
‡352)(66,21$/
‡³%/$&.6,/9(5´
Our No.
No.
Blade
Wdth In
Shf
Pk
Type
Unit
ALLWAY TOOLS INC
Carded
116-9960
76
Stiff
($
Full tang, high-carbon steel blade,
LQGLYLGXDOO\ JURXQG SROLVKHG PLUURU¿QLVKHGDQGFOHDUFRDWHGUXQV
IURPZRUNLQJHGJHWRHQGRIQ\ORQ3URMHFWLRQ,QWHUORFN
KDQGOH ZLWK KDQJ KROH 8VHV )OR/RFN IDVWHQHUV ZLWK
¿VKKRRNWKUHDGIRUDVWURQJHUEODGHWRKDQGOHKROGWKDQ
FRQYHQWLRQDOULYHWV
Our No.
No.
Blade
Wdth In
Type
Shf
Pk
Stiff
1DLOVHWHQG6RIW*ULSKDQGOH
Our No.
No.
Blade
Size In
Shf
Pk
Unit
PURDY CORPORATION
061-4917
($
Unit
HYDE TOOLS
WALL SCRAPERS
Labeled
‡352)(66,21$/
‡³%/$&.6,/9(5´
680-2144
Full tang, high-carbon steel blade,
LQGLYLGXDOO\ JURXQG SROLVKHG PLUURU¿QLVKHGDQGFOHDUFRDWHGUXQV
from working edge to end of nylon
3URMHFWLRQ,QWHUORFN KDQGOH ZLWK KDQJ KROH 8VHV )OR
/RFNIDVWHQHUVZLWK¿VKKRRNWKUHDGIRUDVWURQJHUEODGH
WRKDQGOHKROGWKDQFRQYHQWLRQDOULYHWV
Our No.
No.
Blade
Wdth In
Shf
Pk
Type
Unit
HYDE TOOLS
Labeled
680-1294
Flexible
($
Tempered carbon steel blade has
blunt edge for cement or stucco
ZRUN $ UD]RU HGJH IRU VFUDSLQJ
SDLQW DQG WDSH +DQGOH HDVLO\ DWWDFKHV WR DOO 8QJHU SROHV (UJRQRPLFJULS
684-5457
No.
Our No.
6+&
293-9577
Blade
Wdth In
Shf
Pk
Unit
($
‡³(&2120<6(5,(6´
‡&$5%2167((/
‡³9$/8(6(5,(6´
Shf
Pk
Unit
Unit
($
SCRAPERS
‡('*(+,*+&$5%21
67((/
‡+$00(5+($'.12%
($
Our No.
No.
Blade
Wdth In
Type
569-6513
Shf
Pk
Unit
HYDE TOOLS
Blade
Wdth In
Shf
Pk
Unit
($
SCRAPER BLADES
‡781*67(1&$5%,'(
Labeled
656-2623
No.
PURDY CORPORATION
Stamped carbon steel blade, hardHQHG IRU GXUDELOLW\ (UJRQRPLF
VKDSHIRUFRPIRUWDEOHJULS
Our No.
Labeled
Shf
Pk
1DLOVHWHQG6RIWJULSKDQGOH
HYDE TOOLS
659-6399
Blade
Wdth In
SCRAPERS
Spring steel blade and yellow polypropylene handles with large loop
WR KDQJ WRRO IRU VWRUDJH +DQGOHV
UHVLVWPRVWFRPPRQSDLQWWKLQQHUV
Blade
Wdth In
No.
PURDY CORPORATION
WALL SCRAPERS
No.
‡781*67(1&$5%,'(
‡+$00(5+($'
‡³(5*27(&+6&5$3(5´
UNGER INDUSTRIAL
Our No.
SCRAPERS
1DLOVHWHQG6RIWJULSKDQGOH
SCRAPERS
Our No.
($
Stiff
($
5HSODFHPHQW EODGH IRU 6NX
Our No.
No.
Blade
Wdth In
Shf
Pk
Unit
($
PURDY CORPORATION
724-7869
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - SCRAPER BLADES
PAINTER’S TOOLS
PAINTER’S TOOLS
‡781*67(1&$5%,'(
‡,167$03('&$5%21
67((/
‡,1+$00(5+($'
67,))
‡352)(66,21$/
‡³%/$&.6,/9(5´
5HSODFHPHQW EODGH IRU 6NX
Our No.
No.
Blade
Wdth In
Shf
Pk
Unit
PURDY CORPORATION
814-3315
8VH WR VFUDSH SDLQW VSUHDG FRPSRXQGFOHDQUROOHUVUHPRYHSXWW\
DQG RSHQ FUDFNV 6WDPSHG FDUERQ
VWHHOEODGHKDUGHQHGIRUGXUDELOLW\
(UJRQRPLFVKDSHIRUFRPIRUWDEOHJULS
Our No.
Shf
Pk
No.
Unit
HYDE TOOLS
($
Labeled
624-6557
($
CHISEL SCRAPERS
2IIHUV IXQFWLRQV LQFOXGLQJ VKDUS
EODGHIRUVFUDSLQJSXWW\UHPRYHU
VSUHDGHU URXQG FXWRXW WR UHPRYH SDLQW IURP UROOHUVVKDUSSRLQWWRRSHQFUDFNVIRUSDWFKLQJDQGGLHFDVW
PHWDO HQG EXLOWLQ WR VHW GU\ZDOO QDLOV )XOO WDQJ KLJK
FDUERQVWHHOEODGHLQGLYLGXDOO\JURXQGSROLVKHGPLUURU
¿QLVKHG DQG FOHDUFRDWHG UXQV IURP ZRUNLQJ HGJH WR
Q\ORQ 3URMHFWLRQ,QWHUORFN KDQGOH HQG 8VHV )OR/RFN
IDVWHQHUV ZLWK ¿VKKRRN WKUHDG IRU D VWURQJHU EODGHWR
KDQGOHKROGWKDQFRQYHQWLRQDOULYHWV
Our No.
‡+,*+&$5%2167((/
No.
Blade
Wdth In
Type
Shf
Pk Unit
PURDY CORPORATION
Labeled
563-1858
Stiff
617-5608
8VH WR FOHDQ UROOHUV VFUDSH SDLQW
spread putty/compound, open/
clean cracks, open paint lids and
VHWQDLOV1RVOLSJULS1DLOVHWHQG
5XVWSURRIVWDLQOHVVVWHHOEODGH
Our No.
Shf
Pk
No.
Labeled
297-4640
($
PAINTER’S TOOLS
‡,167$,1/(6667((/
‡³35267$,1/(66´
8VH WR VFUDSH SDLQW VSUHDG FRPSRXQGFOHDQUROOHUVUHPRYHSXWW\
open cracks, and Hammer Head
HQGVHWVQDLOV6WDLQOHVVVWHHOEODGH
UHVLVWV UXVW 'RXEOH KROORZJURXQG ÀH[ EODGHV IRU ÀH[SRLQWDQGORQJHUOLIH'LIIHUHQWLDWHGRYHUPROGKDQGOHVIRU
VFUDSLQJDQGVSUHDGLQJ)XOOGXUDEOHDOOR\+DPPHU+HDG
HQGIRUVHWWLQJQDLOVDQGSRVLWLRQLQJERDUGV
Our No.
Shf
Pk
No.
PAINTER’S TOOLS
‡,1+,*+&$5%21
67((/
8VH WR FOHDQ UROOHUV VFUDSH SDLQW
spread putty/compound, open/
clean cracks, open paint lids and
VHWQDLOV1RVOLSJULS1DLOVHWHQG
Our No.
Unit
741-2141
2IIHUV IXQFWLRQV LQFOXGLQJ VKDUS
EODGH IRU VFUDSLQJ SXWW\ UHPRYHU
VSUHDGHU URXQG FXWRXW WR UHPRYHSDLQWIURPUROOHUVDQGVKDUS
SRLQW WR RSHQ FUDFNV IRU SDWFKLQJ )XOO WDQJ KLJKFDUERQ VWHHO EODGH LQGLYLGXDOO\ JURXQG SROLVKHG PLUURU
¿QLVKHG DQG FOHDUFRDWHG UXQV IURP ZRUNLQJ HGJH WR
HQGRIQ\ORQ3URMHFWLRQ,QWHUORFNKDQGOH8VHV)OR/RFN
IDVWHQHUV ZLWK ¿VKKRRN WKUHDG IRU D VWURQJHU EODGHWR
KDQGOHKROGWKDQFRQYHQWLRQDOULYHWV
Blade
Wdth In
No.
Type
Shf
Pk
Stiff
Unit
Labeled
Unit
680-4611
($
($
‡,1
‡³0$;;*5,3352´
Shf
Pk
PAINTER’S TOOLS
Full tang construction, high-carbon steel, sharp blade with nylon
KDQGOH RIIHUV IXQFWLRQV VFUDSHU
VSUHDGHUSXWW\UHPRYHUKDOIURXQG
FXWRXWWRUHPRYHSDLQWIURPUROOHU
DQGVKDUSSRLQWWRRSHQFUDFNVIRUSDWFKLQJ
PAINTER’S TOOLS
8VH WR VFUDSH SDLQW VSUHDG FRPSRXQGFOHDQUROOHUVUHPRYHSXWW\
open cracks, open lids, pull nails
DQG +DPPHU +HDG HQG VHWV QDLOV
6WDLQOHVV VWHHO EODGH UHVLVWV UXVW
'RXEOHKROORZJURXQGÀH[EODGHVIRUÀH[SRLQWDQGORQJHUOLIH'LIIHUHQWLDWHGRYHUPROGKDQGOHVIRUVFUDSLQJDQG
VSUHDGLQJ)XOOGXUDEOHDOOR\+DPPHU+HDGHQGIRUVHWWLQJQDLOVDQGSRVLWLRQLQJERDUGV
No.
‡,167$1'$5'
‡,167$,1/(6667((/
Unit
8VH WR VFUDS SDLQW VSUHDG FRPSRXQGFOHDQUROOHUVUHPRYHSXWW\
RSHQ FUDFNV ,QFOXGHV IRXU ELWV LQ
WKH KDQGOH ´ VORWWHG ´
VORWWHGSKLOOLSVSKLOOLSV
Our No.
Shf
Pk
No.
Our No.
958-8187
Hang Tag
($
Labeled
Shf
Pk
Unit
Nylon Handle - Labeled
Unit
HYDE TOOLS
090-1868
Blade
Wdth In
No.
MINTCRAFT
HYDE TOOLS
($
HYDE TOOLS
($
PAINTER’S TOOLS
681-6052
Label
Labeled
Our No.
‡,1352)(66,21$/
‡³%/$&.6,/9(5´
Our No.
Shf
Pk
No.
PURDY CORPORATION
HYDE TOOLS
681-6037
Stiff
Unit
PAINTER’S TOOLS
Unit
PURDY CORPORATION
($
Shf
Pk
Labeled
‡,167$,1/(6667((/
Our No.
Type
HYDE TOOLS
PAINTER’S TOOLS
1RVOLSJULS1DLOVHWHQG
Blade
Wdth In
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
/
($
- Maintenance, Repair & Operations
PAINT SCRAPERS
PAINT SCRAPERS
‡&+,6(/(;7(16,2132/(
‡(;75$+($9<'87<67,))
‡³32/(&$7´
‡('*(1$,/6(77(5
‡352)(66,21$/
‡(;75$+($9<'87<
‡³0$;;*5,3781*67(1
7$/21´
8VHKDQGKHOGRUZLWK$FPHWKUHDGed broom handles and extension
SROHV +LJKFDUERQ VWHHO EODGH
EHQWEODGHLWHPDQJOHGDWGHJUHHVIRUHDV\SDLQWUHPRYDO SLHFH SRO\SURS\OHQH KDQGOHV UHVLVW PRVW FRPmon paint thinners and incorporate thumb bolster for
DGGHG KDQGKHOG OHYHUDJH VWHHO JURPPHW IDVWHQHUV IRU
SHUPDQHQWMRLQLQJZLWKEODGHDQGVWRUDJHKDQJKROH
Our No.
No.
Blade
Wdth In
Type
Shf
Pk
%HQW
Unit
HYDE TOOLS
Labeled
617-5616
‡67$,1/(6667((/%/$'(6
)LOH LQVLGH KDQGOH ,QFOXGHV GLIferent hardened and ground stainOHVVEODGHVLQVWRUDJHFDVH
+HDY\GXW\7XQJVWHQFDUELGHEODGH
ZLWK VFUDSLQJ HGJHV ODVWV ORQJHU WKDQ FDUERQ VWHHO
$QJOHGOLJKWZHLJKWGLHFDVWDOOR\VKDIWDQGEODGHKROGHU
keeps knuckles away from work, and allows for paint
VFUDSLQJ HI¿FLHQF\ (UJR(QJLQHHUHG FRQWRXUHG VROLG
SRO\SURS\OHQH VRIWJULS KDQGOH ZLWK KDQJ KROH ¿WV ¿VW
IRU PRUH OHYHUDJH DQG OHVV XVHU IDWLJXH 3XOONQRE JULS
ZLWKPHWDOLQVHUWWRVHWQDLOV8VH1R+\GHHGJH
´UHSODFHPHQWEODGHV
Our No.
($
CONTOUR SCRAPER
SET
Blade
Wdth In
No.
Shf
Pk
Our No.
No.
Blade
Wdth In
Type
Shf
Pk
Stiff
Unit
Labeled
($
656-5444
No.
Blade
Wdth In
Handle
Lgth In
Shf
Pk
Unit
&'
Type
‡7(03(5('67((/
‡('*(%/$'(
Shf
Pk
Unit
Stiff
Our No.
($
PAINT SCRAPERS
‡('*(352)(66,21$/
‡³%/$&.6,/9(5´
$QJOHG FRPSXWHUGHVLJQHG VROLG
polypropylene handles with hang
KROH DUH VKDSHG WR ¿W KXPDQ
KDQGV WR SURYLGH H[WUD OHYHUDJH
DQG WR NHHS NQXFNOHV VDIHO\ DZD\ IURP ZRUN VXUIDFH
%ODGHVXUIDFH DQJOH IRU SDLQW VFUDSLQJ HI¿FLHQF\ +LJK
FDUERQVWHHOEODGHZLWKVFUDSLQJHGJHV8VH1R
+\GH HGJH ´ UHSODFHPHQW EODGHV IRU 1R
1R +\GH ´ IRU 1R DQG 1R
+\GH´IRU1R
Blade
Wdth In
($
PAINT SCRAPER
BLADES
‡('*(&$5%2167((/
+LJKFDUERQ VWHHO EODGH ZLWK VKDUSVFUDSLQJHGJHV)RUXVHZLWK
+\GH HGJH VFUDSHUV 1RV
DQG
Our No.
No.
Wdth
In
Shf
Pk
Unit
Handle
Lgth In
&'
No.
Blade
Size In
Wdth
In
Shf
Pk
Unit
&'
Wdth
In
Shf
Pk
Unit
&'
‡('*(&$5%2167((/
Shf
Pk
Unit
Carded
No.
507-5304
PAINT SCRAPER
BLADES
$OOPHWDOWXEXODU)HDWXUHVFDPEHU
JURXQGEODGHIRUDJJUHVVLYHVFUDSLQJDFWLRQ
ALLWAY TOOLS INC
Our No.
Unit
WOOD SCRAPERS
Labeled
Shf
Pk
No.
HYDE TOOLS
656-6665
HYDE TOOLS
657-3042
($
HYDE TOOLS
High-carbon steel blade designed
IRUXVHZLWKSDLQWUHPRYHUV%ODGH
VHFXUHO\ DWWDFKHG WR ´/ SRO\SURS\OHQHKDQGOHZLWK)OR/RFNIDVWHQHUVKDQJKROHIRUHDV\VWRUDJH
Blade
Wdth In
Our No.
HYDE TOOLS
‡&+,6(//21*+$1'/(
‡(;75$+($9<'87<
No.
&RQWRXU SDLQWLQJ VFUDSHU NLW ZLWK
VL[ EODGHV (UJRQRPLF VRIW KDQGOH
UHGXFHV IDWLTXH DEVRUEV VKRFN
DQGLQFUHDVHVFRPIRUW
$QJOHG FRPSXWHUGHVLJQHG VROLG
polypropylene handles with hang
KROH DUH VKDSHG WR ¿W KXPDQ
KDQGVWRSURYLGHH[WUDOHYHUDJHDQGWRNHHSNQXFNOHV
VDIHO\DZD\IURPZRUNVXUIDFH%ODGHVXUIDFHDQJOHIRU
SDLQWVFUDSLQJHI¿FLHQF\+LJKFDUERQVWHHOEODGHZLWK
scraping edges, and pull-knob grip with metal insert to
VHW QDLOV 8VH 1R RU +\GH HGJH ´
UHSODFHPHQWEODGHV
Our No.
PAINT SCRAPERS
Our No.
&6
&'
‡('*(1$,/6(77(5
‡352)(66,21$/
‡³%/$&.6,/9(5´
HYDE TOOLS
657-3034
Carded
768-2339
PAINT SCRAPERS
High-carbon steel blade angled at
GHJUHHVIRUHDV\SDLQWUHPRYDO
%ODGHVHFXUHO\DWWDFKHGWRSRO\SURS\OHQHKDQGOHZLWK)OR/RFNIDVWHQHUVDQGVWRUDJHKDQJKROH´/RYHUDOO
Unit
ALLWAY TOOLS INC
CONTOUR SCRAPER
KIT
PAINT SCRAPERS
‡%(17&+,6(/
‡(;75$+($9<'87<
Shf
Pk
No.
Unit
HYDE TOOLS
932-6729
Our No.
Shf
Pk
Unit
HYDE TOOLS
656-3902
1
&'
656-4843
&'
656-5188
&'
+LJKFDUERQ VWHHO EODGH ZLWK VKDUSVFUDSLQJHGJHV)RUXVHZLWK
+\GH HGJH VFUDSHUV 1RV
DQG
Our No.
No.
818-2594
)
($
950-3137
HYDE TOOLS
)
($
657-2713
WOOD SCRAPERS
PAINT SCRAPER
BLADES
‡('*(%/$'(7(03(5('
67((/
‡('*(&$5%2167((/
Features camber ground blade for
DJJUHVVLYHVFUDSLQJDFWLRQ
Our No.
No.
Blade
Size In
Shf
Pk
Unit
($
ALLWAY TOOLS INC
042-0661
F1
+LJKFDUERQ VWHHO EODGH ZLWK VKDUS VFUDSLQJ HGJHV URXJK
DQG VPRRWK )RU XVH ZLWK +\GH
HGJH VFUDSHUV 1RV DQG
Our No.
No.
HYDE TOOLS
696-1221
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - WOOD SCRAPER
BLADES
‡+($9<'87<
‡³60$57('*(´
‡('*(&$0%(5*5281'
5HSODFHPHQW EODGH IRU ) 2UJLOO
6.8 ) )( DQG DOO
VLPLODU ODUJH HGJH ZRRG VFUDSHUV
Our No.
No.
Blade
Size In.
Shf
Pk
Unit
&'
ALLWAY TOOLS INC
837-4555
%
Tile Products, Wallpaper Tools &
Home Decor
WALL SCRAPERS
WALL & MOLDING SCRAPERS
:LGHEODGHZLWKHUJRQRPLFKDQGOH
IRUKHDY\GXW\ZDOOJODVVWLOHDSSOLFDWLRQV 6OLGH RXW EODGH VWRUDJH
LQWKHKDQGOH,QFOXGHV%ODGH%L
0DWHULDOKDQGOHIRUFRPIRUW7KXPEUHFHVVSURYLGHVFRPIRUWDEOH OHYHUDJH SRLQW +DQJ +ROH IRU VWRUDJH 'HVLJQ
DOORZVIRUTXLFNDQGHDV\EODGHFKDQJHV
Our No.
Blade
Wdth In
No.
Shf
Pk
Unit
AMERICAN SAFETY RAZOR
156-0663
Blade
Size In
($
‡:$//675,33(5
‡$'-867$%/(+($'
‡³60$57('*(´
Shf
Pk
Unit
&'
ALLWAY TOOLS INC
%
Blade
Wdth In
No.
Shf
Pk
Unit
12” OA Length - Carded
:36
($
WALL SCRAPERS
5HSODFHPHQW EODGH IRU ) 2UJLOO
6.8 ) )( DQG DOO
VLPLODU PHGLXP VL]H HGJH ZRRG
VFUDSHUV
963-9113
Our No.
362-1919
‡('*(&$0%(5*5281'
No.
,QFOXGHV VQDSRQ EODGH JXDUG
/RFNVDQGXQORFNVZLWKRXWDVFUHZGULYHU$OXPLQXPKHDG
ALLWAY TOOLS INC
WOOD SCRAPER
BLADES
Our No.
WALLPAPER STRIPPER
$GMXVWDEOHKHDGIRUPXOWLSOHDWWDFN
angles is designed for either right
RU OHIW KDQGHG XVHUV DOORZV IRU
WZR KDQGHG XVH 6OLS 5HVLVWDQW %L 0DWHULDO KDQGOH ZLWK
UHFHVVHGWKXPEDUHDIRUFRPIRUWDQGFRQWURO%ODGHVWRUDJHLQKDQGOH,QFOXGHV%ODGHV
Our No.
WOOD SCRAPER
BLADES
WALLPAPER STRIPPER
REPLACEMENT BLADES
Blade
Wdth In
No.
Shf
Pk
‡81,9(56$/
)LWV ´ ZLGH ZDOO VWULSSHUV JODVV
DQGWLOHVFUDSHUVSHUFDUG
Our No.
No.
Blade
Wdth In
Unit
ALLWAY TOOLS INC
($
472-8705
Unit
&'
Carded
AMERICAN SAFETY RAZOR
851-3335
Shf
Pk
:6%
‡('*(&$0%(5*5281'
5HSODFHPHQW EODGH IRU ) 6.8
DQG)(
Our No.
No.
Blade
Size In.
Shf
Pk
Unit
&'
ALLWAY TOOLS INC
824-8205X
%
MOLDING SCRAPERS
Shf
Pk
Unit
HYDE TOOLS
696-1437
FLOOR SCRAPERS
No.
‡+($9<'87<
Shf
Pk
Unit
&'
HYDE TOOLS
8VHWRVFUDSHÀDWVXUIDFHVFUDFNV
DQG YDULRXV PROGLQJ FRQWRXUV
5XJJHG VWHHO EODGH KROGHU DQG
´/ WXEXODU PHWDO KDQGOH
with foam hand grip for durability
DQG FRPIRUW KLJKFDUERQ VWHHO
EODGHV LQFOXGLQJ D WULDQJOH ZLWK WKUHH ´ VFUDSLQJ
HGJHVDQGD´[´WHDUGURS
No.
FLOOR SCRAPERS & BLADES
2QH WULDQJXODU EODGH ZLWK WKUHH
´ VFUDSLQJ HGJHV 8VH WR UHSODFH EODGHV IRU +\GH 1R
VFUDSHU
Our No.
Our No.
Knives, Scrapers & Abrasives
MOLDING SCRAPER
BLADES
608-7316
Our No.
464-4829
‡67((/
FDUERQ VWHHO EODGHV SHU GLVSHQVHU 5HYHUVLEOH VKDUS EOXQW EODGHV )RU µ(UJR7HF %UXWH¶
DQG/LJKW'XW\6FUDSHUV
Our No.
No.
Shf
Pk
Unit
3.
016-6397
Shf
Pk
Unit
($
AMERICAN SAFETY RAZOR
884-9598
Unit
H
($
No.
Size
In
Shf
Pk
Unit
M-D BUILDING PRODUCTS
+HDY\GXW\FDUERQVWHHO)LWVZLGH
EODGH VFUDSHU WRRO DQG RWKHU ´
VFUDSHUWRROV
No.
Shf
Pk
,GHDOIRUVFUDSLQJÀRRUVZDOOVDQG
FRXQWHUWRSV &RPSOHWH ZLWK LQFKKDQGOH
Our No.
‡&$5%2167((/
Our No.
5%&
Size
In
FLOOR SCRAPERS
Lgth
In
UNGER INDUSTRIAL
676-2140
No.
HYDE TOOLS
SCRAPER BLADES
&'
WIDE SCRAPER
BLADES
'HVLJQHG WR VWDQG XS WR GDLO\
SURIHVVLRQDO XVH )RU KHDY\ GXW\
scraping and demolition applicaWLRQVWRUHPRYHZDOODQGÀRRUWLOH
OLQROHXP DQG FDUSHW DGKHVLYH
+LJK FDUERQ VWHHO EODGH 'XUDEOH GLH FDVW KHDG (DV\
EODGH FKDQJH 7ZR VLGHG EODGH LV DOVR UHVKDUSHQDEOH
´RYHUDOOOHQJWK
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
- Maintenance, Repair & Operations
FLOOR SCRAPERS
‡$'-867$%/(
+HDY\ GXW\ VFUDSHU UHPRYHV ROG
ÀRRULQJ RU ZDOOFRYHULQJ +LJK FDUERQUHSODFHDEOHVWHHOEODGH
Our No.
No.
Size
In
Shf
Pk
Unit
M-D BUILDING PRODUCTS
798-5054
FLOOR SCRAPER
BLADES
RAZOR BLADE
SCRAPERS
Floor scraper replacement blade
IRU6.8
‡5(75$&7$%/(
‡'(/8;(+($9<'87<
‡³$0(5,&$1/,1(´
Our No.
No.
Size
In
Shf
Pk
Unit
M-D BUILDING PRODUCTS
495-1042
($
$OOPHWDOZLWKEUDVVFDUULHUSRVLWLRQVZLWKVDIHVFUDSLQJVWRS&RQWRXUGHVLJQ
Our No.
($
Shf
Pk
No.
Unit
AMERICAN SAFETY RAZOR
With 5 Blades - Carded
547-7310
FLOOR SCRAPERS
No.
Blade
Wdth In.
‡08/7,3$.
‡³63<'(5´
Shf
Pk
Unit
M-D BUILDING PRODUCTS
924-2140
($
5HVKDUSHQDEOH EODGH )LWV DQ\
EUDQG RI UHFLSURFDWLQJ VDZ ,QFOXGHVEODGHV´EODGHIRUWRXJK
PDWHULDOV DQG SUHFLVLRQ VFUDSLQJFKLVHOLQJ ´ EODGH IRU
VHPLWRXJKPDWHULDOVDQGJHQHUDOVFUDSLQJDQG´EODGH
IRUVRIWPDWHULDOVDQGPD[LPXPYROXPHUHPRYDO
Our No.
No.
Shf
Pk
Unit
($
SIMPLE MAN PRODUCTS
241-1270
FLOOR SCRAPERS
$OXPLQXP FRQVWUXFWLRQ ZLWK HUJRQRPLFJULS
Knives, Scrapers & Abrasives
RAZOR SCRAPERS & BLADES
GLASS SCRAPERS
Our No.
No.
Lgth
In
Shf
Pk
Unit
UNGER INDUSTRIAL
167-8838
/+&
($
195-2373
Size
In
Shf
Pk
Unit
($
Unit
($
With 5 Blades - Carded
657-3174
Blade
Wdth In
Shf
Pk
Unit
($
($
For scraping in hard to reach placHV%ODGHVUHYHUVHIRUVDIHVWRUDJH
8VHV VWDQGDUG VLQJOH HGJH UD]RU
EODGHV /LJKWZHLJKW DQG HFRQRPLFDO SODVWLF :LWK RQH
EODGHRQDFDUG
5HPRYHV FRDWLQJV SDLQW DQG
stickers from glass, mirrors or
ZLQGVKLHOGV 5XJJHG SRO\SURS\Oene construction resists most paint
WKLQQHUV $FFHSWV VWDQGDUG VLQJOH
HGJHUD]RUEODGHV,QFOXGHVRQHEODGH
414-3889X
RAZOR BLADE
SCRAPERS
‡0,1,6,1*/(('*(
‡+,*+9,6,%,/,7<
Our No.
No.
O.A
Lgth. In.
Shf
Pk
Unit
($
STANLEY TOOLS
No.
Shf
Pk
Unit
($
HYDE TOOLS
CLIP STRIP ITEM
741-9062X
RAZOR BLADES
‡6,1*/(('*(
SAFETY SCRAPER
´WKLFNLQGXVWULDOTXDOLW\1HRQ
SODVWLF GLVSHQVHUV ,QFOXGHV SHU
pack
‡5(75$&7$%/(67((/
Size
In
Shf
Pk
Unit
($
HYDE TOOLS
420-5977
Our No.
8VHG IRU UHPRYDO RI ÀRRULQJ WLOH
DQG URR¿QJ 3DFN RI KDUGHQHG
FDUERQ VWHHO EODGHV 5HSODFHPHQW
EODGHIRU+\GHVFUDSHU1R
No.
Shf
Pk
No.
With 1 Blade - Carded
671-4471
‡:,7+%/$'(
FLOOR SCRAPER
BLADES
Our No.
5HPRYHVFRDWLQJVSDLQWDQGVWLFNHUVIURPJODVVPLUURUVRUZLQGVKLHOGV%ODGHKHOGRIIVHW
DWGHJUHHVWRHDVHVFUDSLQJDQGH[WUD¿UPFODPSKROGV
EODGHXQGHUVFUDSLQJSUHVVXUH%XLOWLQ´VDVKJXLGH
PDLQWDLQVSDLQWJODVVVHDO%ODGHWUDFNGHVLJQPLQLPL]HV
FORJVDQGJXPXSVIRUSRVLWLYHEODGHH[WHQVLRQDQGVDIH
UHWUDFWLRQ 5LEUHLQIRUFHG ERG\ FULPSHG DQG ZHOGHG WR
HOLPLQDWHEHQGLQJSLQFKLQJDQGVSUHDGLQJ/DUJHULEEHG
FRQWURO EXWWRQ DQG ORQJHU KDQGOH IRU VDIHW\ (UJRHQJLQHHUHG ¿WV ¿VW IRU EHWWHU JULS DQG FRQWURO /DUJH KDQJ
KROHIRUVWRUDJH
HYDE TOOLS
MINI GLASS SCRAPER
HYDE TOOLS
140-6271
No.
‡5(75$&7$%/(6,1*/(
('*(
‡+($9<'87<
‡³'(/7$´
HYDE TOOLS
8VHG IRU UHPRYDO RI ÀRRULQJ WLOH
DQGURR¿QJ+DUGHQHGFDUERQVWHHO
blade with two sharpened edges
IRU ORQJ OLIH &DQ EH UHVKDUSHQHG
5HSODFHPHQWEODGHIRU+\GH+DPPHU6FUDSHUV1RDQG
No.
($
RAZOR BLADE
SCRAPERS
Our No.
8VHWRUHPRYHFRDWLQJVSDLQWDQG
VWLFNHUV IURP ZLQGRZ JODVV 1R
WRROV UHTXLUHG WR UHSODFH EODGH
5XJJHG DFHWDO FRQVWUXFWLRQ UHVLVWV
PRVW SDLQW WKLQQHUV EODGH LQFOXGHG
Our No.
FLOOR SCRAPER
BLADES
Our No.
SCRAPER BLADE
ATTACHMENT
+HDY\ GXW\ VFUDSHUV UHPRYH ROG
ÀRRULQJ RU ZDOOFRYHULQJ 5HSODFHPHQW%ODGH6.8
Our No.
,QWHUPHGLDWH VDIHW\ EODGH SRVLWLRQ
keeps the blade from sliding out
ZKLOHLQXVH,QFOXGHVEODGHV
Our No.
Our No.
Shf
Pk
No.
Unit
ALLWAY TOOLS INC
719-4905
GS
Shf
Pk
Unit
&'
ALLWAY TOOLS INC
Twin Pack
313-3998
Carded
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
6(%
Maintenance, Repair & Operations - RAZOR BLADES
SANDING PADS
‡6,1*/(('*(
´ WKLFN LQGXVWULDO TXDOLW\
VWHHO 8VH LQ UD]RU EODGH VFUDSHUV
UD]RU NQLYHV ZDOOFRYHULQJ NQLYHV
DQG YLQ\O NQLYHV 2LOHG WR SUHYHQW
UXVWLQJ DQG LQGLYLGXDOO\ ZUDSSHG
IRUVDIHW\
Our No.
Our No.
Shf
Pk
No.
Unit
Type
Pad
No.
&'
RAZOR BLADES
Unit
Shf
Pk
Unit
3-2/3” x 9-1/4 - Pack of 2
3.
S
644-7346
253-2059
($
0HWDO)LQLVKLQJ
3.
805-1054
S
($
STRIPPING PAD TOOLS
‡+($9<'87<)25)/$7
685)$&(6
Our No.
No.
Grit
Shf
Pk
Unit
Pack of 2 - 3-2/3” x 5-3/4”
227-9354
($
Unit
With 10 Blades - Carded
Shf
Pk
Stripping
3M
STANLEY TOOLS
Grit
)RU SDLQW VWULSSLQJ WR UHPRYH ROG
FRDWLQJVVXFKDVSDLQWDQGYDUQLVK
OA
Lgth In
No.
No.
685-3410
‡)/(;,%/(
‡3$,17675,33,1*
‡³6$1'%/$67(5´
Steel-backed high carbon steel
EODGH ¿WV DOO VWDQGDUG UD]RU EODGH
WRROV 5HSODFHPHQW EODGHV IRU
6WDQOH\ DQG VFUDSHUV
Our No.
3M
SANDING PADS
‡6,1*/(('*(
613-3920X
Shf
Pk
For between coats to smooth surface after applying a coat such as
VWDLQ
4-1/2” x 11” - Carded
2 Pkg. of 5 - Carded
Our No.
‡%(7:((1&2$76
)/(;,%/(
‡³6$1'%/$67(5´
3M
HYDE TOOLS
657-3182
FINISHING PAD
)RUSDLQWRUYDUQLVKUHPRYDOPHWDO
¿QLVKLQJRUZRRG¿QLVKLQJ:LOOQRW
rust, splinter or shred like steel
ZRRO
S
($
Pack of 3 - 2-1/4” x 9-1/4”
480-3854
S
(DV\JULSUHXVDEOHKDQGOHDQGUHplaceable pad used with chemical
VWULSSHUV WR TXLFNO\ UHPRYH SDLQW
YDUQLVKHVDQGRWKHU¿QLVKHVZLWKRXW KDUPLQJ ZRRG 'HVLJQHG WR NHHS KDQGV IUHH IURP
chemicals, to allow application of greater pressure for
WRXJK MREV DQG WR DEVRUE UHVLGXH LQ WKH 1R UHSODFHDEOHSDG
Our No.
No.
Size
In
[[
Shf
Pk
Unit
3M
($
642-9856
($
RAZOR BLADES
‡6,1*/(('*(
352)(66,21$/
SANDING PADS
Our No.
Unit
MINTCRAFT
Boxed
750-8146
-/%'/
‡)25&859('685)$&(6
+($9<'87<
)RU EDUH VXUIDFHV WR OHYHO DQG
VPRRWKDQ\EDUHVXUIDFH
Shf
Pk
No.
STRIPPING PADS
‡%$5(685)$&(6)/(;,%/(
‡³6$1'%/$67(5´
)LWV DOO VWDQGDUG UD]RU EODGH WRROV
6.DOOR\VWHHOPPWKLFNQHVV
Our No.
&'
No.
Grit
Shf
Pk
Unit
3M
Pack of 2 - 3-2/3” x 5-3/4”
Knives, Scrapers & Abrasives
217-4183
HS
712-8549
S
995-0056
HS
Our No.
($
($
($
Pack of 3 - 2-1/4” x 9-1/4”
STRIPPING & FINISHING PADS
SANDING PADS
Size
In
[
Shf
Pk
Unit
,+.6
[
3.
‡)25&859('685)$&(6
+($9<'87<
FINISHING PAD
‡)/(;,%/(),1$/
),1,6+,1*
‡³6$1'%/$67(5´
Shf
Pk
Unit
3M
643-0680
Size
In
STRIPPING PADS
5HPRYHV EXEEOHV GXVW QLEV DQG
other blemishes for a super smooth
¿QLVK 5HSODFHV JUDGH VWHHO
wool, but will not shred or splinter
OLNHVWHHOZRRO
No.
No.
3M
643-0045
‡%(7:((1&2$76
),1,6+,1*
Our No.
8VH ZLWK FKHPLFDO SDLQW VWULSSHUV
WR UHPRYH SDLQW YDUQLVKHV DQG
RWKHU ¿QLVKHV ZLWKRXW KDUPLQJ
ZRRG:LOOQRWVSOLQWHURUVKUHGOLNH
VWHHOZRRO'HVLJQHGWREHÀH[LEOHIRUZRUNLQJRQFRQWRXUV5HSODFHDQGRXWSHUIRUPVWHHOZRRO
3.
(IIHFWLYHO\ UHPRYHV SDLQW UHVLGXH
ZLWKRXW KDUPLQJ ZRRG 5HSODFHV
JUDGH VWHHO ZRRO EXW ZLOO QRW
shred, splinter, or rust like steel
ZRRO
)RU¿QDO¿QLVKLQJWRVPRRWKDVXUIDFHSULRUWRDSSO\LQJD¿QDO¿QLVK
%DFNLQJLVKLJKO\FRQIRUPDEOHDQG
FRPIRUWDEOH
Our No.
No.
Grit
Our No.
Shf
Pk
Unit
643-0060
2-1/4” x 5-3/4” - Pack of 3
S
Size
In
Shf
Pk
Unit
[
3.
3M
3M
891-3246
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
STRIPPING PADS
STRIPPING SANDER
‡)25)/$7685)$&(6
+($9<'87<
‡0,&52=,3
‡³*$725´
8VH ZLWK FKHPLFDO SDLQW VWULSSHUV
WR UHPRYH SDLQW YDUQLVKHV DQG
RWKHU ¿QLVKHV ZLWKRXW KDUPLQJ
ZRRG:LOOQRWVSOLQWHURUVKUHGOLNH
VWHHO ZRRO 5HSODFHPHQW SDG IRU 1R KHDY\GXW\
VWULSSLQJWRRO
8VHWRUHPRYHRLOSDLQWVPRRWKLQJ
GU\ZDOO UH¿QLVKLQJ IXUQLWXUH ¿QH
wood working, boat and marine
craft, sanding chair rails, arts and
crafts, auto body work, sanding baseboards, cleaning up
ZHOGVVPRRWKLQJPHWDOV
Our No.
No.
Size
In
Shf
Pk
Unit
3M
642-9914
Our No.
No.
ALUMINUM STEP
STAND
Shf
Pk
Unit
3.
ALI INDUSTRIES
[[
3.
178-7274
‡7<3($'87<5$7,1*
‡(;75$+',1'8675,$/
/DUJH VWUXFWXUDO PROGHG WRS PHDVXUHV ´ ZLGH E\ ´ GHHS
'LDPRQG WUHDG IRU D VOLSUHVLVWDQW
SODWIRUP(DFKVWHSVHFXUHGZLWKVL[ODUJHKHDGHGVHPL
WXEXODUVWHHOULYHWV+HDY\GXW\VWHHOJXVVHWVWRVXSSRUW
ERWWRP VWHS 6WHSV DUH ´ ZLGH 0HHWV RU H[FHHGV WKH
VDIHW\VWDQGDUGVVHWE\$16,DQG26+$
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk Unit
LOUISVILLE LADDER, INC.
300 Pound Duty Rating
STRIPPING &
FINISHING PADS
STRIPPING SANDER
REFILLS
‡6<17+(7,&08/7,
685)$&(
‡³*$725´
‡³*$7250,&52=,3´
8VHG IRU VWULSSLQJ SDLQW DQG YDUnish and cleaning pots, pans, grills
DQGKRXVHKROGVXUIDFHV7REHXVHGZLWKFKHPLFDOVWULSSHUVDQGFOHDQHUV
Our No.
Shf
Pk
No.
Unit
285-4032
No.
Grit
Shf
Pk
Unit
3.
ALI INDUSTRIES
314-0050
$VVRUWHG
ALI INDUSTRIES
4-3/8” x 11” - Carded
271-3006
($
708-6630
($
Ladders & Scaffolding
STEP - ALUMINUM
ALUMINUM WORK
STAND
‡08/7,685)$&(6$1'(5
5(),//
‡³*$725=,3´
([WHUQDO SLQFKSURRI VSUHDGHUV IRU
HDV\ RSHQLQJ DQG FORVLQJ 'RXEOH
DQJOH EUDFLQJ RQ DOO VWHSV 0DU
resistant feet for slip-resistance on concrete, wood and
YLQ\O ÀRRUV 'RXEOH WRS VWHSV SURYLGH ZLGH SODWIRUP
Slip-resistant Traction-Tred Steps on front and rear secWLRQ([WUDZLGHIRUYHUVDWLOHXVHDVZRUNVWDQGVWDJHRU
PDWHULDOVXSSRUW/LJKWZHLJKWDQGSRUWDEOH+HDY\VWHHO
KLQJHV'LPHQVLRQVWRS´[´´ZLGHUDLOV´ZLGH
VWHSVDQG´ZLGHÀDQJH
Our No.
No.
Grit
Unit
338-7362
($
826-8310
($
448-9753
($
539-3772
$VVRUWHG
($
Our No.
STRIPPING &
FINISHING SANDER
,GHDO IRU VWULSSLQJ VDQGLQJ DQG
¿QLVKLQJ ,QFOXGHV WZR HDFK
JULW VKHHWV DQG GLDPRQGVKDSHVDQGHUTXLFNFKDQJHKRRSDQGORRSEDFNLQJ
UHXVDEOH 8VH RQ ZRRG PHWDO ¿EHUJODVV DQG SDLQWHG
VXUIDFHV
Grit
Shf
Pk
Unit
3.
ALI INDUSTRIES
743-6280
$VVRUWHG
Shf
Pk Unit
1
($
%ODFN PROGHG SODVWLF WRS SURYLGHV
ODUJH´ZLGH[´ORQJVWDQGLQJSODWIRUP7UDFWLRQ
7UHGVOLSUHVLVWDQWIXOOVL]HGVWHSV3LQFK3URRIVSUHDGHUV
%RWWRP VWHS KDV GRXEOH EUDFHV %OXH PROGHG YLQ\O IRRW
SDGV ULYHWV WR VLGH UDLOV 8/ /LVWHG 0HHWV $16, &RGH
DQG26+$6WDQGDUGV'LPHQVLRQV)URQW5DLOV´:LGH
5HDU5DLOV´:LGH7RS´[´6WHSV´ZLGH
673-9866
Lgth
Ft
%
1
($
Lgth
Ft
No.
Wdth/nIn
Shf
Pk Unit
300 Pound Duty Rating
828-9639
Wdth/nIn
Shf
Pk Unit
300 Pound Duty Rating
$6
Unit
6OLS UHVLVWDQW UXEEHU IHHW $OXPLnum angle feet with thick rubber
WUHDGRQDOOIRXUOHJVWRSURYLGHVXUHIRRWLQJ1RQFRQGXFWLYHVWUXFWXUDOPROGHGWRSZLWKUHFHVVHGWUD\/DUJHSDUWV
WUD\UHFHVVHG´GHHSZLWKWRROVORWV+HDY\GXW\VLGH
UDLOVDUHIXOOFKDQQHOH[WUXVLRQVRQWKHIURQWDQGPRGL¿HG
FKDQQHORQEDFNOHJV0HHWVRUH[FHHGVWKHVDIHW\VWDQGDUGVVHWE\$16,DQG26+$6WHSV´:LGH
LOUISVILLE LADDER, INC.
696-6014
Shf
Pk
‡7<3(,$$66(5,(6
‡,1'8675,$/
/,*+7:(,*+7
6OLS UHVLVWDQW UXEEHU IHHW $OXPLnum angle feet with thick rubber tread on all four legs
WRSURYLGHVXUHIRRWLQJ1RQFRQGXFWLYHVWUXFWXUDOPROGHG
WRS ZLWK UHFHVVHG WUD\ /DUJH SDUWV WUD\ UHFHVVHG ´
GHHSZLWKWRROVORWV+HDY\GXW\VLGHUDLOVDUHIXOOFKDQQHOH[WUXVLRQVRQWKHIURQWDQGPRGL¿HGFKDQQHORQEDFN
OHJV0HHWVRUH[FHHGVWKHVDIHW\VWDQGDUVVHWE\$16,
DQG26+$6WHSV´:LGH
No.
Wdth/nIn
LOUISVILLE LADDER, INC.
‡)2/',1*7<3(,$
$66(5,(6
‡/,*+7:(,*+7
,1'8675,$/
Our No.
Size
In
No.
ALUMINUM
STEPLADDERS
Our No.
ALUMINUM STEP
STAND
‡08/7,685)$&(
‡³*$725=,3´
No.
Wdth/
nIn
300 Pound Duty Rating
7:
($
300 Pound Duty Rating
WERNER CO
496-5182
Our No.
Lgth
Ft
No.
1
WERNER CO
‡3257$%/(7:6(5,(6
‡7<3(,$'87<5$7,1*
ALI INDUSTRIES
‡+($9<'87<,1'8675,$/
*5$'(7<3(,$
‡³&5$)70$67(50,*+7<
/,7(´
Our No.
STRIPPING &
FINISHING PADS
Shf
Pk
ALUMINUM STEP
STOOL
5H¿OO VKHHWV FRQWDLQV VKHHWV
JULW 8VH ZLWK 6NX
Our No.
$<
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
$6
1
($
Maintenance, Repair & Operations - ALUMINUM
STEPLADDERS
ALUMINUM
STEPLADDERS
FIBERGLASS
STEPLADDERS
‡+',1'8675,$/7<3(,
$66(5,(6
‡/,*+7:(,*+7
‡7<3(,'87<5$7,1*
6(5,(6
‡(;75$+($9<'87<7<3(
,$
‡121&21'8&7,9()6
6(5,(6
6OLS UHVLVWDQW UXEEHU IHHW $OXPLnum angle feet with thick rubber
WUHDG RQ DOO IRXU OHJV WR SURYLGH VXUH IRRWLQJ ,QFOXGHV
352723DQRQFRQGXFWLYHZRUNWUD\PROGHGFRSRO\PHU
ZLWK SUDFWLFDO KDQG\PDQ WRRO VORWV +HDY\GXW\ SODWHG
VWHHOVSUHDGHUEUDFHVZLWKGRXEOHULYHWKLQJHWRSURWHFW
XVHU IURP SLQFKHG ¿QJHUV 0DQXDO FORVLQJ VWUXFWXUDO
PROGHGSDLOVKHOI6NLGUHVLVWDQWVXUIDFHDQGRXWHUUHWDLQLQJ HGJH SURYLGH DGGLWLRQDO IHDWXUHV 0HHWV RU H[FHHGV
WKH VDIHW\ VWDQGDUGV VHW E\ $16, DQG 26+$ 6WHSV ´
ZLGH
Our No.
Lgth
Ft
No.
Wdth
In
Shf
Pk Unit
LOUISVILLE LADDER, INC.
250 Pound Duty Rating
301-7993
$6
1
($
614-3408
$6
1
($
942-7683
$6
1
($
1RQFRQGXFWLYH PROGHG WRS ZLWK
DXWRPDWLF RSHQLQJ SDLO VKHOI 6OLS
UHVLVWDQW UXEEHU IHHW $OXPLQXP DQJOH IHHW ZLWK WKLFN
UXEEHU WUHDG RQ DOO IRXU OHJV WR SURYLGH VXUH IRRWLQJ
+HDY\GXW\ SODWHG VWHHO VSUHDGHU EUDFHV ZLWK GRXEOH
ULYHWKLQJHWRSURWHFWXVHUIURPSLQFKHG¿QJHUV0HHWV
RUH[FHHGVWKHVDIHW\VWDQGDUGVVHWE\$16,DQG26+$
6WHS´ZLGH
Our No.
No.
Lgth
Ft
No.
Shf
Pk Unit
250 Pound Load Capacity
623-3753
1
($
623-5220
1
($
625-2969
1
($
1
($
‡+($9<'87<,1'8675,$/
*5$'(7<3(,$
‡6(5,(6
1
($
015-1332
)6
1
($
630-3895
)6
1
($
6SLOO3URRISDLOVKHOIZLWKUDJUDFN
8QLTXH + VSUHDGHU ZLWK KDQGJULS
RQ¶¶DQG¶PRGHOV%ODFNPROGHG7RRO7UDWRS3LQFKOHVVRXWVLGHVSUHDGHUVRQ¶¶¶DQG¶PRGHOV'RXEOH
DQJOHEUDFLQJRQERWWRPVWHS%ODFNPROGHGYLQ\OVKRH
SDGVULYHWHGWRDOXPLQXPIRRWEUDFNHW8//LVWHG0HHWV
$16,&RGHDQG26+$UHTXLUHPHQWV'LPHQVLRQV)URQW
5DLOV´ZLGH)URQW)ODQJH´ZLGH5HDU5DLOV´
ZLGH 5HDU )ODQJH ´ ZLGH 7RS ´ ZLGH [ ´
ORQJ6WHSV´ZLGH
644-9367
)6
1
($
094-4124
)6
1
($
Our No.
No.
Wdth/nIn
Shf
Pk
Unit
1
($
1
($
628-8427
1
($
628-7254
1
($
629-8871
1
($
1
($
628-8401
1
($
628-8419
683-7082
$6
1
($
970-9049
$6
1
($
7,.
ALUMINUM
STEPLADDERS
Ladders & Scaffolding
Unit
‡121&21'8&7,9(
‡+',1'8675,$/7<3(
)66(5,(6
,QFOXGHV 352723 D QRQFRQGXFWLYH ZRUN WUD\ PROGHG FRSRO\PHU
ZLWK SUDFWLFDO KDQG\PDQ WRRO VORWV +HDY\GXW\ SODWHG
VWHHOVSUHDGHUEUDFHVZLWKGRXEOHULYHWKLQJHWRSURWHFW
XVHUIURPSLQFKHG¿QJHUV6OLSUHVLVWDQWUXEEHUIHHW$OXminum angle feet with thick rubber thread on all four
OHJVWRSURYLGHVXUHIRRWLQJ'RXEOH5LYHWVWHSFRQVWUXFWLRQ (DFK VWHS VHFXUHG ZLWK VL[ ODUJH KHDGHG VHPL
WXEXODUVWHHOULYHWVIRUPD[LPXPVWUHQJWK6NLGUHVLVWDQW
VXUIDFHDQGRXWHUUHWDLQLQJHGJH0HHWVRUH[FHHGVWKH
VDIHW\VWDQGDUGVVHWE\$16,DQG26+$6WHSV´ZLGH
Lgth
Ft
1
($
096-7075
)6
1
($
850-5331
)6
1
($
552-2081
)6
1
($
Wdth/nIn
Shf
Pk
Unit
250 Pound Duty Rating
1
($
634-6415
1
($
634-6522
1
($
Unit
)6
WERNER CO
673-9858
Shf
Pk
617-8826
0ROGHGWRSSURYLGHVODUJHVWDQGLQJ
SODWIRUP 6OLSUHVLVWDQW WUDFWLRQWUHG VWHSV 3ODWHG VWHHO
EUDFHV RQ ERWWRP VWHSV &RPELQDWLRQV UDLO HQG VKLHOG
DQGIRRWZLWKVOLSUHVLVWDQWIRRWSDG([WHUQDOSLQFKSURRI
VSUHDGHUV 'LPHQVLRQV´ [´WRS´VWHSV
´ZLGHIURQWUDLOV´ZLGHIURQWÀDQJH´
ZLGHUHDUUDLOV´ZLGHDQG´ZLGHLQIURQW
No.
Wdth/nIn
250 Pound Duty Rating
‡+($9<'87<,1'8675,$/
*5$'(7<3(,
‡121&21'8&7,9(
6(5,(6
Our No.
Lgth
Ft
No.
LOUISVILLE LADDER, INC.
FIBERGLASS STEP
STOOL
+HDY\ GXW\ H[WUXGHG 7RRO7UD WRS
)RXU VROLG ´ ULYHWV DWWDFK WRS WR IURQW UDLOV RQ HDFK
VLGH´VKRXOGHUEROWDQGORFNQXWRQWRSKLQJH0DVVLYH´WKLFNVLGHSODWHV2XWVLGHVSUHDGHUVRQ¶¶
DQG¶PRGHOV,QVLGHVSUHDGHUVRQ¶DQGDERYHPRGHOV
5HDUKRUL]RQWDOVDUHVSDFHG´DSDUWZLWKNQHHEUDFLQJ
ZKLFK LV PRXQWHG RQ IXOO 8FKDQQHO UHDU UDLOV +HDY\
GXW\ EODFN VOLSUHVLVWDQW IHHW 7UDFWLRQ7UHG GHHSO\ VHUUDWHGVWHSV8//LVWHG0HHWV$16,&RGHDQG26+$UHTXLUHPHQWV'LPHQVLRQV)URQW5DLOV´ZLGH)URQW
)ODQJH´ZLGH5HDU5DLOV´ZLGH5HDU)ODQJH
´ZLGH7RS´ZLGH[´ORQJ6WHSV´ZLGH5HQWDO
FIBERGLASS
STEPLADDERS
Our No.
STEP - FIBERGLASS
‡(;75$+($9<'87<
,1'8675,$/*5$'(7<3(
,$$
‡6(5,(6
,.6
Lgth
Ft
673-9817
300 Pound Duty Rating
)6
$6
375 Pound Duty Rating
Unit
817-0029
$6
WERNER CO
Shf
Pk
)6
073-0648
Wdth/nIn
Wdth/nIn
221-8329
300 Pound Duty Rating
Shf
Pk
Lgth
Ft
No.
ALUMINUM
STEPLADDERS
887-4174
No.
Unit
WERNER CO
225 Pound Duty Rating
Our No.
Shf
Pk
WERNER CO
LOUISVILLE LADDER, INC.
Lgth
Ft
Wdth/nIn
LOUISVILLE LADDER, INC.
‡7<3(,,$66(5,(6
‡,1'8675,$/
/,*+7:(,*+7
Wdth
In
Our No.
(TXLSSHGZLWK'$%227DQGPROGHG WRS ZLWK WRRO VORWV 3RO\SURS\OHQH FRSRO\PHU XSSHU
ERRWSURYLGHVVWUHQJWKGXUDELOLW\DQG¿EHUJODVVUDLOVXUIDFHSURWHFWLRQ7KLFNQRQPDUULQJWKHUPRSODVWLFHODVWRmer tread is bonded and mechanically fastened to the
XSSHUERRWDQGSURYLGHVDVOLSUHVLVWDQWIRRWLQJ1RQFRQGXFWLYHVWUXFWXUDOPROGHGWRSSURYLGHVJUHDWHULPSDFWUHVLVWDQFH6SUHDGHUEUDFHULQVLGH¿EHUJODVVUDLOVKHOSNHHS
EUDFHVIURPJHWWLQJKRRNHGRUDEXVHGLQWUDQVLW'RXEOH
ULYHWVWHSFRQVWUXFWLRQ(DFKVWHSVHFXUHGZLWKVL[ODUJH
KHDGHGVHPLWXEXODUVWHHOULYHWVIRUPD[LPXPVWUHQJWK
9HUWLFDOO\PRXQWHG8VKDSHGEDFNEUDFHVVSDFHGRQRQH
IRRW LQWHUYDOV SURYLGH PD[LPXP VWLIIQHVV DQG GLVFRXUDJH XQVDIH FOLPELQJ 1RQFRQGXFWLYH IXOO FKDQQHO UDLOV
DUHFRQYHUHGZLWKDSRO\HVWHUYHLO0HHWVRUH[FHHGVWKH
VDIHW\VWDQGDUGVVHWE\$16,DQG26+$6WHSV´ZLGH
Our No.
ALUMINUM
STEPLADDERS
Lgth
Ft
6SLOO3URRI SDLO VKHOI ZLWK UDJ UDLO
DQG WRRO KROGHUV ¶ DQG DERYH
%OXH PROGHG 7RRO7UD WRS VORWWHG
IRUSDLQWUROOHUWUD\+DQG\EXFNHWKROGHUFOLS3LQFK3URRI
VSUHDGHUV %RWWRP DQG WRS VWHSV EUDFHG 6OLSUHVLVWDQW
WUHDGRQVWHSV6OLSUHVLVWDQWPROGHGVKRHV+LVWUHQJWK
KHDW WHPSHUHG KHDY\ GXW\ DOXPLQXP 8/ /LVWHG 0HHWV
$16, &RGH DQG 26+$ UHTXLUHPHQWV 'LPHQVLRQV ´:
IURQWUDLOV´:IURQWÀDQJH´:UHDUUDLOV´:
UHDUÀDQJH´:[´/WRS´:VWHSV
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
FIBERGLASS
STEPLADDERS
FIBERGLASS
STEPLADDERS
FIBERGLASS
STEPLADDERS
‡121&21'8&7,9(
&200(5&,$/
‡7<3(,,)66(5,(6
‡(;75$+($9<'87<
,1'8675,$/*5$'(7<3(
,$
‡121&21'8&7,9(
6(5,(6
‡5(17$/
‡(;75$+($9<'87<
,1'8675,$/*5$'(7<3(
,$$
‡6(5,(6
0ROGHG WRS ZLWK KDQG\PDQ¶V WRRO
VORWV 1RQFRQGXFWLYH VWUXFWXUDO
PROGHGWRSSURYLGHVJUHDWHULPSDFWUHVLVWDQFH0ROGHG
LQVORWVKHOSNHHSWRROVFORVHDWKDQG6OLSUHVLVWDQWUXEEHUIHHW$OXPLQXPDQJOHIHHWZLWKWKLFNUXEEHUWKUHDG
RQ DOO IRXU OHJV WR SURYLGH VXUH IRRWLQJ 3LQFK UHVLVWDQW
VSUHDGHUEUDFHV+HDY\GXW\SODWHGVWHHOVSUHDGHUEUDFHV ZLWK GRXEOH ULYHW KLQJH WR SURWHFW XVHU IURP SLQFHG
¿QJHUV 0HHWV RU H[FHHG WKH VDIHW\ VWDQGDUGV VHW E\
$16,DQG26+$
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk
Unit
LOUISVILLE LADDER, INC.
225 Pound Duty Rating
262-3080
)6
1
($
174-8060
)6
1
($
230-8633
)6
1
($
Holster Top with lock-in accessory system secures tools
IURP IDOOLQJ ,QWHUQDO VWHHO VSUHDGHUV SURWHFW DJDLQVW
DEXVH VWRUDJH DQG WUDQVSRUW GDPDJH 'RXEOH ULYHWHG
DOXPLQXP VWHSV DUH GHHSO\ VHUUDWHG IRU VOLSUHVLVWDQFH
$OXPLQXP EUDFHV RQ WRS DQG ERWWRP VWHSV DQG UHDU
KRUL]RQWDOV &RPELQDWLRQ UDLO HQG VKLHOG DQG VKRH ZLWK
H[WUXGHG UXEEHU VOLSUHVLVWDQW IRRW SDG 6KRFNUHVLVWDQW
EXPSHUVEHWZHHQUDLOVDYRLGZHDUDQGGDPDJHLQVWRUDJH DQG WUDQVSRUW 2UDQJH ¿EHUJODVV VLGH UDLOV ZLWK
non-irritating fabric outer mat assures a smooth troubleIUHH VXUIDFH HYHQ DIWHU ZHDWKHULQJ 8/ /LVWHG 0HHWV
$16, $16, DQG 26+$ 6WDQGDUGV 'LPHQVLRQV )URQW
5DLOV´ZLGH)URQW)ODQJH´ZLGH5HDU5DLOV
´ZLGH5HDU)ODQJH´ZLGH7RS´[´
6WHSV´ZLGH5HQWDO
Our No.
No.
Lgth
Ft
Wdth/nIn
Shf
Pk
Unit
+HDY\JDXJH7RRO7UD7RS%DFNXS
SODWHV UHLQIRUFH DOO WRS FRQQHFWRUV 6OLSUHVLVWDQW 7UDFWLRQ7UHGVWHSVDUHGRXEOHULYHWHGDQGNQHHEUDFHG6KRH
SDGV ULYHWHG WR WKH HGJH VWUXFWXUH $OXPLQXP H[WHUQDO
UDLO VKLHOG KHOSV SURWHFW DJDLQVW DEUDVLRQ GDPDJH 7KH
HGJHEUDFLQJV\VWHPKHOSVWRGHFUHDVHGDPDJHWRUDLO
*ODV0DUNYLRODWRUVWULSVRQUDLOVDOORZODGGHUWREHPRUH
YLVLEOH)XOOVHWRIUHDUKRUL]RQWDOVDUHNQHHEUDFHGDQG
VSDFHGRQHSHUIRRW([WUDKHDY\GXW\LQWHUQDOVSUHDGHUV 6KRXOGHU EROW DQG ORFN QXW RQ WRSH KLQJH VROLG
DOXPLQXPULYHWVDWWDFKWRSWRHDFKIURQWUDLO(YHU\ULYHW
EDFNHGXSE\PHWDOSDUWRUZDVKHUWRSURWHFWUDLOV'LPHQVLRQV )URQW UDLOV ´ ZLGH IURQW ÀDQJH ´
ZLGHUHDUUDLOV´ZLGHUHDUÀDQJH´ZLGHWRS
´ZLGH[´ORQJVWHSV´ZLGH0HHWV$16,
DQG26+$6WDQGDUGV
Our No.
Holster Top with lock-in accessory
V\VWHPVHFXUHVWRROVIURPIDOOLQJ)URQWRIODGGHUWRSLV
VORWWHG IRU SDLQW UROOHU WUD\ 6WXUG\ PROGHG KDQJHU FOLS
XQGHUQHDWK WRS KROGV SDLQW FDQ 3LQFK3URRI RXWVLGH
VWHHOVSUHDGHUV$OXPLQXPVWHSVDUHGHHSO\VHUUDWHGIRU
VOLSUHVLVWDQFH 3ODWHG VWHHO EUDFHV RQ WRS DQG ERWWRP
VWHSV DQG UHDU KRUL]RQWDOV 5LEEHG VOLSUHVLVWDQW UXEEHU
IRRWSDGVSURWHFWHGE\DOXPLQXPVKRH6KRFNUHVLVWDQW
EXPSHU SDG RQ LQVLGH UHDU IRRWSDGV DYRLGV ZHDU DQG
GDPDJH LQ VWRUDJH DQG WUDQVSRUW %OXH QRQFRQGXFWLYH
siderails and yellow top with a non-irritating fabric outer
PDW DVVXUHV D VPRRWK WURXEOHIUHH VXUIDFH HYHQ DIWHU
ZHDWKHULQJ0HHWV$16,&RGHDQG26+$6WDQGDUGV'LPHQVLRQV)URQW5DLOV´ZLGH)URQW)ODQJH´
5HDU 5DLOV ´ ZLGH 5HDU )ODQJH ´ ZLGH DQG
´ZLGHLQWKHIURQW7RS´[´6WHSV´
Our No.
No.
Lgth
Ft
Wdth/nIn
Shf
Pk
Unit
WERNER CO
250 Pound Duty Rating
681-7712
1
($
635-5150
1
($
Shf
Pk
Unit
375 Pound Duty Rating
300 Pound Duty Rating
‡+($9<'87<,1'8675,$/
*5$'(7<3(,
‡121&21'8&7,9(
6(5,(6
Wdth/nIn
WERNER CO
WERNER CO
FIBERGLASS
STEPLADDERS
Lgth
Ft
No.
1
($
673-9841
1
($
695-7930
1
($
696-3243
1
($
634-7033
1
($
635-6364
1
($
659-7660
1
($
659-7520
1
($
‡(;75$+($9<'87<
,1'8675,$/*5$'(7<3(
,$$
‡6(5,(6
([WUXGHG KHDY\ JDXJH DOXPLQXP
7RRO7UD WRS 7UDFWLRQ7UHG GHHSO\ VHUUDWHG DOXPLQXP
VWHSVGRXEOHULYHWHG+HDY\GXW\´LQVLGHSODWHGVWHHO
VSUHDGHU EDUV 2SWLRQDO EODFN SDLO VKHOI NLW 0RGHO 1R
&RPELQDWLRQUDLOHQGVKLHOGDQGVKRHZLWKH[WUXGHG
UXEEHU VOLSUHVLVWDQW IRRW SDG 0DVVLYH ´ WKLFN VLGH
SODWHV)RXUVROLG´DOXPLQXPULYHWVDWWDFKWRSWRIURQW
UDLO´VKRXOGHUEROWDQGORFNQXWRQWRSKLQJH(YHU\
ULYHWEDFNHGXSE\PHWDOSDUWRUZDVKHUWRSURWHFW¿EHUJODVV 8FKDQQHO GRXEOH EUDFHV RQ ERWWRP VWHS <HOORZ
¿EHUJODVVVLGHUDLOVZLWKQRQLUULWDWLQJIDEULFRXWHUPDW
DVVXUHVDVPRRWKWURXEOHIUHHVXUIDFHHYHQDIWHUZHDWKHULQJ8//LVWHG0HHWV$16,&RGHDQG26+$UHTXLUHPHQWV'LPHQVLRQV)URQWUDLOV´ZLGH)URQWÀDQJH
´ ZLGH 7RS ´: [ ´/ VWHSV ´ ZLGH
5HDUUDLOV´ZLGH5HDUÀDQJH
No.
Lgth
Ft
Wdth/nIn
FIBERGLASS
STEPLADDERS
‡2/'%/8(6(5,(6
‡7<3(,$$
‡³(/(&75,&,$1¶6
-2%67$7,21´
FIBERGLASS
STEPLADDERS
Our No.
695-7922
Shf
Pk
Unit
WERNER CO
375 Pound Duty Rating
634-6597
1
($
634-6795
1
($
&XVWRPL]HG+ROVWHU7RSZLWKORFNLQ
DFFHVVRU\V\VWHPVHFXUHVWRROVIURPIDOOLQJ&RQYHQLHQW
FRQGXLWFXWWLQJV\VWHP%XLOWLQZLUHVSRROKROGHUVDOORZ
IRUHYHQSXOOLQJIURPERWKODUJHDQGVPDOOVSRROV5XJJHGSURIHVVLRQDOJUDGHEUDFLQJ7RRO/DVVRLQFOXGHG'LPHQVLRQVWRS´[´ZLGHIURQWUDLOV´ZLGH
ÀDQJH´ZLGHVWHSV´ZLGHDQGUHDUUDLOV´
ZLGH
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk Unit
WERNER CO
375 Pound Duty Rating
859-0606
2%(/
1
($
FIBERGLASS
STEPLADDERS
‡2/'%/8(6(5,(6
‡7<3(,$$
‡³&2175$&725¶6
-2%67$7,21´
&XVWRPL]HG+ROVWHU7RSZLWKORFNLQ
DFFHVVRU\ V\VWHP VHFXUHV WRROV IURP IDOOLQJ ,QWHJUDWHG
7RRO/DVVR V\VWHP VHFXUHV WRROV IURP IDOOLQJ 0XOWL8VH
KRRN IRU KDQJLQJ WRROV DQG EXFNHWV 5XJJHG SURIHVVLRQDO JUDGH EUDFLQJ 7RRO/DVVR LQFOXGHG ,QFOXGHV D
WDSHPHDVXUHKROGHU7RRO/DVVRVRFNHWVVFUHZGULYHU
VORWV0DJQD*ULSPDJQHWLFWRROKROGHUDQGDGULOORUKDPPHUKROGHU'LPHQVLRQVWRS´[´ZLGHIURQWUDLOV
´ZLGHÀDQJH´ZLGHVWHSV´ZLGHDQGUHDU
UDLOV´ZLGH
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk Unit
WERNER CO
375 Pound Duty Rating
058-0126
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
2%&1
1
($
Maintenance, Repair & Operations - Ladders & Scaffolding
FIBERGLASS TRIPOD
LADDERS
‡(;75$+',1'8675,$/
7<3(,$
ALUMINUM STEP
STOOL
1RQFRQGXFWLYH ,QFOXGHV VWHHO
reinforced outrigger, center-pull
spreader brace, outrigger rail
EUDFNHWVGRXEOHULYHWVWHSFRQVWUXFWLRQKHDY\GXW\VWHHO
JXVVHW EUDFLQJ DQG IXOO PHWDO ERRW 0HHWV RU H[FHHGV
WKH VDIHW\ VWDQGDUGV VHW E\ $16, DQG 26+$ ´ VWHSV
'LPHQVLRQV´[´WRS´[´IURQWUDLOV
´VTXDUH
‡7<3(,$(;75$+($9<
'87<
‡&200(5&,$/5$7,1*
‡³:25/'¶6*($7(67´
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk
Unit
LOUISVILLE LADDER, INC.
300 Pound Duty Rating
058-8442
)7
FOLDING STEP STOOLS
UTILITY/FOLDING STEP STOOLS
1
($
‡67(367((/
‡+286(+2/''87<5$7,1*
‡352)(66,21$/
/LJKWZHLJKWDOXPLQXPIUDPHWKUHH
ODUJH KHDY\ GXW\ LQMHFWLRQ PROGHG SRO\SURS\OHQH UHVLQ
VWHSV ([WUDODUJH [ WRS SODWIRUP VWHS
([WHQGHG KDQG ZLWK VHFXULW\ ORFN (DV\ RQH KDQG IROG
/DUJHQRQPDUULQJVNLGUHVLVWDQWVWDELOL]LQJIHHWSURWHFW
ÀRRU VXUIDFHV 'HOX[H PROGHG XWLOLW\ WUD\ IHDWXUHV 5HFHVVHGDUHDVIRUSDLQWFDQVWRROVGULOOKROGHUHWF7ZR
ORFNLQJGUDZHUVIRUVPDOOSDUWV0HHWV$16,6WDQGDUGV
´+[´:[´'
Our No.
Shf
Pk
No.
'XUDZKLWH SRZGHU FRDWHG ¿QLVK
6WXUG\ WXEXODU VWHHO IUDPH 1RQ
VOLS VWHS VXUIDFH )ROGV IRU HDV\
VWRUDJH/LJKWZHLJKWHDV\WRFDUU\+LJKHVWVWDQGLQJ
´6WHSVL]H´/[´:2SHQVL]H´+[
´ : [ ´ ' &ORVH VL]H ´ + [ ´ :
[´'
Our No.
Unit
($
‡(;75$+',1'8675,$/
7<3(,$
‡)06(5,(6
1RQFRQGXFWLYH'$%227DSRO\propylene copolymer upper boot
SURYLGHV VWUHQJWK GXUDELOLW\ DQG ¿EHUJODVV UDLO VXUIDFH
SURWHFWLRQ+HDY\JDXJHVWHHOKLQJHV5HLQIRUFHGERWWRP
VWHS,QVLGHVSUHDGHUEUDFHV)XOOFKDQQHO¿EHUJODVVUDLO
0HHWVRUH[FHHGVWKHVDIHW\VWDQGDUGVVHWE\$16,DQG
26+$'LPHQVLRQV´[´WRS´[´VWHSV
´[´UDLOVDQGÀDQJH´[´
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk Unit
LOUISVILLE LADDER, INC.
)0
1
($
‡67(367((/
‡+286(+2/''87<5$7,1*
‡352)(66,21$/
'XUDZKLWH SRZGHU FRDWHG ¿QLVK
6WXUG\ WXEXODU VWHHO IUDPH 1RQ
VOLS VWHS VXUIDFH )ROGV IRU HDV\
VWRUDJH /LJKWZHLJKW HDV\ WR FDUU\ +LJKHVW VWDQGLQJ
´6WHSVL]H´/[´:7UD\VL]H´/[
´:2SHQVL]H´+[´:[´'
&ORVHVL]H´+[´:[´'
010-3887
)0
1
($
Our No.
No.
Color
Shf
Pk
Unit
MINTCRAFT
200 Pound Working Load Limit
182-7856
<&7(1/
:KLWH
:KLWH
($
Ladders & Scaffolding
ALUMINUM EXTENSION
LADDERS
‡&200(5&,$/7<3(,,
‡$(6(5,(6
FOLDING STEP STOOLS
300 Pound Duty Rating
537-5555
<&/
EXTENSION - ALUMINUM
1
$%/
Unit
200 Pound Working Load Limit
182-2634
300 Pound Duty Rating
309-3176
Shf
Pk
Color
MINTCRAFT
COSCO PRODUCTS
FIBERGLASS TWIN
STEPLADDERS
No.
($
48,&./$7&+ HTXLSSHG UXQJORFN
SURYLGHVHDVLHUPHWKRGRIVHFXULQJ
À\ EDVH VHFWLRQV ZKHQ H[WHQGHG
+HDY\GXW\ SODWHG VWHHO VZLYHO VDIHW\ VKRHV ZLWK WKLFN
UXEEHU WUHDG 6KRH FDQ EH XVHG ZLWK WUHDG GRZQ RU LQ
VSLNH SRVLWLRQ 7HPSHUHG VHUUDWHG DOXPLQXP 'VKDSHG
UXQJV SURYLGH IRU D VOLSUHVLVWDQW VXUIDFH 6LGH UDLOV DUH
IXOO ´ H[WUXVLRQV VKDSHG LQWR D PRGL¿HG ,EHDP IRU
VWUHQJWKDQGOLJKWZHLJKW,QWHUORFNLQJUDLOVNHHSÀ\DQG
EDVHVHFWLRQVIURPFRPLQJDSDUW0HHWVRUH[FHHGVWKH
VDIHW\VWDQGDUGVVHWE\$16,DQG26+$'LPHQVLRQV´
UDLOGHSWK´VWDFNKHLJKW´EDVHLQVLGH
´ À\ LQVLGH ´ EDVH RXWVLGH DQG ´ À\
RXWVLGH$(GRHVQRWLQFOXGHURSHSXOOH\
Our No.
Max
Total Lgth Work’g
Sects Ft
L.Ft.
No.
Shf
Pk Unit
LOUISVILLE LADDER, INC.
225 Pound Duty Rating
FIBERGLASS TWIN
STEPLADDERS
1
($
‡+($9<'87<,1'8675,$/
*5$'(7<3(
‡121&21'8&7,9(7
6(5,(6
FOLDING STEP STOOLS
776-6363
$(3*
1
($
‡67(367((/
‡+286(+2/''87<5$7,1*
‡352)(66,21$/
718-1357
$(3*
1
($
030-2752
$(3*
1
($
%DFNXSDOXPLQXPSODWHVUHLQIRUFH
DOO WRS FRQQHFWRUV %UDFHV RQ WRS DQG ERWWRP VWHSV
&RPELQDWLRQ UDLO HQG VKLHOG DQG IRRW ZLWK VOLSUHVLVWDQW
IRRW SDG 5XEEHU VWHS EXPSHUV WR UHVLVW GDPDJH 6OLS
UHVLVWDQW WUDFWLRQWUHG VWHSV RQ IURQW DQG UHDU VHFWLRQV
([WHUQDO 3LQFK3URRI VSUHDGHUV 7RRO7UD7RS ZLWK GXDO
GULOOKROVWHUWRRODQGVPDOOSDUWVWUD\(YHU\ULYHWEDFNHG
XSE\PHWDOSDUWRUZDVKHUWRSURWHFWUDLOV'LPHQVLRQV
7RS ´ [ ´ 6WHSV ´ ZLGH 5DLOV ´ ZLGH
)ODQJH´ZLGH
'XUDZKLWH SRZGHU FRDWHG ¿QLVK
6WXUG\ WXEXODU VWHHO IUDPH 1RQ
VOLS VWHS VXUIDFH )ROGV IRU HDV\
VWRUDJH /LJKWZHLJKW HDV\ WR FDUU\ +LJKHVW VWDQGLQJ
´ 6WHS VL]H ´ / ; ´ : 2SHQ VL]H ´
+;´:[´'&ORVHVL]H´+[´:
[´'
107-3725
$(3*
1
($
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk
7
1
($
Color
Unit
200 Pound Working Load Limit
182-5843
250 Pound Duty Rating
No.
MINTCRAFT
Unit
WERNER CO
629-5240
Our No.
Shf
Pk
<&/
:KLWH
($
657-4917
$(3*
ALUMINUM EXTENSION
LADDERS
‡+286(+2/'7<3(,,,
‡/6(5,(6
7HPSHUHG VHUUDWHG DOXPLQXP '
VKDSHG UXQJV SURYLGH IRU D VOLS
UHVLVWDQW VXUIDFH ,PSDFW UHVLVWDQW
FDSV RQ DOO UDLO HQGV SURYLGH UDLO SURWHFWLRQ IRU ORQJHU
OLIH DQG SURWHFW ZRUN VXUIDFHV IURP PDUULQJ 0HHWV RU
H[FHHGVWKHVDIHW\VWDQGDUGVVHWE\$16,DQG26+$'LPHQVLRQV´UDLOGHSWK´EDVHLQVLGH´
À\LQVLGH´EDVHRXWVLGHDQG´À\RXWVLGH
Our No.
Max
Total Lgth Work’g
Sects Ft
L. Ft.
No.
Shf
Pk Unit
LOUISVILLE LADDER, INC.
200 Pound Duty Rating
028-1972
/
1
($
397-7998
/
1
($
920-7978
/
1
($
270-0896
/
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
ALUMINUM EXTENSION
LADDERS
ALUMINUM EXTENSION
LADDERS
FIBERGLASS
EXTENSION LADDERS
‡+($9<'87<,1'8675,$/
‡&2/25&2'(%/8(7<3(,
‡'6(5,(6)/$7
67(3
‡7<3(,
‡³7+((48$/,=(5´
‡121&21'8&7,9(
‡7<3(,)(6(5,(6
(OLPLQDWHVXQHYHQJURXQG(DV\WR
XVH DGMXVW ´ LQFUHPHQWV XS WR
´&RQYHQLHQWEXLOWLQEXEEOH
OHYHO'XDODFWLRQIRRWIRUXVHRQKDUGRUSHQHWUDEOHVXUIDFHV/LJKWZHLJKWDOXPLQXP([FOXVLYH$OÀR7ZLVW3URRI
SHUIRUPDQFH 6OLSUHVLVWDQW VWHSV DQG UXJJHG ORFNV
5HDFKHVDUHDVRIWKHKRPHWKDWWUDGLWLRQDOODGGHUVFDQQRW'LPHQVLRQVUDLOV´ZLGHUXQJV´EDVH
ZLGWKV ´ RXWVLGH VKRHV ÀDQJH ´ ZLGH DQG
À\ZLGWK´RXWVLGHUDLOV/HQJWKRIH[WHQVLRQODGders when not extended is half the total length of the
VHFWLRQV
4XLFNODWFK HTXLSSHG UXQJORFN SURYLGHVHDVLHUPHWKRGRIVHFXULQJÀ\
EDVHVHFWLRQVZKHQH[WHQGHG2QH
¿QJHU RSHUDWLRQ +HDY\GXW\ SODWHG VWHHO VZLYHO VDIHW\
VKRHV ZLWK WKLFN UXEEHU WUHDG 6KRH FDQ EH XVHG ZLWK
WUHDG GRZQ RU LQ VSLNH SRVLWLRQ 7HPSHUHG VHUUDWHG
DOXPLQXP 'VKDSHG UXQJV SURYLGH IRU D VOLSUHVLVWDQW
VXUIDFH7ZRH[WUDKHDY\GXW\RXUWVLGHVOLGHJXLGHVVHFXUHGWRWRSRIEDVHVHFWLRQZLWKIRXUULYHWVSHUJXLGHIRU
PD[LPXPVWUHQJWK,PSDFWUHVLVWDQWFDSVRQDOOUDLOHQGV
SURYLGH UDLO SURWHFWLRQ IRU ORQJHU OLIH DQG SURWHFW ZRUN
VXUIDFHVIURPPDUULQJ0HHWVRUH[FHHGVWKHVDIHW\VWDQGDUGVVHWE\$16,DQG26+$'RHVQRWLQOFOXGHURSHDQG
SXOOH\'LPHQVLRQV¶UDLOGHSWK¶VWDFNKHLJKW
´ EDVH LQVLGH ´ À\ LQVLGH ´
EDVHRXWVLGHDQG´À\RXWVLGH
7ZLVW3URRI GXH WR WKH $OÀR UXQJ
MRLQWV %OXH PROGHG QRQPDUULQJ HQG FDSV DQG UDLO FORVXUHV +HDY\ GXW\ PRGL¿HG ,%HDP VLGH UDLOV ,QWHUORFNLQJ VLGH UDLOV 6OLSUHVLVWDQW 7UDFWLRQ7UHG 'UXQJV
6PRRWKHU RSHUDWLQJ SXOOH\ GHVLJQ +HDY\ GXW\ VSULQJ
ORDGHGORFNVRSHUDWHVPRRWKO\'XUDEOHVKRHUHVWÀDWRU
LVKHOGLQVSXUSRVLWLRQZLWK6KXORNIHDWXUH'LPHQVLRQV
5DLOV´ZLGH5XQJV´)ODQJH´%DVHZLGWK
´RXWVLGHUDLOV/HQJWKRIH[WHQVLRQODGGHUVZKHQ
QRWH[WHQGHGLVKDOIWKHWRWDOOHQJWKRIWKHVHFWLRQV
Our No.
Max
Total Lgth Work’g
Sects Ft
L. Ft.
No.
Shf
Pk Unit
Our No.
616-0188
'
1
($
616-0170
'
1
($
616-0162
'
1
($
'
1
099-1133
1
($
($
905-6649
EXTENSION - FIBERGLASS
FIBERGLASS
EXTENSION LADDERS
No.
Shf
Pk
Unit
7ZLVW3URRI GXH WR WKH $OÀR UXQJ MRLQWV 6OLSUHVLVWDQW
7UDFWLRQ7UHG GUXQJV 0DUUHVLVWDQW HQG FDSV ([WUD
KHDY\GXW\,EHDPUDLOV7KLFNJXLGHEUDFNHWHQJDJHVIXOO
À\UDLO6PRRWKRSHUDWLQJSXOOH\GHVLJQ(QFORVHGVKDSH
SURWHFWVSXOOH\%DVHDQGÀ\VHSDUDWHHDVLO\IRUXVHDVDQ
H[WHQVLRQRUWZRVLQJOHVHFWLRQV5XEEHGVSULQJORDGHG
ORFNVRSHUDWHVPRRWKO\*XLGHEUDFNHWVIRUGXUDELOLW\DQG
VPRRWKRSHUDWLRQRIÀ\VHFWLRQ5XJJHGVKRHUHVWVÀDW
RULVKHOGLQVSXUSRVLWLRQZLWK6KX/RNIHDWXUH(TXLSSHG
ZLWK URSH DQG VPRRWK RSHUDWLQJ SXOOH\ H[FHSW IRU 1R
''LPHQVLRQV5DLOV´ZLGH)ODQJH´ZLGH
5XQJV ´ ZLGH %DVH ZLGWK ´ RXWVLGH UDLOV
/HQJWK RI H[WHQVLRQ ODGGHUV ZKHQ QRW H[WHQGHG LV KDOI
WKHWRWDOOHQJWKRIWKHVHFWLRQV5HQWDO
Shf
Pk Unit
0DUUHVLVWDQW HQG FDSV RQ DOO UDLO
HQGV SURYLGH UDLO SURWHFWLRQ IRU
longer life and protect work surIDFHIURPPDUULQJ+HDY\GXW\SODWHGVWHHOVZLYHOVDIHW\
VKRHV ZLWK WKLFN UXEEHU WUHDG 48,&./$7&+ HTXLSSHG
UXQJORFN SURYLGHV HDVLHU PHWKRG RI VHFXULQJ À\ EDVH
VHFWLRQVZKHQH[WHQGHG7HPSHUHGVHUUDWHGDOXPLQXP
'VKDSHGUXQJVSURYLGHIRUDVOLSUHVLVWDQWVXUIDFH7ZR
H[WUDKHDY\GXW\RXWVLGHVOLGHJXLGHVVHFXUHGWRWRSRI
EDVH VHFWLRQ ZLWK IRXU ULYHWV SHU JXLGH IRU PD[LPXP
VWUHQJWK'LPHQVLRQVIRU¶5DLOV´ZLGH´5DLO
ÀDQJH ´ 5XQJ %DVH RXWVLGH ZLGWK ´ )O\
RXWVLGHZLGWK´'LPHQVLRQVIRU¶5DLOV´
ZLGH5DLOÀDQJH5XQJ%DVHRXWVLGHZLGWK´
)O\RXWVLGHZLGWK´0HHWVRUH[FHHGVWKHVDIHW\
VWDQGDUGVVHWE\$16,DQG26+$)(GRHVQRWLQFOXGHURSHDQGSXOOH\
Our No.
Max
Total Lgth Work’g
Sects Ft
L. Ft.
No.
Shf
Pk
Unit
LOUISVILLE LADDER, INC.
TYPE I
WERNER CO
)(
1
($
‡352723
‡7<3(,$/6(5,(6
4XLFN/DWFKSURYLGHVHDVLHUPHWKRG
RIVHFXULQJÀ\EDVHVHFWLRQV6WHHO
VZLYHO VDIHW\ VKRH ZLWK PHWDO
VKLHOG 2XWVLGH VOLGH JXLGHV 'VKDSHG UXQJ IRU PRUH
FRPIRUWDEOH VWDQGLQJ 0DUUHVLVWDQW ,QFOXGHV WKH 3URTop, a multifunctional top designed to make work easier
IRU HOHFWULFDOXWLOLW\ KHDY\ FRQVWUXFWLRQ DQG UHVLGHQWLDO
MREV ,QFOXGHV D QRQFRQGXFWLYH ZRUN WUD\ PROGHG FRSRO\PHUZLWKSUDFWLFDOKDQG\PDQWRROVORWV,QWHUJUDWHG
bumper, soft non-marking/non-marring rubber tread
SURWHFWV WKH ZRUN VXUIDFH 9VKDSH GHVLJQ ZLWK UXEEHU
tread allows the ladder to work against corners, poles
DQG WUHHV 7RRO VORWV SURYLGH WKH RSWLRQ IRU ODVKLQJ WKH
ODGGHUWRWKHSROHRUWUHH'LPHQVLRQV´UDLOGHSWK
´ 3737 DQG ´ 37 EDVH LQVLGH
´3737 DQG ´ 37 À\ LQVLGH
´ 3737 DQG ´ 37 EDVH RXWVLGH
DQG ´ 3737 DQG ´ 37 À\ RXWVLGH
Our No.
250 Pound Duty Rating
191-0371
)(
FIBERGLASS
EXTENSION LADDERS
‡+',1'8675,$/7<3(,
$1',$)(6(5,(6
300 Pound Duty Rating
Our No.
250 Pound Duty Rating
Ladders & Scaffolding
‡(;75$+($9<'87<
,1'8675,$/*5$'(7<3(
,$
‡)/$767(36'6(5,(6
‡5(17$/
No.
'(4
LOUISVILLE LADDER, INC.
ALUMINUM EXTENSION
LADDERS
Max
Total Lgth Work’g
Sects Ft
L. Ft.
Max
Total Lgth Work’g
Sects Ft
L. Ft.
250 Pound Duty Rating
250 Pound Duty Rating
Our No.
Shf
Pk Unit
WERNER CO
WERNER CO
616-0121
Max
Total Lgth Work’g
Sects Ft L. Ft.
No.
1
Total
Lgth
Sects Ft
No.
Max
Work’g
L. Ft.
Shf
Pk Unit
LOUISVILLE LADDER, INC.
($
300 Duty Rating
620-3731
'
1
($
620-3806
'
1
($
039-4221
/37
1
($
620-3863
'
1
($
161-6465
/37
1
($
620-3871
'
1
($
102-6467
/37
1
($
620-3889
'
1
($
426-7647
/37
1
($
620-3905
'
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - FIBERGLASS
EXTENSION LADDERS
FIBERGLASS
EXTENSION LADDERS
‡&200(5&,$/7<3(,,
)(6(5,(6
‡(;75$+($9<'87<
,1'8675,$/
‡)/$767(3'
'6(5,(6
1RQFRQGXFWLYH
48,&./$7&+
HTXLSSHGUXQJORFNSURYLGHVHDVLHU
PHWKRG RI VHFXULQJ À\ EDVH VHFWLRQV ZKHQ H[WHQGHG +HDY\ GXW\ SODWHG VWHHO VZLYHO
VDIHW\VKRHVZLWKWKLFNUXEEHUWUHDG6KRHFDQEHXVHG
ZLWKWUHDGGRZQRULQVSLNHSRVLWLRQ'VKDSHGWHPSHUHG
VHUUDWHGDOXPLQXPUXQJVSURYLGHIRUDVOLSUHVLVWDQWVXUIDFH 0DUUHVLVWDQW UDLOHQGFDSV0HHWV RU H[FHHGV WKH
VDIHW\ VWDQGDUGV VHW E\ $16, DQG 26+$ 'LPHQVLRQV
)( VLGH UDLOV ´ [ ´ ZLGH DQG )( [ ´ ´ [ ´ UXQJV ´ RXWVLGH À\
ZLGWKDQG´RXWVLGHEDVHZLGWK)(GRHVQRW
LQFOXGHURSHDQGSXOOH\
Our No.
Lgth
Ft
No.
Wdth/nIn
Shf
Pk
Unit
LOUISVILLE LADDER, INC.
225 Pound Duty Rating
724-4379
)(
1
($
615-0478
)(
1
($
ALUMINUM
ARTICULATED
LADDERS
‡(;75$+($9<'87<
,1'8675,$/
2UDQJH´¿EHUJODVVVLGHUDLOV
'LUHFWUXQJWRUDLOFRQQHFWLRQVZLWKSDWHQWHG$OÀRUXQJ
MRLQWV6OLSUHVLVWDQW7UDFWLRQ7UHG'UXQJV1RQPDUULQJ
HQG FDSV 3UHSLHUFHG KROHV IRU HDV\ ¿HOG LQVWDOODWLRQ
RIDFFHVVRULHV,QWHUQDOJXLGHVRQERWWRPRIÀ\VHFWLRQ
VHFXUHO\ LQWHUORFN UDLOV ,QWHUORFNLQJ VLGH UDLOV ([WHUQDO
JXLGHVDWWRSRIEDVHVHFWLRQVHFXUHO\LQWHUORFNUDLOV7ZR
VHWV RQ ' 5XJJHG JUDYLW\VSULQJ ORFNV RSHUDWH
VPRRWKO\ 5RSH FODPS WLHV URSH WR UXQJ ([WUXGHG DOXPLQXPVKRHZLWKVWHHOLFHSLFNSODWH%DVHDQGÀ\HDV\
WRVHSDUDWH(TXLSSHGZLWKKHDY\GXW\SXOOH\ZLWKURSH
H[FHSW IRU 1R ' 0ROGHG UXQJ EUDFHV 'XUDEOH
rail shield bracket and shoe with shu-lok, slip-resistant
SDG DQG VSXU SODWH 'LPHQVLRQV )ODQJH ´ ZLGH
UXQJV´)O\ZLGWK´RXWVLGHUDLOV%DVHZLGWK´
RXWVLGHVKRHV/HQJWKRIH[WHQVLRQODGGHUVZKHQQRWH[WHQGHGLVKDOIWKHWRWDOOHQJWKRIWKHVHFWLRQV5HQWDO
Our No.
Max
Total Lgth Work’g
Sects Ft
L. Ft.
No.
Shf
Pk Unit
Single hand, single step hinge-reOHDVHURGIRUTXLFNDQGHDV\SRVLWLRQLQJ1XPHURXVSRVLWLRQVDQGIXQFWLRQVSURYLGHYHUVDWLOLW\LQXVHEDVHRIWUDQVSRUWDQGVWRUDJH0XOWLXVHDV
DVWUDLJKWODGGHUOHQJWKVWDQGRIIRUVWUDLJKWODGGHU
¶ RU ¶ VLQJOH GRXEOH VWHSODGGHU ORZKHLJKW VFDIIROG
¶RU¶VFDIIROGRURUOHQJWKVWDLUZD\DQG
OHGJH VFDIIROG RU VWDLUZD\ VWHSODGGHUVFDIIROG $QJOH
EUDFHVDQGEROWRQZLGHVXSSRUWEDUDGGVWDELOLW\´
JURRYHGVTXDUHUXQJVFORVHGSUR¿OHVLGHUDLOVEULJKWUHG
VOLSUHVLVWDQWHQGFDSVDQGUHOHDVHURGJXDUGVSURYLGH
LQFUHDVHG FRPIRUW DQG VDIHW\ 0HHWV $16, FRGH 26+$
UHTXLUHPHQWV
Our No.
Max
Total Lgth Work’g
Sects Ft
L. Ft.
No.
Shf
Pk Unit
MICHIGAN LADDER COMPANY
300 Pound Duty Rating
644-7684
7,6
1
($
WERNER CO
Type 1A - 300 Pound Duty Rating
FIBERGLASS
EXTENSION LADDERS
635-4195
'
1
($
‡+($9<'87<,1'8675,$/
7<3(,
‡)/$76(7'6(5,(6
635-4344
'
1
($
635-5374
'
1
($
635-4260
'
1
($
1RQFRQGXFWLYH ¿EHUJODVV VLGH
UDLOV 1RQPDUULQJ \HOORZ PROGHG
HQGFDSVDQGUDLOFORVXUHV([WHUQDOJXLGHVRQWRSRIEDVH
VHFWLRQDQGLQWHUQDOJXLGHVRQERWWRPRIÀ\VHFWLRQVHFXUHO\ LQWHUORFN UDLOV (TXLSSHG ZLWK KHDY\ GXW\ SXOOH\
DQG URSH H[FHSW IRU ' 5RSH FODPS WLHV URSH WR
UXQJ6PRRWKO\RSHUDWLQJH[WUXGHGJUDYLW\VSULQJORFNV
'LUHFW UXQJ WR UDLO FRQQHFWLRQV &RPELQDWLRQ DOXPLQXP
rail shield bracket and shoe with Shu-lok, slip-resistant
SDG DQG VSXU SODWH 7ZLVW3URRI GXH WR WKH $OÀR UXQJ
MRLQWV 0ROGHG UXQJ EUDFHV 6OLSUHVLVWDQW WUDFWLRQ WUHG
GUXQJV 'LPHQVLRQV UDLOV ´ ZLGH ÀDQJH ´
ZLGH UXQJV ´ ÀDW W\SH À\ ZLGWK ´ RXWVLGH
UDLOV DQG EDVH ZLGWK ´ RXWVLGH VKRHV /HQJWK RI
extension ladders when not extended is half the total
OHQJWKRIWKHVHFWLRQV
Our No.
Max
Total Lgth Work’g
Sects Ft
L. Ft.
No.
Shf
Pk Unit
657-2234
'
1
($
657-2341
'
1
($
Max
Total Lgth Work’g
Sects Ft Ft.
Shf
Pk Unit
WERNER CO
300 Pound Duty Rating
289-1380
'(4
Lgth.Ft.x
Wdth In.
No.
Shf
Pk
Unit
50 POUND DUTY RATING/SQ. FT.
077-3739
$GMXVW ´ LQFUHPHQWV XS WR
´'XDODFWLRQIRRWIRUXVHRQ
KDUG RU SHQHWUDEOH VXUIDFHV 1RQ
FRQGXFWLYH OD\HU FRQVWUXFWLRQ ¿EHUJODVV VLGH UDLOV
$/)/2WZLVWSURRISHUIRUPDQFH6OLSUHVLVWDQWVWHSVDQG
UXJJHG ORFNV 'LPHQVLRQV UDLOV ´ ZLGH UXQJV ´
EDVHZLGWKV´RXWVLGHUDLOV´WRRXWVLGHRI
IHHWÀDQJH´ZLGHDQGÀ\ZLGWK´RXWVLGH
/HQJWK RI H[WHQVLRQ ODGGHUV ZKHQ QRW H[WHQGHG LV KDOI
WKHWRWDOOHQJWKRIWKHVHFWLRQV
No.
,QFOXGHV VDIHW\ ODWFK 6ROLG EROW
FRQVWUXFWLRQ´UDLOVL]H
LOUISVILLE LADDER, INC.
‡7<3(,$
‡³7+((48$/,=(5´
Our No.
250 Pound Duty Rating
‡$/80,180'(&.3'
6(5,(6
‡³6&$)$'(&.´
Our No.
FIBERGLASS
EXTENSION LADDERS
WERNER CO
SCAFFOLD PLATFORMS
1
3'
[
1
($
1
($
75 POUND DUTY RATING/SQ. FT.
815-4908
3'
[
SCAFFOLD
‡$'-867$%/(3257$%/(
,QFOXGHVIRXU´VZLYHOFDVWHUZLWK
EUDNHVDQGD´:[´
/[´7SO\ZRRGERDUG<HOORZ
3RZGHU &RDWLQJ ¿QLVK 6L]H ´ : [ ´ ' [ ´
+ $GMXVWDEOH +HLJKW ´ ´ +HDY\'XW\
VTXDUHWXEH´[´[
($
Our No.
Shf
Pk
No.
Unit
VULCAN
Ladders & Scaffolding
1,000 Pound Loading Capacity
PLATFORM & SCAFFOLDING
879-5478
1
<+6'
($
ALUMINUM LADDERS
‡08/7,385326(7<3(,$
8VHDVDVWUDLJKWH[WHQVLRQODGGHU
/WR/¶
WR¶WZLQVWHSODGGHURUVWDLUZD\
ODGGHU/¶WR¶/
¶ WR ¶ DQG SODQN VXSSRUW /
¶ WR ¶ /¶ WR ¶ ,QFOXGHV KHDY\
GXW\ ORFNLQJ SLQV DQG TXLFN DFWLYDWLQJ VQDSORFN KLQJH
3URYLGHVVWDELOLW\DQGYHUVDWLOLW\IRUWKHPRVWGHPDQGLQJ
SURMHFWV
Our No.
Size
Ft
No.
Shf
Pk
Unit
SCAFFOLD
‡0,1,
Steel contruction with rust resistant
SRZGHU FRDWHG ¿QLVK OE VWHS
FDSDFLW\ZLWKVOLSUHVLVWDQWVXUIDFH
´ ORFNLQJ FDVWHUV ,QFOXGHV DWWDFKDEOHWRROEDJV
Our No.
Size
Ft
No.
Shf
Pk
Unit
VULCAN
LOUISVILLE LADDER, INC.
500 Lb. Capacity
300 Pounds Duty Rating
973-9285
090-6438
/
1
($
812-9983
/
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
<7/
1
($
- Maintenance, Repair & Operations
GUARD RAIL
LADDER STABILIZERS
Our No.
Shf
Pk
No.
Unit
VULCAN
359-1773
1
<+*5%
($
OUTRIGGER
No.
<+75
727-4434
Shf
Pk
Unit
1
6(7
VULCAN
361-0631
CASTERS
‡+($9<'87<
)RU6NXVFDIIROG´'LD
[ ´ :GWK UXEEHU ZKHHO 3LQ
not included
No.
Fits
Dia. In.
<+&6
Unit
Shf
Pk
1
($
LADDER RAIL
EXTENSION
5HTXLUHV QR WRROV GULOOLQJ RU EROWLQJWRKROGLWVHFXUHO\LQSODFH$OXminum design keeps handles from
JHWWLQJ KRW LQ WKH VXQ 6LPSOH WR
use knob, tightens by hand without
VFUDWFKLQJRUGDPDJLQJODGGHU&XVKLRQHGEXPSHUSDGV
KHOSWRSURWHFWWKHHDYHVRIWKHURRI$GGHGKDQGJULSV
IRUHDVLHUXVDJH6DIHW\ODWFKSUHYHQWVXQLWIURPVOLSSLQJ
RIIODGGHU&RPSOLHVZLWK26+$¶VODGGHUUXOHRI´DERYH
HDYHKHLJKW
Our No.
Our No.
Shf
Pk
No.
QUALCRAFT INDUSTRIES
<HOORZSRZGHUFRDWHG¿QLVK6WHHO
PDWHULDO&DVWHUV QRWLQFOXGHG'LPHQVLRQV´+[´:
Our No.
8VH WR FXW WKH ULVN RI IDOOV E\ DOlowing ladders to remain stable on
XQHYHQJURXQG'HVLJQHGIRUERWK
SURIHVVLRQDOVDQGGRLW\RXUVHOIHUV
$WWDFKHVWRWKHERWWRPRIDQ\VWDQGDUGODGGHUNHHSLQJWKHODGGHUVWDEOHDQGOHYHOSURYLGLQJLWZLWKDQH[WUDZLGHDGMXVWDEOHEDVH$GMXVWDEOHIHHW
ZLWK LFH SLFN IHDWXUH 1RQVOLS UXEEHU IHHW NHHS ODGGHU
IURPPRYLQJRXWRISRVLWLRQ7HVWHGWRH[FHHG$16,7\SH
$ DQG &6$ *UDGH ZHLJKW UHTXLUHPHQWV $WWDFKHV WR
PRVW H[WHQVLRQ ODGGHUV 3DWHQWHG OHYHOLQJ PHFKDQLVP
IHDWXUHVHIIRUWOHVVRQHIRRWRSHUDWLRQ0DGHRIKDUGHQHG
VWHHO
Our No.
‡3,(&(
Fits
Dia In
GROUT CLEANER AND
WHITNER
‡%$6(0$7(
<HOORZ 3RZGHU &RDWHG ¿QLVKHG
$VVHPEOHGVL]HRQVFDIIROGLQJ
´+[´:[´')ROGDEOH6WHHO0DWHULDO2QH3LHFH
Shf
Pk
No.
437-9673
1
7,+6
($
MINTCRAFT
986-5726
($
&RPSDWLEOH ZLWK 2%(/ VHULHV
2%37 VHULHV 2%&1 VHULHV
VHULHV VHULHV VHULHV 36 PRGHO DQG $&
PRGHO 6HFXUHV WRROV IURP IDOOLQJ
WR SURWHFW \RXU LQYHVWPHQWV SXWV
WRROVLQHDV\UHDFK
ACCESSORIES
LADDER HOOK
‡67((/:,7+52//(5
Fits single or extension ladders in
ZRRG¿EHUJODVVDQGDOXPLQXPLQ
URXQG DQG ³'´ UXQJ VW\OHV &RQstructed of steel for strength, duUDELOLW\DQGVDIHW\$GMXVWDEOHWR¿W
EHWZHHQWRSWZRODGGHUUXQJV
Our No.
No.
Our No.
Shf
Pk
7,+6
1
($
Tile Products, Wallpaper Tools &
Home Decor
($
CLEANERS
GROUT HAZE REMOVER
LADDER LEVELERS
([WHQGV XS WR ´ IRU VWHSV $Wtaches to either side or on multiple
ODGGHUV /DUJH KHDY\ GXW\ VZLYHO
VKRH ZLWK VSXUV :LWK SDWHQWHG
.H\/RN4XLFN&RQQHFWV\VWHP)LWV
)( )( ¶ DQG ¶ ¶ )( )(+' /37 $( $(
$( $(+' $( DQG / ,QFOXGHV TXLFNFRQQHFWOHYHOHUDQGVHWTXLFNFRQQHFWEDVH
XQLWV
Our No.
No.
Shf
Pk
Unit
LOUISVILLE LADDER, INC.
462-3096
/3
1
Unit
412-5787
=8
($
TILE/GROUT CLEANER
‡&21&(175$7(
352)(66,21$/48$/,7<
‡³7,/(*8$5'´
&XWV WKURXJK VRLO DQG KDUG ZDWHU
EXLOGXS 1RQDEUDVLYH 1RQDFLG
formula breaks down soap scum
DQG JUHDV\ EXLOGXSRQ WLOH DQG JURXW %LRGHJUDGDEOH
&OHDQVDOOQRQSRURXVVXUIDFHV
Our No.
Size
Oz
No.
Shf
Pk
Unit
HOMAX CORPORATION
Trigger Spray
651-5746
7*3&
($
Light Bulbs
STANDARD BULBS
LIGHT BULBS
‡,1&$1'(6&(1792/7
‡)5267('$
‡³0$,17(1$1&(3$&.´
No.
Watts
Avg. Life
Hours
Shf
Pk Unit
MEDIUM BRASS BASE
609-6200
$03
609-6218
$03
3.
609-6234
$03
3.
3.
Unit
QUALCRAFT INDUSTRIES
784-7973
Unit
1 Belt Clip & 2 Lassos - 14”x 6.8” x 9.5”
$&7/
Shf
Pk
FEIT ELECTRIC
WERNER CO
304-3288
Size
Oz
No.
ACUITY SPECIALTY PRODUCTS
Our No.
Shf
Pk
No.
Our No.
%UDVV EDVH UHVLVWV YLEUDWLRQ DQG
FRUURVLRQ/LIHLVLQFUHDVHGDSSUR[LPDWHO\WLPHVOXPHQVGHFUHDVHG
E\DSSUR[LPDWHO\SHUFHQWDQGZDWWDJHGHFUHDVHGE\
DSSUR[LPDWHO\SHUFHQWZKHQWKHVHYROWODPSVDUH
XVHGRQDYROWOLQH
LADDER TOOL LASSO
Ladders & Scaffolding
,QGXVWULDO VWUHQJWK DFLGLF FOHDQHU
IRU JURXW 'HWHUJHQW DQG DFLG
based blend, easily cleans and
ZKLWHQVÀRRUJURXW
Unit
QUALCRAFT INDUSTRIES
Unit
‡352)(66,21$/675(1*7+
‡³=(3´
($
‡³7,/(/$%´
5HDG\WRXVHOLTXLGUHPRYHVJURXW
KD]H RU UHVLGXH DQG HIÀRUHVFHQFH
ZLWKDVDIHWRXVHDFLGLFWUHDWPHQW
Glazed and unglazed ceramic tile
PD\ HWFK VRPH JOD]HG WLOH 127
IRUPDUEOHRUSROLVKHGVWRQH
Our No.
No.
Size
Shf
Pk
Unit
CUSTOM BUILDING
7/*+55$47
Quart
‡,1&$1'(6&(1792/7
‡)5267('$
‡&200(5&,$/9$/8(3$&.
‡³(&2/2*,&´
0HHWV OHJLVODWLRQ UHTXLUHPHQWV
PHHWV &DOLIRUQLD HQHUJ\ HI¿FLHQF\
UHTXLUHPHQWV 'HVLJQHG WR SDVV WKH )HGHUDO 7&/3 FULWHULD IRU FODVVL¿FDWLRQ DV QRQKD]DUGRXV ZDVWH LQ PRVW
VWDWHV´ RYHUDOO OHQJWK /LIH LV LQFUHDVHG DSSUR[LPDWHO\WLPHVOXPHQVGHFUHDVHGE\DSSUR[LPDWHO\
SHUFHQW DQG ZDWWDJH GHFUHDVHG E\ DSSUR[LPDWHO\ SHUFHQW ZKHQ WKHVH YROW ODPSV DUH XVHG RQ D YROWOLQH
Our No.
Bottle
251-4719X
LIGHT BULBS
48$57
No.
Watts
Avg. Life
Hours
Shf
Pk Unit
SYLVANIA LIGHTING
MEDIUM ALUMINUM BASE
810-8755
7,+6
1
%;
469-2539
7,+6
1
%;
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - LIGHT BULBS
LIGHT BULBS
‡,1&$1'(6&(1792/7
‡&/($5$
‡&200(5&,$/9$/8(3$&.
‡³(&2/2*,&´
‡,1&$1'(6&(17$
‡)5267('528*+6(59,&(
0HHWV OHJLVODWLRQ UHTXLUHPHQWV
0HHWV &DOLIRUQLD HQHUJ\ HI¿FLHQF\
UHTXLUHPHQWV'HVLJQHGWRSDVVWKH)HGHUDO7&/3FULWHULD
IRUFODVVL¿FDWLRQDVQRQKD]DUGRXVZDVWHLQPRVWVWDWHV
0D[LPXPRYHUDOOOHQJWK´%XOEFDQEHXVHGLQDQ\
SRVLWLRQ
Our No.
No.
Avg. Life
Hours
Watts
‡,1&$1'(6&(17*/2%(
‡*
6WDQGDUG EDVH LQFDQGHVFHQW YROW $YHUDJHV OLIH KRXUV
7RXJK VKRFN UHVLVWDQW ¿ODPHQW
´OHQJWK
Our No.
No.
8VHIRUYDQLW\VWULSVDQGVZDJ¿[WXUHV´GLDPHWHUPD[LPXPRYHUDOO OHQJWK RI ´ DYHUDJH OLIH RI
KRXUVYROW
Shf
Pk
Watts
Unit
Our No.
SYLVANIA LIGHTING
7,+6
3.
1
%;
155-8295
Light Bulbs
‡,1&$1'(6&(1792/7
‡&/($5$
‡³0$,17(1$1&(3$&.´
Our No.
No.
Watts
Shf
Pk Unit
Watts/
Volts
No.
Avg Life
Hours
Shf
Pk Unit
FEIT ELECTRIC
3.
Light Bulbs
CANDELABRA BRASS BASE
609-5772
&)&
3.
609-5780
&)&
3.
Shf
Pk Unit
FEIT ELECTRIC
$567)
604-9928X $567)
($
($
Our No.
Watts/
Volts
No.
Avg. Life Shf
Hours
Pk Unit
'HVLJQHG IRU UHFHVVHG DQG WUDFN
lighting, replaces standard incanGHVFHQW5EXOEV%UDVVEDVHUHVLVWVYLEUDWLRQDQGFRUURVLRQ YROWV OLIH KRXUV RQ D YROW OLQH
´RYHUDOOOHQJWK
Our No.
Avg.
Life
Watts Hours
No.
Shf
Pk Unit
(7&
+HDY\GXW\ PXOWL¿ODPHQW UHVLVWV
YLEUDWLRQ)RUXVHLQWURXEOHOLJKWV
garages, workshops and other
URXJK XVDJH DUHDV %UDVV EDVHV
UHVLVWYLEUDWLRQDQGFRUURVLRQOXPHQVDWYROW
´RYHUDOOOHQJWKYROWVKRXUVDWYROW
Shf
Pk Unit
FEIT ELECTRIC
MEDIUM BRASS BASE
604-9936
$56
3.
604-9944
$56
3.
No.
3.
‡,1&$1'(6&(17,1'225
‡%5)5267('
6WDQGDUG EDVH LQFDQGHVFHQW
´RYHUDOOOHQJWKYROWV
No.
Watts
Avg. Life
Hours
Shf
Pk
Unit
1
3.
Shf
Pk
Unit
MEDIUM ALUMINUM BASE
3.
REFLECTOR
FLOODLIGHT BULBS
'HVLJQHG IRU YDQLW\ OLJKW ¿[WXUHV
%UDVV EDVH UHVLVWV YLEUDWLRQ DQG
FRUURVLRQ´GLDPHWHU*EXOEDYHUDJHVOLIH
KRXUVZKHQXVHGDWYROWV%R[HG
Our No.
SYLVANIA LIGHTING
‡,1&$1'(6&(17*/2%(
‡*
‡³0$,17(1$1&(3$&.´
Avg.
Life
Hours
‡,1&$1'(6&(17,1'225
‡%5
‡³0$,17(1$1&(3$&.´
Our No.
FEIT ELECTRIC
DECORATIVE LIGHT
BULBS
Watts
($
491-2218
‡,1&$1'(6&(17$
‡)5267('528*+6(59,&(
No.
($
REFLECTOR
FLOODLIGHT BULBS
6WUDLJKW WLS WRUSHGR EXOE %UDVV
EDVHUHVLVWVYLEUDWLRQDQGFRUURVLRQYROWDYHUDJHOLIHKRXUVZKHQUXQRQDYROWOLQH
609-5822
LIGHT BULBS
Our No.
‡,1&$1'(6&(17
&+$1'(/,(5
‡%&/($5
‡³0$,17(1$1&(3$&.´
MEDIUM BRASS BASE
MEDIUM BRASS BASE
763-4058
609-6028 %5)/03
DECORATIVE LIGHT
BULBS
7HÀRQ FRDWHG JODVV WR UHGXFH
EUHDNDJHDQGVKDWWHULQJ)RURSHQ
¿[WXUHV RYHU IRRG SURFHVVLQJ DQG
RXWGRRU OLJKWLQJ +HDY\GXW\ PXOWL¿ODPHQW UHVLVWV YLEUDWLRQ%UDVV EDVHV UHVLVW YLEUDWLRQDQGFRUURVLRQ
YROWVKRXUVOLIHLIXVHGDWYROWV
Watts
MEDIUM BRASS BASE
‡,1&$1'(6&(17$
‡)5267('528*+6(59,&(
‡³78)).27(´
No.
868-0142
FEIT ELECTRIC
LIGHT BULBS
Our No.
($
REFLECTOR
FLOODLIGHT BULBS
ROUGH SERVICE BULBS
Avg.
Life
Hours
Light Bulbs
%UDVV EDVH UHVLVWV YLEUDWLRQ DQG
FRUURVLRQYROWDYHUDJHOLIHKRXUVZKHQXVHG
DWYROWV
Our No.
MEDIUM BRASS BASE
$&/03
INDOOR FLOOD / SPOT BULBS
‡,1&$1'(6&(17
&+$1'(/,(5
‡&/($5%(17)/$0(7,3
‡³0$,17(1$1&(3$&.´
FEIT ELECTRIC
609-6242
493-1077
DECORATIVE LIGHT
BULBS
LIGHT BULBS
Avg.
Life
Hours
Unit
MEDIUM ALUMINUM BASE - SOFT WHITE
CHANDELIER BULBS / GLOBE BULBS
%UDVV EDVH UHVLVWV YLEUDWLRQ DQG
FRUURVLRQDYHUDJHOLIHKRXUV
ZKHQXVHGRQDYROWOLQH
Shf
Pk
Watts
MEDIUM ALUMINUM BASE - CLEAR
Boxed
026-4978
MEDIUM ALUMINUM BASE
679-1982
No.
SYLVANIA LIGHTING
MEDIUM ALUMINUM BASE
Shf
Pk Unit
SYLVANIA LIGHTING
DECORATIVE LIGHT
BULBS
Watts/
Volts
Shf
Pk
Unit
FEIT ELECTRIC
‡,1&$1'(6&(17,1'225
‡5'$</,*+7
‡³'$</,*+7´
%HDPDQJOHRIGHJUHH´
RYHUDOOOHQJWKYROWV
Our No.
No.
Watts
Avg. Life
Hours
SYLVANIA LIGHTING
MEDIUM BASE - 215 LUMENS
MEDIUM BRASS BASE - CLEAR
609-5913
*03
9ROW
3.
609-5921
*03
9ROW
3.
927-9944
MEDIUM BRASS BASE - WHITE
609-5939
*:03
9ROW
3.
609-5947
*:03
9ROW
3.
609-5954
*:03
9ROW
3.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
- Maintenance, Repair & Operations
Light Bulbs
REFLECTOR
FLOODLIGHT BULBS
REFLECTOR
FLOODLIGHT BULBS
‡,1&$1'(6&(17,1'225
‡%55(&(66('
/,*+7,1*
‡³0$,17(1$1&(3$&.´
‡,1&$1'(6&(17,1'225
‡5)5267(''28%/(
/,)(
'HVLJQHGIRUUHFHVVHGOLJKWLQJUHSODFHVVWDQGDUGLQFDQGHVFHQW5EXOE%UDVVEDVHUHVLVWVYLEUDWLRQDQGFRUURVLRQYROWVKRXUVDYHUDJHOLIHZKHQXVHGDWYROW´RYHUDOOOHQJWK
Our No.
No.
Watts
Avg.
Life
Hours
Shf
Pk Unit
FEIT ELECTRIC
PLANT LIGHT BULBS
LINEAR FLUORESCENT
BULBS
‡35(+($7
‡3/$17$48$5,80
‡³*52/8;´
/DVWV WZLFH DV ORQJ DV RUGLQDU\
EXOEV DSSUR[LPDWH /XPHQV
GHJUHHEHDPDQJOH´RYHUDOOOHQJWK
Our No.
Watts/
Volts
No.
Avg. Life
Hours
Shf
Pk
Unit
SYLVANIA LIGHTING
MEDIUM BRASS BASE
382-9553
($
MEDIUM BRASS BASE
609-6069 %5)/03
T12 - 9,000 Hours
‡,1&$1'(6&(17,1'225
‡',00$%/(5
)5267('
6WDQGDUG FRDWHG EXOE ´
RYHUDOO OHQJWK DSSUR[LPDWH
OXPHQV GHJUHH EHDP DQJOH
2SHUDWH RQO\ LQ SRUFHODLQ VRFNHWV VKRXOG EH VKLHOGHG
DJDLQVW PRLVWXUH IDOOLQJ RQ EXOE 0HHWV OHJLVODWLRQ UHTXLUHPHQWVXVHVOHVVHQHUJ\YROWV
Our No.
No.
Shf
Pk
Unit
Our No.
No.
Watts
Avg. Life
Hours
Shf
Pk
($
1
3.
‡,1&$1'(6&(17,1'225
‡%5)5267(''28%/(
/,)(
‡35(+($7&22/:+,7(
($
Our No.
Avg. Life
Hours
Shf
Pk
Unit
SYLVANIA LIGHTING
Watts
Lgth
In
Shf
Pk Unit
T8 - 7,500 Average Life Hours
Our No.
Avg.
Life
Watts Hours
No.
Shf
Pk Unit
FEIT ELECTRIC
MEDIUM BRASS BASE
No.
MEDIUM BI-PIN BASE - 1.10 DIAMETER
'HVLJQHGIRUUHFHVVHGDQGWUDFNOLJKWLQJUHSODFHVVWDQGDUGLQFDQGHVFHQW5EXOE%UDVVEDVHUHVLVWVYLEUDWLRQ
DQGFRUURVLRQYROWVKRXUVDYHUDJHOLIHZKHQ
XVHGRQDYROWOLQH´RYHUDOOOHQJWK
6WDQGDUG FRDWHG EXOE ´
RYHUDOO OHQJWK DSSUR[LPDWH
OXPHQVYROWV
LINEAR FLUORESCENT
BULBS
8VHGRQ%L3LQ¿[WXUHV
‡%5,1&$1'(6&(17
,1'225
‡5(&(66('75$&.
/,*+7,1*
‡³0$,17(1$1&(3$&.´
REFLECTOR
FLOODLIGHT BULBS
481-5528
Light Bulbs
Unit
REFLECTOR SPOTLIGHT
BULBS
Watts
($
SYLVANIA LIGHTING
738-4449
No.
FLUORESCENT BULBS
MEDIUM BRASS BASE
359-9891
095-5849
Our No.
SYLVANIA LIGHTING
SYLVANIA LIGHTING
MEDIUM ALUMINUM BASE
Shf
Pk Unit
SYLVANIA LIGHTING
783-4088X )7/;$4´
‡,1&$1'(6&(17,1'225
‡%5)5267('
'LPPDEOH ,QGRRU 5 ÀRRG OLJKW
EXOE ZDWW OXPHQV :KHQ
XVHGRQDVWDQGDUGYROWOLQHLWLVZDWWOXPHQV
DQGDYHUDJHOLIHKRXUV%R[HG
Lgth
Watts In
No.
MEDIUM BI-PIN BASE - 1.59 DIAMETER
REFLECTOR
FLOODLIGHT BULBS
Avg. Life
Hours
Our No.
3.
REFLECTOR
FLOODLIGHT BULBS
Watts/
Volts
Generates radiant energy, which is
PRVW EHQH¿FLDO IRU SODQWV DQG HQhances growth of many plants for home and commercial
XVH$OVRXVHGIRUDTXDULXPV
MEDIUM BRASS BASE
($
609-6044 %56303
3.
837-8127X
($
109-5801X
($
LINEAR FLUORESCENT
BULBS
‡7&22/:+,7(
‡35(+($70(',80%,3,1
‡³'(6,*1(5´
5DUH HDUWK SKRVSKRU DYHUDJH OLIH KRXUV . FRORU WHPSHUDWXUH&5,$FWXDOOHQJWKLQFKHVQRPLQDO
OHQJWK´GLDPHWHUPHDQOXPHQV
Our No.
No.
Shf
Pk
Watts
Unit
SYLVANIA LIGHTING
HALOGEN PAR
FLOODLIGHTS
6WDQGDUG FRDWHG EXOE ´
RYHUDOO OHQJWK DSSUR[LPDWH
OXPHQV GHJUHH EHDP DQJOH
YROWV
No.
Watts
Avg. Life
Hours
Shf
Pk
Unit
3.
MEDIUM ALUMINUM BASE
($
LINEAR FLUORESCENT
BULBS
‡3$5&2/25('
‡,1'225287'225
SYLVANIA LIGHTING
954-0451
OUTDOOR FLOOD / SPOT BULBS
‡,1&$1'(6&(17,1'225
‡5)5267('
Our No.
743-2024X
Light Bulbs
REFLECTOR
FLOODLIGHT BULBS
‡7&22/:+,7(
‡,1'225
‡³2&7521(&2/2*,&´
2QH SLHFH WXQJVWHQ EXOE XVHG DV
holiday accent or for landscape and
FRPPHUFLDOOLJKWLQJDYHUDJH
OLIHKRXUV´RYHUDOOOHQJWK3$5ER[HG
Our No.
No.
Color
Shf
Pk
$YHUDJHVOLIHKRXUV7ÀXRUHVFHQWODPS&5,.FRORU
WHPSHUDWXUH´GLDPHWHU
Unit
SYLVANIA LIGHTING
Our No.
No.
Watts
Lgth
In
Shf
Pk Unit
SYLVANIA LIGHTING
MEDIUM BRASS BASE -100 WATTS/120 VOLTS
MEDIUM BI-PIN BASE - 1300 LUMENS
473-1949X
<HOORZ
($
904-3001X
5HG
($
993-8432X
Green
($
613-6295X
($
($
MEDIUM BI-PIN BASE - 1950 LUMENS
583-5673X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 53
LINEAR FLUORESCENT
BULBS
LINEAR FLUORESCENT
BULBS
‡,1'2257
‡*%$6(
‡³2&7521(&2/2*,&´
‡75$3,'67$57+,*+
287387
‡5$5(($57+3+263+25
‡³'(6,*1(5´
6XSHUVDYHUH[WHQGHGSHUIRUPDQFH
(FRORJLF 2FWURQ ÀXRUHVFHQW OLJKW
EXOE$YHUDJHVOLIHKRXUVLQLWLDOOXPHQV7
ÀXRUHVFHQWODPS&5,.FRORUWHPSHUDWXUH
Our No.
No.
Lgth
In
Watts
Shf
Pk Unit
28
48
No.
Watts
Avg. Life
Hours
Shf
Pk Unit
110
15
SYLVANIA LIGHTING
MEDIUM BI-PIN BASE - 1” DIAMETER
619-5648X
GFCI EXTENSION
CORDS
5HFHVVHG GRXEOH FRQWDFW EDVH
$YHUDJHV OLIH KRXUV ´ RYHUDOO OHQJWK [ ´
GLDPHWHU LQLWLDO OXPHQV DW & . FRORU WHP
SHUDWXUH&5,
Our No.
SYLVANIA LIGHTING
Household Electrical
EXTENSION CORDS WITH GFCI
30
590-9049X
($
25185
($
‡287'225&21'8&725
‡287/(732:(5%/2&.
‡³<(//2:-$&.(7´
0RUHÀH[LEOHDQGDEUDVLRQUHVLVWDQW
at any temperature than standard
YLQ\OFRPSRXQGVRUEOXHFROGZHDWKHUFRUGV7KUHHRXW
OHWV DQGULJKWDQJOHPDOHSOXJZLWKJURXQGIDXOW FLUFXLW
LQWHUUXSWHU0DQXDOWHVWUHVHWEXWWRQV0HHWV26+$VSHF
L¿FDWLRQVDQG8//LVWHG
Our No.
No.
Lgth
Ft
Shf
Pk
Unit
COLEMAN CABLE INC.
FLUORESCENT FIXTURE PARTS/PAN
‡72&7521(&2/2*,&
‡5$5(($57+3+263+256
FLUORESCENT TUBE
GUARDS
6XLWDEOH IRU LQVWDQW VWDUW RU UDSLG
VWDUW RSHUDWLRQ . &5,
DYHUDJH OLIH KRXUV ´
RYHUDOOOHQJWK
‡3/$67,&&/($5
Our No.
No.
Shf
Pk Unit
SYLVANIA LIGHTING
24
30
Lgth
In
Shf
Pk Unit
SYLVANIA LIGHTING
MEDIUM BI-PIN BASE
472-6121X
34
¶37
48
24
($
604-8359X
¶37
24
($
37
48
48
30
($
25
Lgth
Ft
Shf
Pk
Unit
14/3 SJTW - 12 AMP - 1500 WATTS
25
8
($
LIGHT PANELS
179-5509
&%
50
($
‡$&5</,&35(0,80
‡³'85$/(16´
472-4415
&%
100
4
($
9LUWXDOO\ XQEUHDNDEOH QRQ\HOORZ
LQJDQGHDV\WRFXW'RLW\RXUVHOI
HDV\WRLQVWDOO6OLSVRXWIRUFOHDQ
LQJ)LWVDOOVXVSHQGHGFHLOLQJV\V
WHPV6T)W´[´
GFCI POWER BOXES
No.
Color
‡287/(7-81&7,21%2;
‡³6+2&.6$)(´
Shf
Pk
Unit
$
&OHDU
20
($
20
($
PRISMATIC
520-7642X
&RRO ZKLWH SKRVSKRU . FRORU
WHPSHUDWXUH &5, $YHUDJHV
OLIHKRXUV´02/´DFWXDOOHQJWK´GL
DPHWHU
Avg Life Shf
Hours
Pk Unit
SYLVANIA LIGHTING
SINGLE PIN - NO UPC
No.
&%
707-1384X
‡7,167$1767$57
‡&22/:+,7(6/,0/,1(
‡³683(56$9(5´
021-6283X )7&:66
Our No.
($
CRACKED ICE
Watts
)HDWXUHVFLUFXLWEUHDNHULQWKHSOXJ
ZLWK D UHVHW EXWWRQ :DWHU UHVLV
WDQWÀDPHUHWDUGHQW8OWUDÀH[LEOH
WR GHJUHHV )DKUHQKHLW 8/ OLVWHG PHHWV 26+$ UH
TXLUHPHQWV
997-0328
Our No.
LINEAR FLUORESCENT
BULBS
No.
($
PRIME WIRE & CABLE
PLASKOLITE INC
Our No.
10
Red - Sleeved
6KDWWHU UHVLVWDQW FRDWHG ODPS
5DSLGVWDUW.&5,
DYHUDJHOLIHKRXUV´RYHUDOOOHQJWK
Watts
Unit
FOR T8 TUBES
‡75$3,'67$57
‡&22/:+,7(
‡³6$)(/,1(´
No.
Shf
Pk
604-8342X
246-7835
2
‡287'22575,3/(7$3
‡:,7+&,5&8,7%5($.(5
‡³1229(5/2$'´
FOR T12 TUBES - BULK
($
LINEAR FLUORESCENT
BULBS
Our No.
Size
In
No.
2814
EXTENSION CORDS
FEIT ELECTRIC
MEDIUM BI-PIN BASE - 1.1” DIAMETER
839-8844X
Our No.
Yellow - Sleeved - With PowerLite
675-4014
(QGFDSV DUH PDGH RI EODFN KLJK
KHDWSRO\SURS\OHQH8//LVWHG
Lgth
In.
Watts
12/3SJTW - 15 AMP -125 VOLT
Light Bulbs
LINEAR FLUORESCENT
BULBS
15 ($
$$
&OHDU
3RUWDEOHGXSOH[RXWOHWMXQFWLRQER[
IRRW 6-7: ZDWHU UHVLVWDQW
DQG ÀDPH UHWDUGDQW FRUG +HDY\
GXW\SODVWLFFDVHZLWKKLQJHGFRYHU
WRSURWHFWWKHRXWOHWVIURPWKHHOHPHQWV+DVDKDQJLQJ
VORWRQWKHEDFNRIWKHKRXVLQJWRKDQJRQDVFUHZKHDG
'XUDEOH FRQGXFWRU EODGHV DQG JURXQG SLQ WR SUHYHQW
EUHDNRIIRUSXOORXW3RZHURQRIILQGLFDWRUOLJKW*)&,
UHVHWDQGWHVWEXWWRQVDQGFLUFXLWEUHDNHUUHVHWEXWWRQ
Our No.
ACRYLIC SHEETS
Size
In
Shf
Pk
24x48
5
289-7429
Unit
PLASKOLITE INC
481-7086X
&30
Unit
12/3 SJTW - 15 AMP - 1875 WATTS
0LUURUHGDFU\OLFVKHHWLVPDGHZLWK
2SWL[FRQWLQXRXVO\SURFHVVHGDFU\O
LFVKHHW0LUURUL]LQJLVGRQHE\WKH
SURFHVVRIYDFXXPPHWDOOL]LQJZLWK
DOXPLQXPEHLQJWKHSULPDU\PHWDO
HYDSRUDWHG,WIHDWXUHVDWRXJKSURWHFWLYHEDFNFRDWLQJ
7KH GXUDELOLW\ RI WKLV VKHHW PDNHV LW YLUWXDOO\ VFUDWFK
UHVLVWDQWGXULQJIDEULFDWLRQ´WKLFN
No.
Shf
Pk
PRIME WIRE & CABLE
‡0,5525('
Our No.
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
*)
($
54 - Maintenance, Repair & Operations
GFCI OUTLET
ADAPTERS
‡287/(7,1/,1(
‡32:(5,1',&$725/,*+7
‡³6+2&.6$)(´
7ULSOH WDS H[WHQVLRQ FRUG ZLWK
SRZHU LQGLFDWRU OLJKW FRQGXF
WRU 6-7: IHDWXUHV PROGHGRQ DQG ERQGHG YLQ\O SOXJV
DQGFRQQHFWRUVLQOLQHPHFKDQLFDO*)&,FHQWUDOO\SODFHG
DORQJWKHFRUGDQGWHVWDQGUHVHWEXWWRQV6-7:¶
FRUGDPSZDWW
Our No.
No.
Shf
Pk
Color
Unit
PRIME WIRE & CABLE
GF320803
8
<HOORZ
EXTENSION CORDS
‡287'225/,*+7('(1'
‡&2175$&725*5$'(
‡287'22532:(5/,7(
‡&2175$&725*5$'(
*5281'('
‡³<(//2:-$&.(7´
'HVLJQHGIRUKDUGXVDJHODUJHFDS
DQG FRQQHFWRU WKLFN ÀH[LEOH YLQ\O
MDFNHW WKUHH FRQGXFWRU OLJKWHG
HQG WR VKRZ ZKHQ SRZHU LV RQ
6WRUHLQGRRUVZKHQQRWLQXVH8//LVWHGPHHWV26+$
VSHFL¿FDWLRQV
Our No.
Lgth
Ft
No.
Shf
Pk
Unit
([WUD KHDY\ FOHDU PROGHG SOXJV
DUHUXJJHGGXUDEOHDQGRYHUVL]HG
6XSHUÀH[LEOHDQGDEUDVLRQUHVLVWDQWDWDQ\WHPSHUDWXUH
0DGHWRPHHW26+$VSHFL¿FDWLRQVDQG8//LVWHGµ3RZ
HU/LWH¶LQGLFDWRUSOXJJORZVZKHQWKHFRUGKDVSRZHU
Our No.
COLEMAN CABLE INC.
($
25
12
($
403-3684
025880002
50
($
100
Lgth
Ft
Shf
Pk
Unit
12/3SJTW- 15 AMP - 125 VOLT
466-5907
976-2154
No.
COLEMAN CABLE INC.
12/3 SJTW - 15 AMP - 125 VOLT - 1875 WATTS
Yellow - Sleeved
12/3 SJTW - 15 AMP - 1875 WATT
502-9319
EXTENSION CORDS
4
Yellow - Sleeved
675-3685
2883
25
($
3
($
($
14/3SJTW - 13 AMP - 125 VOLT
($
Yellow - Sleeved
GFCI OUTLET
ADAPTERS
675-3131
Our No.
No.
Color
Shf
Pk
Unit
<HOORZ
12
($
PRIME WIRE & CABLE
512-4060
GF420802
Yellow - Sleeved
‡287'225/,*+7('
/2&.,1*&211(&725
‡&2175$&725*5$'(
0ROGHGRQ DQG ERQGHG YLQ\O IH
male connector and mechanical
*)&,PDOHSOXJFRQGXFWRU6-7:
¶FRUGWULSOHWDS
675-3123
&RQWUDFWRUFRUGZLWKOLJKWHGORFNLQJ
FRQQHFWRU 2LO UHVLVWDQW ZDWHU UH
VLVWDQWÀDPHUHWDUGDQW6WD\VÀH[
LEOHGRZQWRGHJUHHV)DKUHQKHLWXSWRGHJUHHV
)DKUHQKHLW 8/ F8/XV /LVWHG DQG &6$ &HUWL¿HG 0HHWV
26+$UHTXLUHPHQWVIRURXWGRRUXVH1HPDSOXJ
Our No.
Lgth
Ft
No.
Color
Shf
Pk Unit
POWER ZONE
Household Electrical
10/3 SJTOW 15 AMP/125 VOLT/1875 WATT
OUTDOOR EXTENSION CORDS
Ultra Heavy Duty - Boxed
EXTENSION CORDS
‡287'225
‡/2&.,1*3/8*
‡³<(//2:-$&.(7´
Our No.
No.
752-6890
253
50
<HOORZ
4
($
759-4864
253
100
<HOORZ
2
($
Color
Shf
Pk
50
<HOORZ
4
($
669-2602
100
<HOORZ
2
($
‡287'225&21'8&725
0HHWV26+$6SHFL¿FDWLRQV8/F8
/XV/LVWHGIRURXWGRRUXVH
Unit
POWER ZONE
12/3SJTW - 15 AMP - 125 VOLT
Neon Green - Sleeved
2
10/3SJTW-A - 15 AMP - 125 VOLT
251
80
2
Yellow - Boxed
($
748-8661
253
50
<HOORZ
4
($
675-3982
2805
50
2
($
752-6429
253
100
<HOORZ
2
($
675-3909
100
2
($
Yellow - Boxed
675-3115
Lgth
Ft
No.
2885
($
100
2
($
4
($
Yellow - Sleeved
675-3107
Color
Shf
Pk Unit
10/3 SJTOW 20 AMP/125 VOLT/2500 WATT
Ultra Heavy Duty - Boxed
767-3494
253
50
<HOORZ
2
($
769-0308
253
100
<HOORZ
2
($
2884
50
EXTENSION CORDS
‡287'225&21'8&725
‡:,7+7%/$'(
‡³<(//2:-$&.(7´
7EODGH IHPDOH SOXJ DFFHSWV WRROV
ZLWK DPS ZLUH DPS ZLUHDQGDPSZLUHSOXJV7
EODGH RQ IHPDOH SOXJ RQO\ 0DGH WR PHHW 26+$ VWDQ
GDUGVDQG8//LVWHG
Our No.
No.
Lgth
Ft
Shf
Pk
Unit
COLEMAN CABLE INC.
10/3SJTW-A - 20 AMP - 125 VOLT
Yellow - Boxed
($
Neon Pink - Sleeved
438-0333
Unit
POWER ZONE
80
Shf
Pk
<HOORZ
Our No.
251
Lgth
Ft
25
&RQWUDFWRU FRUG ZLWK 7EODGH DQG
OLJKWHG ORFNLQJ FRQQHFWRU 2LO UH
VLVWDQW ZDWHU UHVLVWDQW ÀDPH UHWDUGDQW 6WD\V ÀH[LEOH
GRZQWRGHJUHHV)DKUHQKHLWXSWRGHJUHHV)DKU
HQKHLW8/F8/XV/LVWHGDQG&6$&HUWL¿HG0HHWV26+$
UHTXLUHPHQWVIRURXWGRRUXVH1HPDSOXJ
Shf
Pk
No.
253
‡287'225/,*+7('
/2&.,1*&211(&725
‡7%/$'(&2175$&725
*5$'(
EXTENSION CORDS
437-8931
Our No.
745-2279
EXTENSION CORDS
669-2594
No.
([WUDKHDY\FOHDUPROGHGSOXJVDUH
UXJJHGGXUDEOHDQGRYHUVL]HG6XSHUÀH[LEOHDQGDEUD
VLRQ UHVLVWDQW ,QGLFDWRU SOXJ JORZV ZKHQ WKH FRUG KDV
SRZHU0HHWV26+$VSHFL¿FDWLRQVDQG8//LVWHG5HQWDO
Unit
2/3SJTW-A - 15 AMP - 125 VOLT
Our No.
‡287'22532:(5/,7(
‡&2175$&725*5$'(
*5281'('
‡5(17$/
‡³<(//2:-$&.(7´
12/3SJTW-A - 15 AMP - 125 VOLT
COLEMAN CABLE INC.
Lgth
Ft
50
EXTENSION CORDS
Extra Heavy Duty - Boxed
Lgth
Ft
COLEMAN CABLE INC.
12/3 SJTOW 15 AMP/125 VOLT/1875 WATT
µ/RFN-DZ¶ORFNLQJSOXJNHHSVWRROV
SOXJJHG LQ :RUNV ZLWK DQ\ WRRO
$EUDVLRQ UHVLVWDQW DQG ÀH[LEOH 8/
/LVWHG
100
14/3SJTW- 15 AMP - 125 VOLT
EXTENSION CORDS
‡287/(7
‡³6+2&.6$)(´
2888
675-3826
50
2
($
675-4063
100
2
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 55
EXTENSION CORDS
EXTENSION CORDS
EXTENSION CORDS
‡287'2251(0$
‡³675,3(6´
‡287'225&21'8&725
‡287'225/,*+7('
‡75,3/(7$3
6WULSHG KLJK YLVLELOLW\ URXQG YLQ\O
FRUGV LQFUHDVH VDIHW\ DQG GHWHU
WKHIW IHDWXUHV D GRPLQDQW FRORU
and a colored stripe that runs the
OHQJWKRIWKHFRUG3OXJDQGFRQQHFWRUPDWHULDOLVFOHDU
39&ZLWKQHRQSRZHULQGLFDWRUODPSLQWKHFRUGFRQQHF
WRUVKRZVWKDWWKHSRZHULVRQ8//LVWHGDQG&6$&HUWL
¿HG0HHWV26+$UHTXLUHPHQWVIRURXWGRRUXVH
Our No.
Lgth
Ft
No.
Shf
Pk
Unit
:DWHU UHVLVWDQW DQG ÀDPH UHWDU
GDQW8OWUDÀH[LEOHLQWHPSHUDWXUHV
IURPWRGHJUHHV)2YHU
VL]HG SOXJV 6WUDLQ UHOLHI SUHYHQWV
ZLUH IURP VHSDUDWLQJ IURP WKH
SOXJVF8/XV/LVWHG
Our No.
Lgth
Ft.
No.
Unit
Our No.
POWER ZONE
25
40
12
760-6908
100
4
($
8
($
EXTENSION CORDS
Yellow/Purple Stripe
162-7108
025488822
50
0DQXIDFWXUHG ZLWK VWUDQGHG DQG
FDEOHGFRSSHUFRQGXFWRUVDQGVROLG
PROGHGSOXJVIRUORQJHUOLIH2XWHU
MDFNHW ZRQW PDUN ÀRRUV RU ZDOOV
6-7:&RUGVUHVLVWGHWHULRUDWLRQIURPPRLVWXUHDQGDEUD
VLRQYROWZLUHUDWLQJ
Our No.
No.
Lgth
Ft
Shf
Pk
Our No.
Lgth
Ft.
No.
Shf
Pk
Unit
POWER ZONE
35
12
100
2
‡287'225+($9<'87<
‡75,3/(7$3
($
‡287'225&21'8&725
‡5281'9,1</
5DWHG IRU YROW JURXQGHG
0DQXIDFWXUHG ZLWK FRSSHU FRQ
GXFWRUV DQG VROLG PROGHG SOXJV
DQG WZR OD\HUV RI LQVXODWLRQ RQH
DURXQG HDFK FRQGXFWRU DQG D VHFRQG RXWHU MDFNHW WKDW
ZRQ¶WPDUNÀRRUVRUZDOOVDQGUHVLVWVGHWHULRUDWLRQIURP
PRLVWXUHDQGDEUDVLRQ8/F8/XV/LVWHGPHHWV26+$
VSHFL¿FDWLRQV
Lgth
Ft
No.
100
($
Shf
Pk
Unit
14
($
EXTENSION CORDS
‡287'225287/(7
:DWHU UHVLVWDQW DQG ÀDPH UHWDU
GDQW8OWUDÀH[LEOHLQWHPSHUDWXUHV
IURPWRGHJUHHV)6WUDLQ
UHOLHI SUHYHQWV ZLUH IURP VHSDUDW
LQJIURPWKHSOXJF8/XV/LVWHG
EXTENSION CORDS
Our No.
Unit
EXTENSION CORDS
Orange -Sleeved - X Heavy Duty
0518
Shf
Pk
Blue - Sleeved
261-4147
COLEMAN CABLE INC.
441-6939
Lgth
Ft
16/3SJTW - 10 AMP - 125 VOLT
($
Unit
10/3SJTW - 15 AMP - 125 VOLT
No.
COLEMAN CABLE INC.
Green - Sleeved
25
($
'HVLJQHG IRU XVH LQ H[WUHPH FROG
ZHDWKHU HQYLURQPHQWV &RUG ZLOO
VWD\ ÀH[LEOH GRZQ WR GHJUHHV
)DKUHQKHLW 0DQXIDFWXUHG ZLWK
3RZHUOLWHSOXJIHPDOHHQGOLJKWVZKHQSRZHULVRQ8/
/LVWHGPHHWV26+$VSHFL¿FDWLRQV
Our No.
16/3 SJTW - 13 AMP - 125 VOLT - 1625 WATT
977-1049
4
‡287'22532:(5/,7(
‡(;75(0(&2/':($7+(5
:DWHU UHVLVWDQW DQG ÀDPH UHWDU
GDQW8OWUDÀH[LEOHLQWHPSHUDWXUHV
IURPWRGHJUHHV)6WUDLQ
UHOLHI SUHYHQWV ZLUH IURP VHSDUDW
LQJIURPWKHSOXJF8/XV/LVWHG
‡287'225&21'8&725
‡5281'9,1</
50
253
EXTENSION CORDS
‡287'225
‡75,3/(7$3
EXTENSION CORDS
Unit
Yellow - Boxed
($
Red/White Stripe
135-2244
Shf
Pk
12/3 SJTOW 15 AMP/125 VOLT/1875 WATT
White - Sleeved
976-2394
Lgth
Ft
No.
POWER ZONE
16/3SJTW - 13 AMP - 125 VOLT - 1625 WATT
COLEMAN CABLE INC.
12/3 SJTW - 15 AMP - 125 VOLT
Shf
Pk
&RQWUDFWRU FRUG ZLWK OLJKWHG HQG
2LOUHVLVWDQWZDWHUUHVLVWDQWÀDPH
UHWDUGDQW 6WD\V ÀH[LEOH GRZQ WR
GHJUHHV)DKUHQKHLWVWDQGVXS
WR GHJUHHV )DKUHQKHLW 8/ F8/XV /LVWHG DQG &6$
&HUWL¿HG0HHWV26+$UHTXLUHPHQWVIRURXWGRRUXVH
Shf
Pk
Unit
POWER ZONE
Our No.
Lgth
Ft.
No.
Shf
Pk
Unit
POWER ZONE
50
($
Yellow - Sleeved
435-4379
25
25
($
436-6472
25
50
4
($
436-9997
25
100
2
($
Lgth
Ft
No.
25
8
Household Electrical
POWER SUPPLY CORDS
‡*$5%$*(',6326$/
([WUHPH WHPSHUDWXUH FRUG ZLWK
OLJKWHGORFNLQJFRQQHFWRU%OXHZLWK
RUDQJH VWULSH IRU YLVLELOLW\ 2LO UH
VLVWDQW ZDWHU UHVLVWDQW ÀDPH UHWDUGDQW 6WD\V ÀH[LEOH
GRZQWRGHJUHHV)DKUHQKHLWXSWRGHJUHHV)DKU
HQKHLW SHUFHQW OLJKWHU WKDQ VWDQGDUG UXEEHU FRUGV
8/F8/XV/LVWHGDQG&6$&HUWL¿HG0HHWV26+$UHTXLUH
PHQWVIRURXWGRRUXVH
Our No.
780-4438
APPLIANCE REPLACEMENT CORDS
EXTENSION CORDS
‡287'225$//:($7+(5
‡%/8(:,7+25$1*(
675,3(
12/3 SJTW - 13 AMP - 125 VOLT
Lgth
Ft
Black/Orange
Blue/Yellow - Sleeved
25.
No.
POWER ZONE
14/3 SJTW - 15 AMP - 125 VOLT - 1875 WATT
982-0317
Our No.
Shf
Pk
/RZ SUR¿OH ULJKW DQJOH PROGHG
RQ SOXJ ´ LQVXODWLRQ VWULS ZLWK
WZLVWHGDQGWLSWLQQHGHQGVF8/XV
/LVWHG
Our No.
No.
25&
50
5
($
775-5804
25&
100
3
($
20
($
16/3 SPT-3
Extra Heavy Duty - Sleeved
771-6038
Unit
Gray - Sleeved
775-8576
12/3 SJEOW - 15 AMP/125 VOLT/1875 WATT
Shf
Pk
POWER ZONE
Unit
POWER ZONE
Lgth
Ft
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
25
- Maintenance, Repair & Operations
Household Electrical
GENERATOR CORDS
GENERATOR CORDS
‡287'2257:,6772
/2&.
‡³<(//2:-$&.(7´
<HOORZ -DFNHW FRPSRXQG LV PRUH
ÀH[LEOHDQGWKUHHWLPHVPRUHDEUD
sion resistant at any temperature
WKDQ VWDQGDUG YLQ\O FRPSRXQGV RU EOXH FROG ZHDWKHU
FRUGV 7ZLVWWR/RFN PDOH DQG IHPDOH SOXJV SRZHU DPS SRUWDEOH JHQHUDWRUV DQG SRZHU WUDQVIHU VZLWFKHV
8//LVWHG0HHWV26+$VSHFL¿FDWLRQV
Our No.
No.
Lgth
Ft
Shf
Pk
Unit
EXTENSION CORDS
POWER CENTERS
‡287'225287/(7
‡&21'8&725
*5281'('
‡32:(5%/2&.
‡³5+,12%2;´
(QFORVXUHLVPDGHRIFROGUROOHG
JDXJHVWHHOOHJVDUHPDGHRIFROG
UROOHG JDXJH VWHHO VWDFNDEOH
GHVLJQDOORZVPXOWLSOHXQLWVWRORFN
WRJHWKHUIRUWUDQVSRUWDQGVWRUDJH
*)&,DQGRYHUORDGSURWHFWLRQF(7/XVOLVWHG
6ROLG PROGHG RXWOHW SOXJV )RU
WRROVWKDWXVHXSWRDPS0HHWV
26+$VWDQGDUGV8//LVWHG
Our No.
Lgth
Ft
No.
Shf
Pk
Unit
COLEMAN CABLE INC.
Our No.
809-9418
2
10
($
25
CORD REELS
2
($
‡287'225&21'8&725
‡287/(732:(5%/2&.
‡³<(//2:-$&.(7´
POWER BLOCKS
‡287'225287/(7
‡,1/,1(*)&,
32:(5%/2&.
‡³<(//2:-$&.(7´
Our No.
*),SURWHFWHG¶6-7:SRZHU
EORFNFRUGZLWKLQOLQH*)&,FRQYHUWVRXWOHWLQWR*)&,
SURWHFWHGRXWOHWV/LJKWLQGLFDWHVZKHQWKHSRZHULVRQ
DPSYROWZDWW0HHWV26+$VSHFL¿FDWLRQV
8/OLVWHG
No.
‡&,5&8,7%5($.(5
‡*5281'('5(&(37$&/(6
7KUHH RXWOHW DGDSWHUV ZLWK KLJK
JORVVH[WUDGXUDEOHVXSHUÀH[LEOH
ZLUH 6ROLG PROGHG SRZHU EORFN
KHDG VWDQGV XS WR KHDW FROG DQG URXJK XVH 0DGH WR
PHHW26+$VWDQGDUGVDQG8//LVWHG
GFCI EXTENSION
CORDS
Our No.
QUAD PLUG CORD
REELS
EXTENSION CORDS
Household Electrical
Cord
Lgth Ft
Shf
Pk
Unit
COLEMAN CABLE INC.
No.
Lgth
Ft
Shf
Pk
Unit
COLEMAN CABLE INC.
12/3SJTW-A - 15 AMP - 125 VOLT - 300 VOLT INSULATED
WIRE
Yellow - Sleeved
675-3735
50
1
2882
2
10
($
Yellow - Sleeved
2
EXTENSION CORDS
‡287'225287/(7
‡+($9<'87<
&2175$&725*5$'(
‡³75,6285&(´
‡287'225287/(7
‡&21'8&725*5281'('
‡32:(5%/2&.
6ROLG PROGHG URXQG YLQ\O SRZHU
EORFNRXWOHWSOXJV0HHWV26+$
VWDQGDUGV 8/ /LVWHG 7KH RXWHU
MDFNHWUHVLVWVGHWHULRUDWLRQIURPPRLVWXUHDEUDVLRQDQG
H[WHQGHGH[SRVXUHWRVXQOLJKWYROWZLUHUDWLQJ
Our No.
No.
Lgth
Ft
Shf
Pk
Unit
COLEMAN CABLE INC.
Lgth
Ft
No.
Orange - Sleeved
675-4188
50
3
($
675-4170
0820
100
2
($
14/3SJTW-A - 15 AMP - 125 VOLT
0825
25
12
($
675-4048
50
($
651-2479
Shf
Pk
043888802
50
4
($
091-8805
100
3
($
‡287/(732:(5%/2&.6
‡&21'8&725*5281'('
Lgth
Ft
Shf
Pk
Unit
30
1
($
Household Electrical
‡&21'8&725
‡*5281'('287'225
‡³<$5'67$.(´
Three outlets provide outdoor
SRZHUZKHUHQHHGHG7KHURWDWLQJ
KHDG PRYHV DV \RX ZRUN DURXQG
WKH\DUG*UHHQFRORUYROWZDWWV8//LVWHG
No.
Cord
Lgth Ft
Shf
Pk
Unit
COLEMAN CABLE INC.
16/3 SJTW-A
675-4105
Shf
Pk
Unit
AWG 12/3STW - 15 AMP - 125 VOLT - 1875 WATT
Yellow - Sleeved
2
No.
MULTI-OUTLET STRIPS
POWER ZONE
25$'
($
Orange
675-4196
Our No.
6ROLG PROGHG RXWOHW SOXJV )RU
WRROVWKDWXVHXSWRDPS0HHWV
26+$VWDQGDUGV8/F8/XV/LVWHG
435-2019
4
STAKE OUTLETS
220-5839
Lgth
Ft
.
‡287/(732:(5%/2&.
‡&21'8&725*5281'
Unit
10/3 SJTW - 15 AMP - 125 VOLT - 1875 WATTS
No.
2UDQJH
Unit
RETRACTABLE CORD
REELS
COLEMAN CABLE INC.
Our No.
Shf
Pk
16/3SJTW-A - 10 AMP - 125 VOLT
EXTENSION CORDS
Orange - Sleeved
675-4030
Color
COLEMAN CABLE INC.
Yellow - Boxed
12/3SJTW-A - 15 AMP - 125 VOLT
No.
BAYCO PRODUCTS
Our No.
'HVLJQHGIRUKDUGXVH7KUHHRXW
OHW ODUJH FDS DQG FRQQHFWRU WKLFN
WRXJKÀH[LEOHYLQ\OMDFNHW0ROGHGFRQQHFWRULVPRLVWXUH
UHVLVWDQW0HHWV26+$VSHFL¿FDWLRQV8//LVWHGIRURXW
GRRUDQGLQGRRUXVH
Our No.
Our No.
6ROLGPROGHGSOXJVWHHOFDVHZLWK
KDQJLQJ KDUGZDUH 0HHWV 26+$
VSHFL¿FDWLRQV
($
EXTENSION CORDS
,PSDFW UHVLVWDQW SRO\SURS\OHQH
KDQG ZLQG UHHO ZRUNV ZLWK DOPRVW
DQ\ VLQJOH WDS H[WHQVLRQ FRUG
+ROGVXSWR¶RIRUJDXJHH[WHQVLRQFRUGVRUXS
WR¶RIJDXJH6WHHOVWDQGZLWKJULSKDQGOHSRODU
L]HGSOXJZLWKJURXQGHGUHFHSWDFOHVUHVHWWDEOHDPS
FLUFXLWEUHDNHUOE
($
2
($
675-3990 2820 100
12/3STW-A - 15 AMP - 125 VOLT - 600 VOLT INSULATED
WIRE
Yellow - Sleeved - X Heavy Duty
675-3230
12/3 SJTW - 15 AMP - 120 VOLT - 1800 WATT
688-1866
($
Household Electrical
10/4 STW - 30 AMP - 250 VOLT
1
5%0(
Orange - Sleeved
COLEMAN CABLE INC.
218-2939
Unit
COOPER WIRING
802-3962
12/3STW - 15 AMP - 125 VOLT
Shf
Pk
No.
10
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
12428
15
3
($
Maintenance, Repair & Operations - MULTIPLE OUTLET
STRIPS
MULTIPLE OUTLET
STRIPS
MULTIPLE OUTLET
CORDS
‡287/(70(7$/
‡³3/8*02/'728*+´
‡287/(7675$,*+7
3/8*
‡287/(7
‡+286(+2/'86(
3RZHUVWULSSOXJVLQWRH[LVWLQJRXW
OHWV ZLWK QR KDUGZLULQJ KDV D ¶
FRUGLV´ORQJDQGSURYLGHV¿YH
GXSOH[DPSYROWUHFHSWDFOHVIRUDWRWDORIRXW
OHWV5XJJHGPHWDO³GLDPRQGSODWH´KRXVLQJEXLOWLQFLU
FXLWEUHDNHUGHVLJQHGIRUJDUDJHRUZRUNVKRSWRPRXQW
RQWKHZDOORUZRUNEHQFK0RXQWLQJKDUGZDUHLQFOXGHG
8/DQGF8//LVWHG
6WUDLJKW SOXJ FRQYHUWV RQH RXWOHW
LQWRVL[ZLWKEXLOWLQFLUFXLWEUHDNHU
VZLWFKHVWRSUHYHQWRYHUORDGV5DW
HGDPSYROWZDWWV8/OLVWHG
&RQYHUWVRQHRXWOHWLQWRVL[$OORZV
IRU FRQQHFWLRQ RI RYHUVL]H SOXJV
DQG WUDQVIRUPHUV &LUFXLW EUHDNHU
ZLWKUHVHWIHDWXUHVKXWVSRZHURIILIRYHUORDGHG&RUGV
DUH6-739&SRZHUVXSSO\FRUGLV¶ORQJEUDQFK
HVDUH´ORQJ5DWHGDPSYROWZDWW%ODFN
FDUGHG8/OLVWHG
Our No.
Lgth/
In
No.
Shf
Pk
Unit
WIREMOLD COMPANY
296-4294
48
307&
3
Cord Lgth
In
White - Carded
Shf
Pk
Color
Unit
24
,YRU\
12
($
POWER ZONE
791-5655
25
18
12
($
800-6967
Our No.
No.
Cord Lgth
Ft
Shf
Pk
Unit
Unit
POWER ZONE
($
25
Our No.
No.
Cord Lgth
Ft
3RZHUVWULSRXWOHWVDPS
YROWZDWWVF8/XV/LVWHG
Our No.
4
No.
Cord Lgth
In
Shf
Pk
Unit
12
3.
Color
Shf
Pk
Unit
:KLWH
12
($
Color
Shf
Pk
Unit
Gray
POWER ZONE
White
798-2861
25;
18
($
MULTIPLE OUTLET
STRIPS
‡287/(76
‡³:22'6´
6OLGLQJ VDIHW\ RXWOHW FRYHUV /LJKW
HGVZLWFK¶FRUGF8/XV/LVWHG
+HDY\ GXW\ PHWDO FDVH ZRUNVKRS
SRZHUVWULSFRQYHUWVVWDQGDUGZDOO
RXWOHWLQWRJURXQGHGRXWOHWVZLWK
EXLOWLQ FLUFXLW EUHDNHU WUDQVIRUPHU RXWOHWV 5DWHG DPSYROWZDWWV8/OLVWHG
0412018821
:KLWH
Shf
Pk
Our No.
No.
COLEMAN CABLE INC.
683-2349
041401
Unit
Black - Carded
($
796-2657
MULTIPLE OUTLET
STRIPS
Color
Shf
Pk Unit
PRIME WIRE & CABLE
%ODFN
($
No.
Cord Lgth
Ft
‡287/(76
‡0(7$/
‡³:22'6´
6OLGLQJ VDIHW\ RXWOHW FRYHUV /LJKW
HGVZLWFK¶FRUGF8/XV/LVWHG
Our No.
3RZHUVWULSSOXJVLQWRH[LVWLQJRXW
OHWV ZLWK QR KDUGZLULQJ ¶ FRUG
ULJKW DQJOH SOXJ VDIHW\ FRYHUV
EXLOWLQ FLUFXLW EUHDNHU 5DWHG DPSYROWZDWWV8/OLVWHG
Our No.
MULTIPLE OUTLET
STRIPS
682-4841
Shf
Pk
Unit
POWER ZONE
($
795-8085
25
8
No.
COLEMAN CABLE INC.
White - Carded
4’ - 12 Outlet
3%3%
10
‡287/(7
:RUNVKRSSRZHUVWULSKDVDKHDY\
GXW\ PHWDO FDVH OLJKWHG RQRII
FLUFXLWEUHDNHUVZLWFKDQGZLGH
VSDFHG WUDQVIRUPHU RXWOHWV &RPHV ZLWK D JDXJH
SURQJSRZHUFRUG0RXQWVWRDZDOORUZRUNEHQFKZLWK
LQFOXGHGKDUGZDUH1RWDVXUJHSURWHFWRU
No.
25
MULTIPLE OUTLET
STRIPS
‡75$16)250(5287/(76
‡:25.6+230(7$/&$6(
047-4866
4
Unit
POWER ZONE
COLEMAN CABLE INC.
Our No.
Shf
Pk
‡287/(7:25.6+23
‡0(7$/&$6(
3RZHU VWULS DGGV PRUH RXWOHWV
ZKHUHQHHGHG6OLGLQJRXWOHWVDIHW\
FRYHUV 6LGH HQWU\ RXWOHWV ¿W PRUH DFFHVVRULHV F8/XV
/LVWHG
683-2331
4
Shf
Pk
‡287/(7
MULTIPLE OUTLET
STRIPS
Color
2563<%/.
Cord Lgth
Ft
MULTIPLE OUTLET
STRIPS
3RZHUVWULSSOXJVLQWRH[LVWLQJRXW
OHWV ZLWK QR KDUGZLULQJ KDV D ¶
FRUG LV ´ ORQJ &RQYHUWV VLQJOH
RXWOHW WR ZLGHVSDFHG WUDQV
IRUPHU RXWOHWV 8QOLJKWHG RQRII VZLWFK 5DWHG DPS
YROWZDWWV8/OLVWHG
800-5118
($
‡287/(76
‡:$//7$36,'((175<
‡³:22'6´
No.
No.
25
Black
MULTIPLE OUTLET
STRIPS
Our No.
Our No.
793-0365
COOPER WIRING
9
Unit
POWER ZONE
‡287/(7:25.6+23
7KHUPRSODVWLF KLJKLPSDFW VWULS
converts single outlet to multiple
RXWOHWV 5DWHG DPS YROW
DQGZDWWV&LUFXLWEUHDNHUZLWKUHVHWIHDWXUHVKXWV
SRZHURIILIRYHUORDGHG8/OLVWHG6-7¶FRUG
608-8645
Shf
Pk
MULTIPLE OUTLET
STRIPS
‡287/(7&219(57(56
3/$67,&
No.
No.
($
MULTIPLE OUTLET
STRIPS
Our No.
Our No.
8
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
041550
($
58 - Maintenance, Repair & Operations
MULTIPLE OUTLET
TIMERS
SURGE PROTECTOR
TAPS
SURGE PROTECTOR
TAPS
‡0(&+$1,&$/287/(76
‡,1'225
‡287/(76$)(7<
&29(56
‡+286(+2/'86(
‡287/(7
‡³:22'6´
%XLOWLQ WLPHU KHOSV FRQWURO FRVWV
DQG DYRLG ZDVWLQJ HQHUJ\ )RXU
SOXJJHGLQDSSOLDQFHVFDQEHWLPHG
WR WXUQ RII DW VHW WLPHV DQG WKH RWKHU IRXU RXWOHWV DUH
VZLWFKRSHUDWHGF\FOHVSHUGD\0DQDJHFRPSXWHUV
JDPLQJ FRQVROHV WHOHYLVLRQV DQ\ GHYLFH WKDW FDQ EH
SRZHUHG RII ZKHQ QRW LQ XVH 6HW ODPSV WR WXUQ RQ DW
GXVNWRDFKLHYHDOLYHGLQORRNWRGHWHUEXUJODUV)HDWXUHV
1(9(5/26(SLQVWKDWZLOOVWD\LQSODFH¶FRUGDPS
YROWZDWW&RPSDWLEOHZLWK&)/EXOEV
Our No.
No.
Color
Shf
Pk
&RQYHUWV RQH RXWOHW LQWR VL[ ZLWK
EXLOWLQ FLUFXLW EUHDNHU VZLWFKHV WR
SUHYHQWRYHUORDGV6OLGLQJRXWOHWVDIHW\FRYHUVFORVHRXW
OHWVQRWLQXVH5DWHGMRXOHDPSYROW
ZDWWV8/OLVWHG
Our No.
No.
Color
Shf
Pk
:KLWH
8
Unit
POWER ZONE
804-3739
25
:KLWH
($
‡287/(7:,7+7,0(5
6HYHQGLIIHUHQWWLPHUF\FOHVWRVHW
DVFKHGXOH2QFHVHWWKHF\FOHUH
SHDWV GDLO\ XQWLO FKDQJHG $FFRP
PRGDWHVXSWRGLIIHUHQWSOXJJHG
LQ LWHPV +DUG\ ZHDWKHUSURRI JDXJH¶FRUGDQGUDLQWLJKWWLPHUDQGRXWOHWFRYHU9
$:5HVLVWLYH9$:7XQJVWHQ
Color
Shf
Pk
Green
Our No.
No.
Joule
Rating
Shf
Pk
Unit
COLEMAN CABLE INC.
683-0913
041152
($
SURGE PROTECTOR
TAPS
‡287/(7
25
8
No.
Joule
Rating
Shf
Pk
Unit
041153
1000
($
($
Cord Lgth
Ft
Shf
Pk
Unit
POWER ZONE
Black - Carded
25
15
4
($
+RXVHKROG XVH VXUJH SURWHFWRU
)XOOOLQHSURWHFWLRQDJDLQVWVXUJ
HV WKURXJK KRW QHXWUDO RU JURXQG OLQHV EXLOWLQ FLUFXLW
EUHDNHU VZLWFKHV WR SUHYHQW DJDLQVW RYHUORDGV 6DIHW\
FRYHUV FORVH RXWOHWV QRW LQ XVH 6XSHULRU -RXOH UDWLQJV
DQGFODPSLQJYROWDJHUDWLQJV5DWHGMRXOHDPS
YROWZDWWV8/OLVWHG
Our No.
Unit
No.
Cord Lgth
Ft
Shf
Pk
Unit
12
($
POWER ZONE
Black - Carded
SURGE PROTECTOR
TAPS
($
No.
‡287/(76$)(7<
&29(56
‡+286(+2/'86(
PHONE / FAX / DSL PROTECTION
:KLWH
Our No.
3URWHFWV YDOXDEOH HTXLSPHQW IURP
GDQJHURXVVSLNHVDQGHQHUJ\VXUJ
HV6XUJHSURWHFWLRQDODUP*URXQG
LQGLFDWRU6OLGLQJVDIHW\FRYHUV(0,5),QRLVH¿OWUDWLRQ
*UD\FRORUF8/XV/LVWHG
683-0947
POWER ZONE
803-2278
SURGE PROTECTOR
STRIPS
COLEMAN CABLE INC.
Color
041000
‡287/(76
‡³:22'6´
Our No.
RXWOHW-RXOHVXUJHWDSZKLWH
5DWHG DPS YROW DQG ZDWWV %XLOWLQ FLUFXLW EUHDNHU WR
SURWHFWDJDLQVWRYHUORDGV3URWHFW
HGDQGJURXQGHGLQGLFDWRUOLJKWV
No.
682-4858
813-9164
SURGE PROTECTOR
TAPS
($
SURGE PROTECTORS
Our No.
Gray
Unit
COLEMAN CABLE INC.
+RXVHKROGXVHPHWDOVXUJHSURWHF
WRU )XOO OLQH SURWHFWLRQ DJDLQVW
VXUJHV WKURXJK KRW QHXWUDO RU
JURXQG OLQHV EXLOWLQ FLUFXLW EUHDNHU VZLWFKHV WR SUH
YHQW DJDLQVW RYHUORDGV WUDQVIRUPHU SDGV 6XSHULRU
-RXOHUDWLQJVDQGFODPSLQJYROWDJHUDWLQJV5DWHG
MRXOHDPSYROWZDWWV8/OLVWHG
3URWHFWV YDOXDEOH HTXLSPHQW IURP
GDQJHURXVVSLNHVDQGHQHUJ\VXUJ
HV6XUJHSURWHFWLRQLQGLFDWRU6OLG
LQJVDIHW\FRYHUV(0,5),QRLVH
¿OWUDWLRQ*UD\FRORUF8/XV/LVWHG
Unit
Household Electrical
Shf
Pk
Shf
Pk
‡287/(760(7$/
‡+286(+2/'86(
COLEMAN CABLE INC.
626-0053
Color
SURGE PROTECTOR
STRIPS
‡287/(76
No.
No.
($
SURGE PROTECTOR
TAPS
YARD STAKES
Our No.
Our No.
Unit
COLEMAN CABLE INC.
327-0485
3URWHFW YDOXDEOH HTXLSPHQW IURP
GDQJHURXVVSLNHVDQGHQHUJ\VXUJ
HV:LWKVXUJHDODUP6XUJHHQHUJ\
UDWLQJMRXOHVF8/XV/LVWHG
812-7839
25
4
‡287/(76
‡³:22'6´
SURGE PROTECTOR
TAPS
3URWHFWV YDOXDEOH HTXLSPHQW IURP
GDQJHURXVVSLNHVDQGHQHUJ\VXUJ
HV6XUJHSURWHFWLRQLQGLFDWRU6OLG
LQJVDIHW\FRYHUV(0,5),QRLVH¿OWUDWLRQ*UD\FRORU
F8/XV/LVWHG
‡287/(7
6XUJHSURWHFWHGRXWOHWMRXOH
VXUJHWDS%XLOWLQFLUFXLWEUHDNHUWR
SURWHFWDJDLQVWRYHUORDGV*URXQG
HGJUHHQOLJKW3URWHFWHGUHGOLJKW
5DWHGDPSYROWDQGZDWWV
Our No.
No.
Our No.
25
Joule
Rating
Shf
Pk
Unit
COLEMAN CABLE INC.
Color
Shf
Pk
:KLWH
8
682-4874
Unit
POWER ZONE
803-7921
No.
($
041104
($
SURGE PROTECTOR
STRIPS
‡287/(7675$,*+7
3/8*
‡+286(+2/'86(
+RXVHKROG XVH VXUJH SURWHFWRU
VWUDLJKWSOXJ)XOOOLQHSURWHFWLRQ
DJDLQVWVXUJHVWKURXJKKRWQHXWUDORUJURXQGOLQHVEXLOW
LQFLUFXLWEUHDNHUVZLWFKHVWRSUHYHQWDJDLQVWRYHUORDGV
6XSHULRU -RXOH UDWLQJV DQG FODPSLQJ YROWDJH UDWLQJV
5DWHGMRXOHDPSYROWZDWWV8/OLVWHG
Our No.
No.
Cord Lgth
In
Shf
Pk
Unit
12
($
POWER ZONE
White - Carded
811-2807
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
25
18
Maintenance, Repair & Operations - SURGE PROTECTOR
STRIPS
SURGE PROTECTOR
STRIPS
SURGE PROTECTOR
STRIPS
‡287/(76$)(7<
&29(56
‡287/(7608/7,0(',$
‡5-5--&20%2&2$;
&211(&7,216
‡287/(7
‡32:(5&21752/
‡³60$57675,3´
'HVLJQHGIRUXVHZLWKKRPHWKHDWHU
DQG KRPH RI¿FH HOHFWURQLF HTXLS
PHQW)XOOOLQHSURWHFWLRQDJDLQVWVXUJHVWKURXJKKRW
QHXWUDORUJURXQGOLQHVEXLOWLQFLUFXLWEUHDNHUVZLWFKHV
WRSUHYHQWDJDLQVWRYHUORDGV6XSHULRU-RXOHUDWLQJVDQG
FODPSLQJ YROWDJH UDWLQJV 3URWHFWHG DQG JURXQGHG LQGL
FDWRU OLJKWV +DV URWDWLQJ RXWOHWV ZLWK 5-5- FRQ
QHFWLRQV IRU '6/%URDGEDQG SKRQH ID[ DQG PRGHP
SURWHFWLRQ DQG FRD[ FRQQHFWLRQV IRU SURWHFWLQJ EURDG
EDQGFDEOHPRGHPVDQGFDEOH79&OHDQVGDWDVLJQDOVWR
HOLPLQDWHH[FHVVQRLVHDQGGLVWRUWLRQ5DWHGMRXOH
DPSYROWZDWWV:KLWHFDUGHG8/OLVWHG
&RPELQHV VXUJH SURWHFWLRQ ZLWK
DXWRPDWLF SRZHU FRQWURO ,W DXWR
PDWLFDOO\WXUQVRIISRZHU WR SULQWHUV '9' SOD\HUV DQG
RWKHUHOHFWURQLFVZKHQWKH\DUHQRWLQXVHVDYLQJHOHF
WULFLW\DQGPRQH\RXWOHWVZLWKWUDQVIRUPHUVSDFHG
¶FRUGVXUJHHQHUJ\UDWLQJMRXOHV8//LVWHG
6OLGLQJ VDIHW\ FRYHUV FORVH RXWOHWV
QRW LQ XVH 3URWHFWHG LQGLFDWRU
OLJKW IRRW FRUG ZLWK ORZSUR¿OH
SOXJMRXOHVDPSYROWZDWWV8/
UG(GLWLRQFRPSOLDQW(0,5),¿OWHULQJDXWRVKXWGRZQ
WHFKQRORJ\:KLWHFDUGHG
Our No.
Cord Lgth
Ft
No.
Shf
Pk
Unit
POWER ZONE
982-1968
8
25
8
($
Our No.
SURGE
PROTECTOR STRIPS
818-1539
5DWHG DPS YROW ZDWWV DQG VXUJH HQHUJ\ UDWLQJ RI
MRXOHV YROW FODPSLQJ
(0,5),¿OWHULQJN+]P+]RXWOHWVDOZD\V
RQ PDVWHU ZLWK HQHUJ\ VDYHU RXWOHWV WKDW WXUQ RII
ZKHQ WKH PDVWHU GRHV ¶ SRZHU FRUG ZLWK ORZ SUR¿OH
SOXJ8/F8/XV/LVWHG
No.
Color
Shf
Pk
Unit
POWER ZONE
6 FOOT CORD
463-4689
25(6
:KLWH
2
($
SURGE PROTECTOR
STRIPS
‡287/(7)8//
3527(&7,21
Full protector plastic strip converts
standard grounding receptacle to
VXUJH SURWHFWRU IRU VWHUHRV 79V
FRPSXWHUV RU RWKHU HOHFWURQLFEDVHG HTXLSPHQW 5DWHG
DPSYROW&ODPSLQJOHYHOYROW6XUJHHQHUJ\
UDWLQJ-RXOHV0D[LPXPVXUJHFXUUHQWDPS
Our No.
No.
Color
Shf
Pk
Unit
Shf
Pk
Unit
25
2
4’ CORD
9
,YRU\
&'
‡287/(708/7,0(',$
'HVLJQHG IRU XVH ZLWK KRPH WKH
DWHU DQG KRPH RI¿FH HOHFWURQLF
HTXLSPHQW )XOO OLQH SURWHFWLRQ
DJDLQVW VXUJHV WKURXJK KRW QHX
WUDO RU JURXQG OLQHV EXLOWLQ FLUFXLW EUHDNHU VZLWFKHV WR
SUHYHQW DJDLQVW RYHUORDGV 6XSHULRU -RXOH UDWLQJV DQG
FODPSLQJ YROWDJH UDWLQJV 3URWHFWHG DQG JURXQGHG LQGL
FDWRUOLJKWVDQGOLJKWHGRQRIIVZLWFK+DVRQHLQDQGRQH
RXW5-FRQQHFWLRQVIRUSKRQHID[DQGPRGHPSURWHF
WLRQDQGWZRLQDQGWZRRXWFRD[FRQQHFWLRQVIRUSURWHFW
LQJEURDGEDQGFDEOHPRGHPVDQGFDEOH79&OHDQVGDWD
VLJQDOV WR HOLPLQDWH H[FHVV QRLVH DQG GLVWRUWLRQ 7KUHH
WUDQVIRUPHU SDGV +' 79 UHDG\ 5DWHG -RXOH DPSYROWZDWWV%ODFNFDUGHG8/OLVWHG
No.
Cord Lgth
Ft
25
%ODFN
($
($
Unit
COLEMAN CABLE INC.
483-6037
CONNECTIVITY WITH COAX
239-8386
%ODFN
‡287/(76
‡³:22'6´
SURGE PROTECTOR
STRIPS
‡08/7,0(',$
‡5-&2$;
&211(&7,216
'HVLJQHGIRUXVHZLWKKRPHWKHDWHU
DQG KRPH RI¿FH HOHFWURQLF HTXLS
PHQW)XOOOLQHSURWHFWLRQDJDLQVWVXUJHVWKURXJKKRW
QHXWUDORUJURXQGOLQHVEXLOWLQFLUFXLWEUHDNHUVZLWFKHV
WRSUHYHQWDJDLQVWRYHUORDGV6XSHULRU-RXOHUDWLQJVDQG
FODPSLQJYROWDJHUDWLQJV3URWHFWHGDQGJURXQGHGLQGLFD
WRUOLJKWV+DVRQHLQDQGRQHRXW5-FRQQHFWLRQVIRU
SKRQH ID[ DQG PRGHP SURWHFWLRQ DQG RQH LQ DQG RQH
RXWFRD[FRQQHFWLRQVIRUSURWHFWLQJEURDGEDQGFDEOHPR
GHPVDQGFDEOH79&OHDQVGDWDVLJQDOVWRHOLPLQDWHH[
FHVVQRLVHDQGGLVWRUWLRQ5DWHGDPSYROW
ZDWWV:KLWHFDUGHG8/OLVWHG
Our No.
Cord Lght
Ft
No.
Shf
Pk
Shf
Pk
3URWHFWV YDOXDEOH HTXLSPHQW IURP
GDQJHURXVVSLNHVDQGHQHUJ\VXUJ
HV6XUJHSURWHFWLRQDQGJURXQGLQ
GLFDWRUV/LWUHVHWRQRIISRZHUDQG$FLUFXLWEUHDNHU
VZLWFKHVWUDQVIRUPHURXWOHWV5LJKWDQJOHSOXJ6OLGLQJ
VDIHW\FRYHUV(0,5),QRLVH¿OWUDWLRQ%ODFNFRORUF8
/XV/LVWHG
Our No.
2
No.
Joule
Rating
Cord Lgth
Ft
Shf
Pk
Unit
COLEMAN CABLE INC.
683-1713
1250
4
($
683-1739
1250
10
($
4
($
4
($
PHONE / FAX / DSL PROTECTION
683-1754
1500
4
SATELLITE / CABLE PROTECTION
Unit
POWER ZONE
683-1762
1500
4
1250 JOULE
815-5244
25
4
4
($
4
($
1800 JOULE
816-5680
25
&RPELQHV VXUJH SURWHFWLRQ ZLWK
DXWRPDWLF SRZHU FRQWURO ,W DXWR
PDWLFDOO\WXUQVRIISRZHU WR SULQWHUV'9'SOD\HUV DQG
RWKHU HOHFWURQLFV ZKHQ WKH\ DUH QRW LQ XVH RXWOHWV
ZLWKWUDQVIRUPHUVSDFHG¶FRUGVXUJHHQHUJ\UDWLQJ
MRXOHV8//LVWHG
No.
267-5999
Our No.
Shf
Pk
%ODFN
4
($
4
($
Unit
683-2034
Joule
Rating
Shf
Pk
Unit
2000
3
($
3
($
PHONE / FAX / DSL PROTECTION
3000
SATELLITE / CABLE / PHONE / FAX / DSL PROTECTION
683-2323
W/PHONE - 2-COAX/DATA
%ODFN
No.
COLEMAN CABLE INC.
683-2059
Color
COLEMAN CABLE INC.
228-4248
‡287/(76
‡³:22'6´
3URWHFWV YDOXDEOH HTXLSPHQW IURP
GDQJHURXVVSLNHVDQGHQHUJ\VXUJ
HV 6XUJH SURWHFWLRQ DQG JURXQG
LQGLFDWRUV%OX%DU³3RZHU2Q´LQGLFDWRU/LWUHVHWRQRII
SRZHU DQG $ FLUFXLW EUHDNHU VZLWFKHV WUDQVIRUPHU
RXWOHWVIRRWFRUG5LJKWDQJOHSOXJ6OLGLQJVDIHW\FRY
HUV(0,5),QRLVH¿OWUDWLRQ%ODFNFRORUF8/XV/LVWHG
SURGE PROTECTOR
STRIPS
Our No.
SURGE PROTECTOR
STRIPS
Unit
POWER ZONE
816-8015
Shf
Pk
SURGE PROTECTOR
STRIPS
‡287/(7+($9<'87<
‡32:(5&21752/
‡³60$57675,3´
SURGE PROTECTOR
STRIPS
Our No.
Color
($
COOPER WIRING
681-9155
No.
POWER ZONE
‡287/(7(1(5*<6$9(5
Our No.
Cord Lgth
Ft
No.
Our No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
3000
3
($
- Maintenance, Repair & Operations
Household Electrical
SURGE PROTECTOR
STRIPS
GFCI SURGE
PROTECTORS
‡287/(76
‡³:22'6´
‡6,1*/(287/(7
‡³<(//2:-$&.(7´
3URWHFWV YDOXDEOH HTXLSPHQW
IURP GDQJHURXV VSLNHV DQG HQ
HUJ\ VXUJHV 6XUJH SURWHFWLRQ DQG
JURXQGLQGLFDWRUV/LWUHVHWRQRIISRZHUDQG$FLUFXLW
EUHDNHUVZLWFKHVIRRWFRUG5LJKWDQJOHSOXJ6OLGLQJ
VDIHW\FRYHUV(0,5),QRLVH¿OWUDWLRQ*UD\FRORUF8/XV
/LVWHG
Grounded single outlet adapter
GHWHFWV SRZHU OHDNV DQG VKXWV RII
electricity in less than a second to
SUHYHQWVKRFN7HVWDQGUHVHWEXWWRQV
Our No.
No.
Joule
Rating
Shf
Pk
Unit
Our No.
CLAMP LIGHTS
BROODER LAMPS
ZDWW
Shf
Pk
No.
Unit
Our No.
COLEMAN CABLE INC.
295-3479
($
683-0962
041455
1000
($
)XOOOLQHSURWHFWLRQDJDLQVWVXUJ
HVWKURXJKKRWQHXWUDORUJURXQG
OLQHV %XLOWLQ FLUFXLW EUHDNHU
VZLWFKHV WR SUHYHQW DJDLQVW RYHU
ORDGV+DVURWDWLQJRXWOHWVMRXOH
Unit
POWER ZONE
814-9619
25
4
+LJKJORVVVXSHUÀH[LEOHZLUHKLJK
KHDWUHVLVWDQWEXOEFROODUJURXQGHG
PHWDOJXDUGDPSJURXQGHGUH
FHSWDFOHLQKDQGOHDQGGXDOKRRNV+H[VKDSHFDJHKHOSV
GLUHFW OLJKWZKHUHQHHGHG&RDWHGZLUHFDJHNHHSVKRW
UHÀHFWRUIURPVNLQRUXSKROVWHU\<HOORZFRUGVOHHYHG
%XOEUDWLQJZDWW0DGHWRPHHW26+$VWDQGDUGVDQG
8//LVWHG
($
Our No.
Cord
Lgth Ft
No.
Shf
Pk
675-3073
‡:+2/(+286(
‡3+21($1'&2$;
‡³685*(%5($.(53/86´
Shf
Pk
Unit
SQUARE D
6'6%&
12
1
3DWHQWHG GXDO KRRN V\VWHP KDQJ
E\ WKH JXDUG RU KDQGOH +HDW UH
VLVWDQW KRXVLQJ VWD\V FRRO HYHQ ZLWK VKRUW QHFN EXOEV
5RXQG ÀH[LEOH YLQ\O MDFNHW 0HHWV 26+$ VSHFL¿FDWLRQV
IRUWHPSRUDU\OLJKWLQJ8/UDWHGIRUZDWWEXOEV8/
/LVWHG
Our No.
Cord
Lgth Ft
No.
Shf
Pk
Unit
COLEMAN CABLE INC.
Shf
Pk
Unit
LEVITON MFG
5$&6
18/2 SPT-2 - 150 WATT - 125 VOLT
Black
12
4
($
Orange Cord - Sleeved
675-4162
25
12
($
675-4154
50
($
3
675-4055
%$
Shf
Pk
Unit
2551
($
LED WORK LIGHTS
5HPRYDEOH OLJKW URWDWHV GH
JUHHV GHJUHH WLOW DQJOH 8VH
/(' WLJKW IRFXV VSRWOLJKW EHDP
OXPHQVKUVUXQWLPH/('
ÀRRGOLJKWOXPHQVKUVUXQWLPHRUIRUPD[LPXP
OLJKW /(' ERWK VSRW DQG ÀRRG OXPHQV KUV
UXQWLPH/('VKDYHKRXUOLIH8VHIUHHVWDQGLQJ
ZLWK FODPS WKDW DWWDFKHV WR VTXDUH DQG URXQG REMHFWV
DVKDQGKHOGRUZLWKVWURQJPDJQHWDWWDFKHGWRDQ\VWHHO
VXUIDFH$$$DONDOLQHEDWWHULHVLQFOXGHG
Color
Shf
Pk
:KLWH
858-3387X
Unit
BAYCO PRODUCTS
383-6236
($
Cord
Lgth Ft
No.
Color
Shf
Pk
Unit
BAYCO PRODUCTS
)LWV &ODPSOLJKW PRGHOV DQG
$FFHSWV FRUG FRUURVLRQ
UHVLVWDQWWHUPLQDOV,QFOXGHVPRLV
WXUHJDVNHWVDQGHOHFWULFDOLQVXODWRUZDWWYROW
&DUGHG
No.
No.
COLEMAN CABLE INC.
Our No.
‡325&(/$,1
‡0(',80%$6(
Our No.
Our No.
‡/('&/$0367</(
‡+$1'6)5((0$*1(7,&
16/3 SJT - 13 AMP - 125 VOLT
REPLACEMENT
SOCKETS
6WUXFWXUHGPHGLDFHQWHU-%R[NLW
ZLWK RQH DPS GXSOH[ VXUJH
SURWHFWHG UHFHSWDFOH 3URYLGHV
(0,5),¿OWHULQJWKDWPHHWV8/VWDQGDUGV,IVXUJH
SURWHFWLRQLVORVWDQDODUPZLOOVRXQGWRZDUQKRPHRZQ
HUV WKDW WKH RXWOHWLVQRORQJHUSURWHFWHG ´KLJK[´
ZLGH[´GHHS
7,+6
Unit
COLEMAN CABLE INC.
$OXPLQXP ´ GLDPHWHU UHÀHF
WRU 3URWHFWLYH YLQ\O FRYHUHG JULSV
IXOO VZLYHO KHDG 3RODUL]HG 8/
/LVWHG
‡*5281'('287/(7
‡0(7$/*5281'('*8$5'
‡&21'8&725:,7+
6:,7&+
CLAMP LIGHTS
‡(0,5),),/7(5,1*
‡³6758&785('0(',$´
007-4955
Shf
Pk
‡&/$0321
WORK LIGHTS
($
SURGE PROTECTOR
OUTLETS
No.
Cord
Lgth Ft
($
Light Fixtures
Our No.
No.
REFLECTOR LIGHTS
:KROH KRXVH 6XUJH 3URWHFWLYH
'HYLFH 63' WKDW KHOSV SURWHFW
sensitive electronics and other
LPSRUWDQW LWHPV VXFK DV ZDVKHUV GU\HUV UHIULJHUDWRUV
DQG OLJKWLQJ 7KHUPDO DQG VXUJHIXVHG PHWDO R[LGH YD
ULVWRU GHVLJQ ZLWK PRGXOHV IRU WHOHSKRQH OLQHV DQG FR
D[LDOYLGHRFDEOHV'HVLJQHGIRUVLQJOHSKDVHWKUHHZLUH
9 +] UHVLGHQWLDO SRZHU V\VWHPV ZKRVH
DYDLODEOH VKRUWFLUFXLW FDSDFLW\ GRHV QRW H[FHHG $PSV\PPHWULFDOVKRUWFLUFXLWFXUUHQW/('VRQWKHIDFH
RIWKH$&PRGXOHVKLQHWKURXJKWKHIURQWFRYHUDQGLQ
GLFDWH WKH RSHUDWLRQDO VWDWXV RI $& VXUJH VXSSUHVVLRQ
,I HLWKHU RI WKH /('V JR RII WKH $& PRGXOH VKRXOG EH
UHSODFHG7KHWHOHSKRQHPRGXOHSURYLGHVVXUJHVXSSUHV
VLRQ IRU IRXU WHOHSKRQH OLQHV 7KH FRD[LDO PRGXOH SUR
YLGHVVXUJHSURWHFWLRQIRURQHFRD[LDOFDEOH5DWHG1(0$
WKH 63' FDQ EH ÀXVK RU VXUIDFH PRXQWHG /LVWHG WR
8/7KLUG(GLWLRQDQGF8//LVWHGIRUXVHLQ&DQDGD
181-2916
25
Our No.
675-4006
16/3SJT - 13 AMP - 125 VOLT
SURGE PROTECTORS
No.
3.
6WURQJ YLQ\O FRDWHG VSULQJ FODPS
JULSV SLSH OXPEHU DQG PRUH $OX
PLQXP ´ GLDPHWHU UHÀHFWRU 7RXJK KHDW UHVLVWDQW
VRFNHW'RXEOHVZLYHOFODPSVZLWKYLQ\OJULSV%ODFNFRUG
ZDWWYROWUDWLQJ8//LVWHG
Unit
COLEMAN CABLE INC.
Our No.
8
‡&21'8&725+($9<
'87<
‡&/$0321
‡³7,*+7*5,3´
‡&21'8&725
‡3527(&7,9(*8$5'
‡³<(//2:-$&.(7´
‡287/(708/7,0(',$
‡527$7,1*287/(76
Shf
Pk
3=3'4
REFLECTOR LIGHTS
WORK LIGHTS
SURGE PROTECTORS
No.
Unit
Household Electrical
DROP LIGHTS
Our No.
Shf
Pk
POWER ZONE
346-2421X
COLEMAN CABLE INC.
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%$3
<HOORZ%ODFN
2
($
Maintenance, Repair & Operations - Household Electrical
HALOGEN WORK
LIGHTS
HALOGEN WORK
LIGHTS
WORK LIGHT GUARDS
‡,1'225287'225
‡3/$67,&$'-867$%/(
+HDY\GXW\ ZLUH JXDUG 'LHFDVW
DOXPLQXP KRXVLQJ IRU EHWWHU KHDW
GLVSHUVHPHQW 6WHHO WXEH VWDQG
DQG KDQGOH :HDWKHUSURRI GHVLJQ
2QHVSDUHEXOELQFOXGHGVWRUHGLQVWDQG6KRFNUHVLVWDQW
KDQGOH JULS JDXJH SRZHU FRUG 7 GRXEOHHQG
YROW KDORJHQ EXOEV LQFOXGHG F8/XV /LVWHG IRU
ZHWORFDWLRQXVH
‡5(029($%/(75,32'
67$1'
‡'28%/(/,*+7+($9<
'87<
WORK LIGHTS
+LJK VWUHQJWK LPSDFW UHVLVWDQW
WKHUPRSODVWLF (DV\ RSHQ JXDUG
SHUPLWV UHODPSLQJ ZLWKRXW UHPRY
LQJJXDUG
Our No.
No.
Shf
Pk
Color
Unit
COOPER WIRING
608-8546
<63
10
<HOORZ
Our No.
($
Cord
Lgth Ft
No.
Shf
Pk
Unit
COOPER LIGHTING
REPLACEMENT BULB (1) 250 WATT
4 In 1 Hook, Clamp, Spike & Base
343-9270
WORK LIGHT GUARDS
346,1
3
($
Our No.
3465
Shf
Pk
Color
Unit
REPLACEMENT BULB TYPE: (2) 500 WATT
600 Total Watts
392-1764
)RU LQFDQGHVFHQW ZRUN OLJKWV DQG
UHHOV
No.
COOPER LIGHTING
REPLACEMENT BULB (2) 300 WATT
‡5(3/$&(0(17
‡0(7$/
'HWDFKDEOHVOHGGHVLJQDOORZVOLJKW
KHDGVWRRSHUDWHDVDSRUWDEOHOLJKWVHSDUDWHIURPWKH
WULSRG'LHFDVWDOXPLQXPOLJKWKRXVLQJ6WHHOWXEHVWDQG
DQG KDQGOH )L[WXUH VWDQGV ´ ZKHQ IXOO\ H[WHQGHG IRRWJDXJHSRZHUFRUG:HDWKHUSURRIGHVLJQF8
/XV/LVWHGIRUZHWORFDWLRQLQGRRURURXWGRRUXVH,QGH
SHQGHQW ZHDWKHUSURRI VZLWFK SURYLGHV DGMXVWDEOH OLJKW
FRQWURO7ULSRGFROODSVHVGRZQDQGVWRUHVFRQYHQLHQWO\LQ
WKHVOHGGHVLJQ,QFOXGHV7GRXEOHHQGYROWKDOR
JHQEXOEV6SDUHEXOELQFOXGHGVWRUHVLQVOHGKDQGOH
3
4
($
Switchable - 500/1000 Watt - Quick-Disconnect
280-5653
7464'
2
<HOORZ
($
REPLACEMENT BULB TYPE: (4) 300 WATT
Our No.
Shf
Pk
No.
Unit
HALOGEN WORK
LIGHTS
($
‡75,32'67$1'
‡+($9<'87<
BAYCO PRODUCTS
461-3303
%$
FLUORESCENT WORK
LIGHTS
‡722/%2;0$*1(7,&
‡)/(;,%/(*226(1(&.
‡³08/7,´
0DJQHWLF WRROER[ OLJKW ZLWK VLOL
FRQH SDGV DW DOO PDJQHW ORFD
WLRQV6KDSHGWRSURYLGHDQRSHQLQJIRUWKHWRROER[KDQ
GOH)OH[LEOHJRRVHQHFNSXWVWKHOLJKWZKHUHLWLVQHHGHG
2Q2IIVZLWFKDQGH[WUDRXWOHW,QFOXGHVDSLQZDWW
FRPSDFWÀXRUHVFHQWODPSSURWHFWHGE\DIURVWHGSODVWLF
OHQV(OHFWURQLFLQVWDQWVWDUWODPSEDOODVW*URXQGHG¶
JDXJH6-7FRUG.H\KROHVORWVIRUPRXQWLQJWRGU\ZDOO
Our No.
No.
Wattage
Shf
Pk
Switchable - 300/600/900/1200 Watt - Quick-Disconnect
075-8573
4XLFNGLVFRQQHFWIHDWXUHWRUHPRYH
SRUWDEOHZRUNOLJKWIURPVWDQG'LH
FDVWDOXPLQXPOLJKWKRXVLQJ+HDY\
GXW\ZLUHJULOOHJXDUGDQGWHPSHUHGJODVVOHQVIRUDGGHG
VDIHW\ )L[WXUH VWDQGV ´ ZKHQ IXOO\ H[WHQGHG IRRW
JDXJHSURQJJURXQGHGSRZHUFRUG:HDWKHUSURRI
GHVLJQF8/XV/LVWHGIRUZHWORFDWLRQLQGRRURURXWGRRU
XVH7GRXEOHHQGYROWKDORJHQEXOE,QFOXGHG
VSDUHEXOELQFOXGHGLQSRUWDEOHEDVH
Our No.
No.
Shf
Pk
Unit
COOPER LIGHTING
2
6464'
($
Unit
18
1
:LWKIWUHHO
FLUORESCENT WORK
LIGHTS
Our No.
,PSDFWUHVLVWDQWSRO\HWK\OHQHZLWK
FOHDU FKHPLFDO UHVLVWDQW KLJKLP
SDFWODPSSURWHFWRUDQGKLJKJORVV
UHÀHFWRUIRRWJDXJHFRUG
ZLWK 697 MDFNHW 5RFNHU RQRII VZLWFK SRODUL]HG SOXJ
Q\ORQWLSSHGKDQGVIUHHKRRNKRXUUDWHGZDWW
ÀXRUHVFHQW EXOE HTXLYDOHQW WR ZDWW LQFDQGHVFHQW
. QDWXUDO GD\OLJKW LOOXPLQDWLRQ 0RXQWLQJ EUDFNHW
DQGZDWWEXOELQFOXGHG
POWER ZONE
No.
Color
Shf
Pk
%$
<HOORZ
2
Shf
Pk
No.
Unit
COOPER LIGHTING
/('
4
($
LED WORK LIGHTS
350-4776X
No.
3=
Shf
Pk
2
Shf
Pk
No.
Unit
COOPER LIGHTING
Unit
873-2463
/('
4
($
Shf
Pk
Unit
($
LED WORK LIGHTS
Unit
BAYCO PRODUCTS
367-8638X
Our No.
Our No.
‡5(75$&7$%/(5((/
Our No.
,QVWDQW 21 VZLWFK 'XUDEOH SRO\
FDUERQDWH OHQV &XVKLRQHG JULS
6ZLYHO KRRN URWDWHV GHJUHHV
¶JDXJHFRUG
'XUDEOHSRO\FDUERQDWHOHQV&XVK
LRQHGJULS6ZLYHOKRRNURWDWHV
GHJUHHV$&DGDSWHUIRUKRXVHKROG
FKDUJLQJ'&DGDSWHUIRUFDUFKDUJ
LQJ0DJQHWLFFODPS(QGRIOLJKWGRXEOHVDVDVSRWOLJKW
‡/('6
($
‡3/8*,1
‡/('6
‡5(&+$5*($%/(
‡/('6
LED WORK LIGHTS
Instant Start
0/7(&7
($
500 Total Watts - Quick-Disconnect
269-2366
AMERICAN FLUORESCENT
170-8130
2
<HOORZ
LED WORK LIGHTS
188-9179
REPLACEMENT BULB TYPE: (1) 500 WATT
7464'5
($
Our No.
No.
POWER ZONE
34 Led - Rechargeable
926-1728
3=5
2
($
60 Led - With 25 Ft Cord
930-4098
3=
2
($
66 Led - Rechargeable
926-6081
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
3=5
2
($
- Maintenance, Repair & Operations
LED WORK LIGHTS
FLASHLIGHTS
FLASHLIGHTS
‡/('65(&+$5*($%/(
‡*(1(5$/,1'225
/,*+7,1*
‡³0,*+7'/,*+7´
‡.5<3721%8/%
‡$'-867$%/(
‡³0$*/,7(´
‡;(121/$03
‡³0,1,0$*´
,OOXPLQDWHV ZLWK OHVV KHDW WKDQ
W\SLFDO KDORJHQ ZRUN OLJKWV 'X
UDEOH SRO\FDUERQDWH OHQV )ULFWLRQ WHQVLRQ KLQJH DOORZV
IRUÀH[LEOHDGMXVWPHQWWRDQ\DQJOHWZRSRZHUIXOHDUWK
PDJQHWV DOORZV IRU VHFXUH FRQWDFW RQ PRVW PHWDOV 'R
QRW XVH PDJQHW IRU KRUL]RQWDO RYHUKHDG PRXQWLQJ 5H
ÀHFWLYH VWULSV LPSURYH YLVLELOLW\ 1\ORQ KRRN URWDWHV GHJUHHV$&DGDSWHUIRUKRXVHKROGFKDUJLQJ'&DGDSWHU
IRUFDUFKDUJLQJ%DWWHULHVZLOOUHDFKIXOOFKDUJHLQDERXW
KRXUV/('LQGLFDWRUOLJKWJORZVUHGZKLOHWKHEDWWHULHV
DUH FKDUJLQJ :KHQ WKH OLJKW LV IXOO\ FKDUJHG WKH /('
LQGLFDWRUOLJKWWXUQVWRJUHHQ2SHUDWHVKRXUVRQDIXOO
FKDUJH
Our No.
Shf
Pk
No.
Unit
COOPER LIGHTING
215-5588
2
/('
($
LED WORK LIGHTS
‡/('6
OXPHQV
/LQHDU IRFXVLQJ VSRW WR ÀRRG
EHDP 3DWHQWHG FDP DFWLRQ IR
FXVLQJ EHDP )OXVK VHDOHG UXEEHU
WKXPE EXWWRQ :KLWH 6WDU .U\SWRQ JDV ODPS 7ULSOH DF
WLRQVHOIFOHDQLQJLQWHUQDOVZLWFK2QRIIDQGVLJQDOLQJ
VZLWFKFDSDELOLW\$QRGL]HGWRSUHYHQWFRUURVLRQ2ULQJ
VHDOHGIRUPD[LPXPZDWHUUHVLVWDQFH'LDPRQGNQXUOHG
JULS 0DFKLQHG DOXPLQXP 6SDUH ODPS LQVLGH WDLO FDS
6HULDO QXPEHUHG IRU LGHQWL¿FDWLRQ %DWWHULHV DUH QRW LQ
FOXGHG
Our No.
No.
Batteries
Num/Sze
Color
Shf
Pk Unit
:LWK1DWLRQDO%UHDVW&DQFHU)RXQ
GDWLRQ1%&)ORJRSLQNZLWKSLQN
NH\OHDGDQG$$EDWWHULHVLQEOLV
WHUSDFNDJLQJ6SDUHEXOELQWKHWDLO
FDS)RFXVLQJEHDPZLWKFDQGOHPRGH&DQEHVHHQIRU
PHWHUV$$EDWWHULHVODVWKRXUVDQGPLQXWHV
ZLWK OXPHQV RI OLJKW RXWSXW :HDWKHU UHVLVWDQW VXU
YLYHVDPHWHUGURS$86$PDQXIDFWXUHU
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
$$
12
($
MAG INSTRUMENT
474-7879
0$0:
MAG INSTRUMENT
048-1606
66'
'
6LOYHU
&'
251-0634
66'
'
6LOYHU
($
FLASHLIGHTS
032-2016
66'
'
%OXH
($
620-1941
6'
'
%ODFN
12 &'
620-2790
6'
'
%ODFN
12 &'
‡,1&$1'(6&(17
‡:,7+.(</($'
‡³62/,7$,5(´
620-3533
6'
'
%ODFN
12 &'
085-5064
66'
'
5HG
&'
753-5099
66'
'
Gray
($
610-6009
6'
'
&DPRXÀDJH
12 &'
&RQVWUXFWHG RI KLJKVWUHQJWK DOX
PLQXP H[WHULRU FRPSRQHQWV $G
MXVWVIURPDGLIIXVHGWRDSLQSRLQW
OLJKW6SDUHEXOELQWKHWDLOFDS:LWKNH\OHDGDFFHVVRU\
6LQJOHFHOO$$$SUHPLXPDONDOLQHEDWWHU\LQFOXGHG
Our No.
No.
Batteries
Num/Sze
Color
Shf
Pk Unit
$$$
6LOYHU
12
MAG INSTRUMENT
Our No.
No.
Unit
POWER ZONE
334-7432X
3=3%
2
&'
Specialty Electrical
BATTERY FLASHLIGHTS
'HOX[H HFRQRP\ ÀDVKOLJKW 'X
UDEOH VZLWFK KLJK LPSDFW UHVLQ
6XSHU EULJKW .U\SWRQ EHDP *UHDW
IRU KRPH XVH JORYH ER[HV QLJKW
VWDQGVHWF$VVRUWHGFRORUVQRFRORUFKRLFHDYDLODEOH
Batteries
Num/Sze
No.
Shf
Pk
Unit
12
($
DORCY INTERNATIONAL
‡.5<3721%8/%
‡:$7(55(6,67$17
‡³:25./,*+7´
678-7311
:HDWKHUUHVLVWDQWPDGHZLWKKLJK
LPSDFWUHVLQVUXEEHUL]HGSXVKEXW
WRQ VZLWFK KHDG DQG WDLO FDS 6X
SHUEULJKW.U\SWRQEXOE6SULQJOHVVGHVLJQV\VWHP+HDY\
GXW\EDWWHULHVLQFOXGHG
FLASHLIGHTS
No.
Batteries
Num/Sze
Shf
Pk Unit
Color
DORCY INTERNATIONAL
403-9988
$$
<HOORZ
($
769-4144
'
<HOORZ
($
'
Batteries
Num/Sze
No.
Shf
Pk
Unit
No.
$$
($
($
8.125” Lgth x 1.81” Wdth
/LQHDU IRFXVLQJ VSRW WR ÀRRG
EHDP 3DWHQWHG FDP DFWLRQ IR
FXVLQJ EHDP )OXVK VHDOHG UXEEHU
WKXPEEXWWRQ:KLWH6WDU.U\SWRQJDVODPS7ULSOHDF
WLRQVHOIFOHDQLQJLQWHUQDOVZLWFK2QRIIDQGVLJQDOLQJ
VZLWFKFDSDELOLW\$QRGL]HGWRSUHYHQWFRUURVLRQ2ULQJ
VHDOHGIRUPD[LPXPZDWHUUHVLVWDQFH'LDPRQGNQXUOHG
JULS0DFKLQHGDOXPLQXP6SDUHODPSLQVLGHWDLOFDS6H
ULDOQXPEHUHGIRULGHQWL¿FDWLRQ%ODFNFRORU%DWWHULHVQRW
LQFOXGHG$86$PDQXIDFWXUHU
Our No.
Batteries
Num/Sze
Shf
Pk
Unit
6&
&
12
&'
620-5835
6&
&
12
&'
Batteries
Num/Sze
Color
Shf
Pk Unit
'
0$
$$$
%ODFN
12
&'
‡,1&$1'(6&(17
‡+2/67(5&20%23$&.
‡³0,1,0$*/,7(´
0LQL 0DJOLWH ÀDVKOLJKW PXOWLSXU
SRVH SRO\SURS\OHQH EHOW KROVWHU D
VSDUH EXOE LQ WKH WDLOFDS DQG WZR
SUHPLXP$$DONDOLQHEDWWHULHVLQFOXGHG$86$PDQX
IDFWXUHUOXPHQVUXQVKRXUVDQGFDQVXUYLYHD
PHWHUGURS
Our No.
No.
Batteries
Num/Sze
Color
Shf
Pk Unit
MAG INSTRUMENT
696-6006
0$+
$$
%ODFN
12
&'
608-9668
0$+
$$
5HG
12
&'
610-5993
0$+
$$
&DPR
12
&'
MAG INSTRUMENT
620-4416
No.
FLASHLIGHTS
6” Lgth x 1.29” Wdth
473-4984
:LWK OLQHDU IRFXVLQJ ÀRRG WR VSRW
EHDP 0DFKLQHG DOXPLQXP 'LD
PRQG NQXUOHG JULS $QRGL]HG WR
SUHYHQW FRUURVLRQ ,QWHUQDO IXOO\ VHDOHG VZLWFK 2ULQJ
VHDOHGIRUPD[LPXPZDWHUUHVLVWDQFH7ZR$$$DONDOLQH
SUHPLXPEDWWHULHVDQGSRFNHWFOLSLQFOXGHG
620-0372
5XEEHU DQG VWDLQOHVV VWHHO FRQ
VWUXFWLRQ ZDWHU UHVLVWDQW VKRFN
UHVLVWDQWVHDOHGRQRIIVZLWFK6X
SHUEULJKW;HQRQEXOE+HDY\GXW\
EDWWHULHVLQFOXGHG&DUGHG
162-5029
‡,1&$1'(6&(17
‡$$$:,7+32&.(7&/,3
‡³0,1,0$*/,7(´
MAG INSTRUMENT
‡;(121%8/%
‡³%266´
Our No.
‡.5<3721%8/%
‡$'-867$%/(
‡³0$*/,7(´
($
FLASHLIGHTS
Our No.
DORCY INTERNATIONAL
FLASHLIGHTS
.$
‡.5<3721%8/%
‡³/80,1$725´
Our No.
FLASHLIGHTS
Our No.
682-7950
FLASHLIGHTS
Shf
Pk
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - FLASHLIGHTS
FLASHLIGHTS
FLASHLIGHTS
‡,1&$1'(6&(17
‡7:,1'(/8;(
‡/(':$77
‡$/80,180
‡³0,1,0$*/,7(/('´
‡/8;(21/('
‡³0(7$/*($5/('´
6XSHU EULJKW LQFDQGHVFHQW OLJKW
7ZR GHOX[H ' ÀDVKOLJKWV $VVRUW
HGFRORUVQRFRORUFKRLFHDYDLODEOH
,QFOXGHVOLJKWVDQG'RUF\KHDY\
GXW\EDWWHULHV
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
DORCY INTERNATIONAL
956-8635
'
($
3URMHFWLQJ EHDP IRFXVHV E\ UR
WDWLQJ WKH KHDG EDODQFHG RSWLFV
FRPELQLQJDKLJKO\UH¿QHGUHÀHFWRU
ZLWKDTXDOLW\ZDWW/('IRUDEULOOLDQWDGMXVWDEOHEHDP
,QWHOOLJHQW(QHUJ\6RXUFH0DQDJHPHQWSDWHQWSHQGLQJ
EDODQFLQJKLJKEULJKWQHVVZLWKH[WHQGHGEDWWHU\OLIHDQG
&DQGOHPRGHE\XQVFUHZLQJWKHÀDVKOLJKWKHDGSODFLQJ
LWRQDVWDEOHÀDWVXUIDFHDQGVHWWLQJWKHÀDVKOLJKWEDUUHO
LQWRWKHKHDG,QFOXGHV$$EDWWHULHVDQGKROVWHU´
OHQJWK[´EDUUHOGLDPHWHU
Our No.
No.
Batteries
Num/Sze
Color
MAG INSTRUMENT
‡,1&$1'(6&(17
‡',6326$%/(
‡³/80,1$725´
433-1708
63+
$$
%ODFN
($
777-2346
63+
$$
Gray
($
Our No.
Shf
Pk
No.
Unit
DORCY INTERNATIONAL
680-4223
FLASHLIGHTS
‡,1&$1'(6&(17
‡:,7+.(</($'
‡³62/,7$,5(´
No.
‡/(':$77
‡$/80,180
‡³0$*/,7(/('´
No.
Batteries
Num/Sze
Color
Shf
Pk Unit
Batteries
Num/Sze
Shf
Pk
Unit
$$$
12
($
10” LGTH X 1-9/16” BARREL DIA.
272-8079
67'
'
%ODFN
($
364-5579
67'
'
Gray
($
12-11/32” LGTH X 1-9/16” BARREL DIA.
209-5735
67'
'
%ODFN
($
675-9252
67'
'
Gray
($
.$0:
‡/('$/80,180
‡³0$*/,7(;/³
0DFKLQHG EODFN DOXPLQXP FDVH
3XVKEXWWRQ WDLO FDS VZLWFK $QRG
L]HG IRU FRUURVLRQ UHVLVWDQFH DQG
GXUDELOLW\ ³6SRWWR)ORRG´ DGMXVW
DEOH /(' EHDP ,QGLYLGXDOO\ VHULDO QXPEHUHG 3RZHUHG
E\ WKUHH $$$ DONDOLQH EDWWHULHV LQFOXGHG &DQ EH
VHHQIRUPHWHUV$$$EDWWHULHVODVWKRXUVDQG
PLQXWHV DW IXOOSRZHU ZLWK OXPHQVRI OLJKWRXWSXW
/DVWKRXUVRQORZSRZHU:HDWKHUUHVLVWDQWVXUYLYHV
DPHWHUGURSZD\VWDUWTXLFNFOLFNWXUQVRQKLJK
SRZHUTXLFNFOLFNVDFWLYDWHVDWSHUFHQWSRZHUDQG
TXLFN FOLFNV WXUQV RQ WKH HPHUJHQF\ VDIHW\ VWUREH $
86$PDQXIDFWXUHU
Batteries
Num/Sze
Shf
Pk
;/6
$$$
$$$
3
%ODFN
($
FLASHLIGHTS
‡/('
‡³+$:.(<(/('´
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
DORCY INTERNATIONAL
168-6328
3
$$$
($
FLASHLIGHTS
:HDWKHUUHVLVWDQW/('ÀDVKOLJKW
KRXU UXQ WLPH 7DLO FDS SXVK
EXWWRQ VZLWFK Q\ORQ ODQ\DUG ,Q
FOXGHV$$$KHDY\GXW\EDWWHULHV
$VVRUWHGFRORUVQRFRORUFKRLFHDYDLODEOH
Our No.
No.
+LJKSRZHUHG/XPHQKRXUV
UXQWLPHPHWHUEHDP./X[
HRQVROLGVWDWHGLRGH/('ZDWW
DQRGL]HG DOXPLQXP FRQVWUXFWLRQ
RULQJVHDOVWRSURWHFWIURPGXVWDQGPRLVWXUHUHFHVVHG
WDLO FDS VZLWFK DQG EXLOW LQ EDWWHU\ LQGLFDWRU JUHHQ PRUHWKDQSHUFHQWEDWWHU\OLIHUHGOHVVWKDQSHU
FHQWEDWWHU\OLIH´OHQJWK[´ZLGWKSRXQGV
8VHV$$$EDWWHULHVLQFOXGHG
Batteries
Num/Sze
Shf
Pk
Unit
$$$
($
Our No.
No.
Batteries
Num/Sze
Color
Shf
Pk Unit
DORCY INTERNATIONAL
564-7177
$$$
%ODFN
3
($
FLASHLIGHTS
‡/('
‡³/('´
&RPSDFW GHVLJQ WZR ZD\ WDLO FDS
SXVK EXWWRQ IRU FRQVWDQW RU PR
PHQWDU\ XVH $OXPLQXP FRQVWUXF
WLRQZLWKDUXEEHUL]HGFRPIRUWJULS
DURXQGWKHEDUUHODQGKHDGRIWKHÀDVKOLJKW/XPHQ
+RXUUXQWLPH,QFOXGHVDQ\ORQKROVWHUDQG$$FHOO
EDWWHULHV
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
DORCY INTERNATIONAL
062-2688
Unit
FLASHLIGHTS
($
‡/('$/80,180
‡³/('´
MAG INSTRUMENT
620-1529
477-5243
FLASHLIGHTS
FLASHLIGHTS
No.
DORCY INTERNATIONAL
678-7303
‡/8;(21./('
‡³./8;(21/('´
Our No.
Shf
Pk Unit
Color
DORCY INTERNATIONAL
MAG INSTRUMENT
692-3577
Batteries
Num/Sze
‡/('
‡³/('´
MAG INSTRUMENT
:LWK1DWLRQDO%UHDVW&DQFHU)RXQ
GDWLRQ1%&)ORJRSLQNZLWKSLQN
NH\OHDGDQG$$$EDWWHU\LQEOLV
WHUSDFNDJLQJ&DQEHVHHQIRUPHWHUV$$$EDWWHU\
ODVWVKRXUVDQGPLQXWHVZLWKOXPHQVRIOLJKWRXW
SXW:HDWKHUUHVLVWDQWVXUYLYHVDPHWHUGURS)RUNH\
FKDLQVDQGKDQGEDJV$86$PDQXIDFWXUHU
Our No.
FLASHLIGHTS
Our No.
No.
+DZNH\HÀDVKOLJKWZLWKSRXFKDQG
OHQVHV /XPHQ VROLG VWDWH /('
KRXUUXQWLPH¶EHDP$OX
PLQXPDQGUXEEHUFRQVWUXFWLRQWDLO
FDS SXVK EXWWRQ VZLWFK ,QFOXGHV ,QWHUFKDQJHDEOH EOXH
DQGUHGOHQVHVFDQYDVFDUU\LQJFDVHDQG$$$EDWWHU
LHV
3RZHUIXO SURMHFWLQJ EHDP IRFXVHV
E\URWDWLQJWKHKHDGEDODQFHGRS
WLFVFRPELQLQJDKLJKO\UH¿QHGUH
ÀHFWRUZLWKDTXDOLW\ZDWW/('IRUDEULOOLDQWDGMXVWDEOH
EHDP ,QWHOOLJHQW (QHUJ\ 6RXUFH 0DQDJHPHQW SDWHQW
SHQGLQJ EDODQFLQJ KLJK EULJKWQHVV ZLWK H[WHQGHG EDW
WHU\OLIH%DWWHULHVQRWLQFOXGHG
($
Our No.
Shf
Pk Unit
FLASHLIGHTS
3DOP OLJKW ZLWK EDWWHU\ JUHDW IRU
HQG FDSV FOLS VWULSV VLGH SDQHOV
DQG FKHFNRXWV PLQXWHV UXQ
WLPH 2QRII VZLWFK $VVRUWHG FRORUV QR FRORU FKRLFH
DYDLODEOH
/X[HRQ/XPHQVROLGVWDWH/('
KRXUUXQWLPH¶EHDP$OX
minum construction tail cap push
EXWWRQVZLWFK,QFOXGHV$$$EDW
WHULHVDQGDKROVWHU´OHQJWK[´ZLGWK[´KHLJKW
&DUGHG
$$
($
$OXPLQXP DOOR\ /XPHQ 7DLO
FDSSXVKEXWWRQVZLWFK3URMHFWVD
EHDPIHHWKRXUUXQWLPHRQ
$$EDWWHULHVLQFOXGHG
Our No.
No.
Batteries
Num/Sze
Color
Shf
Pk Unit
DORCY INTERNATIONAL
077-2988
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
$$
%ODFN
3
($
- Maintenance, Repair & Operations
FLASHLIGHTS
FLASHLIGHTS
FLASHLIGHTS
‡/('.(<&+$,1
‡/('6:+,7(1,&+,$&6
‡³+$5'&$6(352´
‡/('6:+,7(1,&+,$*6
‡,175,16,&$//<6$)(
‡³&2175$&725´
&DUDELQHHU ERWWOH RSHQHU NH\FKDLQ
OLJKW ZLWK EDWWHULHV $VVRUWHG FRO
RUVQRFRORUFKRLFHDYDLODEOH
Our No.
Shf
Pk
No.
Unit
DORCY INTERNATIONAL
379-6752
($
,PSDFW UHVLVWDQW OLJKW VXUYLYHV D
IRRW GURS 6KDWWHUSURRI OHQV
SURWHFWV /('V IURP GDPDJH
:HDWKHUSURRI ÀRDWV IRU HDV\ UH
WULHYDOIURPZDWHUSXVKEXWWRQVZLWFK DQGDQWLUROOGH
VLJQ)RXUIRFXVHGEULJKWZKLWHVSRW1LFKLD&6/('V
OXPHQVKRXUUXQWLPHRQ$$DONDOLQHEDWWHULHVLQ
FOXGHGR]ZLWKEDWWHULHV´OHQJWK[´ZLGWK
%ODFNGDUNJUD\LQFRORU
Our No.
Batteries
Num/Sze
No.
Shf
Pk
Unit
ENERGIZER BATTERY
FLASHLIGHTS
003-0577
‡/('3(1/,*+7
‡$/80,180
78)$$3(
$$
($
Batteries
Num/Sze
Shf
Pk Unit
‡/('6
‡:+,7(5('*5((1
‡³+$5'&$6(&203$&7352´
‡/('
‡3$/0/,*+7
Our No.
815-5384
$$$
6LOYHU
($
Our No.
No.
Batteries
Num/Sze
144-1492
$$
Unit
Shf
Pk
Unit
ENERGIZER BATTERY
048-7249
78)$$3(
$$
$$
($
Unit
78)6:3+
$$
4
($
:DWHUSURRIGXVWSURRIDQGVXUYLYHV
DPHWHUGURSWHVW%XLOWLQFDUDEL
QHHUEHOWFOLS7KHEULJKWLQGXVWULDO
\HOORZ FRORU SURYLGHV LQVWDQW UHFRJQLWLRQ 7KH /8;(21
ZKLWH /(' ODPS VXSSOLHV VWHDG\ EULJKW LOOXPLQDWLRQ /XPHQVKRXUVUXQWLPHRQ'EDWWHULHV$SSURYHGE\
JOREDODJHQFLHVIRULQWULQVLFDOO\VDIHOLJKWV8/&8/LQWULQ
VLFVDIHW\IRUKD]DUGRXVORFDWLRQV7\SLFDOZHLJKWRI
JUDPV ZLWKRXW EDWWHULHV PP [ PP [ PP<HOORZEODFNFRORU
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
($
,1/'(
'
($
FLASHLIGHTS
‡/('3(1/,*+7
Our No.
,PSDFWUHVLVWDQWVXUYLYHVDIRRW
GURS 6KDWWHUSURRI OHQV SURWHFWV
/('VIURPGDPDJH:HDWKHUSURRI
SXVK EXWWRQ VZLWFK DQG DQWLUROO
GHVLJQ OXPHQV KRXU UXQ WLPH RQ $$ DONDOLQH
EDWWHULHV R] ZLWK EDWWHULHV ´ OHQJWK [ ´
ZLGWK$$(QHUJL]HUEDWWHULHVDQGEHOWSRXFKLQFOXGHG
%ODFNGDUNJUD\LQFRORU
No.
Shf
Pk
$OXPLQXPVLOYHUERG\SXVKEXWWRQ
WDLO VZLWFK IRU RQH KDQGHG RSHUD
WLRQ DQG D VWXUG\ FOLS 2QH VXSHU
EULJKWOLIHWLPH/('/XPHQVDQG
RYHUKRXUVUXQWLPHZLWK$$$
DONDOLQHEDWWHULHVLQFOXGHG7\SLFDOZHLJKWLVR]ZLWK
EDWWHULHV´[´
($
‡/('6:+,7(1,&+,$
‡³+$5'&$6(352´
Our No.
,1/$$(
‡:$77/('
‡,175,16,&$//<6$)(
‡³&2175$&725´
899-2331
Shf
Pk
FLASHLIGHTS
Batteries
Num/Sze
Unit
ENERGIZER BATTERY
ENERGIZER BATTERY
DORCY INTERNATIONAL
920-4553
Batteries
Num/Sze
No.
ENERGIZER BATTERY
$VVRUWHG FRORUV UHG EOXH DQG \HO
ORZ QR FRORU FKRLFH DYDLODEOH OXPHQV KRXUV UXQ WLPH %HDP
GLVWDQFH RI IHHW ´ OHQJWK [
´ZLGWKOE2QRIIVZLWFK
Shf
Pk
FLASHLIGHTS
FLASHLIGHTS
Color
DORCY INTERNATIONAL
Batteries
Num/Sze
No.
FLASHLIGHTS
:HDWKHUSURRI DQG ZDWHU UHVLVWDQW
LPSDFW UHVLVWDQW VXUYLYHV IRRW
GURS ,W KDV OLJKW PRGHV EULJKW
VSRWORZVSRWIRUH[WHQGHGEDWWHU\OLIHUHGIRUQLJKWYL
VLRQDQGJUHHQIRULQVSHFWLRQ:KLWH/('RXWSXWLVOX
PHQV6ZLYHOKHDGDQGKDQGVIUHHRSHUDWLRQVWXUG\FOLS
DWWDFKHV WR EHOW RU VWUDS ÀDW EDVH VWDQGV RQ VXUIDFHV
´[´[´7\SLFDOZHLJKWLVR]ZLWKRXW
$$EDWWHULHV%ODFNJUD\LQFRORU
No.
Our No.
723-8934
/LJKWZHLJKW DOXPLQXP FRQVWUXF
WLRQ ZLWK PHWDO FOLS /LIHWLPH EXOE
QHYHUQHHGVUHSODFLQJOXPHQV
KRXU UXQ WLPH %HDP GLVWDQFH
¶´OHQJWK[´ZLGWK´GLDPHWHUOE3XVK
EXWWRQWDLOFDS8VHV$$$EDWWHULHVLQFOXGHG
Our No.
:DWHUSURRIGXVWSURRIDQGVXUYLYHV
D PHWHU GURS WHVW %XLOWLQ FDUD
ELQHHU EHOW FOLS FRPSDFW VL]H ¿WV
HDVLO\ LQ DQ\ WRROER[ 7KH EULJKW LQGXVWULDO \HOORZ FRORU
SURYLGHVLQVWDQWUHFRJQLWLRQ7KHZKLWH/('ODPSVVXSSO\
VWHDG\EULJKWLOOXPLQDWLRQ/XPHQVKRXUVUXQWLPH
RQ$$EDWWHULHV$SSURYHGE\JOREDODJHQFLHVIRULQWULQ
VLFDOO\VDIHOLJKWV8/&8/LQWULQVLFVDIHW\IRUKD]DUGRXV
ORFDWLRQV7\SLFDOZHLJKWRIJUDPVZLWKRXWEDWWHULHV
PP[PP[PP<HOORZEODFNFRORU
Batteries
Num/Sze
No.
Shf
Pk
Unit
ENERGIZER BATTERY
858-5028
3/('$(+
$$$
($
FLASHLIGHTS
‡/(':+,7(
‡&203$&7
‡³:($7+(55($'<´
6PDOO VL]H DQG H[WHQGHG EDWWHU\
OLIH,GHDOFKRLFHIRUDQHPHUJHQF\
EDJRUIRUVWRUDJHLQVPDOOVSDFHV
/XPHQVODVWVXSWRKRXUVRQRQHVHWRIIRXU$$
EDWWHULHV3UHPLXPZKLWH1LFKLD/('VQHYHUQHHGUH
SODFLQJ 7\SLFDO ZHLJKW RI JUDPV PP OHQJWK
[PPZLGWK[PPKHLJKW5HGDQGEODFNFRORU
Our No.
613-9992
‡/('3(1/,*+7
‡:+,7(1,&+,$/('
2QH ZKLWH OLIHWLPH /(' GHOLYHUV
/XPHQV KRXU UXQ WLPH RQ
$$$$DONDOLQHEDWWHULHVLQFOXGHG
)RFXVHGOHQVSURMHFWVFRQFLVHVSRW
6KDWWHUSURRI SRO\FDUERQDWH OHQV LV JOREHVW\OH IRU GHJUHHOLJKWSURMHFWLRQ&DVHLVPDGHRIQRQFRQGXFWLYH
(JODVVPDNLQJWKHOLJKWVXLWDEOHIRUXVHLQHOHFWULFDODS
SOLFDWLRQV6WXUG\SRFNHWFOLS:DWHUUHVLVWDQWIRURXWGRRU
XVH0RPHQWDU\VZLWFKH[WHQGVUXQWLPHWZLVWVZLWFKIRU
VWHDG\RQ3DVVHVPHWHUGURSWHVWPP[PP
7\SLFDOZHLJKWRIJUDPV%ODFNLQFRORU
No.
Batteries
Num/Sze
Shf
Pk
Unit
3/('$(
Shf
Pk
Unit
$$$$
($
:5&/'(
$$
($
FLASHLIGHTS
‡/('6:+,7(
‡3/$67,&
(YHU\GD\ÀDVKOLJKWUXQVKRXUV
/XPHQVRQ'VL]H&DUERQ=LQF
EDWWHULHV DQG WKH OLIHWLPH ZKLWH
/('VQHYHUQHHGUHSODFLQJ+DVDQ
DWWDFKHGZULVWODQ\DUGDQGDVOLGHVZLWFK&RORUVDUHUHG
EODFNDQGEOXHQRFRORUFKRLFH7\SLFDOZHLJKWLVR]
ZLWKRXWEDWWHULHV´[´
Our No.
ENERGIZER BATTERY
529-7437
Batteries
Num/Sze
ENERGIZER BATTERY
FLASHLIGHTS
Our No.
No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
ENERGIZER BATTERY
324-3243
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
(9//6
'
($
Maintenance, Repair & Operations - FLASHLIGHTS
FLASHLIGHTS
FLASHLIGHTS
‡/('/,1./,*+7
‡$/80,180%2'<
‡/('$/80,180
‡/('32&.(7/,*+7
3XVKEXWWRQ WDLOFDS VZLWFK *XQ
PHWDOJUD\FRORU/('VQHYHUQHHG
UHSODFLQJ SURGXFH OXPHQV RI
OLJKW ZLWK D EHDP GLVWDQFH RI PHWHUV $16O1('$ 6HULHV '
5XQ WLPH RI KRXUV ZLWK (YHUHDG\ VXSHU KHDY\ GXW\
EDWWHULHV7\SLFDOZHLJKWJUDPVZLWKRXWEDWWHULHV
PP[PP
/(' EXOE QHYHU QHHGV UHSODFLQJ
8VHV$$$(QHUJL]HUDONDOLQHEDW
WHULHV LQFOXGHG &RPSDFW WR ¿W LQ
SRFNHWRUSXUVHSXWVRXWOXPHQV
RIOLJKWIRUKRXUV
/LQN´ZLWK/('ÀDVKOLJKW,Q
FOXGHV EDWWHULHV6KHOI SDFN GLVSOD\
MDU $VVRUWHG FRORUV EOXH UHG RU
\HOORZ'R1RW6SHFLI\&RORU
Our No.
Shf
Pk
No.
Unit
TOOLBASIX
378-7025X
30
-/:$//
($
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
Our No.
Batteries
Num/Sze
No.
Shf
Pk
Unit
ENERGIZER BATTERY
714-6186
(1/$(
$$$
($
ENERGIZER BATTERY
987-7309
(10/'6
'
($
FLASHLIGHTS
FLASHLIGHTS
‡:+,7(/('
‡/('75,32'
‡7+5((,121(
/('WULSRGÀDVKOLJKWSURYLGHVÀH[
LELOLW\ RI XVH DV WKUHH LQGLYLGXDO
ÀDVKOLJKWV RU FRPELQHG IRU IXOO
SRZHUDVDKDQGVIUHHWULSRGÀDVK
OLJKW LQGHSHQGHQW :DWW /(' ÀDVKOLJKWV JHQHUDWH
OXPHQVRIOLJKWDQGKDYHGHJUHHPXOWLGLUHFWLRQDO
URWDWLQJKHDGV1RQVOLSUXEEHUJULSIRUFRPIRUW:HDWKHU
UHVLVWDQW ZLWK VKDWWHU UHVLVWDQW OHQV 2QH WRXFK VZLWFK
ZLWK D JORZLQJ ULQJ VKRZV ÀDVKOLJKW LV 212)) 2QH
WRXFKWULSRGUHOHDVHEXWWRQ´[´[´8VHV$$
EDWWHULHVQRWLQFOXGHG%ODFNFRORU&DUGHG
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
STANLEY TOOLS
368-7340
$$
4
($
Batteries
Num/Sze
Shf
Pk
Unit
DORCY INTERNATIONAL
Our No.
No.
Batteries
Num/Sze
Num
LEDS
Shf
Pk Unit
DORCY INTERNATIONAL
Our No.
Batteries # LEDs
Num/Sze Lumens
No.
Shf
Pk Unit
ENERGIZER BATTERY
55MM X 149MM - 103 GRAMS W/O BATTERIES
444-9971
$$$
3
3
($
120-9675
$$$
3
($
‡/('
‡,163(&7,21/,*+7
‡³+$5'&$6(
352)(66,21$/´
7UXH 6SRW UHÀHFWRU /XPHQ KRXU UXQ WLPH GXUDEOH FRQVWUXF
WLRQ VXUYLYHG DQ ¶ GURS WHVW ,Q
FOXGHV$$EDWWHULHV
646-6312
6OHHN DQG FRPSDFW GHVLJQ ZLWK
RSWLFDOPDJQLI\LQJOHQVHVKRXU
UXQWLPH7HVWHGZLWKDIRRWGURS%DWWHULHVLQFOXGHG
$VVRUWHGFRORUVQRFRORUFKRLFHDYDLODEOH&DUGHG
5XEEHU/LJKWUHGDQGEODFN1RQ
VOLS WH[WXUHG UXEEHU KDQGOH DQG D
SXVKEXWWRQ VZLWFK ODUJH HQRXJK
WR XVH ZKLOH ZHDULQJ JORYHV %XLOW
LQ VWDQG QRQUROO GHVLJQ WH[WXUHG
KDQGOHIRUQRQVOLSJULS/('VQHYHUQHHGUHSODFLQJSUR
YLGH KRXUV RI XVH EHWZHHQ EDWWHU\ FKDQJHV XVLQJ (QHUJL]HU0D[EDWWHULHV7HVWHGDFFRUGLQJWR$16,1(0$
)/6WDQGDUGV
976-9456
(158%(
$$$
($
72MM X 190MM - 222 GRAMS W/O BATTERIES
(158%(
$$
($
FLASHLIGHTS
‡/('+,*+/8;
‡³&<%(5/,*+7´
No.
‡00/('
‡237,&$/0$*1,)<,1*
/(16(6
‡³/('´
987-7283
FLASHLIGHTS
Our No.
FLASHLIGHTS
$$
3
($
FLASHLIGHTS
%LJOLJKWLQDVPDOOSDFNDJHUHDG\
WR WDNH RQ WKH WRXJKHVW MREV )LWV
LQDSRFNHWRUWKHLQFOXGHGEHOWKROVWHU:DWHUUHVLVWDQW
VKDWWHUSURRI OHQV DQG FDQ ZLWKVWDQG D PHWHU GURS OLIHWLPHZKLWH&5((;5&/('OXPHQVDQGKRXU
UXQ WLPH ZLWK $$$ EDWWHULHV 7\SLFDO ZHLJKW JUDPVZLWKRXWEDWWHULHV%ODFNDQGJUD\FRORU
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
ENERGIZER BATTERY
FLASHLIGHTS
826-3659
78)3/3+
$$$
($
‡/('/80(1
‡32/<&$5%21$7(
5()/(&725
‡³287'2256(5,(6´
$LUFUDIWJUDGHKDUGHQHGDOXPLQXP
ZDWHUSURRIZLWKSRO\FDUERQDWHRS
WLFDO UHÀHFWRU &DQEH VHHQ IRU RYHU PLOH OXPHQV
&5((/('OLIHLVKRXUV8VHVRQH$$EDWWHU\QRW
LQFOXGHG
Our No.
No.
Batteries
Num/Sze
/*
$$
Shf
Pk
Unit
LIFE GEAR
490-4488
4
($
‡/('$/80,180
/LJKWZHLJKW FRPSDFW VPDOO VL]H
DQG VOLP GHVLJQ *XQPHWDO JUD\
FRORU 3XVKEXWWRQ WDLOFDS VZLWFK
/('V QHYHU QHHG UHSODFLQJ SUR
GXFH OXPHQV RI OLJKW ZLWK D
EHDPGLVWDQFHRIPHWHUV$16O1('$6HULHV'5XQ
WLPH RI DQ KRXU DQG D KDOI ZLWK (YHUHDG\ VXSHU KHDY\
GXW\EDWWHULHV7\SLFDOZHLJKWJUDPVZLWKRXWEDWWHU
LHVPP[PP
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
ENERGIZER BATTERY
987-7291
(10/$$6
$$
($
FLASHLIGHTS
FLASHLIGHTS
‡/('/80(1
‡³287'2256(5,(6´
‡/('3/$67,&
‡'%$77(5,(6
‡³(9(5($'<´
(FRQRP\ ÀDVKOLJKW DQWLUROO GH
VLJQ ULEEHG FDVLQJ IRU VWUHQJWK
DQGDQRQVOLSJULS&RQWRXUHGVOLGH
VZLWFK/LIHWLPHZKLWH/('QHYHUQHHGVUHSODFLQJ2SHU
DWHV IRU KRXUV XVLQJ (YHUHDG\ VXSHU KHDY\ GXW\
'VL]H EDWWHULHV LQFOXGHG OXPHQV ZLWK D EHDP GLV
WDQFHRIPHWHUV7\SLFDOZHLJKWRIJUDPVZLWKRXW
EDWWHULHV PP OHQJWK [ PP GLDPHWHU $VVHPEOHG
LQWKH86$5HGEOXHJUHHQDQGRUDQJHFRORUV'RQRW
VSHFLI\FRORU
Our No.
No.
Batteries
Num/Sze
Shf
Pk
Unit
0DGHZLWKDLUFUDIWJUDGHKDUGHQHG
DOXPLQXP :DWHU SURRI XS WR IHHW ,3 6HH XS WR IHHW
OLJKW KDV EHHQ VHHQ IRU XS WR PLOHV/DZHQIRUFHPHQWJUDGHSRO\FDUERQDWHRSWLFDOUH
ÀHFWRU&5((3/('V$YHUDJHEDWWHU\OLIHLVKRXUV
8VHVWKUHH&EDWWHULHVQRWLQFOXGHG
Our No.
/%3
'
12
($
772-6680
/6
'
12
($
901-5165
/6
'3HU/LJKW
12
3.
Batteries
Num/Sze
Color
Shf
Pk
/*
&
%ODFN
2
Unit
LIFE GEAR
128-0148
ENERGIZER BATTERY
699-7803
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
- Maintenance, Repair & Operations
Specialty Electrical
FLASHLIGHT SETS
Our No.
No.
Shf
Pk Unit
Color
DORCY INTERNATIONAL
328-0328
$$' <HOORZ
($
Battery
Size
Shf
Pk
Unit
'
12
&'
001-6188
‡%(/7
‡/($7+(5
)XOO JUDLQ OHDWKHU GXUDEOH Q\ORQ
FUDGOH $FFHSWV EHOWV XS WR ´
ZLGH8VHZLWK'VL]HÀDVKOLJKWV
$6;'
Shf
Pk
Unit
12
&'
862-8398
Shf
Pk
Unit
DORCY INTERNATIONAL
No.
3
($
/*
$$
3N6N\3X
3
($
/*
$$
5%*
3
($
Specialty Electrical
RECHARGEABLE FLASHLIGHTS
FLASHLIGHTS
Batteries
Num/Sze
Shf
Pk
Unit
9ROW
($
‡/('1,0+
‡5(&+$5*($%/(
‡³:($7+(55($'<´
&RPHV RQ DXWRPDWLFDOO\ ZKHQ WKH
SRZHUJRHVRXWPDNLQJLWHDV\WR
¿QG ZKHQ QHHGHG WKH PRVW 7KH
EULJKWZKLWH/('QHYHUQHHGVUHSODFLQJDQGWKHKLJKFD
SDFLW\UHFKDUJHDEOHP$K1L0+EDWWHU\ODVWVRYHU
KRXUV EHWZHHQ FKDUJHV LQ QLJKWOLJKW PRGH KRXUV DW
IXOOSRZHU+LJKDQGORZEHDPVHWWLQJVWRFRQVHUYHEDW
WHU\SRZHULIQHFHVVDU\)HDWXUHVKLJKEHDPORZEHDP
DQGQLJKWOLJKWVHWWLQJV/XPHQV7\SLFDOZHLJKWLV
R]ZLWKEDWWHU\&KDUJLQJSURQJVIROGLQIRUFRPIRUWDEOH
JULS´OHQJWK[´ZLGWK[´KHLJKW8//LVWHG
Our No.
167-4605
Batteries
Num/Sze
Shf
Pk
Unit
$$
($
:KLWH
4
Unit
5&/10:5
($
5HFKDUJHDEOH 1,0+ QLFNHO PHWDO
EDWWHU\ FLJDUHWWH OLJKWHU UHFKDUJ
LQJ *ORZV DQG KDV HPHUJHQF\
ÀDVKLQJ OLJKW RSWLRQ 8VHV $* EDWWHULHV LQFOXGHG
KRXU EDWWHU\ OLIH LQ ÀDVKHU PRGH *ORZV UHG 0DJ
QHWLFEDVH
No.
Batteries
Num/Sze
/*
$*
Shf
Pk
Unit
LIFE GEAR
465-5064
Batteries
Num/Sze
Color
Shf
Pk
9ROW
<HOORZ
Unit
ENERGIZER BATTERY
/6
Shf
Pk
‡/('5(&+$5*($%/(
‡/80(16
‡³$872*/2:&/´
+HDY\GXW\FRQVWUXFWLRQLVZHDWK
HUSURRIDQGÀRDWV2SHUDWHVIRU
FRQWLQXRXV KRXUV XVLQJ D YROW
&DUERQ=LQFEDWWHU\LQFOXGHGOXPHQVPHWHUEHDP
GLVWDQFH)HDWXUHVDVKDWWHUSURRIOHQVGXUDEOHLQMHFWLRQ
PROGHGSRO\HWK\OHQHFDVHDQGVRIWSXVKEXWWRQVZLWFK
6XUYLYHVDPHWHUGURS7\SLFDOZHLJKWJUDPVZLWK
RXWEDWWHU\PP[PP[PP7HVWHGDFFRUGLQJ
WR$16,1(0$)/6WDQGDUGV0DGHLQWKH86$
114-5747
Color
FLASHLIGHTS
Our No.
‡/(':+,7(1,&+,$
‡)/2$7,1*
‡³(9(5($'<´
No.
No.
ENERGIZER BATTERY
LANTERNS
Our No.
Shf
Pk Unit
110-8786X
DORCY INTERNATIONAL
'XDO IXQFWLRQ /(' OLJKW /('
EOLQNLQJOLJKW:LQGWRFKDUJH2QHPLQXWHZLQGXS
/('VFDQODVWIRUPLQXWHVRUÀDVKLQJFDQODVWIRU
PLQXWHVDW/XPHQV)RUHPHUJHQF\KRPHDXWR
FDPSLQJDQGPRUH&DUGHG
380-0836
Color
114-2652X
/X[HRQ/('EXOEVIRUGHJUHHV
RI OLJKW /LJKWZHLJKW DQG SRUWDEOH
GXUDEOHURWDWLQJVZLWFKDQGDKDQ
GOHKDQJKRRNKRXUUXQWLPHRQ
$$ EDWWHULHV QRW LQFOXGHG OXPHQV ZLWK D EHDP
GLVWDQFHRIIHHW´OHQJWK[´ZLGWKZHLJKWRI
SRXQGV$VVRUWHGFRORUVQRFRORUFKRLFHDYDLODEOH
Our No.
‡/('/,*+7/('
%/,1.,1*
‡³/('´
No.
No.
Batteries
Num/Sze
($
‡/('0,1,
‡$%6%2'<
CRANK
FLASHLIGHTS
Our No.
LANTERNS
MAG INSTRUMENT
762-2087
9ROW
No.
LIFE GEAR
DORCY INTERNATIONAL
FLASHLIGHT HOLSTERS
No.
Our No.
Unit
5XEEHU YROW ODQWHUQ UXJJHG
KXJHKHDGDQGUHÀHFWRUDVVHPEO\
UXEEHU ERRWHG SXVK EXWWRQ VZLWFK
ZLWK D KDQGV IUHH PXOWL SRVLWLRQ UDWFKHWLQJ VWDQG OXPHQV KRXUV UXQ WLPH EHDP GLVWDQFH RI IHHW
6XSHUEULJKW.U\SWRQEXOEYROWKHDY\GXW\EDWWHU\LQ
FOXGHG
Our No.
Our No.
No.
Shf
Pk
‡92/7.5<3721
‡5$7&+(7,1*67$1'
‡³/80,1$725´
MAG INSTRUMENT
$6;'
Our No.
Batteries
Num/Sze
7XUQV RQ DXWRPDWLFDOO\ ZKHQ LP
PHUVHG LQ ZDWHU *ORZ IHDWXUH LQ
KDQGOH SRUWLRQ ÀDVKHU PRGH IRU
HPHUJHQF\VLJQDOLQJ6WRUDJHFRP
SDUWPHQWVXSHUEULJKWKRXU/('VEULJKW
ZKLWHHPHUJHQF\UHGKRXUEDWWHU\OLIH8VHV
$$EDWWHULHVLQFOXGHG
LANTERNS
)RU'VL]H0DJOLJKWV
608-9700
)ORDWLQJYROWODQWHUQZLWKZLUHOHVV
LQWHJUDWHGEDWWHU\FRQWDFWSODWH
OXPHQV KRXUV UXQ WLPH EHDP
GLVWDQFH IHHW $VVRUWHG FRORUV
QR FRORU FKRLFH DYDLODEOH LQFOXGHV '25&< 0DVWHUFHOO YROWVXSHUKHDY\GXW\EDWWHU\
683-4386
‡)25'6,=(0$*/,*+76
‡³0$*/,7(´
No.
‡92/7,1&$1'(6&(17
‡³/80,1$725´
DORCY INTERNATIONAL
FLASHLIGHT
MOUNTING BRACKETS
Our No.
‡/('
‡:$7(53522))/2$76
LANTERNS
:RUN OLJKW FRPER VXSHU EULJKW
.U\SWRQ EXOEV ZHDWKHU UHVLVWDQW
KHDY\ GXW\ FRQVWUXFWLRQ PDGH
ZLWKKLJKLPSDFWUHVLQV5XEEHUL]HGSXVKEXWWRQVZLWFK
KHDG DQG WDLO FDSV 6SULQJOHVV GHVLJQ V\VWHP IHHW
EHDP GLVWDQFH $$ DQG ' KHDY\ GXW\ EDWWHULHV LQ
FOXGHG
Batteries
Num/Sze
LANTERNS
BATTERY LANTERNS
‡.5<3721%8/%6
‡:25./,*+7&20%2
‡³:25./,*+7´
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
Maintenance, Repair & Operations - Specialty Electrical
RECHARGEABLE
FLASHLIGHTS
‡5(&+$5*($%/(6<67(0
‡),9(&(//%$77(5<3$&.
‡³0$*&+$5*(5´
Shf
Pk
No.
Unit
MAG INSTRUMENT
676-5135
1
5(
‡0,1,$785(%,3,1
‡³62/,7$,5(´
CRANK
FLASHLIGHTS
%DWWHU\ SDFN FDQ UHFKDUJH XS WR
WLPHV :LWK GHJUHH
FKDUJLQJULQJFDQEHPRXQWHGDQGFKDUJHGHDVLO\LQDQ\
SRVLWLRQ6ROLGVWDWHHOHFWURQLFVWKURXJKRXW6WDWHRIWKH
DUWHOHFWURIRUPHGUHÀHFWRU7KHFKDUJLQJXQLWFDQRSHU
DWH RQ D YHKLFOH RU KRXVH FXUUHQW ,QFOXGHV RQH HDFK
FDQGOHSRZHU UHFKDUJHDEOH 0DJ &KDUJHU ÀDVK
OLJKWFKDUJHUXQLWYROW'&SRZHUFRUGIRUFDUFHOO
EDWWHU\ SDFN YROW FRQYHUWHU $& YROW FRQYHUWHU
$&SRZHUFRUGIRUKRPH
Our No.
FLASHLIGHT BULBS
CRANK FLASHLIGHTS
($
‡/('6:+,7(1,&+,$
‡1,0+%$77(5<
‡³:($7+(55($'<´
1HYHUQHHGVEDWWHULHV&UDQNLQJUH
VWRUHVWKHUHFKDUJHDEOH1L0+EDWWHULHVWRWKHLUFKDUJHG
VWDWH 7KH OLIHWLPH 1LFKLD /('V DUH EULJKW YLUWXDOO\ XQ
EUHDNDEOH DQG QHYHU QHHG UHSODFLQJ YROW P$+
1L0+QRQUHSODFHDEOHEDWWHU\SDFNLVFKDUJHGZLWKWKH
FUDQN RQO\ &UDQN RSHUDWHV LQ HLWKHU GLUHFWLRQ 4XLFN WR
XVH FDUDELQHHU FOLS PDNHV LW HDV\ WR KDQJ DQG UHPRYH
OLJKW([FHOOHQWVROXWLRQIRUH[WHQGHGSRZHURXWDJHVDQG
VLWXDWLRQVZKHUHWKHOLJKWZLOOEHVWRUHGIRUORQJSHULRGV
RIWLPH7\SLFDOZHLJKWRIJUDPVZLWKUHFKDUJHDEOH
EDWWHU\PP[PP[PP
Our No.
No.
Shf
Pk
Color
Unit
ENERGIZER BATTERY
RECHARGEABLE
FLASHLIGHTS
362-3618
‡1,&.(/&$'0,80%$77(5<
‡00/('
3RZHU IDLOXUH IHDWXUH JUHDW IRU
HPHUJHQFLHV OXPHQV KRXUV
UXQ WLPH EHDP GLVWDQFH IHHW
)ROGRXW SOXJ 1HYHU QHHG WR UHSODFH WKH EXOE 3RZ
HUHGE\VHDOHGQLFNHOFDGPLXPEDWWHU\SLHFHYROW
P$KEXWWRQFHOO&DUGHG
Our No.
No.
Shf
Pk
Color
:5&.&&%3
5HG
Batteries
Num/Sz
166-3889
DORCY INTERNATIONAL
4
($
No.
Shf
Pk
Unit
B 3-1/2 BULB - KPR102
135-7888
Shf
Pk
Color
Unit
DORCY INTERNATIONAL
003-2359
4
6LOYHU
576-0541
Unit
DORCY INTERNATIONAL
4
($
'
12
&'
294-2159
&'
‡0,1,$785(%,3,1
‡³0,1,0$*/,7(´
6SHFL¿FDOO\GHVLJQHGWRGHOLYHUWKH
EULJKWHVW ZKLWHVW IDUUHDFKLQJ
OLJKW EHDP ZLWKRXW FRPSURPLVLQJ
EDWWHU\ OLIH %L3LQ YDFXXPVHDOHG
DQGH[WUHPHO\EULJKWIRULWVVL]H
No.
Type/Num
Cells
Shf
Pk
Unit
120-7430
/0$
$$
12
&'
302-3017
/0$
$$$
12
&'
FLASHLIGHT BULBS
‡+$/2*(1
‡³0$*&+$5*(5´
No.
Shf
Pk
Unit
12
&'
MAG INSTRUMENT
676-4823
&$$
12
&'
/5
Specialty Electrical
B 3-1/2 BULB - KPR113
AAA BATTERY/BATTERIES
4.8 Volts - 0.75 Amps
206-7288
9ROW'
12
&'
$$
ALKALINE BATTERIES
‡³8/75$32:(5´
2.25 Volts - 0.6 Amps
+LJK FDSDFLW\ VHDOHG OHDG DFLG UH
FKDUJHDEOH EDWWHU\ VXSHU ZKLWH
KDORJHQ EXOE PLQXWHV UXQ
WLPHEHDPGLVWDQFHRIIHHW+RPH$&DQGDXWR'&
DGDSWRUV /RFNLQJ WULJJHU VZLWFK WR SUHYHQW WXUQLQJ RQ
ZKLOHLQVWRUDJH
Shf
Pk
12
2.2 Volts - .47 Amps
($
‡+$/2*(1
‡0,//,21&$1'/(32:(5
253-1549
/.$
FLASHLIGHT BULBS
Our No.
TL3 BULB - KPR222 SCREW BASE
RECHARGEABLE
SPOTLIGHTS
No.
199-1322
&'
B 3-1/2 BULB - KPR104
473-9363
Our No.
12
3.6 Volts - .75 Amps
5XEEHUL]HG FRPIRUW JULS IRRW
EHDP KRXU UXQ WLPH &KDUJH
WLPHKRXUV&KDUJHLQGLFDWRU$&
'& FKDUJLQJ NLW LQFOXGHG 6XSHU
EULJKW00/('EXOEVQHYHUQHHGWREHUHSODFHG´
ORQJ[´ZLGHOE
No.
'
Unit
MAG INSTRUMENT
B 3-1/2 BULB - KPR103
‡/('3,672/*5,3
Our No.
Shf
Pk
)LWV1R5(5HFKDUJHDEOH0DJ
&KDUJHUÀDVKOLJKW
2.4 Volts - .7 Amps
RECHARGEABLE
SPOTLIGHTS
No.
MAG INSTRUMENT
5HSODFHPHQW EXOE ZLWK WXQJVWHQ
¿ODPHQW ZLUHV JODVV WXEHV DQG
FRSSHUVWHPV
Unit
Our No.
Our No.
‡.5<37215(3/$&(0(17
Our No.
:KLWH
($
FLASHLIGHT BULBS
DORCY INTERNATIONAL
6SHFL¿FDOO\GHVLJQHGWRGHOLYHUWKH
EULJKWHVW ZKLWHVW IDUUHDFKLQJ
OLJKW EHDP ZLWKRXW FRPSURPLVLQJ
EDWWHU\ OLIH %L3LQ YDFXXPVHDOHG
DQGH[WUHPHO\EULJKWIRULWVVL]H)RUVLQJOHFHOO$$$ÀDVK
OLJKW
12
&'
/DVWVORQJHULQKLJKGUDLQDQGIUH
quently used devices that require
KLJKEDWWHU\RXWSXWOLNHYLGHRJDPH
FRQWUROOHUV DQG KLJKSRZHUHG
ÀDVKOLJKWV
FLASHLIGHT BULBS
Our No.
‡;(121
‡³0$*18067$5´
DURACELL
617-9014
6SHFL¿FDOO\GHVLJQHGWRGHOLYHUWKH
EULJKWHVW ZKLWHVW IDUUHDFKLQJ
OLJKW EHDP ZLWKRXW FRPSURPLVLQJ
EDWWHU\ OLIH :RUNV ZLWK D & RU '
EDWWHU\ ÀDVKOLJKWZLWK DONDOLQHRU FDUERQ ]LQF EDWWHULHV
%XOEVVROGRQHSHUFDUG
Our No.
No.
Cells
Shf
Pk
Unit
MAG INSTRUMENT
120-8453
/06$
2
12
&'
122-2058
/06$
3
12
&'
120-0864
/06$
4
12
&'
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
No.
Type
Batteries
Shf
Pk
Unit
0;%=
$$$
12
3.
- Maintenance, Repair & Operations
ALKALINE BATTERIES
PHOTO ELECTRONIC
BATTERIES
‡&233(5723
‡³32:(5&+(&.´
No.
Num/Type
Batteries
Shf
Pk
Unit
196-6019
01%=$$$
$$$
18
&'
756-1608
01%=
$$$
10
3.
DURACELL
6KHOIOLIHRI\HDUVDWGHJUHHV
&SHUFHQWRIUDWHGFDSDFLW\8/
/LVWHG0+7\SLFDOFDSDFLW\
P$KWRYROW&DUGHG
Our No.
0157=
12
$$$
&'
Type
Batteries
No.
MAH
Rating
Shf
Pk Unit
ENERGIZER BATTERY
498-9505
/%3
1250
$$$
&'
AA BATTERY/BATTERIES
‡,1'8675,$/
‡³(1(5*,=(5,1'8675,$/´
3ODVWLFODEHOMDFNHW\HDUVKHOIOLIH
DWSHUFHQWRIUDWHGFDSDFLW\
YROWP$FRQWLQXRXVGUDLQDWUDW
HGFDSDFLW\2SHUDWLQJWHPSHUDWXUH
WRGHJUHHV)1RWLQWHQGHGIRUUHWDLOVDOH&DUGHG
Our No.
No.
Size
Batteries
MAH
Rating
Shf
Pk
(1
$$$
24
/DVWVORQJHULQKLJKGUDLQDQGIUH
quently used devices that require
KLJKEDWWHU\RXWSXWOLNHYLGHRJDPH
FRQWUROOHUV DQG KLJKSRZHUHG
ÀDVKOLJKWV
Our No.
No.
Type
Batteries
Shf
Pk
Unit
0;%=
$$
12
3.
DURACELL
617-8974
‡³(1(5*,=(50$;´
)RUPXODWHGWRSURYLGHGHSHQGDEOH
ORQJODVWLQJSRZHU8VHLQWR\VDX
GLR GHYLFHV ÀDVKOLJKWV HOHFWURQLF
GHYLFHV UHPRWH FRQWURO FRPPX
QLFDWLRQ GHYLFHV VPRNH GHWHFWRUV
DQGVHFXULW\V\VWHPV3ODVWLFODEHOMDFNHW\HDUVKHOIOLIH
DWSHUFHQWRIUDWHGFDSDFLW\YROWP$FRQWLQX
RXVGUDLQDWUDWHGFDSDFLW\2SHUDWLQJWHPSHUDWXUHWR
GHJUHHV)&DUGHG
Our No.
No.
Shf
Pk
Unit
1,250 MAH
024-0648
(03
$$$
&'
433-8786
(/3
$$$
12
&'
$$
($
)RUPXODWHGWRSURYLGHGHSHQGDEOH
ORQJODVWLQJSRZHU8VHLQWR\VDX
GLR GHYLFHV ÀDVKOLJKWV HOHFWURQLF
GHYLFHV UHPRWH FRQWURO FRPPX
QLFDWLRQ GHYLFHV VPRNH GHWHFWRUV
DQGVHFXULW\V\VWHPV3ODVWLFODEHOMDFNHW\HDUVKHOIOLIH
DWSHUFHQWRIUDWHGFDSDFLW\YROWP$FRQWLQX
RXVGUDLQDWUDWHGFDSDFLW\2SHUDWLQJWHPSHUDWXUHWR
GHJUHHV)&DUGHG
Our No.
No.
Batteries
No./Type
Shf
Pk
Unit
ENERGIZER BATTERY
$$
12
($
116-2676
$$
48
‡&233(5723
‡³32:(5&+(&.´
(03
&'
304-4559
(/3
$$
12
&'
+LJK HQHUJ\ GHQVLW\ FDSDEOH RI
SHUIRUPDQFH DW KLJK GLVFKDUJH
UDWHV 7\SLFDO WHPSHUDWXUH UDQJH
WRGHJUHHV)6KHOIOLIHRIXS
WRSHUFHQWFDSDFLW\UHPDLQLQJDIWHU\HDUVRIVWRUDJH
DWGHJUHHV)
ALKALINE BATTERIES
Size
Batteries
Shf
Pk
Unit
$$
10
&'
Our No.
No.
Num/Type
Batteries
Shf
Pk
Unit
01%=
$$
14
&'
/RQJODVWLQJUHOLDEOHSRZHU
DURACELL
824-7546
Our No.
727-5357
ALKALINE BATTERIES
‡$$
‡³352&(//´
No.
C BATTERY/BATTERIES
No.
Shf
Pk
Unit
3&.'
%;
POWER ZONE
475-5476
$$$
10
&'
060-4785
$$$
10
&'
HEAVY DUTY
BATTERIES
‡³(9(5($'<´
&DUERQ=LQF0HWDOMDFNHWYROW
P$ FRQWLQXRXV GUDLQ DW UDWHG
FDSDFLW\ 2SHUDWLQJ WHPSHUDWXUH WRGHJUHHV)
Our No.
ALKALINE BATTERIES
Unit
841-6463
3ODVWLFODEHOMDFNHW\HDUVKHOIOLIH
DWSHUFHQWRIUDWHGFDSDFLW\
YROWP$FRQWLQXRXVGUDLQDWUDW
HGFDSDFLW\2SHUDWLQJWHPSHUDWXUH
WRGHJUHHV)1RWLQWHQGHGIRUUHWDLOVDOH&DUGHG
No.
Size
Batteries
MAH
Rating
Shf
Pk
Unit
$$
24
($
ENERGIZER BATTERY
225-6253X
(1
No.
Size
MAH
Rating
Shf
Pk Unit
&
12
ENERGIZER BATTERY
‡,1'8675,$/
‡³(1(5*,=(5,1'8675,$/´
Our No.
Specialty Electrical
/RQJODVWLQJSRZHU
264-8566
Shf
Pk
$%3
2,850 MAH
DURACELL
/RQJODVWLQJUHOLDEOHSRZHU
Size
Batteries
244-1566
(%3
Our No.
ALKALINE BATTERIES
No.
Unit
POWER ZONE
ENERGIZER BATTERY
Our No.
Shf
Pk
836-9357
ALKALINE BATTERIES
($
Size
Batteries
ENERGIZER BATTERY
Unit
ALKALINE BATTERIES
Batteries
No./Type
No.
‡³(1(5*,=(50$;´
ALKALINE BATTERIES
ENERGIZER BATTERY
610-3303X
Our No.
ALKALINE BATTERIES
‡³8/75$32:(5´
ALKALINE BATTERIES
3ODVWLF ODEHO MDFNHW \HDU VKHOI
OLIHDWSHUFHQWRIUDWHGFDSDFLW\
YROW P$ FRQWLQXRXV GUDLQ
DW UDWHG FDSDFLW\ 2SHUDWLQJ WHP
SHUDWXUHWRGHJUHHV)
0$+&DUGHG
Specialty Electrical
Recloseable
056-1043
‡³(9(5($'<*2/'´
‡/,7+,80(1(5*,=(5
+LJK HQHUJ\ GHQVLW\ FDSDEOH RI
SHUIRUPDQFH DW KLJK GLVFKDUJH
UDWHV 7\SLFDO WHPSHUDWXUH UDQJH
WRGHJUHHV)6KHOIOLIHRIXS
WRSHUFHQWFDSDFLW\UHPDLQLQJDIWHU\HDUVRIVWRUDJH
DWGHJUHHV)
Our No.
ALKALINE BATTERIES
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
6:
($
Maintenance, Repair & Operations - ALKALINE BATTERIES
ALKALINE BATTERIES
‡352)(66,21$/
‡³352&(//´
‡&233(5723
‡³32:(5&+(&.´
/RQJODVWLQJSRZHU
/DVWV ORQJHU LQ KLJKWHFK GHYLFHV
+LJK HQHUJ\ GHQVLW\ FDSDEOH RI
SHUIRUPDQFH DW KLJK GLVFKDUJH
UDWHV
Our No.
No.
Size
Batteries
3&
&
Shf
Pk
Unit
%;
DURACELL
947-4594
ALKALINE BATTERIES
No.
Battery
Size
824-6993
01%=
137-4081
015=
Our No.
Specialty Electrical
9 VOLT BATTERY/BATTERIES
‡352)(66,21$/
‡92/7
‡³352&(//´
/RQJODVWLQJSRZHU
Shf
Pk
Unit
'
&'
'
12
&'
DURACELL
Shf
Pk
Unit
%;
No.
Shf
Pk
Unit
824-7512
01%=
12
&'
137-5989
01%=
12
&'
Our No.
No.
DURACELL
999-2801
3&%.'
ALKALINE BATTERIES
‡&233(5723
‡³32:(5&+(&.´
ALKALINE BATTERIES
/DVWV ORQJHU LQ KLJKWHFK GHYLFHV
+LJK HQHUJ\ GHQVLW\ FDSDEOH RI
SHUIRUPDQFH DW KLJK GLVFKDUJH
UDWHV
No.
Battery
Size
824-7348
01%=
&
8
&'
137-4149
015=;
&
18
&'
Our No.
Shf
Pk
Unit
DURACELL
‡³(1(5*,=(5,1'8675,$/´
ALKALINE BATTERIES
/RQJ ODVWLQJ $ONDOLQH YROW P$ FRQWLQXRXV GUDLQ DW UDWHG FD
SDFLW\ 3ODVWLF ODEHO MDFNHW \HDU
VKHOI OLIH DW SHUFHQW RI UDWHG
FDSDFLW\ 0$+ WR YROW
2SHUDWLQJWHPSHUDWXUHWRGHJUHHV)1RWLQWHQGHG
IRUUHWDLOVDOH
+LJK HQHUJ\ GHQVLW\ FDSDEOH RI
SHUIRUPDQFH DW KLJK GLVFKDUJH
UDWHV
Our No.
No.
Size
Batteries
Shf
Pk
Unit
'
12
($
ENERGIZER BATTERY
361-2272X
(1
‡&233(5723
‡92/7
Our No.
DURACELL
ALKALINE BATTERIES
‡³(1(5*,=(5,1'8675,$/´
/RQJ ODVWLQJ $ONDOLQH YROW P$ FRQWLQXRXV GUDLQ DW UDWHG FD
SDFLW\ 3ODVWLF ODEHO MDFNHW \HDU
VKHOI OLIH DW SHUFHQW RI UDWHG
FDSDFLW\ 0$+ WR YROW
2SHUDWLQJWHPSHUDWXUHWRGHJUHHV)1RWLQWHQGHG
IRUUHWDLOVDOH
Our No.
Size
Batteries
No.
Shf
Pk
Unit
ENERGIZER BATTERY
059-6205X
(1
ALKALINE BATTERIES
ALKALINE BATTERIES
‡³(9(5($'<*2/'´
‡92/7
‡³(1(5*,=(5´
/RQJ ODVWLQJ $ONDOLQH YROW P$ FRQWLQXRXV GUDLQ DW UDWHG FD
SDFLW\2SHUDWLQJWHPSHUDWXUHWR
GHJUHHV)&DUGHG
Our No.
Type
Battery
No.
Shf
Pk
Unit
ENERGIZER BATTERY
12
&
Our No.
19,500 MAH
($
921-4727
ALKALINE BATTERIES
$%3
0HWDOMDFNHW\HDUVKHOIOLIHDW
SHUFHQW RI UDWHG FDSDFLW\ YROW
P$ FRQWLQXRXV GUDLQ DW UDWHG
FDSDFLW\ 2SHUDWLQJ WHPSHUDWXUH WRGHJUHHV)0$+&DUGHG
'
No.
12
($
841-4682
%3
12
($
812-0198
%3
12
($
ALKALINE BATTERIES
7HVWHURQHYHU\EDWWHU\3ODVWLFOD
EHO MDFNHW \HDUV VKHOI OLIH DW SHUFHQWRIUDWHGFDSDFLW\YROW
P$ FRQWLQXRXV GUDLQ DW UDWHG
FDSDFLW\ 2SHUDWLQJ WHPSHUDWXUH WRGHJUHHV)
‡³(1(5*,=(5´
ALKALINE BATTERIES
7HVWHURQHYHU\EDWWHU\3ODVWLFOD
EHO MDFNHW \HDUV VKHOI OLIH DW SHUFHQWRIUDWHGFDSDFLW\YROW
P$ FRQWLQXRXV GUDLQ DW UDWHG
FDSDFLW\ 2SHUDWLQJ WHPSHUDWXUH WRGHJUHHV)
‡92/7
‡³(9(5($'<*2/'´
Size
Batteries
No.
Shf
Pk
Unit
ENERGIZER BATTERY
Our No.
837-2054
(%3
&
($
139-9419
(%3
&
12
($
Specialty Electrical
5DWHG FDSDFLW\ DW P$ FRQWLQX
RXVGUDLQWRGHJUHHV)RSHU
DWLQJWHPSHUDWXUH\HDUVKHOIOLIH
DWSHUFHQWRIUDWHGFDSDFLW\
0$+&DUGHG
Our No.
No.
Shf
Pk
Unit
12
($
ENERGIZER BATTERY
837-4092
(%3
'
12
($
139-9856
(%3
'
12
($
576-4725
$%3
ALKALINE BATTERIES
‡,1'8675,$/
‡92/7
‡³(1(5*,=(5´
ALKALINE BATTERIES
‡352)(66,21$/
‡³352&(//´
0HWDO-DFNHW\HDUVKHOIOLIHDW
SHUFHQWRIUDWHGFDSDFLW\YROW
P$ FRQWLQXRXV GUDLQ DW UDWHG
FDSDFLW\2SHUDWLQJWHPSHUDWXUHWRGHJUHHV)
0$+WRYROW
/RQJODVWLQJSRZHU
Size
Batteries
Shf
Pk
Unit
Our No.
No.
Shf
Pk
Unit
12
($
ENERGIZER BATTERY
DURACELL
874-1779
Unit
20,500 MAH - Carded
D BATTERY/BATTERIES
No.
Shf
Pk
ENERGIZER BATTERY
8,350 MAH - Carded
Our No.
Size
Batteries
No.
Unit
ENERGIZER BATTERY
‡³(1(5*,=(5´
Our No.
Shf
Pk
3&
'
%;
652-6412X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
(1
- Maintenance, Repair & Operations
Specialty Electrical
LITHIUM BATTERIES
LANTERN BATTERIES
‡1215(&+$5*($%/(
‡92/7
‡92/7
‡³683(5+($9<'87<´
/LJKWZHLJKW KLJK HQHUJ\ GHQVLW\
8SWR\HDUVHUYLFHOLIH:LGHRS
HUDWLQJ WHPSHUDWXUH UDQJH /DVWV
up to 5 times longer than ordinary
YROW DONDOLQH EDWWHULHV /LWKLXP0DQJDQHVH 'LR[LGH
QRQUHFKDUJHDEOHWRYROWYROWDYHUDJH1RP
LQDOFDSDFLW\RI$KDWP$WRYROWDWGHJUHHV
&0D[LPXPGLVFKDUJHRIP$FRQWLQXRXV2SHUDWLQJ
WHPSHUDWXUHRIWRGHJUHHV&
&DUERQ=LQFEDWWHU\3ODVWLFMDFNHW
&RLOVSULQJWHUPLQDOYROWP$
FRQWLQXRXVGUDLQDWUDWHGFDSDFLW\
2SHUDWLQJWHPSHUDWXUHGHJUHHV)
WRGHJUHHV)/RZHUXQLWZHLJKWWKDQDONDOLQH$+
W2YROW
Our No.
No.
Shf
Pk
Unit
12
($
Our No.
No.
Type
Terminal
WATCH BATTERY/BATTERIES
Shf
Pk
Unit
ENERGIZER BATTERY
653-0844
6SULQJ
12
WATCH/CALCULATOR
BATTERIES
‡6,/9(52;,'(
‡³29(57,0(´
5HSODFHV 63 9 DQG
656: PP GLDPHWHU [
PP ZLGWK P$+ YROW
FDUGHG
Our No.
($
Shf
Pk
No.
ULTRALIFE BATTERIES,INC
510-8659
7,+6
89/;
Unit
ENERGIZER BATTERY
NO MERCURY
887-0735X
%3=
($
LANTERN BATTERIES
‡$/.$/,1(&233(5723
92/7
‡92/7
LITHIUM BATTERIES
‡92/7$'9$1&('
/,7+,80
/RQJHU VHUYLFH DQG OLJKWHU WKDQ
RWKHUSULPDU\EDWWHU\W\SHVHVSH
cially in moderate to heavy drain
DSSOLFDWLRQV+LJKHURSHUDWLQJYROW
DJH DQG ÀDWWHU GLVFKDUJH FXUYH ZLWK JRRG OHDNDJH UH
VLVWDQFH 1R DGGHG PHUFXU\ FDGPLXP RU OHDG 3ODVWLF
ODEHOPLQLDWXUHVQDSWHUPLQDO\HDUVKHOIOLIHPP
KHLJKW[PPOHQJWK[PPZLGWK
Our No.
No.
Shf
Pk
Unit
12
($
/$6%3
LANTERN BATTERIES
No.
Type
Terminal
Shf
Pk
Unit
6SULQJ
12
($
POWER ZONE
6SULQJ
&'
01
6FUHZ3RVW
4
($
3ODVWLF MDFNHW YROW P$ FRQ
WLQXRXVGUDLQDWUDWHGFDSDFLW\2S
erating temperature 0 degrees F to
GHJUHHV)
Type
Terminal
No.
1.55 Volt - Card/3
842-0812
Type
Terminal
842-0804X
Shf
Pk
622-8530
&RLO6SULQJ
($
PHOTO ELECTRONIC
BATTERIES
Unit
12
($
%3=
($
WATCH/CALCULATOR
BATTERIES
‡6,/9(52;,'(%87721
&(//
5HSODFHV 656:: 75
6: PP GLDPHWHU [ PP
KHLJKWYROWFDUGHG
Our No.
Shf
Pk
Shf
Pk
No.
Unit
ENERGIZER BATTERY
27 MAH TO 1.3 VOLT - NO MERCURY
842-0820X
%3=
Unit
WATCH/CALCULATOR
BATTERIES
($
‡6,/9(52;,'(%87721
&(//
ENERGIZER BATTERY
ENERGIZER BATTERY
6FUHZ3RVW
($
%3
($
Unit
4
Volt
10
%3=
1.55 Volt - Carded
6FUHZ3RVW
632-4149
Unit
150 MAH TO 1.3 VOLT - NO MERCURY
528
No.
Shf
Pk
No.
ENERGIZER BATTERY
622-8472
Our No.
Shf
Pk
5HSODFHV $* /5 (3;
$ /5 656:: 'XUDFHOO
' *ROGSHDN .RGDN
/ 0D[HOO 65: 3DQDVRQLF 63 5D\RYDF 5HQDWD 6RQ\ 65: 7RVKLED 65: DQG 9DUWD
9PPGLDPHWHU[PPKHLJKW
Our No.
2SHUDWLQJWHPSHUDWXUHRIWR
GHJUHHV ) 3ODVWLF MDFNHW ÀDW FRQ
WDFWVWHUPLQDO6L]HUHSODFHV.
DQG6KHOIOLIHRI\HDUV
DW GHJUHHV & SHUFHQW RI LQLWLDO FDSDFLW\ &HOO LV
IRXULQVHULHVP$+&DUGHG
‡92/7
‡³&/$66,&´
6
01
651-8252
‡$/.$/,1((1(5*,=(5
LANTERN BATTERIES
635-4476
651-6900
Unit
ENERGIZER BATTERY
/RQJODVWLQJUHOLDEOHSRZHUIRUHY
HU\GD\XVH
No.
Shf
Pk
DURACELL
Our No.
‡+($9<'87<
‡92/7
Our No.
Type
Terminal
0HWDO MDFNHW RSHUDWLQJ WHPSHUD
WXUHRIWRGHJUHHV)
P$+WRYROW
6 VOLT BATTERY/BATTERIES
216-3376
No.
Our No.
‡$/.$/,1(
‡92/7
‡³(1(5*,=(5´
Specialty Electrical
Our No.
‡6,/9(52;,'(%87721
&(//
LANTERN BATTERIES
ENERGIZER BATTERY
358-9454
WATCH/CALCULATOR
BATTERIES
3URYLGHVSRZHUDQGORQJOLIH
($
5HSODFHV 65756: 'XUDFHOO
' 0D[HOO 656: 3DQDVRQLF
63 6RQ\ 656: 7RVKLED
656: DQG 9DUWD 9 PP GLDPHWHU [ PP
KHLJKWYROWFDUGHG
Our No.
No.
MAH
Rating
Shf
Pk
Unit
ENERGIZER BATTERY
NO MERCURY
842-1000X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%3=
20
($
Maintenance, Repair & Operations - WATCH/CALCULATOR
BATTERIES
WATCH/CALCULATOR
BATTERIES
WATCH/CALCULATOR
BATTERIES
‡6,/9(52;,'(%87721
&(//
‡6,/9(52;,'(%87721
&(//
‡/,7+,80&2,1&(//
5HSODFHV
656::
756: PP GLDPHWHU [
PPKHLJKWYROWFDUGHG
'HVLJQHGIRUXVHRQFRQWLQXRXVORZ
GUDLQ5HSODFHV/5
656:: 'XUDFHOO '
' DQG ' 0D[HOO 65: 3DQDVRQLF 63
6RQ\ 65: 7RVKLED 65: DQG 9DUWD 9
PPGLDPHWHU[PPKHLJKWYROWFDUGHG
Our No.
No.
Shf
Pk
Unit
ENERGIZER BATTERY
34 MAH TO 1.3 VOLT - NO MERCURY
642-8429X
%3=
Our No.
($
No.
Shf
Pk
Our No.
Unit
ENERGIZER BATTERY
85 MAH TO 1.3 VOLT - NO MERCURY
891-5332X
%3=
5HSODFHV
656::
75: 'XUDFHOO DQG '
(QHUJL]HU 0D[HOO 656:
3DQDVRQLF 63 5HQDWD 6RQ\ 656: 7LPH[
%$7RVKLED656:DQG9DUWD9PPGLDPHWHU
[PPKHLJKWYROWFDUGHG
Our No.
No.
Shf
Pk
Unit
ENERGIZER BATTERY
642-8452X
%3=
'HVLJQHG IRU XVH RQ FRQWLQXRXV
ORZGUDLQ5HSODFHV'XUDFHOO'
3DQDVRQLF 63 9DUWD 9 7L
PH[ / 0D[ZHOO 6RQ\ DQG 7RVKLED 65: PP
GLDPHWHU[PPKHLJKWYROWFDUGHG
WATCH/CALCULATOR
BATTERIES
%3=
'HVLJQHG IRU XVH RQ FRQWLQXRXV
ORZ GUDLQ 5HSODFHV 656::
75: 'XUDFHOO ' '
' ' ' ' ' ' ' '
' ' ' ' ' ' ' '
' ' ' '/ (QHUJL]HU *ROGSHDN
0D[HOO 656: 5D\RYDF 5: 5:
5:5:5:5:5:5:5:
5: 5: 5: 5: 5: 5: 5:
5: 5: 5: 5: 5HQDWD 6RQ\ 65
6: 7LPH[ -$ 7RVKLED 656: DQG 9DUWD 9
PPGLDPHWHU[PPKHLJKWYROWFDUGHG
Shf
Pk
Shf
Pk
%3=
Unit
Our No.
'HVLJQHG IRU XVH RQ FRQWLQXRXV
ORZ GUDLQ 5HSODFHV /5 656:: 'XUDFHOO DQG'(QHUJL]HUDQG*ROGSHDN0D[
HOO65:3DQDVRQLF635D\RYDF5HQDWD
6RQ\65:7LPH[+7RVKLED65:DQG9DUWD9
PPGLDPHWHU[PPKHLJKWYROWFDUGHG
ENERGIZER BATTERY
648-4356X
(&5%3
3
($
369-8875
%3
3
12
&'
5HSODFHV 'XUDFHOO '/ (QHU
JL]HU(&53DQDVRQLF&5
DQG 5D\RYDF &5 PP GL
DPHWHU [PPKHLJKW/LWKLXP
0DQJDQHVH'LR[LGH/L0Q2P$KWRYROWV
&DUGHG8//LVWHG0+
Our No.
Volts
Shf
Pk
Unit
3
($
%3
3
10
&'
%3=
($
WATCH/CALCULATOR
BATTERIES
Shf
Pk
Unit
5HSODFHV &5 PP GL
DPHWHU [ PP ZLGWK YROW
/LWKLXP 0DQJDQHVH 'LR[LGH /L
0Q2 P$K WR YROWV
&DUGHG8//LVWHG0+
Unit
'HVLJQHGIRUXVHRQFRQWLQXRXVORZ
GUDLQ 5HSODFHV 656::
75: 'XUDFHOO ' 0D[HOO
656:3DQDVRQLF636RQ\656:7LPH[/$
7RVKLED 656: DQG 9DUWD 9 PP GLDPHWHU [
PPKHLJKWYROWFDUGHG
Our No.
No.
Shf
Pk
Our No.
098-2876X
Unit
ENERGIZER BATTERY
52 MAH TO 1.3 VOLT - NO MERCURY
692-4492X
%3=
No.
Volts
ENERGIZER BATTERY
($
120 MAH TO 1.3 VOLT - NO MERCURY
No.
ENERGIZER BATTERY
ENERGIZER BATTERY
%3=
Volts
‡/,7+,80&2,1&(//
‡6,/9(52;,'(%87721
&(//
828-7716X
No.
(&5%3
‡6,/9(52;,'(%87721
&(//
Shf
Pk
Shf
Pk
5HSODFHV'XUDFHOO'/DQG5D\
RYDF &5 PP GLDPHWHU [
PP KHLJKW /LWKLXP 0DQJD
QHVH 'LR[LGH /L0Q2 P$K
WRYROW&DUGHG8//LVWHG0+
098-8345
($
WATCH/CALCULATOR
BATTERIES
No.
&'
648-7425X
WATCH/CALCULATOR
BATTERIES
Our No.
($
12
41 MAH TO 1.3 VOLT - NO MERCURY
845-5206X
3
Unit
14.5 MAH TO 1.3 VOLT - NO MERCURY
880-0450X
3
%3
ENERGIZER BATTERY
Unit
ENERGIZER BATTERY
(&5%3
015-1340
‡/,7+,80&2,1&(//
'HVLJQHG IRU XVH RQ FRQWLQXRXV
ORZ GUDLQ 5HSODFHV /5 656:: 'XUDFHOO '
(QHUJL]HU*ROGSHDN0D[HOO65:3DQDVRQLF
63 5D\RYDF 5HQDWD 6RQ\ 65: 7LPH[
. 7RVKLED 65: DQG 9DUWD 9 PP GLDPHWHU [
PPKHLJKWYROWFDUGHG
No.
191-3896X
WATCH/CALCULATOR
BATTERIES
‡6,/9(52;,'(%87721
&(//
Our No.
Unit
ENERGIZER BATTERY
($
WATCH/CALCULATOR
BATTERIES
‡6,/9(52;,'(%87721
&(//
No.
Unit
49 MAH TO 1.3 VOLT - NO MERCURY
828-8003X
Our No.
Shf
Pk
ENERGIZER BATTERY
($
Shf
Pk
‡/,7+,80&2,1&(//
‡6,/9(52;,'(%87721
&(//
No.
Volts
WATCH/CALCULATOR
BATTERIES
WATCH/CALCULATOR
BATTERIES
Our No.
26 MAH TO 1.3 VOLT - NO MERCURY
No.
($
WATCH/CALCULATOR
BATTERIES
‡6,/9(52;,'(%87721
&(//
5HSODFHV (QHUJL]HU (&5 ´
GLDPHWHU[´KHLJKW/LWKLXP
0DQJDQHVH 'LR[LGH /L0Q2 P$KWRYROWVW\SLFDOFDSDFLW\
JUDPVR]W\SLFDOZHLJKW&DUGHG8//LVWHG
0+
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
(&5%3
3
($
- Maintenance, Repair & Operations
WATCH/CALCULATOR
BATTERIES
HEARING AID
BATTERIES
PHOTO ELECTRONIC
BATTERIES
‡/,7+,80&2,1&(//
‡=,1&$,5
‡/,7+,80
5HSODFHV DOO EDWWHULHV
PPGLDPHWHU[PPKHLJKW
/LWKLXP 0DQJDQHVH 'LR[LGH /L
0Q2 P$K WR YROWV
&DUGHG8//LVWHG0+
/RQJ ODVWLQJ %HVW IRU FRQWLQXRXV
XVHYROWFDUGHG
/DVWV ORQJHU WKDQ DONDOLQH LQ HOHF
WURQLFGHYLFHV
Our No.
No.
Shf
Pk
Volts
Our No.
Unit
ENERGIZER BATTERY
&'
632-5294
ENERGIZER BATTERY
475-7233
Shf
Pk
No.
635 MAH TO 0.9 VOLT
3
(&5%3
$=(
‡0$1*$1(6(',2;,'(
%87721&(//
‡$/.$/,1(
Our No.
No.
Volt
Shf
Pk
3;$3.
Our No.
Unit
&'
($
ALKALINE BATTERIES
‡0(',&$/3+2725(027(
‡6,=(-
Our No.
Shf
Pk
Volt
&'
No.
Volt
Shf
Pk
Our No.
3
&'
No.
Volt
Shf
Pk
Unit
3;/%3.
&'
DURACELL
Unit
679-7344
$%3=
12
($
PHOTO ELECTRONIC
BATTERIES
‡/,7+,80(1(5*,=(5
PHOTO ELECTRONIC
BATTERIES
2SHUDWLQJ WHPSHUDWXUH WR GHJUHHV)&RQWDLQVD3RVLWLYH7HP
SHUDWXUH &RHI¿FLHQW 37& VDIHW\
device to limit current during short
FLUFXLW FRQGLWLRQV 5HSODFHV '/$ 7\SLFDO FDSDFLW\
P$KWRYROW
6L]H UHSODFHV 3;$ /5
DQG 93; YROW P$K
&HOOLVIRXU1R$EDWWHULHVLQVH
ULHVZLWKDPHWDOMDFNHWP$+
&DUGHG
ALKALINE BATTERIES
‡$$$$
‡³(1(5*,=(5´
'HOLYHUVORQJHUODVWLQJPRUHSRZ
HUIXO SHUIRUPDQFH IRU GHPDQGLQJ
KLJKWHFK GHYLFHV VXFK DV 03
SOD\HUVSRUWDEOH&'SOD\HUVGLJLWDO
FDPHUDVKDQGKHOGHOHFWURQLFJDPHVDQGRWKHUGLJLWDO
GHYLFHV3ODVWLFODEHOMDFNHW\HDUVKHOIOLIHDWSHUFHQW
RI UDWHG FDSDFLW\ YROW P$ FRQWLQXRXV GUDLQ DW
UDWHGFDSDFLW\2SHUDWLQJWHPSHUDWXUHWRGHJUHHV
)0$+&DUGHG
Shf
Pk
Unit
3.
ENERGIZER BATTERY
(%3
'/%3.
/DVWV ORQJHU WKDQ DONDOLQH LQ HOHF
WURQLFGHYLFHV
‡$/.$/,1(%$77(5<67$&.
371-4474
Unit
‡/,7+,80
‡92/7
Unit
DURACELL
No.
Shf
Pk
NO MERCURY
576-4733
Our No.
Volt
ENERGIZER BATTERY
/RQJODVWLQJSRZHU
.%3.
No.
PHOTO ELECTRONIC
BATTERIES
'HVLJQHG IRU HOHFWURQLF DSSOLFD
WLRQV ZKLFK PD\ UHTXLUH KLJK UDWH
pulses such as remotes and camer
DV&HOOLVHLJKW1R/5EDWWHULHV
LQVHULHVLQDEDWWHU\VWDFNP$+&DUGHG
Specialty Electrical
688-8390
&'
DURACELL
679-4788
PHOTO ELECTRONIC
BATTERIES
SPECIALTY BATTERY/BATTERIES
No.
3ULPDU\XVDJHLVIRUNH\OHVVHQWU\
/DVWVORQJHUWKDQDONDOLQH
‡$/.$/,1(%8772167$&.
Our No.
3
Unit
Unit
150 MAH TO 0.9 VOLT - NO MERCURY
$%3=
'/1%%3.
Shf
Pk
‡/,7+,80
ENERGIZER BATTERY
576-9914
Volt
PHOTO ELECTRONIC
BATTERIES
DURACELL
680-4181
No.
($
/DVWVORQJHULQHOHFWURQLFGHYLFHV
Shf
Pk
No.
679-8177
PHOTO ELECTRONIC
BATTERIES
'HVLJQHG IRU HOHFWURQLF DSSOLFD
WLRQV ZKLFK PD\ UHTXLUH KLJK UDWH
SXOVHV 5HSODFHV $* /5
(3;$/5656::'XUDFHOO/5(QHUJL]HU
$3DQDVRQLF/3DQDVRQLF/55D\RYDF5D\R
YDF5:DQG9DUWD9*$PPGLDPHWHU[PP
KHLJKWYROWFDUGHG
Our No.
DURACELL
WATCH/CALCULATOR
BATTERIES
Our No.
Unit
Our No.
No.
Volts
Our No.
Shf
Pk
No.
Volt
Shf
Pk
Unit
ENERGIZER BATTERY
Unit
ENERGIZER BATTERY
1500 MAH - Carded
648-6666
(/$3%3
3
($
NO MERCURY
625-8321
$%3=
($
PHOTO ELECTRONIC
BATTERIES
‡/,7+,80(1(5*,=(5
‡³/,7+,803+272´
PHOTO ELECTRONIC
BATTERIES
2SHUDWLQJ WHPSHUDWXUH WR GHJUHHV)&RQWDLQVD3RVLWLYH7HP
SHUDWXUH &RHI¿FLHQW 37& VDIHW\
GHYLFHWROLPLWFXUUHQWGXULQJVKRUWFLUFXLWFRQGLWLRQV6L]H
UHSODFHV&57\SLFDOFDSDFLW\P$KWRYROW
‡$/.$/,1(
3ODVWLFODEHOMDFNHWYROWP$
FRQWLQXRXVGUDLQDWUDWHGFDSDFLW\
2SHUDWLQJ WHPSHUDWXUH WR GHJUHHV)P$+&DUGHG
Our No.
No.
Volt
Shf
Pk
Our No.
Unit
ENERGIZER BATTERY
(%3
632-4685
Volt
Shf
Pk
Unit
ENERGIZER BATTERY
2-N-1 PAK
674-9808
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
(/&5%3
($
Maintenance, Repair & Operations - Specialty Electrical
PHOTO ELECTRONIC
BATTERIES
‡/,7+,80(1(5*,=(5
6L]H UHSODFHV '/$ DQG %53
2SHUDWLQJ WHPSHUDWXUH WR GHJUHHV)&RQWDLQVD3RVLWLYH7HP
SHUDWXUH &RHI¿FLHQW 37& VDIHW\
GHYLFH WR OLPLW FXUUHQW GXULQJ VKRUW FLUFXLW FRQGLWLRQV
7\SLFDOFDSDFLW\P$KWRYROW
Our No.
No.
Shf
Pk
Volt
Unit
ENERGIZER BATTERY
632-4479
($
Type
Batteries
MAH
Rating
Shf
Pk Unit
ENERGIZER BATTERY
648-6567
/%3
$$
3000
721-4539
/%3
$$
932-7065
/%3
$$$
($
3000
4
($
1250
3.
'/&5%3.
3
No.
603-5703
1+1%3
Shf
Pk
Unit
975-4474
MAH
Rating
Shf
Pk
Unit
($
&'
DURACELL
Type
Batteries
MAH
Rating
Shf
Pk Unit
603-5687
1+%3
$$$
850
($
603-5679
1+%3
$$
2500
($
603-5695
1+%3
$$
2500
($
‡6,/9(52;,'((1(5*,=(5
Our No.
RECHARGEABLE
BATTERIES
No.
Volt
Unit
ENERGIZER BATTERY
NO MERCURY
198-2677
(3;%3=
($
&+01&3
No.
&+0)&&+)&9
3
($
Color
Shf
Pk
Gray
3
Unit
‡1,&.(/0(7$/+<'5,'(
1,0+
‡$$$$$
‡³60$57&+$5*(5´
&KDUJHVRU$$RU$$$DWDWLPH
FKHFNV LI WKH EDWWHULHV DUH VWLOO UH
FKDUJHDEOH)XHOJDXJHDQGFRXQWGRZQFORFNWHOOVZKHQ
EDWWHULHVDUHGRQHFKDUJLQJ0D[LPL]HVF\FOHOLIHRIWKH
1L0+FHOOVZLWKEXLOWLQRYHUFKDUJHSURWHFWLRQ6KXWRII
PHFKDQLVP 'HOWD 9 'HWHFWLRQ KRXU WLPHU &KDUJLQJ
FXUUHQWRU[$$0DRU$$$P$)ROGLQJ
SOXJ UHYHUVH SRODULW\ SURWHFWLRQ 7\SLFDO ZHLJKW JUDPVR]
1L0+URXQGFHOOEDWWHULHV¶OHDGLQJ
HGJHWHFKQRORJ\PDNHVWKHPLGHDO
IRU WKH PRVW DGYDQFHG KLJKGUDLQ
GHYLFHV GLJLWDO FDPHUDV SHUVRQDO GLJLWDO DVVLVWDQW
3'$VKDQGKHOGJDPHVSRUWDEOH&'SOD\HUVDQGSDOP
WRSFRPSXWHUV5HFKDUJHVXSWRWLPHV&DUGHG
ENERGIZER BATTERY
Type
Batteries
MAH
Rating
910-3375
Shf
Pk Unit
ENERGIZER BATTERY
603-5711
1+%3
&
2500
($
603-5729
1+%3
'
2500
($
($
BATTERY CHARGERS
Our No.
No.
&KDUFRDO*UD\
&KDUJHV RU $$ $$$ & RU '
VL]H1L0+EDWWHULHVRURUYROW
1L0+EDWWHULHVRYHUQLJKW%DWWHULHVPXVWEHFKDUJHGLQ
SDLUV 5HG /(' FKDUJH LQGLFDWRUV JR RII ZKHQ FKDUJLQJ
LVFRPSOHWH5HYHUVHSRODULW\SURWHFWLRQDJDLQVWGDPDJH
IURPLQFRUUHFWO\LQVWDOOHGEDWWHULHV8//LVWHG
‡1,&.(/0(7$/+<'5,'(
Our No.
Unit
‡)$0,/<&+$5*(51,0+
‡$$$$$&'92/7
603-5752
PHOTO ELECTRONIC
BATTERIES
Shf
Pk
Shf
Pk
ENERGIZER BATTERY
ENERGIZER BATTERY
'HVLJQHG IRU SKRWR XVH 6L]H UH
SODFHV60656*$
93;DQG653$YHUDJHFDSDF
LW\P$KWRYROWFDUGHG
Color
BATTERY
CHARGERS
Our No.
3ODVWLF ODEHO MDFNHW YROW )RU
high drain devices such as digi
WDO FDPHUDV &' SOD\HUV WR\V DQG
JDPHV +LJK HQHUJ\ FRPHV FKDUJHG IURP WKH IDFWRU\
UHDG\WRXVH5HFKDUJHVXSWRWLPHV&DUGHG
No.
No.
ENERGIZER BATTERY
‡1,&.(/0(7$/+<'5,'(
Our No.
&KDUJHV RQH WR IRXU $$ RU $$$
1L0+VL]HEDWWHULHVLQDERXWPLQXWHV&KDUJHULQGLYLG
XDOO\PRQLWRUVFHOOFRQGLWLRQ5HYHUVHSRODULW\SURWHFWLRQ
DJDLQVWGDPDJHIURPLQFRUUHFWO\LQVWDOOHGEDWWHULHV,OOX
PLQDWHGUHG/('OLJKWZKLOHFKDUJLQJWXUQVJUHHQZKHQ
FKDUJLQJ LV FRPSOHWH ,GHDO IRU KLJK GUDLQ DSSOLFDWLRQV
,QSXWUDWLQJYROW$&+]ZDWW$&DGDSWHULV
LQFOXGHG8//LVWHG
Our No.
RECHARGEABLE
BATTERIES
/DVWV ORQJHU WKDQ DONDOLQH LQ HOHF
WURQLFGHYLFHV/LJKWLQZHLJKWDQG
FRPSDFW KLJK HQHUJ\ GHQVLW\ H[
FHOOHQWVKHOIOLIHORQJWHUPUHOLDELO
LW\ DQG KLJK UDWH FDSDELOLW\ RYHU D EURDG WHPSHUDWXUH
UDQJH
Volts
&'
ENERGIZER BATTERY
‡8/75$/,7+,80
No.
1
$5;;
1L0+ OHDGLQJHGJH WHFKQRORJ\ IRU
KLJKGUDLQGHYLFHVGLJLWDOFDPHU
DVSHUVRQDOGLJLWDODVVLVWDQW3'$VKDQGKHOGJDPHV
SRUWDEOH&'SOD\HUVDQGSDOPWRSFRPSXWHUV5HFKDUJHV
XSWRWLPHV&DUGHG
Our No.
PHOTO ELECTRONIC
BATTERIES
680-3845
Unit
‡1,&.(/0(7$/+<'5,'(
‡92/7
6KHOIOLIHRI\HDUVDWGHJUHHV
&SHUFHQWRIUDWHGFDSDFLW\8/
/LVWHG0+7\SLFDOFDSDFLW\
P$KWRYROW&DUGHG
Our No.
Shf
Pk
No.
RECHARGEABLE
BATTERIES
‡/,7+,80(1(5*,=(5
No.
‡1,&.(/0(7$/+<'5,'(
1,0+
‡$$$$$
5HSODFHPHQW YROW EDWWHU\ IRU
5(UHFKDUJHDEOHÀDVKOLJKW
Our No.
BATTERY CHARGERS
BATTERY
CHARGERS
‡1,&$'%$77(5<3$&.6
608-9718
PHOTO ELECTRONIC
BATTERIES
Our No.
RECHARGEABLE
BATTERIES
MAG INSTRUMENT
(/$3%3
Specialty Electrical
RECHARGEABLE BATTERY/BATTERIES
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
No.
&+3:%
Color
Shf
Pk
%ODFN
3
Unit
($
- Maintenance, Repair & Operations
BATTERY
CHARGERS
‡1,&.(/0(7$/+<'5,'(
1,0+
‡³9$/8(&+$5*(5´
&KDUJHV RU $$ DQGRU $$$
1L0+ EDWWHULHV DW D WLPH 7ZR JUHHQ /('V LQGLFDWH
ZKHQEDWWHULHVDUHFKDUJLQJ5HYHUVHSRODULW\SURWHFWLRQ
SUHYHQWV GDPDJH IURP LQFRUUHFWO\ LQVWDOOHG EDWWHULHV
&KDUJHV1L0+EDWWHULHVLQWRKRXUVGHSHQGLQJRQ
W\SH DQG QXPEHU %DWWHULHV PXVW EH FKDUJHG LQ SDLUV
1R VKXWRII PHFKDQLVP W\SLFDO ZHLJKW R] )ROGRXW
SOXJYROW+]PPZLGWK[PPOHQJWK[
PPKHLJKW
Our No.
No.
Shf
Pk
Color
LIGHT BULB CHANGERS
SMOKE ALARMS
‡5(029(6%52.(1%8/%6
‡67((/)25.*/$66
&$7&+(5
‡%$77(5<32:(5('
‡,21,=$7,216(1625
‡³)$0,/<*$5'´
)XOO\ LQVXODWHG UHPRYHV PDQ\
VL]HV RI EURNHQ EXOE EDVHV 6QDS
RQ WKH 8QJHU 7HOH3ROH WR FKDQJH
EXOEVDVKLJKDVIHHW=LQFSODWHGVWHHOIRUNZLWKSODV
WLFJODVVFDWFKHU
%DWWHU\ RSHUDWHG LRQL]DWLRQ VPRNH
DODUPZLWKWHVWEXWWRQYROWEDW
WHU\ LQFOXGHG ,RQL]DWLRQ VPRNH
sensors are generally more sensitive at detecting small
SDUWLFOHVZKLFKWHQGWREHSURGXFHGLQJUHDWHUDPRXQWV
E\ÀDPLQJ¿UHV%HHSLQJVLJQDOZDUQVZKHQWKHEDWWHU\
QHHGVUHSODFLQJ+LQJHGFRYHUIRUHDV\EDWWHU\UHSODFH
PHQW 0HHWV $16,8/ VWDQGDUG \HDU OLPLWHG ZDU
UDQW\
Our No.
&+9&:%
4
6LOYHU
Unit
UNGER INDUSTRIAL
232-4309
5
($
Our No.
Shf
Pk
No.
Unit
FIRST ALERT/BRK BRANDS
Unit
Tools & Testers
ENERGIZER BATTERY
910-3359
Shf
Pk
No.
LOW BATTERY WARNING
FIRE/SMOKE ALARMS
($
050-3722
FG200
($
SMOKE ALARMS
‡%$77(5<32:(5('
‡,21,=$7,217(&+12/2*<
Tools & Testers
LIGHT BULB CHANGERS
INCANDESCENT BULB
CHANGERS
&KDQJH EXOEV VDIHO\ IURP WKH
JURXQG )HDWXUHV VL[ VSULQJ VWHHO
JULSSLQJ QRQPDUNLQJ UXEEHU
FRYHUHG LQVXODWHG ¿QJHUV 5HSODFH
PDQ\VL]HVDQGVKDSHGOLJKWEXOEV
TXLFNO\ 8VH ZLWK 8QJHU FRQH DGDSWHU DQG SROHV VROG
VHSDUDWHO\
Our No.
No.
Shf
Pk
Unit
SMOKE ALARMS
7HVW EXWWRQ IRU VHQVRU DQG KRUQ
,RQL]DWLRQ VPRNH VHQVRU 6OLG
LQJ VLGH EDWWHU\ GUDZHU IRU YROW
EDWWHU\ LQFOXGHG 0LVVLQJ EDWWHU\
JXDUGWRHQVXUHDEDWWHU\LVLQVWDOOHG%OLQNLQJSRZHULQ
GLFDWLRQFRQ¿UPVXQLWLVUHFHLYLQJSRZHU/RXGGHFLEHO
DODUP ORZ EDWWHU\ ZDUQLQJ 8/ OLVWHG \HDU OLPLWHG
ZDUUDQW\
Our No.
No.
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
Ionization Smoke Sensor
002-3622
6$&1
:KLWH
3
($
UNGER INDUSTRIAL
880-3132
5
‡%$77(5<32:(5('
‡'8$/,21,=$7,21
%DWWHU\ RSHUDWHG 59 DSSURYHG
LRQL]DWLRQVPRNHDODUPZLWKOLJKWHG
SRZHU DQG DODUP LQGLFDWRU YROW
EDWWHU\ LQFOXGHG :LWK VLOHQFH
IHDWXUH ,RQL]DWLRQ VPRNH VHQVRUV DUH JHQHUDOO\ PRUH
VHQVLWLYH DW GHWHFWLQJ VPDOO SDUWLFOHV ZKLFK WHQG WR EH
SURGXFHG LQ JUHDWHU DPRXQWV E\ ÀDPLQJ ¿UHV 7DPSHU
UHVLVWDQW ORFNLQJ SLQ +LQJHG FRYHU IRU HDV\ EDWWHU\ UH
SODFHPHQW0HHWV$16,8/VWDQGDUG
Our No.
Shf
Pk
Color
Unit
FIRST ALERT/BRK BRANDS
740-8271
($
No.
)*%
:KLWH
($
SMOKE ALARMS
‡%$77(5<32:(5('
‡,21,=$7,217(&+12/2*<
LIGHT BULB CHANGERS
‡)/22'/,*+7
&KDQJH UHFHVVHG ÀRRG OLJKWV DQG
OLJKW EXOEV ZDWWV DQG ODUJHU
TXLFNO\ DQG HDVLO\ 7KLV SDWHQWHG
LQVXODWHG WRRO IHDWXUHV VL[ VXFWLRQ
FXSV DQG UHSODFHV ÀDW EHYHOHG
DQGURXQGEXOEV8VHZLWK8QJHUFRQHDGDSWHUDQGSROHV
Our No.
No.
Shf
Pk
Unit
UNGER INDUSTRIAL
082-8608
5
SMOKE ALARMS
:LWK VLOHQFH DQG WHVW DODUP IXQF
WLRQVEXWWRQDQGORZEDWWHU\ZDUQ
LQJ 6LGH EDWWHU\ GUDZHU VOLGHV
RSHQ IRU EDWWHU\ UHSODFHPHQW UH
VLVWV FORVLQJXQOHVVEDWWHU\ LVLQVWDOOHG%OLQNLQJSRZHU
LQGLFDWRUFRQ¿UPVXQLWLVUHFHLYLQJSRZHU/RXGGHFL
EHODODUP8/OLVWHG\HDUOLPLWHGZDUUDQW\
Our No.
No.
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
10 YEAR 9 VOLT LITHIUM BATTERY INCLUDED
($
767-7321
6$&1
:KLWH
3
($
3
($
9 VOLT BATTERY INCLUDED
394-7918
LIGHT BULB CHANGERS
No.
Our No.
Shf
Pk
976-5942
SMOKE ALARMS
No.
Shf
Pk
Unit
Unit
5
($
12
($
Boxed - With Battery Backup
773-0138
%ULJKWHVFDSHOLJKW,OOXPLQDWHVWKH
SDWK WR VDIHW\ ,RQL]DWLRQ VPRNH
VHQVRU:LWKVLOHQFHDQGWHVWDODUP
IXQFWLRQV EXWWRQ DQG ORZ EDWWHU\ ZDUQLQJ 6LGH EDWWHU\
GUDZHUVOLGHVRSHQIRUEDWWHU\UHSODFHPHQWUHVLVWVFORV
LQJXQOHVVEDWWHU\LVLQVWDOOHG%OLQNLQJSRZHULQGLFDWRU
FRQ¿UPVXQLWLVUHFHLYLQJSRZHU/RXGGHFLEHODODUP
8/ OLVWHG YROW EDWWHU\ LQFOXGHG \HDU OLPLWHG ZDU
UDQW\
Our No.
No.
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
516-5014
6$&1
SLIDING BATTERY DRAWER
‡%$77(5<32:(5('
‡,21,=$7,217(&+12/2*<
‡³(6&$3(/,*+7´
UNGER INDUSTRIAL
184-9926
:KLWH
6PRNH DODUP ZLWK WHVWVLOHQFH
EXWWRQ DQG LQVHFW VFUHHQHG GXDO
LRQL]DWLRQVHQVLQJFKDPEHU,QSXW
YROW $& +] JUHHQ /('
SRZHURQ LQGLFDWRU UHG /(' WR FRQ¿UP XQLW LV ZRUNLQJ
SURSHUO\ VLQJOH WHVWVLOHQFH EXWWRQ WR FKHFN DOO DODUP
IXQFWLRQV6ROLGVWDWHSLH]RKRUQUDWHGDWG%PLQLPXP
DWIHHWSOXJLQFRQQHFWRUFDSDEOHRILQWHUFRQQHFWLRQ
RIXSWRDODUPVRIZKLFKFDQEHVPRNHDODUPV
0HHWVWKHUHTXLUHPHQWVRI8/&6)01)3$1)3$
,&%2%2&$6%&&,DQG&$%2\HDUOLPLWHGZDU
UDQW\
FIRST ALERT/BRK BRANDS
/DUJHVXFWLRQFXSHQGIRUFKDQJLQJ
UHFHVVHG DQGRU WUDFN OLJKW EXOEV
VDIHO\ IURP WKH JURXQG ,QFOXGHV
HDV\SXOO FRUG IRU VXFWLRQ UHOHDVH
)XOO\ LQVXODWHG 8VH ZLWK 8QJHU
FRQHDGDSWHUDQGSROHV
Our No.
6$&1
‡$&32:(5(',21,=$7,21
‡+$5':,5('
:KLWH
3
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%
12
($
Maintenance, Repair & Operations - Tools & Testers
SMOKE ALARMS
FIRE EXTINGUISHERS
FIRE EXTINGUISHERS
‡,213+2726(16256
‡+$5':,5('92/7
‡³9257(;´
FIRE EXTINGUISHERS
8WLOL]HV ERWK LRQL]DWLRQ DQG SKR
WRHOHFWULF VPRNH VHQVRUV WR GH
WHFW ERWK ÀDPLQJ DQG VPROGHULQJ
EXUQLQJ¿UHVLQWKHLUHDUOLHVWVWDJHV:LWKYROWDONDOLQH
EDWWHU\ EDFNXS &DQ EH LQWHUFRQQHFWHG ZLWK XS WR XQLWV6LQJOHEXWWRQWHVWVLOHQFH9RUWH[WXUUHWGHVLJQIRU
RSWLPDOVPRNHHQWU\$ODUPVRXUFHLQGLFDWRUDODUPDQG
SRZHUWHVWIHDWXUH6RXQGOHYHORIG%DWIHHW2SHU
DWHVDWWRGHJUHHV)7DPSHUUHVLVWDQW³/RFNLW´
NH\PRXQWLQJKDUGZDUHLQFOXGHG´GLDPHWHU[´
ZLGWK\HDUVOLPLWHGZDUUDQW\
5HFKDUJHDEOH LQGXVWULDO ¿UH H[WLQ
JXLVKHU (IIHFWLYH DJDLQVW ¿UHV LQ
YROYLQJ SDSHU ZRRG WH[WLOHV DQG
SODVWLFVDVZHOODVÀDPPDEOHOLTXLG
¿UHV DQG HOHFWULFDO HTXLSPHQW ¿UHV 0HWDO SXOO SLQ ZLWK
VDIHW\VHDO/DUJHFRUURVLRQUHVLVWDQWHDV\WRUHDGFRORU
FRGHG SUHVVXUH JDXJH SRXQGV 6XSHU KHDY\GXW\
PRXQWLQJEUDFNHWDQGVWUDSDUHLQFOXGHG
Our No.
No.
Color
Shf
Pk
Unit
‡+($9<'87<
&200(5&,$/
Our No.
:KLWH
472-4035
3
&RPELQDWLRQ YROW $& VPRNH
DQG FDUERQ PRQR[LGH DODUP ZLWK
YROW EDWWHU\ EDFNXS ,QWHUFRQ
QHFWDEOHZLWKDOO%5.VPRNHDQG&2DODUPV,WHOLPLQDWHV
WKHQHHGIRUWZRVHSDUDWHHOHFWULFDOER[HVVDYLQJLQVWDO
ODWLRQ WLPH DQG PDWHULDOV 6HSDUDWH YLVXDO DQG DXGLEOH
VPRNH DQG &2 LQGLFDWRUV HOLPLQDWH FRQIXVLRQ &RQWUROV
FDQVLOHQFHWKHORZEDWWHU\FKLUSIRUXSWRHLJKWKRXUVRU
WHPSRUDULO\ VLOHQFH DQ XQZDQWHG QXLVDQFH DODUP ,QWHO
OLJHQW6HQVLQJ7HFKQRORJ\KHOSVUHGXFHQXLVDQFHDODUPV
/DWFKLQJ DODUP LQGLFDWRU PRXQWLQJ EUDFNHW DQG EDWWHU\
GUDZHUORFNV7KHDODUPPHHWVEXLOGLQJFRGHVZKHUH$&
'& VPRNH DQG FDUERQ PRQR[LGH DODUPV DUH UHTXLUHG
HLWKHUVHSDUDWHO\RULQFRPELQDWLRQ\HDUOLPLWHGZDU
UDQW\
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
645-6818
6&%
:KLWH
12
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
UL RATED 10-B:C
1
)($%
Color
Boxed - 4.9 Pounds
($
326-5550X
*$5$*(
5HG
4
($
FIRE EXTINGUISHERS
FIRE EXTINGUISHERS
‡+$5':,5(',21,=$7,21
‡%$77(5<%$&.83
No.
Unit
No.
($
SMOKE/CARBON
MONOXIDE ALARMS
Our No.
No.
Our No.
UL RATED - 20-A:120-B:C
Battery Backup - Carded
6$&1
Shf
Pk
&RUURVLRQUHVLVWDQWPHWDOYDOYHDQG
WULJJHU ODUJH HDV\WRUHDG FRORU
FRGHGSUHVVXUHJDXJH6RGLXPEL
FDUERQDWHH[WLQJXLVKLQJDJHQW8VHGWR¿JKWÀDPPDEOH
OLTXLGV DQG HOHFWULFDO ¿UHV 86 FRDVW JXDUG DSSURYHG
ZKHQXVHGZLWKLQFOXGHGSODVWLFPRXQWLQJEUDFNHWZLWK
VWUDS 8QLW GLPHQVLRQV ´ ZLGWK [ ´ KHLJKW \HDUOLPLWHGZDUUDQW\
FIRST ALERT/BRK BRANDS
FIRST ALERT/BRK BRANDS
625-2977
‡5(&+$5*($%/(*$5$*(
+20(
‡&200(5&,$/*5$'(
($
‡5(&+$5*($%/(08/7,
385326(
‡+($9<'87<
‡5(&+$5*($%/(
5HFKDUJHDEOHKRPH¿UHH[WLQJXLVK
HU0RQRDPPRQLXPSKRVSKDWHH[
WLQJXLVKLQJDJHQW(IIHFWLYHDJDLQVW
¿UHVLQYROYLQJSDSHUZRRGWH[WLOHV
DQG SODVWLFV DV ZHOO DV ÀDPPDEOH OLTXLG ¿UHV DQG HOHF
WULFDO ¿UHV &RUURVLRQ UHVLVWDQW PHWDO YDOYH DQG WULJJHU
0HWDOSXOOSLQZLWKVDIHW\VHDO/DUJHHDV\WRUHDGFRORU
FRGHGSUHVVXUHJDXJH´KHLJKW[´ZLGWK0RXQW
LQJ EUDFNHW DQG VWUDS DUH LQFOXGHG 86 &RDVW *XDUG
DSSURYHG\HDUOLPLWHGZDUUDQW\
'U\ FKHPLFDO ¿UH H[WLQJXLVKHU
containing monoammonium phos
SKDWH ¿UH H[WLQJXLVKLQJ DJHQW
&RPPHUFLDO JUDGH PHWDO YDOYH
DQG WULJJHU )RU XVH LQ KRPH RI¿FHV VPDOO EXVLQHVVHV
DQGOLJKWLQGXVWULDOPDQXIDFWXULQJDSSOLFDWLRQV(IIHFWLYH
DJDLQVW¿UHVLQYROYLQJSDSHUZRRGWH[WLOHVDQGSODVWLFV
DVZHOODVÀDPPDEOHOLTXLGDQGHOHFWULFDO¿UHV5HFKDUJH
DEOH ZLWK ODUJH HDV\ WR UHDG FRORU FRGHG SUHVVXUH
JDXJH0RXQWLQJEUDFNHW DQGVWUDS LQFOXGHG´KHLJKW
[´GLDPHWHU
Our No.
No.
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
Our No.
No.
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
UL RATED 1A:10-B:C
UL RATED 3-A:40-BC
2.4 Pounds
619-1811X
+20(
5HG
4
($
182-0778X
'+20(
'HVLJQHU3HZWHU
4
($
498-0298X
0$5,1(
4
($
5 Pounds
336-3587X
352
2
5HG
($
2.4 Pounds - Marine
:KLWH
FIRE EXTINGUISHERS
‡6,1*/(86(.,7&+(1
FIRE EXTINGUISHERS
SMOKE/CARBON
MONOXIDE ALARMS
‡5(&+$5*($%/(
5(&5($7,21$/
‡%$77(5<32:(5('92,&(
$/$50
‡3+272(/(&75,&6(1625
9RLFH DODUP FDQ EH SURJUDPPHG
WRWHOOW\SHDQGORFDWLRQRIGDQJHU
LI VPRNH RU FDUERQ PRQR[LGH LV GHWHFWHG 6LOHQFHWHVW
IHDWXUH XVHV PRVW UHPRWH FRQWUROV WR WHPSRUDULO\ TXLHW
XQZDQWHG DODUPV 3HDN OHYHO PHPRU\ UHFDOO VWRUHV DQG
YHUEDOO\FRPPXQLFDWHVKLJKHVWOHYHORIFDUERQPRQR[LGH
GHWHFWHG 3XOO RXW EDWWHU\ GUDZHU IRU EDWWHU\ UHSODFH
PHQW/RZEDWWHU\VLOHQFHTXLHWVORZEDWWHU\DOHUWZLWK
RXW DIIHFWLQJ DODUP RSHUDWLRQ /RXG GHFLEHO DODUP
ORZ EDWWHU\ ZDUQLQJ (QG RI OLIH DODUP FKLUSV ZKHQ LW
LV WLPH WR UHSODFH GHWHFWRU $$ EDWWHULHV LQFOXGHG8/
OLVWHG\HDUOLPLWHGZDUUDQW\
Our No.
No.
Color
Shf
Pk
&RUURVLRQUHVLVWDQWPHWDOYDOYHDQG
WULJJHU ODUJH HDV\WRUHDG SUHV
VXUH JDXJH 6RGLXP ELFDUERQDWH
H[WLQJXLVKLQJ DJHQW 8VHG WR ¿JKW
ÀDPPDEOH OLTXLGV DQG HOHFWULFDO ¿UHV 86 FRDVW JXDUG
DSSURYHG ZKHQ XVHG ZLWK LQFOXGHG SODVWLF PRXQWLQJ
EUDFNHWZLWKVWUDS´OHQJWK[´ZLGWK[´
KHLJKW
Our No.
No.
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
(IIHFWLYH DJDLQVW ÀDPPDEOH OLTXLG
DQG HOHFWULFDO ¿UHV 6RGLXP ELFDU
ERQDWH ¿UH H[WLQJXLVKLQJ DJHQW $
SODVWLFYDOYHDVVHPEO\DQGDZKLWH
VWHHOFDQZLWKDTXLFNUHOHDVHSODV
WLFPRXQWLQJEUDFNHWGHVLJQHGIRUGHFRUDWLYHNLWFKHQLQ
VWDOODWLRQV 3XVK EXWWRQ SUHVVXUH FKHFN ´ KHLJKW [
´GLDPHWHU
Our No.
:KLWH
4
6&2&1
:KLWH
3
Unit
UL RATED 5-B:C
146-1375X
($
Unit
FIRST ALERT/BRK BRANDS
141-5249
Shf
Pk
Boxed - 2.7 Pounds
Boxed - 4.1 pounds
5(&
Color
FIRST ALERT/BRK BRANDS
UL RATED 5-B:C
867-6389X
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
.,7&+(1
:KLWH
4
($
- Maintenance, Repair & Operations
FIRE EXTINGUISHERS
FIRE EXTINGUISHER
KITS
‡,1'8675,$/
5(&+$5*($%/(
Monoammonium phosphate extin
JXLVKLQJ DJHQW &RPPHUFLDO JUDGH
PHWDO YDOYH DQG WULJJHU 5XJJHG
FRQVWUXFWLRQ DQG H[WUDODUJH FD
SDFLW\ IRU FRPPHUFLDO DQG LQGXVWULDO XVH )LWV VWDQGDUG
¿UHER[HV5HFKDUJHDEOHODUJHHDV\WRUHDGFRORUFRGHG
SUHVVXUH JDXJH 0RXQWLQJ EUDFNHW DQG VWUDS LQFOXGHG
(IIHFWLYH DJDLQVW WKH PRVW FRPPRQ KRXVHKROG ¿UHV
ZRRGSDSHUIDEULFÀDPPDEOHOLTXLGDQGOLYHHOHFWULFDO
Our No.
No.
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
UL RATED 4-A:60-B:C
Boxed - 16.9 Pounds
777-1082X
352
5HG
5HFKDUJHDEOH KRPH ¿UH H[WLQ
JXLVKHU 2UJLOO ,QF 6.8 &RQWDLQV SRXQGV RI 0RQRDP
PRQLXP SKRVSKDWH GU\ FKHPLFDO H[WLQJXLVKLQJ DJHQW
(IIHFWLYHDJDLQVW¿UHVLQYROYLQJSDSHUZRRGWH[WLOHVDQG
SODVWLFV DV ZHOO DV ÀDPPDEOH OLTXLG ¿UHV DQG HOHFWULFDO
¿UHV &RUURVLRQ UHVLVWDQW PHWDO YDOYH DQG WULJJHU 0HWDO
SXOOSLQZLWKVDIHW\VHDO/DUJHHDV\WRUHDGFRORUFRGHG
SUHVVXUHJDXJH´KHLJKW[´ZLGWK,QFOXGHV2U
JLOO 6.8 EODFN FRUURVLRQUHVLVWDQW ¿QLVK VWHHO
EUDFNHWZLWKVWDLQOHVVVWHHOVWUDSV86&RDVW*XDUGDS
SURYHG´KHLJKW[´ZLGWK
Shf
Pk
No.
+20(%5.7
‡+($9<'87<
5(&+$5*($%/(
FIRE EXTINGUISHER
KITS
&RPPHUFLDOJUDGHPHWDOYDOYHDQG
WULJJHU /DUJH HDV\ WR UHDG SUHV
VXUH JDXJH (IIHFWLYH DJDLQVW ¿UHV
LQYROYLQJ SDSHU ZRRG WH[WLOHV
DQG SODVWLFV DV ZHOO DV ÀDPPDEOH OLTXLG ¿UHV DQG OLYH
HOHFWULFDO ¿UHV 0RQRDPPRQLXP SKRVSKDWH H[WLQJXLVK
LQJDJHQW:DOOKRRNLQFOXGHG´KHLJKW[´ZLGWK
‡(;7,1*8,6+(53/86
%5$&.(7
Color
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
UL RATED 2-A:10-B:C
Boxed - 9.8 Pounds
865-7868X
+20(
:KLWH
2
($
Shf
Pk
Unit
UL RATED 5-B:C
Boxed - 3.0 Pounds
$872
5HG
Unit
FIRST ALERT/BRK BRANDS
0.94 Pounds
426-9569X
%5$&.(7
2
%ODFN
($
Tools & Testers
‡,213+2726(16256
No.
4
($
330-1215X
2
352%5.7
($
STRAP BRACKETS
‡),5((;7,1*8,6+(5
‡+($9<'87<
'HVLJQHGWRIDVWHQ)LUVW$OHUWEUDQG
¿UH H[WLQJXLVKHUV LQ PDULQH DXWR
PRWLYH DQG LQFDE WUXFN DSSOLFD
WLRQV RU DQ\ZKHUH D PRUH VHFXUH
LQVWDOODWLRQLVQHHGHG6WHHOEUDFNHWEODFNFRDWHG¿QLVK
UHVLVWV FRUURVLRQ UXVW DQG FKLSV 6WDLQOHVV VWHHO VWUDSV
8QLWHG6WDWHV&RDVW*XDUGDSSURYHGIRUPDULQHXVHZLWK
)LUVW$OHUW¿UHH[WLQJXLVKHUPRGHOV)(*5)(*5DQG
)($*5´KHLJKW[´ZLGWK8//LVWHG
Our No.
No.
Color
'HWHFWV ERWK IDVW ÀDPLQJ DQG
VPROGHULQJ¿UHV)DVWÀDPLQJ¿UHV
VSUHDG TXLFNO\ 6PROGHULQJ ¿UHV
EXUQ ORQJ DQG FDQ ¿OO WKH KRPH
ZLWK VPRNH 5HPRWH FRQWUROOHG
PXWH SRLQW DQG FOLFN ZLWK DQ\ UHPRWH FRQWURO WR TXLHW
XQZDQWHGDODUPV6PDUWVHQVRUKHOSVUHFRJQL]HWKHGLI
IHUHQFH EHWZHHQ QRQWKUHDWHQLQJ FRQGLWLRQV DQG UHDO
HPHUJHQFLHV (DV\ DFFHVV EDWWHU\ GUDZHU /RXG GE
DODUPYROWEDWWHU\LQFOXGHG0HHWV8/VWDQGDUG
Our No.
750-9508
%ODFN
Unit
6$&1
3
:KLWH
($
Shf
Pk
SMOKE/CARBON
MONOXIDE ALARMS
‡%$77(5<32:(5('92,&(
$/$50
‡3+272(/(&75,&6(1625
‡³),567$/(5721(/,1.´
)LUVW $OHUW 21(/,1.HQDEOHG YRLFH
DODUP ZLWK XS WR SURJUDPPDEOH ORFDWLRQV $GG DG
GLWLRQDO EDWWHU\RSHUDWHG )LUVW $OHUW 21(/,1.HQDEOHG
DODUPVWRFUHDWHDZLUHOHVVVDIHW\QHWZRUN3KRWRHOHFWULF
VPRNH DODUP UHGXFHV QXLVDQFH DODUPV $ODUP DQG ORZ
EDWWHU\VLOHQFHIHDWXUH
Our No.
4
No.
Shf
Pk
Unit
FIRST ALERT/BRK BRANDS
070-4171
Unit
0.49 Pounds
%5$&.(7
Shf
Pk
Color
FIRST ALERT/BRK BRANDS
FIRST ALERT/BRK BRANDS
502-5705X
No.
Unit
2 Piece
FIRST ALERT/BRK BRANDS
890-5176X
Shf
Pk
Color
SMOKE ALARMS
FIRST ALERT/BRK BRANDS
'U\ SRZGHU ¿UH H[WLQJXLVKHU ZLWK
DSODVWLFYDOYHDVVHPEO\DQGDUHG
VWHHOFDQFRQWDLQLQJVRGLXPELFDU
ERQDWH ¿UH H[WLQJXLVKLQJ DJHQW
3RSXSSLQLQGLFDWRUWRFKHFNSUHV
VXUH )LJKWV RLO JDVROLQH DQG HOHFWULFDO ¿UHV 86 '27
DSSURYHG0RXQWLQJEUDFNHWLQFOXGHG´KLJK[´
ZLGH
Color
No.
($
Shf
Pk
‡6,1*/(86($872
No.
4
'U\ FKHPLFDO ¿UH H[WLQJXLVKHU 2U
JLOO,QF6.8FRQWDLQLQJ
SRXQGV RI PRQRDPPRQLXP SKRV
SKDWHGU\FKHPLFDO¿UHH[WLQJXLVKLQJDJHQW&RPPHUFLDO
JUDGHPHWDOYDOYHDQGWULJJHU)RUXVHLQKRPHRI¿FHV
VPDOOEXVLQHVVHVDQGOLJKWLQGXVWULDOPDQXIDFWXULQJDS
SOLFDWLRQV(IIHFWLYHDJDLQVW¿UHVLQYROYLQJSDSHUZRRG
WH[WLOHVDQGSODVWLFVDVZHOODVÀDPPDEOHOLTXLGDQGHOHF
WULFDO¿UHV5HFKDUJHDEOHZLWKODUJHFRORUFRGHGSUHVVXUH
JDXJH´KHLJKW[´GLDPHWHU,QFOXGHV2UJLOO6.8
OEVWHHOEUDFNHWZLWKFRUURVLRQUHVLVWDQW¿Q
LVKDQGVWDLQOHVVVWHHOVWUDSV8QLWHG6WDWHV&RDVW*XDUG
DSSURYHG´ZLGWK[´KHLJKW
Our No.
FIRE EXTINGUISHERS
Our No.
Our No.
CARBON MONOXIDE DETECTORS
FIRE EXTINGUISHERS
No.
Unit
'HVLJQHGWRIDVWHQ)LUVW$OHUWEUDQG
¿UH H[WLQJXLVKHUV LQ PDULQH DXWR
PRWLYH DQG LQFDE WUXFN DSSOLFD
WLRQV RU DQ\ZKHUH D PRUH VHFXUH
LQVWDOODWLRQLVQHHGHG6WHHOEUDFNHWEODFNFRDWHG¿QLVK
UHVLVWV FRUURVLRQ UXVW DQG FKLSV 6WDLQOHVV VWHHO VWUDSV
8QLWHG6WDWHV&RDVW*XDUGDSSURYHGIRUPDULQHXVHZLWK
)LUVW $OHUW ¿UH H[WLQJXLVKHU PRGHOV )($*5 )($
*5DQG)($*5´KHLJKW[´ZLGWK8//LVWHG
FIRST ALERT/BRK BRANDS
($
183-6154X
Our No.
‡),5((;7,1*8,6+(5
‡+($9<'87<
‡(;7,1*8,6+(53/86
%5$&.(7
Our No.
2
STRAP BRACKETS
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
6&2&167
3
($
Maintenance, Repair & Operations - CARBON MONOXIDE
DETECTORS
CARBON MONOXIDE
DETECTORS
‡3/8*,1',*,7$/',63/$<
‡%$77(5<%$&.83
‡$&%$77(5<%$&.83
(OHFWURFKHPLFDO FDUERQ PRQR[LGH
VHQVRU&RYHUVRQO\RQHZDOORXWOHW
3OXJWKHDODUPLQWRDUHJXODURXWOHW
WHVWDQGLW¶VUHDG\%DWWHU\EDFNXSNHHSVDODUPZRUNLQJ
LIHOHFWULFLW\IDLOV3RLQWDQGFOLFNDQ\UHPRWHFRQWUROXQLW
WRTXLHWXQZDQWHGDODUPVUHPRWHQRWLQFOXGHG(=YLHZ
EDFNOLWGLJLWDOFDUERQPRQR[LGHOHYHOGLVSOD\WRYLHZGDQ
JHUOHYHOVFXUUHQWDQGSHDN&2OHYHOV0HPRU\VWRUHV
UHFDOOVDQGGLVSOD\VKLJKHVWOHYHOVRI&2GHWHFWHG/RZ
EDWWHU\ ZDUQLQJ ORZ EDWWHU\ VLOHQFH TXLHWV ORZ EDWWHU\
DOHUWZLWKRXWDIIHFWLQJDODUPRSHUDWLRQ(QGRIDODUPOLIH
WLPHUDODUPFKLUSVZKHQLWLVWLPHWRUHSODFHVKRXOGEH
UHSODFHG HYHU\ \HDUV IRU PD[LPXP SURWHFWLRQ /RXG
GHFLEHODODUP´KHLJKW[´ZLGWK[´GHSWK
SRXQGV8//LVWHG\HDUOLPLWHGZDUUDQW\8VHV
$$EDWWHULHVLQFOXGHG
Our No.
No.
Shf
Pk
Color
Unit
FIRST ALERT/BRK BRANDS
846-2277
&2
1
:KLWH
‡(/(&75,&3/8*,1
‡(/(&752&+(0,&$/
6(1625
1R EDWWHULHV UHTXLUHG YROW
SOXJLQ :LWK VLOHQFH IHDWXUH
VDPSOHV WKH DLU DQG SHUIRUPV VHOIGLDJQRVWLF WHVWV DS
SUR[LPDWHO\ HYHU\ VHFRQG $ PLFURFKLS LQVLGH WKH XQLW
VWRUHV HDFK UHDGLQJ DQG UHPHPEHUV WKH OHYHOV RI &2
LW KDV EHHQ H[SRVHG WR RYHU WLPH &RQWUROV DUH 7HVW
6LOHQFH EXWWRQ JUHHQ SRZHU OLJKW \HOORZ VHUYLFH OLJKW
UHGDODUPOLJKW/RXGGHFLEHODODUP8/OLVWHG\HDU
OLPLWHG ZDUUDQW\ ´ KHLJKW [ ´ ZLGWK [ ´ GHSWK
SRXQGV
Shf
Pk
No.
‡&21&($/('6&5(:02817
‡³0$1+$77$1&2//(&7,21´
+DUGZLUHGFDUERQPRQR[LGHDODUP
ZLWK YROW DONDOLQH EDWWHU\ EDFN
XS(OHFWURFKHPLFDOFDUERQPRQR[
LGHVHQVRU/DWFKLQJDODUPLQGLFD
WRU 6LQJOH EXWWRQ WHVWVLOHQFH 6LOHQFHV WKH ORZEDWWHU\
FKLUS IRU XS WR HLJKW KRXUV RU WHPSRUDULO\ VLOHQFHV DQ
XQZDQWHG QXLVDQFH DODUP ,QWHOOLJHQW 6HQVLQJ 7HFKQRO
RJ\KHOSVUHGXFHWKHQXPEHURIQXLVDQFHDODUPV'XVW
FRYHU\HDUZDUUDQW\
Our No.
No.
Color
Shf
Pk
Unit
12
($
FIRST ALERT/BRK BRANDS
998-4253
&2%1
:KLWH
Unit
1
&2
0XOWLKD]DUGFRPERGHWHFWVFDUERQ
PRQR[LGHSURSDQHJDVDQGQDWXUDOPHWKDQHJDV%DFNOLW
GLJLWDOGLVSOD\ZLWKWHVWDQGVLOHQFH&RYHUVRQO\RQHZDOO
RXWOHW3OXJWKHDODUPLQWRDUHJXODURXWOHWWHVWDQGLW¶V
UHDG\ %DWWHU\ EDFNXS NHHSV DODUP ZRUNLQJ LI HOHFWULF
LW\IDLOV3RLQWDQGFOLFNDQ\UHPRWHFRQWUROXQLWWRTXLHW
XQZDQWHGDODUPVUHPRWHQRWLQFOXGHG:LWKDOLQHFRUG
IRUKLJKPRXQWLQJWRVHQVHPHWKDQHORZPRXQWLQJIRU
SURSDQH(QGRIDODUPOLIHWLPHUDODUPFKLUSVZKHQLWLV
WLPH WR UHSODFH VKRXOG EH UHSODFHG HYHU\ \HDUV IRU
PD[LPXPSURWHFWLRQ/RXGGHFLEHODODUP´KHLJKW
[´ZLGWK[´GHSWKSRXQGV0HHWV8/
DQG8/JDVGHWHFWRUVWDQGDUGV%DWWHU\EDFNXS
YROWEDWWHU\LQFOXGHG
Our No.
No.
Shf
Pk
Color
Unit
FIRST ALERT/BRK BRANDS
456-6196
*&2&1
($
:KLWH*UD\
3
($
:RUNV GXULQJ SRZHU RXWDJHV
1R LQVWDOODWLRQ UHTXLUHG 3ODFH RU
PRXQWDOPRVWDQ\ZKHUH0XWHEXWWRQWRTXLHWXQQHFHV
VDU\DODUPVDOVRWHVWVDODUPIXQFWLRQZLWKVDPHEXWWRQ
/RXGGHFLEHODODUPORZEDWWHU\ZDUQLQJ/RZEDWWHU\
PXWH TXLHWV ORZ EDWWHU\ VLJQDO IRU XS WR KRXUV (DV\
DFFHVV IURQWRSHQ FRPSDUWPHQW DOORZV EDWWHU\ FKDQJH
ZLWKRXWWDNLQJDODUPGRZQ(OHFWURFKHPLFDOVHQVRULVWKH
PRVWDFFXUDWHWHFKQRORJ\DYDLODEOHIRUGHWHFWLQJFDUERQ
PRQR[LGH(QGRIOLIHWLPHUDODUPFKLUSVZKHQLWLVWLPH
WR UHSODFH WKH DODUP 0HHWV 8/ VWDQGDUG \HDU
OLPLWHGZDUUDQW\8VHV$$EDWWHULHVLQFOXGHG
Unit
FIRST ALERT/BRK BRANDS
980-7017
&2
:KLWH
1
:KLWH&RUDO
5
&'
TISSUE HOLDERS
‡&21&($/('6&5(:02817
‡³$7/$17,6&2//(&7,21´
No.
Finish
Shf
Pk
Unit
832-9757
//
&KURPH
10
&'
935-7336
//
:KLWH
10
&'
Shf
Pk
Unit
TISSUE HOLDERS
‡&21&($/('6&5(:02817
‡³9(1(7,$1&2//(&7,21´
9LHZER[SDFNDJH
Our No.
No.
Finish
MINTCRAFT SIGNATURE
368-3851
//
&KURPH
&'
368-8215
/%/
%U1LFNHO
&'
369-9279
//
2LO5EG%UQ]
&'
‡5(&(66('
‡³0$1+$77$1&2//(&7,21´
‡&21&($/('6&5(:02817
‡³0$1+$77$1&2//(&7,21´
Shf
Pk
775-2678
TISSUE HOLDERS
TISSUE HOLDERS
‡%$77(5<32:(5('
‡(/(&752&+(0,&$/
6(1625
Color
//
Unit
Bath Hardware
CARBON MONOXIDE
DETECTORS
No.
Finish
MINTCRAFT
TISSUE HOLDERS
Our No.
Shf
Pk
No.
MINTCRAFT
Our No.
FIRST ALERT/BRK BRANDS
857-7272
Our No.
COMBINATION
ALARMS
‡3/8*,1%$77(5<%$&.83
',63/$<
‡(;3/26,9(*$6&$5%21
0212;,'(
($
CARBON MONOXIDE
DETECTORS
Our No.
TISSUE HOLDERS
Our No.
No.
Finish
Shf
Pk
800-1075
&6%/
3RO%UDVV
10
&'
714-9362
&6&/
&KURPH
10
&'
Our No.
Unit
Finish
Shf
Pk
&6&/
&KURPH
5
Unit
MINTCRAFT
831-8958
MINTCRAFT
No.
&'
TISSUE HOLDERS
&KURPH ¿QLVK )UHHVWDQGLQJ GH
VLJQ QR PRXQWLQJ UHTXLUHG 'LV
SHQVHV RQH UROO DQG VWRUHV IRXU
UROOV
TISSUE HOLDERS
‡&21&($/('6&5(:02817
‡³3$5/,0(17´
9LHZER[SDFNDJH
($
Our No.
Our No.
No.
Finish
Shf
Pk
//
&KURPH
4
Shf
Pk
Unit
INTER-DESIGN
Unit
615-8356
MINTCRAFT
835-4938
No.
&'
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
4
($
- Maintenance, Repair & Operations
TISSUE HOLDERS
&KURPH¿QLVK,QFUHDVHVEDWKURRP
VWRUDJHRSWLRQVOLPLWHGE\SHGHVWDO
VLQNV5XVWUHVLVWDQWFKURPH2YHU
WKH WDQN GHVLJQ IRU LQVWDOODWLRQ LQ
VHFRQGV 'LVSHQVHV RQH UROO DQG
VWRUHVDVHFRQGUROO
Our No.
Shf
Pk
No.
Unit
SAFETY GRAB BARS
‡3/$67,&08/7,6723
‡.185/('),1,6+
67$,1/(6667((/
‡&21&($/('6&5(:
Our No.
No.
Finish
Shf
Pk
´GLDPHWHUIRUEDWKDQGVKRZ
HU VDIHW\ 0HHWV KDQGLFDS FRGHV
$'$&RPSOLDQW
Unit
WORLDWIDE SOURCING
INTER-DESIGN
615-6848
TISSUE ROLLERS
4
005-9162
($
30%/
:KLWH
Lgth
In
No.
Shf
Pk
Unit
MINTCRAFT
25
%$*
Bath Hardware
TISSUE HOLDERS
Our No.
BATH SAFETY
Hanging Bag
776-5779
/)(/
18
($
778-5959
/)(/
24
($
779-8309
/)(/
48
3
($
SOAP HOLDERS
‡:,7+*5$%%$5
No.
Finish
Shf
Pk
079-0691
628
%UXVKHG1LFNHO
10
&'
Our No.
066-0886
628
9HQHWLDQ%URQ]H
10
&'
MINTCRAFT
Our No.
Unit
SAFETY GRAB BARS
MINTCRAFT
Shf
Pk Unit
No.
Finish
077-0024
+628
%UXVKHG1LFNHO
5
&'
062-7745
+628
9HQHWLDQ%URQ]H
5
&'
TISSUE HOLDERS
´ NQXUOHG FKURPH GLDPHWHU
FKURPH¿QLVKHGEDUVPD\EHXVHG
KRUL]RQWDOO\ RU YHUWLFDOO\ 0RXQWLQJ
KDUGZDUHLQFOXGHVWZRUXEEHUSDGV
DQGVL[´UXVWUHVLVWDQWVFUHZVSHU
EDU
Our No.
No.
Lgth
In
Shf
Pk
Unit
MEDLINE INDUSTRIES
849-4890
0'6&+5
12
3
($
500-1391
0'6&+5
24
3
($
‡5(&(66('
SAFETY GRAB BARS
‡&200(5&,$/+($9<
'87<
‡&21&($/('6&5(:6
Our No.
Shf
Pk Unit
BATH BENCHES
6WDLQOHVV VWHHO 0HHWV KDQGLFDS
FRGHV
No.
Finish
076-6410
+628
%UXVKHG1LFNHO
5
&'
Our No.
058-7618
+628
9HQHWLDQ%URQ]H
5
&'
MINTCRAFT
MINTCRAFT
Lgth
In
No.
Shf
Pk
Unit
Hanging Bag
TISSUE ROLLERS
Our No.
No.
Finish
Shf
Pk Unit
076-5412
%(628
%UXVKHG1LFNHO
20 &'
058-5406
%(628
9HQHWLDQ%URQ]H 20 &'
MINTCRAFT
/%(/
4
($
MEDLINE INDUSTRIES
375-2664
/%(/
24
4
($
099-0960
014-1580
/%(/
4
($
Lgth
In
Shf
Pk
Unit
MINTCRAFT
Hanging Bag
Our No.
No.
Finish
Shf
Pk
Unit
MINTCRAFT
771-4231
&6%/
3RO%UDVV
20
&'
360-0053
&6&/
&KURPH
20
&'
2
Unit
($
‡75$16)(5
JDXJH ´ VWDLQOHVV VWHHO
WXELQJ &RQFHDOHG VFUHZV 0HHWV
+DQGLFDS&RGHV$'$&RPSOLDQW
No.
0'6.'
Shf
Pk
BATH BENCHES
‡67$,1/(6667((/
&21&($/('6&5(:6
Our No.
TISSUE ROLLERS
No.
002-0826
SAFETY GRAB BARS
Our No.
*UD\ KLJKGHQVLW\ SRO\HWK\OHQH
VHDWDQJOHGOHJVGLVWULEXWHZHLJKW
RYHUDODUJHUDUHD6XFWLRQFXSWLSV
RQDOOIRXUOHJVGXUDEOHDOXPLQXP
IUDPH VHDW KHLJKW DGMXVWPHQWV LQ
LQFK LQFUHPHQWV :LWKRXW EDFN
1RQDVVHPEOHG
715-6490
/(/
12
($
375-2383
/(/
($
618-9518
/(/
24
($
776-7718
/(/
30
3
($
802-6973
/(/
32
3
($
775-6653
/(/
($
716-0328
/(/
42
3
($
801-5828
/(/
48
3
($
015-3288
/(/
54
3
($
3ODVWLF WUDQVIHU EHQFK IHDWXUHV D
FRQYHQLHQWKDQGKHOGVKRZHUKROG
HU DQG LQWHJUDWHG VRDS WUD\ RS
WLRQDOUHPRYDEOHKDQGOHWKDWKHOSV
DLGSDWLHQWEDODQFHSUHFLVHKHLJKW
DGMXVWDEOHOHJVWKDWDGMXVWLQLQFKLQFUHPHQWVQRQVOLS
¿QLVKRQVHDW5XVWSURRIFRPSRVLWHFRQVWUXFWLRQOE
ZHLJKWFDSDFLW\6HDWKHLJKW´´VHDWGHSWK´
VHDWZLGWK´RYHUDOOKHLJKW´´RYHUDOOZLGWKDW
EDVH´RYHUDOOGHSWKDWEDVH´%DFNDQG
DUPVLQFOXGHG
Our No.
No.
Shf
Pk
Unit
MEDLINE INDUSTRIES
336-8305
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
0'65
2
($
Maintenance, Repair & Operations - SWIVEL SEATS
DRAIN OPENERS
DRAIN OPENERS
‡/$7(;)5((
‡352)(66,21$/675(1*7+
‡³/,48,'3/805´
‡'5$12
‡³'8$/)25&()2$0(5´
:RUNV IDVW WR FOHDU IXOO\ FORJJHG
GUDLQV ZLWK VWDQGLQJ ZDWHU DQG
VORZGUDLQV*HOSHQHWUDWHVDQGGLV
VROYHV FORJV 5HPRYHV KDLU JXQN
JUHDVH VRDS VFXP 6DIH IRU DOO SLSHV 39& SODVWLF
FRSSHUROGSLSHVVHSWLFV\VWHPVDQGJDUEDJHGLVSRVDOV
'HHSFOHDQLQJ IRDP SXUJHV SLSH
ZDOOVRIKDLUDQGJXQNDQGDWWDFNV
SODFHVRUGLQDU\OLTXLGVFDQ¶WUHDFK
,W¶VDOVRVDIHIRUDOOSLSHVDQGVHSWLF
V\VWHPV
Our No.
Shf
Pk
No.
Unit
MEDLINE INDUSTRIES
705-9629
0'66:,9(/:
Our No.
($
‡5$,6('
Unit
3
($
TOILET SEATS
)URQW FODPSLQJ PHFKDQLVP ORFNV
WKHVHDWRQWRWKHWRLOHWZLGHFRQ
WRXUHGVXUIDFHUDLVHVVHDWOHYHOE\
´SURYLGHVPD[LPXPFRPIRUW
DQG ¿WV PRVW WRLOHW ERZOV IURP
´´ORQJOEFDSDFLW\6HDWZLGWK´VHDW
GHSWK´
Shf
Pk
Unit
MEDLINE INDUSTRIES
053-1715
($
694-1892X
00243
32
($
571-0199
30548
($
&OHDUV WKH WRXJKHVW FORJV ZLWKRXW
KDUPLQJ \RXU SLSHV &OHDUV FORJV
XSWRIHHWGRZQ2IIHUVDTXLFN
VDIHQRQWR[LFDQGHDV\ZD\WRJHW
ULGRIFORJV1RKDUVKDFLGVRUO\H&DQKDVDPD[LPXP
RI DSSOLFDWLRQV 8VH 3RZHU 3OXPEHU LQ VLQNV WXEV
VKRZHUVWDOOVDQGHYHQWRLOHWV
Our No.
‡(/(9$7(':,7+$506
No.
80
‡35(6685,=('
‡³&/5´
Shf
Pk
0'65:
Our No.
00228
3
0'6
($
Toilet & Sink Repair
No.
Size
Ozs.
Shf
Pk
Unit
33
12
($
758-9492
DRAIN OPENERS
32
8
($
Unit
($
Our No.
No.
No.
Size
Lb
Shf
Pk
Unit
+'&5<
2
12
($
056-4328
Unit
OE
12
($
‡³&5<67$/+($7´
No.
Size
Ozs.
20113
18
No.
Size
Lb.
Shf
Pk
Unit
&5<
2
12
($
DRAIN OPENERS
‡*(/$1'61$.(
‡³/,48,'3/805´
Our No.
Shf
Pk
No.
Unit
CLOROX COMPANY
Shf
Pk
Unit
SC JOHNSON
611-0803
Shf
Pk
&RPELQHV WKH VWUHQJWK RI /LTXLG
3OXPU*HOZLWKFRQYHQLHQFHRIWKH
VQDNHIRUWRXJKFORJVR]JHO
%HVW RQ JUHDVH DQG NLWFKHQ FORJV
:RUNV LQ DV OLWWOH DV PLQXWHV
+DQGOHV KDLU JUHDVH DQG JXQN
(IIHFWLYHRQEDWKURRPDQGNLWFKHQ
FORJV6DIHRQSLSHVWRXJKRQFORJV6DIHIRUVHSWLFV\V
WHP
Our No.
Size
COMSTAR INTERNATIONAL
386-5680
‡&5<67$/&21&(175$7(
‡³'5$12´
Shf
Pk
6XSHUSXUHEHDGVL]HGUDLQRSHQHU
,QGXVWULDOVWUHQJWKELRGHJUDGDEOH
FOHDUV RXW GUDLQV JUHDVH WUDSV
VHSWLF V\VWHPV URRWV 2GRUOHVV
QRQDFLGIRUPXODLVVDIHRQ¿QH¿[
WXUHVFKURPHWULPDQGSODVWLFSLSHV
ENFORCER PRODUCTS
DRAIN OPENERS
CLOROX COMPANY
00242
Unit
DRAIN OPENERS
Our No.
+HDY\ GXW\ FU\VWDO GUDLQ RSHQHU
contains 100% sodium hydrox
LGH FDXVWLF VRGD O\H DQG FOHDUV
WRXJKFORJVIURPSLSHVDQGGUDLQV
'HVWUR\VJUHDVHDQGRWKHUNLWFKHQ
FORJVDQGZLOONHHSGUDLQVFOHDU
474-4264
&OHDUV WRXJK FORJV DQG HOLPLQDWHV
RGRUV 5HPRYHV KDLU VRDS VFXP
DQG JXQN 6WDUWV ZRUNLQJ LPPH
GLDWHO\ 6DIH IRU DOO SLSHV 39&
SODVWLF FRSSHU ROG SLSHV VHSWLF
V\VWHPVDQGJDUEDJHGLVSRVDOV
958-9706X
7,.6
‡+($9<'87<&5<67$/
‡³/,48,'3/805´
Size
Ozs.
Shf
Pk
:RUNV JUHDW RQ JUHDVH DQG RWKHU
NLWFKHQ FORJV ZRQ¶W KDUP SLSHV
VHSWLFWDQNVRUFHVVSRROV
ROEBIC LABORATORIES
DRAIN OPENERS
No.
Size
Oz
DRAIN OPENERS
JELMAR
Our No.
DRAIN OPENER CHEMICALS
Our No.
No.
SC JOHNSON
989-4932
883-1471X
DRAIN OPENERS
MEDLINE INDUSTRIES
394-5854
Unit
Our No.
‡³385(/<(´
&RQWRXUHGSODVWLFUDLVHGWRLOHWVHDW
KHDY\GXW\ ZKLWH SRO\HWK\OHQH
UDLVHVVHDWOHYHOE\´´VHDW
ZLGWKOEZHLJKWFDSDFLW\
No.
Shf
Pk
CLOROX COMPANY
TOILET SEATS
Our No.
No.
Size
Ozs.
($
359-5311
($
DRAIN OPENERS
‡³'5$12´
%UHDNV GRZQ FORJV RQ FRQWDFW
&ORJV DUH PLQLPL]HG RU GLVVROYHG
DIWHUWRPLQXWHV&RQWDLQVD
special ingredient to protect pipes
IURP FRUURVLRQ 6DIH IRU SODVWLF
39&PHWDOSLSHVJDUEDJHGLVSRVDOVDQGVHSWLFV\VWHPV
Our No.
No.
Size
Ozs.
Shf
Pk
Unit
32
12
($
SC JOHNSON
913-4164
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
80 - Maintenance, Repair & Operations
DRAIN OPENER KITS
DRAIN CLEANERS
‡35(6685,=('
‡³&/5´
‡³'5$,1287(1=<0(´
&OHDUV WKH WRXJKHVW FORJV ZLWKRXW
KDUPLQJ\RXUSLSHV2IIHUVDTXLFN
VDIH QRQWR[LF DQG HDV\ ZD\ WR
JHWULGRIFORJV1RKDUVKDFLGVRU
O\H8VH3RZHU3OXPEHULQVLQNVWXEVVKRZHUVWDOOVDQG
HYHQWRLOHWV.LWLQFOXGHVDQH[WHQVLRQKDQGOHIRUWRLOHWV
DQGXULQDOVDR]FDQDQGDZD\XQLYHUVDODGDSWHU
Our No.
Size
Ozs.
No.
Shf
Pk
Unit
JELMAR
112-0120X
33.,7
Shf
Pk
12
(31(31
24
Unit
Our No.
7,6
Our No.
Unit
ENFORCER PRODUCTS
922-6689X
+.
(/'&
128
4
($
No.
Size
Ozs.
(+&5
Our No.
Size
Lb
No.
Shf
Pk
Unit
IRON OUT INC
675-1499
'&1'&1
2
($
&KXUQV WKURXJK RUJDQLF REVWUXF
WLRQV LQ VHZHU OLQHV JUHDVH WUDSV
NLWFKHQ VLQNV ODYDWRULHV DQG WXEV
&RPPHUFLDOVWUHQJWKGUDLQDQGVHZHURSHQHU7KHLGHDO
VXEVWLWXWHIRUVXOIXULFDFLG
Our No.
No.
Size
Shf
Pk
Unit
IRON OUT INC
675-1481X
'(1'&1
4XDUW
12
($
675-1473X
'(1
*DOORQ
($
DRAIN CLEANERS
‡³'5$120$;´
Shf
Pk
Unit
ENFORCER PRODUCTS
674-4296X
Unit
(35'2
)DVW DFWLQJ :LOO QRW KDUP SLSHV
2SHQVKDLUFORJJHGGUDLQV6DIHIRU
VHSWLFV\VWHPV
Shf
Pk
Shf
Pk
($
(Q]\PDWLFGUDLQFOHDQHUHQGVVORZ
GUDLQV FOHDQV DQG UHPRYHV \HDUV
RIEXLOGXSIURPSOXPELQJV\VWHPV
6DIH IRU DOO SOXPELQJ DQG VHSWLF
V\VWHPV3URYLGHVXSWRGUDLQWUHDWPHQWV
%HJLQVWRZRUNRQFRQWDFWWRFOHDU
GUDLQVDQGVHZHUOLQHREVWUXFWLRQV
:LOO QRW KDUP SOXPELQJ ¿[WXUHV
PHWDORUSODVWLFSLSHVRUVHSWLFV\VWHPV5HJXODUXVHSUH
YHQWV VORZ GUDLQV FORJV DQG EXLOGXS &RQWDLQV VRGLXP
K\GUR[LGHVRGLXPQLWUDWHDQGDOXPLQXPFXWWLQJV
‡352)(66,21$/&/2*
5(029(5
‡³'5$,1287(;75$´
8
‡+$,5&/2*5(029(5
‡³0,187(´
‡&200(5&,$/675(1*7+
‡³'5$,1287&5<67$/´
LIQUID DRAIN OPENER
LIQUID DRAIN OPENER
No.
($
(35'2
‡/,48,'
‡³'5$,1&$5(´
Our No.
ENFORCER PRODUCTS
631-9974
($
Size
Ozs.
No.
DRAIN CLEANERS
Size
Ozs.
Unit
7KLFN OLTXLG SRXUV WKURXJK ZDWHU
VWUDLJKWWRWKHFORJ:LOOQRWKDUP
SLSHV
674-4304X
Shf
Pk
‡³'5$,1&$5(´
CLOROX COMPANY
017-6644
Size
Ozs.
No.
LIQUID DRAIN OPENER
7ZR SRZHUIXO OLTXLGV DFWLYDWH RQ
FRQWDFW WR IRUP D GHHS FOHDQLQJ
IRDP:RUNV IDVW WR GLVVROYH KDLU
DQG JXQN 3HQHWUDWHV GHHS LQWR
SLSHWR¿QGFORJ6DIHIRUDOOSLSHV39&SODVWLFFRSSHU
ROGSLSHVVHSWLFV\VWHPVDQGJDUEDJHGLVSRVDOV
No.
Our No.
877-6296
‡)2$0,1*61$.(3,3(
‡³/,48,'3/805´
Our No.
3RZGHU ZKROHKRXVH IRUPXOD
+RXVHKROG GUDLQV DQG VHZHU OLQH
EXLOGXS DUH HDV\ WR FOHDU ZLWK
'UDLQ 2XW EXLOGXS UHPRYHU 3RZ
GHUFOLQJVWRLQVLGHRIDOOGUDLQDQG
VHZHUSLSHVLQWKHKRXVH7KLVIRUPXODRIQDWXUDOEDFWH
ULDDQGHQ]\PHV ZLOOEUHDNGRZQDQGHOLPLQDWHWKHRU
JDQLFZDVWHWKDWLVFDXVLQJWKHREVWUXFWLRQV6DIHIRUXVH
LQJDUEDJHGLVSRVDOV
IRON OUT INC
($
DRAIN CLEANERS
Size
Ozs.
DRAIN/SEWER
OPENER
8
)RUPXODWHG WKLFN WR GLVVROYH WKH
WRXJKHVWFORJVIDVW3RXUVWKURXJK
ZDWHU VWUDLJKW WR WKH FORJ +DV D
special ingredient to protect pipes
IURP FRUURVLRQ 6DIH IRU SODVWLF
39&PHWDOSLSHVJDUEDJHGLVSRVDOVDQGVHSWLFV\VWHPV
:RQ¶WKDUPSLSHVZKHQXVHGRYHUQLJKW
($
Our No.
($
No.
Size
Ozs.
Shf
Pk
Unit
SC JOHNSON
DRAIN CLEANERS
Size
Ozs.
Shf
Pk
Unit
ENFORCER PRODUCTS
638-4416X
7.6
('&
18
12
($
Our No.
No.
Size
Ozs.
696-2849
Shf
Pk
Unit
WHINK PRODUCTS
469-2976X
18
22118
42
8
($
COMMERCIAL LINE - MAX LIQUID
3URIHVVLRQDO VWUHQJWK OLTXLG GUDLQ
FORJ UHPRYHU DWWDFNV DQG EUHDNV
GRZQ KDLU DQG VRDS VFXP 7KLFN
IRUPXODSRXUVWKURXJKVWDQGLQJZDWHU6DIHRQDOOSLSHV
DQGVHSWLFV\VWHPV
(Q]\PDWLF GUDLQ FOHDQHU HQGV
VORZGUDLQV6DIHIRUDOOSOXPELQJ
&OHDQVDQGUHPRYHV\HDUVRIEXLOG
XSIURPSOXPELQJV\VWHPV
No.
696-2922
‡+$,5&/2*5(029(5
‡352)(66,21$/675(1*7+
‡³+$,5&/2*%/$67(5´
‡32:'(5
‡³'5$,1&$5(´
Our No.
COMMERCIAL LINE - MAX GEL
LIQUID DRAIN OPENER
($
128
4
($
12
($
MAX GEL
533-2457X
32
DRAIN CLEANERS
‡³,167$)/2´
)RU GUDLQV JUHDVH WUDSV VHSWLF
V\VWHPVDQGURRWFRQWURO2GRUOHVV
DQG ZLOO QRW KDUP SOXPELQJ ¿[
WXUHVSRUFHODLQRUVHSWLFV\VWHPV
Our No.
No.
Size
Lb
Shf
Pk
Unit
THRIFT MARKETING
623-0510X
0$0,6
1
24
($
623-0528X
0$0,6
2
12
($
0$0,6
4
($
623-0544X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7,.6
Maintenance, Repair & Operations - 81
GARBAGE DISPOSAL
CLEANER
DRAIN CLEANERS
&OHDQV DQG GHRGRUL]HV &RQWDLQV
QR VROYHQWV ELRGHJUDGDEOH VDIH
IRUDOOSOXPELQJ¿[WXUHVDQGSLSHV
&OHDQIUHVKVFHQW
2UJDQLF GLJHVWHU ELRGHJUDGDEOH
'LVVROYHV JUHDVH KDLU VDQLWDU\
QDSNLQV VOXGJH VRDS DQG SDSHU
5HPRYHV OLPH VFDOH DQG UXVW GH
SRVLWV 6DIH IRU VHSWLF WDQNV DQG
SLSHV
Our No.
No.
Size
Shf
Pk
Unit
Our No.
ROEBIC LABORATORIES
551-8691
*'&
4XDUW
12
‡*(1(5$/385326(
‡³3/80%(5¶63/81*(5´
3RXUV WKURXJK ZDWHU DQG IUHHV
FORJJHG GUDLQV :LOO QRW KDUP
SLSHV1RQDFLG
No.
Size
4XDUW
Shf
Pk
Unit
12
($
LIQUID DRAIN OPENER
Unit
3,17
12
376-1046X
6
32
12
48$57
537-5480X
6
*/
739-0057X
6
128
4
*$/
‡%8,/'835(029(5
‡0$;/,48,'
8QLTXH IRUPXOD FRQWDLQLQJ QDWXUDO
HQ]\PHV DQG EDFWHULD *UHDW DW
SUHYHQWLQJ FORJV IURP WDNLQJ URRW
LQ\RXUSLSHVUHPRYHVGUDLQEXLOG
XSZRUNVLQPLQXWHV'LVVROYHVKDLUDQGRWKHUFRP
PRQFORJV3RXUVWKURXJKVWDQGLQJZDWHUVWUDLJKWWRWKH
FORJ6DIHIRUSLSHVJDUEDJHGLVSRVDOVDQGVHSWLFWDQNV
Our No.
696-2955
No.
Size
Oz
Shf
Pk
Unit
3'2
4XDUW
12
($
539-7781X
3'2+
*DOORQ
($
252-7950X
3'2*
Gallon
4
($
Unit
12
($
ROEBIC LABORATORIES
.%$*
ROOT KILLER
‡³5227&/($5´
(IIHFWLYHO\ NLOOV URRWV DQG SUHYHQWV
QHZ JURZWK LQ VHZHU OLQHV ZKLFK
FDQFDXVHVORZUXQQLQJGUDLQVDQG
VHZHUV&DQDOVREHXVHGLQVHSWLF
WDQNV FHVVSRROV DQG GUDLQ ¿HOGV
&RQWDLQV FRSSHU VXOIDWH ZKLFK LV D ORQJ HVWDEOLVKHG
PHWKRGRIFRQWUROOLQJGDPDJLQJURRWVLQUHVLGHQWLDODQG
FRPPHUFLDOGUDLQDJHV\VWHPV
Our No.
No.
Size
lb
Shf
Pk
Unit
IRON OUT INC
646-9886
5&1
2
($
Toilet & Sink Repair
DRAIN AUGERS/OPENERS
($
‡³+20(2:1(5´
DRAIN OPENER/
CLEANER
)RU XVH LQ PRVW KRXVHKROG WRLOHWV
3RO\ VDIHW\ JXLGH WXEH )HDWXUHV
SODVWLFQRQVOLSJULSKDQGOH
,QGXVWULDO JUDGH EHDG VL]H GUDLQ
RSHQHU %LRGHJUDGDEOH FOHDUV RXW
GUDLQV JUHDVH WUDSV VHSWLF V\V
WHPVDQGURRWV2GRUOHVVQRQDFLG
IRUPXODLVVDIHRQ¿QH¿[WXUHVFKURPHDQGSODVWLF
Our No.
No.
Size
DRAIN CLEANERS
COMSTAR INTERNATIONAL
‡$&,'352)(66,21$/86(
21/<
‡³+2732:(5´
614-7185X
OE
Our No.
No.
Lgth
Ft
Shf
Pk
Unit
COBRA PRODUCTS
116-9705
Shf
Pk
Unit
12
($
40030
3
5
&'
TOILET AUGERS
‡³67$1'$5'´
8VH IRU FOHDQLQJ GUDLQV DQG ZDVWH
V\VWHPV &RQWDLQV FRUURVLRQ LQ
KLELWRUVWRSURWHFWSLSHV%RWWOHKDV
FKLOGSURRI FDS ZLWK OLQHU DQG DQ RXWHU SURWHFWLYH EDJ
127)25+20(86(
Size
Shf
Pk
Unit
‡³&200(5&,$//<(´
686-8079X
No.
4
No.
TOILET AUGERS
ROEBIC LABORATORIES
Our No.
Shf
Pk
Our No.
959-9655
SC JOHNSON
Size
Shf
Pk
6
3URYLGHV H[WUD FORJ EXVWLQJ SRZHU
WR RSHQ WKH PRVW VWXEERUQ FORJV
IDVWDQGHDV\HYHQWKURXJKVWDQG
LQJ ZDWHU 6DIH IRU SOXPELQJ ¿[
WXUHV SODVWLF SLSHV DQG VHSWLF
WDQNV
No.
Size
Ozs.
154-7553X
‡352)(66,21$/675(1*7+
Our No.
.HHSV GUDLQV DQG WUDSV UXQQLQJ
IUHHO\ZLWKDUHJXODUDSSOLFDWLRQD
SRZHUIXOQRQFRUURVLYHDQGQDWXUDO
GUDLQFOHDQLQJSURGXFW
DRAIN CLEANERS
COMSTAR INTERNATIONAL
895-0693X
No.
‡281&(%$*
JONES STEPHENS
($
LIQUID DRAIN OPENER
Our No.
DRAIN AND TRAP
CLEANERS
‡³)/2:($6<´
Shf
Pk
Unit
COMSTAR INTERNATIONAL
676-2710X
4XDUW
12
($
938-4371X
*DOORQ
($
190-2196X
Gallon
4
($
)RU XVH LQ PRVW KRXVHKROG WRLOHWV
:HOGHG VWHHO WXEH UXEEHU ERZO
JXDUG3ODVWLFQRQJULSKDQGOH
DRAIN OPENER/
CLEANER
‡.,7
‡³'5$1261$.(3/86´
´ VQDNH EHQGV VDIHO\ WKURXJK
\RXUSLSHVDQGWKHWKLFNFORJEXVW
LQJIRUPXODKDVDVSHFLDOLQJUHGLHQW
WR SURWHFW SLSHV IURP FRUURVLRQ 6DIH IRU SODVWLF 39&
PHWDOSLSHVJDUEDJHGLVSRVDOVDQGVHSWLFV\VWHPV
Our No.
No.
Shf
Pk
No.
Lgth
Ft
Shf
Pk
Unit
COBRA PRODUCTS
613-7095
42030
3
12
($
613-7103
12
($
Unit
SC JOHNSON
936-7764
Our No.
($
TOILET AUGERS
‡³+$1'(´
5HPRYHV REVWUXFWLRQV LQ DQ\ W\SH
RI WRLOHW ¶ PXVLF ZLUH FDEOH IRU
JUHDWHU ÀH[LELOLW\ +HDY\ GXW\ ]LQF
SODWHGFRQVWUXFWLRQ3URWHFWLYHWXE
LQJKHOSVSUHYHQWPDUULQJRIWRLOHW
ERZO
Our No.
No.
Shf
Pk
Unit
ELECTRIC EEL MFG
948-8982
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
&$$
1
($
82 - Maintenance, Repair & Operations
TOILET AUGERS
AUGERS
DRAIN AUGER CABLES
´[¶
‡'580
‡6(5,(6
+LJK LPSDFW SRO\PHU KRXVLQJ
TXLFNOHYHU FDEOH ORFN FHQWHUEDO
DQFHGSLVWROJULS
5HSODFHPHQWFDEOHIRUGUDLQ
DXJHUVHULHV2SHQKRRNFDEOH
Our No.
Shf
Pk
No.
Unit
PLUMB PAK
078-7432
Our No.
No.
5
33
&'
Unit
85150
[
4
($
113-4139
85250
[
4
($
AUGERS
For use in small and medium
KRXVHKROG GUDLQV 5XVW UHVLVWDQW
KLJKJUDGHFDUERQURXQGGLDPHWHU
6SULQJVWHHOZLUHIRUPD[LPXPÀH[
LELOLW\ IRU WKH WLJKWHVW EHQGV ,QWH
JUDWHG FRUNVFUHZ RSHQZRXQG ERULQJ KHDG *DOYDQL]HG
VWHHOFUDQNKDQGOHZLWKKLJKSRZHU³WRUTXHWZLVW´GHVLJQ
SURYLGHVPD[LPXPWKUXVWLQJDFWLRQ
‡'580
No.
Lgth
Ft
Shf
Pk
Unit
COBRA PRODUCTS
No.
113-3529
10150
15
5
&'
113-3545
10250
25
5
&'
613-7079
30500
50
1
($
DRAIN TAPE
613-7087
31000
100
1
($
‡)/$7
+LJKTXDOLW\VSULQJZLUHJDOYDQL]HG
VWHHOFUDQNKDQGOHZLWKKLJKSRZHU
WRUTXH WZLVW GHVLJQ 8VH IRU VPDOO
DQGPHGLXPKRXVHKROGGUDLQV
No.
Our No.
Size
In x Ft
Shf
Pk
Shf
Pk
Unit
794-1057
Our No.
Unit
4
No.
Our No.
Unit
631-4777
02250
25
12
($
613-7202
02500
50
12
($
617-7869
20500
[
3
($
DRAIN AUGER CABLES
113-3594
10080
[
5
($
‡6(5,(6
5HSODFHPHQW FDEOH IRU 6HULHV
SRZHU GUDLQ DXJHUV ,QQHU FRUG
FDEOHZLWKVORWWHGHQG
AUGERS
‡'580
Our No.
+LJK LPSDFW SRO\PHU KRXVLQJ
VFUHZFRQVWUXFWLRQ
No.
Size
In x Ft
Shf
Pk
Unit
COBRA PRODUCTS
097-8221
682-6341
[
4
Unit
($
1
($
No.
Lgth
Ft
Shf
Pk
Unit
81250
25
1
($
DRAIN CLEANERS
7,.6
,QFOXGHV ´ [ ¶ LQQHU FRUH
FDEOH VHW RI FOHDQLQJ WRROV
³7´ ZUHQFK DQG WRRO EDJ &OHDQV
´´GLDPHWHUOLQHV0DQXDO
SRZHUHG GUDLQ FOHDQHU XQLW LV OLJKWZHLJKW DQG LGHDO IRU
URRIWRSZRUNLQGRZQVSRXWV3RZGHUFRDWHGFDJHURWDWHV
IUHHO\6HOIDOLJQLQJEHDULQJV6WHHOVLGHEUDFHVRQIUDPH
SURYLGHH[WUDGXUDELOLW\7KXPEVFUHZORFNVFDEOHDWIURQW
RIFDJH
Our No.
[
1
($
DRAIN AUGER CABLES
‡6(5,(6
5HSODFHPHQW FDEOH IRU VHULHV
SRZHUGUDLQDXJHU
Our No.
No.
Size
In x Ft
Shf
Pk
Unit
COBRA PRODUCTS
694-0423
[
1
No.
Shf
Pk
Unit
ELECTRIC EEL MFG
416-0545
84250
Unit
‡0$18$/32:(5('
02'(/.
($
113-4097
Shf
Pk
No.
COBRA PRODUCTS
Shf
Pk
No.
($
$WWDFKHVWRDSRZHUGULOO6QDNHLV
HQFDVHG LQ D SODVWLF WXEH WKDW UH
PDLQV VWDWLRQDU\ DV WKH VQDNH LV
URWDWHGE\WKHGULOO5XVWSURRISUR
WHFWLYHYLQ\OWXELQJ´GLDPHWHU
Lgth
Ft
[
Our No.
1
‡³32:(561$.(´
20250
COBRA PRODUCTS
DRAIN CLEANERS
617-8123
Shf
Pk
7,+6
($
COBRA PRODUCTS
Size
In x Ft
[
Unit
COBRA PRODUCTS
522-2732
[
COBRA PRODUCTS
Size
In x Ft
Shf
Pk
,QFOXGHV JUHDVH FXWWHU VWUDLJKW ERULQJ KHDG VLGH FXW
WHUDQGVSHDUKHDGFXWWHU8VH
RQ´WR´FDEOHVL]HV
)RU VPDOO KRXVHKROG GUDLQV +LJK
FDUERQ RLO WHPSHUHG QRQNLQN
ÀDW ´ VWHHO ZLUH &ORVHG ZRXQG
VSULQJERULQJKHDG6WHHOURGIUDPH
KROGHU IRU HDV\ VWRUDJH DQG XVH
´ZLGH[´WKLFN
DRAIN AUGERS
Size
In x Ft
‡6(5,(63,(&(
COBRA PRODUCTS
113-4147
No.
CUTTER SET
+LJK LPSDFW SRO\PHU KRXVLQJ
TXLFNOHYHU FDEOH ORFN FHQWHUEDO
DQFHGUXEEHUSLVWROJULSPDQXDORU
GULOOSRZHUHGRSHUDWLRQ
Our No.
Our No.
COBRA PRODUCTS
113-4121
‡´',$0(7(5
Our No.
Shf
Pk
COBRA PRODUCTS
DRAIN AUGERS
Our No.
Size
In x Ft
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
,+.6
..,&
1
($
Maintenance, Repair & Operations - 83
DRAIN CLEANERS
DRAIN CLEANERS
‡02'(/=
,QFOXGHVVWDQGDUGSLHFHWRROVHW
8QLW LV EXLOW RQ KHDY\GXW\ VWHHO
IUDPHZLWKIROGLQJKDQGOHIRUHDV\
WUDQVSRUWDQGVWRUDJH3RZHUFRUG
LV ZUDSSHG DURXQG FRQYHQLHQWO\
SODFHGEUDFNHWVIRUVDIHSUREOHPIUHHWUDQVSRUW*URXQG
IDXOWFLUFXLWLQWHUUXSWHU*)&,VDIHW\IHDWXUHFRPHVVWDQ
GDUGZLWKIRRWSRZHUFRUG(DV\WRXVHDLURSHUDWHG
IRRWVZLWFKDOORZVWKHXVHRIERWKKDQGVZKHQZRUNLQJ
ZLWK FDEOH ,PSDFWUHVLVWDQW SODVWLF EHOW JXDUG IRU DG
GLWLRQDO RSHUDWRU VDIHW\ %XLOWLQ GUXP VKDIW VOLS FOXWFK
PLQLPL]HVFDEOHDQGWRROEUHDNDJHDQGSURYLGHVRYHUORDG
SURWHFWLRQ 8QLTXH LQQHU GUXP GHVLJQ HOLPLQDWHV FDEOH
EXFNOLQJ&DEOHLV´FHUWL¿HGPXVLFZLUHZLWKJHQXLQH
JDOYDQL]HG DLUFUDIW ZLUH LQQHU FRUH IRU ORQJHU OLIH &DVW
DOXPLQXP EUDFNHW ZLWK EHDULQJ VXSSRUWHG JXLGH WXEH
)XOO\ RSHQ FDJH IRU HDV\ FDEOH LQVSHFWLRQ DQG FOHDQ
LQJ/DUJH´ZKHHOVIRUEHWWHUPDQHXYHUDELOLW\:KHHO
EUDNHVWDELOL]HVXQLWZKLOHLQRSHUDWLRQ5XJJHG+3
UHYHUVLEOH%DOGRUPRWRUGHOLYHUVSOHQW\RIVSHHGFOHDQLQJ
SRZHU +DQG\ WRRO EDJ SURYLGHV FRQYHQLHQW VWRUDJH RI
WRROVZLWKXQLW
Our No.
Lgth
Ft
No.
Shf
Pk
Unit
ELECTRIC EEL MFG
WITH AUTO CABLE FEED
465-6278
=.,&$)
1
($
DRAIN CLEANERS
No.
Size
In
Shf
Pk
1
Unit
ELECTRIC EEL MFG
715-7431
6.5(,&
($
DRAIN CLEANERS
868-5588
1
5).,&
Dia
In
No.
Shf
Pk
No.
&7.(,&$
1
($
‡02'(/5
,QFOXGHVVWDQGDUGSLHFHWRROVHW
UHWULHYHU WRRO URRW VDZ JUHDVH
WRRO VWDUWLQJ GULOO DQG VSDQQHU
ZUHQFK +HDY\GXW\ +3 EDO
GRUFDSDFLWRUVWDUWPRWRU5XJJHGIUDPHFRQVWUXFWHGRI
´ VWHHO WXELQJ 5HPRYDEOH KDQGOH IRU HDV\ WUDQV
SRUWLQJ DQG ZRUN LQ WLJKW VSDFHV 6QDSORFN FRXSOLQJV
KROGWRROV¿UPO\LQSODFHQRVFUHZVUHTXLUHGWRFRQQHFW
WRROV %XLOWLQ JURXQG IDXFHW FLUFXLW LQWHUUXSWHU RQ D IWOLQHFRUGWRSURWHFWRSHUDWRUIURPHOHFWULFDOVKRFN$LU
IRRWVZLWFKDQGFRUGDVVHPEO\VWDQGDUGIRUHDV\RSHUD
WLRQ7KUHHHOHPHQW7UL0D[FDEOH/DUJH´ZKHHOVIRU
HDV\PDQHXYHULQJ5HLQIRUFHGFDEOHFDJHKROGV¶RI
7UL0D[FDEOHDQGUHPRYHVTXLFNO\IRUHDV\ORDGLQJ,P
SDFWUHVLVWDQWEHOWJXDUGIRUDGGLWLRQDORSHUDWLRQVDIHW\
5.,&
Unit
1/2’ WIDE X 1/16” THICK
50250
25
3
($
631-4553
50500
50
1
($
613-7129
25
1
($
613-7137
50
1
($
3/4’ WIDE X 1/8” THICK
613-7152
50
1
($
613-7160
100
1
($
Shf
Pk
Unit
SEWER ROD HEAD
ASSEMBLY
)LWVDOOÀDWVHZHUURGV6LOYHU
Unit
DRAIN CLEANING
MACHINE
,+
Shf
Pk
613-7111
Our No.
Size
In
Shf
Pk
1
No.
Head
Dia. In.
COBRA PRODUCTS
657-7845
No.
Lgth
Ft
No.
1
($
DRAIN OPENER/
CLEANER
‡³+$1'(´
2SHQV FORJJHG VLQNV ODYDWRULHV
EDWKWXEV DQG VKRZHU VWDOO GUDLQV
´ PXVLF ZLUH FDEOH IRU PD[L
PXPÀH[LELOLW\DQGGXUDELOLW\´
[ ¶ FDEOH QHJRWLDWHV PRVW EDWKWXE FURVVEDUV +HDY\
GXW\ VWHHO GUXP &RQYHQLHQW WKXPE VFUHZ ORFNV FDEOH
VHFXUHO\
Our No.
No.
Shf
Pk
Unit
ELECTRIC EEL MFG
162-3164
1
+((
($
Unit
($
DRAIN OPENER/
CLEANER
‡0,1,61$.(
‡³'5$,1.,1*´
Shf
Pk
Unit
WITH AUTO CABLE FEED
Our No.
3/4’ WIDE X 1/16” THICK
'HVLJQHG WR FOHDQ ´ WR ´
GUDLQ OLQHV ZLWK D WZR ZD\DXWR
IHHG WKDW DGYDQFHV DQG UHWULHYHV
WKHFDEOHZLWKWKHSXVKRIDOHYHU
DORQJZLWKDFDEOHJXLGHKRVHWKDW
NHHSVKDQGVRIIWKHURWDWLQJFDEOH
DQGNHHSVWKHZRUNDUHDFOHDQ$XQLTXHYDULDEOHVSHHG
PRWRU FRQWURO DOORZV WKH XVHU WR FRQWURO WKH VSHHG DW
ZKLFKWKHFDEOHIHHGVLQWRWKHOLQH7KHXQLWVLWVRQWKH
ÀRRURUFRXQWHUIRUHDV\RSHUDWLRQDQGZHLJKVRQO\OEV
IRUHDVHRIWUDQVSRUW$VWDLQOHVVVWHHOFDEOHGUXP*)&,
DQG KHDY\ GXW\ VWHHO IUDPH DUH DOO VWDQGDUG IHDWXUHV
,QFOXGHV3RZHUXQLWZDXWRFDEOHIHHGDQGJXLGHKRVH
´[¶LQQHUFRUHFDEOHGURSKHDGVHWRIFOHDQ
LQJWRROV
930-6945
ELECTRIC EEL MFG
(.5,&$)
2LO WHPSHUHG VSULQJ VWHHO ZLWK
VSHDU SRLQW UROOHU EDOO KHDG 7ZR
SLHFH DGMXVWDEOH JULS KDQGOH IRU
HDV\ FOHDQLQJ RI OLQHV &OHDQV DOO
VL]HVRIVHZHUGUDLQSLSHV5HQWDO
($
DRAIN CLEANERS
547-2790
‡67((/
‡5(17$/
COBRA PRODUCTS
ELECTRIC EEL MFG
&OHDQV ´ ´ GLDPHWHU OLQHV
XS WR IW &DEOH IHDWXUHV JDOYD
QL]HGDLUFUDIWZLUHLQQHUFRUH&RP
PRQ DSSOLFDWLRQV LQFOXGH YHQWV
GRZQVSRXWVDQGNLWFKHQGUDLQV
464-2500
Unit
ELECTRIC EEL MFG
Our No.
‡02'(/(
Our No.
Shf
Pk
No.
ELECTRIC EEL MFG
+DQGKHOG GULOOSRZHUHG PDFKLQH
IRUFOHDQLQJVPDOOLQVLGHOLQHVVXFK
DVVLQNVWXEVDQGVKRZHUV´
´ LQ GLDPHWHU XS WR IW
(DV\WRWLJKWHQFDEOHFKXFNPDGH
RIQHZFRPSRVLWHPDWHULDOZLWKKDUGHQHGVWHHOOLQHUDQG
MDZV¿WVVHFXUHO\LQSODFHDQGUHVLVWVUXVWIRUORQJHUOLIH
/LJKWZHLJKWVWDLQOHVVVWHHOGUXPSURYLGHVH[FHOOHQWGXUD
ELOLW\ DQG LV FRUURVLRQ UHVLVWDQW ZKHQ H[SRVHG WR KDUVK
OLTXLGV&DVWDOXPLQXPKDQGJXDUGLVGHVLJQHGIRUVDIHW\
DQGHDVHRIXVH9DULDEOHVSHHG´UHYHUVLQJGULOOZLWK
GRXEOH EDOO EHDULQJ JHDU KHDG IRU ORQJHU OLIH LV GRXEOH
LQVXODWHGIRULQFUHDVHGRSHUDWRUSURWHFWLRQDQGVPRRWK
TXLHWSHUIRUPDQFH$OOFDEOHVDUHFRQVWUXFWHGRIFHUWL¿HG
PXVLFZLUHDQG,&FDEOHVKDYHJHQXLQHJDOYDQL]HGDLU
FUDIWZLUHLQQHUFRUHIRUORQJODVWLQJRSHUDWLRQ
Our No.
Our No.
Our No.
‡02'(/6
FLAT SEWER RODS
0DLQOLQH PDFKLQH IRU WUHH URRWV
´[¶HOHFWULFZLWKDXWRFDEOH
IHGFDEOHJXLGHVSULQWVHWRIIRXU
FOHDULQJWRROVÀH[LEOHOHDGHUVSDQ
QHU ZUHQFK OHDWKHU JORYHV WRRO
EDJ $XWR FDEOH IHHG DQG FDEOH
JXLGHVSULQJDOORZIRUHDVLHURSHUDWLRQDQGDGGHGVDIHW\
1
($
DRUM AUGERS
‡32:(5&$%/('580
0$&+,1(
&OHDQV ´ ´ OLQHV XS WR IW 8VH IRU ÀRRU GUDLQV DQG PDLQ
GUDLQV+3PRWRUZLWKIRUZDUG
RIIUHYHUVH VZLWFK 9EHOW SXOOH\
GULYH V\VWHP ´ UHLQIRUFHG PROGHG FDEOH GUXP DQG
DGMXVWDEOHKDQGOHV2YHUVL]HG´ZKHHOVIRUHDV\WUDQV
SRUW7KUHHSRVLWLRQSRZHUIHHGZLWKVSHHGFRQWURO
Our No.
No.
Size
In x Ft
Shf
Pk
0LQL VQDNH GUDLQ FOHDQHU 8QFORJV
VLQNV VKRZHUV EDWK GUDLQV DQG
XULQDOV 6DIH DQG HDV\WRXVH 1R
FKHPLFDOV DQG QR QHHG WR UHPRYH GUDLQ FRYHUV ,QVHUW
PLQLVQDNHLQGUDLQURWDWHWKHQSXOORXWGHEULV´:
KDQGOH[´'[´/DXJHU
Our No.
7,+.
&3
[
1
Shf
Pk
Unit
($
GT WATER PRODUCTS
127-8753
Unit
COBRA PRODUCTS
158-0117
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
'.06
84 - Maintenance, Repair & Operations
Chemicals,Cleaners & Cleaning
Implements
PLUNGERS
PLUNGERS
PLUNGERS
PLUNGERS
‡'8$/72,/(7'5$,1
‡$,5'5$,1%/$67(5
´KDQGOH
&OHDUV FORJJHG DQG VORZ UXQQLQJ
VLQNV VKRZHUV WXE GUDLQV DQG
WRLOHWV )DVW DQG HDV\ ZLWK D VDIH
DQGHIIHFWLYHEXUVWRIDLU$WWDFK
RI GUDLQ DWWDFKPHQWV SXPS WKH
EODVWHUSRVLWLRQRYHUWKHGUDLQDQGSXOOWKHWULJJHU)LWV
PRVWGUDLQVL]HV
/RQJ UHDFK KDQGOH ZLWK FRPIRUW
JULS&RQYLQHQWDQGVDQLWDU\FDGG\
IRUVWRUDJH
Our No.
No.
Diam. In.
Shf
Pk
Unit
33
10
($
PLUMB PAK
Our No.
No.
Shf
Pk
5025
625-7471
Unit
($
)RUFH EODFN UXEEHU FXS ´ ZRRG
KDQGOH
Our No.
No.
SEPTIC SYSTEM
TREATMENT
‡³5,';´
Shf
Pk
Unit
30
($
LAVELLE INDUSTRIES
620-8938X
Shf
Pk
Unit
($
WORLDWIDE SOURCING
%
4
‡72,/(7
)RUFHEODFNFXS´ZRRGKDQGOH
RECKITT BENCKISER
‡³32:(53/81*(5´
422-4747
Our No.
614-5742
Dia
In
Shf
Pk
Unit
($
WORLDWIDE SOURCING
996-8736
%
No.
Shf
Pk
Unit
($
´FXS´KDQGOH
PLUNGERS
‡72,/(7
Our No.
No.
Shf
Pk
Unit
33
10
&'
PLUMB PAK
562-0455
Our No.
No.
Cup Dia.
Shf
Pk
Unit
24
($
WORLDWIDE SOURCING
706-0155
73/
‡$,532:(5('
‡³3/81*,7´
No.
Shf
Pk
Unit
COBRA PRODUCTS
875-4319
Our No.
No.
Shf
Pk
Unit
24
($
00300
%'/
($
6HSWLFV\VWHPWUHDWPHQWSOXVGUDLQ
PDLQWDLQHU &RQWDLQV ELOOLRQ RI
QDWXUDO DFWLYH EDFWHULD DQG
HQ]\PHV WKDW KDYH EHHQ VHOHFWHG WR HIIHFWLYHO\ GLJHVW
VHSWLF V\VWHP ZDVWH %UHDNV GRZQ WKH VROLG RUJDQLF
ZDVWH WKDW FDQ DFFXPXODWH LQ WKH VHSWLF WDQN VXFK DV
GHWHUJHQWV VRDSV JUHDVH DQG SDSHU $OVR KHOSV NHHS
GUDLQVUXQQLQJVPRRWKO\RXQFHVHYHU\PRQWKDS
SUR[LPDWHO\FXSVIRUVHSWLFWDQNVXSWRJDO
ORQV'UDLQ0DLQWDLQHU3RXURXQFHVDSSUR[LPDWHO\
FXS GRZQ WKH GUDLQ IROORZHG E\ RXQFHV FXS
ZDWHU
Our No.
Size
Oz
No.
Shf
Pk
Unit
RECKITT BENCKISER
027-0819
2
($
Our No.
24
($
No.
Size
Ozs.
Shf
Pk
Unit
12
($
ENFORCER PRODUCTS
610-5142X
WORLDWIDE SOURCING
291-5007
Gel
‡3/86'5$,10$,17$,1(5
‡³5,';´
‡+,*+&$3$&,7<
Our No.
Shf
Pk Unit
3UHYHQWVVHSWLFWDQNEDFNXS.HHSV
¿HOGOLQHVRSHQ%UHDNVGRZQIDWV
RLOV JUHDVH ZDVWH 6DIH IRU DOO
SOXPELQJ
&OHDUVFORJJHGWRLOHWVVLQNVVKRZ
HUDQGWXEGUDLQV
%ODFNUXEEHUFXS´ZRRGKDQGOH
Type
SEPTIC TANK
TREATMENT
PLUNGERS
PLUNGERS
Size
Ozs.
SEPTIC SYSTEM
TREATMENT
PLUNGERS
%OXHFXS´SODVWLFKDQGOH
No.
PLUNGERS
HARVEY’S
No.
&RQWDLQV PLOOLRQV RI EDFWHULD DQG
HQ]\PHV WR KHOS SUHYHQW VHSWLF
EDFNXS E\ EUHDNLQJ GRZQ VROLG
RUJDQLFZDVWH'LJHVWVSDSHUIDWV
RLOVJUHDVHSURWHLQDQGVWDUFKHVQDWXUDODFWLYH
LQJUHGLHQWVVDIHIRUDOOSLSHVDQGSOXPELQJ
Our No.
)OH[LEOHEODFNUXEEHUFXSZLWK´
\HOORZ ZRRG KDQGOH :RUNV DW DOO
angles to clean clogged toilets in
DKXUU\
PLUNGERS
Our No.
($
Toilet & Sink Repair
‡'5$,1
PLUNGERS
544-7354
3
SEPTIC TANK CLEANER
3URIHVVLRQDO VWUHQJWK SOXQJHU
PDGH RI QRQPDUNLQJ UXEEHU ´
\HOORZZRRGKDQGOH)LWVDOOWRLOHWV
LQFOXGLQJ $WWUDFWLYH PHUFKDQ
GLVHU´[´[´
No.
7,.6
‡352)(66,21$/67</(
‡³.25.<´
PLUNGERS
Our No.
Unit
PLUNGER DISPLAY
Toilet & Sink Repair
Dia
In
Shf
Pk
No.
COBRA PRODUCTS
540-3993
HOMEBASIX
028-5239X
Our No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
(67
Maintenance, Repair & Operations - 85
Toilet & Sink Repair
SEPTIC TANK
CLEANERS
‡%$&7(5,$/35(9(17$7,9(
Shf
Pk
No.
Unit
ENFORCER PRODUCTS
719-4285
8
(673
($
Toilet & Sink Repair
DRAIN ROOT TREATMENT
No.
Shf
Pk
Unit
12
($
ROEBIC LABORATORIES
959-9648
.
32
No.
ROOT KILLER
No.
4XDUW
12
($
604-4036X
.+
*DOORQ
($
CESSPOOL TREATMENT
‡%$&7(5,$/35(9(17,9(
Shf
Pk
(5.
2
12
Unit
Size
Lb
($
Shf
Pk
)5.
1
4XDUW
12
($
Unit
($
No.
59
Size
Shf
Pk
Unit
4XDUW
12
($
Air Conditioning & HVAC Filters
439-0100
:KLWH%OXH
1
($
No.
Color
Shf
Pk
Unit
ESSICK AIR PRODUCTS
578-8740
+
/W2DN
1
($
HUMIDIFIERS
‡&2162/(
VSHHG PRWRU +XPLGL¿HV VTXDUH IHHW 'LJLWDO K\JURPHWHU
HDV\ SRXULQ ¿OO PHWKRG DQG GXDO
ZLFNV 2SWLRQDO $LU&DUH ¿OWHU JDOORQV SHU GD\ RXWSXW $XWRPDWLF
KXPLGLVWDW :LFN XVHG 6.8 DLU ¿OWHU
RSWLRQDO
868-3773
No.
Color
Shf
Pk
Unit
1
($
9DULDEOH VSHHG PRWRU +XPLGL¿HV
VTXDUH IHHW 'LJLWDO K\JURP
HWHU DQG GXDO ZDWHU ERWWOHV JDOORQVSHUGD\RXWSXW5H¿OOOLJKWV
DXWR VKXWRII DQG UHSODFHDEOH $LU
&DUH ¿OWHU :LFN XVHG 6.8 DLU ¿OWHU
6.8
Unit
ESSICK AIR PRODUCTS
Titanium/Charcoal
1
:KLWH
‡&2162/(
897-4479
Shf
Pk
'
HUMIDIFIERS
VSHHG PRWRU +XPLGL¿HV VTXDUH IHHW 'LJLWDO K\JURPHWHU
DQG KXPLGLVWDW JDOORQV SHU GD\
RXWSXW $XWR VKXWRII UH¿OO OLJKWV
(DV\ ¿OO GXDO ZDWHU WDQNV 8VH UH
SODFHPHQWZLFN6.8
'
'
VSHHG PRWRU +XPLGL¿HV VTXDUH IHHW 6LQJOH ZDWHU ERWWOH
DXWR VKXWRII DQG UH¿OO OLJKW JDOORQVSHUGD\RXWSXW:LFNXVHG
6.8 RSWLRQDO
DLU¿OWHU6.8
‡72:(5:+2/(5220
890-6406
Unit
No.
Color
Shf
Pk
Unit
ESSICK AIR PRODUCTS
HUMIDIFIERS
No.
Shf
Pk
HUMIDIFIERS
Our No.
HUMIDIFIERS & ACCESSORIES
Our No.
Color
ESSICK AIR PRODUCTS
ROEBIC LABORATORIES
631-2912
No.
ESSICK AIR PRODUCTS
Our No.
‡³590$5,1(´
Our No.
ROEBIC LABORATORIES
676-6935
Unit
6DIH HIIHFWLYH EDFWHULDO IRUPXOD
WLRQ IRU RGRU FRQWURO DQG ZDVWH
GLJHVWLRQ LQ 59V &RQWDLQV QR
PHWK\O DOFRKRO RU IRUPDOGHK\GH
1RQVWDLQLQJ &DQ EH GXPSHG DW DQ\ GXPSLQJ VWDWLRQ
RU VHSWLF WDQN ZLWKRXW DGGLQJKDUPIXOFKHPLFDOV WR WKH
V\VWHP
1HZ SDWHQWHG SURGXFW ZKLFK
IRDPVRQFRQWDFWZLWKZDWHUWR¿OO
WKHHQWLUHVHZHUSLSHZLWKWKHURRW
NLOOLQJDJHQWGLFKOREHQLO,WFRYHUV
WKHLQVLGHVXUIDFHRIWKHSLSHDQG
VWLFNV ZHOO WR URRWV UHVXOWLQJ LQ ORQJHU ODVWLQJ UHVLGXDO
NLOOLQJDFWLRQ$OVRFRQWDLQVLQJUHGLHQWVWRVSHHGXSWKH
QDWXUDOGHFD\LQJSURFHVVRIWKHURRWVUHVXOWLQJLQTXLFNHU
UHOLHIIURPFORJV
No.
Size
Shf
Pk
HOLDING TANK
TREATMENT
FOAMING ROOT
KILLER
Our No.
.
Our No.
Our No.
$ FRPELQDWLRQ RI EDFWHULDO VWUDLQV
FRQWDLQLQJ VSRUHEHDULQJ DHUR
ELF EDFWHULD 6SHFL¿FDOO\ SURGXFH
SURWHRO\WLF DQG RWKHU HQ]\PHV RI
HVVHQWLDO YDOXH LQ WKH OLTXLI\LQJ RI
VHZHU ZDVWH 7KHVH EDFWHULD DUH VHOIUHSURGXFLQJ DQG
JLYH D IXOO \HDU RI SURWHFWLRQ DJDLQVW FORJJLQJ 8VH TXDUWIRUHDFKJDOORQFHVVSRROFDSDFLW\RQFHD\HDU
No.
VSHHG PRWRU +XPLGL¿HV VTXDUH IHHW 'LJLWDO K\JURPHWHU
RQHZDWHUERWWOHDQGDXWRPDWLFKX
PLGLVWDWJDOORQVSHUGD\RXWSXW
8VH UHSODFHPHQW ZLFN 6.8
‡&2162/(
.
934-2528
ENFORCER PRODUCTS
981-2074
Unit
ROEBIC LABORATORIES
.LOOV RQO\ WKH URRW LQVLGH WKH SLSH
FOHDUV SLSHV DQG DOORZV QRUPDO
V\VWH ÀRZ ZLOO QRW KDUP WUHHV VKUXEVFRQWDLQVFRSSHUVXOIDWH
Our No.
Shf
Pk
959-9457
Our No.
Size
Lb
Size
ROEBIC LABORATORIES
.HHSVOLQHVIUHHIURPFORJJLQJWUHH
DQG VKUXE URRWV 5RRWV KDYH WKH
DELOLW\WRVHHNRXWVPDOORSHQLQJVLQ
SLSHOLQHVLQVHDUFKRIZDWHU2QFH
DSLSHLVSHQHWUDWHGUDSLGJURZWK
LQ WKH SLSH FDXVHV EORFNDJH 7KLV
IRUPXODLVSURYHQE\\HDUVRIVXFFHVVLQFOHDULQJVHZHU
DQG GUDLQV RI URRW JURZWK HWF )DVW DQG HDV\ WR XVH
+DUPOHVVWREDFWHULDLQVHSWLFWDQNDQGFHVVSRROV3UH
YHQWVURRWEORFNDJHIRUDIXOO\HDU
Our No.
&RQWDLQV DQDHURELF VSRUHEHDULQJ
EDFWHULD VHOHFWHG FRQGLWLRQHG DQG
FXOWXUHG IRU XVH LQ VHSWLF WDQNV
5HVLVWDQWWRVRDSVDQGGHWHUJHQWV
FRQWLQXDOO\SURGXFHVHQ]\PHVZKLFKGLJHVWSURWHLQNHHS
WDQN FRQWHQWV OLTXLG DQG SUHYHQW RYHUDFFXPXODWLRQ RI
RUJDQLFZDVWH$VLQJOHWUHDWPHQWSUHYHQWVWDQNFORJJLQJ
DQGEXLOGXSIRURQHIXOO\HDU2QHTXDUWWUHDWVRQH
JDOORQFDSDFLW\WDQN
Our No.
ROOT KILLER
Size
Ozs.
‡7$%/(723
SEPTIC TANK
TREATMENT
7ZR SUHPHDVXUHG WUHDWPHQW
SDFN HDV\ SHULRGLF WUHDWPHQWV
NHHS V\VWHPV ÀRZLQJ KHOSV SUH
YHQWVHSWLFEDFNXSV
Our No.
HUMIDIFIERS
ENZYME TREATMENTS
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
'
:KLWH
1
($
- Maintenance, Repair & Operations
HUMIDIFIERS
HUMIDIFIERS
‡:+2/(+286(
‡&22/0,67
‡0(',805220
KUV UXQ WLPH ZLWK JDOORQ
RXWSXWIRUXSWRVTIWFRYHU
DJH$GMXVWDEOHPDQXDOKXPLGLVWDW
ZLWKVSHHGV%XLOWLQ)LOWHUFKHFN
PRQLWRUVFRQGLWLRQRIZLFN¿OWHU*(
PRWRU HDV\ WR ¿OO UHPRYDEOH ZDWHU WDQNV ZLWK FRP
IRUWFDUU\KDQGOHZKHHOFDVWHUVRQERWWRPSDQHOWKDW
HQVXUHV HDV\ PRELOLW\ DQG VHSDUDWH SRZHURQ DQG UH¿OO
OLJKWV 0LFUREDQ DQWLEDFWHULDO SURWHFWLRQ LQKLELWV JURZWK
RIEDWHULDDQGPROG
Our No.
Shf
Pk
No.
HUMIDIFIER WICK
FILTERS
+XPLGL¿HURXWSXWLVJDOORQV3HU
IHFWIRUPHGLXPVL]HGURRPV5XQV
XS WR KRXUV SHU ¿OOLQJ )LOWHU
FKHFNPRQLWRUV¿OWHUFRQGLWLRQ([
WHQGHGUXQWLPHVHWWLQJ$UPDQG+DPPHURGRUFRQWURO
Our No.
Shf
Pk
No.
Unit
PATTON ELECTRIC
027-1429
‡+80,',),(5
5(3/$&(0(17
‡:+2/(5220
5HSODFHPHQWZLFNV¿OWHUVIRU9RU
QDGR 9RUWH[ :KROH 5RRP +XPLGL
¿HUV'LPHQVLRQV´+[´:[´'
Our No.
No.
Shf
Pk
Unit
&'
VORNADO AIR LLC
4
+08
($
Unit
643-2603
0'
PATTON ELECTRIC
212-5698
1
+08
($
HUMIDIFIER WICK
FILTERS
HUMIDIFIERS
‡³&$5()5((+80,',),(5
3/86´
8VHV3HUPD:LFN¿OWHUQHYHUQHHGV
UHSODFHPHQW&RQWDLQVDQWLPLFUREL
DOSURSHUWLHVWKDWLQKLELWJURZWKRI
PROGIXQJLDQGEDFWHULDRQSODVWLF
SDUWV DQG ZLFN 5HJXODWHG UHOHDVH V\VWHP WR HOLPLQDWH
VWDJQDQWZDWHU'LVKZDVKHUVDIHSDQDQGWUD\(DV\WR
¿OOWRWHDZD\WDQN1LWH*OR1LJKWOLJKW$XWRVKXWRII5H¿OO
OLJKW0HFKDQLFDO+XPLGLVWDW:KLVSHUTXLHWKXQWHUIDQ
Our No.
Size
Gal
No.
HUMIDIFIER WICKS
‡5(3/$&(0(17
‡(;7(1'('/,)(
‡³+80,',:,&.´
Shf
Pk
5HSODFHPHQW &RQVROH ZLFN )LWV
DQG('VHULHV
5HLQIRUFHG GHVLJQ IRU ORQJHU OLIH
DQG EHWWHU HI¿FLHQF\ 7UDSV LPSX
ULWLHV LQ WKH ZDWHU 0LFUR)UHH )LWV
+ROPHV +XPLGL¿HU 0RGHOV +0 DQG +:)
Our No.
No.
Shf
Pk
Unit
12
($
BESTAIR
,6
+&
33223
1
‡(;7(1'('/,)(
‡³+80,',:,&.´
HUMIDIFIERS
‡³&$5()5((+80,',),(5
3/86´
+XPLGL¿HU KDV *DOORQ RXWSXW
IRU XS WR VTIW FRYHUDJH
8VHV3HUPD:LFN¿OWHUQHYHUQHHGV
UHSODFHPHQW &RQWDLQV DQWLPLFUR
ELDO SURSHUWLHV WKDW LQKLELW JURZWK RI PROG IXQJL DQG
EDFWHULD RQ SODVWLF SDUWV DQG ZLFN 5HJXODWHG UHOHDVH
V\VWHPWRHOLPLQDWHVWDJQDQWZDWHU'LVKZDVKHUVDIHSDQ
DQG WUD\ (DV\WR¿OO WRWH DZD\ WDQN $XWR VKXWRII 5H
¿OO OLJKW 0HFKDQLFDO +XPLGLVWDW VSHHG ZKLVSHUTXLHW
KXQWHUIDQ
Our No.
No.
Shf
Pk
Unit
HUNTER FAN COMPANY
603-9853
34352
5HLQIRUFHG GHVLJQ IRU ORQJHU OLIH
DQG EHWWHU HI¿FLHQF\ WKDQ VWDQ
GDUG H[SDQGHG ZLFNLQJ ¿OWHUV
7UDSV LPSXULWLHV LQ WKH ZDWHU $QWL0LFURELDO 7UHDWHG
0LFUR)UHH )LWV (VVLFN $LU (PHUVRQ DQG 0RLVW$LU +X
PLGL¿HU&RQVROHV0RGHOV+'::9::
:9 : : : : +' DQG +' +'& $OVR ¿WV .HQPRUH
0RGHOV &+'&
Our No.
1
Shf
Pk
No.
Unit
BESTAIR
($
350-8611
,6
(6:&
($
HUMIDIFIER WICKS
Our No.
No.
Shf
Pk
Unit
ESSICK AIR PRODUCTS
111-9650
1040
($
HUMIDIFIER WICKS
‡5(3/$&(0(17
5HSODFHPHQW &RQVROH ZLFN )LWV
+VHULHV
Our No.
No.
Shf
Pk
Unit
ESSICK AIR PRODUCTS
1045
3
($
Shf
Pk
‡³(;3$1'('/,)(´
Unit
PATTON ELECTRIC
4
‡5(3/$&(0(17
HUMIDIFIER WICK
FILTERS
+XPLGL¿HU KDV JDOORQV RXWSXW
3HUIHFWIRUVPDOOURRPV5XQVXSWR
KRXUVRQRQH¿OOLQJ1R¿OWHUVWR
HYHU UHSODFH VHWWLQJV KLJK DQG
ORZ0LFUREDQDQWLPLFURELDOSURGXFWSURWHFWLRQ
+0
HUMIDIFIER FILTERS
‡:$500,67
‡60$//5220
036-9785
1041
($
HUMIDIFIERS
No.
880-6770
160-4974
2 Pack
Our No.
Unit
ESSICK AIR PRODUCTS
5HSODFHPHQW ZLFN 7ZLQ 3DFN WDEOH WRS ZLFNV SHU FDUWRQ )LWV
'3 ' DQG %
6HULHV
HUMIDIFIER WICK
FILTERS
($
Shf
Pk
‡5(3/$&(0(17
HUNTER FAN COMPANY
382-5569
No.
2 Pack
748-6913
Unit
Up to 1200 Sq. Ft. - 3 Speed
Our No.
5HLQIRUFHG ¿OWHU IRU H[WHQGHG OLIH
DQG HI¿FLHQF\ 0LFUR)UHH )LWV
/DVNR 1DWXUDO &DVFDGH +XPLGL¿HU
0RGHOV DQG 7+)
0RGHO UHTXLUHV RQH ¿OWHU DQG UHTXLUHV WZR
¿OWHUV
($
Our No.
Shf
Pk
No.
$LU&DUH)LOWHU7ZRVWDJHDLUFOHDQ
LQJ ¿OWHU UHPRYHV GXVW SROOHQ
VPRNHDQGRGRUV)LWV+
DQG(6HULHV+'
Our No.
681-5153
Unit
2 Pack
,6
/
Shf
Pk
Unit
ESSICK AIR PRODUCTS
BESTAIR
801-9986
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
1051
($
Maintenance, Repair & Operations - HUMIDIFIER FILTERS
HUMIDIFIER FILTERS
HUMIDIFIER FILTERS
‡5(3/$&(0(17
‡(;7(1'('/,)(
‡(;7(1'('/,)(
0LFUREDQ DQWLPLFURELDO SURGXFW
SURWHFWLRQ 5HLQIRUFHG IRU ORQJHU
OLIH +ROPHV ¿OWHU ¿WV +0
DQG0HHWVRULJL
QDOPDQXIDFWXUHU¶VVSHFL¿FDWLRQV
$QWLEDFWHULDOWUHDWHGWUDSVPLQHU
DOV )LWV PRVW +ROPHV KXPLGL¿HUV
0HWDO UHLQIRUFHPHQW $GGV ULJLGLW\
WR VKDSH RI WKH ZLFN ¿OWHU ZKHQ
PRLVWHQHG$OVRDGGVVWDELOLW\ZLWK
WRGD\¶V VRIWHU PRUH DEVRUEHQW SDSHU 3UHYHQWV ³VOXPS
LQJ´RU³VDJJLQJ´RYHUWLPHRUZKHQZHW+HOSVPDLQWDLQ
WKHKXPLGL¿HU¶VGHVLJQHGRXWSXW
$QWLPLFURELDO WUHDWHG WUDSV PLQ
HUDOV 5HSODFHPHQW ¿OWHU ¿WV %H
PLV PRGHO + VHULHV FRQVROHV
0HWDO UHLQIRUFHPHQW $GGV ULJLGLW\
WR VKDSH RI WKH ZLFN ¿OWHU ZKHQ
PRLVWHQHG$OVRDGGVVWDELOLW\ZLWKWRGD\¶VVRIWHUPRUH
DEVRUEHQWSDSHU3UHYHQWV³VOXPSLQJ´RU³VDJJLQJ´RYHU
WLPH RU ZKHQ ZHW +HOSV PDLQWDLQ WKH KXPLGL¿HU¶V GH
VLJQHGRXWSXW
Our No.
Shf
Pk
No.
Unit
PATTON ELECTRIC
925-1133
4
+:)34'8
($
Our No.
No.
Shf
Pk
Unit
BESTAIR
259-7292
7,+6
+&
($
HUMIDIFIER FILTERS
Our No.
No.
Shf
Pk
Unit
BESTAIR
823-6895
,+6
&%
($
‡5(3/$&(0(17
HUMIDIFIER FILTERS
5RXQG ¿OWHU ZLWK PLFUREDQ &DU
ERQ; ¿OWHU WHFKQRORJ\ )RU XVH
ZLWK +0 DQG
Our No.
Shf
Pk
No.
Unit
PATTON ELECTRIC
773-4155
4
+:)3'48
($
361-4062
)LWV PRVW +ROPHV 'XUDFUDIW .HQ
PRUH DQG +RQH\ZHOO KXPLGL¿HUV
0HWDO UHLQIRUFHPHQW $GGV ULJLGLW\
WR VKDSH RI WKH ZLFN ¿OWHU ZKHQ
PRLVWHQHG$OVRDGGVVWDELOLW\ZLWKWRGD\¶VVRIWHUPRUH
DEVRUEHQWSDSHU3UHYHQWV³VOXPSLQJ´RU³VDJJLQJ´RYHU
WLPH RU ZKHQ ZHW +HOSV PDLQWDLQ WKH KXPLGL¿HU¶V GH
VLJQHGRXWSXW
Shf
Pk
Unit
3.
BESTAIR
720-7103
$//
,6
No.
7,+6
)LWV PRVW (PHUVRQ DQG .HQPRUH
KXPLGL¿HUV 0HWDO UHLQIRUFHPHQW
$GGV ULJLGLW\ WR VKDSH RI WKH ZLFN
¿OWHU ZKHQ PRLVWHQHG $OVR DGGV
VWDELOLW\ ZLWK WRGD\¶V VRIWHU PRUH
DEVRUEHQWSDSHU3UHYHQWV³VOXPSLQJ´RU³VDJJLQJ´RYHU
WLPH RU ZKHQ ZHW +HOSV PDLQWDLQ WKH KXPLGL¿HU¶V GH
VLJQHGRXWSXW
Shf
Pk
Unit
3.
BESTAIR
,+6
$//
$QWLEDFWHULDOWUHDWHGWUDSVPLQHU
DOV)LWVPRVW(PHUVRQKXPLGL¿HUV
0HWDO UHLQIRUFHPHQW $GGV ULJLGLW\
WR VKDSH RI WKH ZLFN ¿OWHU ZKHQ
PRLVWHQHG$OVRDGGVVWDELOLW\ZLWK
WRGD\¶V VRIWHU PRUH DEVRUEHQW SDSHU 3UHYHQWV ³VOXPS
LQJ´RU³VDJJLQJ´RYHUWLPHRUZKHQZHW+HOSVPDLQWDLQ
WKHKXPLGL¿HU¶VGHVLJQHGRXWSXW
Our No.
No.
Shf
Pk
Unit
7,+6
(5
12
3.
‡(;7(1'('/,)(
$QWLEDFWHULDO WUHDWHG WUDSV PLQ
HUDOV 5HSODFHPHQW ¿OWHU ¿WV +RQ
H\ZHOO .D] 9LFNV DQG 5RELWXVVLQ
KXPLGL¿HUV 0HWDO UHLQIRUFHPHQW
$GGV ULJLGLW\ WR VKDSH RI WKH ZLFN
¿OWHU ZKHQ PRLVWHQHG $OVR DGGV VWDELOLW\ ZLWK WRGD\¶V
VRIWHU PRUH DEVRUEHQW SDSHU 3UHYHQWV ³VOXPSLQJ´ RU
³VDJJLQJ´ RYHU WLPH RU ZKHQ ZHW +HOSV PDLQWDLQ WKH
KXPLGL¿HU¶VGHVLJQHGRXWSXW
)LOWHU KDV 0LFUREDQ DQWLPLFURELDO
SURGXFW SURWHFWLRQ )LWV +ROPHV
¿OWHU 1RV+0 DQG :KLWH :HVW
LQJKRXVH 1RV::+0 DQG
::+0
360-1879
+:)3'48
7,+6
($
‡(;7(1'('/,)(
$QWLEDFWHULDOWUHDWHGWUDSVPLQHU
DOV )LWV PRVW +ROPHV KXPLGL¿HUV
0HWDO UHLQIRUFHPHQW $GGV ULJLGLW\
WR VKDSH RI WKH ZLFN ¿OWHU ZKHQ
PRLVWHQHG$OVRDGGVVWDELOLW\ZLWK
WRGD\¶V VRIWHU PRUH DEVRUEHQW SDSHU 3UHYHQWV ³VOXPS
LQJ´RU³VDJJLQJ´RYHUWLPHRUZKHQZHW+HOSVPDLQWDLQ
WKHKXPLGL¿HU¶VGHVLJQHGRXWSXW
Our No.
No.
Shf
Pk
Unit
+&
12
($
BESTAIR
7,+6
No.
,6
+:
Shf
Pk
Unit
($
HUMIDIFIER FILTERS
5HLQIRUFHG GHVLJQ IRU ORQJHU OLIH
DQGEHWWHUHI¿FLHQF\WKDQVWDQGDUG
ZLFNLQJ ¿OWHUV 5HPRYHV PLQHUDOV
IURP ZDWHU $QWLEDFWHULDO WUHDWHG
)LWV %HPLV PRGHOV DQG VHULHV 0HWDO UHLQIRUFHPHQW $GGV
ULJLGLW\WRVKDSHRIWKHZLFN¿OWHUZKHQPRLVWHQHG$OVR
DGGVVWDELOLW\ZLWKWRGD\¶VVRIWHUPRUHDEVRUEHQWSDSHU
3UHYHQWV³VOXPSLQJ´RU³VDJJLQJ´RYHUWLPHRUZKHQZHW
+HOSVPDLQWDLQWKHKXPLGL¿HU¶VGHVLJQHGRXWSXW
Our No.
No.
Shf
Pk
Unit
BESTAIR
064-8097
4
'
Unit
HUMIDIFIER FILTERS
Unit
PATTON ELECTRIC
110-2078
Shf
Pk
HUMIDIFIER FILTERS
BESTAIR
Shf
Pk
No.
BESTAIR
534-3371
HUMIDIFIER FILTERS
No.
3.
‡(;7(1'('/,)(
Our No.
Our No.
$QWLEDFWHULDO WUHDWHG WUDSV PLQ
HUDOV 5HSODFHPHQW ¿OWHU ¿WV PRVW
+ROPHV KXPLGL¿HUV 0HWDO UHLQ
IRUFHPHQW $GGV ULJLGLW\ WR VKDSH
RIWKHZLFN¿OWHUZKHQPRLVWHQHG
$OVR DGGV VWDELOLW\ ZLWK WRGD\¶V VRIWHU PRUH DEVRUEHQW
SDSHU 3UHYHQWV ³VOXPSLQJ´ RU ³VDJJLQJ´ RYHU WLPH RU
ZKHQZHW+HOSVPDLQWDLQWKHKXPLGL¿HU¶VGHVLJQHGRXW
SXW
HUMIDIFIER FILTERS
531-7805
‡$//
496-9366
%&
BESTAIR
HUMIDIFIER FILTERS
No.
Unit
‡(;7(1'('/,)(
531-9256
Our No.
Our No.
Shf
Pk
BESTAIR
‡:,&.,1*
‡$//(;7(1'('/,)(
No.
$QWLEDFWHULDO WUHDWHG WUDSV PLQ
HUDOV )LWV %HPLV KXPLGL¿HUV
0HWDO UHLQIRUFHPHQW $GGV ULJLGLW\
WR VKDSH RI WKH ZLFN ¿OWHU ZKHQ
PRLVWHQHG$OVRDGGVVWDELOLW\ZLWK
WRGD\¶V VRIWHU PRUH DEVRUEHQW SDSHU 3UHYHQWV ³VOXPS
LQJ´RU³VDJJLQJ´RYHUWLPHRUZKHQZHW+HOSVPDLQWDLQ
WKHKXPLGL¿HU¶VGHVLJQHGRXWSXW
Our No.
HUMIDIFIER FILTERS
Our No.
HUMIDIFIER FILTERS
‡(;7(1'('/,)(
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7,+6
&%
($
88 - Maintenance, Repair & Operations
Air Conditioning & HVAC Filters
HUMIDIFIER FILTERS
Our No.
Shf
Pk
No.
Unit
BESTAIR
856-5095
7,6
+
($
$XWRPDWLF ZDWHU OHYHO VKXWRII
GUDLQRSWLRQVHDV\WRXVHFRQWUROV
DXWR UHVWDUW DQG VOLGHRXW ¿OWHU
&KHFN¿OWHUOLJKWWRUHPLQGWRFOHDQ
¿OWHU 6WRQH ZKLWH FDELQHW ¿QLVK
5ROOVHDV\IURPURRPWRURRPRQGXUDEOHFDVWHUV'HIURVW
FRQWURO&RPHVFKDUJHGZLWKWKHHQYLURQPHQWDOO\IULHQG
O\UHIULJHUDQW5$IDQVSHHGV&868//LVWHG$W
OHDVW´RSHQVSDFHVKRXOGEHDOORZHGRQDOOVLGHVRIWKH
XQLWIRUWRSDLUGLVFKDUJHYROWV
Cap.
Pints/
Day
No.
Bucket
Cap.
Shf
Pk Unit
%+'*
30
1
No.
Size
Oz
Shf
Pk
Unit
1T
32
12
($
%+'*
50
21
1
($
964-9005
%+'*
21
1
($
643-4476
No.
Size
Ounces
Shf
Pk
Unit
=8+7&
32
12
($
626-2232
=8+7&
128
4
($
Size
Oz
Shf
Pk
Unit
128
2
265-9480
7,+6
245
32
12
($
648-3937
,+6
($
5(1*
($
‡352)(66,21$/
‡$//,121(
‡³)$67$&7,21´
Shf
Pk
No.
Unit
82102
($
&RPSOHWH VWHS FDUSHW FOHDQHU
&OHDQV SURWHFWV GHRGRUL]HV QHX
WUDOL]HVVWDWLFDQGGHIRDPV8VHLQ
GHHSFOHDQLQJKRWZDWHUH[WUDFWLRQFDUSHWFOHDQLQJPD
FKLQHV
Our No.
No.
Size
Oz
Shf
Pk
128
2
Unit
LUNDMARK WAX CO.
244-4222X
Floor Care & Floor Protection
5(1*
($
CARPET CARE
CARPET SHAMPOO
CARPET CLEANER
‡352)(66,21$/675(1*7+
‡&21&(175$7('
‡³=(3´
HUMIDIFIER WATER
TREATMENT
‡%$&7(5,267$7,&
‡352)(66,21$/
‡75$)),&/$1(+($9<
'87<
‡³)$67$&7,21´
3UHPLXP ORZ IRDP FDUSHW GHWHU
JHQWIRUH[WUDFWLRQPDFKLQHV'HHS
FOHDQV FDUSHWV /LIWV WRXJK VSRWV
DQGVWDLQV
%DFWHULD WUHDWPHQW (3$ UHJLV
WHUHG +HOSV FRQWURO EDFWHULD DQG
DOJDH EXLOGXS DQG NHHSV ZDWHU
VPHOOLQJFOHDQ
Our No.
Shf
Pk
Unit
12
($
ESSICK AIR PRODUCTS
No.
CARPET CLEANER
BESTAIR
32
890-1829
008-8153X
HOUSEHOLD ESSENTIALS LL
Unit
LUNDMARK WAX CO.
DE-HUMIDIFIERS
Our No.
579-7154
Shf
Pk
ACUITY SPECIALTY PRODUCTS
Our No.
Chemicals,Cleaners & Cleaning
Implements
$EVRUEVKXPLGLW\LQVWRUDJHDUHDV
JDUPHQWEDJVWRROER[HVFDPHUD
EDJV HWF %OXH LQGLFDWRU FU\VWDOV
YDQLVK ZKHQ LWV WLPH WR UHSODFH
2QHSHUSDFNDJH
‡%$&7(5,267$7,&
No.
Size
Oz
&OHDQVLQVWHS/RZIRDPLQJ8VH
LQ H[WUDFWLRQ W\SH PDFKLQHV 6DIH
RQVWDLQUHVLVWDQWFDUSHWV
347-1372
DISPOSABLE
DEHUMIDIFIER
HUMIDIFIER WATER &
SCALE TREATMENT
Our No.
No.
‡352)(66,21$/
‡³)$67$&7,21´
‡'5<3$&.
Size
Oz
Our No.
($
24-1/2”H x 15-1/2”W x 12-6/8”D. 6.7 Amps
BESTAIR
Our No.
&RQYHQLHQW JHQHUDO XVH FDUSHW
VSRWWHU 5HPRYHV GHHS VWDLQV (Q
]\PHDFWLRQHOLPLQDWHVRGRUV6SH
FLDOO\IRUPXODWHGIRUKLJKWUDI¿FDUHDVR]LVD7ULJJHU
6SUD\R]LVDERWWOH
CARPET CLEANER
19-7/8”H x 13-3/8”W x 9-6/16”D. 3.8 Amps
530-9935
+XPLGL75($7 +XPLGL¿HU :DWHU
DQG6FDOH7UHDWPHQWLVIRUXVHLQDOOSRUWDEOHHYDSRUDWLYH
KXPLGLIHUV DQG LV VSHFLDOO\ IRUPXODWHG WR SUHYHQW OLPH
DQGVFDOHEXLOGXSDQGUHPRYHLPSXULWLHVIURP\RXUKX
PLGL¿HU¿OWHU
7,+6
‡³&20)257$,5(´
HEAT CONTROLLER
‡+80,',75($7(;75$
675(1*7+
‡:$7(56&$/(
‡³%(67$,5´
182-0851
‡352)(66,21$/675(1*7+
‡+,*+75$)),&
‡³=(3´
DEHUMIDIFIERS
Our No.
HUMIDIFIER WATER
TREATMENT
Our No.
CARPET CLEANER
DE-HUMIDIFIERS
)LOWHU IRU +0 &RRO0LVW KX
PLGL¿HU0HWDOUHLQIRUFHPHQW$GGV
ULJLGLW\ WR VKDSH RI WKH ZLFN ¿OWHU
ZKHQPRLVWHQHG$OVRDGGVVWDELO
LW\ZLWKWRGD\¶VVRIWHUPRUHDEVRU
EHQWSDSHU3UHYHQWV³VOXPSLQJ´RU
³VDJJLQJ´ RYHU WLPH RU ZKHQ ZHW +HOSV PDLQWDLQ WKH
KXPLGL¿HU¶VGHVLJQHGRXWSXW
No.
Size
Oz
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
898-5673
=83;&
($
274-0058
=83;&
128
4
($
$ FOHDQHU ZKLFK LV DQ DOOSXUSRVH
VSRWWHU %UHDNV GRZQ PRVW IRRG
and light oil stains that are most common stains in car
SHWLQJ'HVLJQHGWREHVSUD\HGRQWUDI¿FDUHDVSULRUWR
H[WUDFWLRQFOHDQLQJ7UDI¿F/DQHZLOOEUHDNGRZQWKHRLOV
LQWKHVWDLQKROGWKHPLQVXVSHQVLRQDQGDOORZWKHVWDLQ
LQJVXEVWDQFHWREHÀXVKHGRXWZLWKWKHSURSHUVKDP
SRR$OVRNLOOVRGRUV
Our No.
No.
Size
Oz
Shf
Pk
Unit
LUNDMARK WAX CO.
580-0701X
CARPET SHAMPOO
‡352)(66,21$/675(1*7+
‡(;75$&725
‡³=(3´
(FRQRPLFDO FRQFHQWUDWHG H[WUDF
WLRQ GHWHUJHQW 3URYLGHV GHHS
FOHDQLQJZLWKORZIRDP0DNHVXS
WRJDOORQV)UHVK)UDJUDQFH
Our No.
No.
Size
Oz
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
185-6624
=8&(&
128
4
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
5(1)
32
($
Maintenance, Repair & Operations - CARPET CLEANER
CARPET CLEANER
CARPET CLEANER
‡75,3/($&7,21
‡³5(62/9(´
‡3(7'((3&/($132:'(5
‡³5(62/9(´
3HQHWUDWHV EUHDNV GRZQ DQG OLIWV
RXW 5HPRYHV VWDLQV VXFK DV UHG
ZLQHIRRGJUHDVHSHWVWDLQVFRI
IHH PXG LQN WHD GLUW FROD IUXLW
MXLFHGLUW\PRWRURLODQGPRUH7ULJJHU6SUD\
5HVROYH 3HW 'HHS &OHDQ 3RZGHU
OLIWV UHPRYHV WRXJK JURXQG LQ
GLUWPHVVHVRGRUVOHIWEHKLQGE\
SHWV'HHSFOHDQVWROLIWUHPRYH
JURXQGLQGLUWSHWPHVVHVRGRUV2GRU6WRS7HFKQRO
RJ\ (OLPLQDWHV 3HW RGRUV IUHVKHQV ZLWK D OLJKW FOHDQ
VFHQW
‡'((3&/($1,1*2;<
62/87,21
‡³)(%5(=(´
Our No.
Size
Oz
No.
Shf
Pk
Unit
Our No.
RECKITT BENCKISER
633-8552
For compact deep cleaning ma
FKLQHV ; FRQFHQWUDWH (OLPLQDWHV
RGRUV DQGIUHVKHQV 3RZHUIXOR[\
JHQFOHDQLQJDFWLRQIRUGHHSGRZQGLUWDQGVWDLQUHPRY
DO1RGULSERWWOH
22
12
Our No.
No.
Size
Oz
Shf
Pk
Unit
HOME CARE INDUSTRIES
DQGGLVFRXUDJHVSHWUHVRLOLQJ
($
No.
Size
Oz
Shf
Pk
Unit
896-3936X
)
20
($
RECKITT BENCKISER
027-0884
CARPET CLEANER
‡5($'<7286(
‡³6,03/(*5((1
1$785$/6´
No.
Size
Oz
Shf
Pk
Unit
SUNSHINE MAKERS
527-1622
12304
18
($
24
($
‡3(767($0&21&(175$7(
‡³5(62/9(´
5HVROYH 3HW 6WHDP &RQFHQWUDWH
ZLWK 2GRU 6WRS 7HFKQRORJ\ LV
XQLTXHO\IRUPXODWHGZLWKSHWRZQ
HUVLQPLQG7KHDFWLYHLQJUHGLHQWV
UHPRYHWRXJKSHWVWDLQVOLNHXULQHYRPLWDQGIHFHVZKLOH
WKH RGRU HOLPLQDWLRQ WHFKQRORJ\ GLVFRXUDJHV UHVRLOLQJ
DQGQHXWUDOL]HVSHWDQGRWKHUKRXVHKROGRGRUV
Our No.
No.
CARPET CLEANER
‡'((3&/($1,1*2;<
62/87,21
‡&$56758&.6
‡³)(%5(=(´
CARPET CLEANER
)RUXVHRQVSRWPHVVHVRQFDUSHWV
UXJVDQGIRUTXLFNFOHDQXSRIKLJK
WUDI¿FDUHDV+HOSVNHHSFDUSHWVDQGUXJVIUHVKDQGQHZ
ORRNLQJE\DLGLQJLQWKHTXLFNUHPRYDORIW\SLFDOFDUSHW
VRLOVDQGVSLOOV)UHHDQGFOHDUVFHQW7ULJJHU6SUD\
Our No.
Size
Oz
Shf
Pk
For compact deep cleaning ma
FKLQHV(OLPLQDWHVRGRUVDQGIUHVK
HQV5HPRYHVVWDLQVRQFDUSHWXSKROVWHU\LQFDUVDQG
WUXFNV6WDLQVZRQ¶WUHDSSHDU
Our No.
No.
Size
Oz
Shf
Pk
Unit
HOME CARE INDUSTRIES
896-3951X
)
20
($
Unit
RECKITT BENCKISER
CARPET CLEANER
027-0900
‡&21&(175$7(
‡)2567($00$&+,1(6
‡³5(62/9(´
7KLV ORZ IRDPLQJ FRQFHQWUDWHG
IRUPXOD SURWHFWV DJDLQVW GLUW DQG
GHRGRUL]HV WKH FDUSHW ZLWK D UH
IUHVKLQJFOHDQVFHQW2QO\XVHR]SHUJDOORQRIZDWHU
8VHRQZRROQ\ORQV\QWKHWLFDQGVWDLQUHVLVWDQWFDUSHWV
Our No.
No.
Size
Oz
Shf
Pk
Unit
RECKITT BENCKISER
330-7113
48
($
5HVROYH3HW+LJK7UDI¿F)RDPKDVD
XQLTXHFOHDQLQJDQGSURWHFWLYHIRU
PXOD WR KHOS PDNH FOHDQLQJ ODUJH
DUHDV RI FDUSHW DQG XSKROVWHU\
HDVLHU 3RZHUIXO 2GRU 6WRS 7HFKQRORJ\ (OLPLQDWHV SHW
RGRUVIUHVKHQVZLWKDOLJKWFOHDQVFHQWGLVFRXUDJHVSHW
UHVRLOLQJDQGSURWHFWVDJDLQVWGLUWDQGSHWVWDLQVZKLOH
OHDYLQJ FDUSHW SOXVK 0DNHV FOHDQLQJ HDVLHU DQG KHOSV
SUHYHQWIXWXUHVRLOVIURPVHWWLQJGHHSLQWRFDUSHW¿EHUV
DQGXSKROVWHU\IDEULFV
Size
Oz
Shf
Pk
Unit
22
12
($
RECKITT BENCKISER
($
5HVROYH 3HW 6WDLQ ,QVWDQW (UDVHU
KDV D UDSLG EXEEOLQJ DFWLRQ WKDW
penetrates deep to remove tough
SHW VWDLQV RGRUV ZLWKRXW WKH VFUXEELQJ ,QVWDQWO\ UH
PRYHVWRXJKSHWVWDLQVOLNHXULQHYRPLWIHFHVDQGSHW
WUDFNV 3RZHUIXO 2GRU 6WRS 7HFKQRORJ\ HOLPLQDWHV SHW
RGRUV $OVR UHPRYHV HYHU\GD\ SHRSOH VWDLQV OLNH UHG
ZLQHJUDSHMXLFHDQGJUHDV\IRRG
No.
CARPET CLEANER
‡$//(5*(15('8&(5
62/87,21
‡³)(%5(=(´
‡3(767$,1,167$17
(5$6(5
‡³5(62/9(´
560-7486
‡3(7+,*+75$)),&)2$0
‡³5(629(´
027-0876
Size
Oz
Shf
Pk
For compact deep cleaning ma
FKLQHV ; FRQFHQWUDWH (OLPLQDWHV
RGRUVDQGIUHVKHQV+HOSVUHPRYH
GHHSGRZQGLUWSHWGDQGHUSROOHQDQGGLUWPLWHGHEULV
DOOHUJHQV
1RGULSERWWOH
Our No.
No.
Size
Oz
Shf
Pk
Unit
HOME CARE INDUSTRIES
896-3944X
)
20
($
Unit
RECKITT BENCKISER
CARPET CLEANER
No.
48
CARPET CLEANER
Our No.
Our No.
22
($
CARPET CLEANER
DEFOAMER
‡352)(66,21$/,167$17
‡³)$67$&7,21´
CARPET CLEANER
‡($6<&/($1
‡³5(62/9(´
(DV\&OHDQ&DUSHW&OHDQLQJV\VWHP
LV DQ HDV\ ZD\ WR GHHS FOHDQ FDU
pets so you don’t have to get on
\RXU KDQGV DQG NQHHV WR VFUXE
&RQYHQLHQWGLVSHQVLQJWULJJHUDQGXSULJKWEUXVKPDNHV
FOHDQLQJHDVLHU)RDPVDIHO\FOHDQVDQGGHRGRUL]HVODUJH
FDUSHW DUHDV 3URWHFWV DJDLQVW GLUW DQG WKH WRXJKHVW
JUHDV\ VWDLQV ZKLOH OHDYLQJ FDUSHWV SOXVK 6\VWHP FRQ
WDLQV R] 5HVROYH +LJK 7UDI¿F )RDP DQG (DV\ &OHDQ
&DUSHW%UXVK&RPSDWLEOHZLWK5HVROYH+LJK7UDI¿F)RDP
DQG3HW+LJK7UDI¿F)RDP
&RQFHQWUDWHGPLON\ZKLWHHPXOVLRQ
SUHYHQWV RYHUVXGVLQJ 2SWLPL]HV
PDFKLQH SHUIRUPDQFH 'RHV QRW
SURPRWHUHVLGXHIRUPDWLRQ6DIHWRXVHRQVXUIDFHVQRW
KDUPHGE\ZDWHU
Our No.
No.
Shf
Pk
268-4132X
Unit
RECKITT BENCKISER
027-0868X
2
Size
Oz
Shf
Pk
Unit
LUNDMARK WAX CO.
:RUNV JUHDW RQ WKHVH VWDLQV EHHI JUDY\ FRIIHH FROD
IRRGJUHDVHJUDSHMXLFHPDNHXSDQGUHGZLQH
Our No.
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
5(1)
32
($
- Maintenance, Repair & Operations
Floor Care & Floor Protection
CARPET STAIN
REMOVERS
CARPET STAIN
REMOVERS
‡32:'(5
‡³5(62/9(´
‡$'9$1&('3(767$,1
62/87,21
‡³)(%5(=(´
)DVWGU\LQJIRUPXODUHPRYHVWRXJK
JURXQGLQGLUW&DUSHWGULHVLQRQO\
PLQXWHV 6DIHO\ FOHDQV FDUSHWV
LQFOXGLQJVWDLQUHVLVWDQWVH[FHSWVSHFLDOFDUSHWVOLNHDQ
WLTXHRURULHQWDO
Our No.
Size
Oz
No.
Shf
Pk
Our No.
18
CARPET STAIN
REMOVERS
For compact deep cleaning ma
FKLQHV ; FRQFHQWUDWH 6SHFLDOO\
IRUPXODWHG WR QHXWUDOL]H SHW RGRUV DQG IUHVKHQV (IIHF
WLYHO\ UHPRYHV GHHS GRZQ GLUW DQG VWDLQV 6DIH WR XVH
DURXQGSHWV1RGULSERWWOH
Unit
RECKITT BENCKISER
241-9216X
SPOT & STAIN REMOVERS
Size
Oz
No.
Shf
Pk
Unit
HOME CARE INDUSTRIES
($
896-3928X
5HPRYHV PRVW VWDLQV FDXVHG E\
SHW XULQH WHD FRIIHH ZLQH IUXLW
MXLFH DQG RWKHU DFLG W\SH VWDLQV
1HXWUDOL]HVWKHDFLGDQGSUHYHQWVEOHDFKLQJ8VHLQWDQ
GHPZLWKFDUSHWFOHDQLQJPDFKLQHV
Our No.
20
)
‡352)(66,21$/3(767$,1
‡³)$67$&7,21´
($
No.
CARPET STAIN
REMOVERS
‡)2$0
‡³5(62/9(´
Our No.
No.
Size
Oz
Shf
Pk
Unit
22
12
($
RECKITT BENCKISER
607-3118
Size
Oz
No.
Shf
Pk
Unit
HOME CARE INDUSTRIES
‡3(767$,12'25
5(029(5
‡:,7+2;<*(1$&7,21
‡³)(%5(=(´
No.
Size
Oz
Shf
Pk
Unit
HOME CARE INDUSTRIES
F81022
22
No.
,6
Our No.
Size
Oz
Shf
Pk
128
4
Unit
*
($
‡'((3&/($16,1*
Size
Oz
Shf
Pk
Unit
HOME CARE INDUSTRIES
Trigger Spray
896-3902X
F82022
=86327
24
12
($
1RQWR[LF LQVWDQW SHW DQG FDUSHW
VWDLQ UHPRYHU VDIHO\ DQG SHUPD
nently eliminates pet stains and
RGRUVDQGSUHYHQWVWKHPIURPUHWXUQLQJ5HPRYHVHYHQ
WKHZRUVWSHWVWDLQVLQFOXGLQJWUDFNHGLQPXGGLUWDQG
RLO6DIHIRUFKLOGUHQDQGSHWV(QYLURQPHQWDOO\IULHQGO\
7ULJJHU6SUD\
Our No.
Size
Oz
No.
Shf
Pk
Unit
WD-40 COMPANY
7,+6
22
($
22
CARPET SPOT
REMOVERS
5HPRYHV DOOHUJHQV )RUPXODWHG
ZLWK¿EHUFRDWSURWHFWDQW7RXJKRQ
VSRWVDQGVWDLQV6DIHIRUDOOGHHS
FOHDQVLQJPDFKLQHV
(OLPLQDWHVRGRUVDQGIUHVKHQV5H
PRYHVKRXVHKROGVWDLQVRQFDUSHW
UXJVDQGXSKROVWHU\6WDLQVZRQ¶WUHDSSHDU
No.
Unit
CARPET DETERGENT
‡728*+63272;<67$,1
5(029(5
‡³)(%5(=(´
Our No.
Shf
Pk
‡,167$173(767$,1
‡³63276+27´
516-6541
CARPET STAIN
REMOVERS
Size
Oz
No.
CARPET STAIN
REMOVERS
3HQHWUDWHV GLUW ¿OPV ORRVHQV GLUW
DQG GLVSHUVHV WKH VRLO DQG NHHSV
LW IURP EHLQJ UHGHSRVLWHG $OOV\Q
WKHWLFFOHDQHU%LRGHJUDGDEOH&RQWDLQVQRSKRVSKDWHV
333-2079X
($
($
LUNDMARK WAX CO.
($
12
$HURVRO IRDPLQJ FDUSHW VSRWWHU
6SHFLDOO\ GHVLJQHG IRU RLO\ VWDLQV
*UHDWIRUUHPRYLQJJUHDVHDQGIRRGV$HURVRO
534-2373
‡)25$8720$7,&)/225
0$&+,1(6
Our No.
Trigger Spray
896-3894X
22
LOW FOAMING
CLEANER
)RU FDUSHW UXJV DQG XSKROVWHU\
(OLPLQDWHV RGRUV DQG IUHVKHQV 5HPRYHV WRXJK SHW
VWDLQVDQGRGRUVOLNHXULQHYRPLWIHFHVEORRGDQGPRUH
6WDLQVZRQ¶WUHDSSHDU
Our No.
F82322
896-3910X
ACUITY SPECIALTY PRODUCTS
Trigger Spray
CARPET STAIN
REMOVERS
5(1)
‡352)(66,21$/675(1*7+
‡)2$0
‡³=(3´
(OLPLQDWHV RGRUV DQG IUHVKHQV
5HPRYHV VWDLQV RQ FDUSHW DQG XSKROVWHU\ LQ FDUV DQG
WUXFNV6WDLQVZRQ¶WUHDSSHDU
Our No.
Unit
CARPET STAIN
REMOVERS
‡728*+63272;<67$,1
5(029(5
‡&$56758&.6
‡³)(%5(=(´
(IIHFWLYHDQGVDIHVWDLQUHPRYDOIRU
FDUSHWV)RUWRXJKVSRWVDQGKHDY\
WUDI¿FDUHDV$HURVRO
Shf
Pk
LUNDMARK WAX CO.
511-5407X
CARPET STAIN
REMOVERS
Size
Oz
($
‡,167$17
No.
Size
Oz
733-3313
$+
48
4
($
510-5994
$+
128
4
($
Our No.
Shf
Pk
Unit
HOOVER CO
6DIHO\ UHPRYHV WRXJK VSRWV DQG
VWDLQV IURP FRORUIDVW FDUSHW UXJV
XSKROVWHU\DQGFORWKLQJ'RHVQRW
OHDYHDVWLFN\UHVLGXH1RULQVLQJRU
YDFXXPLQJQHFHVVDU\
Our No.
No.
Size
Oz
Shf
Pk
Unit
32
32
12
($
FOLEX
607-3597
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - CARPET SPOT
REMOVERS
STAIN & ODOR
REMOVER
‡352)(66,21$/
‡³)$67$&7,21´
3HQHWUDWHV DQG EUHDNV XS VSRWV
DQG VWDLQV IRU UHPRYDO 'RHV QRW
damage sensitive carpets or uphol
VWHU\ IDEULFV 5HPRYHV SDLQW RLO JUHDVH FUD\RQ VKRH
SROLVKOLSVWLFNLQNDQGZD[
Our No.
Size
Oz
No.
Shf
Pk
Unit
LUNDMARK WAX CO.
782-5920
5(1)
12
6DIHO\ DQG HIIHFWLYHO\ UHPRYHV RU
JDQLF VWDLQV DQG RGRUV ZLWK WKLV
HQ]\PH DQG OHPRQ RLO EDVHG IRU
PXOD:LOOQRWVHWWKHVWDLQRUIDGH
FRORUV&DQEHXVHGRQSRURXVDQG
QRQSRURXVVXUIDFHV0DGHZLWKRQO\VXVWDLQDEOH
SODQWEDVHG LQJUHGLHQWV 'RHV QRW FRQWDLQ G\HV RU V\Q
WKHWLFSHUIXPHVQHXWUDOS+JUH\ZDWHUDQGVHSWLFVDIH
5HFRJQL]HG IRU VDIHU FKHPLVWU\ E\ WKH (3$¶V 'HVLJQ IRU
WKH(QYLURQPHQW3URJUDP
Our No.
($
BAKING SODA
No.
Shf
Pk
Unit
12
($
EARTH FRIENDLY PRODUCTS
CARPET/UPHOLSTERY
CLEANER
‡352)(66,21$/675(1*7+
‡2;<
‡³=(3´
Floor Care & Floor Protection
Our No.
No.
Shf
Pk
Unit
12
($
ACUITY SPECIALTY PRODUCTS
978-4588
=2;<
32
Chemicals,Cleaners & Cleaning
Implements
)RDP EUHDNV XS LQ PLQXWHV OHDY
LQJ FDUSHW GU\ ZKLOH WUDSSHGLQ
RGRUV DUH HOLPLQDWHG 1R YDFXXP
LQJQHHGHG/RQJODVWLQJIUDJUDQFHOHDYHVURRPVPHOOLQJ
IUHVKDQGFOHDQR]FDQ
No.
Fragrance
Shf
Pk
Unit
0RUQLQJ5DLQ
12
($
STAIN REMOVERS
Our No.
No.
Chemicals,Cleaners & Cleaning
Implements
288-3775X
01155
12
($
‡:2;,&/($1',57
),*+7(56
‡³$50+$00(53(7
)5(6+´
No.
Size
Oz
217-2534
11448
30
Unit
51313
12
($
Our No.
377-8818X
4
($
HOUSEHOLD ESSENTIALS LL
908-1480X
No.
Size
Oz
788-3150
84802
2
($
‡³67,1.(56¶
.LOOVRGRUVLQSHWEHGVPDWWUHVVHV
XSKROVWHU\DQGFDUSHWV)RUVNXQN
PROGDQGPLOGHZ&RQWDLQVQRIUD
JUDQFHVRUVWLFN\UHVLGXHV
No.
Size
Oz
Shf
Pk
Unit
12
($
Shf
Pk
Unit
CHEMICAL TECHNOLOGIES I
Trigger Spray
ODOR REMOVERS
Shf
Pk
Unit
ODOR REMOVERS
708-0450X
Size
Lb
Shf
Pk
CHURCH & DWIGHT
CEDAR AND LAVENDER
SPRAY
&RPELQHG ZLWK ODYHQGHU HVVHQFH
5HVWRUHV VFHQW RI FHGDU ZRRG
SURGXFWV $OVR D JUHDW KRXVHKROG
GHRGRUL]HU:RUNZHOOLQSHWDUHDV
Shf
Pk
&
32
Unit
‡/,*+7/<6&(17('
‡(;75$675(1*7+
‡³)(%5(=(´
($
(OLPLQDWHVRGRUVDQGIUHVKHQVIDE
ULFVFDUSHWVDQGDLU
Our No.
STAIN REMOVERS
No.
Size
Oz
PROCTER & GAMBLE
‡08/7,385326(
‡³7(&+67$,15(029(5´
BAKING SODA
:RUNV JUHDW WR UHPRYH VWDLQV EH
IRUH \RX ZDVK &RQWDLQV QR KDUVK
FKHPLFDOVEOHDFKRUDQ\WKLQJWKDW
FDQGXOOWKHFRORUVRQIDEULFV6DIH
WR XVH RGRUOHVV QRQÀDPPDEOH DQG HIIHFWLYH RQ DQ\
ZDVKDEOH IDEULF VXFK DV FDUSHW FORWKLQJ ODXQGU\ SUH
ZDVK XSKROVWHU\ DQG YLQ\O 7HFK 6WDLQ 5HPRYHU KDV
HDUQHG WKH 6HDO RI $SSURYDO IURP WKH &DUSHW DQG 5XJ
,QVWLWXWH&DUGHG
No.
Unit
CHURCH & DWIGHT
Our No.
ODOR REMOVERS
CHURCH & DWIGHT
Our No.
Shf
Pk
Our No.
907-9328
For removing stains in and around
WKH KRPH )RUPXODWLRQ ZRUNV EHW
WHULQWKHZDVKDQGZKHQXVHGWR
SUHWUHDW DQG LV PRUH DGYDQFHG LQ
WKHUHPRYDORIJUDVVVWDLQVJUHDVH
DQG GLUW WKDQ WKH RULJLQDO IRUPXODWLRQ 8VH RQ PXOWLSOH
VXUIDFHV OLNH FDUSHW XSKROVWHU\ NLWFKHQ DQG EDWK VXU
IDFHV DQG ZRUNV RXWGRRUV RQ JXWWHUV XQ¿QLVKHG GHFNV
DQGSDWLRIXUQLWXUH&RORUVDIHSHUFHQWFKORULQHIUHH
Size
Oz
‡129$&880)2$0
‡³&$53(7)5(6+´
WD-40 COMPANY
‡³2;,&/($1´
No.
CARPET ODOR
ELIMINATOR
Our No.
SPOT & STAIN REMOVERS
Our No.
7KHSRZHURIEDNLQJVRGDDQGR[L
FOHDQ GLUW ¿JKWHUV DEVRUEV RGRUV
DQG UHPRYHV GLUW IURP VPRNH PROG DQG PLOGHZ (DV\
SHWKDLUSLFNXS'RHVQRWUHPRYHFDUSHWVWDLQV/HDYHV
EHKLQGDSOHDVDQWIUDJUDQFHIRUORQJODVWLQJIUHVKQHVV
ODOR REMOVERS
(IIHFWLYHFDUSHWVWDLQUHPRYHU'H
signed to remove colored organic
DQGSURWHLQVWDLQV*UHDWIRUMXLFHDQGZLQHVWDLQV7ULJ
JHU6SUD\
Size
Oz
3/
6SLOOSURRI SDFNDJH ZLWK ÀRWKUX
IUHVKHQLQJ5HPRYHIURQWDQGEDFN
SDQHO WR H[SRVH WZLFH WKH EDNLQJ
VRGD
ODOR REMOVERS
32 Oz
242-3994
‡³$50+$00(5)5,'*(
1)5((=(5´
Size
Shf
Pk
Unit
Trigger Spray
‡³$50+$00(5´
648-5932X
($
)RU EDNLQJ FOHDQLQJ DQG GHRGRU
L]LQJ
Our No.
No.
ODOR REMOVERS
Size
Shf
Pk
Unit
‡635,1*5(1(:$/
‡³)(%5(=(´
(OLPLQDWHVRGRUVDQGIUHVKHQVIDE
ULFVFDUSHWVDQGDLU
CHURCH & DWIGHT
827-0746
01110
2]
24
($
788-8233X
/E
($
TECH ENTERPRISES INC.
190-1115X
'
2XQFH
24
($
Our No.
237-6119X
6
2XQFH
12
($
PROCTER & GAMBLE
059-4127X
6
1 Gallon
4
($
No.
Size
Oz
Shf
Pk
Unit
Trigger Spray
461-9029
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
- Maintenance, Repair & Operations
ODOR REMOVERS
ODOR REMOVERS
ODOR REMOVERS
‡602.((/,0,1$725
‡³=(3´
‡08/7,385326(
‡121%$7+5220685)$&(6
‡³85,1(2))´
‡08/7,3(7,1-(&725&$3
‡³85,1(2))´
1HXWUDOL]HVPDORGRUV(VSHFLDOO\HI
IHFWLYHRQVPRNH/HDYHVDLUVPHOO
LQJIUHVKDQGFOHDQ
Our No.
Size
Oz
No.
Shf
Pk
Unit
12
($
ACUITY SPECIALTY PRODUCTS
Aerosol
485-4261
=862(
:RUNV RQ DOO QRQEDWKURRP VXU
IDFHVE\XVLQJVSHFLDOL]HGHQ]\PHV
DQG EDFWHULD WR EUHDN GRZQ WKH
FRPSRQHQWV RI XULQH (DV\ WR XVH DQG HIIHFWLYHO\ UH
PRYHVXULQHDQGLWVSURWHLQVDVZHOODVRWKHUVRLOV8VH
DVDFDUSHWDQGXSKROVWHU\VSRWFOHDQHUWKDWZLOOUHPRYH
PRVW RUJDQLF VWDLQV DQG RGRUV IURP YLUWXDOO\ DOO FDUSHW
DQGXSKROVWHU\¿EHUV
Our No.
No.
Size
Oz
Shf
Pk
8VHWRSUHWUHDWRUDVDSUHVSRWWHU
WR UHPRYH XULQH EHIRUH DGGLWLRQDO
FOHDQLQJ &RPHV ZLWK D FDUSHW LQ
MHFWRU FDS WR HQVXUH VDWXUDWLRQ RI
FDUSHWDQGSDGGLQJ7RXJKIRUPXODZRUNVRQROGVWDLQV
UHPRYLQJRGRUDQGROGXULQHGHSRVLWV3HUIHFWIRUFOHDQ
LQJFDUSHWLQJIDEULFDQGXSKROVWHU\1HZHDV\JULSERWWOH
PDNHVFOHDQLQJHDV\DQGFRQYHQLHQW
Our No.
Unit
Size
Oz
No.
648-5809
&RQFHQWUDWHGKLJKO\HIIHFWLYHPDO
RGRUQHXWUDOL]HU)RURXWGRRUDSSOL
FDWLRQV0DNHVTXDUWV
Our No.
Shf
Pk
Unit
12
($
Fresh Evergreen Scent - Aerosol
7,+6
=8*2&(
32
555-0405
Size
Lb
Shf
Pk
Unit
12
($
DELTA MARKETING INTERNATIONAL
567-1557
1
Shf
Pk
Unit
1
$667
Counter Display Box
8
Size
Oz
No.
Shf
Pk
Unit
12
($
URINE OFF BY BIO-PRO RE
Trigger Spray
05
($
‡08/7,3(767$57(5
6<67(0
‡³85,1(2))´
‡$//(5*(15('8&(5
‡³)(%5(=(´
8ULQH ¿QGHU FRPER SDFN LQFOXGHV
DQ/('ÀDVKOLJKWDQGUHDG\WRXVH
VSUD\WRKHOS¿QGDQGHOLPLQDWHLQ
YLVLEOHGHSRVLWV8VHV$$$EDWWHULHV1RW,QFOXGHG
(OLPLQDWHV RGRUV IURP IDEULF DQG
UHGXFHV XS WR RI DOOHUJHQV
IURP FDWV GRJV DQG GXVW PLWHV
WKDWFDQEHFRPHDLUERUQH
No.
Size
Ozs.
Shf
Pk
Unit
Size
Oz
05
($
‡2'25(/,0,1$725
‡³60(//6%(*21(´
(OLPLQDWHVXQZDQWHGRGRUV6LPSO\
spray directly on the odor source
and occasionally spray to maintain
DIUHVKOLYLQJHQYLURQPHQW
Shf
Pk
Unit
Our No.
No.
Fragrance
Shf
Pk
Unit
PUNATI CHEMICAL
12 Ounce Pump Spray
Trigger Spray
Unit
URINE OFF BY BIO-PRO RE
ODOR REMOVERS
PROCTER & GAMBLE
596-3947X
Shf
Pk
($
1HXWUDOL]HVSHWRGRUVLQIDEULFVDQG
DLU
No.
Size
Oz
No.
Trigger Spray - Carded
‡3(72'25(/,0,1$725
‡³)(%5(=(´
Our No.
Our No.
433-8174
ODOR REMOVERS
COMSTAR INTERNATIONAL
12
ODOR REMOVERS
378-2711
/RQJODVWLQJJHOFXSVSURYLGHFRQ
VWDQWIUDJUDQFHZKLOHHOLPLQDWLQJDOO
W\SHV RI XQZDQWHG RGRUV QRW MXVW
PDVNRYHUWKHPHDFKRIFKHUU\
PLQWRUDQJHDQGSXUHDLUVFHQWVLQ
FRXQWHUWRSGLVSOD\ER[%LRGHJUDGDEOH
097-6670
32
Our No.
818-7825
Trigger Spray
‡*(/%20%$662570(17
Size
Oz
Unit
PROCTER & GAMBLE
ODOR REMOVERS
No.
Shf
Pk
5HDG\WRXVHHDV\JULSVSUD\ERWWOH
IRU FRQYHQLHQW FOHDQXSV 7RXJK
IRUPXOD ZRUNV HYHQ RQ ROG VWDLQV
removing odor and old urine de
SRVLWV )RU FOHDQLQJ KDUG DQG VRIW VXUIDFHV HVSHFLDOO\
ZDOOVÀRRULQJJURXWDQGIDEULFV
ODOR REMOVERS
Our No.
Our No.
-6
($
‡08/7,3(7635$<
‡³85,1(2))´
Trigger Spray
2GRU DEVRUEHU 1RQWR[LF HQYLURQ
PHQWDOO\ VDIH ELRGHJUDGDEOH )RU
IUHVK FOHDQ DLU LQGRRUV $EVRUEV
SROOXWDQWVDQGUHPRYHVRGRUV(OLPLQDWLQJRGRUVVXFKDV
WREDFFRVPRNHFRRNLQJRGRUVSHWVPHOOVSDLQWIXPHV
FOHDQLQJVROYHQWVZHWFDUSHWVJDVROLQH
32
ODOR REMOVERS
URINE OFF BY BIO-PRO RE
‡$,56321*(2'25
$%625%(5
No.
No.
Size
Oz
05
($
6SHFLDOO\IRUPXODWHGIRUGDLO\EDWK
URRP PDLQWHQDQFH :RUNV RQ DOO
EDWKURRP VXUIDFHV XVLQJ VSHFLDO
L]HGHQ]\PHVDQGEDFWHULDWREUHDN
GRZQWKHFRPSRQHQWVRIXULQHDQGRWKHUERG\GLVFKDUJ
HVWKDWFDXVHRGRUDQGVWDLQV8VHRQWXEWLOHDQGJURXW
WRLOHWVLQNÀRRUDQGZDOOV
Our No.
ODOR REMOVERS
Our No.
12
‡%$7+5220
‡³85,1(2))´
ACUITY SPECIALTY PRODUCTS
087-9809
32
595-3898
ODOR REMOVERS
Size
Oz
No.
-6
12
Injector Cap Bottle
Trigger Spray
‡*$5%$*(&21752/
‡&21&(175$7(
‡³=(3´
Unit
URINE OFF BY BIO-PRO RE
URINE OFF BY BIO-PRO RE
ODOR REMOVERS
Shf
Pk
($
991-8269
00112
2ULJLQDO
12
($
560-8906
03112
&LWUXV
12
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - ODOR REMOVERS
ODOR REMOVERS
‡'(2'25,=(5
‡³60(//6%(*21(´
‡*$5%$*(2'25
(/,0,1$725
‡³1$785$/0$*,&´
6ROLG RGRU DEVRUEHU GHRGRUL]HU
&RQWLQXDOO\ DEVRUEV RGRUV ZKLOH
HPLWWLQJDSOHDVDQWPLOGIUDJUDQFH
FRQWDLQHUODVWVXSWRGD\VDQG
ZLOOWUHDWXSWRVTXDUHIHHW8VHLQDQ\URRPLQWKH
KRXVHZLWKPXVW\RGRUV&KLOGDQGSHWUHVLVWDQWFRYHU
Our No.
No.
Fragrance
Shf
Pk
Unit
PUNATI CHEMICAL
15 Ounce
AIR & FABRIC
FRESHENER
‡/(021*5$66
‡³(&2%5((=(´
6WLFN WKH GLVFUHWH 1DWXUDO 0DJLF
*DUEDJH 2GRU (OLPLQDWRU RQ WKH
XQGHUVLGH RI \RXU JDUEDJH FDQ OLG
DQG ULG \RXUVHOI RI DQQR\LQJ JDUEDJH RGRUV *HO JRHV
EH\RQGPDVNLQJWRSHUPDQHQWO\QHXWUDOL]HWRXJKRGRUV
UHSODFLQJ WKHP ZLWK D 3XUH 6N\ VFHQW WKDW OHDYHV \RXU
JDUEDJHFDQVPHOOLQJIUHVKDQGFOHDQIRUXSWRGD\V
&RPSDFWDQGYHUVDWLOHWKLVJHOLVJUHDWIRUJDUEDJHFDQV
OLWWHUER[HVSHWFDJHVDQGGLDSHUSDLOV
471-2402
&DOPLQJ5DLQ
12
($
Our No.
705-2418
6RRWKLQJ%UHH]H
12
($
MAGIC AMERICAN
740-6168
(QHUJL]LQJ&LWUXV
12
($
844-4903X
798-3299
5HOD[LQJ/DYHQGDU
12
($
No.
Shf
Pk
Unit
12
($
6DIHO\ IUHVKHQV DQG HOLPLQDWHV
RGRUVIURPIDEULFVZLWKQDWXUDORU
JDQLF HVVHQWLDO RLOV :LOO QRW VWDLQ
RUOHDYHVWLFN\UHVLGXHEHKLQGVDIHRQDOOZDWHUVDIHIDE
ULFV([FHOOHQWZKHQXVHGDVDJHQHUDODLUIUHVKHQHUDV
ZHOO3RSXODULQKRVSLWDOLW\UHQWDOFDUDQGRI¿FHDSSOLFD
WLRQV0DGHZLWKRQO\VXVWDLQDEOHSODQWEDVHGLQ
JUHGLHQWV'RHVQRWFRQWDLQG\HVRUV\QWKHWLFSHUIXPHV
QHXWUDO S+ JUH\ZDWHU DQG VHSWLF VDIH 5HFRJQL]HG IRU
VDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQIRUWKH(QYLURQPHQW
3URJUDP
Our No.
ODOR REMOVERS
‡2'25(/,0,1$725'5236
‡³1$785$/0$*,&´
‡2'25$%625%,1**(/
‡³1$785$/0$*,&´
0DGH IURP QDWXUDOO\ GHULYHG UH
QHZDEOH UHVRXUFHV 7KLV VXSHU
SRZHUIXO JHO JRHV EH\RQG PDVN
ing to trapping and eliminating
XQZDQWHG DLUERUQH RGRUV DQG UHSODFLQJ WKHP ZLWK D
OLJKW SOHDVDQW VFHQW *XPEDVHG JHO FRQWUROV IUDJUDQFH
UHOHDVHIRUDORQJODVWLQJHIIHFW1RQEXUQLQJDOWHUQDWLYH
to candles in a visually appealing decorative container is
LGHDOIRUHYHU\URRPLQWKHKRXVH:RUNVFRQWLQLRXVO\IRU
XSWRGD\V
No.
Scent
Unit
0DGH ZLWK HVVHQWLDO RLOV 2GRU
(OLPLQDWRU 'URSV SHUPDQHQWO\
FKDQJH WKH PROHFXODU VWUXFWXUH RI
RGRUPROHFXOHVHOLPLQDWLQJVWURQJ
RGRUVEHIRUHWKH\EHFRPHDSUREOHP3RUWDEOHDQGGLV
FUHHWZLWKDSOHDVDQWIUHVKUHYLYDOVFHQW\RXFDQSUHYHQW
SHVN\ RGRU DURXQG WKH KRPH RU RQWKHJR 2YHU XVHVSHUERWWOH*UHDWIRUWRLOHWVOLWWHUER[HVSHWDUHDV
DQGGLDSHUSDLOV
Our No.
Shf
Pk
No.
Unit
MAGIC AMERICAN
844-4911X
12
3RPHJUDQDWH$FDL
($
844-4994X
&UDQEHUU\&XUUDQW
($
844-5009X
*UDSHIUXLW
($
ODOR REMOVERS
&UqPH%UXOqH
($
844-4945X
2518
9DQLOOD
($
844-4952X
:DUP$SSOH3LH
($
6WLQN 0DJQHW 2GRU (OLPLQDWRU
1DWXUDO 0DJLF RGRU DEVRUELQJ JHO
ZRUNV FRQWLQXRXVO\ WR NHHS DZD\
XQZDQWHG RGRUV 7KLV JHO JRHV
EH\RQG PDVNLQJ WR WUDS DQG HOLPLQDWH WRXJK DLUERUQH
RGRUV UHSODFLQJ WKHP ZLWK D OLJKW SOHDVDQW VFHQW WKDW
OHDYHV \RXU VSDFH VPHOOLQJ IUHVK DQG FOHDQ *UHDW IRU
VPRNH FRRNLQJ FORVHWV SHW JDUEDJH NHQQHOV OLWWHU
ER[HV SDLQW IXPHV DQG PXVW\ RGRUV /DVWV XS WR GD\VLQURRPVXSWRVTXDUHIHHW
ODOR REMOVERS
‡&22.,1*2'256
(/,0,1$725
‡³1$785$/0$*,&´
Our No.
1DWXUDO 0DJLF &RRNLQJ 2GRUV
(OLPLQDWRU ¿JKWV OLQJHULQJ FRRNLQJ
RGRUV9DQLOOD'UHDPIUDJUDQFH¿OOV
WKH DLU DV WKH SRZHUIXO JHO DEVRUEV DQG HOLPLQDWHV ODVW
QLJKW¶VGLQQHURGRUV*HOODVWVXSWRGD\VZKHQRSHQ
DQG DEVRUEV RGRUV LQ URRPV XS WR VTXDUH IHHW 2]
Our No.
No.
Scent
Shf
Pk
Unit
9DQLOOD'UHDP
12
($
MAGIC AMERICAN
844-4861X
($
‡2'25$%625%,1**(/
‡³1$785$/0$*,&´
8VH WR UHPRYH XQZDQWHG RGRUV
DQG UHSODFH WKHP ZLWK VXEWOH IUD
JUDQFHV 8QSOHDVDQW RGRUV ZLOO EH
QHXWUDOL]HG DQG UHSODFHG ZLWK D
ZDUP DQG SOHDVLQJ VFHQW 3OHDVLQJ VFHQWV DUH UHOHDVHG
JUDGXDOO\KRXUVDGD\/DVWXSWRGD\V
Our No.
No.
Fragrance
Shf
Pk
Unit
14 Ounce
050-1478X
&LWUXV
12
($
730-7663X
5DVSEHUU\
12
($
850-7600X
2FHDQ
12
($
‡2'25$%625%,1**(/
‡³1$785$/0$*,&´
6.5 Oz
844-4937X
12
AIR FRESHENERS
($
16 Oz
3/
MAGIC AMERICAN
MAGIC AMERICAN
844-4960X
Unit
32 Oz
ODOR REMOVERS
Our No.
Shf
Pk
EARTH FRIENDLY PRODUCTS
371-4482
Shf
Pk
No.
No.
Scent
Shf
Pk
Unit
MAGIC AMERICAN
844-4879X
2444
%UXVKHG&RWWRQ
12
AIR FRESHENERS
‡³60(//6%(*21(´
2GRUQHXWUDOL]LQJJHOEHDGV7UDSV
XQZDQWHG RGRUV OHDYLQJ EHKLQG
D OLJKW SOHDVDQW IUDJUDQFH 6LPSO\
open the cap and place in any
URRPZKHUHRGRUVOLQJHU2QHFRQ
WDLQHUUHVWRUHVDQDUHDRIDSSUR[LPDWHO\VTXDUHIHHW
IRUGD\V6L]HR]
Our No.
($
52012
6XQZDVKHG/LQHQ
($
/DYHQGHU9DQLOOD
($
991-8285
52812
$SSOH&LQQDPRQ
($
991-8301
52512
&DOPLQJ5DLQ
($
VDVVDIUDV IUDJUDQFH WKDW SURYLGHV LPPHGLDWH UHOLHI
6NXQN;LVVDIHIRUDOOVXUIDFHVLQFOXGLQJSHWVVRLWFDQ
EHVSUD\HGGLUHFWO\RQWKHSUREOHPDUHD
Shf
Pk
Unit
TECH ENTERPRISES INC.
059-4333X
6
32
Unit
991-8319
)RUPXODWHGZLWKQDWXUDOVDVVDIUDV
VSHFLDOO\GHVLJQHGVXUIDFWDQWVDQG
VHOHFWLYHO\DGDSWHGRUJDQLFVDOWVWR
HIIHFWLYHO\QHXWUDOL]HDQGHOLPLQDWH
VNXQN RGRUV TXLFNO\ ZLWKRXW WKH
QHHGWRZDLWIRUHQ]\PHVWRZRUN6NXQN;KDVDQDWXUDO
Size\Oz
Shf
Pk
991-8277
‡³6.81.;´
No.
Fragrance
PUNATI CHEMICAL
ODOR REMOVERS
Our No.
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
Chemicals,Cleaners & Cleaning
Implements
Chemicals,Cleaners & Cleaning
Implements
RUST REMOVERS
RUST/STAIN REMOVER
‡³6&27&+*$5'´
6SUD\IRUPXODWREHXVHGRQWRXJK
UXVW DQG LURQ VWDLQV $GYDQFHG
IRUPXOD LV DV HIIHFWLYH \HW VDIHU
than traditional liquid rust remov
HUVZKLFKFRQWDLQK\GURÀXRULFDFLG&OHDQVWRLOHWERZOV
VLQNV ¿EHUJODVV DQG DFU\OLF WXEV VKRZHUV DQG VSDV
ZKLWHDQGFRORUIDVWFORWKLQJ
Size
Oz
No.
Shf
Pk
Unit
IRON OUT INC
634-5243X
No.
Size
Shf
Pk
Unit
2]
12
($
6KLHOGV IDEULF DQG XSKROVWHU\
DJDLQVW PDQ\ GDPDJLQJ VRLOV
VSLOOV DQG VWDLQV3URWHFWV IDEULF VR
LW ORRNV FOHDQHU ORQJHU &UHDWHV DQ
LQYLVLEOHVKLHOGIRUHDVLHUFOHDQLQJ
0DLQWDLQVWKHRULJLQDOORRNIHHODQG
EUHDWKDELOLW\RIIDEULFV2GRUOHVVZKHQGU\$SSOLFDWLRQV
8SKROVWHU\PLFUR¿EHUUXJVFDUSHWLQJGUDSHU\WDEOHOLQ
HQVDXWRIDEULFLQWHULRUVIDEULFDSSDUHOQXEXFNDQLOLQH
DQGVXHGHOHDWKHUV1RWIRUXVHRQ¿QLVKHGOHDWKHUV
Our No.
No.
Size
Oz
Shf
Pk
Unit
11
12
($
Size
Shf
Pk
2]
14
Unit
639-1239
4
($
$Q LQWHQVLYH PXOWLVWDLQ UHPRYHU
system that eliminates the tough
HVWVWDLQVIURPIXUQLWXUHDQGDXWR
PRWLYH IDEULF XSKROVWHU\ DQG FDU
SHWLQJ LQFOXGLQJ IRRG EHYHUDJH
FRRNLQJRLOJUHDVHEORRGXULQHPRWRURLOWDULQNDQG
SHUPDQHQW PDUNHU 0D\ QRW UHPRYH DUWL¿FLDO UHG G\HV
IURPVRPHIDEULFV1RWIRUXVHRQVLON,QFOXGHV3DFNHW
/HYHO6WDLQ5HPRYHU1HW:WR]DQG%RWWOH/HYHO
6WDLQ5HPRYHU)OR]
Our No.
Shf
Pk
No.
Unit
GUARDSMAN
321500
8
($
CARPET CLEANER
Unit
/RRVHQVDQGUHPRYHVWRXJKVWDLQV
HPEHGGHGGLUWDQGRGRUVIURP¿
EHUV)RUPXODWHGWRVDIHO\GHHSFOHDQIDEULFXSKROVWHU\
DQGFDUSHW¿EHUV1RQWR[LF'ULHVTXLFNO\$HURVRO
Our No.
($
No.
Size
Oz
Shf
Pk
Unit
12
12
($
BISSELL INC
RUST/STAIN REMOVER
/LTXLG UXVW UHPRYHU 4XLFNO\ UH
PRYHV UXVW VWDLQV IURP DQ\ ZDVK
DEOH FRORUIDVW IDEULF RU FDUSHWLQJ
DQG IURP ZKLWH VLQNV DQG WRLOHW
ERZOV 6DIH RQ SLSHV DQG VHSWLF
V\VWHPV
Size
Oz
'
Shf
Pk
CARPET PROTECTION
‡)2$0+20($872
‡:,7+6321*(%586+
+($'
683-2901
No.
Size
Oz
3M
025-5455
UPHOLSTERY
SHAMPOO
WHINK PRODUCTS
Our No.
No.
Floor Care & Floor Protection
3URIHVVLRQDOVWUHQJWKUXVWUHPRYHU
*UHDW IRU UHPRYLQJ UXVW DQG LURQ
VWDLQVDOODURXQGWKHKRXVH&OHDQV
VWDLQVIURPZKLWHODXQGU\NLWFKHQV
EDWKURRPV DSSOLDQFHV FRQFUHWH
VLGLQJERDWVDQG59V6DIHIRUXVHLQGRRUDQGRXW
05221
10
831-9154X
‡08/7,385326(
344-8032X
4101
GUARDSMAN
($
RUST/IRON REMOVER
No.
Unit
Our No.
3M
FABRIC PROTECTOR
IRON OUT INC
,21,21
No.
Shf
Pk
&OHDQVDQGUHSURWHFWV¿QHKRXVH
KROGIDEULFVDQGXSKROVWHU\LQFOXGLQJVRIWVFKDLUFXVK
LRQVWKURZSLOORZVDQGFDULQWHULRUV2QHFDQFOHDQVDQG
SURWHFWVRQHVRIDRUWZRFKDLUV$HURVRO
FABRIC/UPHOLSTERY
CLEANER
&OHDQV WRLOHWV VLQNV EDWKWXEV
ZKLWH FORWKHV ZDWHU VRIWHQHUV
GLVKZDVKHUVDQGPXFKPRUH6DIH
WR XVH RQ YLUWXDOO\ DQ\ VXUIDFH
4XLFNO\ DQG HIIHFWLYHO\ UHPRYHV WKH WRXJKHVW UXVW DQG
LURQVWDLQV
Our No.
Our No.
Size
Oz
($
‡08/7,385326(
‡³683(5,521287´
899-1986
+HOSV UHSHO VSLOOV DQG VWDLQV 8VH
RQ VRIDV WDEOH OLQHQV VLON WLHV
DIJKDQV VKRHV DQG WKURZ SLO
ORZV3URWHFWVIDEULFVVXFKDVVLONV
ZRROVDQGGU\FOHDQRQO\2QHFDQW\SLFDOO\SURWHFWVRQH
FKDLU$HURVRO
213-0367
/,231
RUST/STAIN REMOVER
Our No.
‡:,7+6&27&+*$5'
3527(&7,21
‡'((3)2$0,1*$&7,21
‡³6&27&+*$5'´
FABRIC/UPHOLSTERY
PROTECTOR
‡/,48,'
‡³5867287´
Our No.
FABRIC/UPHOLSTERY
CLEANER
UPHOLSTERY CLEANERS
Shf
Pk
Unit
WHINK PRODUCTS
827-3674X
($
148-4062X
01281
10
($
‡:,7+6&27&+*$5'
3527(&7,21
‡+($9<75$)),&
‡³),%(5&/($16,1*
)2508/$´
;8OWUD&RQFHQWUDWHG¿EHUFOHDQV
LQJ IRUPXOD IRU FDUSHW DQG XSKROVWHU\ ZLWK 6FRWFKJDUG
SURWHFWDQW 1HZ FRQFHQWUDWHG IRUPXOD GHHS FOHDQV DQG
UHVLVWVVWDLQV6DIHIRUXVHLQPRVWEUDQGVRIGHHSFOHDQ
LQJFDUSHWPDFKLQHVDQGH[WUDFWRUV 8QLYHUVDOODERUD
WRU\WHVWHGDQGVDIHWRXVHLQ%LVVHOO+RRYHU'LUW'HYLO
DQGRWKHUEUDQGVIXOOVL]HGHHSFOHDQLQJPDFKLQHVLQ
FOXGLQJUHQWDOPDFKLQHV&RYHUVVTIWRU
DYHUDJHVL]HURRPV
No.
Size
Oz
(
24
FABRIC/UPHOLSTERY
CLEANER
Our No.
‡³:22/,7(´
735-5902X
&RPELQHV WKH FOHDQLQJ SRZHU RI
DIRDPFOHDQHUZLWKWKHDGYDQFHG
WHFKQRORJ\RIDIDEULFIUHVKHQHU)L
EUD3XUHRGRUHOLPLQDWRUWHFKQRORJ\
HOLPLQDWHVWKHWRXJKHVWRGRUVE\KHOSLQJWRSUHYHQWWKH
UHOHDVHRIPDORGRUPROHFXOHVLQWRWKHDLU6DIHO\FOHDQV
DQGIUHVKHQVIDEULF/HDYLQJXSKROVWHU\FOHDQIUHVKDQG
VRIWZLWKQRVWLFN\UHVLGXH$HURVRO
RUG/CARPET
PROTECTOR
Our No.
No.
Size
Oz
0835
14
Unit
BISSELL INC
Shf
Pk
Unit
BISSELL INC
607-3431
Shf
Pk
($
7,+6
($
‡³6&27&+*$5'´
5HVLVWVVRLODQGVWDLQVWRNHHSUXJV
DQGFDUSHWVFOHDQDQGQHZORRNLQJ
ORQJHUFDQSURWHFWVDSSUR[LPDWH
O\D¶[¶DUHD$HURVRO
Our No.
No.
Size
Oz
+
14
Shf
Pk
Unit
3M
693-1372
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
Maintenance, Repair & Operations - Floor Care & Floor Protection
FLOOR CARE - HOME
WOOD FLOOR
REJUVENATOR
3URWHFWLYHEDUULHUIRUSRO\XUHWKDQH
ÀRRUV 5HVWRUHV RULJLQDO EHDXW\
,PSURYHVSURWHFWLRQRI\RXUZRRG
Our No.
No.
FLOOR WAX
‡,17(5,2586(
‡6$7,1),1,6+
‡³75(:$;*2/'/$%(/´
6HDOVDQGSURWHFWVVODWHÀDJVWRQH
WHUUD]]RXQJOD]HGWLOHPRVDLFWLOH
EULFNKHDUWKVVWRQHDQGFRQFUHWH
*LYHV JORVV DQG GHSWK &U\VWDO
&OHDU
‡³32/<3527(&+´
Size
Oz
SLATE SEALER
Our No.
Shf
Pk
Size
Oz
No.
5HFRPPHQGHG IRU YLQ\O OLQROHXP
UXEEHUDQGWLOHÀRRUV6HDOVÀRRUV
SURYLGLQJ GXUDEOH SURWHFWLRQ DQG
ZHDU&DUQDXEDEDVHG
Shf
Pk
Unit
LUNDMARK WAX CO.
Unit
647-6139X
,+
616-3786X
,+
)
32
($
,
*
128
2
($
)
32
($
WOOD/LAMINATE
FLOOR CLEANER
Unit
($
Our No.
‡³62/$5%5,*+7´
5HFRQGLWLRQVDQGUHVWRUHVVKLQHRQ
³QRZD[´ ÀRRUV FDXVHG E\ UHGXF
WLRQ RI JORVV GXH WR KHDY\ WUDI¿F
5HVLVWVEODFNPDUNV$QWLVOLS
Our No.
No.
Size
Oz
Shf
Pk
LUNDMARK WAX CO.
058-5356X
.6
*
128
2
Size
Oz
No.
Shf
Pk
32
6
($
‡5($'<7286(
‡³%21$´
Shf
Pk
Unit
LUNDMARK WAX CO.
7,+6
674-6408X
)
32
($
*
128
2
($
8VH HYHU\ PRQWKV WR NHHS
ÀRRUVIUHVKDQGORRNLQJWKHLUEHVW
$ GXUDEOH XUHWKDQH DFU\OLF EOHQG
ZLWK H[FHSWLRQDOO\ IDVW GU\ WLPH
DQG QR ZD[\ EXLOGXS $GGV SURWHFWLYH QHZ OD\HU DQG
¿OOV LQ PLFURVFUDWFKHV HYHQLQJ RXW WKH DSSHDUDQFH RI
\RXUÀRRU
Our No.
Size
Oz
No.
Shf
Pk
Unit
High Gloss
515-6856
ACRYLIC FLOOR WAX
‡6(/)32/,6+,1*683(5
*/266
‡6(/)32/,6+,1*
Size
Oz
:3
8
($
WOOD FLOOR CARE
+DUG ¿QLVK DFU\OLF ZD[ LV VDIH IRU
XVH RQ DOO ÀRRULQJ %ODFNPDUN UH
VLVWDQWVFXIISURRIDQGDQWLVOLS
No.
Shf
Pk
Unit
969-7699X
7,+
)
32
($
771-4686X
7,.6
*
128
2
($
:DWHUOHVV QR EXII ZD[ IRUPXOD
OLIWV DZD\ GLUW DQG KHHO PDUNV RQ
VHDOHG ZRRG ÀRRUV DQG OHDYHV D
ULFKVDWLQ¿QLVK1REXLOGXSHDFK
FRDWGLVVROYHVWKHROGRQH,WFDQDOVREHXVHGRQVHDOHG
FRUNÀRRUV
Our No.
ACRYLIC FLOOR WAX
607-3290
‡6(/)32/,6+,1*+,*+
*/266
2QFH D \HDU ÀRRU FRQGLWLRQLQJ
'HWHUJHQW UHVLVWDQW VFXIÀHVV 'X
UDEOH
Size
Oz
,+6
*
128
Our No.
No.
Size
Shf
Pk
Unit
BEAUMONT PRODUCTS INC
658-4395
2]
($
516-1096
*DO
4
($
FLOOR WAX
No.
00125
Our No.
Shf
Pk
2
Size
Oz
No.
Shf
Pk
Unit
RECKITT BENCKISER
638-1636
32
($
ACRYLIC FLOOR WAX
3OHGJHZLWK)XWXUHVKLQH3URYLGHV
WRXJK DFU\OLF SURWHFWLRQ IRU QR
ZD[ ÀRRUV 0DNHV FOHDQLQJ HDVLHU
E\ SUHYHQWLQJ GLUW IURP JHWWLQJ
WUDSSHG LQ ÀRRU JURRYHV 5HVWRUHV
VKLQHWRROGHUÀRRUV
Size
Oz
Shf
Pk
Unit
22
($
634-5193
No.
Size
Oz
Shf
Pk
Unit
11182
($
FLOOR SEALER
FINISHES
‡,1'225287'225
‡6721(7,/(
‡³75(:$;´
2QHVWHS EHDXW\ WUHDWPHQW IRU LQ
WHULRUH[WHULRU VWRQH DQG PDVRQU\
VXUIDFHV 3URYLGHV H[FHOOHQW SURWHFWLRQ DQG GXUDELOLW\
'HWHUJHQWVFXIIDQGVWDLQUHVLVWDQW
Our No.
No.
Size
Shf
Pk
Unit
BEAUMONT PRODUCTS INC
Unit
LUNDMARK WAX CO.
646-8078X
)RU YLQ\O UXEEHU OLQROHXP DQG
VHDOHG ZRRG ÀRRUV 6HDOV ÀRRUV
SURYLGLQJ D EULOOLDQW JORVV GXUDEOH
SURWHFWLRQDQGZHDU
SC JOHNSON
SC JOHNSON
No.
($
‡+,*+*/266
‡³75(:$;*2/'/$%(/´
Our No.
‡12%8)):$;
‡³21(67(3´
LUNDMARK WAX CO.
Our No.
4
‡³)8785(´
BONAKEMI USA, INC
Our No.
1
/HDYHVDKLJKJORVVGXUDEOHVKLQH
RQERWKUHJXODUDQGQRZD[ÀRRUV
&OHDQV DQG VKLQHV DV \RX GDPS
PRS
FLOOR POLISH
*RRGIRUDOOW\SHVRIÀRRULQJ'ULHV
LQDKLJKJORVVLVZDWHUSURRIDQG
DQWLVOLS5HVLVWVEODFNUXEEHUKHHOPDUNV
892-9713X
‡/,48,'
‡³023*/2´
‡6(/)32/,6+,1*+,*+
*/266
‡$//:$;
‡³$//:$;´
Size
Oz
658-4569
Unit
FLOOR FINISHES
No.
Unit
TECH ENTERPRISES INC.
059-4283X
Our No.
Shf
Pk
FLOOR SEALER WAX
7HFK :RRG /DPLQDWH )ORRU
&OHDQHU LV S+ EDODQFHG WR VDIHO\
FOHDQ SRO\XUHWKDQH FRDWHG ZRRG
ÀRRUV6SUD\RQ\RXUÀRRUDQGPRS
ZLWKDQ\PLFUR¿EHUPRSOHWGU\$
XQLTXH GU\LQJ DJHQW HQVXUHV WKDW \RXU ZRRG ÀRRUV DUH
PRLVWXUHIUHH9HUVDWLOHPXOWLXVHFOHDQHUIRUGDLO\PDLQ
WHQDQFHDVZHOODVSHULRGLFWKRURXJKFOHDQLQJWRTXLFNO\
UHPRYHDEUDVLYHVRLOVDQGVDOWVWKDWFDQGDPDJHZRRG
ÀRRUV'ULHVTXLFNO\1RULQVLQJUHTXLUHG/HDYHVQRUHVL
GXHRUEXLOGXS%LRGHJUDGDEOHDQGSKRVSKDWHIUHH
FLOOR REJUVENATOR
Size
Gal
No.
BEAUMONT PRODUCTS INC
LUNDMARK WAX CO.
589-2393X
Our No.
637-3609
32
($
658-4536
1
4
($
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
Brooms, Mops & Trash Bags
WAX STRIPPER
Size
Oz
No.
‡+$5':22'
‡³60227+*/,'(´
Shf
Pk
Unit
BEAUMONT PRODUCTS INC
658-4387
32
‡&200(5&,$/675(1*7+
‡:(7/22.
‡³=(3´
FLOOR CARE SYSTEM
4XLFNO\ DQG HDVLO\ SHQHWUDWHV DQG
OLIWV DOO EUDQGV RI ÀRRU ¿QLVK IRU
HDV\ SLFN XS ZLWK D PRS RU ZHW
YDFXXP
Our No.
FLOOR FINISHES
FLOOR CARE - HOME
‡,167$17&21&(175$7(
‡³75(:$;´
($
6PRRWK*OLGH PLFUR¿EHU PRS DO
ORZV PRS WR HDVLO\ WUDS GXVW GLUW
DQGDOOHUJHQV,QFOXGHVR]0LQ
ZD[ KDUGZRRG DQG ODPLQDWH ÀRRU
FOHDQHUPRSZLWKPXOWLSLYRWKHDGZDVKDEOHPRSFRYHU
Our No.
Shf
Pk
No.
Unit
MINWAX CO INC
431-1387
‡&21&(175$7(
‡³75(:$;´
Size
Gal
Shf
Pk
Unit
1
4
($
Size
Oz
No.
Shf
Pk
338-0912
8VH HYHU\ PRQWKV WR NHHS
ÀRRUVIUHVKDQGORRNLQJWKHLUEHVW
$ GXUDEOH XUHWKDQH DFU\OLF EOHQG
ZLWK IDVW GU\ WLPH DQG QR ZD[\
EXLOGXS$GGVDKLJKJORVVSURWHF
WLYHOD\HUDQG¿OOVLQPLFURVFUDWFKHVHYHQLQJRXWWKHDS
SHDUDQFHRI\RXUÀRRU
Size
Oz
Shf
Pk
Unit
BONAKEMI USA, INC
:3
Unit
3
($
8
CLEANING PADS
No.
Size
In
Shf
Pk
Unit
Hangtag
221-7149
[
8
($
Floor Care & Floor Protection
FLOOR CARE - COMMERCIAL
6SHFLDOO\ IRUPXODWHG WR VDIHO\ OLIW
DZD\ GXVW JUHDVH DQG JULPH WR
UHYHDO \RXU ZRRG¶V QDWXUDO EHDX
W\ 7KHUH¶V QR PL[LQJ RU GLOXWLQJ
6TXLUWDQGPRS\RXUZRRGÀRRUVZLWKRXWOHDYLQJDGXOO
RUVWLFN\UHVLGXH
Size
Ozs.
No.
Size
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
838-7839
=8+7))
2]
4
($
895-3234
=8+7))*
*DO
1
($
%ODFNPDUNDEUDVLRQDQGVFXIIUH
VLVWDQW)RUXVHLQWUDGLWLRQDOKLJK
VSHHGDQGXOWUDKLJKVSHHGSURJUDPV8VHRQYLQ\OYLQ\O
DVEHVWRV DVSKDOW UXEEHU WLOH OLQROHXP WHUUD]]R DJ
JUHJDWH TXDUU\ WLOH EULFN FRQFUHWH VHDOHG ZRRG DQG
SDUTXHW :LWKVWDQGV UHSHDWHG VFUXEELQJ EXI¿QJ DQG
EXUQLVKLQJ
No.
Size
Shf
Pk
Unit
LUNDMARK WAX CO.
‡648,57023
‡³0853+<´
Shf
Pk
Unit
12
($
DOT FOODS, INC. COLGATE PALMOLIVE
32
($
1
Our No.
OIL SOAP
1150
4
*DO
($
FLOOR CARE - HOME
611-3682
2]
=8:/))*
‡&200(5&,$/+,*+
62/,'6
‡+,*+3(5)250$1&(
‡³0$7&+/(66´
)RUKDUGZRRGDQGODPLQDWHÀRRUV
XVHZHWRUGU\7UDSVGLUWGXVWDQG
DOOHUJHQV 0DFKLQH ZDVKDEOH ,Q
FOXGHVFOHDQLQJSDG
Our No.
($
Chemicals,Cleaners & Cleaning
Implements
No.
=8:/))
819-1967
FLOOR FINISHES
‡0,&52),%(5
‡³60227+*/,'(´
MINWAX CO INC
Our No.
781-8206
Our No.
‡+$5'685)$&(
743-3717
Unit
ACUITY SPECIALTY PRODUCTS
'XUDEOHPLQLPDOPDLQWHQDQFH¿Q
LVK IRU KLJK WUDI¿F DUHDV (DV\ WR
DSSO\ UHVLVWV VFXI¿QJ 0HHWV VOLS
UHVLVWDQFHVWDQGDUGV
5HPRYHV GXVW GLUW JULPH DQG DO
OHUJHQV/HDYHVQRVWUHDNVRUGXOO
LQJUHVLGXH1RPL[LQJQHHGHG
MINWAX CO INC
FLOOR REFRESHER
No.
Shf
Pk
‡352)(66,21$/675(1*7+
‡+,*+75$)),&
‡³=(3´
‡+$5':22'5(),//
‡³0,1:$;´
Our No.
Our No.
Size
($
FLOOR CLEANER
BEAUMONT PRODUCTS INC
633-3447
No.
FLOOR FINISHES
4XLFNO\ DQG HDVLO\ SHQHWUDWHV DQG
OLIWV DOO EUDQGV RI ÀRRU ¿QLVK IRU
HDV\ SLFN XS ZLWK D PRS RU ZHW
YDFXXP
No.
Our No.
Box
WAX STRIPPER
Our No.
+LJK JORVV ³ZHW ORRN´ ¿QLVK GH
VLJQHGIRU8+6%XUQLVKLQJ'XUDEOH
DQG VOLS UHVLVWDQW 5HVLVWV VFXIIV
DQGEODFNKHHOPDUNV
147-2067X
*
2]
4
($
519-9948
*
*DO
1
3$,/
ACRYLIC FLOOR
FINISH
‡&200(5&,$/
‡85(7+$1()257,),('
‡³0$5.7+$1(,´
ACRYLIC TILE SEALER
‡&200(5&,$/
)RU KLJK VSHHG EXUQLVKLQJ $ KLJK
VROLGV DFU\OLF ÀRRU ¿QLVK ZLWK D
ZDWHU ERUQH XUHWKDQH &DQ EH DSSOLHG LQ RI¿FH EXLOG
LQJV VFKRROV FKXUFKHV ZDUHKRXVHV VKRSSLQJ PDOOV
KRVSLWDOVDQGUHVWDXUDQWV&DQEHXVHGRQUHVLGHQWW\SH
ÀRRUV TXDUU\ WLOH WHUUD]]R FRQFUHWH VHDOHG ZRRG DQG
FRUNDQGQHDUO\DQ\RWKHUW\SHRIÀRRU
Our No.
No.
Size
Shf
Pk
Unit
LUNDMARK WAX CO.
:DWHU HPXOVLRQ UHVLQ VHDOHU )RU
PXODWHGWR¿OODQGVHDOWKHQDWXUDO
SRURVLW\ RI FHUWDLQ W\SHV RI ÀRRU
LQJ /LQROHXP DVSKDOW WLOH YLQ\O
DVEHVWRV FRUN WLOH WHUUD]]R DQG
YLQ\OWLOH3URYLGHVDVPRRWKKDUGGXUDEOHVXUIDFHXSRQ
ZKLFK WR DSSO\ ¿QLVK FRDWV RI YHU\ KLJK TXDOLW\ ZDWHU
HPXOVLRQZD[RUUHVLQ
Our No.
No.
Size
Shf
Pk
Unit
LUNDMARK WAX CO.
768-2420X
*
2]
4
($
983-2700X
2]
($
*
*DO
1
*
4
680-9362
3$,/
236-3307
3280G05
*DO
1
3$,/
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - Floor Care & Floor Protection
SPRAY BUFF
COMPOUND
‡&200(5&,$//2:63(('
‡&21&(175$7('
PASTE WAX
&OHDQVDZD\EODFNKHHOPDUNVGLUW
DQG JULPH 5HVWRUHV VXUIDFH ¿OP
DQG HQKDQFHV WKH QDWXUDO VKLQH
$SSO\ZLWKVSUD\GHYLFHVDQGEXIIHGRXWZLWKVWDQGDUGRU
ORZVSHHGPDFKLQHV
)RU DOO ZRRG ¿QH IXUQLWXUH DQG
PDUEOH &RYHUV DSSUR[LPDWHO\ VTXDUHIHHWR]FDQ
Our No.
No.
7,.6
$OOSXUSRVH ZD[ GHVLJQHG IRU XVH
RYHU ZRRG ¿QLVK 5HFRPPHQGHG
IRU LQLWLDO ZD[LQJ 3URYLGHV SURWHF
WLRQDQGDGHHSKDQGUXEEHGOXV
WUH &OHDQV SROLVKHV DQG SURWHFWV
ÀRRUVIXUQLWXUHDQGZRRGZRUN/EFDQ
‡³75(:$;´
Size
Oz
Shf
Pk
128
4
Unit
LUNDMARK WAX CO.
893-5322X
WOOD PASTE
FINISHING WAX
PASTE WAXES
Our No.
No.
Finish
Our No.
Unit
MINWAX CO INC
699-5906
($
Unit
Regular for Light Surfaces
BEAUMONT PRODUCTS INC
*
Shf
Pk
No.
Shf
Pk
658-4064
&OHDU
12
($
658-4106
Mahogany
12
($
($
Special for Dark Surfaces
699-5922
($
FLOOR STRIPPER
‡352)(66,21$/675(1*7+
‡+($9<'87<
&21&(175$7('
‡³=(3´
PASTE WAX
(FRQRPLFDO FRQFHQWUDWHG ÀRRU
VWULSSHUZLWKQRDPPRQLDRUSKRV
SKDWHV(IIHFWLYHDQGULQVHVHDVLO\
Our No.
No.
Size
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
=8
2]
4
($
784-7288
=8*
*DO
1
($
799-9667X
5HPRYHVZD[HVVW\UHQHVDFU\OLFV
PHWDO FURVVOLQNHG DQG XUHWKDQH
IRUWL¿HG ¿QLVKHV %LRGHJUDGDEOH
DQGQRQSKRVSKDWH1RQDPPRQLDWHG
Size
Shf
Pk
Unit
LUNDMARK WAX CO.
*
2]
4
($
3
&OHDU
($
Shf
Pk
No.
Unit
SC JOHNSON
00203
Size
Oz
128
Our No.
4
Unit
($
Our No.
Size
Oz
No.
Shf
Pk
Unit
HOWARD PRODUCTS
643-5598
&6
8
($
Floor Care & Floor Protection
FLOOR CLEANERS
‡+,*+63(('0$&+,1(6
‡³683(5621,&´
8VH WR UHPRYH VFUDWFKHV VFXIIV
DQG EODFN KHHO PDUNV &RQWDLQV
acrylic polymer to revive and en
KDQFH JORVV $SSO\ ZLWK VSUD\ GHYLFHV DQG EXIIHG RXW
ZLWKVWDQGDUGRUKLJKVSHHGPDFKLQHV
:D[HV DQG FOHDQV ZDOO SDQHOLQJ
ZRRGZRUN DQG FDELQHWV 0DGH
ZLWK SXUH FDUQDXED ZD[ 6OLS UH
VLVWDQW
Shf
Pk
([FHOOHQW IRU UHMXYHQDWLQJ DQG
SURWHFWLQJ WKH ¿QLVK RQ DQWLTXHV
IXUQLWXUH FDELQHWV SDQHOLQJ DQG
ZRRGÀRRUV,WHQKDQFHVWKHQDWX
UDO EHDXW\ RI WKH ZRRG JUDLQ DQG EXIIV WR D EULOOLDQW
ORQJODVWLQJVKLQH%UD]LOLDQ&DUQDXEDZD[SURYLGHVVX
SHULRUSURWHFWLRQIRU\RXUZRRG,GHDOIRUSULPLWLYHSLQHV
DQG RWKHU XQ¿QLVKHG ZRRGV ZKHUH DQ HDV\ DSSOLFDWLRQ
DQGDEHDXWLIXOQDWXUDOORRNLQJ¿QLVKDUHGHVLUHG,WGLV
WULEXWHVWKHFRORUHYHQO\LQWRWKHZRRGKLJKOLJKWLQJWKH
ZRRGJUDLQ
($
‡/,48,'+($9<'87<
ACUITY SPECIALTY PRODUCTS
=8)6/5
,+
PASTE WAX
6OLS DQG VWDLQ UHVLVWDQW ZDWHU
HPXOVLRQVHDOHU*LYHVÀRRUVDFOHDU
JORVVDQGVHDOHU FRDWLQJHOLPLQDW
LQJÀRRULPSHUIHFWLRQV
004-9551
Unit
SPRAY BUFF
COMPOUND
‡67$,15(6,67$17
‡352)(66,21$/675(1*7+
‡³=(3´
No.
Our No.
937-1766
FLOOR SEALER
Our No.
Shf
Pk
Finish
'HHS FOHDQV PDQ\ VXUIDFHV VXFK
DVVHDOHGZRRGYLQ\OFRUNPHWDO
OHDWKHU DQG SODVWLF %OHQG RI KDUG
¿QLVKZD[HVSURGXFHVDULFKVDWLQ\
OXVWHU3URYLGHVODVWLQJEHDXW\DQG
SURWHFWLRQ IRU DOO ZRRG VXUIDFHV
PHWDO OHDWKHU SODVWLF FRUN DQG YLQ\O +HOSV UHYLWDOL]H
DQWLTXHIXUQLWXUHDQGZRUQRUGDPDJHGZRRG/EFDQ
‡&200(5&,$/
‡&21&(175$7('
‡³683(5675,3´
030-9377X
No.
FURNITURE WAX
‡&,75866+,(/'
PASTE WAX
FLOOR STRIPPER
No.
Our No.
PASTE WAXES
LUNDMARK WAX CO.
340-3508
Our No.
Chemicals,Cleaners & Cleaning
Implements
:D[IRUWL¿HGZLWKDKDUGHQHU&DU
QDXEDZD[LQWXUSHQWLQH$QWLVOLS
3ROLVK IUHH RI VWUHDNV *UHDVHOHVV
+DUG ¿QLVK &RPEXVWLEOH PL[WXUH
/EFDQ
No.
Size
Oz
Shf
Pk
Unit
LUNDMARK WAX CO.
932-0268X
+
)
32
($
932-2355X
,
*
128
2
($
Our No.
No.
Size
Oz
Shf
Pk
128
4
Unit
LUNDMARK WAX CO.
161-6085X
,
*
($
FLOOR WAX REMOVER
‡+,*+32:(5
PASTE WAX
6WULSVZD[EXLOGXS)DVWDFWLQJ
‡&5<67$/&/($5
3URWHFWVDQGSROLVKHVZRRG1HW:W
R]OE
Our No.
Our No.
No.
Shf
Pk
Unit
OLD MASTERS
699-9395
4
($
No.
Size
Oz
Shf
Pk
Unit
LUNDMARK WAX CO.
776-6579X
,6
)
32
($
458-1849X
,6
*
128
2
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
WAX REMOVER
FLOOR CLEANER
)RU UHPRYLQJ SDVWH ZD[ RU OLTXLG
SDVWHZD[IURPDOOVXUIDFHVVXFKDV
ZRRG ÀRRUV OLQROHXP YLQ\O FRUN
WLOH ZRRG ZDOO SDQHOLQJ ZRRG
ZRUNFDELQHWVDSSOLDQFHVPDUEOH
VWRQHVODWHWHUUD]]RDQGIXUQLWXUH
'R QRW XVH RQ DVSKDOW RU UXEEHU WLOH 'RHV QRW FRQWDLQ
ZDWHURUZD[
Our No.
No.
Size
Oz
Shf
Pk
Unit
LUNDMARK WAX CO.
998-1655X
,+
)
32
Our No.
Size
Oz
No.
Shf
Pk Unit
Scent
ACUITY SPECIALTY PRODUCTS
144-1229
128
=8+/)
4
)UHVK6FHQW
($
=8+/)
32
Shf
Pk
12
)UHVK6FHQW
($
Unit
12
3/
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
711-9282
32 Oz
Size
Oz
=81(87
128
4
($
12305
24
Our No.
Our No.
Size
Oz
No.
Unit
LUNDMARK WAX CO.
065-8211X
,+6
)
32
($
,
*
128
2
($
Shf
Pk
Unit
BONAKEMI USA, INC
Size
Oz
No.
:3
8
($
‡2,/%$6('
Shf
Pk
Unit
)RU GXVWLQJ DQG FOHDQLQJ ÀRRUV
8VH RQO\ D WUHDWHG PRS DQG GXVW
ÀRRUVLQWKHXVXDOPDQQHU'RQRW
DSSO\WRWKHÀRRU
LUNDMARK WAX CO.
962-4602X
($
DUST MOP TREATMENT
'HVLJQHG WR FOHDQ ZD[HG ÀRRUV
6DIH WR XVH RQ DOO ÀRRULQJ 'RHV
QRW UHPRYH ZD[ QR GXOOLQJ ¿OP
DQGHQYLURQPHQWDOO\VDIH
Shf
Pk
Unit
8VH HYHU\ PRQWKV WR NHHS
ÀRRUVIUHVKDQGORRNLQJWKHLUEHVW
$ GXUDEOH XUHWKDQH DFU\OLF EOHQG
ZLWK H[FHSWLRQDOO\ IDVW GU\ WLPH
DQG QR ZD[\ EXLOGXS $GGV SURWHFWLYH QHZ OD\HU DQG
¿OOV LQ PLFURVFUDWFKHV HYHQLQJ RXW WKH DSSHDUDQFH RI
\RXUÀRRU
003-1799
‡$//685)$&(
&21&(175$7(
&OHDQVDQGOLJKWO\ZD[HV&DUQDXED
ZD[ LQ WXUSHQWLQH )RU FOHDQLQJ
SDVWH ZD[ ¿QLVKHG ÀRRUV )UHVKHQ
XS DQG SROLVKHV WKH VXUIDFH DV LW
FOHDQV)RUDOOZRRGOLQROHXPFRUN
DQGYLQ\ODQGZRRGSDQHOLQJ3UH
YHQWVVSOLWWLQJDQGFUDFNLQJ6OLSUHVLVWDQW
Size
Oz
Shf
Pk
Low Gloss
WOOD FLOOR CLEANER
No.
161-8875
($
FLOOR CLEANER
Our No.
Size
Oz
No.
‡5($'<7286(
‡³%21$´
/RZIRDPJHQHUDOSXUSRVHFOHDQHU
IRUPRVWÀRRULQJ5LQVHVHDVLO\DQG
¿OPIUHH*UHDWRQPDUEOHJUDQLWH
DQGVWRQHÀRRUV
No.
Our No.
FLOOR POLISH
‡1(875$/&21&(175$7('
‡352)(66,21$/675(1*7+
‡³=(3´
Our No.
)RU DOO ÀRRU W\SHV ODPLQDWHV
VHDOHG KDUGZRRG WLOH DQG OLQR
OHXP $ TXLFN VSUD\ DQG PRS UHVWRUHV FOHDQOLQHVV ZLWK
D IUHVK ZRRGV\ VFHQW 7ULJJHU 6SUD\ 6SDUNOLQJ 6SUXFH
6FHQW
SUNSHINE MAKERS
FLOOR CLEANER
EARTH FRIENDLY PRODUCTS
428-9625
*HQWO\ FOHDQV KDUGZRRG ODPLQDWH
DQG RWKHU QDWXUDO ÀRRULQJ OHDYLQJ
QR VWLFN\ UHVLGXH 0LOG GHWHUJHQW
IRUPXODWLRQ
758-1176
6DIHO\ FOHDQ VHQVLWLYH KDUGZRRG
DQG ODPLQDWH ÀRRULQJ ZLWK WKLV
OHPRQ RLO DQG YLQHJDU QHXWUDO S+
IRUPXODWLRQ (DVLO\ UHPRYHV GLUW
JUHDVHDQGVFXIIPDUNV0DGHZLWK
RQO\ VXVWDLQDEOH SODQWEDVHG LQJUHGLHQWV 'RHV
QRW FRQWDLQ G\HV RU V\QWKHWLF SHUIXPHV JUH\ZDWHU DQG
VHSWLFVDIH
No.
‡5($'<7286(
‡³6,03/(*5((1
1$785$/6´
Trigger Spray
($
HARDWOOD FLOOR
CLEANER
Our No.
FLOOR CLEANER
‡+$5':22'/$0,1$7(
‡³=(3´
381-1189X
,.6
)
32
($
311-6472X
*
128
2
Our No.
,+6
($
LUNDMARK WAX CO.
545-3550X
No.
,.6
*
Size
Oz
Shf
Pk
128
4
Unit
($
FLOOR CLEANER
WOOD FLOOR CLEANER
‡&21&(175$7(
‡³32/<&/($1´
)RUPXODWHG IRU FOHDQLQJ RQ DOO
SRO\XUHWKDQH WUHDWHG ZRRG ÀRRUV
5HVWRUHV RULJLQDO EHDXW\ /HDYHV
ÀRRUVVSDUNOLQJFOHDQ&OHDQVWKRU
RXJKO\&RQWDLQVQRKDUVKVROYHQWV
Our No.
No.
Size
Oz
Shf
Pk
Unit
LUNDMARK WAX CO.
‡1(875$/*(1(5$/
385326(
‡³35()(55('´
FLOOR CLEANER
3HQHWUDWHV GLUW DQG JULPH DQG
KROGV WKHP LQ VXVSHQVLRQ /HDYHV
QR KDUG ZDWHU ¿OP RU VRDS VFXP
5HVWRUHV RULJLQDO JORVV 8VHG RQ DOO VXUIDFHV DVSKDOW
WLOHYLQ\OUXEEHUOLQROHXPWHUUD]]RFRPSRVLWLRQVÀRRUV
VHDOHGZRRGPDUEOHORFNHUVVWHHO¿OHVDXWRXSKROVWHU\
DQGRWKHUVXUIDFHQRWKDUPHGE\ZDWHU
'HVLJQHG WR UHPRYH GLUW DQG
JUHDVH1RGXOOLQJUHVLGXH6ROYHQW
IUHH PLQLPL]HV ZDWHU FRQWDFW )RU
XQZD[HG ¿QLVKHV WKDW DUH FRDWHG
ZLWKDFOHDU¿QLVK
Our No.
No.
Size
‡+$5':22'
Shf
Pk
No.
Size
Oz
Shf
Pk
Unit
MINWAX CO INC
Unit
LUNDMARK WAX CO.
186-2465X
,+6
)
32
($
198-2529X
*
2]
4
($
577-8964X
,
*
128
2
($
464-9190
*
*DO
1
3$,/
7,6
Our No.
619-4468
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
32
48$57
Maintenance, Repair & Operations - FLOOR CLEANER
FLOOR CLEANER
‡+$5':22'
‡³6:(',6+)2508/$´
$Q HIIHFWLYH QRQWR[LF DQG ELRGH
JUDGDEOHIRUPXODOHDYHVQRUHVLGXH
DQG LV IRU DOO W\SHV RI UHVLGHQWLDO
KDUGZRRGÀRRUV6SHFLDOO\GHVLJQHGWREHVDIHIRUÀRRUV
IDPLOLHVDQGWKHHQYLURQPHQW
Our No.
No.
Size
Shf
Pk
Unit
BONAKEMI USA, INC
:0
4
2]
:0
8
2]
($
No.
Size
Shf
Pk
Unit
BONAKEMI USA, INC
5H¿OO
984-1990
:0
4
($
8
($
($
4XDUW
($
Size
Oz
Size
Oz
No.
Shf
Pk
32
Unit
Unit
($
Size
Oz
Shf
Pk
Unit
11
‡)253$1(/,1*
‡+$5'685)$&(
‡³)/2250$7(´
5HQHZV RULJLQDO EHDXW\ RI ZRRG
SDQHOLQJ
IXUQLWXUHZRRGZRUN
+LGHV VFUDWFKHVVFXIIV 1RXULVKHV
ZRRGZLWKQDWXUDORLOV+HUEDOIUD
JUDQFH$HURVRO
)RUPXODWHG IRU FOHDQLQJ DOO VHDOHG
KDUG ÀRRUV 5HPRYHV WRXJK VRLO
VSRWVDQGVWDLQV&OHDQVDQGVKLQHV
ZLWK QR GXOOLQJ UHVLGXH 8VH RQ
DQ\KDUGVXUIDFHZLWKRXWFKDQJLQJVROXWLRQV6DIHIRUDOO
KDUGÀRRUFOHDQLQJPDFKLQHV
No.
$+
48
Shf
Pk
Unit
4
12
($
Shf
Pk
Unit
WOOD CLEANER/
PRESERVATIVE
No.
Scent
638-3210
10014
$OPRQG
12
($
641-0864
11014
/HPRQ
12
($
BUTCHER BLOCK OIL
+RZDUG%XWFKHU%ORFNDQG&XWWLQJ
%RDUG2LOFRQWDLQVIRRGJUDGHPLQ
HUDO RLO VWDELOL]HG ZLWK 9LWDPLQ (
0HHWV )'$ UHTXLUHPHQWV IRU IRRG
FRQWDFW VXUIDFHV DQG LV VDIH IRU
DOO IRRG SUHSDUDWLRQ VXUIDFHV ,W LV
WDVWHOHVVDQGZLOOQHYHUJRUDQFLG7KLVSURGXFWLVSHUIHFW
IRUVHDVRQLQJFXWWLQJERDUGVEXWFKHUEORFNVDQGZRRGHQ
XWHQVLOV0HHWVDOOUHTXLUHPHQWVIRU863/LJKW0LQHUDO2LO
1DWLRQDO )RUPXODU\ 1) )'$ &)5 DQG &)5 D IRU GLUHFW DQG LQGLUHFW FRQWDFW ZLWK
IRRG
Our No.
12
($
590-7092
Shf
Pk
No.
Unit
%%%
($
WOOD POLISHING
CLOTHS
Our No.
No.
Size
Oz
‡³/,48,'*2/'´
Shf
Pk
Unit
&$1
MAGIC AMERICAN
243-2623
30
)RU XVH RQ ZRRG YLQ\O DQG OHDWK
HU 5HPRYHV GXVW ¿QJHUSULQWV
VPXGJHV 3UH0RLVWHQHG (QKDQF
HVZRRG¶VULFKQHVV/HDYHVQRRLO\
RUGXOOLQJUHVLGXH*UHDWIRUXVHEHWZHHQDSSOLFDWLRQVRI
OLTXLGJROGZRRGFOHDQHUDQGSUHVHUYDWLYH&DQLVWHU
Our No.
No.
Count
Shf
Pk
Unit
SCOTTS LIQUID GOLD
641-4882
HOOVER CO
433-8331
($
WOOD CLEANERS
Our No.
HOWARD PRODUCTS
GUARDSMAN
682-1516
No.
FLOOR CLEANER
Size
Oz
638-3228
SCOTTS LIQUID GOLD
&DQ EH XVHG RQ DOO XQZD[HG LQ
WHULRU ZRRG VXUIDFHV LQ WKH KRPH
WKDWDUHFRDWHGZLWKDFOHDU¿QLVK
&OHDQV FDELQHWV IXUQLWXUH GRRUV
DQG RWKHU ZRRG VXUIDFHV &RYHU
DJH VTXDUH IHHW SHU TXDUW
0LQZD[ ZRRG FOHDQHU LV 127 IRU XVH RQ ZD[HG RLOHG
RUXQ¿QLVKHGZRRGRUZRRG¿QLVKHGZLWKVKHOODF7ULJ
JHU6SUD\
Our No.
BEAUMONT PRODUCTS INC
32
Unit
SCOTTS LIQUID GOLD
Our No.
WOOD CLEANERS
6DIHO\ DQG HDVLO\ UHPRYHV ROG
ZD[SROLVKDQGPDQ\RWKHUVWDLQV
2]RQHVDIH
Shf
Pk
Shf
Pk
)RU FDELQHWV SDQHOLQJ DQG ZRRG
ÀRRUVRXQFHDHURVRO
WOOD CLEANERS
*UHDWIRUQRZD[ÀRRUVYLQ\OZRRG
ODPLQDWH PDUEOH WHUUD]]R DQG
SDYHUV/HDYHVVXUIDFHVEULJKWDQG
VKLQLQJHYHU\WLPH\RXFOHDQ
2]
00100
940-7123
2]
‡1(875$/&21&(175$7(
‡³75(:$;´
686-0647X
00104
627-0227X
MINWAX CO INC
FLOOR CLEANER
No.
Size
Oz
Unit
977-8036X
Our No.
2]
Spray
Our No.
No.
WOOD CLEANERS
(DV\ VDIH DQG HIIHFWLYH FOHDQHU
IRU VHDOHG KDUG VXUIDFH ÀRRUV LQ
FOXGLQJ OLQROHXP VWRQH WHUUD]]R
YLQ\O VHDOHG SRURXV PDUEOH ODPL
QDWH VXFK DV 3HUJR DQG QRZD[ VHDOHG WLOH FHUDPLF
0H[LFDQ 6DOWLOOR TXDUU\ :DWHUERUQH QRQWR[LF DQG
OHDYHVQRGXOOLQJUHVLGXH
:0
Shf
Pk
Chemicals,Cleaners & Cleaning
Implements
‡+$5'685)$&(
‡³6:(',6+)2508/$´
913-0386
Size
Our No.
‡³/,48,'*2/'´
FLOOR CLEANER
Our No.
No.
)RU FDELQHWV SDQHOLQJ DQG ZRRG
ÀRRUV 2ULJLQDO DOPRQG IUDJUDQFH
3RXUDEOH
MAGIC AMERICAN
($
Spray
537-6801
‡³/,48,'*2/'´
For interior and exterior stone
ÀRRUV DQG LQVWDOODWLRQ FOHDQ XS
&DQEHXVHGLQDQDXWRPDWLFVFUXE
EHUSUHVVXUHZDVKHURUXVHGZLWK
DVSRQJHRUPRS6WUHDNIUHHIRUPXOD:LOOQRWGXOOHWFK
FRUURGHRUVFUDWFKVWRQHWH[WXUH6DIHO\FOHDQVDOOSRURXV
VWRQHVXUIDFHVZLWKRXWKDUPLQJWKHVWRQH8/&ODVVL¿HG
IRUVOLSUHVLVWDQFH1RULQVLQJUHTXLUHG
Our No.
5H¿OO
156-5035
WOOD CLEANER/
PRESERVATIVE
‡&21&(175$7('
‡³0$5%$/(;´
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
::3
20
($
100 - Maintenance, Repair & Operations
WOOD WASH
FURNITURE POLISH
FURNITURE POLISH
‡&21&(175$7(
‡,1&/($132/,6+
‡³25$1*(*/2´
‡',6326$%/(:,3(6
‡³2/'(1*/,*+´
&OHDQV DQG VKLQHV ZRRG ¿QLVKHV
throughout your home in one easy
VWHS &RQWDLQV SXUH YDOHQFLD RU
DQJH RLO WR UHYLYH \RXU ZRRG UH
VWRUHLWVOXVWHUDQGUHPRYHGLUWJUHDVHDQGZD[EXLOGXS
$OVRJUHDWRQVWDLQOHVVVWHHOFHUDPLFWLOHDQG¿EHUJODVV
WR UHPRYH JUHDVH VRDS ¿OP JXP DQG VWLFNHUV )UHVK
RUDQJHVFHQW7ULJJHU6SUD\
5HPRYHVGXVWDQGVPXGJHPDUNV
FRQGLWLRQV ZRRG DQG KHOS SURWHFW
IXUQLWXUH IURP ZDWHU GDPDJH 8VH
WR QXUWXUH WKH QDWXUDO OXVWHU RI
ZRRG IXUQLWXUH :LSH DQG WRVV OHDYLQJ IXUQLWXUH ZLWK D
KHDOWK\ORRNLQJVKLQH8VHRQZDOOXQLWVIXUQLWXUHNLWFKHQ
FDELQHWVOHDWKHUPDUEOHSDLQWHGZRRGSODVWLFFKURPH
EUDVV VWDLQOHVV VWHHO DQG YLQ\O 3UHPRLVWHQHG ZLSHV
ZLWK1DWXUDO/HPRQ2LO´[´VKHHWVL]H
)RUFOHDQLQJODUJHVXUIDFHV&OHDQV
GLUWJUHDVHDQGJULPHZLWKRXWGXOO
LQJ UHVLGXH 8VH RQ ZRRG VLPX
ODWHGZRRGSDLQWHGVXUIDFHVOLQR
OHXP WLOH SRUFHODLQ YLQ\O FKURPH
EUDVVDQG¿EHUJODVV)UHVKIUDJUDQFH
Our No.
Size
Oz
No.
Shf
Pk
Unit
SCOTTS LIQUID GOLD
210-0931
::$
25
($
Our No.
No.
Size
Oz
Shf
Pk
Unit
CHURCH & DWIGHT
831-4098
($
WOOD WASH
Our No.
No.
Count
Shf
Pk
Unit
25
12
($
RECKITT BENCKISER
137-4479
‡5($'<7286(
FURNITURE POLISH
&OHDQV JUHDVH DQG JULPH ZLWKRXW
GXOOLQJUHVLGXH
Our No.
Size
Oz
No.
‡12:$;)2508/$
‡³6:,))(5'8676+,1(´
Shf
Pk
Unit
SCOTTS LIQUID GOLD
655-8878
::$
24
($
WATER RING & MARK
REMOVER
Our No.
Shf
Pk
No.
Scent
Shf
Pk
Unit
255-0853X
&LWUXV
($
682-7836X
/DYHQGHU
($
459-8835X
Tropical
($
FURNITURE POLISH
405512
12
‡1$785$/2,/
‡³2/'(1*/,6+´
($
5H¿QHGQDWXUDORLOIRU¿QHIXUQLWXUH
DQGZRRGZRUN0RLVWXUL]HVWRJLYH
IXUQLWXUH D ULFK GHHS JORZ &OHDQV
DQGSUHVHUYHVZRRG3URWHFWVZLWK
RXWEXLOGXSDQGUHVWRUHVQDWXUDORLOV0D\DOVREHXVHG
RQÀRRUVWRFOHDQDQGJLYHEHDXW\DQGOXVWHU/HPRQ2LO
Chemicals,Cleaners & Cleaning
Implements
FURNITURE POLISH
FURNITURE
PROTECTOR
Our No.
No.
Size
Oz
Shf
Pk
Unit
‡$/021'/8675(
RECKITT BENCKISER
&OHDQVVKLQHVQRXULVKHVDQGSUR
WHFWVZRRGIXUQLWXUH$HURVRO
690-6424
8
12
($
604-7260
($
Our No.
No.
Size
Oz
Shf
Pk
650-1480
30000000
FURNITURE POLISH
Our No.
+RZDUG )HHG1:D[ LV D VSHFLDO
EOHQG RI EHHVZD[ DQG RUDQJH RLO
WKDW HQKDQFHV WKH QDWXUDO EHDXW\
DQGGHSWKRIJUDLQLQ¿QLVKHGDQG
XQ¿QLVKHGZRRGHVSHFLDOO\RDN,WKHOSVSUHYHQWGU\LQJ
DQG GHWHULRUDWLRQ RI DOO ZRRG ¿QLVKHV DQG SROLVKHV DOO
ZRRGVXUIDFHVWRDVRIWOXVWHU
Size
Oz
Shf
Pk
Our No.
):
Size
Oz
Shf
Pk
Unit
HOWARD PRODUCTS
643-5572
256
($
:D[IUHH EOHQG RI QDWXUDO DQG RU
JDQLFRLOVPHOWHGZLWKJHQWOHFOHDQ
LQJDJHQWV3URGXFHVDQDWXUDODQG
EULOOLDQW VKLQH 2]RQHVDIH RXQFHDHURVRO
Our No.
No.
Scent
Shf
Pk
Unit
GUARDSMAN
682-1326
:RRG
12
($
697-8530
/HPRQ
12
($
FURNITURE POLISH
No.
Wood
Type
Our No.
No.
Size
Oz
Shf
Pk
Unit
12
($
SC JOHNSON
Shf
Pk
649-0817
Unit
RECKITT BENCKISER
938-5758
'DUN
($
690-7919
/LJKW
($
Unit
HOWARD PRODUCTS
643-5531
No.
$HURVRO
+HOSV UHVWRUH GDPDJHG ZRRG VXU
IDFHV +LGHV XQVLJKWO\ VFUDWFKHV
DQG QLFNV 8VH RQ ZRRG IXUQLWXUH
SDQHOLQJDQGÀRRUVRXQFH
‡/,48,'
‡³)(('1:$;´
No.
+RZDUG2UDQJH2LOXVHVWKHFOHDQ
LQJ SRZHU RI UHDO RUDQJH RLO WR
EUHDNGRZQGLUWDQGZD[EXLOGXS
2QO\WKHIUHVKVFHQWRIRUDQJHVDQGDODVWLQJVKLQHUH
PDLQ RQ WKH ¿QLVK &RQWDLQV QR VLOLFRQH RU OLQVHHG RLO
6DIHVWZD\WRFOHDQDQGSROLVKDQWLTXHVIXUQLWXUHFDEL
QHWVDQGDOORWKHUZRRGVXUIDFHV7ULJJHU6SUD\
‡/,48,'6&5$7&+&29(5
‡³2/'(1*/,6+´
($
FURNITURE WAX
Our No.
‡25$1*(2,/
‡:,7+/(021:$;
‡³)$925´
Unit
MINWAX CO INC
FURNITURE
POLISH
FURNITURE POLISH
Unit
GUARDSMAN
883-2008
No.
PROCTER & GAMBLE
(OLPLQDWHV ZDWHU KHDW DQG RWKHU
PDUNVIURPZRRG¿QLVKHV
Our No.
3URYLGHVWKHULJKWOHYHORIFOHDQLQJ
DQG VKLQH 1R ZD[ IRUPXOD WKDW
OHDGVWROHVVVPHDU\UHVLGXH7UDSV
DOOHUJHQV IURP FDW GRJ DQG GXVW
PLWHV 0RUH VXVWDLQDEOH ZRRG FOHDQLQJ VROXWLRQ 1LWUR
JHQSURSHOODQWQDWXUDOLQJUHGLHQWPDNHVXSSHUFHQWRI
WKHDLUZHEUHDWKH1R&)&6,QDUHF\FODEOHDOXPLQXP
FDQRXQFH
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 101
FURNITURE POLISH
FURNITURE
TREATMENT
‡&200(5&,$/60($5
)5((
‡³3/('*(´
No.
Size
Oz
Shf
Pk
Unit
&RQWDLQVUHDOOHPRQRLO%ULQJVRXW
ZRRGV QDWXUDO OXVWUH DQG SHQH
WUDWHVUHSODFLQJQDWXUDORLOV+HOSV
SUHYHQW DEVRUSWLRQ RI PRLVWXUH ZKLFK FDQ FDXVH FUDFN
LQJVSOLWWLQJDQGGLVFRORUDWLRQ
20
12
($
Our No.
SC JOHNSON
696-3656
‡352)(66,21$/675(1*7+
‡³*22*21(´
‡/(0212,/
‡³)250%<¶6´
$HURVRO
Our No.
PROBLEM CLEANERS
Size
Oz
No.
Shf
Pk
Unit
1RXULVKHV DQG UHYLWDOL]HV WKH ¿Q
LVK %OHQG RI QDWXUDO DQG RUJDQLF
RLOVZLWKFOHDQLQJDJHQWV3URGXFHV
D QDWXUDO DQG EULOOLDQW VKLQH :D[
DQGVLOLFRQHIUHH7ULJJHU6SUD\
RXQFH
Our No.
No.
Unit
:RRG
12
($
Scent
Shf
Pk
Unit
:RRG
12
($
No.
‡³728*+-2%´
No.
Size
Shf
Pk
Unit
731-5831
7-53
3LQW
12
3,17
810-9308X
7-5*
1 Gallon
4
*$/
Shf
Pk
Unit
12
($
No.
Size
In
Shf
Pk
Unit
12
($
HOMAX CORPORATION
029-0379
[
EARTH FRIENDLY PRODUCTS
PROBLEM CLEANERS
32 Oz
796-7482
3/
‡&,758632:(5
‡³*22*21(35232:(5´
FURNITURE POLISH
‡³3/('*(´
3OHGJH /HPRQ &OHDQ FDQ EH XVHG
all around the house to clean leath
HU PDUEOH ZRRG VWDLQOHVV VWHHO
ODPLQDWH JUDQLWH DQG SODVWLF ,W
TXLFNO\FOHDQVFRQGLWLRQVDQGSUR
WHFWVZKLOHOHDYLQJEHKLQGWKDWIUHVKOHPRQ3OHGJHVFHQW
,WDOVRIHDWXUHV$OOHUJHQ7UDSSHUVWRUHPRYHXSWR
RIDOOHUJHQVLQGXVW
Our No.
No.
Size
Oz
Shf
Pk
Unit
12
($
8VHG IRU WRXJK WDVNV WDUJHWHG DW
',<DQGFRQWUDFWRU¶VMREFOHDQXS
UHPRYDORIFDXONDQGVLOLFRQHFRQ
WUDFWRU¶V DGKHVLYH JUHDVH DQG WDU
WDSHWDSHUHVLGXHYDUQLVKZD[DQGJOXH6DIHRQJODVV
PHWDOSODVWLFGRRUVZRRGDQGYLQ\OVXUIDFHV
Our No.
Size
Oz
No.
Shf
Pk
Unit
HOMAX CORPORATION
**3
*=
Our No.
5011484
24
Unit
($
($
($
Size
Oz
Shf
Pk
Unit
MAGIC AMERICAN
428-2836
12
**+6
($
STICKER REMOVER
‡³*22*21(´
5HPRYHVVWLFNHUVWDSHODEHOVGH
FDOVSULFHWDJVDQGJXP0XOWLXVH
WRROHDVLO\OLIWVWKHSUREOHPULJKWRII
WKHVXUIDFHFOHDQDQGVFUDWFKIUHH
No.
Size
Oz
Shf
Pk
Unit
2
12
($
MAGIC AMERICAN
660-4201
**6/
Floor Care & Floor Protection
KITCHEN & BATH CLEANERS
TILE/VINYL FLOOR
CLEANER
7HFK 7LOH 9LQ\O )ORRU &OHDQHU LV
S+EDODQFHGWRFOHDQYLQ\OFHUDPLF
WLOHDQGOLQROHXPÀRRUVTXLFNO\DQG
OHDYH\RXUÀRRUVFOHDQ7HFK7LOH
9LQ\O)ORRU&OHDQHUKDVDVSHFLDOO\
GHVLJQHG GU\LQJ DJHQW WKDW KHOSV ÀRRUV GU\ TXLFNO\ VR
\RXFDQUHVXPHQRUPDODFWLYLWLHVZLWKRXWZRUU\RIVOLS
SLQJRQZHWÀRRUV0L[FXSRIFOHDQHUZLWKJDOORQRI
ZDUPZDWHUDQGPRS\RXUÀRRUV
'RHVQRWFRQWDLQDQ\DJJUHVVLYHVROYHQWVRLOVRUKDUVK
FDXVWLFEXLOGHUV:KHWKHULWLVXVHGLQURXWLQHPRSSLQJ
PDFKLQH VFUXEELQJ RU LQ DQ DXWRPDWLF ÀRRU PDFKLQH
7HFK7LOH9LQ\O)ORRU&OHDQHUOHDYHV\RXUÀRRUVFOHDQ
DQG\RXUKRPHVPHOOLQJIUHVK
Our No.
No.
Size
Oz
Shf
Pk
Unit
TECH ENTERPRISES INC.
SC JOHNSON
867-2636
32
No.
Trigger Spray Gel
032-2024
Shf
Pk
6SUD\ JHO FOLQJV WR WKH VXUIDFH IRU
QRGULS QRPHVV FOHDQLQJ %H
FDXVH LW KROGV RQWR WKH VWDLQ LW
FOHDQVIDVWHUDQGPRUHHIIHFWLYHO\
7ULJJHU6SUD\
059-4267X
Pump Spray
048-1614
651-6868
Our No.
&ORWK UHPRYHU KDV PXOWLSOH XVHV
LQFOXGLQJ UHPRYLQJ KHDW PDUNV
ZDWHUPDUNV PDJLF PDUNHUV SHQV
DQG PLQRU VXUIDFH VFUDWFKHV IURP
YDUQLVK ODFTXHU DQG VKHOODF ZRRG
¿QLVKHV ,W DOVR UHPRYHV WDUQLVK DQG R[LGL]DWLRQ IURP
FRSSHUDQGEUDVV5HXVDEOHDQGODVWVXSWR\HDUV,Q
FOXGHVUHVHDODEOHEDJ'RHVQRWFRQWDLQVLOLFRQH1RWIRU
XVHRQLPLWDWLRQZRRGRUSRO\XUHWKDQH&DUGHG
Our No.
Size
Oz
‡635$<*(/
‡³*22*21(´
‡)851,785(&/27+
&OHDQV FRQGLWLRQV DQG SURWHFWV
ZLWK WKH QDWXUDO SRZHU RI RUDQJH
OHPRQ DQG ROLYH RLOV )RUPXODWHG
VSHFL¿FDOO\IRUUHDOZRRGVXUIDFHV
¿QLVKHG RU XQ¿QLVKHG 2OLYH 2LO
SHUPHDWHV ZRRG UHVWRULQJ ZRRG
WRKHDOWK\DQGQDWXUDOVWDWH0DGHZLWKRQO\VXV
WDLQDEOHSODQWEDVHGLQJUHGLHQWV'RHVQRWFRQWDLQG\HV
RUV\QWKHWLFSHUIXPHVQHXWUDOS+JUH\ZDWHUDQGVHSWLF
VDIH
No.
PROBLEM CLEANERS
WHITE RING REMOVER
FURNITURE POLISH
Our No.
3,17
D-MAND BETTER PRODUCTS,
GUARDSMAN
37
Our No.
%OHQG RI QDWXUDO DQG RUJDQLF RLOV
ZLWK FOHDQLQJ DJHQWV 3URGXFHV D
QDWXUDODQGEULOOLDQWVKLQH0DNHV
SLQWVRXQFH
682-1391
6DIHO\ UHPRYHV GULHG ODWH[ SDLQW
SOXV FUD\RQ FDQGOH ZD[ PDUNHU
JOXHDGKHVLYHVSDSHUODEHOVJUDI
IDWL FKHZLQJ JXP WDU JUHDVH
PDVWLF VRDS VFXP OLSVWLFN SLQH
VDSOLTXLGSDSHUVFXIIVNLGPDUNVDQGPRUH6DIHIRU
XVHRQPRVWVXUIDFHV
‡&21&(175$7('&5($0
No.
8
30115000
SPOT/STAIN REMOVER
Shf
Pk
FURNITURE POLISH
Our No.
30015000
616-2630
REMOVERS
GUARDSMAN
682-1458
611-2676
Chemicals,Cleaners & Cleaning
Implements
Scent
Our No.
MAGIC AMERICAN
MINWAX CO INC
FURNITURE POLISH
&LWUXVSRZHUHG VROXWLRQ IRU WRXJK
FOHDQLQJ SUREOHPV 'LVVROYHV GLI
¿FXOW PHVVHV OLNH WDU DGKHVLYHV
FKHZLQJJXPVKRHSROLVKFUD\RQ
JUHDVH PDNHXS VWDLQV ODEHOV PDVNLQJ WDSH UHVLGXH
SULFHVWLFNHUVDQGEXPSHUVWLFNHUV
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
6
32
($
102 - Maintenance, Repair & Operations
GROUT CLEANER
7HFK *URXW &OHDQHU LV D VDIH DQG
HDV\ZD\WRFOHDQGLUW\JURXW7KLV
QRQDFLGLFIRUPXODLVRGRUOHVVDQG
ELRGHJUDGDEOH VR LW LV VDIH
WR XVH DURXQG \RXU IDPLO\ DQG
SHWV6SUD\LWRQXVHWKHLQFOXGHG
EUXVKDQGPRSWRUHVWRUH\RXUJURXWWROLNHQHZ(DV\WR
XVH/HDYHVQRUHVLGXH2GRUOHVVDQGFRORUOHVV
Our No.
Size
In
No.
Shf
Pk
Unit
TECH ENTERPRISES INC.
059-4242X
KITCHEN/BATH
CLEANER
‡*(/:,7+%/($&+
‡³62)76&58%´
‡:,7+%/($&+
‡³&/252;&/($183´
)RUPXODWHG IRU FOHDQLQJ DQG UH
PRYLQJ JUHDVH JULPH DQG WRXJK
VWDLQV IURP FRXQWHUWRSV VLQNV
EDWKWXEVWLOHVVWRYHWRSVJODVVVKRZHUGRRUVDQGDSSOL
DQFHHQDPHO1RQ$EUDVLYH5LQVHVFOHDQ
&OHDQHU ZLWK EOHDFK &OHDQV DQG
GLVLQIHFWV KDUG QRQSRURXV VXUIDF
HV.LOOVRIKRXVHKROGJHUPV
LQVHFRQGV)UHVKIUDJUDQFH7ULJJHU6SUD\
Our No.
No.
Size
Oz
Shf
Pk
Unit
DIAL CORPORATION
32
6
KITCHEN/BATH
CLEANER
($
744-2437X
Chemicals,Cleaners & Cleaning
Implements
7RXJKVWDLQUHPRYHUZLWKDQWLEDF
WHULDO IRUPXOD 5HPRYHV JUHDV\
GLUW PROG PLOGHZ DQG VRDS VFXP .LOOV SHUFHQW
KRXVHKROG JHUPV OLNH 6DOPRQHOOD 8VH LW RQ WXEV DQG
WLOHVVLQNVDQGVWRYHWRSVWRLOHWVDQGFRXQWHUWRSV
Size
Oz
Shf
Pk
Unit
50331015
607-3308X
($
&OHDQ DQG SROLVK KDUG VXUIDFHV
VXFKDVJODVVVWRQHFKURPHDOX
PLQXP¿EHUJODVVDQGSDLQWHGVXUIDFHV(DVLO\UHPRYHV
VRDSVFXPVFXIIPDUNVZDWHUOLQHVWDLQVR[LGDWLRQDQG
PXFKPRUH)UHVKVFHQW7XE
Size
Oz
Shf
Pk
Unit
CHEMICAL TECHNOLOGIES I
786-3327X
Shf
Pk
Unit
12
($
Size
Oz
Shf
Pk
Unit
DIAL CORPORATION
056-1787X
No.
32
12
($
(YHQWKHGLUWLHVWVWDLQHGJURXWOLQHV
EHWZHHQWLOHFOHDQHDVLO\ZLWKFRP
ELQHGIRUFHVRIGLVLQIHFWDQWIRUPXOD
DQG VSHFLDO %UXVK µQ 6SRQJH FDS
)RDPV RQ WR EULJKWHQ FRORU UHPRYHV HYHQ VXEVXUIDFH
JULPHKDUGZDWHUVWDLQVPROGPLOGHZ6DIHRQDOOWLOH
SRUFHODLQ1RKDUVKDEUDVLYHVRUFDXVWLFDFLGVWRVFUDWFK
PDURUGXOO¿[WXUHV$HURVRO
Our No.
No.
Size
Shf
Pk
Unit
238-0954
GT22
3LQW
&$1
KITCHEN/BATH
CLEANER
For cleaning tough grease and
VRDS VFXP &XWV WKURXJK WRXJK
GLUW *HWV ULG RI XQVLJKWO\ EXLOGXS
LQ EDWKWXEV &OHDQV WLOHV VLQNV VWRYHWRSV WRLOHWV DQG
FRXQWHUWRSV
Our No.
01204
MAGIC AMERICAN
‡:,7+/(021
‡³62)76&58%´
‡08/7,385326(
‡62)76&58%32/,6+
‡³(=&/($1´
No.
Size
Oz
KITCHEN/BATH
CLEANER
KITCHEN/BATH
CLEANER
Our No.
No.
DIAL CORPORATION
MAGIC AMERICAN
592-7637
Our No.
Unit
CLOROX COMPANY
‡7,/(*5287
)RUPXODWHG WR EHDXWLI\ DV WKH\
FOHDQ ZKLOH OHDYLQJ EHKLQG D
SURWHFWLYH EDUULHU WR KHOS JXDUG
DJDLQVW ZDWHU PDUNV GLUW JULPH
DQGKLGHVVFUDWFKHV$HURVRO
No.
Shf
Pk
KITCHEN/BATH
CLEANER
‡³&203/(7(´
Our No.
Size
Oz
($
‡$17,%$&7(5,$/:,7+
%/($&+
‡³62)76&58%´
WOOD CLEANERS
No.
607-3548X
KITCHEN/BATH
CLEANER
KITCHEN & BATH CLEANERS
Our No.
($
($
‡$17,%$&7(5,$/
‡%$6,178%7,/(
‡³6&58%%,1*%8%%/(6,,´
)RDPLQJ DFWLRQ WKRURXJKO\ FOHDQV
VKLQHV GLVLQIHFWV DQG GHRGRUL]HV
WXEV VKRZHUV EDVLQV ¿[WXUHV FHUDPLF WLOH VWDLQOHVV
VWHHOFKURPH¿EHUJODVVDQGSRUFHODLQVXUIDFHV(DVLO\
UHPRYHVVRDSVFXPKDUGZDWHUVWDLQVDQGGLUW&RQWUROV
PROGDQGPLOGHZJURZWK:LOOQRWVFUDWFKVXUIDFHVUH
TXLUHVQRVFUXEELQJ
Our No.
Size
Oz
No.
Shf
Pk
Unit
12
($
SC JOHNSON
Lemon Scent - Aerosol
KITCHEN/BATH
CLEANER
KITCHEN/BATH
CLEANER
‡)2$0'((3&/($1
‡³62)76&58%´
‡:,7+%/($&+
‡³&/252;&/($183´
5HPRYHV WRXJK VWDLQV DQG JUHDV\
GLUW 'LVLQIHFWV DQG KDV D FOHDQ
IUHVKIUDJUDQFH
Our No.
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
694-1819
01240
32
072-3312
+HOSV UHPRYH WRXJK VWDLQV VRDS
VFXP OLPH FDOFLXP DQG KDUG
ZDWHU GHSRVLWV 8VH RQ EDWKWXEV
VLQNV IDXFHWV VKRZHUKHDGV FRXQWHUWRSV VKRZHU WLOHV
JODVVVKRZHUGRRUVDQGWRLOHWV7KLFNIRDPFOLQJVWRVXU
IDFH )UHVK FOHDQ VFHQW /HDYHV EDWKURRPV VPHOOLQJ DV
FOHDQDVLWORRNV7ULJJHU6SUD\
Our No.
($
No.
Size
Oz
Shf
Pk
Unit
DIAL CORPORATION
392-7498X
KITCHEN/BATH
CLEANER
,+.6
($
KITCHEN/BATH
CLEANER
‡$17,%$&7(5,$/
‡%$6,178%7,/(
‡³6&58%%,1*%8%%/(6´
)RDPLQJ DFWLRQ WKRURXJKO\ FOHDQV
VKLQHV GLVLQIHFWV DQG GHRGRUL]HV
WXE VKRZHUV EDVLQV ¿[WXUHV FHUDPLF WLOH VWDLQOHVV
VWHHOFKURPH¿EHUJODVVDQGSRUFHODLQVXUIDFHV(DVLO\
UHPRYHVRDSVFXPKDUGZDWHUVWDLQVDQGGLUW&RQWUROV
PROGDQGPLOGHZJURZWK:LOOQRWVFUDWFKVXUIDFHVUH
TXLUHVQRVFUXEELQJ
Our No.
SC JOHNSON
8VHWRFOHDQDOODURXQGWKHKRXVH
&RQWDLQVEOHDFKIRUDQH[WUDFOHDQ
LQJSRZHU6FUDWFKIUHH
492-1698
No.
Size
Oz
21
Shf
Pk
Unit
12
($
Regular Scent - Aerosol
Shf
Pk
Unit
30
($
DOT FOODS, INC. COLGATE PALMOLIVE
672-1468
Size
Oz
No.
‡32:'(5:,7+%/($&+
‡³$-$;´
Our No.
25
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
22
Maintenance, Repair & Operations - 103
KITCHEN/BATH
CLEANER
KITCHEN CLEANER
BATHROOM CLEANER
‡³.$%220)2$07$67,&´
‡/,48,'
‡³%$5.((3(56)5,(1'´
‡$//385326(
$17,%$&7(5,$/
‡³)2508/$´
$ OLTXLG FOHDQVHU IRU WKH NLWFKHQ
DQGEDWKURRPZKLFKUHPRYHVUXVW
IURPVWDLQOHVVVWHHOVLQNVDQGFRRN
ZDUH
'LVLQIHFWLQJSRZHUWKDWNLOOVKDUP
IXO NLWFKHQ EDFWHULD 8VH RQ KDUG
QRQSRURXV QRQIRRG FRQWDFW VXU
IDFHV6WUHDNIUHH
Our No.
No.
Size
Oz
Shf
Pk
Unit
Our No.
Unit
12
($
Lemon Fresh Scent
Fliptop Bottle
Shf
Pk
CLOROX COMPANY
SERVAAS LABORATORY
692-6471
Size
Oz
No.
6SUD\ RQ WKH SHQHWUDWLQJ EOXH
IRDP DQG R[L FOHDQ VWDLQ ¿JKWHUV
ZRUNRQFRQWDFWEUHDNLQJXSVRDS
VFXPDQGKDUGZDWHUVWDLQV:KHQ
WKHIRDPWXUQVZKLWHMXVWZLSHDQG
ULQVHWRUHYHDODEULOOLDQWVKLQH&OHDQVZLWKDIUHVKVFHQW
5HPRYHV VRDS VFXP GLUW KDUG ZDWHU VWDLQV FDOFLXP
OLPHJUHDVHDQGJULPH8VHRQWXEVJOD]HGFHUDPLFWLOH
¿EHUJODVVVKRZHUGRRUVDQGYLQ\OFXUWDLQVVLQNVFRXQ
WHUWRSVDQGFKURPH¿[WXUHV$HURVRO
156-0390X
($
03083
22
Our No.
&UHDP\ /HPRQ 2LO IRUPXODWLRQ
FXWV WKURXJK VRDS VFXP PLOGHZ
GLUW DQG JUHDVH 'HHS FOHDQV DQG
SROLVKHV QRQSRURXV KDUG VXUIDFHV
ZLWKRXWDQ\ULVNRIVFUDWFKLQJ([
FHOOHQW ZKLWHERDUG FOHDQHU UHPRYHV WKH WRXJKHVW GU\
HUDVH PDUNHU JKRVW VWDLQV 0DGH ZLWK RQO\ VXV
WDLQDEOHSODQWEDVHGLQJUHGLHQWV'RHVQRWFRQWDLQG\HV
RUV\QWKHWLFSHUIXPHVQHXWUDOS+JUH\ZDWHUDQGVHSWLF
VDIH5HFRJQL]HGIRUVDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQ
IRUWKH(QYLURQPHQW3URJUDP
No.
Shf
Pk
Unit
12
($
EARTH FRIENDLY PRODUCTS
3/
‡³3$56/(<3/86´
&OHDQV GHJUHDVHV DQG GHRGRUL]HV
ZLWK WKH QDWXUDO SRZHU RI SDUVOH\
1RULQVHQHXWUDOS+FOHDQHULVVDIH
DQG HIIHFWLYH RQ DQ\ ZDWHUVDIH
VXUIDFH ([FHOOHQW LQ HYHU\ DUHD RI D NLWFKHQ DQG EDWK
URRPLQFOXGLQJJUDQLWHDQGPDUEOHVXUIDFHV0DGHZLWK
RQO\ VXVWDLQDEOH SODQWEDVHG LQJUHGLHQWV 'RHV
QRW FRQWDLQ G\HV RU V\QWKHWLF SHUIXPHV JUH\ZDWHU DQG
VHSWLFVDIH5HFRJQL]HGIRUVDIHUFKHPLVWU\E\WKH(3$¶V
'HVLJQIRUWKH(QYLURQPHQW3URJUDP
Shf
Pk
No.
Unit
EARTH FRIENDLY PRODUCTS
32 Oz
3/
12
($
‡:,7+%/($&+
‡³&/252;&/($183´
Our No.
($
Size
Oz
No.
Shf
Pk
&OHDQV DQG GHOLPHV VKRZHU VWDOOV
WRLOHWV VLQNV DQG ¿QLVKHG ÀRRUV
&RQWDLQVQRDONDOLVRUVWURQJDFLG
Unit
Our No.
995-5535X
1358452
($
Size
Oz
No.
Shf
Pk
Unit
LUNDMARK WAX CO.
006-5425X
,
)
32
($
748-7960X
+.
*
128
4
($
Our No.
No.
Shf
Pk
Size
Unit
MAGIC AMERICAN
$0
Shf
Pk
Unit
&LWUXV
12
($
7LOH[ EDWKURRP FOHDQHU ZLOO QRW
VFUDWFK FRQWDLQV QR EOHDFK 'XDO
WULJJHU DFWLRQ VSUD\ IRU UHJXODU
FOHDQLQJDQGIRDPIRUGHHSFOHDQ
LQJ
3LQW
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
&$1
Trigger Spray
607-3530X
12
($
638-6346X
32
($
BATHROOM CLEANER
‡:2;<)2$0,1*$&7,21
‡³$50+$00(56&58%
)5((´
BATHROOM CLEANER
No.
Size
Oz
Shf
Pk
Unit
32
12
($
CHURCH & DWIGHT
Scent
‡121$%5$6,9(
‡³7,/(;´
Our No.
Aerosol
239-9822
BATHROOM CLEANER
420-8369
35240
‡%/($&+)2$0(5
‡³&/252;´
)RU WKH WXE VLQN DQG WLOH &OHDU
7ULJJHU6SUD\
Our No.
No.
Size
In
Shf
Pk
Unit
CLOROX COMPANY
513-9712
CLOROX COMPANY
359-5287
8
‡$//385326(
‡³%$7+%5,7(´
DIAL CORPORATION
Our No.
5HPRYHV VWDLQV GLUW JUHDVH DQG
JULPH LQ WKRVH WRXJK VSRWV OLNH
\RXU NLWFKHQ DQG EDWKURRP 8VH
RQFRXQWHUWRSVWXEVVKRZHUVWRLOHWVVLQNVDQGDSSOL
DQFHV2]
No.
BATHROOM CLEANER
&OHDQV DQG GHJUHDVHV HQWLUH
NLWFKHQLQFOXGLQJWKHLQVLGHRIWKH
PLFURZDYH :RUNV XSVLGH GRZQ
IRDPRUVSUD\/HPRQ6FHQW7ULJ
JHU6SUD\
:LWK R[\ IRDPLQJ DFWLRQ $UP +DPPHU 6FUXE )UHH EDWKURRP
FOHDQHU TXLFNO\ FXWV WKURXJK VRDS
VFXPKDUGZDWHUVWDLQVDQGGXOOLQJ¿OP5HFRPPHQGHG
IRU XVH RQ FHUDPLF WLOH VKRZHU GRRUV ¿[WXUHV SODVWLF
FKURPHDQGRQSRUFHODLQDFU\OLFDQG¿EHUJODVVWXEVDQG
VLQNV/HPRQ6FHQW7ULJJHU6SUD\
KITCHEN/BATH
CLEANER
Our No.
‡$//385326(
‡³62)76&58%727$/´
)RUDOODSSOLDQFHVSRUFHODLQPHWDO
FDELQHWV VWDLQOHVV VWHHO FRSSHU
FKURPH &OHDQV ZLWKRXW VWUHDNLQJ
and leaves a tough silicone shield
RQ WKH VXUIDFH 5HPRYHV IRRG
VWDLQVGHSRVLWV FRRNLQJ JUHDVH
¿QJHUPDUNVGXOOLQJ¿OPDOOGLUWVRLOLQWKHNLWFKHQ$OVR
IRUEDWKURRP¿[WXUHV
KITCHEN/BATH
CLEANER
692-6703
Unit
KITCHEN CLEANER
17 Oz
Our No.
Shf
Pk
KITCHEN CLEANER
KITCHEN/BATH
CLEANER
108-5984
Size
Oz
CHURCH & DWIGHT
379-4757
Our No.
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
30
($
104 - Maintenance, Repair & Operations
SHOWER CLEANER
BATHROOM
CLEANER
‡5($'<7286(
‡³6,03/(*5((1
1$785$/6´
)RU WXE VLQN DQG WLOH :RUNV RQ
UHPRYLQJ W\SLFDO DONDOLQH EDWKURRP VRLOV ZLWKRXW KDUVK
FKHPLFDOVRUIXPHV5RVHPDU\0LQWVFHQW7ULJJHU6SUD\
Our No.
No.
Size
Oz
Shf
Pk
Unit
SUNSHINE MAKERS
078-4041
12303
SHOWER/TUB/TILE
CLEANER
‡³7,/(;´
Our No.
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
Fresh Scent
639-6451
24
‡:2;,&/($1
‡³.$%220´
%UHDNV XS VRDS VFXP DQG GLUW
/LIWV SDUWLFOHV RII VXUIDFHV 6KHHW
LQJ DFWLRQ WR ZDVK SDUWLFOHV GRZQ
WKHGUDLQ&OHDUIRUPXODQRKDUVK
FKHPLFDOFXH)LQHVSUD\QR]]OH
32
($
:LWKWKHSRZHURI2[L&OHDQVWDLQ
¿JKWHUV .DERRP VKRZHU WXE
DQG WLOH FOHDQHU SRZHUV WKURXJK
WKH WRXJKHVW EDWKURRP JULPH $ PXOWLSXUSRVH EDWK
URRPFOHDQHUZKLFKLVWRXJKRQVRDSVFXPKDUGZDWHU
EXLOGXSFODFLXPOLPHVWDLQVJUHDVHDQGJULPH&DQEH
XVHG RQ SRUFHODLQ FHUDPLF VWDLQOHVV VWHHO ¿EHUJODVV
DFU\OLF SODVWLFV FRQFUHWH DQG EUDVV DOO ZLWKRXW REQR[
LRXVIXPHV
($
Our No.
$FWLYH FOHDQHUV ZRUN IRU GD\V ,Q
YLVLEOH JULPH EDUULHU LV DFWLYDWHG
HDFK WLPH EDWKURRP VXUIDFHV JHW
ZHWFOHDQLQJIRUIRXUGD\V
3RZHUFOHDQHUVFXWWKURXJKVRDSVFXPDQGJULPH&OHDQV
VLQNVVKRZHUVWXEVWLOHDQGFKURPHWRDVKLQH
No.
Shf
Pk
Unit
SC JOHNSON
215-5281
326-5220
8
&OHDQVVRDSVFXPDQGPROGPLO
GHZ VWDLQV +DQJV IURP VKRZHU
KHDG GHJUHH SRZHU VSUD\HU
FRYHUV WXE DQG VKRZHU ZDOOV
:RUNV LQ VKRZHUV ZLWK FXUWDLQV RU JODVV GRRUV 6SUD\V
XSWRIW&OHDQVVKRZHUPRUHWKDQWLPHV,QFOXGHV
RQH GXDO VSUD\HU DQG ERWWOH )/ 2= RI FOHDQLQJ
VROXWLRQ DQG RQH VWDLQOHVV VWHHO KDQJHU 5HTXLUHV $$
DONDOLQHEDWWHULHV127,1&/8'('
Our No.
Shf
Pk
No.
Unit
SC JOHNSON
($
592-6936
BATHROOM CLEANER
2
($
SHOWER CLEANER
‡%$7+6&58%%(5
‡³05&/($10$*,&
(5$6(5´
.HHSV\RXUVKRZHUFOHDQIRUXSWR
GD\V 1R VFUXEELQJ ZLSLQJ RU
ULQVLQJ $WWDFNV VRDS VFXP PROG
PLOGHZVWDLQV(OLPLQDWHVRGRUV
DVLWFOHDQV*ODGH5HIUHVKLQJ6SD
)UDJUDQFH
Our No.
Shf
Pk
Unit
($
Shf
Pk
No.
Unit
215-5299
8
($
SHOWER/TUB/TILE
CLEANER
Our No.
No.
Size
Oz
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
Shf
Pk
Unit
SC JOHNSON
Shf
Pk
Unit
12
($
‡³7,/(;´
&OHDQVWLOHJURXWWRLOHWVDQG¿EHU
JODVV5HPRYHVPROGDQGPLOGHZ
Our No.
8
($
Jug
994-3507
=8677
033-7154
=86773)
128
Size
Oz
No.
CLOROX COMPANY
Trigger Spray
958-7692X
01100
&RQWDLQV&ORUR[EOHDFK
Our No.
No.
Size
Oz
Unit
CLOROX COMPANY
32
($
Shf
Pk
Unit
)RUPXODWHGIRUHIIHFWLYHFOHDQLQJRI
JODVVFHUDPLFDQGSRUFHODLQFRRN
WRSV &XWV WKURXJK WRXJK JUHDVH
DQG UHPRYHV EXUQW RQ GHSRVLWV
ZLWKRXWVFUDWFKLQJOHDYLQJDVWUHDN
IUHHVKLQH
Our No.
No.
4
($
MAGIC AMERICAN
12
($
447-6008
Trigger Spray
32
Shf
Pk
‡³&203/(7(´
3URIHVVLRQDO VWUHQJWK VKRZHU WXE
WLOH FOHDQHU 5HDG\WRXVH DFLG
EDVHG EDWKURRP FOHDQHU WKDW UH
PRYHVVFDOHDQGVFXPIDVW
&RORU 3RZHU 7HFKQRORJ\ :KHQ
IRDP WXUQV ZKLWH VLPSO\ ZLSH
FOHDQ
551-5259
($
COOKTOP CLEANERS
‡³=(3´
‡³6&58%%,1*%8%%/(6´
No.
12
MILDEW STAIN
REMOVER
359-5295
8
BATHROOM CLEANER
Our No.
32
7LOH[0ROG6WDLQ0LOGHZ6WDLQ5H
PRYHUDWWDFNVPROGVWDLQVDQGPLO
GHZVWDLQVDQGOHDYHVDUHIUHVKLQJ
VFHQWWRNHHS\RXUEDWKURRPVPHOO
LQJDVFOHDQDVLWORRNV'HOLYHUVDSRZHUIXOFOHDQZLWKRXW
VFUXEELQJ5HPRYHVPROGVWDLQVDQGPLOGHZVWDLQV
PROCTER & GAMBLE
092-2732
35015
‡³7,/(;´
SC JOHNSON
No.
Unit
MOLD/MILDEW STAIN
REMOVER
‡³6&58%%,1*%8%%/(6´
0U&OHDQ0DJLF(UDVHU%DWK6FUXE
EHU FOHDQV ZLWK ; PRUH VRDS
VFXP SHU VZLSH :LWK DQ (UDVHU
SDGWKDW¶VODUJHUDQGPRUHGXUDEOHWKDQWKH0DJLF
(UDVHU2ULJLQDOFRPELQHGZLWKDEXLOWLQVRDSVFXPGLV
VROYLQJFOHDQVHUWKHSRZHUIXOPLFURVFUXEEHUVLQWKH0U
&OHDQ 0DJLF (UDVHU %DWK 6FUXEEHU PDNH WDFNOLQJ EDWK
URRPEXLOGXSHDV\
Our No.
Shf
Pk
‡67$57(5.,7$8720$7,&
‡³6&58%%,1*%8%%/(6´
‡(;7(1'$&/($1
‡³6&58%%,1*%8%%/(6´
Our No.
Size
Oz
CHURCH & DWIGHT
SHOWER CLEANER
BATHROOM CLEANER
No.
Size
Oz
Cream
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
50334025
($
Maintenance, Repair & Operations - 105
COUNTERTOP
CLEANERS
IRUPXOD 7KLV SURGXFW LV HIIHFWLYH DQG VDIH IRU VHDOHG
FRXQWHUWRSV
Size
Oz
No.
Shf
Pk
Unit
BONAKEMI USA, INC
118-9398
:0
SPECIALTY CLEANERS
‡',6,1)(&7,1*
‡³&/252;´
6SHFL¿FDOO\ GHVLJQHG WR DGGUHVV
WKH PRVWVWXEERUQ FOHDQLQJ QHHGV
LQ D QRQWR[LF ELRGHJUDGDEOH
VWUHDNIUHH
Our No.
Floor Care & Floor Protection
BATHROOM CLEANER
8
MARBLE RESTORER
5HPRYHV WRXJK VRDS VFXP ZLWK
RXW VFUXEELQJ )UHVK FLWUXV VFHQW
%OHDFKIUHH 8VH RQ KDUG QRQSR
URXV EDWKURRP VXUIDFHV VXFK DV
JOD]HGFHUDPLFWLOHVKRZHUGRRUVWRLOHWH[WHULRUVSODV
WLF FKURPH ¿EHUJODVV JOD]HG SRUFHODLQ DQG V\QWKHWLF
PDUEOH
Our No.
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
($
427-2530
08033
)RU SURWHFWLQJ VHDOLQJ DQG UHVWRU
LQJ KDUG VXUIDFH ÀRRUV 3URWHFWV
WKHÀRRUVIURPVWDLQVHWWLQJLQDQG
PROG DQG PLOGHZ IURP JURZLQJ
5HSHOV ZDWHU VWDLQV IURP VHHSLQJ
LQ E\ OHDYLQJ WKH ZDWHU RQ WRS RI
WKHVHDO$OORZVIRUHDV\FOHDQXSRIFDOFLXPGHSRVLWVOHIW
E\KDUGZDWHUV
Our No.
30
($
Formulated to clean and shine all
stainless steel appliances includ
LQJ UHIULJHUDWRUV GLVKZDVKHUV
RYHQVVWRYHVFRXQWHUWRSVEDUEHTXHJULOOVDQGH[WHULRU
RI PDQ\VPDOOVWDLQOHVV VWHHO DSSOLDQFHV5HPRYHV GLUW
UHVLGXH ZDWHU VSRWV DQG ¿QJHUSULQWV /HDYHV D VWUHDN
IUHH VKLQ\ SURWHFWLYH EDUULHU ZKLFK UHSHOV GXVW GLUW
JULPH$HURVRO
Our No.
No.
&66
12
Shf
Pk
Unit
JELMAR
374-6575X
.LOOV SHUFHQW RI KRXVHKROG
PROGV DQG WRXJK PLOGHZ ZLWK
RXW VFUXEELQJ 5HPRYHV PLOGHZ
VWDLQV'LVLQIHFWVZLWKWKHSRZHURI
EOHDFKOHDYLQJDIUHVKOHPRQVFHQW8VHRQJOD]HGWLOH
JURXWWXEVVKRZHUGRRUVYLQ\OFXUWDLQVFRXQWHUVVLQNV
DQG QRZD[ ÀRRUV $OVR XVH RQ FHPHQW SRRO DUHDV DQG
RXWGRRUIXUQLWXUHYLQ\ODQGSODVWLF
‡³0$5%/(&/($1´
Our No.
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
32
($
Our No.
Shf
Pk
Unit
MAGIC AMERICAN
50333015
14
No.
Size
Oz
Shf
Pk
Unit
BONAKEMI USA, INC
118-9380
:0
1HXWUDO SRURXV VWRQH FOHDQHU )RU
PXODWHG WR PDLQWDLQ ERWK GRPHV
WLF DQG LPSRUWHG ÀRRULQJ PDUEOH
JUDQLWHTXDUU\WLOHFHUDPLFVODWH
VWRQH WHUUD FRWWD DQG OLPHVWRQH /HDYHV QR VRDS UHVL
GXHVWKDWDWWUDFWGLUWDQGGXOODÀRRU
Our No.
8
806-0345X
,
0DNHV FOHDQLQJ TXLFN DQG HDV\
ZLWKGHHSJORVVVKLQH)LQJHUSULQW
UHVLVWDQWDQGVWUHDNIUHHFOHDQ
Shf
Pk
Unit
MAGIC AMERICAN
Aerosol
657-4560
50333020
32
)
($
&OHDQV DQG VKLQHV ZLWK QR GXOO
LQJ UHVLGXH &OHDQV DQG EULJKWHQV
JURXW 5HPRYHV KRXVHKROG VWDLQV
DQGUHWXUQVJURXWWRRULJLQDOFRORU
8VH ZLWK JOD]HG FHUDPLF WLOH YLQ\O PDUEOH DQG VWRQH
ÀRRUV6DIHIRUDOOKDUGÀRRUFOHDQLQJPDFKLQHV
Our No.
($
No.
Size
Oz
Shf
Pk
Unit
HOOVER CO
($
Paint & Primers
‡(;7(1'$&/($1
‡$&7,9(6&58%
‡³6&58%%,1*%8%%/(6´
‡³&203/(7(´
Size
Oz
Unit
($
STAINLESS STEEL
CLEANER
No.
Shf
Pk
LUNDMARK WAX CO.
790-2729
Size
Oz
No.
ALL-PURPOSE CLEANER
Our No.
($
‡*5287&/($1,1*
‡³)/2250$7(´
Trigger Spray
500-2795
FLOOR CLEANER
6SHFLDOO\IRUPXODWHGIRUFDELQHWVWR
DGGUHVV FRPPRQ FDELQHW FOHDQLQJ
QHHGV LQ D QRQWR[LF ELRGHJUDG
DEOH QRUHVLGXH IRUPXOD 1R GXOO
LQJ UHVLGXH (DVLO\ UHPRYHV ¿QJHU
SULQWV
0DNHV FOHDQLQJ TXLFN DQG HDV\
/HDYHV D VKRZURRP VKLQH SOXV D
SURWHFWLYHEDUULHUWRKHOSUHVLVW¿Q
JHUSULQWVDQGZDWHUVSRWV)LQJHU
SULQWUHVLVWDQW
No.
32
)
MARBLE/GRANITE
CLEANER
CABINET CLEANERS
‡³&203/(7(´
Our No.
,+
‡02/'0,/'(:5(029(5
‡³7,/(;´
499-4927
($
STAINLESS STEEL
CLEANER
Size
Oz
Unit
BATHROOM CLEANER
‡.,7&+(1%$7+
‡³&/5´
Size
Oz
Shf
Pk
LUNDMARK WAX CO.
018-6429X
STAINLESS STEEL
CLEANER
Size
Oz
No.
($
ENAMELS
$OOSXUSRVH FOHDQVHU IRU FOHDQLQJ
WKURXJKRXW WKH KRXVH 7KLV YHUVD
tile cream cleanser cleans rust and
FXWVWKURXJKWRXJKVRDSVFXPIURPWRLOHWVWXEVWLOHV
FOHDQV WRXJK VWDLQV JUHDV\ VRLOV GULHG RQ IRRGV IURP
FRXQWHUWRSV NLWFKHQ VLQNV DQG FXWV WKURXJK WRXJK
JUHDVHDQGFRRNHGRQIRRGIURPVWRYHV$FWLYHFOHDQHUV
ZRUN IRU GD\V ,QYLVLEOH JULPH EDUULHU LV DFWLYDWHG HDFK
WLPHVXUIDFHVJHWZHWFOHDQLQJIRUIRXUGD\V(IIHFWLYHO\
FOHDQV SRUFHODLQ FHUDPLF VWDLQOHVV VWHHO JUDQLWH &RUL
DQSODVWLFODPLQDWHJODVVDQGFKURPHLQWKHEDWKURRP
NLWFKHQ DQG RWKHU DUHDV WKURXJKRXW WKH KRPH 8VH LQ
WKHEDWKURRPRQWRLOHWVWXEVDQGWLOHVRQFRXQWHUWRSV
DQG NLWFKHQ VLQNV VWRYHV DQG RWKHU DSSOLDQFHV /HDYHV
EHKLQGDEULOOLDQWVKLQH
SPRAY PAINT
‡(1$0(/08/7,685)$&(
‡,17(5,25(;7(5,25
‡³35(0,80´
7ZLVWORFN FDS SUHYHQWV DFFLGHQ
WDO VSUD\V 6SUD\V IURP DQ\ DQJOH
DQG KDUGWRUHDFK SODFHV 'ULHV
WRDWRXJKKDUGZHDULQJ¿QLVK)DVWGU\LQJ:DWHUDQG
VFUDWFKUHVLVWDQW3URWHFWVDJDLQVWUXVW
Our No.
No.
Shf
Pk
8
Shf
Pk Unit
SATIN
12 Ounce
Unit
SC JOHNSON
511-6793
Color
VALSPAR
630-3150
Our No.
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
85203
++*OGQ0]
&$1
- Maintenance, Repair & Operations
MILDEW STAIN
REMOVER
MARBLE POLISH &
CLEANER
‡&200(5&,$/675(1*7+
‡126&58%
‡³=(3´
1RVFUXE PROG DQG PLOGHZ VWDLQ
UHPRYHU (IIHFWLYH DJDLQVW WRXJK
PLOGHZ3HQHWUDWHVZKLWHQVDQGUHPRYHVPLOGHZVWDLQV
Our No.
Size
Oz
No.
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
FABRIC/FURNITURE
STAIN REMOVER
‡287'2255($'<7286(
‡³-20$;´
&OHDQVSROLVKHVDQGSURWHFWV5H
PRYHV DOO GLUW JULPH DQG VPRNH
¿OP 5HVLVWV ZDWHU VSRWWLQJ DQG
¿QJHU PDUNLQJ 5HYHDOV WUXH KXHV
DQGHQKDQFHV
Our No.
Size
Oz
No.
Shf
Pk
Unit
Our No.
LUNDMARK WAX CO.
872-0583X
,
5HPRYHV GLUW DQG PLOGHZ VWDLQV
IURP XPEUHOODV FXVKLRQV DQG
PRUH6DIHIRUXVHQHDUSODQWVDQG
VKUXEV&RQWDLQV2[\IRUPXODDQGEOHDFKIUHH
3215F10
10
12
($
Size
Oz
No.
Trigger Spray
128
=80,/'(:
4
($
12
($
614-9926
Trigger Spray
653-4754
32
=80,/'(:
‡&2817(5*/266
‡³*(/*/266´
8QLTXH EOHQG RI FOHDQHUV ZDWHU
VSRW UHPRYHUV SROLVKLQJ DJHQWV
DQG &DUQXED ZD[ 6DIH RQ VROLG
VXUIDFHVJUDQLWHDQGPDUEOHWLOHDQGODPLQDWH
Our No.
No.
32
($
GRANITE/MARBLE/
QUARTZ CLEANER
COUNTERTOP
CLEANERS
Size
Oz
Unit
RUST-OLEUM
Jug
396-7239
Shf
Pk
‡³=(3´
ICE MAKER CLEANER
3URIHVVLRQDO VWUHQJWK JHQWOH S+
QHXWUDOFOHDQHU'HVLJQHGWRVDIHO\
FOHDQ VHQVLWLYH PDUEOH DQG RWKHU
QDWXUDO VXUIDFHV &OHDQV DQG SRO
LVKHV LQ RQH VWHS /HDYHV VXUIDFHV VKLQQLQJ QR EXI¿QJ
UHTXLUHG
‡1,&.(/6$)(
Our No.
Size
Oz
No.
Shf
Pk
Unit
5HPRYHV VFDOH PXFN DQG VOLPH
ZKLFKFDQFDXVHEDGWDVWHDQGIRXO
RGRUV HQVXULQJ FOHDQ FROG WDVWH
IUHH LFH 6DIH IRU QLFNHOSODWHG
VXUIDFHV )RRG JUDGH DFLG FOHDQHU
RSHQV FRQVWULFWHG ZDWHU OLQHV 0HHWV 0DQLWRZRF 6SHF
*(6
ACUITY SPECIALTY PRODUCTS
Our No.
Trigger Spray
Shf
Pk
Unit
12
($
789-3589
32
=80$5%
12
($
TR INDUSTRIES
No.
Size
Oz
Shf
Pk
Unit
12
($
RECTORSEAL CORP
308-0355X
7+.6
88312
Aerosol
719-0887
12
&*
GRANITE/MARBLE/
STONE CLEANER
WASHING MACHINE
CLEANER
‡³&/5´
SPECIALITY STAIN
REMOVER
‡)22'%(9(5$*(
&2))(0$.(5
‡³',3,7´
6WDLQ 5HPRYHU 3RZGHUHG FOHDQHU
UHPRYHVIRRGDQGEHYHUDJHVWDLQV
&RIIHHPDNHU &OHDQHU /LTXLG FOHDQHU GLVVROYHV DQG UH
PRYHVEXLOGXSRIOLPHFDOFLXPDQGRWKHUZDWHUGHSRV
LWV5HDG\7R8VH
Our No.
Size
Oz
No.
Shf
Pk
6SHFLDOO\ IRUPXODWHG WR FOHDQ DQG
SURWHFW DJDLQVW VSLOOV IRRG DQG
JULPH RQ D ZLGH YDULHW\ RI KDUG
VXUIDFHV LQFOXGLQJ *UDQLWH PDU
EOH &RULDQ DQG WLOH 3URYLGHV D VWUHDN IUHH VKLQH WKDW
UHVLVWV ¿QJHUSULQWV DQG VPXGJHV &OHDQV ZLWK RQH VWHS
FOHDQLQJ DQG SURWHFWLRQ :LOO QRW VFUDWFK 5HVWRUHV DQG
PDLQWDLQVWKHOXVWHURIWKHVXUIDFHZLWKQRJUHDV\¿OPRU
VWLFN\UHVLGXH$HURVRO
Our No.
No.
Size
Oz
&*6
12
Shf
Pk
Unit
JELMAR
Unit
497-5686X
8
($
8
PATIO FURNITURE
CLEANER
($
‡³:$6+(50$*,&´
5HPRYHV OLPH VFDOH VRDS VFXP
LURQDQGPLQHUDOVWDLQVIURP\RXU
ZDVKLQJ PDFKLQH DQG UHGXFHV
DEUDVLYH EXLOGXS WKDW LV KDUPIXO
WRODXQGU\5HFRPPHQGHGXVDJHLVRQFHDPRQWKWRHQ
VXUHRSWLPDOFOHDQLQJDQGSUHYHQWEXLOGXS6DIHIRUDOO
ZDVKLQJPDFKLQHPRGHOV
Our No.
Shf
Pk
Unit
IRON OUT INC
596-7054
Size
Oz
No.
:01:0'
24
($
($
RECKITT BENCKISER
LIQUID FORMULA
759-3650X
POWDER FORMULA
258-4464X
5
&OHDQV GLVLQIHFWV DQG FRQWUROV
PROG DQG PLOGHZ 5HPRYHV GLUW
PROG DQG JULPH IURP UHVLQ SODV
WLF DQG WUHDWHG RU SDLQWHG ZRRG
VXUIDFHV 5HPRYHV VWDLQV IURP
RXWGRRUIDEULF&RQWUROVDQGKHOSVSUHYHQWWKHUHWXUQRI
PROGDQGPLOGHZDQGGHVWUR\VEDFWHULDORGRUV
HOT IRON CLEANER
5HPRYHV UHVLGXHV IURP WKH VROH
SODWHRID+RW,URQ)XVLEOHVLQWHU
IDFLQJV PHOWHG V\QWKHWLF IDEULFV
SDWFKJOXHDQGVWDUFKDOOPHOWDZD\
HDVLO\1RQHHGWRZDLWIRUWKHLURQ
WRFRROGRZQ
Our No.
No.
Size
Oz
WASHING MACHINE
CLEANER
Our No.
No.
Size
Oz
Shf
Pk
Unit
:RUNV LQ +( PDFKLQHV DQG WUDGL
WLRQDOWRSORDGLQJPDFKLQHV
Our No.
359-5246
Trigger Spray
Unit
12
($
627-2173
25
($
FAULTLESS STARCH
Pack of 2
971-8834X
40105
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
SPRAY NINE/PERMATEX
Shf
Pk
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
30815
30
($
Maintenance, Repair & Operations - WASHING MACHINE
CLEANER
6PHOO\ :DVKHU &OHDQHU LV XVHG E\
DGGLQJ D OHYHO FDS WEVS WR D
KRW VHWWLQJ DQG DOORZLQJ WKH F\FOH
WR FRPSOHWH 0RVW XVHUV ¿QG WKLV
ZLOO UHPRYH RGRU IURP DQ\ WRS RU
IURQWORDGLQJZDVKHU:RUVH FDVHV ZLOOQHHGPRUHWKDQ
FOHDQLQJDQGHYHQVRDNLQJWRUHPRYHWKHRGRUFDXVLQJ
EXLOGXSR]ERWWOH
Our No.
Shf
Pk
No.
Unit
SMELLY WASHER INC.
988-7241X
Chemicals,Cleaners & Cleaning
Implements
METAL CLEANER
‡67$,1/(6667((/&233(5
&+520(
‡/,48,'
‡³./((1.,1*´
LAUNDRY CARE
STAIN REMOVERS
‡³:$6+$:$<´
&OHDQV DQG EULJKWHQV VWDLQOHVV
VWHHO FRSSHU DQG FKURPH 5H
PRYHV WDUQLVK KHDW DQG IRRG VWDLQV ZLWK FKHPLFDO DF
WLRQ 5HPRYHV KDUG ZDWHU VWDLQV DQG PLQHUDO GHSRVLWV
1RQWR[LFDQWLWDUQLVKIRUPXOD
Our No.
Size
Oz
No.
Shf
Pk
Unit
FAULTLESS STARCH
212
12
($
616-6474X
Our No.
,+.
/DXQGU\SUHWUHDWPHQWVWDLQUHPRY
HU 5HPRYHV WKH WRXJKHVW ODXQGU\
VWDLQV LQFOXGLQJ EORRG FRIIHH
JUHDVHJUDVVDQGFKRFRODWH6DIH
RQ DOO ZDVKDEOH FRORUIDVW IDEULFV
DQGZRUNVZHOOLQDOOZDWHUWHPSHUDWXUHV
14
12
($
‡³)2508/$´
'LVKZDVKHU 0DJLF 3OXV VDIHO\ DQG
HIIHFWLYHO\ UHPRYHV OLPH VFDOH
LURQ VRDS VFXP DQG JUHDVH OHIW
EHKLQG LQ \RXU GLVKZDVKHU ,V
DOVR D OLPLWHG GLVLQIHFWDQW DJDLQVW
JUDPQHJDWLYH EDFWHULD VXFK DV (VFKHULFKLD FROL $7&&
DQG6DOPRQHOOD&KROHUDHVXLV$7&&,P
SURYHVFOHDQLQJSHUIRUPDQFHDQGH[WHQGVWKHOLIHRI\RXU
GLVKZDVKHU 6DIH IRU SOXPELQJ DQG VHSWLF V\VWHPV DQG
DOOPRGHOLQWHULRUV8VHRQFHDPRQWKWRHQVXUHRSWLPDO
FOHDQLQJDQGSUHYHQWEXLOGXS
Our No.
No.
Shf
Pk
'01
12
12
($
$OO QDWXUDO HDV\ WR XVH 5HPRYHV
RGRUR]ERWWOH
No.
Shf
Pk
Unit
12
($
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
105-7058
10
($
30108
32
2Q WKH JR VWDLQ UHPRYHU 4XLFNO\
UHPRYHV XQH[SHFWHG VSLOOV VSRWV
DQG VWDLQV IURP ZDVKDEOH FRORU
IDVWIDEULFVZLWKRXWODXQGHULQJ5H
PRYHV FRIIHH FKRFRODWH NHWFKXS
MXLFHOLSVWLFNPRVWLQNVDQGPRUH&RQYHQLHQWVL]HIRU
SXUVHEULHIFDVHFDUGHVNGLDSHUEDJDQGWUDYHO
($
Our No.
No.
Size
Oz
Shf
Pk
Unit
1
12
($
WHINK PRODUCTS
530-6428X
6R\EDVHG IRUPXOD GHHS FOHDQV
polishes and protects stainless
VWHHO :LOO QRW OHDYH VWUHDNV KD]
LQJ RU RLO\ UHVLGXH EHKLQG 3UR
WHFWV DJDLQVW ZDWHU VSRWV DQG ¿Q
JHU SULQWV ([FHOOHQW RQ RWKHU PHWDO VXUIDFHV VXFK DV
DOXPLQXP EUDVV FKURPH FRSSHU ]LQF VLOYHU DQG PLOG
VWHHO0DGHZLWKRQO\VXVWDLQDEOHSODQWEDVHGLQ
JUHGLHQWV'RHVQRWFRQWDLQG\HVRUV\QWKHWLFSHUIXPHV
QHXWUDO S+ JUH\ZDWHU DQG VHSWLF VDIH 5HFRJQL]HG IRU
VDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQIRUWKH(QYLURQPHQW
3URJUDP
Our No.
SMELLY WASHER INC.
988-7266X
Our No.
STAINLESS STEEL
CLEANER/POLISH
DISHWASHER/
DISPOSAL CLEANER
Our No.
18281
INSTANT SPOT
REMOVER
)RU PDUEOH VWDLQOHVV VWHHO DQG
JUDQLWH (OLPLQDWHV VPXJHV 1RQ
ZD[\6WUHDNIUHHVKLQH
Unit
IRON OUT INC
124-1504
Unit
STONE/STEEL CLEANER
‡³',6+:$6+(50$*,&´
Size
Oz
Shf
Pk
WHINK PRODUCTS
993-4910X
DISHWASHER CLEANER
Size
Oz
No.
No.
Shf
Pk
Unit
12
($
EARTH FRIENDLY PRODUCTS
7+.6
02011
FABRIC SOFTENER
‡,1'5<(5&/27+6
‡³$50+$00(5´
LQ PRLVW GU\HU FORWKV DUH D
FRPELQDWLRQRIDOLTXLGIDEULFVRIW
QHU DQG D GU\HU VKHHW &RQWUROV
VWDWLFZLWK&ODVVLF)UHVK6FHQW,Q
FOXGHVVKHHWV
Our No.
No.
Shf
Pk
Unit
10
($
CHURCH & DWIGHT
069-7268
32 Oz
931-2679
3/
METAL CLEANER
‡67$,1/(6667((/&233(5
&+520(
‡32:'(5
‡³./((1.,1*´
Our No.
No.
Toilet & Sink Repair
Size
Oz
Shf
Pk
Unit
14
12
($
FAULTLESS STARCH
529-0762X
7,+
03020
‡/,48,'
‡³68$9,7(/´
SPECIALTY CLEANERS
&OHDQV DQG EULJKWHQV VWDLQOHVV
VWHHO FRSSHU DQG FKURPH 5H
PRYHV WDUQLVK KHDW DQG IRRG VWDLQV ZLWK FKHPLFDO DF
WLRQ 5HPRYHV KDUG ZDWHU VWDLQV DQG PLQHUDO GHSRVLWV
1RQWR[LFDQWLWDUQLVKIRUPXOD
FABRIC SOFTENER
*LYHV FORWKHV DQ LUUHVLVWLEOH VRIW
QHVV/HDYHVDUHIUHVKLQJOLQHGULHG
VFHQW0DNHVLURQLQJHDVLHU
GARBAGE DISPOSAL
CLEANER
Size
Oz
‡³',6326(5&$5(´
Our No.
&OHDQV DQG GHRGRUL]HV \RXU JDU
EDJH GLVSRVHU %OXH IRDPLQJ DF
WLRQ VFUXEV DZD\ IRRG JUHDVH
DQG RGRUV FOHDQLQJ \RXU HQWLUH
JDUEDJH GLVSRVHU DQG GUDLQ OHDYLQJ D SOHDVDQW OHPRQ
IUHVK VFHQW (DV\ WR XVH 1RQFRUURVLYH ELRGHJUDGDEOH
DQGVDIHIRUWKHVHSWLFV\VWHP,WLVDOVRVDIHIRUSLSHVRI
DOODJHVLQFOXGLQJ39&SLSHV3DFNRI
DOT FOODS, INC. COLGATE PALMOLIVE
Our No.
No.
Shf
Pk
'313%
Shf
Pk
Unit
12
($
Shf
Pk
Unit
Field Flower Scent
847-9891X
FABRIC SOFTENER
Unit
‡/,48,'
‡³'2:1<8/75$´
($
6RIWHQV DQG FRQWUROV VWDWLF FOLQJ
ZLWK $SULO )UHVK VFHQW &RQWDLQV
HQRXJKIRUDERXWORDGVRIZDVK
IRON OUT INC
368-8645
No.
Our No.
No.
Size
Oz
PROCTER & GAMBLE
624-7993X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
34
($
108 - Maintenance, Repair & Operations
FABRIC SOFTENER
LAUNDRY DETERGENT
‡6+((76
‡³%281&(´
‡67$57(5.,76+((76
‡³385(;LQ´
5HPRYHVVWDWLFFOLQJIURPFORWKLQJ
ZLWKDQ2XWGRRU)UHVKVFHQW
&RPSOHWH LQ ODXQGU\ NLW LQ
cludes 1 dispenser and 20 laundry
VKHHWV (DFK VKHHW LQFOXGHV WKH
GHWHUJHQW VRIWQHU DQG DQWLVWDWLF
'URSLQZDVKHUWUDQVIHUZLWKFORWKHVWRGU\HU8VH6.8
1R WR UH¿OO VWDUWHU NLW 5H¿OO LQ
FOXGHVVKHHWV
Our No.
No.
Count
Shf
Pk
Unit
25
15
($
PROCTER & GAMBLE
624-8017X
Our No.
LAUNDRY STAIN
REMOVERS
Shf
Pk
No.
Unit
DIAL CORPORATION
Spring Oasis
FABRIC SOFTENER
255-9458X
8
($
‡35(75($7(5
‡³2;,&/($10$;)25&(´
LQSRZHUJHOVWLFNKDVW\SHV
RI VWDLQ ¿JKWHUV ZLWK D VSHFLDO
VFUXEELQJWRSWRKHOSUHPRYH\RXU
WRXJKHVW GULHGLQ VWDLQV WKH VW WLPH *UDVV DQG EORRG
IRRGVWDLQVVRLODQGFOD\JUHDVHDQGRLO8OWUDFRQFHQ
WUDWHGJHOKDVVWDLQJUDEELQJQXEVWKDWKHOSEUHDNDSDUW
DQG UHPRYH VWDLQV ZLWKRXW GDPDJLQJ IDEULF 7UHDW QRZ
DQGZDVKODWHUXSWRRQHZHHNEHIRUHZDVKLQJ1RQ
VWDLQLQJEOXHIRUPXODOHWV\RXVHHZKHUH\RX¶YHWUHDWHG
WKHQULQVHVDZD\FOHDQ
Our No.
No.
‡³385(;&5<67$/6´
CHURCH & DWIGHT
QDWXUDO FU\VWDOV WKDW JR LQ DW
WKHVWDUWRIWKHZDVK2]
064-2066
Our No.
No.
Scent
51355
Size
Oz
Shf
Pk
Unit
12
($
Size
Oz
Shf
Pk
Unit
12
($
LAUNDRY DETERGENT
Shf
Pk
‡/,48,'
‡³:22/,7(´
Unit
DIAL CORPORATION
255-9466X
)UHVK6SULQJ:DWHUV
($
255-9474X
/DYHQGHU%ORVVRP
($
255-9482X
7URSLFDO6SODVK
($
LAUNDRY STAIN
REMOVERS
6DIHO\FOHDQVDOOPDFKLQHZDVKDEOH
IDEULFV 6SHFLDOO\GHVLJQHG IRUPX
ODV FRQWDLQ QR EOHDFK SKRVSKDWHV
RU HQ]\PHV DQG ZLOO QRW FDXVH
VKULQNLQJVWUHWFKLQJRUIDGLQJ
Our No.
Size
Oz
No.
‡³2;,&/($1´
Shf
Pk
8VH RQ ZLQH DQG WRPDWR VDXFH
VWDLQV )DVW DFWLQJ DQG FKORULQH
IUHH7ULJJHU6SUD\
Unit
RECKITT BENCKISER
448-6650X
Our No.
12
($
LAUNDRY BOOSTER
No.
CHURCH & DWIGHT
222-1455
‡³%25$;´
$FWVDVDZDWHUFRQGLWLRQHUERRVW
LQJ WKH FOHDQLQJ SRZHU RI GHWHU
JHQW +HOSV JHW ULG RI RGRUV UH
GXFH VWDLQLQJ LQ GLDSHUV FDUSHWV
RUXSKROVWHU\PDNHVGLDSHUVPRUH
DEVRUEHQWFOHDQVDQGGHRGRUL]HUHIULJHUDWRUVWRLOHWVDQG
JDUEDJHSDLOV1DWXUDOO\RFFXUULQJPLQHUDOFRPSRVHGRI
VRGLXPERURQR[\JHQDQGZDWHU1RWKDUPIXOWRZDVK
LQJPDFKLQHVSOXPELQJRUVHSWLFWDQNV'RHVQRWFRQWDLQ
SKRVSKDWHVRUFKORULQH$OVRXVHDVDKRXVHKROGFOHDQHU
Our No.
No.
Size
Oz
Shf
Pk
Unit
DIAL CORPORATION
110-6103X
00201
LAUNDRY BARS
)RU SUHWUHDWLQJ JUHDV\ RLO\ VWDLQV
OLNH SHUVSLUDWLRQ VWDLQV DQG ULQJ
DURXQGWKH FROODU :RUNV RQ VWDLQV
PDGH E\ FKRFRODWH SHUVSLUDWLRQ
EDE\ IRUPXOD DQG PDNHXS &DQ
HOLPLQDWHSRLVRQLY\UHVLQIURP\RXUFORWKLQJ
Our No.
No.
‡³:+,7(%5,7(´
Size
Oz
Shf
Pk
Unit
24
($
DIAL CORPORATION
595-8970
($
LAUNDRY STAIN
REMOVERS
‡³)(/61$37+$´
/DXQGU\ DGGLWLYH DQG ERRVWHU GH
VLJQHG IRU XVH ZLWK UHJXODU GH
WHUJHQW 5HPRYHV \HOORZLQJ UXVW
VWDLQV DQG FRORU UXQV IURP ZKLWH
ZDVKDEOH IDEULFV 7RXJK RQ VWDLQV DQG HDV\ RQ IDEULF
%HWWHUDQGVDIHUWKDQEOHDFK
Our No.
‡/,48,'
‡8/75$&21&(175$7(
‡³385(;´
Shf
Pk
&RPELQHVW\SHVRIVWDLQ¿JKWHUV
WR JHW RXW PRUH RI \RXU WRXJKHVW
GULHGLQVWDLQV ZKLFK LQFOXGHV
JUDVV DQG EORRG JUHDVH DQG RLO
IRRGVWDLQVVRLODQGFOD\
Our No.
Mountain Breeze
50
887-7862
50
No.
($
($
Size
Oz
Shf
Pk
Unit
12
($
Trigger Spray
247-3130
:%1<21
30
($
‡67,&.
‡³635$<C1:$6+´
CHURCH & DWIGHT
Unit
DIAL CORPORATION
463-5546
Unit
LAUNDRY STAIN
REMOVERS
‡³2;,&/($10$;)25&(´
)RUPXODWHG ZLWK VWDLQ ¿JKWLQJ DF
WLYHV ZKHQ SUHWUHDWHG UHPRYHV
VWDLQV 3HQHWUDWHV GHHS GRZQ LQWR
IDEULF¿EHUVUHPRYLQJJURXQGLQGLUWDQGVRLOV3XUH&OHDQ
WHFKQRORJ\:KLWHUZKLWHVDQGEULJKWHUFRORUV&RQWDLQV
HQRXJKIRUDERXWORDGV
Size
Oz
Shf
Pk
LAUNDRY STAIN
REMOVERS
LAUNDRY DETERGENT
No.
Size
Oz
IRON OUT INC
646-9605
Our No.
No.
51244
12
3UHZDVK WUHDWPHQW VSHFLDOO\ IRU
mulated so you can treat stains
ZKHQWKH\KDSSHQDQGWKHQZDVK
ODWHUXSWRDZHHNODWHU(IIHFWLYHDQGVDIHVWDLQUHPRYDO
RQDOOW\SHVRIIDEULFV
Our No.
No.
Size
Oz
Shf
Pk
Unit
12
($
RECKITT BENCKISER
607-3183
Original Fresh
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - LAUNDRY STAIN
REMOVERS
‡³635$<C1:$6+´
3UHZDVK WUHDWPHQW (IIHFWLYH DQG
VDIH VWDLQ UHPRYDO RQ DOO W\SHV RI
IDEULFV
Our No.
Size
Oz
No.
Shf
Pk
Unit
RECKITT BENCKISER
LIQUID BLEACH
DRY BLEACH
‡&21&(175$7(
‡³&/252;´
‡&2/256$)(
‡³&/252;´
6WDLQ¿JKWHUDQGFRORUERRVWHUDQG
ZKLWHQVZKLWHV&OHDQVORDGV
8VHZLWKGHWHUJHQWLQHYHU\ORDGWR
SRZHURXWWRXJKVWDLQVDQGEULJKW
HQIDEULFVIRUEULOOLDQWFRORUVDQGYL
EUDQW ZKLWHV 6SHFLDOO\ IRUPXODWHG
WR UHPRYH WRXJK VWDLQV 6SHFLDO EULJKWHQHUV GHVLJQHG
WRERRVW\RXUFRORUV(IIHFWLYHLQERWKVWDQGDUGDQG+(
KLJKHI¿FLHQF\PDFKLQHV
Our No.
No.
Size
Oz
Unit
CLOROX COMPANY
Trigger Spray
651-3618
Shf
Pk
22
Original
12
617-9642X
($
33
($
Our No.
LIQUID BLEACH
9HUVDWLOH XVH DV SRZGHU PL[HG
LQWR D VROXWLRQ RU SDVWH IRU KRPH
XVHRQFDUSHWVFORWKLQJDQGODXQ
GU\RUIRUNLWFKHQDQGEDWKURRP6DIHIRUFRORUHGIDEULFV
DQGVXUIDFHV&KORULQHRGRUIUHH
Our No.
Size
Oz
No.
Shf
Pk
04581
32
8
Size
Oz
Shf
Pk
Unit
2
12
($
CLOROX COMPANY
*$/
128
LIQUID BLEACH
8VH LQ WKH EDWKURRP DQG NLWFKHQ
IRU DQ HDV\ ZD\ WR UHPRYH VWDLQV
RQWLOHJURXWFDXONLQJDQGSRUFH
ODLQ 8VH RQ ODXQGU\ WR JHW ULG RI
VWDLQVRQFORWKHV'XDOWLSSHGDSSOLFDWRU¿QHSRLQWDQG
EURDGVFUXEEHUWLSV
687-1842
Unit
($
‡*(/08/7,385326(
‡³&/252;´
No.
No.
Shf
Pk
Regular Scent
440-5544X
BLEACH PEN
Our No.
Our No.
Shf
Pk
Regular Scent
128
*$/
‡+,*+()),&,(1&<
0$&+,1(6
:KLWHQLQJ IRUPXOD WKDW JHWV HYHQ
\RXU GLUWLHVW FORWKHV ZKLWH LQ D
VPDOOHUERWWOHWKDW¶VHDV\WRKDQGOH
DQGSRXU
&ORUR[ +LJK (I¿FLHQF\ %OHDFK KDV
WKH SRZHU WR NHHS \RXU ZKLWHV
ZKLWH,W¶VIRUPXODWHGWRZRUNZLWK
LQ WKH PHFKDQLFV RI \RXU KLJK HI
¿FLHQF\ZDVKLQJPDFKLQHWRJLYH\RXWKHZKLWHVWZKLWHV
7KLFNHUIRUPXODJLYHV\RXFRQWUROPDNLQJLWHDV\WRSRXU
ZLWKOHVVVSODVKLQJ2]
Scent
Shf
Pk
Unit
CLOROX COMPANY
Our No.
182 Ounce
318-7986X
02513
5HJXODU
3
($
02450
5HJXODU
12
($
Scent
Shf
Pk
02510
5HJXODU
8
($
613-4217X
02452
5HJXODU
($
&OHDQ/LQHQ
($
829-5347X
)UHVK0HDGRZ
($
809-2017X
/DYHQGHU
($
45
($
Unit
&OHDQV FORWKHV QDWXUDOO\ DQG ZLWK
WKHSRZHU\RXH[SHFWIURP&ORUR[
WR UHPRYH WRXJK GLUW DQG VWDLQV &RQWDLQV SODQWEDVHG
LQJUHGLHQWV WKDW DUH ELRGHJUDGDEOH )RU $// ZDVKLQJ
PDFKLQHV LQFOXGLQJ +( 1R RXQFH FRQWDLQV
HQRXJKIRUDERXWORDGVRIZDVK1RRXQFH
FRQWDLQVHQRXJKIRUDERXWORDGVRIZDVK
Our No.
359-5261X
2ULJLQDO
($
359-5253X
)UHVK0HDGRZ
($
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
Original Scent
752-6320X
45
($
232-8102X
4
($
96 Ounce
822-5153X
‡1$785$/
‡³*5((1:25.6´
60 Ounce
961-1898X
Unit
LAUNDRY
DETERGENT
CLOROX COMPANY
24 Ounce
317-3804X
No.
Shf
Pk
Unit
JAMES AUSTIN CO
098-1068X
Size
Oz
No.
Lavendar Scent
032-9623X
LIQUID BLEACH
No.
&OHDQV FORWKHV QDWXUDOO\ &OHDQV
ZLWK WKH SRZHU \RX H[SHFW IURP
&ORUR[WRUHPRYHWRXJKGLUWDQGVWDLQV&RQWDLQVSODQW
EDVHGLQJUHGLHQWVWKDWDUHELRGHJUDGDEOH)RU$//ZDVK
LQJ PDFKLQHV LQFOXGLQJ +( RXQFH FRQWDLQV HQRXJK
IRUDERXWORDGVRIZDVK
CLOROX COMPANY
Size
Oz
($
‡1$785$/
‡³*5((1:25.6´
:RUNV ZLWK GHWHUJHQW LQ SURYLG
LQJ D ZKLWHU EULJKWHU DQG FOHDQHU
ZDVK (IIHFWLYH GHRGRUDQW DQG
VWDLQUHPRYHUIRUFOHDQLQJSXUSRV
HVUHJXODUEOHDFK
No.
LAUNDRY
DETERGENT
Our No.
LIQUID BLEACH
Our No.
‡³$%/($&+´
Our No.
Unit
LAUNDRY DETERGENTS
JAMES AUSTIN CO
Unit
CLOROX COMPANY
026-9621X
6WDLQ UHPRYHU JHQHUDO VXUIDFH
FOHDQHUDQGGHRGRUDQWUHJXODU
EOHDFK
Size
Oz
Shf
Pk
Chemicals,Cleaners & Cleaning
Implements
‡³%/($&+´
‡08/7,385326(32:'(5
‡³2;<*(1$&7,21´
Size
Oz
CLOROX COMPANY
341-8795X
LAUNDRY STAIN
REMOVERS
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
110 - Maintenance, Repair & Operations
LAUNDRY
DETERGENT
‡1$785$/
‡³*5((1:25.6´
&OHDQV FORWKHV QDWXUDOO\ DQG ZLWK
WKHSRZHU\RXH[SHFWIURP&ORUR[
WR UHPRYH WRXJK GLUW DQG VWDLQV &RQWDLQV SODQWEDVHG
LQJUHGLHQWV WKDW DUH ELRGHJUDGDEOH )RU $// ZDVKLQJ
PDFKLQHV LQFOXGLQJ +( RXQFH FRQWDLQV HQRXJK IRU
DERXWORDGVRXQFHFRQWDLQVHQRXJKIRUDERXW
ORDGVRIZDVK
Our No.
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
Free and Clear
651-8260X
45
($
890-2678X
30320
4
($
LAUNDRY DETERGENT
LAUNDRY DETERGENT
‡/,48,';
&21&(175$7('
‡³;75$´
‡/,48,'
‡³*$,1´
;WUD OLTXLG ODXQGU\ GHWHUJHQW ,Q
FOXGHV ELRGHJUDGDEOH VXUIDFWDQWV
$QLRQLF DQG 1RQLRQLF 6DIH IRU
VHSWLFWDQNV&RQWDLQVQRSKRVSKDWH1RHQRXJK
IRUDERXWORDGVRIZDVK1RHQRXJKIRUDERXW
ORDGVRIZDVK
Our No.
No.
Size
In
Shf
Pk
704-9562X
Our No.
No.
Size
Oz
Shf
Pk
194-6466X
8
($
32
($
LAUNDRY DETERGENT
464-8077X
41300
300
2
($
‡32:'(5
‡³$50+$00(5´
No.
Size
Oz
Shf
Pk
Unit
PROCTER & GAMBLE
Unit
($
)RUPXODWHG ZLWK GHHS FOHDQLQJ
VWDLQ¿JKWHUVWRKHOSUHPRYHWRXJK
VWDLQV 3URYLGHV HQKDQFHG FOHDQ
LQJ SHUIRUPDQFH ZKLOH KHOSLQJ WR
SURWHFW IDEULFV IURP IDGLQJ E\ QHXWUDOL]LQJ WKH FKORULQH
LQZDVKZDWHU&RQWDLQVVRLOVXVSHQGLQJDJHQWVGHVLJQHG
WRWUDSWKHGLUWLQWKHZDVKZDWHUNHHSLQJLWIURPUHGH
SRVLWLQJLQ\RXUFORWKHV1HXWUDOL]HVRGRUVLQ\RXUZDVK
OHDYLQJ\RXUFORWKHVVPHOOLQJIUHVK&RQWDLQVHQRXJKIRU
DERXWORDGV
Our No.
126-8507X
25
($
467-3489X
50
($
No.
Size
Lb
Shf
Pk
Unit
CHURCH & DWIGHT
Clean Burst Scent
173-1447X
Original Scent
50
Shf
Pk
Mountain Rain Scent - Jug
CHURCH & DWIGHT
Clean Burst Scent
Our No.
Unit
Size
Oz
487-0002X
7ZLFHWKHVWDLQ¿JKWLQJSRZHUHQ
DEOLQJ XVHU WR JHW VDPH QXPEHU
RI ORDGV LQ D VPDOOHU ERWWOH 1HZ
IRUPXODUHPRYHV VWDLQEHWWHU WKDQ
EHIRUH1RFRQWDLQVHQRXJK
IRUDERXWORDGV1RFRQWDLQVHQRXJKIRUDERXW
32 loads
Formulated to help remove tough
GLUW DQG RGRUV IURP \RXU FORWKHV
&RQWDLQVVSHFLDOEULJKWHQLQJLQJUH
GLHQWVWKDWJLYHVZKLWHUZKLWHVDQG
EULJKWHUFRORUV&RQWDLQVHQRXJKIRUDERXWORDGV
No.
PROCTER & GAMBLE
Unit
‡/,48,';8/75$
‡/,48,';&21&(175$7(
‡³$50$1'+$00(5´
Our No.
CHURCH & DWIGHT
LAUNDRY DETERGENT
LAUNDRY DETERGENT
&RQWDLQV HQRXJK IRU ORDGV
/DXQGU\ VWD\V IUHVKHU ORQJHU ZLWK
.HHS,W )UHVK IRUPXOD 2ULJLQDO
IUHVKVFHQW
4
4
($
LAUNDRY DETERGENT
LAUNDRY DETERGENT
LAUNDRY DETERGENT
‡/,48,';&21&(175$7(
‡³(;75$2;,&/($1´
‡/,48,':,7+'2:1<
‡³7,'(´
&OHDQVHQRXJKIRUORDGV&U\VWDO
&OHDQVFHQW
Our No.
No.
Size
Oz
Shf
Pk
Unit
CHURCH & DWIGHT
952-7391
41550
($
%DNLQJ VRGD IUHVK FRPELQHV WKH
FOHDQLQJ DQG IUHVKHQLQJ SRZHU RI
$UP+DPPHUGHWHUJHQWZLWK2[L
&OHDQ6WDLQ)LJKWHUV&OHDQVRYHUVWDLQV\HWLVFRORU
VDIH1RIDGLQJQREOHDFKLQJ7KLVSDFNDJHFRQWDLQVGH
WHUJHQWIRUPHGLXPORDGVRIZDVK)UHVK6FHQW
8VHVWKHFRPELQDWLRQRIGHWHUJHQW
DQG IDEULF VRIWHQHU IRU VWDLQ UH
PRYDOZKLWHQHVVEULJKWFRORUVDQG
VRIWHQ&RQWDLQVHQRXJKIRUDERXW
ORDGVRIZDVK
Our No.
58
‡32:'(5
‡³$50+$00(52;,
&/($1´
No.
Size
Oz
Shf
Pk
Our No.
Unit
PROCTER & GAMBLE
No.
Size
Lb
Shf
Pk
4
Unit
CHURCH & DWIGHT
865-3297
($
April Fresh Scent
196-7751
13844
50
($
LAUNDRY DETERGENT
LAUNDRY DETERGENT
‡³$50+$00(52;,
&/($1´
&OHDQV RYHU VWDLQV %DNLQJ
VRGD IUHVK ZKLWHU ZKLWHV DQG
EULJKWHUEULJKWV)UHVK6FHQW
Our No.
No.
‡/,48,'
‡³;8/75$7,'(
&2/':$7(5´
Size
Oz
Shf
Pk
Unit
CHURCH & DWIGHT
272-1991
‡32:'(5
‡³$50$1'+$00(5´
LAUNDRY DETERGENT
($
3URYLGHV D GHHS FOHDQ LQ WKH FDUH
RI FROGZDWHU 5HPRYHV VWDLQV DQG
KHOSV FRORUV VWD\ EULJKWHU DQG
ZKLWHV VWD\ ZKLWHU &RQWDLQV HQRXJK RI DERXW ORDGV
RIZDVK
Our No.
No.
Size
Oz
Shf
Pk
$OO QDWXUDO 6XSHU :DVKLQJ 6RGD
:RUNV DV D ODXQGU\ GHWHUJHQW
ERRVWHUDQGDVDKRXVHKROGFOHDQ
HU
Our No.
473-9587X
Unit
Fresh Scent
50
Size
Oz
Shf
Pk
Unit
55
12
($
CHURCH & DWIGHT
PROCTER & GAMBLE
227-0239
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
03020
Maintenance, Repair & Operations - 111
LAUNDRY DETERGENT
LAUNDRY DETERGENT
‡32:'(5
‡³7,'(´
‡)5((&/($5
:LWK GHHS FOHDQLQJ DFWLYDWHG +\
GURJHQ 3HUR[LGH 1R FRQ
WDLQVHQRXJKIRUDERXWORDGVRI
ZDVK 1R FRQWDLQV HQRXJK
IRUDERXWORDGVRIZDVK
Our No.
No.
Size
Oz
Shf
Pk
Unit
PROCTER & GAMBLE
624-7878
15
($
403-5648X
211
2
($
DISHWASHER
DETERGENT
&DQ EH XVHG LQ +( PDFKLQHV RU
VWDQGDUG PDFKLQHV :LOO QRW IDGH
FRORU RU UHGXFH LQWHJULW\ RI IDEULF
)UHH&OHDUIRUPXODGRHVQRWFRQ
WDLQ DQ\ VFHQWV RU IDEULF VRIWHQHU
PDNLQJ LW LGHDO IRU SULVRQV QXUVLQJ KRPHV DQG PLFUR
¿EHU FDUH 0DGH ZLWK RQO\ VXVWDLQDEOH SODQW
EDVHG LQJUHGLHQWV 'RHV QRW FRQWDLQ G\HV RU V\QWKHWLF
SHUIXPHV QHXWUDO S+ JUH\ZDWHU DQG VHSWLF VDIH 5HF
RJQL]HGIRUVDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQIRUWKH
(QYLURQPHQW3URJUDP
Our No.
Shf
Pk
No.
Unit
EARTH FRIENDLY PRODUCTS
100 Oz
LAUNDRY DETERGENT
016-1695
‡32:'(5
‡³7,'(+(´
)RU KLJK HI¿FLHQF\ ZDVKHUV )RU
PXODWHG WR SURYLGH FOHDQLQJ ZLWK
WKHULJKWDPRXQWRIVXGV&RQWDLQV
HQRXJKIRUDERXWORDGVRIZDVK
Our No.
No.
Size
Oz
‡0$*12/,$/,/<
Shf
Pk
Unit
($
LAUNDRY DETERGENT
&DQ EH XVHG LQ +( PDFKLQHV RU
VWDQGDUG PDFKLQHV :LOO QRW IDGH
FRORU RU UHGXFH LQWHJULW\ RI IDEULF
&RQWDLQV QDWXUDO FRFRQXWEDVHG
IDEULF VRIWHQHU 0DGH ZLWK RQO\
VXVWDLQDEOH SODQWEDVHG LQJUHGLHQWV 'RHV QRW
FRQWDLQG\HVRUV\QWKHWLFSHUIXPHVQHXWUDOS+JUH\ZD
WHUDQGVHSWLFVDIH5HFRJQL]HGIRUVDIHUFKHPLVWU\E\WKH
(3$¶V'HVLJQIRUWKH(QYLURQPHQW3URJUDP
‡32:'(5
‡48,&.',662/9,1*
‡³7,'(´
Our No.
+HOSVNHHSHYHU\GD\ODXQGU\ORRN
LQJ FOHDQ DQG QHZ 4XLFN GLVVROY
LQJLVIRUPXODWHGWRGLVVROYHLQDQ\
WHPSHUDWXUH &RQWDLQV HQRXJK IRU DERXW ORDGV RI
ZDVK
125-0364
Our No.
No.
Size
Oz
Shf
Pk
Unit
4
No.
988-7258X
Shf
Pk
Unit
213
($
Our No.
No.
Size
Oz
Shf
Pk
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
016-3287
($
DISHWASHER
DETERGENT
‡,17$%6+($9<'87<
‡-(7'5<32:(5%$//
‡³(/(&75$62/´
6FUXEV RII KHDY\ IRRG EUHDNV
GRZQ EDNHGRQ IRRGV ZLWK WKH
FRPELQHG FOHDQLQJ RI SUHVRDNHUV GHWHUJHQW DQG -(7
'5<5LQVH$JHQW-HWGU\ULQVHDJHQWOHDYHVGLVKHVVKLQ\
DQGVSRWOHVV
Our No.
No.
Count
Shf
Pk
Unit
8
3.
RECKITT BENCKISER
Orange Scent
639-4142
20
DISHWASHER
DETERGENT
‡,1$&7,213$&6
‡³&$6&$'(´
Our No.
No.
Size
Oz
Shf
Pk
5
Unit
PROCTER & GAMBLE
577-5564
Shf
Pk
Unit
DISHWASHER
DETERGENT
12
($
‡*(/:,7+6+,1(6+,(/'
‡³&$6&$'(´
($
&RPELQDWLRQ RI WKH FOHDQLQJ RI
&DVFDGH ZLWK WKH JUHDVH¿JKWLQJ
SRZHURI'DZQ)UHVK6FHQW
Chemicals,Cleaners & Cleaning
Implements
DISH DETERGENT
)UHVK/HPRQ6SODVK6FHQW)UHHRI
SKRVSKDWH
&RQFHQWUDWHG LQ DFWLRQ SDFV
TXLFNO\GLVVROYHLQZDWHU&RPELQHV
WKH FOHDQLQJ RI FDVFDGH ZLWK WKH
JUHDVH¿JKWLQJSRZHURIGDZQLQDZDWHUVROXEOHSRXFK
6KLQHVDQGUHPRYHVVWDLQVZLWKWKHFRPELQDWLRQRIOLTXLG
DQGSRZGHUFRXQW)UHVK6FHQW
SMELLY WASHER INC.
PROCTER & GAMBLE
883-0663
($
TOWEL/CLOTHES
ODOR CLEANER
Our No.
2IIHUV FRORUVDIH EOHDFK +HOSV
UHPRYH WRXJK VWDLQV ZLWKRXW
WKH GDPDJLQJ HIIHFWV RI FKORULQH
EOHDFK&RQWDLQVHQRXJKIRUDERXW
ORDGVRIZDVK
No.
4
3/
6PHOO\ 7RZHO &OHDQHU ZLOO UHPRYH
PLOGHZRGRUIURP\RXUWRZHOVDQG
FORWKLQJ DQG DOVR PDNHV D JUHDW
GHWHUJHQWERRVWHU-XVWDWHDVSRRQ
ZLWK \RXU GHWHUJHQW HYHQ OLTXLG
GHWHUJHQWZLOOHQKDQFHFRORUVDQGNHHS\RXUWRZHOVDQG
FORWKLQJORRNLQJOLNHQHZR]ERWWOH
($
‡32:'(5:,7+%/($&+
‡³7,'(´
Our No.
Unit
100 Oz
LAUNDRY DETERGENT
Size
Oz
Shf
Pk
No.
EARTH FRIENDLY PRODUCTS
PROCTER & GAMBLE
419-0393
($
LAUNDRY DETERGENT
PROCTER & GAMBLE
381-9851
4
3/
‡*(/
‡³3$/02/,9((&2´
Our No.
No.
Size
Oz
Shf
Pk
Unit
PROCTER & GAMBLE
DISHWASHER
DETERGENT
637-2619
45
($
‡*(/%$.,1*62'$
‡³3$/02/,9(´
6XSHULRU RQ VWDLQ UHPRYDO VSRW
SUHYHQWLRQ¿OPSUHYHQWLRQDQGUH
PRYLQJWRXJKIRRGVRLOV
Our No.
No.
Size
Oz
DISHWASHER
DETERGENT
Shf
Pk
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
591-9303
45
($
‡$8720$7,&32:'(5
‡³&$6&$'(´
+HOSVWRSURWHFWGLVKHVDQGJODVVHV
IURPEHFRPLQJGXOO:LWKVKHHWLQJ
action to leave dishes clean and
YLUWXDOO\VSRWOHVV)UHVK6FHQW
Our No.
No.
Size
Oz
Shf
Pk
Unit
45
14
($
PROCTER & GAMBLE
689-5510
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
34034
112 - Maintenance, Repair & Operations
DISHWASHER
DETERGENT
SHUFHQWQDWXUDOELRGHJUDGDEOH
SODQW EDVHG GLVK OLTXLG ZLWKRXW
KDUVKFKHPLFDOV
&RPELQDWLRQ RI WKH FOHDQLQJ RI
&DVFDGH ZLWK WKH JUHDVH ¿JKWLQJ
SRZHURI'DZQ
No.
Size
Oz
Shf
Pk
Scent
Our No.
Unit
Size
Oz
No.
Unit
)UHVK6FHQW
($
043-0694
34041
/HPRQ6FHQW
($
333-1766X
22
12
($
12
($
Original
105-7033X
22
8OWUD 3DOPROLYH DQWLEDFWHULDO GLVK
OLTXLGZLWKRUDQJHH[WUDFWV7RXJK
DW UHPRYLQJ DOO NLQGV RI JUHDVH
ZKLOH VWLOO EHLQJ PLOG RQ KDQGV
$QWLEDFWHULDOSURWHFWLRQIRUKDQGVZKHQXVHGDVDKDQG
VRDS
Our No.
Free and Clear
248-6132
‡/,48,'
‡³$-$;´
$OOLQRQH DFWLRQ 5HPRYHV HYHQ
WKH WRXJKHVW IRRG UHVLGXH JHQWO\
VFUXEV\RXUGLVKHVJODVVHVDQGVLO
YHUZDUHVSDUNOLQJFOHDQ-HW'U\ULQVHDJHQWDFWLRQKHOSV
HOLPLQDWHVSRWVDQG¿OP3URWHFWVIURPSHUPDQHQWHWFK
LQJVDIHIRUVHSWLFV\VWHPV&RQWDLQVJHOSDFNV
Shf
Pk
No.
Unit
24
($
Shf
Pk
Unit
24
($
20
($
DOT FOODS, INC. COLGATE PALMOLIVE
273-6999X
Unit
8
Our No.
Size
Oz
No.
Our No.
Shf
Pk
Unit
Regular
988-2598X
Antibacterial Orange
Ultra
24
($
24
($
881-8643X
Lemon
348-5364X
Size
Oz
No.
DOT FOODS, INC. COLGATE PALMOLIVE
DOT FOODS, INC. COLGATE PALMOLIVE
589-4142X
($
5HPRYHVEDNHGRQJUHDVH/HDYHV
\RX GLVKHV VSDUNOLQJ 0LOG RQ
KDQGV
&XWVWKURXJKJUHDVHWROHDYHGLVKHV
VSDUNOLQJFOHDQ/RQJODVWLQJVXGV
$QWLEDFWHULDOVRDS¿JKWV JHUPV RQ
KDQGV
RECKITT BENCKISER
DISHWASHER
DETERGENT
10
DISH DETERGENT
‡³'$:1´
‡³:$9(´
3DWHQWHG IRUPXOD FRQWDLQV QR
SKRVSKDWHV DQG KDV QHXWUDO S+
&OHDQVGLVKHVDQGJODVVZDUHZLWK
RXW VFUDWFKLQJ HWFKLQJ RU KD]LQJ
0DGH ZLWK RQO\ VXVWDLQDEOH SODQWEDVHG LQJUH
GLHQWV 'RHV QRW FRQWDLQ G\HV RU V\QWKHWLF SHUIXPHV
QHXWUDO S+ JUH\ZDWHU DQG VHSWLF VDIH 5HFRJQL]HG IRU
VDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQIRUWKH(QYLURQPHQW
3URJUDP
No.
Shf
Pk
‡/,48,'
‡³3$/02/,9(´
DISH DETERGENT
‡*(/3$&.
‡³(/(&75$62/´
Our No.
Size
Oz
No.
DISH DETERGENT
DISHWASHER
DETERGENT
055-2190X
Shf
Pk
CLOROX COMPANY
PROCTER & GAMBLE
Our No.
‡/,48,'$17,%$&7(5,$/
‡³3$/02/,9(´
‡/,48,'*5((1:25.6
‡³&/252;´
‡32:'(5:,7+6+,1(
6+,(/'
‡³&$6&$'(´
Our No.
DISH DETERGENT
DISH DETERGENT
Scent
Shf
Pk
Unit
'LVKZDVKLQJ OLTXLG IRU KDQGZDVK
LQJRISRWVSDQVDQGGLVKHV)UHVK
VTXHH]HGFLWUXVVFHQW3XOO7RS
Our No.
No.
Size
Oz
Our No.
Size
Oz
No.
Shf
Pk
Unit
10
($
PROCTER & GAMBLE
Shf
Pk
Ultra - Orginal Scent
Unit
SUNSHINE MAKERS
994-2228
EARTH FRIENDLY PRODUCTS
'DZQOLTXLGVRDS1RQFRQFHQWUDW
HG
DISH DETERGENT
‡/,48,'&21&(175$7(
‡³6,03/(*5((1
1$785$/6´
12
043-8622
22205
24
Ultra Antibacterial - Orange Scent
($
043-8630
24
10
($
40 Oz
098-8519
3/
/DYHQGHU
8
($
973-4468
3/
)UHH&OHDU
8
($
DISH DETERGENT
DISHWASHER
DETERGENT ADDITIVE
3HUIRUPDQFH ERRVWHU WR EH XVHG
DORQJ ZLWK DXWRPDWLF GLVKZDVKHU
GHWHUJHQWWRUHPRYHPLQHUDOVIURP
KDUGZDWHUWKDWFDXVHVZKLWH¿OPGHSRVLWV
No.
Size
Oz
‡+$1'5(1(:$/:,7+
2/$<%($87<
‡³'$:1´
8OWUD 3DOPROLYH 2[\ 3OXV 2GRU
(OLPLQDWRUFRQFHQWUDWHGGLVKOLTXLG
3RZHUIXO R[\JHQDWHG FOHDQLQJ DF
WLRQOLIWVWKHWRXJKHVWEDNHGRQJUHDVHZKLOHVWLOOEHLQJ
PLOGRQKDQGV
‡3(5)250$1&(%2267(5
‡³*/$660$*,&´
Our No.
DISH DETERGENT
‡/,48,'2;<3/862'25
(/,0,1$725
‡³3$/02/,9(´
Our No.
No.
Size
Oz
Shf
Pk
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
Shf
Pk
Unit
137-0113X
20
12
'DZQ +DQG 5HQHZDO ZLWK 2OD\
%HDXW\ KHOSV VNLQ IHHO VRIWHU DQG
PRUH EHDXWLIXO ZKLOH DOVR JLYLQJ
\RXJUHDVH¿JKWLQJSRZHU*UHDWIRUKDQGVZKLOHVWLOOJLY
LQJ\RXFOHDQGLVKHV2]
Our No.
8
Scent
Shf
Pk
Unit
3RPHJUDQDWH6SODVK
10
($
PROCTER & GAMBLE
($
043-8663
RECKITT BENCKISER
621-8168X
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 113
DISH DETERGENT
‡³',6+0$7(´
6DIHO\DQGHIIHFWLYHO\FOHDQVGLVKHV
DQG FXWV JUHDVH 1DWXUDO LQJUHGL
HQWVDUHJHQWOHRQWKHKDQGV0DGH
ZLWKRQO\VXVWDLQDEOHSODQW
EDVHG LQJUHGLHQWV 'RHV QRW FRQ
WDLQ G\HV RU V\QWKHWLF SHUIXPHV QHXWUDO S+ JUH\ZDWHU
DQG VHSWLF VDIH 5HFRJQL]HG IRU VDIHU FKHPLVWU\ E\ WKH
(3$¶V'HVLJQIRUWKH(QYLURQPHQW3URJUDP
Our No.
No.
Scent
Shf
Pk
Unit
‡*(/
‡³6&58%%,1*%8%%/(6´
‡,1'8675,$/675(1*7+
‡³&/5´
3RZHUIXODQGQRQWR[LFWKLVPXOWL
use cleaner dissolves the hardest
FDOFLXPOLPHDQGUXVWEXLOGXS&OHDQVKDUGZDWHUVWDLQV
IURPJODVVZDUHGHFDQWHUVFRIIHHDQGWHDSRWV,QVWDQWO\
UHPRYHVUXVWIURPEULFNVWXFFRSRUFHODLQFKURPHDQG
PHWDO
Our No.
EARTH FRIENDLY PRODUCTS
TOILET BOWL CLEANER
CALCIUM/LIME/
RUST REMOVER
No.
Size
Oz
Shf
Pk
Unit
(OLPLQDWHVRGRUVFOHDQVZLWKHDFK
ÀXVK DQG FOLQJV WR WKH ERZO ,Q
FOXGHV GLVSHQVHU DQG GLVFV
ZKLFKFOHDQVXSWRZHHN
Our No.
No.
Shf
Pk
Unit
12
($
Size
Oz
Shf
Pk
Unit
24
12
($
Size
Oz
Shf
Pk
Unit
24
12
($
($
Scent
SC JOHNSON
Size - 1.34”
938-3266
)UHVK0WQ0RUQLQJ
JELMAR
25 Oz
192-6146
3/
)UHH&OHDU
12
($
657-1988
&/
28
12
($
216-0869
3/
*UDSHIUXLW
12
($
600-4832
&/
128
4
($
TOILET BOWL CLEANER
‡728*+67$,1)2508/$
Chemicals,Cleaners & Cleaning
Implements
‡&$/&,805867
‡&21&(175$7(
‡³=(3´
MINERAL DEPOSIT REMOVER
KITCHEN/BATH
CLEANER
Our No.
Size
Oz
Shf
Pk
Unit
IRON OUT INC
678-3575
$21
24
Size
Oz
No.
CLOROX COMPANY
435-5335X
Shf
Pk
Unit
401-5459
=8&$/
32
12
48$57
404-7197X
=8&$/
128
4
*$/
Our No.
'DLO\ PXOWLSXUSRVH QRQWR[LF PXOWLVXUIDFH FOHDQHU
)RDP VSUD\ WKDW LQVWDQWO\ UHPRYHV FDOFLXP OLPH DQG
KDUGZDWHU GHSRVLWV GLVFRORUDWLRQ VRDS VFXP DQG GLUW
(3$¶V'I(IRUPXODIRUVDIHUFKHPLVWU\6HSWLF6DIH)UHVK
VFHQW
%.
895-2590X
4W
($
289-4368X
Shf
Pk
Unit
'LVVROYHV VRDS VFXP DQG PLQHUDO
GHSRVLWV DQG GHRGRUL]HV 6DIH
RQ SRUFHODLQ FHUDPLF WLOH JODVV
FKURPH DQG VWDLQOHVV VWHHO 0LOG EXIIHUHG DFLG 1RQ
DEUDVLYH DQG QRQÀDPPDEOH &RQWDLQV QR EOHDFK DP
PRQLDRUSKRVSKRUXV:LQWHUJUHHQVFHQW7ULJJHU6SUD\
Size
Oz
Shf
Pk
Unit
22
12
($
No.
50022
24
TOILET BOWL CLEANER
12
($
7KLFN FRDWLQJ IRUPXOD ZLWK EOHDFK
ZRUNVRQVWDLQVUXVWDQGKDUGZD
WHU&RRO:DYHVFHQW
Our No.
No.
Size
In
Shf
Pk
Unit
24
12
($
CLOROX COMPANY
680-3662
TOILET BOWL CLEANER
Size
Oz
Shf
Pk
Unit
RECKITT BENCKISER
637-0761
12
($
607-3225
24
12
($
‡352)(66,21$/
‡³9$1,62/´
+LJKDFLGERZOFOHDQHUDQGGHRGRU
L]HUIRUXVHLQKRVSLWDOVLQVWLWXWLRQ
DODQGLQGXVWULDOIDFLOLWLHV
Our No.
No.
Size
Oz
Shf
Pk
Unit
32
12
($
RECKITT BENCKISER
401-4908X
SUNSHINE MAKERS
607-3688
‡:,7+%/($&+*(/
‡³&/252;´
+HDY\GXW\DFWLRQVSHFLDOO\IRUPX
lated to remove tough rust stains
DQG PLQHUDO GHSRVLWV &RQYHQLHQW
DQJOHQHFNERWWOH
Our No.
2 Pack
Carton
‡7+,&./,48,'
',6,1)(&7$17
‡³/<62/´
‡³6,03/(*5((1´
No.
607-3514X
COMSTAR INTERNATIONAL
TOILET BOWL CLEANER
LIME SCALE
REMOVER
Our No.
Size
Unit
JELMAR
607-4900
No.
No.
CLOROX COMPANY
%ULJKWHQV DQG FOHDQV ERZOV %OXH
YLVFRXV ÀXLG FOLQJV WR ERZO DV LW
GLVVROYHVVFDOHFOHDQVDQGVKLQHV
Shf
Pk
‡:,7+%/($&+
‡³&/252;´
Our No.
‡352)(66,21$/72,/(7
%2:/&/($1(5
‡³6+,1<%2:/´
‡0,1(5$/'(326,762$3
6&805(029(5
‡121$%5$6,9(
‡³&/5´
Size
Oz
TOILET BOWL CLEANER
TOILET CARE
($
KITCHEN/BATH
CLEANER
No.
.LOOV WRLOHW ERZO JHUPV ZLWK GLV
LQIHFWLQJ SRZHU RI EOHDFK )UHVK
6FHQW
Chemicals,Cleaners & Cleaning
Implements
DELIMER/CLEANER
Our No.
No.
ACUITY SPECIALTY PRODUCTS
([WUDVWURQJWRGLVVROYHWRXJKOLPHUXVWVRDSVFXPDQG
PLQHUDO GHSRVLWV ([WUDWKLFN IRUPXOD FOLQJV WR YHUWLFDO
VXUIDFHV /HDYHV WRLOHWV VLQNV WXEV WLOH DQG VKRZHUV
IUHVKDQGFOHDQZLWKRXWVFUXEELQJ)OLS7RS%RWWOH
No.
Our No.
3URIHVVLRQDO VWUHQJWK FRQFHQWUDW
HG IDVWDFWLQJ IRUPXOD 'HVLJQHG
WRUHPRYHFDOFLXPOLPHDQGUXVW
‡&$/&,80/,0(5867
5(029(5
‡+($9<'87<121
$%5$6,9(
‡³/,0(287(;75$´
Our No.
)RU7RXJK6WDLQVZRUNVRQUXVWDQG
KDUGZDWHUVWDLQVLQWKHERZO7KH
WKLFNQRQEOHDFKIRUPXODZRUNVWR
remove the toughest stains and to
KHOSSUHYHQWWRLOHWULQJ
LIME STAIN REMOVER
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
114 - Maintenance, Repair & Operations
TOILET BOWL CLEANER
TOILET BOWL CLEANER
TOILET BOWL CLEANER
‡$8720$7,&
‡:,7+7()/21685)$&(
3527(&725
‡³&/252;´
‡%,&2/257$%/(76
$8720$7,&
‡%/8(3/86%/($&+
‡³%2:/)5(6+´
‡5(),//
‡³)/86+µ163$5./(´
/HDYHV WRLOHW ERZOV VPHOOLQJ IUHVK
ÀXVK DIWHU ÀXVK 7HÀRQ VXUIDFH
SURWHFWRU FOHDQV WRLOHWV DQG NHHSV GLUW DQG VWDLQV IURP
VWLFNLQJNHHSLQJEDWKURRPVXUIDFHVFOHDQHUORQJHU
)LJKWV VWDLQV ZLWK 2[\JHQ %OHDFK
&OHDQV DQG GHRGRUL]HV XVLQJ %R
UD[ DQG GHWHUJHQWV 3UHYHQWV VWDLQV GXH WR KDUG ZDWHU
PLQHUDO VXEVWDQFHV DQG OLPH VFDOH 6DIH IRU SOXPELQJ
DQG VHSWLF V\VWHPV (DFK WDEOHW ODVWV XS WR GD\V
1HWZHLJKWIRUHDFKWDEOHWLVR]0RXQWDLQ)UHVKIUD
JUDQFH&DUGRI
Our No.
No.
Size
Oz
Shf
Pk
Unit
CLOROX COMPANY
Blue
978-3234
Our No.
12
($
No.
Size
Oz
Shf
Pk
Unit
12
($
;7
‡$8720$7,&'523,16
‡³9$1,6+´
TOILET BOWL CLEANER
950-5504
607-0270X
00250 3
Shf
Pk
Unit
12
($
($
SC JOHNSON
'HRGRUL]HV DQG FOHDQV ZLWK HYHU\
ÀXVKWDEOHWZLOOODVWIRUXSWR
PRQWKV :LOO QRW KDUP SOXPELQJ
DQGSUHYHQWVVWDLQVGXHWRKDUGZDWHUPLQHUDOVDQGOLPH
VFDOH6DIHWRXVHDURXQGSHWVDQGFKLOGUHQ1HWZHLJKW
IRUHDFKWDEOHWLVR]7ZLQFDUWRQ
Blue
Our No.
828-5546X
'HRGRUL]HV DQG FOHDQV ZLWK HYHU\
ÀXVKWDEOHWZLOOODVWIRUXSWR
PRQWKV &RQWDLQV QR SKRVSKDWHV
RU SKRVSKRUXV FRPSRXQGV :LOO QRW KDUP SOXPELQJ RU
VHSWLFWDQNV&DUWRQ
Size
Oz
Shf
Pk
Unit
12
($
WILLERT HOME PRODUCTS
&;7
Shf
Pk
Unit
WHINK PRODUCTS
20223
12
($
Our No.
No.
Shf
Pk
Unit
148-7693
8
3
($
TOILET BOWL CLEANER
($
Our No.
Size
Oz
No.
Shf
Pk
Unit
12
($
WILLERT HOME PRODUCTS
765-2977
TOILET BOWL CLEANER
8QLTXHYLVFRXVWRLOHWERZOFOHDQHU
LVIRUPXODWHGZLWKFHGDURLODQGFLW
ULFDFLGWRVDIHO\FOHDQHUWRLOHWVXUL
QDOV DQG RWKHU FHUDPLF EDWKURRP
VXUIDFHV 5HPRYHV KDUG ZDWHU
VWDLQVDQGPLQHUDOGHSRVLWVZLWKRXW
DQ\KD]DUGRXVRURIIHQVLYHIXPHV0DGHZLWKRQO\
VXVWDLQDEOH SODQWEDVHG LQJUHGLHQWV 'RHV QRW FRQWDLQ
G\HV RU V\QWKHWLF SHUIXPHV QHXWUDO S+ JUH\ZDWHU DQG
VHSWLFVDIH5HFRJQL]HGIRUVDIHUFKHPLVWU\E\WKH(3$¶V
'HVLJQIRUWKH(QYLURQPHQW3URJUDP
Our No.
No.
Shf
Pk
Unit
12
($
EARTH FRIENDLY PRODUCTS
24 Oz
450-7059
3/
US PUMICE CO
7%5'
($
(QYLURQPHQWDOO\ IULHQGO\ FOHDQV
WRLOHWVIRUWKUHHPRQWKV(DVLO\LQ
VWDOOHG LQ OHVV WKDQ ¿YH PLQXWHV
¿WV PRVW WZRSLHFH WRLOHWV 5HSHOV
VWDLQV ZLWK HYHU\ ÀXVK ,VRODWHV
FOHDQHU IURP WKH WDQN ZDWHU VR WDQN SDUWV DUHQ¶W GDP
DJHG E\ GHWHUJHQWV RU EOHDFK XVHG E\ RWKHU LQWDQN
FOHDQHUV &OHDQHUWUHDWHG ZDWHU LV LQMHFWHG RQO\ WR WKH
ERZO ZKHUH LW¶V QHHGHG VR FOHDQHU DSSOLFDWLRQ LV HI¿
FLHQW&DUGHG
Our No.
No.
TOILET BOWL CLEANER
‡21(67(3
‡³6&58%%,1*%8%%/(6´
‡³)/86+µ163$5./(´
6WRSV UXVW ZLWK HYHU\ ÀXVK 3UH
YHQWV WKH IRUPDWLRQ RI UXVW DQG
KDUG ZDWHU EXLOGXS LQ WRLOHW ERZOV
DQGUHVHUYRLUV6DIHIRUSHWV
535-7884X
;7
TOILET BOWL CLEANER
‡7,0(5(/($6('7$%/(76
‡³5867*8$5'´
No.
Unit
5HPRYHVEXLOGXSRIUXVWDQGOLPH
LQ WRLOHWV 6DIH IRU SRUFHODLQ ERZOV
DQGHQYLURQPHQW1RDGGHGFKHPL
FDOV2GRUIUHHSHUFHQWQDWXUDOSXPLFH6WRQHVL]H
´[´[´
373-9935
TOILET BOWL CLEANER
Our No.
Shf
Pk
‡352)(66,21$/*5$'(
‡5,1*5(029(5
‡³380,(´
‡7$%/(7$8720$7,&
‡%/($&+7$%
‡³%2:/)5(6+´
967-0167X
Size
Oz
TOILET BOWL CLEANER
TOILET BOWL CLEANER
No.
No.
WILLERT HOME PRODUCTS
Blue - Twin Pack
Our No.
Unit
FLUIDMASTER INC
$XWRPDWLF WRLOHW ERZO EOXH IUHVK
FOHDQHU
‡7$%/(76$8720$7,&
‡%/8(7$%6
‡³%2:/)5(6+´
6ROLG GLVSRVDEOH GLVF GHVLJQHG
IRU QRPHVV DXWRPDWLF WRLOHW ERZO
FOHDQLQJ 'LVVROYHV FRPSOHWHO\ LQ
WKHWDQNWRKHOSFOHDQDQGGHRGRU
L]HWKHERZOIRUXSWRVL[ZHHNV
Size
Oz
Shf
Pk
No.
‡$8720$7,&
‡³%2:/)5(6+´
TOILET BOWL CLEANER
No.
Our No.
WILLERT HOME PRODUCTS
549-9306X
Our No.
)RUXVHZLWK)OXVKµQ6SDUNOHWRLOHW
ERZOFOHDQLQJV\VWHPVDIHWRKDQ
GOH ZLWKRXW JORYHV &RQFHQWUDWHG
IRUPXOD GHOLYHUV PRUH WKDQ FOHDQLQJÀXVKHV(DV\WRUHSODFH&DUGHG
Shf
Pk
3RZHUIXO FOHDQHU WDFNOHV WRLOHW
ULQJV KDUG ZDWHU PDUNV DQG OLPH
VFDOH -XVW VWHS VSUD\ GH
gree sprayer cleans the complete
ERZOHYHQXQGHUWKHULP5H¿OOODVWVXSWRGD\VZKHQ
XVHGDVLQVWUXFWHG1REDWWHULHVUHTXLUHG
Our No.
3
Unit
SC JOHNSON
215-5307
Unit
($
REFILL ONLY
FLUIDMASTER INC
367-5824
Shf
Pk
No.
For use with SKU 215.5307
8
($
215-5315
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
12
($
Maintenance, Repair & Operations - 115
TOILET BOWL CLEANER
+DQJV RQ WKH LQVLGH RI WKH WRLOHW
ERZOWRKHOSPDLQWDLQD³&RPSOHWH
&OHDQ´EHWZHHQGHHSFOHDQLQJ\RXU
WRLOHWERZO,WQRWRQO\FOHDQV\RXU
WRLOHWERZOZLWKHYHU\ÀXVKEXWLWDOVRIUHVKHQV\RXUHQ
WLUH EDWKURRP &RQWDLQV DQWLPLFURELDO SURWHFWLRQ LQ WKH
KRRNWRUHVLVWRGRUFDXVLQJEDFWHULD
Our No.
No.
Chemicals,Cleaners & Cleaning
Implements
TOILET BOWL
DEODORANT
‡120(66$8720$7,&
‡³/<62/´
Scent
Shf
Pk
Unit
RECKITT BENCKISER
261-3727
&LWUXV
4
($
261-3719
/DYHQGHU)LHOGV
4
($
261-3701
6SULQJ:DWHUIDOO
4
($
DISINFECTANTS
‡:,7+3/$67,&+$1*(5
‡:,7+2;<*(1%/($&+
‡³%2:/)5(6+3/86´
Our No.
LIQUID BLEACH
No.
‡*(50,&,'$/
‡&200(5&,$/62/87,21
‡³&/252;8/75$´
Shf
Pk
Unit
48
($
WILLERT HOME PRODUCTS
Shelf Tray
648-1634X
7
URINAL SCREENS
Our No.
‡³./((16&5((1´
TOILET BOWL
CLEANER/
DEODORIZER
‡³=(3´
3URIHVVLRQDO VWUHQJWK FOHDQV DQG
GHRGRUL]HVWRLOHWVZLWKWKHDELOLW\WR
GLVVROYHERWKRUJDQLFDQGKDUGZD
WHUVWDLQV&RORUFKDQJHLQGLFDWHVQHXWUDOL]DWLRQSURFHVV
Our No.
No.
Size
Oz
Shf
Pk
Unit
Size
Oz
No.
Shf
Pk
Unit
1
%;
CONTINENTAL COMMERCIAL
ACUITY SPECIALTY PRODUCTS
012-4255
=8
32
12
($
340-4084
=8
128
4
($
Cherry
100-4936
1,
4
Lemon
403-9871
1
Our No.
No.
Unit
CHURCH & DWIGHT
859-5118
35113
1
‡%8,/7,1'(2'25$17
‡81,9(56$/6+$3(
)/25$/
‡³'(2'26&5((1´
Our No.
($
($
Shf
Pk
Unit
DISINFECTANT
‡&/($1(5
‡&21&(175$7(
‡³=(3´
&OHDQV DQG GHRGRUL]HV &RQFHQ
WUDWHG EURDG VSHFWUXP GLVLQIHF
WDQW )RUPXODWHG WR SUHYHQW PROG
DQGPLOGHZJURZWK
Our No.
Size
Oz
No.
Pine Scent
=8033
128
4
($
(OLPLQDWHV XSOHDVDQW RGRUV 'LV
LQIHFWV FOHDQV DQG GHRGRUL]HV
0DNHVJDOORQV
Shf
Pk
No.
Unit
6
Size
Oz
No.
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
1
Our No.
Lemon Fresh Scent
%;
997-5459
=82&&
128
4
($
Toilet & Sink Repair
TOILET CARE
3UHYHQWVUXVWDQGKDUGZDWHUVWDLQV
RQ\RXUWRLOHWERZO6DIHIRUVHSWLF
V\VWHPV :RQ¶W KDUP WRLOHW WDQN
SDUWV&OHDQVFRPSOHWHO\HYHQXQGHUWKHWRLOHWERZOULP
3URYLGHV DXWRPDWLF SRZHUIXO VWDLQ WRLOHW ERZO FOHDQLQJ
FRQWLQXRXVO\IRUXSWRPRQWKV
Shf
Pk
Unit
1
3.
CHURCH & DWIGHT
35133
($
3
‡2'25&21752/
‡&21&(175$7(
CONTINENTAL COMMERCIAL
‡5(),//&$575,'*(
‡³.$%220´
837-4258
182
DISINFECTANT
%OXH YLQ\O XULQDO VFUHHQV KDV GD\VRIEXLOWLQGHRGRUDQW8QLYHU
VDOVKDSH¿WVPRVWXULQDOV
TOILET BOWL
CLEANING SYSTEM
No.
URINAL SCREENS
739-6062
Our No.
586-2776X
678-6040
Shf
Pk
Unit
567-3835X
%;
TOILET BOWL
CLEANING SYSTEM
3UHYHQWVUXVWDQGKDUGZDWHUVWDLQV
RQ\RXUWRLOHWERZO6DIHIRUVHSWLF
V\VWHPV :RQ¶W KDUP WRLOHW WDQN
SDUWV&OHDQVFRPSOHWHO\HYHQXQ
GHU WKH WRLOHW ERZO ULP 3URYLGHV
DXWRPDWLF SRZHUIXO VWDLQ WRLOHW ERZO FOHDQLQJ FRQWLQX
RXVO\IRUXSWRPRQWKV5H¿OODEOH
Shf
Pk
ACUITY SPECIALTY PRODUCTS
4
7,.6
Size
Oz
No.
CLOROX COMPANY
(Q]\PDWLF GHRGRUDQW EORFN FRQ
WDLQV VXUIDFWDQWV DQG FKHODWLQJ
DJHQWV WR FOHDQ DQG GHRGRUL]H IRU
GD\VXSWRÀXVKHV%OX
LQJ DJHQWV DUH UHOHDVHG ZLWK HDFK
ÀXVKVR\RXNQRZWKDWLW¶VZRUNLQJ,QFUHDVHGYHQWDOD
WLRQ UHGXFHV SRWHQWLDO VSODVK EDFN DQG ÀH[LEOH VFUHHQ
WUDSV PRUH GHEULV WR SUHYHQW FRVWO\ GUDLQ FORJV %ORFN
SDFNHGLQHQYLURQPHQWDOO\VDIH39$ZDWHUVROXDEOH¿OP
%XLOWLQ GLVSRVDEOH UHPRYDO WRRO KHOSV WR SUHYHQW FURVV
FRQWDPLQDWLRQ
Our No.
'LVLQIHFWV VDQLWL]HV DQG GHRGRU
L]HV KDUG QRQSRURXV VXUIDFHV
:KHQ XVHG DV GLUHFWHG HIIHFWLYH
DV EDFWHULFLGDO IXQJLFLGDO DQG YLUXFLGDO (3$UHJLVWHUHG
DVDGLVLQIHFWDQWQRZSURYHQWREHHIIHFWLYHDJDLQVW7%
+,9DQG+HSDWLWLV$&RPSOLHVZLWK26+$JXLGHOLQHVIRU
EORRGERUQHSDWKRJHQV0HHWV)'$JXLGHOLQHVIRUVDQLWL]
LQJIRRGFRQWDFWVXUIDFHV
DISINFECTANT
RUST & STAIN
REMOVER
‡$17,%$&7(5,$/&/($1(5
‡:,7+/(021
‡³=(3´
‡$8720$7,&
'HVLJQHG DQG WHVWHG WR UHSHO UXVW
DQG KDUG ZDWHU VWDLQV ZLWK HYHU\
ÀXVK RI WKH WRLOHW ERZO &RQFHQ
WUDWHG IRUPXOD FOHDQV UXVW DZD\
DQGUHSHOVQHZVWDLQVIURPIRUPLQJIRUDWOHDVWGD\V
SHUWDEOHW6DIHIRUVHSWLFVDQGWRLOHWSDUWV
Our No.
Our No.
No.
Size
Ozs.
Shf
Pk
Unit
$77
12
($
IRON OUT INC
690-9212
7,+6
5HDG\WRXVH KRVSLWDO JUDGH JHU
PLFLGDOFOHDQHUDQGGHRGRUDQWZLWK
OHPRQ &XWV WKURXJK JUHDVH DQG
RWKHUVRLOV%URDGVSHFWUXPGLVLQIHFWDQWDFWLRQLQFOXGLQJ
056$DQG+,9
No.
Size
Oz
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
160-4933
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
=8%$&
128
4
($
- Maintenance, Repair & Operations
DISINFECTANT
DISINFECTANT
HOUSEHOLD CLEANER
‡125,16()/225
‡&21&(175$7(
‡³=(3´
‡$17,%$&7(5,$/&/($1(5
‡&21&(175$7(
‡³/<62/´
‡08/7,385326(
&OHDQVDQGGLVLQIHFWVZLWKRXWGDP
DJLQJÀRRU¿QLVKHV+RVSLWDOJUDGH
GHWHUJHQWDQGGLVLQIHFWDQW
&RQWUROV PROG DQG PLOGHZ DQG
HOLPLQDWHV RGRU FDXVLQJ EDFWHULD
&OHDQHU DQG GHJUHDVHU IRU IRRG
DQGQRQIRRGDUHDV)RUOLJKWGXW\FOHDQLQJDQGVDQLWL]LQJ
PDNHVXSWRJDOORQV)RUKHDY\GXW\FOHDQLQJDQG
GLVLQIHFWLQJPDNHVXSWRJDOORQV16)&DWHJRU\&RGH
'5HJ1R
Our No.
Size
Oz
No.
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
901-4929
128
=8156
4
($
Our No.
Size
Gal
No.
Shf
Pk
Unit
924-1209
1
4
($
‡³3,1(/´
Size
Oz
No.
Shf
Pk
Unit
*
128
4
($
Shf
Pk
Unit
12
($
Crisp Linen Scent - Aerosol
607-3142
8VHWRFOHDQSODVWLFFXWWLQJERDUGV
FKLOGUHQ¶VWR\VSHWERZOVDQGGLVK
UDFNV .LOOV EDFWHULD RQ KDUG QRQ
SRURXVVXUIDFHV'RHVQ¶WOHDYHDQ\KDUPIXOOUHVLGXH1R
QHHG WR ULQVH DIWHU XVH 6DIH IRU XVH DURXQG NLGV SHWV
DQGIRRG
No.
Size
Oz
No.
RECKITT BENCKISER
‡635$<
‡³$1<:+(5(+$5'
685)$&(´
Size
Oz
.LOOV YLUXVHV DQG EDFWHULD RQ HQYL
URQPHQWDO VXUIDFHV LQ KRPHV DQG
LQ SXEOLF SODFHV (OLPLQDWHV RGRU
FDXVLQJ EDFWHULD WR OHDYH KRPHV
IHHOLQJIUHVKDQGFOHDQ.LOOVDQGSUHYHQWVWKHJURZWKRI
PROGDQGPLOGHZRQEDWKURRPVXUIDFHVVKRZHUFXUWDLQ
OLQHUVVLQNVNLWFKHQVSODVWLFPDWWUHVVFRYHUVHWF.LOOV
RQFRQWDFW
Our No.
DISINFECTANT
Shf
Pk
Unit
Unit
2]
12
($
614-8506
Gallon
4
($
12
($
22
2]
Early Morning Breeze Scent - Aerosol
843-5984X
614-7201
ALL-PURPOSE CLEANER
‡+($9<'87<
&21&(175$7('
‡³/(672,/´
8VHWRFOHDQRLOJUHDVHWDUJUHDV\
IRRG VWDLQV SHUVSLUDWLRQ DQG LQN
VWDLQV DQG ODXQGU\ &OHDQV JDUDJH
ÀRRUVDQGRWKHUVXUIDFHVZKHUHJUHDVHDQGRLOH[LVW8VH
RQFRXQWHUVÀRRUVZDOOVDQGDSSOLDQFHV'RQ¶WXVHRQ
PHWDOOLFIDEULFVRURQZKLWHVLONV
Our No.
No.
Size
Oz
Shf
Pk
Unit
28
12
($
Shf
Pk
Unit
CLOROX COMPANY
359-5238X
12
($
12
($
PINE-SOL
12
($
&OHDQVGLVLQIHFWVGHRGRUL]HV.LOOV
KRXVHKROGJHUPV
Original Scent - Aerosol
18
Spring Waterfall Scent - Aerosol
614-7227
18
CLOROX COMPANY
589-7905X
Shf
Pk
‡635$<
‡³/<62/,,,´
Pine Scented
Our No.
Size
614-8514
486-2777
DISINFECTANT
LUNDMARK WAX CO.
010-0875X
No.
Trigger Spray
)RU XVH LQ ZDVK URRPV ORFNHU
URRPVNHQQHOVDQGHWFFRPSRVHG
RI TXDWHUQDU\ DPLQHV DQG QRQ
LRQLF GHWHUJHQW EOHQG WKDW OLIW DQG
VXVSHQGVVRLOIRUIUHHULQVLQJ
Our No.
Our No.
SPRAY NINE/PERMATEX
RECKITT BENCKISER
DISINFECTANT
8VHWRFOHDQWKHZRUVWGLUWJUHDVH
JULPH DQG RWKHU VWXEERUQ VRLOV
+RVSLWDO JUDGH (3$ UHJLVWHUHG GLV
LQIHFWDQWZKLFKNLOOVDEURDGVSHF
WUXP RI JHUPV DQG YLUXVHV LQ VHFRQGV +HOSV FRQWURO PROG DQG PLOGHZ DQG GHVWUR\V
EDFWHULDORGRUV2QHERWWOHGRHVWKHMRERIVHYHUDOSURG
XFWVIRUKRXVHKROGDXWRPRWLYHDQGSURIHVVLRQDOFOHDQLQJ
QHHGV
($
DISINFECTANT
‡&21&(175$7('
‡³/<62/´
DISINFECTANT
'HRGRUL]HV ZKLOH FXWWLQJ WKH
WRXJKHVWVWDLQVJUHDVHDQGJULPH
Our No.
No.
Size
Oz
Shf
Pk
No.
Size
Oz
Lemon Fresh Scent
Shf
Pk
Unit
607-3571X
28
12
($
582-7787
48
8
($
111-7753
($
Mountain Energy
RECKITT BENCKISER
Unit
CLOROX COMPANY
633-8339
12
12
($
275-2244X
40152
28
12
($
646-9639X
40115
48
8
($
Orange Energy Scent
Lavender Scent
959-2510X
48
Size
Oz
No.
CLOROX COMPANY
'HRGRUL]HV GLVLQIHFWV DQG FOHDQV
ZLWKDIUHVKVFHQW.LOOVKRXVHKROG
JHUPV&RQWUROVPLOGHZDQGPROG
0DNHVJDOORQV
‡³3,1(62/´
Our No.
Our No.
8
($
787-7624
28
12
($
553-1306X
48
8
($
Regular Scent
945-5536
40145
15
12
($
945-5585
28
12
($
607-3563X
40125
48
8
($
639-6469
($
038-5021
144
3
($
Sparkling Wave Scent
714-6079
48
8
($
445-7289
40238
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 117
DISINFECTING WIPES
HOUSEHOLD CLEANER
‡%/($&+)5((
‡³&/252;´
‡*(1(5$/385326(
‡³',57(;´
$ TXLFN DQG HDV\ ZD\ WR GLVLQIHFW
and clean household surfaces. The
EOHDFKIUHHIRUPXODFOHDQVDQGNLOOV
SHUFHQW RI WKH EDFWHULD 7KH
wipes can be used throughout the house, kitchen, and
bathroom and disposed in trash after use.
$ VSHFLDOO\ IRUPXODWHG PLOGO\ DP
moniated cleaner for cleaning off
JUHDVH RLO\ ¿OP ¿QJHU DQG KDQG
marks, soap and fruit stains from
ZLQGRZV PLUURUV FRXQWHUV EDWKURRP DQG NLWFKHQ ¿[
WXUHVZDOODQGÀRRUWLOHUHIULJHUDWRUGRRUVDQGFKURPH
plated appliances. Cleans bugs and dirt from windshields,
windows and plastic upholstery on cars and boats. Con
WDLQVQRÀXRURFDUERQVWRSROOXWHWKHDWPRVSKHUH
Our No.
No.
Scent
Shf
Pk
Unit
CLOROX COMPANY
150 Count - Twin Pack
614-8910X
)UHVK/HPRQ
Our No.
6
($
No.
Size
Oz
30666
/HPRQ
12
($
692-5077
12
($
'LVLQIHFWLQJSRZHUWKDWNLOOVKDUP
IXO NLWFKHQ EDFWHULD 8VH RQ KDUG
QRQSRURXV QRQIRRG FRQWDFW VXU
IDFHV6WUHDNIUHH
Shf
Pk
Unit
CLOROX COMPANY
Our No.
No.
Size
Oz
00888
32
Shf
Pk
Unit
Trigger Spray
12
($
350-5906
10763
22
For tough jobs. Preferred by paint
ing and cleaning professionals for
removing heavy deposits of greasy grime, smoke and
VRRW VWDLQV IURP ZDOOV ZRRGZRUN DQG ÀRRUV 8VHG WR
ZDVKDZD\PLOGHZDQGFKDONHGSDLQW5HFRPPHQGHGIRU
washing away paint remover sludge.
Our No.
No.
Size
Lb
Shf
Pk
Unit
SAVOGRAN CO
683-5375
10621
1
12
($
683-5409
10622
8
($
‡3+263+$7()5((
SAVOGRAN CO
Lemon Fresh Scent
‡+($9<'87<$//
385326(
‡³763´
ALL-PURPOSE CLEANER
$ VSHFLDOO\ IRUPXODWHG PLOGO\ DP
moniated cleaner for cleaning off
JUHDVH RLO\ ¿OP ¿QJHU DQG KDQG
marks, soap and fruit stains from
ZLQGRZV PLUURUV FRXQWHUV EDWKURRP DQG NLWFKHQ ¿[
WXUHVZDOODQGÀRRUWLOHUHIULJHUDWRUGRRUVDQGFKURPH
plated appliances. Cleans bugs and dirt from windshields,
windows and plastic upholstery on cars and boats. Con
WDLQVQRÀXRURFDUERQVWRSROOXWHWKHDWPRVSKHUH
‡$//385326(
$17,%$&7(5,$/
‡³)2508/$´
062-4171
15
‡*(1(5$/385326(
‡³',57(;´
KITCHEN CLEANER
Size
Oz
10761
HOUSEHOLD CLEANER
ALL PURPOSE CLEANERS
No.
Unit
$HURVRO
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
Our No.
Shf
Pk
SAVOGRAN CO
&RXQW7UDYHO3DFN
359-5279X
TRISODIUM
PHOSPHATE CLEANER
12
$ KHDY\GXW\ QRQVXGVLQJ SKRV
SKDWHIUHH IRUPXOD WKDW FXWV
through and removes heavy de
posits of greasy dirt and grime
IURP ZDOOV ZRRGZRUN DQG ÀRRUV
UHPRYHV VPRNH DQG VRRW VWDLQV RQ ¿UHSODFH PDQWHOV
DGMRLQLQJ ZDOOV DQG FHLOLQJV 8VH WR ZDVK DZD\ PLOGHZ
DQGFKDONHGSDLQW$OVRUHFRPPHQGHGIRUZDVKLQJDZD\
paint remover sludge.
Our No.
No.
Size
Lb
Shf
Pk
Unit
SAVOGRAN CO
748-2201
10611
1
12
BX
636-1919
10612
8
($
($
ALL-PURPOSE CLEANER
KITCHEN CLEANER
8VH RQ DOO ZDVKDEOH VXUIDFHV QR
need to rinse. Kills harmful bacte
ria such as salmonella, which can
remain on kitchen surfaces. Cleans
WRXJKJUHDVHDQGJULPH$SSHDOLQJFLWUXVVFHQW(3$UHJ
istered.
Our No.
No.
Size
Oz
Shf
Pk
Unit
22
12
($
RECKITT BENCKISER
607-3126
HOUSEHOLD CLEANER
721-9249
Size
Lb
Shf
Pk
8
Unit
SAVOGRAN CO
683-6142
10602
Cleans surfaces in preparation for
painting. Cuts through and removes heavy deposits of
greasy dirt and grime from interior and exterior surfaces.
3KRVSKDWHIUHHFRQFHQWUDWHGFOHDQHURQHTXDUWPDNHV
up to 4 gallons, and one gallon will make up to 16 gal
ORQVRIFOHDQLQJVROXWLRQDQGUHTXLUHVQRULQVLQJ5HFRP
mended for walls, woodwork, ceilings, concrete, metal,
YLQ\ODQGDOXPLQXPVLGLQJ5HPRYHVPLOGHZVWDLQVZKHQ
mixed with bleach. Can be applied by hand or with a
pressure washer.
No.
Size
Shf
Pk
Quart
6
Unit
SAVOGRAN CO
For use on every washable surface
LQWKHKRPH4XLFNGLVVROYLQJ$P
moniated to deliver greater clean
LQJSRZHU\HWYHU\JHQWOHWRWKHVNLQ$SSO\ZLWKZDUP
ZDWHU DQG VSRQJH RU VRIW WRZHO /HDYHV VXUIDFH FOHDQ
without rinsing for repainting or rewaxing.
No.
‡+($9<'87<$//
385326(
‡/,48,'68%67,787(
‡³763´
Our No.
‡*(1(5$/385326(
32:'(5
‡³',57(;´
Our No.
‡³:,3('2:1´
TRISODIUM
PHOSPHATE CLEANER
‡$17,%$&7(5,$/',5(&7
‡³/<62/´
($
10632
48$57
TRISODIUM
PHOSPHATE CLEANER
No.
Size
Our No.
646-9696X
0261
16
Shf
Pk
Unit
5801
32
12
($
Shf
Pk
Unit
‡*5($6(),*+7,1*
‡³)2508/$´
Cuts through the toughest kitchen
JUHDVH DQG JULPH (OLPLQDWHV XQ
wanted odors and powers through
those household messes.
No.
Size
Oz
CLOROX COMPANY
-XJ5H¿OO
614-5155
00636
64
6
($
12
($
Trigger Spray
958-7585
Shf
Pk
Unit
12
($
Tub
,+.6
Size
Oz
ALL-PURPOSE CLEANER
RED DEVIL INC
632-9338
No.
CHEMICAL TECHNOLOGIES I
Our No.
$ WULVRGLXP SKRVSKDWH VXEVWLWXWH
WKDW QHXWUDOL]HV DQG ÀRDWV DZD\
grease, grime, dirt, oil, and smoke
¿OP &RQWDLQV QR SKRVSKRURXV
soap, lye, or abrasives. Packaged
LQDUHVHDODEOHEDJ'RQRWXVHRQJODVV
Our No.
Quickly removes oil, scum, road
grime, bugs, salt spray and more.
,W OHDYHV D KLJK JORVV SURWHFWLYH
coating. Keeps your autos, boats
DQG 59¶V ORRNLQJ JUHDW ,GHDO IRU
VWDLQOHVV VWHHO FKURPH SODVWLF YLQ\O ¿EHUJODVV DQG
painted surfaces.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
32
118 - Maintenance, Repair & Operations
ALL-PURPOSE CLEANER
ALL-PURPOSE CLEANER
ALL-PURPOSE CLEANER
‡+($9<'87<
&21&(175$7('
‡³/(672,/´
‡/(02132:(5
‡³)$17$67,.´
‡2;<32:(5
‡³)$17$67,.´
&XWV WKURXJK JUHDVH (IIHFWLYH
on countertops, sinks, applianc
es, cabinets, microwave ovens,
ÀRRUVFHUDPLFWLOHVWDLQOHVVVWHHO
FKURPH ¿EHUJODVV SRUFHODLQ VXUIDFHV EDWKURRPV DQG
more.
:LSHVRXWWRXJKJUHDVHDQGJULPH
on a wide variety of household sur
faces including removing spots and
VWDLQVIURPFDUSHWV/HDYHVEHKLQG
no smeary residue of strong chemical odors.
8VHWRFOHDQRLOJUHDVHWDUJUHDV\
food stains, perspiration and ink
stains and laundry. Cleans garage
ÀRRUVDQGRWKHUVXUIDFHVZKHUHJUHDVHDQGRLOH[LVW8VH
RQFRXQWHUVÀRRUVZDOOVDQGDSSOLDQFHV'RQ¶WXVHRQ
metallic fabrics or on white silks.
Our No.
No.
Size
Oz
Shf
Pk
Our No.
Unit
CLOROX COMPANY
314-4680
8
Shf
Pk
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
53047
28
12
($
12
No.
Size
Oz
Shf
Pk
Unit
32
12
($
SC JOHNSON
713-3150
78271
ALL-PURPOSE
CLEANER
Cleans, shines, deodorizes and
GLVLQIHFWV:LSHVRXWWRXJKJUHDVH
DQG JULPH DQG NLOOV IRRGUHODWHG
bacteria and odor causing germs.
(IIHFWLYH RQ FRXQWHUWRSV VLQNV DSSOLDQFHV ÀRRUV FHLO
ings, ceramic tile, stainless steel, chrome, bathrooms and
more.
Our No.
Lavender Scent
857-5755X
32
‡$17,%$&7(5,$/
‡³)$17$67,.´
0XOWLXVHFOHDQHUZLWKORQJODVWLQJ
IUDJUDQFH (DV\ JULS ERWWOH ZLWK
FKLOGVDIHW\ FDS &OHDQV ZLWKRXW
leaving residue.
Size
Oz
00335
ALL-PURPOSE CLEANER
‡³)$%8/262´
No.
Unit
Our No.
($
ALL-PURPOSE CLEANER
Our No.
Shf
Pk
SC JOHNSON
606-5122
48
No.
Size
Oz
No.
Size
Oz
Shf
Pk
Unit
SC JOHNSON
($
655-6054X
00286
32
12
($
‡&21&(175$7('
‡³6,03/(*5((1´
Cleans tough stains from any
ZDVKDEOH VXUIDFH 6WURQJ HQRXJK
to degrease an engine, gentle enough to remove stains
IURPIDEULFV1RQWR[LFELRGHJUDGDEOH1RQDEUDVLYH
Our No.
No.
Size
Oz(ML)
Shf
Pk
Unit
SUNSHINE MAKERS
-XJ5H¿OO
697-4323
13014
67
6
($
697-4489
13005
128
6
($
12
($
12
($
Pump Sprayer
ALL-PURPOSE CLEANER
6SHFLDOO\IRUPXODWHGFOHDQHUWKDWLV
HIIHFWLYH RQ YLQ\O ¿QLVKHG ZRRGV
counter tops, appliances, chrome,
WLOH ¿EHUJODVV JODVV VXUIDFHV XS
holstery, carpets, and clothing.
:LOO QRW VWUHDN OHDYHV D ¿OPIUHH
VXUIDFH)RUXVHLQDQGDURXQGWKHKRPH6SUD\RQDQG
ZLSHRII&RQWDLQVQRFKORURÀXRUFDUERQV1RWIRUXVHRQ
patent leather.
Our No.
No.
Size
Oz
Shf
Pk
Our No.
12
695-5546X
Shf
Pk
Unit
6XPPHU&LWUXV
($
&RQFHQWUDWHGQRQWR[LFELRGHJUDG
able formula can be diluted with water to remove grease,
soap scum, coffee, juice stains, ink and lipstick from any
washable indoor or outdoor surface.
Our No.
($
No.
Size
Oz
Shf
Pk
Unit
SUNSHINE MAKERS
LEMON SCENT
5H¿OO
Cleans, deodorizes and degreases
SDUWVZRUNDUHDVZDOOVDQGÀRRUV
5HPRYHV GLUW\ KDQG SULQWV VFXII
marks, bathtub rings, soot, grease,
VPRNH¿OPRLOGXVWOLSVWLFNFUD\RQPDUNVHWF:LSHV
down washable painted surfaces, window sills, venetian
blinds, porcelain and tile. Formulated with orange citrus
solvents. Contains no chlorinated solvents.
Size
Oz
No.
Shf
Pk
Unit
12
($
SPRAYWAY, INC.
$HURVRO
284-0742X
40 Ounce
31502
6
32
Unit
‡&,7586
‡³&5$=<&/($1(5´
PROCTER & GAMBLE
441-3217X
16
13033
‡%,2'(*5$'$%/(121
72;,&&21&(175$7(
‡³6,03/(*5((1´
ALL-PURPOSE CLEANER
.LOOV SHUFHQW RI KRXVHKROG
JHUPV LQFOXGLQJ 6DOPRQHOOD FKRO
HUDHVXLV (VFKHULFKLD FROL DQG
3URWHXVPLUDELOLVDQGWKHYLUXVHV,QÀXHQ]D$DQG+HU
SHV6LPSOH[W\SHFDXVHFROGVRUHV(IIHFWLYHDJDLQVW
*UDPQHJDWLYHEDFWHULDRQO\6DIHWRXVHRQDSSOLDQFHV
ÀRRUV DQG FRXQWHUWRSV IURP NLWFKHQ WR EDWK WR WRXJK
MREVOLNHYLQ\OVLGLQJ1275(&200(1'('IRUFDUSHWVRU
DOXPLQXPVXUIDFHV$VVRUWHGGLVSOD\VKHOISDFNLQFOXGHV
6SDUNOLQJ$SSOHDQG6XPPHU&LWUXVVFHQWV
Scent
70312
16
ALL-PURPOSE
CLEANER
Our No.
‡$17,%$&7(5,$/
‡³05&/($16($6216¶
)5(6+1(66´
No.
No.
Shf
Pk
Trigger Spray
($
ALL-PURPOSE CLEANER
Our No.
8VHWRFOHDQDQGGXVWDOO\RXUKDUG
surfaces. Cleans wood, glass and
PRUH $QWLVWDWLF IRUPXOD LV JUHDW
IRUHOHFWURQLFV5HPRYHVGXVWGLUW
smudges and common allergens from dust mites, pet
GDQGHUDQGSROOHQ6WUHDNIUHHFOHDQ/HDYHVQRVPHDU\
residue.
SC JOHNSON
$HURVRO
639-6956
697-8548
Size
Oz
13002
Trigger Spray
‡08/7,685)$&(
‡³3/('*(´
Unit
KELLOGG’S PROFESSIONAL
697-3929
ALL-PURPOSE CLEANER
6:5(7$,/
115-1588
14010
128
6
($
12
($
Trigger Sprayer
941-4012
14003
32
ALL-PURPOSE
CLEANER
‡5($'<7286(
‡³6,03/(*5((1
1$785$/6´
)RU KDUG ZDWHU VXUIDFHV TXLFNO\
cleans spills and keeps counters, cabinets, and appli
ances shiny, clean, and fresh smelling. Powers out dirt,
IRRGDQGRLOVZLWKRXWKDUVKFKHPLFDOV/HPRQ9HUEHQD
VFHQW7ULJJHU6SUD\
Our No.
No.
Size
Oz
Shf
Pk
Unit
SUNSHINE MAKERS
058-6735
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
12300
32
6
($
Maintenance, Repair & Operations - ALL-PURPOSE
CLEANER
$ VDIH DQG HIIHFWLYH DOO SXUSRVH
cleaner that can be custom diluted for a variety of larger
FOHDQLQJ DSSOLFDWLRQV ,W FDQ EH GLOXWHG DQ\ZKHUH IURP
HTXDO SDUWV SURGXFW ZDWHU XS WR FXS RI
SURGXFWSHUFXSVRIZDWHUGHSHQGLQJRQWKHVHYHULW\
RIWKHVRLO,WFDQEHXVHGE\VSUD\LQJZLSLQJRUPRSSLQJ
RQWRDQ\ZDVKDEOHKDUGVXUIDFH0D\DOVREHXVHGDVDQ
DGGLWLYHLQ\RXUODXQGU\&LWUXV0LQWVFHQW
No.
OIL SOAP
‡$//385326(&/($1(5
‡:,7+25$1*(2,/
‡08/7,86(
‡³0853+<´
For linoleum, plastic, ceramic tiles,
painted walls, laundry, windows,
glass and mirrors.
‡&21&(175$7('
‡³6,03/(*5((1
1$785$/6´
Our No.
AMMONIA
Size
Oz
Shf
Pk
Our No.
Size
Oz
No.
Shf
Pk
Unit
JAMES AUSTIN CO
Our No.
Lemon Scent
842-8377X
32
12
48$57
145-3927X
128
4
*$/
12301
48
6
0XOWLSXUSRVH FOHDQHU IRU ODXQGU\
and general household chores like
cleaning kitchens, sinks, garbage
GLVSRVDOV DQG WUDVK FDQV 8VH IXOO
strength, wait a few minutes, and
ULQVHZLWKFOHDUZDWHU&DQEHXVHGRQFHPHQWÀRRUV
ALL-PURPOSE CLEANER
‡³)$%8/262´
0XOWLSXUSRVH FOHDQHU /DYHQGHU
scent.
Our No.
No.
Size
Oz
Shf
Pk
Unit
JAMES AUSTIN CO
Our No.
No.
Size
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
616-2333X
04307
Gal
4
($
Shf
Pk
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
53046
202-1582X
50
32
12
($
334-7945X
51
64
8
($
403-0409X
52
128
4
*$/
0DGHZLWKRULJLQDOIRUPXODJHQWOH
feldspar for polishing and soap for
FOHDQLQJ'HIRJVZLQGRZVDQGPLU
rors. Cleans and polishes metal
VXUIDFHVDFWVDVUXVWUHWDUGDQW1R
GHWHUJHQWRUEOHDFK$PHULFDQRULJLQDOVVLQFH
Our No.
($
No.
Size
Oz
Shf
Pk
Unit
04030
12
24
($
AMMONIA
‡$//385326(&/($1(5
‡³3$5621¶6´
Size
Oz
22
12
($
Shf
Pk
Unit
‡/,48,'
‡³0853+<´
For cleaning walls, woodwork,
ÀRRUV OHDWKHU YLQ\O¿EHUJODVV
WXEV8VHDVDODXQGU\SUHVSRWWHU
dog shampoo.
Our No.
Size
Oz
No.
DOT FOODS, INC. COLGATE PALMOLIVE
643-6810
16
12
($
643-6851
1106
32
12
($
OIL SOAP
Our No.
No.
Size
Shf
Pk
Unit
4
*$/
Shf
Pk
Unit
12
($
DOT FOODS, INC. COLGATE PALMOLIVE
1103
914-4486X
Gallon
CLEANER/
DEGREASER
‡1$785$/25$1*(
‡³75(:$;´
CLEANING POWDER
For easy removal of grease, oil,
ink, coffee, grass stains, blood, pet
stains and other tough cleaning problems.
‡586767$,1+($9<
'87<
‡³=8'´
8VH IXOO VWUHQJWK RU GLOXWHG LQ D
spray bottle or bucket. Cleans
ÀRRUV FHUDPLF WLOHV DQG SDLQWHG
ZRRGZRUN1RQVWUHDNLQJIRUJODVV
or chrome.
No.
1030
603-6362
FAULTLESS STARCH
681-8066
Our No.
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
Cleans wood, leather, vinyl and
RWKHU ¿QH TXDOLW\ VXUIDFHV &RQ
tains no harsh abrasives.
‡³%21$0,´
/HDYHV \RXU KRPH VKLQ\ FOHDQ
fresh, and fragrant. 32 oz trigger
VSUD\/DYHQGHUVFHQW
857-5763X
&OHDU
CLEANING POWDER
‡³)$%8/262´
No.
Shf
Pk
‡/,48,'
‡³0853+<´
ALL-PURPOSE CLEANER
Our No.
Size
Oz
OIL SOAP
AMMONIA
($
‡$//385326(&/($1(5
Shf
Pk
No.
Unit
SUNSHINE MAKERS
038-5575
Cleans away dust, grease, grime
DQGZD[EXLOGXSWRUHYHDOZRRG¶V
QDWXUDO EHDXW\ 8VH RQ ZRRG WD
bles, chairs, wood cabinets, doors, painted wood furni
WXUHZRRGÀRRUV
Our No.
Size
Oz
No.
BEAUMONT PRODUCTS INC
Shf
Pk
Unit
CHURCH & DWIGHT
Our No.
No.
Trigger Spray
Size
Oz
Shf
Pk
Unit
16
12
($
607-3456
883620035
32
MALCO PRODUCTS, INC.
Lemon Scent
618-1267X
855
28
12
($
637-6941X
56
($
637-7261
CLEANER/
DEGREASER
‡$//385326(
‡³25$1*(&/($1(5´
For household, lawnmowers, auto
motive engines, grills to showers.
Cuts grease and deodorizes with orange peels plus natu
ral citrus oils for sunshine freshness and performance.
Our No.
No.
Size
Oz
Shf
Pk
128
4
Unit
LUNDMARK WAX CO.
817-5697
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
+.6
*
($
120 - Maintenance, Repair & Operations
6ROYHQWV3DWFK5HSDLU
ALL PURPOSE CLEANERS
HOUSEHOLD CLEANER
‡*(1(5$/385326(
32:'(5
‡³',57(;´
For use on every washable surface
LQWKHKRPH4XLFNGLVVROYLQJ$P
moniated to deliver greater clean
LQJSRZHU\HWYHU\JHQWOHWRWKHVNLQ$SSO\ZLWKZDUP
ZDWHU DQG VSRQJH RU VRIW WRZHO /HDYHV VXUIDFH FOHDQ
without rinsing for repainting or rewaxing.
Our No.
No.
Size
Lb
Shf
Pk
Unit
1
12
($
OVEN CLEANERS
ALL-PURPOSE CLEANER
‡635$<21+($9<'87<
‡³($6<2))´
‡³25$1*(3/86´
For cleaning warm or cold ovens,
broilers, barbecue grills and stain
less steel surfaces. Cuts through
WRXJKEDNHGRQJUHDVH
Our No.
Size
Oz
No.
Shf
Pk
Unit
12
($
RECKITT BENCKISER
$HURVRO
630-4869
6233800138
16
10601
592-4451
Our No.
Shf
Pk
Unit
DAP INC
611-5174
63001
1
6
($
611-5182
63004
4
6
($
Size
Oz
No.
Shf
Pk
Unit
12
($
SPRAYWAY, INC.
$HURVRO
416-1873X
6:5(7$,/
GRILL/OVEN CLEANER
Our No.
DEGREASERS
Size
Oz
No.
=829*5
22
Unit
12
($
‡³.58'.877(5´
2QH VWHS UHDG\WRXVH IRUPXOD LV
GHVLJQHGIRUXVHRQKDUGQRQSR
rous surfaces such as vinyl, plastic,
glazed ceramic, glazed porcelain,
FKURPH VWDLQOHVV VWHHO EUDVV FRSSHU SDLQWHG¿QLVKHG
woodwork, laminated surfaces, and baked enamel sur
IDFHV DVVRFLDWHG ZLWK ÀRRUV ZDOOV FHLOLQJV WDEOHV
chairs, countertops, glazed tile, sinks, shower rooms,
and locker rooms. Cleans, disinfects, and deodorizes
QRQSRURXV VXUIDFH LQ NLWFKHQ EDWKURRPV DQG ÀRRUV
,QKLELWV WKH JURZWK RI PROG DQG PLOGHZ RQ KDUG QRQ
porous surfaces.
Shf
Pk
284-1963
'+
2]6SUD\HU
6
48$57
047-6952X
'+
1 Gallon Bottle
2
*$/
No.
Shf
Pk
Unit
SUNSHINE MAKERS
SASSAFRAS SCENT
(DV\3RXU:LWK+DQGOH
678-7659
13006
5
22732
32
6
($
646-9878
22701
128
6
($
Shf
Pk
Unit
‡+($9<'87<&,7586
‡³=(3´
Citrus based degreaser dissolves
heavy soils from many surfaces,
including engines, machinery, and
DXWRZKHHOV5LQVHVHDVLO\ZLWKRXW
alkaline residues.
Size
Oz
No.
Jug
1RQWR[LF ELRGHJUDGDEOH QRQ
DEUDVLYHDQGQRQÀDPPDEOH0LOG
SK8VHGIRUEXLOGLQJVDQG
grounds maintenance. Janitorial
FOHDQLQJ ÀRRUV ZDOOV FRXQWHUV GRRUV FRQFUHWH WLOH
DQGVWDLQOHVVVWHHO6XUIDFHSDLQWSUHSDUDWLRQPDQXIDF
WXULQJDQG052FOHDQLQJ&OHDQVDQGGHRGRUL]HVJUHDVH
¿OWHUVDQGWUDSV
Our No.
SUPREME CHEMICALS
Unit
ACUITY SPECIALTY PRODUCTS
‡&21&(175$7('
‡³6,03/(*5((1´
Size
*DO
Shf
Pk
007-6257
Our No.
ALL-PURPOSE CLEANER
Unit
Size
Oz
CLEANER/DEGREASER
Shf
Pk
$HURVRO
547-3533
No.
SPRAY NINE/PERMATEX
ACUITY SPECIALTY PRODUCTS
KITCHEN/BATH
CLEANER
Size
($
$SURIHVVLRQDOVWUHQJWKGHJUHDVLQJ
IRUPXOD WKDW LV ZDWHUEDVHG DQG
ELRGHJUDGDEOH 8VH RQ JUHDVH
grime and many soils, including
PRVWSHWUROHXPEDVHGVRLOV7KLVSRZHUIXOQRQÀDPPD
EOHXVHUIULHQGO\GHJUHDVHULVDOVR92&FRPSOLDQWLQDOO
VWDWHV7ULJJHU6SUD\
Our No.
Professional strength, highly effec
tive aerosol. Powerful foam clings
to surface, removing carbon de
SRVLWV JUHDV\ ZDVWHV DQG EDNHG
RQIRRGV
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
No.
12
3/
‡+($9<'87<
‡³*5(=2))´
‡+($9<'87<
‡³=(3´
Package - White
Our No.
Unit
CLEANER/DEGREASER
Cuts through heavy grease, baked
on food and carbon stuck to ovens,
JULOOVDQGKRRGV:RUNVLQPLQXWHV
8VH SULRU WR SDLQWLQJ H[WHULRU VXU
faces such as plaster, tile, brick or
FRQFUHWH 5HPRYHV PROG DQG PLOGHZ DQG GHJORVVHV
VXUIDFHV WKDW DUH RLOEDVH SDLQWHG )RU FOHDQLQJ JDUDJH
RU EDVHPHQW ÀRRUV 8VH WR UHVWRUH GULHG XVHQG SDLQW
brushes.
Size
Lb
Shf
Pk
‡+($9<'87<
‡,167,787,21$/675(1*7+
‡32:'(5$//385326(
‡(;7(5,25
‡³763´
No.
No.
32 Oz
BBQ/GRILL/OVEN
CLEANER
TRISODIUM
PHOSPHATE CLEANER
Our No.
Our No.
EARTH FRIENDLY PRODUCTS
SAVOGRAN CO
637-2486
Cleans, degreases and deodorizes
with the natural power of oranges.
1RULQVHQHXWUDOS+FOHDQHULVVDIH
DQG HIIHFWLYH RQ DQ\ ZDWHUVDIH
VXUIDFH (IIHFWLYHO\ UHPRYHV PLOG
DGKHVLYHUHVLGXHDQGGHFDOV0DGHZLWKRQO\VXV
WDLQDEOHSODQWEDVHGLQJUHGLHQWV'RHVQRWFRQWDLQG\HV
RU V\QWKHWLF SHUIXPHV JUH\ZDWHU DQG VHSWLF VDIH 5HF
RJQL]HGIRUVDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQIRUWKH
(QYLURQPHQW3URJUDP
1
3$,/
762-0438
128
=8&,7
4
($
12
($
Shf
Pk
Unit
Trigger Spray
916-4211
=8&,7
32
CLEANER/DEGREASER
‡,1'8675,$/3853/(
‡&21&(175$7(
‡³=(3´
,QGXVWULDO SXUSOH FOHDQHU DQG
degreaser concentrate removes
heavy grease and carbonaceous
soils.
Our No.
No.
Size
ACUITY SPECIALTY PRODUCTS
426-8975X
=8
2]
4
*$/
563-7608
=8*
5 Gal.
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 121
CLEANER/DEGREASER
CLEANER/DEGREASER
CLEANER/DEGREASER
‡$//385326(
‡&21&(175$7(
‡³=(3´
‡08/7,385326(
‡³*5($6('/,*+71,1*´
‡&,7586%$6('
‡³5,*+7678))´
Cuts through grime on stove vents
RYHQV DQG PLFURZDYHV 5HPRYHV
red wine, pet stains and dirt from
HYHU\GD\ WUDI¿F RQ FDUSHWV 8VH
as a laundry pretreat for tough stains including grease,
grass and ink. Tackles soap scum and mildew stains in
WKH VKRZHU 5HYLWDOL]H SDWLR IXUQLWXUH E\ UHPRYLQJ GLUW
DQGRXWGRRUGHEULV1RWH1RWUHFRPPHQGHGIRUXVHRQ
painted surfaces.
%LRGHJUDGDEOH QRQWR[LF DOOQDW
ural, made with fresh orange oil.
6DIHWRXVHRQDOPRVWDQ\VXUIDFH
/HDYHV EHKLQG DQ RUDQJH VFHQW
Tough on grease and dirt.
$ GLOXWDEOH JUHHQ FOHDQHU IRU DOO
ZDVKDEOH VXUIDFHV 9HUVDWLOH DQG
easy rinsing.
Our No.
Size
Oz
No.
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
844-5546
128
=8
4
($
Our No.
‡,1'8675,$/)$67
‡³=(3´
5HDG\WRXVHIDVWLQGXVWULDOFOHDQ
er and degreaser. Penetrates pores
and crevices to remove dirt without
heavy scrubbing.
Size
Oz
No.
Shf
Pk
Unit
128
4
($
Trigger Spray
209-1437
32
=8
650-0839
QT
Quart
12
($
650-0854
*$/
Gallon
6
($
12
($
Our No.
No.
HOME CARE LABS
‡&200(5&,$/5($'<72
86(
‡³)2508/$´
125-8367
5HPRYHV JUHDVH JULPH IRRG
VWDLQV DQG RWKHU RLOEDVHG GLUW
:LGHUDQJHRIFOHDQLQJWDVNDUHDV
(3$UHJLVWHUHG GLVLQIHFWDQW DQG VDQLWL]HU IRU QRQIRRG
contact surfaces.
No.
Size
Oz
Shf
Pk
128
4
Unit
CLOROX COMPANY
912-0411X
35300
($
1120B
Unit
12
($
AIKEN CHEMICAL COMPANY,
Trigger Spray
827-4086
36
32
No.
GG66
675-0673
Shf
Pk
Unit
32
12
($
Unit
12
($
Shf
Pk
Unit
SUNBELT CHEMMICALS
121-9351X
14025
32
CLEANER/DEGREASER
‡+($9<'87<
‡&21&(175$7('
‡³5,*+7678))´
Our No.
No.
Size
SUNBELT CHEMMICALS
643-0672
2]
12
($
643-1928
1 Gal.
4
($
643-2207X
2.5 Gal.
2
($
643-2249
5 Gal.
1
3$,/
‡+($9<'87<%87</
Tackles dirt on virtually any sur
face in and around the home, from
VWRYHWRSVWRGULYHZD\VIURPEDWKURRPVWRFRXQWHUWRSV
8VHIXOOVWUHQJWKRUGLOXWHGWRPDNHXSWRJDOORQVRI
JHQHUDOSXUSRVHFOHDQHU
MAGIC AMERICAN
Size
Oz
Shf
Pk
‡&21&(175$7('$//
385326(
‡³*22*21(*5($6(
&877,1*´
‡08/7,385326(
‡&21&(175$7(
‡³3853/(32:(5´
$ FRQFHQWUDWHG VXSHU VWUHQJWK
FOHDQHU DQG GHJUHDVHU 0DGH ZLWK
natural citrus oils, it cleans and
deodorizes leaving a fresh clean citrus scent. Contains
6 percent natural citrus oils in addition to other clean
LQJ VROYHQWV DQG VXUIDFWDQWV (QYLURQPHQWDOO\ VDIH DQG
biodegradable.
Size
Oz
CLEANER/DEGREASER
CLEANER/DEGREASER
No.
Shf
Pk
CLEANER/
DEGREASER
Our No.
Our No.
Size
Oz
3KRVSKDWHIUHH ELRGHJUDGHDEOH
cleans dirt, grease and oil. Can be
used full strength or diluted with
ZDWHU)RUPXODSXUSOH
‡08/7,385326(
‡³*5($6('/,*+71,1*
25$1*(%/$67´
CLEANER/DEGREASER
Our No.
Unit
Combines the cleaning power of
traditional greased lightning with
SXUH RUDQJH RLO 5HPRYHV ¿QJHU
prints and grime from your refrigerator and microwave.
:LSHVRXWVRDSVFXPDQGPLOGHZLQWXEVDQGVKRZHUV
'LVVROYHVFDNHGRQEDE\IRRGDQGVWLFN\PHVVHVRQKLJK
chairs. Cleans dust and debris on ceiling fans.
Jug
=8
Shf
Pk
CLEANER/DEGREASER
ACUITY SPECIALTY PRODUCTS
297-4160
Size
No.
HOME CARE LABS
CLEANER/DEGREASER
Our No.
No.
Our No.
Size
Oz
22
Shf
Pk
6
Unit
Shf
Pk
Unit
MAGIC AMERICAN
Trigger Spray
697-4752
,
$*
32
Size
Shf
Pk
Unit
LUNDMARK WAX CO.
739-6500X
860-6576
,
,+.6
*
2]
4
($
3276G05
5 Gal.
1
3$,/
‡&21&(175$7('
‡³.58'.877(5´
Formulated to attack the toughest
FOHDQLQJ MREV 6DIH DURXQG SHWV
SODQWV DQG JUDVV (QYLURQPHQWDOO\
IULHQGO\ 5LSV WKURXJK JUHDVH RLO
JULPHDQGVRLOEXLOGXS:RUNVRQFRQFUHWHEULFNSODV
tic, wood, aluminum, painted surfaces. Can be used to
FOHDQ JDUDJH ÀRRUV HQJLQHV DXWRUY HTXLSPHQW DQG
grills.
Size
Oz
No.
CLEANER/
DEGREASER
‡,1'225287'225
‡³*5($6(*5,==/<´
No.
Our No.
($
CLEANER/DEGREASER
Our No.
5HPRYHV JUHDVH RLO ZD[ JXP
dirt, dye, ink, soap tallow, smudge,
light carbon, etc. Cleans metal,
plastic, rubber, porcelain, composition, concrete and
ZRRG VXUIDFHV VDIHO\ DQG HIIHFWLYHO\ 1RQWR[LF QRQ
ÀDPPDEOHDQGQRQFRUURVVLYH
$OO SXUSRVH ZDWHUEDVHG PXOWL
task cleaner, degreaser, stain
UHPRYHU DQG H[WHULRU KRXVH ZDVK 5HPRYHV HYHQ WKH
WRXJKHVWVWDLQV/HDYHVQRUHVLGXHDQGUHTXLUHVQRULQV
LQJ 1RQWR[LF ELRGHJUDGDEOH QRQDEUDVLYH DQG QRQ
ÀDPPDEOH
Our No.
No.
Size
Shf
Pk
Unit
SUPREME CHEMICALS
634-7918
KK32
2]
12
($
634-9237
KK01
Gallon
6
*$/
%RQXV3DFN2]7ULJJHU6SUD\*DOORQ5H¿OO
6
($
540-4447X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
..
2]*DO
4
($
122 - Maintenance, Repair & Operations
CLEANER/DEGREASER
HAND CLEANERS
‡&,7586%$6('
,1'8675,$/675(1*7+
‡08/7,385326(
‡1$785$/&,7586),1(
380,&(/27,21
‡³)$6725$1*(´
$OO QDWXUDO DOWHUQDWLYH EDVHG RQ
FLWUXV E\SURGXFWV %LRGHJUDGDEOH
1RQWR[LFQRQFDXVWLF2QHJDOORQ
Biodegradable, waterless, petro
OHXP VROYHQWIUHH KDQG FOHDQHU
that contains no harsh chemicals,
mineral oils or ammonia that can sting cuts and abra
VLRQV 3XUH IUHVKVPHOOLQJ QDWXUDO FLWUXV SRZHU GRHV
WKH FOHDQLQJ )RUWL¿HG ZLWK DORH ODQROLQ JO\FHULQ DQG
other skin conditioners. Fine pumice formula gently deep
FOHDQVWKHWRXJKHVWGLUW:RUNVRQODXQGU\VWDLQVVFXII
PDUNVWLOHÀRRUVSHWRGRUVDQGRWKHUKRXVHKROGFOHDQ
LQJ QHHGV 8VH WR FOHDQ UHVLQV RLO JUHDVH WDU JULPH
VRLOSULQWHUV¶LQNHSR[LHVSDLQWUXEEHUFHPHQWJDVNHW
DQGWLOHFHPHQWV1DLOEUXVKZLWKPXOWLOHYHOEULVWOHVDQG
2 nail scrapers easily reattaches to bottle for storage.
Our No.
No.
Shf
Pk
Unit
4
*$/
COMPLEMENTARY COATINGS
760-7328X
3&
:D[HV3ROLVKHV$XWR$FFHVVRULHV
HAND CLEANERS
HAND CLEANERS
Our No.
‡1$785$/&,7586
‡),1(380,&(/27,21
‡³)$6725$1*(´
PERMATEX INC
Our No.
No.
Shf
Pk
Unit
PERMATEX INC
6TXHH]H%RWWOH:LWK1DLO%UXVK
620-1594
25113
15
Size
‡³)$6725$1*(´
Shf
Pk
Unit
12
($
620-9118
Gallon
4
($
HAND CLEANERS
Size
Oz
Shf
Pk
620-9001
No.
Size
Shf
Pk
Unit
PERMATEX INC
%RWWOH:LWK3XPS
620-6379
23218
Gallon
845-7400
2XQFH
4
($
12
PK 25
HAND CLEANERS
HAND SOAP
Green and white striated bar pro
vides a full, rich lather and a de
odorant system for maximum pro
tection.
229-9303
No.
Size
Oz
Shf
Pk
Unit
14108
4.5
18
PK 3
HAND SOAP
‡'(2'25$17
2ULJLQDO EDU FRORU DQG PLOG IUD
grance.
No.
Shf
Pk
Unit
18
PK 3
*ROG
‡380,&(32:(5('
‡³/$9$´
Size
Oz
Shf
Pk
Unit
7.5
12
($
Our No.
No.
Size
Oz
Shf
Pk
Unit
5.75
24
($
WD-40 COMPANY
673-6466
PERMATEX INC
25108
6
HAND SOAP
Biodegradable, waterless, petro
OHXP VROYHQWIUHH KDQG FOHDQHU
that contains no harsh chemicals,
mineral oils or ammonia that can sting cuts and abra
VLRQV 3XUH IUHVKVPHOOLQJ QDWXUDO FLWUXV SRZHU GRHV
WKH FOHDQLQJ )RUWL¿HG ZLWK DORH ODQROLQ JO\FHULQ DQG
other skin conditioners. Fine pumice formula gently deep
FOHDQVWKHWRXJKHVWGLUW:RUNVRQODXQGU\VWDLQVVFXII
PDUNVWLOHÀRRUVSHWRGRUVDQGRWKHUKRXVHKROGFOHDQ
LQJ QHHGV 8VH WR FOHDQ UHVLQV RLO JUHDVH WDU JULPH
VRLOSULQWHUV¶LQNHSR[LHVSDLQWUXEEHUFHPHQWJDVNHW
and tile cements.
050-9372
25
($
‡1$785$/&,7586
‡),1(380,&(/27,21
‡³)$6725$1*(´
No.
25025
DIAL CORPORATION
HAND CLEANERS
Our No.
Unit
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
716-8578X
Biodegradable, waterless, petro
OHXP VROYHQWIUHH FRQWDLQV QR
harsh chemicals, mineral oils or
DPPRQLDWKDWFDQVWLQJFXWVDQGDEUDVLRQV3XUHIUHVK
VPHOOLQJQDWXUDOFLWUXVSRZHUGRHVWKHFOHDQLQJ)RUWL¿HG
with aloe, lanolin, glycerin, and other skin conditioners.
*HQWO\GHHSFOHDQVWKHWRXJKHVWGLUW:RUNVRQODXQGU\
stains, pet odors, and other household cleaning needs.
8VHWRFOHDQUHVLQVRLOJUHDVHWDUJULPHVRLOSULQWHUV¶
ink, epoxies, paint, rubber cement, gaskets and tile ce
ment.
Our No.
35013
Shf
Pk
PERMATEX INC
Our No.
3ODVWLF7XE
‡1$785$/&,7586
60227+/27,21
‡³)$6725$1*(´
Count
Unit
PERMATEX INC
HAND CLEANERS
No.
DOT FOODS, INC. COLGATE PALMOLIVE
3XUHIUHVKVPHOOLQJQDWXUDOFLWUXV
power cleans deep down to remove
the most stubborn grease and
JULPH5HDGLO\ELRGHJUDGDEOHQRQ
WR[LFDQGSHWUROHXPVROYHQWIUHHIRUPXODIRUWKRVHZKR
SUHIHUDWKLFNHUFRQVLVWHQF\KDQGFOHDQHU)RUWL¿HGZLWK
SUHPLXPVNLQFRQGLWLRQHUV6XJJHVWHGDSSOLFDWLRQVUHV
LQVRLOJUHDVHWDUJULPHVRLOSULQWHUV¶LQNDGKHVLYHV
paint, food stains, scuff marks along with gasket and tile
FHPHQWV$OVRZRUNVJUHDWRQODXQGU\VWDLQVSHWRGRUV
and many other household cleaning needs.
No.
Our No.
Our No.
‡&5($0)2508/$380,&(
‡³)$6725$1*(´
Our No.
+HDY\GXW\FOHDQVKDQGVDQGDORW
more.
‡'(2'25$1725,*,1$/
‡³,5,6+635,1*´
%RWWOH:LWK3XPS1DLO%UXVK
Biodegradable, waterless, petro
OHXP VROYHQWIUHH KDQG FOHDQHU
that contains no harsh chemicals,
mineral oils or ammonia that can sting cuts and abra
VLRQV 3XUH IUHVKVPHOOLQJ QDWXUDO FLWUXV SRZHU GRHV
WKH FOHDQLQJ )RUWL¿HG ZLWK DORH ODQROLQ JO\FHULQ DQG
other skin conditioners. Fine pumice formula gently deep
FOHDQVWKHWRXJKHVWGLUW:RUNVRQODXQGU\VWDLQVVFXII
PDUNVWLOHÀRRUVSHWRGRUVDQGRWKHUKRXVHKROGFOHDQ
LQJ QHHGV 8VH WR FOHDQ UHVLQV RLO JUHDVH WDU JULPH
VRLOSULQWHUV¶LQNHSR[LHVSDLQWUXEEHUFHPHQWJDVNHW
DQGWLOHFHPHQWV1DLOEUXVKZLWKPXOWLOHYHOEULVWOHVDQG
2 nail scrapers easily reattaches to bottle for storage.
Size
Oz
No.
HAND CLEANING
TOWELS
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 123
HAND SOAP
HAND SOAP
HAND SOAP
‡/,48,'02,6785,=,1*
‡:,7+$/2(
‡³62)762$3´
‡)2$0$17,%$&7(5,$/
‡³&203/(7(´
‡3($5/,=('/,48,'
:LWKSXUH$ORH9HUDH[WUDFWFOHDQV
gently. Concentrated, a few drops
provide a rich cleansing lather.
/LJKW PRLVWXUL]HUV KHOS NHHS VNLQ IHHOLQJ VPRRUK DQG
VRIW4XLFNO\FXWVWKURXJKVRLOVRQVNLQ5LQVHVIUHHIDVW
IRUDVTXHDN\FOHDQIHHOLQJ*HQWOHZLOOQRWVWULSVNLQRI
natural oils. Preservative system helps prevent microbial
contamination.
Our No.
No.
Size
Oz
Shf
Pk
Unit
12
($
DOT FOODS, INC. COLGATE PALMOLIVE
692-9269
26012
7.5
8VHVDJHQWOHIRUPXODWKDWLVPLOG
on the skin and is effective at
cleaning away dirt, grease, ink and
HWF2IIHUV$FWLY)RDP6\VWHPWKDW
GHOLYHUVDKLJKO\HIIHFWLYHJHUPNLOOLQJIRUPXODWKURXJKD
VHOIIRDPLQJSXPS3DFNHGZLWKJHUP¿JKWLQJSRZHUWR
leave hands feeling fresh and clean. Kills a wide variety
RI GLVHDVHFDXVLQJ JHUPV LQFOXGLQJ 6DOPRQHOOD VWUHS
VWDSK DQG (FROL 'LVSHQVHV D OLJKW FUHDP\ IRDP LQWR
your hands.
Our No.
Size
Ozs.
No.
Shf
Pk
02725
7.5
8
($
HAND SOAP
(OLPLQDWHVWKHWRXJKGLUW\RXUIDP
ily encounters. Gentle cleansing
IRUPXOD /HDYHV VNLQ IHHOLQJ VRIW
DQGVPRRWK'HUPDWRORJLVWWHVWHG$VVRUWHGWKHPHODEHO
LQJLQFOXGLQJ%ODFN5DVSEHUU\DQG9DQLOOD'R1RW6SHFLI\
/DEHOLQJ
Shf
Pk
7.5
Pearly white lotion enhanced with
HVVHQFHRIWURSLFDOIUXLWVDQGÀRZ
ers. Formulated with a combination
RISUHPLXPTXDOLW\V\QWKHWLFGHWHU
gents and natural emollient. Balanced to clean thorough
ly without stripping natural moisturizers from the skin.
Our No.
Unit
7URSLFDO6FHQWHG
128
*
4
($
No.
Size
Oz
Shf
Pk
128
4
Unit
HAND SOAP
1RQGU\LQJ IRUPXOD &OHDQV DQG
VRIWHQV KDQGV 0DGH IURP SODQWV
Free of formaldehyde, Petrochemi
FDOV*02¶V3KRVSKDWHV&KORULQH
DQG $PPRQLD ELRGHJUDG
DEOH S+ QHXWUDO 5HFRJQL]HG IRU
VDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQIRUWKH(QYLURQPHQW
Program.
Our No.
No.
Scent
Shf
Pk
Unit
EARTH FRIENDLY PRODUCTS
17 Oz
441-7648
3/
/DYHQGHU
6
($
795-3698
3/
/HPRQJUDVV
6
($
LUNDMARK WAX CO.
Pump
‡$17,0,&52%,$/
‡³)2508/$´
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
135-8316X
Shf
Pk
LUNDMARK WAX CO.
Unit
Pump
‡/,48,'
‡³62)762$3)$%8/286
)5$*5$1&(6´
Size
Oz
Size
Oz
No.
517-3646X
HAND SOAP
No.
Our No.
DIAL CORPORATION
372-5884X
Our No.
Formulated to penetrate deep into
skin pores, around knuckles and
¿QJHUQDLOVWRGLVVROYHWUDFHVRIVRLO
Pearly white lotion hand cleaner
has the fragrance of exotic tropical
IUXLWVDQGÀRZHUV
12
923-9617
($
*
($
HAND SOAP
‡&,75866&(17
‡³62)762$3´
‡/,48,'
‡³62)762$3$48$5,80
6(5,(6´
Concentrated, a few drops pro
YLGH D ULFK FOHDQVLQJ ODWKHU /LJKW
moisturizers help keep skin feeling
smooth and soft. Quickly cuts through soils on skin. Gen
WOHZLOOQRWVWULSVNLQRIQDWXUDORLOV&OHDUVRDS$TXDULXP
Our No.
No.
‡:,7+$/2(
‡³62)762$3´
HAND SOAP
HAND SOAP
Size
Oz
Shf
Pk
.LWFKHQ )UHVK +DQGV &LWUXV 6FHQW
QHXWUDOL]HVRGRUOLTXLGKDQGVRDS
Our No.
No.
Size
Oz
Shf
Pk
Unit
26583
8.5
No.
616-2341X
Pump
814-6144X
Our No.
Size
Shf
Pk
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
DOT FOODS, INC. COLGATE PALMOLIVE
Unit
DOT FOODS, INC. COLGATE PALMOLIVE
3UHPLXPULFKODWKHULQJOLTXLGVRDS
with mild, yet effective skin clean
ers. Conditioners and moisturizing
agents smooth and protect skin by
PDLQWDLQLQJLWVQDWXUDOS+EDODQFH*HQWOHFOHDQVLQJIRU
mula with a touch of aloe vera.
12
Gallon
4
($
($
Pump
874-4138
26800
8.5
12
($
HAND SOAP DISPLAYS
HAND SOAP
‡³*$5'(1(5¶6*5,0($:$<´
HAND SOAP
‡5(),//%277/(
‡³62)762$3´
‡/,48,'$17,%$&7(5,$/
/LJKWPRLVWXUL]HUOLTXLGKDQGVRDS
'LVSOD\ &RQWDLQV EDUV 3XUH
VRDS ZLWK JULWV DQG SXPLFH 0LOG
but scrubs away dirt and grime.
Kills a broad spectrum of bacterial
and yeasts and helps to prevent
WKH JURZWK RI JUDPSRVLWLYH DQG
JUDPQHJDWLYHSDWKRJHQV
Our No.
No.
Size
Oz
Our No.
Shf
Pk
No.
Size
Oz
Shf
Pk
Our No.
Unit
DIAL CORPORATION
56
6
($
Pump
164-4020X
11.25
12
Unit
1
',63
%DU'LVSOD\
335-0287
6TXHH]H%RWWOH
116-6909X
Shf
Pk
REMWOOD PRODUCTS
DOT FOODS, INC. COLGATE PALMOLIVE
Unit
Size
Oz
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
,+.6
62018
7
124 - Maintenance, Repair & Operations
HAND SOAP DISPLAYS
HAND CLEANER
HAND CLEANER
‡385(
‡³*5$1'0$¶6/<(62$3´
‡)2$0,1*6$1,7,=(5
‡$/&2+2/
‡³=(3´
‡1$785$/&,7586
60227+/27,21
‡³)$6725$1*(´
Contains aloe skin conditioner leav
ing hands soft, without any sticky
UHVLGXH .LOOV RI JHUPV
Provides up to 1,000 pumps.
Biodegradable, waterless, petro
OHXP VROYHQWIUHH FRQWDLQV QR
harsh chemicals, mineral oils or
DPPRQLDWKDWFDQVWLQJFXWVDQGDEUDVLRQV3XUHIUHVK
VPHOOLQJQDWXUDOFLWUXVSRZHUGRHVWKHFOHDQLQJ)RUWL¿HG
with aloe, lanolin, glycerin, and other skin conditioners.
*HQWO\GHHSFOHDQVWKHWRXJKHVWGLUW:RUNVRQODXQGU\
stains, pet odors, and other household cleaning needs.
8VH WR FOHDQ UHVLQV RLO JUHDVH WDU JULPH VRLO SULQW
HUV¶LQNHSR[LHVSDLQWUXEEHUFHPHQWJDVNHWVDQGWLOH
FHPHQW 1DLO EUXVK ZLWK PXOWLOHYHO EULVWOHV DQG QDLO
scrapers easily reattaches to bottle for storage.
'LVSOD\ &RQWDLQV %DUV /\H
6RDS &DQ EH XVHG IRU 3VRULDVLV
(F]HPD7HHQDJH$FQH3RLVRQ,Y\
DQG3RLVRQ2DN5DVK.HHSV0RV
TXLWRHVDQGFKLJJHUVDZD\/\HLVXVHGLQWKHPDQXIDF
turing process but is burnt away leaving the soap pure.
Our No.
No.
Size
Oz
Shf
Pk
Unit
REMWOOD PRODUCTS
60018
Size
Oz
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
7
005-0690
1
=8)+6
18
6
($
',63
Our No.
HAND CLEANER
HAND SOAP
DISPENSER
Cap
Oz
No.
Shf
Pk
Unit
12
($
No.
Unit
6
&$1
Green
58028
NORTH AMERICAN PAPER CO
674-3538
266702
40
HAND CLEANER
‡1$785$/&,7586
‡),1(380,&(/27,21
‡³)$6725$1*(´
HAND CLEANER
DISPENSERS
‡81,9(56$/
$OORZV IRU PHWHUHG XVH RI DOO '/
Permatex hand cleaners in the pro
fessional size containers noted with
D ³SOXV VLJQ´ 'HVLJQHG WR RIIHU
\HDUVRIWURXEOHIUHHUHSHDWHGXVH&RQVLVWHQWO\FRQWUROV
the amount of hand cleaner dispensed, cutting down on
unnecessary waste.
Our No.
Shf
Pk
No.
Unit
PERMATEX INC
502-5366
6
($
Biodegradable, waterless, petro
OHXP VROYHQWIUHH KDQG FOHDQHU
that contains no harsh chemicals,
mineral oils or ammonia that can sting cuts and abra
VLRQV 3XUH IUHVKVPHOOLQJ QDWXUDO FLWUXV SRZHU GRHV
WKH FOHDQLQJ )RUWL¿HG ZLWK DORH ODQROLQ JO\FHULQ DQG
other skin conditioners. Fine pumice formula gently deep
FOHDQVWKHWRXJKHVWGLUW:RUNVRQODXQGU\VWDLQVVFXII
PDUNVWLOHÀRRUVSHWRGRUVDQGRWKHUKRXVHKROGFOHDQ
LQJ QHHGV 8VH WR FOHDQ UHVLQV RLO JUHDVH WDU JULPH
VRLOSULQWHUV¶LQNHSR[LHVSDLQWUXEEHUFHPHQWJDVNHW
and tile cements.
Our No.
No.
Size
*DO
Shf
Pk
‡,1'8675,$/
‡+($9<'87<25$1*(
‡³=(3´
Size
Oz
No.
6
Our No.
128
=8
16
No.
Size
*DO
Shf
Pk
Unit
%RWWOH:LWK3XPS
677-4582
23217
6
($
HAND CLEANER
($
Cleans sticky messes off hands and
leaves a light herbal aroma with
RXWVWULSSLQJVNLQ¶VQDWXUDOSURWHFWLYHRLOV+HUE*DUGHQ
scent. Pump.
No.
Size
Oz
Shf
Pk
Unit
16
12
($
SUNSHINE MAKERS
232-9266
Shf
Pk
Unit
4
($
12
($
6TXHH]H%RWWOH
659-8940
($
PERMATEX INC
%RWWOH:LWK3XPS
=8
12
Biodegradable, waterless, petro
OHXP VROYHQWIUHH FRQWDLQV QR
harsh chemicals, mineral oils or ammonia that can sting
FXWV DQG DEUDVLRQV 3XUH IUHVKVPHOOLQJ QDWXUDO FLWUXV
SRZHU GRHV WKH FOHDQLQJ )RUWL¿HG ZLWK DORH ODQROLQ
glycerin, and other skin conditioners. Gently deep cleans
WKH WRXJKHVW GLUW :RUNV RQ ODXQGU\ VWDLQV SHW RGRUV
DQGRWKHUKRXVHKROGFOHDQLQJQHHGV8VHWRFOHDQUHVLQV
RLOJUHDVHWDUJULPHVRLOSULQWHUV¶LQNHSR[LHVSDLQW
rubber cement, gaskets and tile cement.
ACUITY SPECIALTY PRODUCTS
230-2388
15
‡1$785$/&,7586
60227+/27,21
‡³)$6725$1*(´
Our No.
,QGXVWULDO VWUHQJWK KDQG FOHDQHU
combines citrus solvents and the
scrubbing action of pumice, en
riched with aloe vera to prevent chapping.
Our No.
25217
23113
Unit
%RWWOH:LWK3XPS
678-4110
Unit
‡/,48,'
‡³6,03/(*5((1
1$785$/6´
PERMATEX INC
HAND CLEANER
Shf
Pk
HAND CLEANER
Shf
Pk
KIMBERLY CLARK
911-3788
Size
Oz
6TXHH]H%RWWOH:LWK1DLO%UXVK
606-3168
2QHVWHS FOHDQXS ZLSHV SHU
FDQLVWHU 3UHPRLVWHQHG ZLSH ZLWK
D KHDY\ GXW\ FOHDQVHU (DVLO\ UH
moves grease, grime, oil, paint and
LQN5RXJKVLGHIRUH[WUDVFUXEELQJVWUHQJWK
Our No.
No.
PERMATEX INC
‡+$1':,3(6&,7586
‡³6&277´
3XVKLQ YDOYH GLUHFWV RSHUDWLQJ
SUHVVXUH WRZDUG ZDOO &RUURVLRQ
UHVLVWDQW VHOIFOHDQLQJ YDOYH GLV
SHQVHVZLGHUDQJHRIOLTXLGVRDSV
lotions, and synthetic detergents.
9DQGDOUHVLVWDQW ZLWK NH\OHVV ORFNLQJ GHYLFH /DUJH FD
pacity, translucent container provides visible soap level.
&RQFHDOHG ZDOO IDVWHQLQJ 7ZRWRQH EODFN DQG JUH\
´:[´+´ZDOOWRSXVKEXWWRQ
Our No.
No.
%RWWOH:LWK3XPS
%DU'LVSOD\
902-3102
Our No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
12306
Maintenance, Repair & Operations - 125
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
HAND CLEANER
HAND SANITIZERS
‡:$7(5/(66&5($0
‡³%/8(/$%(/´
‡,167$17
‡³=(3´
Gentle to hands. Cream formula
ZDWHUOHVV KDQG FOHDQHU 'RHV QRW
OHDYH JUHDV\ IHHOLQJ 8VH IRU RLO
grease, tar, grime, soil, resins,
SULQWHUV¶LQNHSR[LHVSDLQWUXEEHUFHPHQWJDVNHWVDQG
WLOHFHPHQW7KHOEFDQ¿WVPRVWGLVSHQVHUVLQFOXGLQJ
'/3HUPDWH[1R
Convenient hand washing supple
PHQW6DQLWL]HVKDQGVE\UHPRYLQJ
potential harmful microorganisms.
Contains aloe skin conditioner.
6TXHH]H%RWWOH
Our No.
No.
Shf
Pk
Size
Unit
PERMATEX INC
Our No.
GLASS CARE
Size
Oz
No.
GLASS CLEANER
‡/,48,'&21&(175$7(
‡³648((*(=<´
Shf
Pk
Unit
12
($
ACUITY SPECIALTY PRODUCTS
234-9603
4
=8,+653
Tub
01013
2]
12
($
004-1483
01406
/E
6
($
401-2233X
HAND CLEANER
‡1$785$/&,7586&5($0
‡³)$6725$1*(´
3XUHIUHVKVPHOOLQJQDWXUDOFLWUXV
power cleans deep down to remove
the most stubborn grease and
JULPH 5HDGLO\ ELRGHJUDGDEOH QRQWR[LF DQG SHWUROHXP
VROYHQWIUHH)RUWL¿HGZLWKVNLQFRQGLWLRQHUV8VHIRUUHV
LQVRLOJUHDVHWDUJULPHVRLOSULQWHUV¶LQNDGKHVLYHV
paint, food stains, scuff marks along with gasket and tile
FHPHQWV:RUNVRQODXQGU\VWDLQVSHWRGRUVDQGPDQ\
other household cleaning needs.
Size
Oz
Shf
Pk
Unit
Our No.
Size
Oz
No.
Shf
Pk
Unit
28
33013
14
($
12
($
HAND CLEANER
‡35(02,67(1('
72:(/(77(6
‡³6&58%6,1$%8&.(7´
&LWUXVEDVHG IRUPXOD LV FRPELQHG
with a tough, texture blue towel
to loosen, dissolve and absorb dirt
DQGJUHDVHOHDYLQJKDQGVFOHDQ8VHWRUHPRYHGLUWWDU
oils, grease, paints, adhesives, epoxies, caulks, inks and
G\HV XUHWKDQV OXEULFDQWV FDEOH MHOO\ DQG DVSKDOW 8VH
on tools, plastics, painted surfaces, metals, work sur
IDFHVHTXLSPHQWYLQ\ODQGWRROER[HV´[´
Our No.
No.
No. of
7RZHOV3N
Shf
Pk
Unit
ITW DYMON
618-1747
42272
72
056-9350X
8
6
($
272-6628X
03054
15
6
($
411-0706
1000001474
40
6
($
48
($
04866
2.5
6
($
45337
25
Our No.
6240
10
Shf
Pk
Unit
8VHGWRUHGXFHEDFWHULDDQGLQIHF
tion at hospitals, health facilities,
homes, schools and businesses.
8VHRQ\RXUKDQGVHVSHFLDOO\ZKHQ
VRDS DQG ZDWHU DUH XQDYDLODEOH .LOOV SHUFHQW RI
JHUPV$OFRKROEDVHG0RLVWXUL]HVZLWKYLWDPLQ(3XPS
Our No.
No.
Size
Oz
Shf
Pk
6
($
Shf
Pk
Unit
‡675($.)5((
‡³=(3´
Our No.
Size
Oz
No.
ACUITY SPECIALTY PRODUCTS
Jug
242-9231
128
=8
4
($
12
($
Trigger Spray
238-6142
=8
32
Unit
VI-JON LABORATORIES
202-2556X
08738
8
6
($
GLASS CLEANER
‡$0021,$)5((
‡&21&(175$7(
‡³=(3´
HAND SANITIZERS
Our No.
853-6948X
6
Size
Oz
‡$/2($17,%$&7(5,$/
‡³*(50;´
Concentrated, economical glass
DQG OLJKW GXW\ FOHDQHU ,GHDO IRU
KRPH DQG DXWR 1RQVWUHDNLQJ
DPPRQLDIUHH IRUPXOD 5HPRYHV VPXGJHV GLUW DQG
GXVW0DNHVJDOORQV
Size
Oz
No.
Shf
Pk
Unit
LIL DRUG STORE PRODUCTS
Shf
Pk
No.
GLASS CLEANER
1
6
($
1
',63
414-0034
&RXQWHU7RS'LVSOD\
037-4546
1
No.
Size
Oz
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
Unit
OATEY
196-2349
($
CHEMICAL TECHNOLOGIES I
Our No.
5HPRYHV VROYHQW FHPHQWV VHDO
ants, putty, compounds and oils
from hands without water. Conditions hands leaving skin
VRIW 8VH LW ZKHQ SDLQWLQJ ODQGVFDSLQJ DXWRPRWLYH
maintenance and repair.
Count
12
5HPRYHVKDUGZDWHUVSRWVJULPH
dirt, soap scum and the most stub
born stains from glass, tiles, por
FHODLQ FKURPH ¿[WXUHV DQG PXFK
PRUH+HDY\GXW\EURZQ
HAND SANITIZERS
:LWK DORH EHDGV IRU PRLVWXUL]LQJ
'LVSOD\KDVSHJVZLWKVDQLWL]HUV
on each peg, 36 total pieces.
‡35(02,67(1('
72:(/(77(6
‡$17,%$&7(5,$/
‡³+(5&8/(6´
No.
32
5HDG\WRXVH KHDY\ GXW\ JODVV
FOHDQHU 5HPRYHV ¿OP JUHDV\ ¿Q
gerprints, bugs, lipstick and other
soils.
HAND CLEANER
Our No.
Unit
‡³%58&(¶6*65´
140-3609X
3ODVWLF7XE
678-4128
Shf
Pk
Tub
Pump
512-7576X
12
6242
VI-JON LABORATORIES
6TXHH]H%RWWOH
%RQXV3DN3ODVWLF7XE
Size
Oz
GLASS CLEANER
0RLVWXUL]HV ZLWK 9LWDPLQ ( *UHDW
alternative when soap and water
are unavailable. Perfect for high
WUDI¿F DUHDV *UHDW IRU KHDY\ XVHUV RI KDQG VDQLWL]HU
SURGXFWV 8VHG WR UHGXFH EDFHULD DQG LQIHFWLRQ DW KRV
pitals, health facilities, homes, schools and businesses.
$OFRKROEDVHG
PERMATEX INC
239-1878
No.
HAND SANITIZERS
‡25,*,1$/$17,%$&7(5,$/
‡&/($5
‡³*(50;´
No.
Our No.
CHEMICAL TECHNOLOGIES I
678-4086
Our No.
Biodegradable glass cleaning con
centrate intended for use with a
VRIWDEVRUEHQWVFUXEEHUDQGVTXHH
gee. 2 Tbsp. per gallon of water.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
=8
128
4
($
126 - Maintenance, Repair & Operations
GLASS CLEANER
Size
Oz
No.
Shf
Pk
Unit
SC JOHNSON
807-9543X
70230
12
‡³:,1'(;´
‡$0021,$)5((
‡5($'<7286(
‡³6,03/(*5((1
1$785$/6´
6WUHDNIUHHVKLQH$HURVRO
Our No.
GLASS CLEANER
GLASS CLEANER
‡)2$0,1*
‡³:,1'(;´
($
For glass, mirrors, chrome and
RWKHU UHÀHFWLYH VXUIDFHV DOO DURXQG WKH KRPH &OHDQV
ZLWKRXW DPPRQLD DQG DOFRKRO 5RVHPDU\ 0LQW VFHQW
7ULJJHU6SUD\
Our No.
No.
Size
Oz
Shf
Pk
Unit
SUNSHINE MAKERS
811-3110
12302
32
6
GLASS CLEANER
Size
Oz
‡$//385326(
‡³5(1=(=´
Shf
Pk
Unit
12
($
ACUITY SPECIALTY PRODUCTS
24
=8)2*$
:LQGRZ DQG DOO SXUSRVH ZDVKHU
VSUD\HU $WWDFK WR JDUGHQ KRVH WR
wash outside windows through
VFUHHQV8VHRQFDUVVLGLQJERDWV
59¶V DQG PRUH ,QFOXGHV VSUD\HU DQG RQH R] VRDS
SDFNHW:LOOQRWKDUPSODQWVRUVKUXEV
Our No.
996-7068
‡³63$5./(´
Cuts through grease, grime and
ZLQGRZ ¿OP /HDYHV QR VWUHDNV
:RUNVRQZLQGRZVPLUURUVVWDLQ
OHVVVWHHODQGSOH[LJODVV$PPRQLD
IUHH'HLRQL]HGIRUPXOD
No.
Size
20500
Gal.
Shf
Pk
No.
12001
6
Shf
Pk
Unit
4
Our No.
2]
12
276-1609X
Shf
Pk
Unit
14001
16
12
($
Size
Ozs.
Shf
Pk
Unit
Our No.
494-7461X
12
&$1
No.
Size
Oz
Shf
Pk
Unit
950-5074
00126
32
12
($
923-3727
00128
67.6
6
($
718-4914X
12207
128
4
($
No.
13001
‡&200(5&,$/9,1(*$5'
‡³:,1'(;´
/HDYHV D VWUHDNIUHH VKLQH (DV\
cleaning of glass, stainless steel,
chrome, porcelain, ceramic tile and
IRUPLFD/LTXLGFOHDUJUHHQFRORU
No.
Size
Oz
Shf
Pk
Unit
12
($
Size
Oz
Shf
Pk
Unit
32
12
($
Trigger Spray
Size
Oz
Shf
Pk
Unit
4
72
($
08520
32
GLASS CLEANER
‡&200(5&,$/$0021,$'
‡³:,1'(;´
/HDYHV D VWUHDNIUHH VKLQH )RU
easy cleaning of glass, stainless
steel, chrome, porcelain, ceramic
WLOHDQGIRUPLFD/LTXLGFOHDUEOXH
color.
No.
SC JOHNSON
Size
Ozs.
696-3540
Shf
Pk
Unit
12
&$1
RADIATOR SPECIALTY
$HURVRO
($
SC JOHNSON
Our No.
8VH IRU KRPH RI¿FH FDU RU ERDW
Cleans windshields, all glass win
dows, mirrors, appliances, ceramic
tile, chrome, stainless steel, and
DOXPLQXPZLWKRXWVWUHDNLQJ6DIHIRUWLQWHGZLQGRZV
GC3
12
‡$0021,$'5(),//
‡³:,1'(;´
696-3524
REMWOOD PRODUCTS
22
SC JOHNSON
6LQJOHXVHUH¿OOXVHZLWK5HQ](=
6SUD\HU6NXIRURXWVLGH
ZLQGRZV FDUV 5Y¶V VLGLQJ DQG
more.
‡$0021,$)5((
‡³*81.´
027-6162X
70255
GLASS CLEANER
Our No.
‡5(),//
‡³5(1=(=´
GLASS CLEANER
No.
No.
Size
Oz
GLASS CLEANER
$HURVRO
Our No.
($
Our No.
REMWOOD PRODUCTS
($
RADIATOR SPECIALTY
GC1
($
12
GLASS CLEANER
8VH IRU KRPH RI¿FH FDU RU ERDW
Cleans windshields, all glass win
dows, mirrors, appliances, ceramic
tile, chrome, stainless steel, and
aluminum without streaking.
397-6396X
12
26
:LQGRZ DQG DOO SXUSRVH FOHDQHU
XVHZLWK6NX
($
‡:,7+$0021,$
‡³*81.´
No.
12
20133
($
‡635$<(55(),//%2;
‡³5(1=(=´
GLASS CLEANER
Our No.
00123
999-6638
Unit
GLASS CLEANER
Trigger Spray
20122
$PPRQLD')RUPXOD5HJXODU6FHQW
Cleans dirt and grease with no
streaks, cleans appliances, car win
dows, chrome, counter tops, mir
URUV SLFWXUH JODVV SRUFHODLQ 79
screens, etc.
5H¿OO
614-8381
Unit
%OXH5HJXODU6FHQW
AJ FUNK CO
614-8407
Shf
Pk
923-3412
REMWOOD PRODUCTS
GLASS CLEANER
Our No.
Size
Oz
SC JOHNSON
936-7756
No.
No.
GLASS CLEANER
Convenient, aerosol delivery pro
vides premium glass and mirror
FOHDQLQJ(DV\WRXVHIRDPIRUPX
ODWLRQ$HURVRO
455-5017
Our No.
9LQHJDU')RUPXOD/HPRQ6FHQW
‡)2$0,1*
‡³=(3´
Our No.
($
Cleans dirt and grease with no
VWUHDNV $OVR FOHDQV DSSOLDQFHV
mirrors, porcelain, tile, chrome,
car windows, picture glass, coun
WHU WRSV 79 VFUHHQV HWF 7ULJJHU
6SUD\
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
08521
Maintenance, Repair & Operations - 127
GLASS CLEANER
GLASS CLEANER
‡(/(&7521,&685)$&(
‡³:,1'(;´
‡$//,121(67$57(5.,7
‡287'225
‡³:,1'(;´
1R UHVLGXH VWUHDNIUHH VKLQH
Cleans televisions, cell phones,
FRPSXWHUV DQG PRUH 8VH ZLWK
:LQGH[ HOHFWULF GU\ FORWK 1R
6.8$HURVRO
Our No.
No.
Size
Oz
Shf
Pk
Unit
SC JOHNSON
70228
506-1148X
6
($
831-5822
$WWDFK WR JDUGHQ KRVH VSUD\ DQG
rinse.
No.
Size
Oz
Shf
Pk
10122
32
8
($
GLASS CLEANER
‡³63$5./(´
Size
Oz
Shf
Pk
20
12
Our No.
Shf
Pk
No.
051-9850
16
Unit
7,+6
0400
1
6
($
3UHPHDVXUHG DQG LQGLYLGXDOO\
SDFNDJHG 0L[ ZLWK JDOORQV
RIZDWHU3LOOTXLFNO\GLVVROYHVKHOS
LQJ\RXWRXVHWLPHHI¿FLHQWO\(DV
ily lifts and removes soil deposits.
Our No.
No.
Shf
Pk
Unit
10
($
UNGER INDUSTRIAL
737-6924X
7,6
3/
WINDOW CLEANER
‡/$9(1'(5
Cleans glass and mirrors without
leaving any streaks or hazing be
KLQG 'ULHV IDVW0DGH ZLWK RQO\
VXVWDLQDEOH SODQWEDVHG LQ
JUHGLHQWV 'RHV QRW FRQWDLQ G\HV
RUV\QWKHWLFSHUIXPHVQHXWUDOS+JUH\ZDWHUDQGVHSWLF
VDIH5HFRJQL]HGIRUVDIHUFKHPLVWU\E\WKH(3$¶V'HVLJQ
IRUWKH(QYLURQPHQW3URJUDP
No.
Shf
Pk
Unit
12
($
EARTH FRIENDLY PRODUCTS
32 Oz
644-3014
Size
Oz
Shf
Pk
Unit
8
12
($
3/
GLASS/SURFACE
CLEANER
‡³)2508/$´
Unit
&OHDQV \RXU NLWFKHQ WR D VWUHDN
free shine. For stainless steel appli
ances, glass tops, and many other
hard surfaces throughout your
home.
GLASS CLEANER
‡³12675((.´
995-2672
Our No.
TR INDUSTRIES
SC JOHNSON
70118
($
Polishes in one convenient, easy
DSSOLFDWLRQ8VHIRUVXSHULRU¿QLVK
es on all glass, chrome and metal
VXUIDFHV DQG RQ PLUURUV $ WUXH
professional grade polish, works on
hard water spots.
)RU XVH ZLWK 2XWGRRU$OO,Q2QH
6WDUWHU .LW 6.8 &RQ
WDLQV UH¿OO FOHDQLQJ SDGV HDFK
pad cleans 20 windows.
450-8131
12
‡³12675((.´
($
‡$//,121(5(),//6
‡287'225
‡³:,1'(;´
No.
6:5(7$,/
GLASS CLEANER
GLASS CLEANER
Our No.
Unit
Unit
$HURVRO
20620
Shf
Pk
Shf
Pk
UNGER INDUSTRIAL
‡&200(5&,$/*5$'(
‡³7+(3,//´
$HURVRO
AJ FUNK CO
662-3995
Size
Oz
No.
Size
Liter
No.
($
SPRAYWAY, INC.
317-9124X
No.
6
Our No.
GLASS CLEANER
Cleans glass, windows, mirrors,
windshields, enamel surfaces,
chrome, tile, porcelain and other
KDUG VXUIDFHV 'LVVROYHV GLUW
JUHDVH JULW DQG JULPH +HDY\
duty foam clings to vertical sur
IDFHV /HDYHV QR ¿OP &RQWDLQV SHUIXPHJUDGH DOFRKRO
$PPRQLDIUHH
Our No.
,QGXVWULDO XVH JODVV FOHDQHU &XWV
through grease, grime and window
¿OP6WUHDNIUHH
Our No.
70117
Clean faster and easier with ultra
JOLGH 5HPRYHV WRXJK GLUW OHDYHV
QR ¿OP IRDP RU VWUHDNV %LRGH
JUDGDEOHVNLQIULHQGO\OLWHUERWWOHPDNHVJDOORQV
Unit
GLASS CLEANER
Unit
SC JOHNSON
687-9738
Shf
Pk
No.
SC JOHNSON
‡&21&(175$7('+26(
(1'
‡³:,1'(;287'225´
Our No.
Provides a faster, easier way to
clean outdoor windows. Prevents
streaks and spotting, Cleans 20
ZLQGRZVZLWKDVLQJOHSDG5HDFKHVXSWRIHHWVR\RX
can safely and easily tackle tough outdoor grime without
the hassle of using a ladder. Cleans outdoor windows in
MXVWHDV\VWHSV6SUD\ZLQGRZDQGFOHDQLQJSDGZLWK
JDUGHQ KRVH :LSH ZLQGRZ ZLWK FOHDQLQJ SDG 5LQVH
ZLQGRZZLWKJDUGHQKRVH1RQHHGWRKDQGGU\.LW,Q
FOXGHVFOHDQLQJKHDG¶KDQGOH¶SROHVHFWLRQV
FOHDQLQJSDG5H¿OO6.8
Our No.
GLASS CLEANER
GLASS CLEANER
‡/,48,'&21&(175$7(
‡³($6<*/,'(´
($
8VH WR FOHDQ VKLQH DQG SURWHFW
8VH RQ JODVV FKURPH PHWDO DQG
PLUURUHG VXUIDFHV /HDYHV QR
streak even in direct sunlight.
Our No.
No.
Our No.
16
Size
Oz
Shf
Pk
Unit
12
($
CLOROX COMPANY
Trigger Spray
Size
Oz
Shf
Pk
Unit
12
($
335-7712
TR INDUSTRIES
886-8168X
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
14812
32
128 - Maintenance, Repair & Operations
GLASS/SURFACE
CLEANER
‡³*/$663/86´
Size
Oz
No.
Shf
Pk
Unit
RECKITT BENCKISER
32
‡728*+2'2562/87,216
‡635$<
‡³*/$'(´
Our No.
12
Size
Oz
No.
Shf
Pk
Unit
LIL DRUG STORE PRODUCTS
795-7897X
Trigger Spray
651-3543
AIR FRESHENERS
‡635$<
‡³&,75$´
1HXWUDOL]HVRGRUVZLWKFOHDQFLWUXV
smell.
*ODVV DQG PXOWLVXUIDFH OLTXLG
cleaner. Cuts through dirt, grease
DQGJULPH1R$PPRQLD1RVWUHDN
formula.
Our No.
AIR PURIFIER
Our No.
1.5
24
($
AIR FRESHENERS
Provides continuous air freshening.
Place in bathroom, closet, kitchen,
RI¿FHDQGRWKHUURRPV/RQJODVW
ing.
3UHPRLVWHQHGQRQZRYHQ´[
´ WRZHOHWWHV FOHDQ JODVV SOXV
PRUHDQGOHDYHDVWUHDNIUHHVKLQH
6OLJKW IUXLW\ ÀRUDO ERXTXHW RGRU
1RW5HFRPPHQGHGIRUSDLQWHGRUZRRGVXUIDFHV
Count
Shf
Pk
Our No.
30
12
($
Unit
‡)$%5,&0,67
‡³/<62/1(875$$,5´
(OLPLQDWHV EDFWHULDO RGRUV DW WKH
source and leaves a light, fresh
VFHQW6XLWDEOHWRXVHRQPRVWIDE
rics and in the air. Proven to elimi
nate tough odors including pet odors, smoke odors, and
ERG\RGRUV.LOOVRIEDFWHULDRQVRIWVXUIDFHV
Shf
Pk
Unit
027-0835
&ULVS/LQHQ
($
0RUQLQJ5DLQ
($
&OHDU6SULQJV
8
($
881-8601
72624
)UHVK6FHQW
($
‡728*+2'2562/87,216
‡6(16(635$<67$57(5
.,7
‡³*/$'(´
6XSHU2GRU.LOOHU
12
($
Our No.
939-6854X
03663
$IWHU7KH5DLQ
12
($
SC JOHNSON
375-9214X
35000
&LWUXV6XQEXUVW
12
($
833-3320
Our No.
No.
Fragrance
6.8
Size
Oz
Fragrance
Shf
Pk
Unit
.43
&OHDU6SULQJV
10
($
‡6(16(635$<
‡67$57(5'(6,*1.,7
‡³*/$'(´
(OLPLQDWHV RGRUV LQ WKH DLU IDEULF
DQG FDUSHW (OLPLQDWHV WKH WRXJK
est odors such as tobacco smoke,
EDWKURRP DQG SHW RGRUV /HDYHV D IUHVK FOHDQ ORQJ
ODVWLQJIUDJUDQFH6DIHRQPRVWIDEULFVDQGFDUSHWVZKHQ
used as directed.
Size
Oz
No.
AIR FRESHENERS
Shf
Pk Unit
DIAL CORPORATION
36043
13
Pure Breeze
6
0RWLRQDFWLYDWHGIUHVKQHVVIRUDQ\
URRPLQ\RXUKRPH,QFOXGHVUH¿OO
DQGWZR$$EDWWHULHV5H¿OOODVWVXS
WRGD\V8VHZLWK5H¿OO1R6.8
Our No.
No.
Size
Oz
Fragrance
.43
/DY9DQLOOD
Shf
Pk
Unit
SC JOHNSON
733-7447
71482
6
($
($
AIR FRESHENERS
‡6(16(635$<
‡67$57(5'(6,*1.,7
‡³*/$'(´
AIR FRESHENERS
‡728*+2'2562/87,216
‡)$%5,&$,5635$<
‡³*/$'(´
‡&217,182862'25
(/,0,1$725
‡(1&/26('62/,'
‡³2'25*(1,(´
(QFORVHG VROLG JHO GLVVLSDWHV
through vents in gray container
DERXW´GLD3ODFHZKHUHQHHGHGWRHOLPLQDWHXQZDQWHG
odors. Charcoal layer removes odors, does not mask
RGRUV HPLW RGRUV RU PDVN XQZDQWHG VPHOOV ,PPHGL
DWHO\EHJLQVWRZRUNRQFH¿OPLVUHPRYHG8VHLQFDUV
boats, campers, storage rooms, bathrooms, pet areas,
trash cans, diaper pails, etc. to eliminate organic odors
LQFOXGLQJ SHW ¿VK XULQH YRPLW IHFHV JDUEDJH EHHU
VPRNHIURPWREDFFRZRRGDPPRQLDPLOGHZDOOIRUPV
of decomposition, sewage, carbon dioxide, Freon, form
aldehyde, ethylene, nitrogen, methyl alcohol, helium,
DQGPRUH/DVWVXSWRZHHNVGD\VVTIWFRY
erage approximately.
Size
Oz
Shf
Pk
Unit
DAMP RID INC
5H¿OO IRU
(OLPLQDWHV RGRUV RQ XSKROVWHU\
clothing and carpet, as well as in
WKHDLU*ODGH7RXJK2GRU6ROXWLRQV
ZLWK RGRU ¿JKWHU WHFKQRORJ\ LV VSHFLDOO\ IRUPXODWHG WR
¿JKWFRRNLQJEDWKURRPDQGSHWRGRUV
Our No.
No.
Size
Oz
Fragrance
Shf
Pk
Our No.
No.
6.8
Size
Oz
Fragrance
Shf
Pk
Unit
239-6620
.43
/DY9DQLOOD
10
($
Unit
SC JOHNSON
AIR FRESHENERS
Trigger Spray
680-2136
71708
22
&OHDU6SULQJ
8
($
385-3108
71711
22
)UHVK6FHQW
8
($
‡6&(17('2,/&$1'/(
‡:,7+*/$66+2/'(5
‡³*/$'(´
,QFOXGHV UH¿OODEOH KROGHU DQG RLOFDQGOH(DFKFDQGOHKROGHULVUH
¿OODEOH ZLWK DQ\ *ODGH VFHQWHG RLO
FDQGOH IUDJUDQFH %XUQV DSSUR[LPDWHO\ KRXUV 8VH
ZLWK5H¿OO1R6.8
No.
Size
Oz
Fragrance
0.5
/DY9DQLOOD
Shf
Pk
Unit
SC JOHNSON
:LOG%HUU\6FHQW&DUGHG
8
1R
SC JOHNSON
Our No.
)*+
1R
261-5367X
AIR PURIFIER
214-4210
72626
Trigger Spray
027-0850
No.
Unit
467-6300
039-8214X
RECKITT BENCKISER
Our No.
Shf
Pk
SC JOHNSON
5H¿OO IRU
7.5 Ounce
‡),1(0,67635$<
‡683(52'251(875$/,=(5
‡³5(18=,7³
ODOR REMOVERS
Scent
Shf
Pk
Fragrance
AIR FRESHENERS
AIR FRESHENERS
No.
No.
Unit
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
Our No.
Fragrance
AIR FRESHENERS
DIAL CORPORATION
RECKITT BENCKISER
171-9111
Size
Oz
‡$'-867$%/(
‡³5(18=,7/21*/$67´
‡³*/$663/86´
No.
No.
$HURVRO
($
GLASS/SURFACE
WIPES
Our No.
2GRU ¿JKWHU WHFKQRORJ\ TXLFNO\
freshens the air in your bathroom,
kitchen, living room, bedroom,
den, and helps eliminate pet odors.
6
($
725-6530
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
71175
6
($
Maintenance, Repair & Operations - AIR FRESHENERS
AIR FRESHENERS
AIR FRESHENERS
‡6&(17('2,/&$1'/(
‡5(),//
‡³*/$'(´
‡$,5())(&76
‡³)(%5(=(´
‡67,&.836
‡³:,=$5'´
(OLPLQDWHVRGRUVFDXVHGE\EDFWH
ULD DQG IUHVKHQV WKH DLU /HDYHV D
fresh scent.
5H¿OO IRU 1R 6.8
DQG 1R 6.8
%R[RIRLOFDQGOHV
Our No.
No.
Size
Oz
Fragrance
2.0
/DY9DQLOOD
Shf
Pk
Unit
SC JOHNSON
446-3261
Our No.
No.
Fragrance
Shf
Pk
Unit
PROCTER & GAMBLE
AIR FRESHENERS
607-3175
104-2217X
45536
6SULQJ5HQHZDO
248-6009X
45535
0HDGRZV5DLQ
($
720-6055X
07100
/LQHQ6N\
($
Shf
Pk
Fragrance
Unit
MAGIC AMERICAN
8 Ounce
064-7032
Shf
Pk
Unit
Crisp Breeze
12
($
AIR FRESHENERS
‡&21&(175$7(
‡³2'256$:$<´
8VHWRDEVRUEDQGGHVWUR\DLUERUQH
odors. Can be placed in bathrooms,
VWDOH VWRUDJH DUHDV FDUV (OLPL
nates smoke, pet odor, cooking,
JDVROLQHPLOGHZRUSDLQWIXPHV6ROLGJHOFRQWDLQLQJ2[L
%HDGV7UHDWVDQDUHDDERXW¶[¶
No.
Fragrance
($
‡2'25$,50$*1(7
‡³1$785$/0$*,&´
Our No.
No.
RECKITT BENCKISER
2XQFH$HURVRO
($
Our No.
AIR FRESHENERS
3URYLGHVJHQWOHQRIDGHIUDJUDQFH
8VHRQO\ZLWKVFHQWHGRLOSOXJLQV
1R 6.8 1R
DQG1R6.8
Our No.
12
2ULJLQDO
2GRUGHVWUR\LQJOLTXLGZLWKEXLOWLQ
DSSOLFDWRUGURSLVHTXLYDOHQWRI
VSUD\RI1R6.8
8QEUHDNDEOHSODVWLFERWWOHFRQWDLQV
enough for 240 applications.
‡)256&(17('2,/)$1
3/8*,1
‡³*/$'(´
No.
Fragrance
Our No.
No.
Size
Oz
Shf
Pk
Unit
24
($
WRAP ON CO
'URSSHU%RWWOH
Shf
Pk
Unit
183-5156
71000
SC JOHNSON
($
5H¿OO
AIR FRESHENERS
‡67$57(581,73/8*,1
‡127,&($%/(62,/:$50(5
‡³)(%5(=(´
(OHFWULF DLU IUHVKHQHU WKDW DOWHU
nates automatically between two
complementary scents. Contains 1
GXDOVFHQWHGRLOUH¿OO
Our No.
22714
Unit
6
($
AIR FRESHENERS
Fragrance
($
13271
12
AIR FRESHENERS
&OHDQ/LQHQ
($
691-9344
00018
9DQLOOD%UHH]H
12
($
‡0(7(5('
‡³&28175<9(7´
)RU XVH LQ &RXQWU\ 9HW DXWRPDWLF
PHWHUHGGLVSHQVHUV2GRUFRXQWHU
actant is released into air every 15
minutes, 24 hours a day, for a full
30 days. Great for kitchens, bathrooms, party rooms, pet
DUHDVEDVHPHQWVGD\WRGD\DQGRQKROLGD\V
1RQHOHFWULF PRLVWXUH DEVRUEHU
combined with a fresh scent to
protect against damage caused by
H[FHVV PRLVWXUH $EVRUEV PXVW\
odors caused by stagnant air and creates fresher, health
LHU DLU (QFORVHG ZKLWH SHOOHWV ODVW DSSUR[LPDWHO\ ZHHNVWRDFKHLYHWRUHODWLYHKXPLGLW\1RQWR[LF
VHSWLFVDIHDQGHQYLURQPHQWIULHQGO\
No.
Size
Oz
Shf
Pk
Unit
DAMP RID INC
651-9581
,QFOXGHV WZR FRPSOHPHQWDU\
scents that alternate automatically
WKURXJKRXW WKH GD\ 8VH ZLWK )H
EUHH]H1RWLFHDEOHVDOWHUQDWLQJVFHQWHGRLOZDUPHUV
No.
12
523-5833
Our No.
‡5(),//127,&($%/(62,/
:$50(5
‡³)(%5(=(´
Our No.
$SSOH&LQQDPRQ
AIR FRESHENERS
PROCTER & GAMBLE
043-8614
2827
‡&/26(7+$1*,1*
Shf
Pk
No.
448-2980
Shf
Pk Unit
PROCTER & GAMBLE
618-6035
45420
7KDL'UDJRQ)UXLW0RRQÀRZHU
8
($
625-1664
45556
/DYHQGHU9DQLOOD&RPIRUW
8
($
625-1649
45570
6SULQJ5HQHZDO
8
($
625-1623
45541
0HDGRZV5DLQ
8
($
625-1524
45540
/LQHQ6N\
8
($
FG80
14
6
($
AIR FRESHENERS
Size
Oz
Shf
Pk
Unit
2XQFH$HURVRO
050-6477
&9&$37
&LQQPQ6SLFH
12
($
436-7330
&9&$37
Fresh Cotton
12
($
728-7154
&9&$37
9DQLOOD&DUPHO
12
($
794-4879
&9&$37
&XFPEU0HORQ
12
($
2XQFH$HURVRO
330-7766
&9&$
0DQJR
12
($
067-4671
&9&$
'XWFK$SSOH
12
($
Our No.
No.
Fragrance
Shf
Pk
Unit
+DZDLLDQ%UHH]H
12
($
SC JOHNSON
632-7498
$HURVRO
73000
ENFORCER PRODUCTS
5H¿OOIRU*ODGH3OXJ,QV/RQJODVW
LQJODVWVXSWRGD\V1R
6.8 1R DQG
1R6.8
WRAP ON CO
882-0888
Shf
Pk Unit
Scent
‡)5$*5$1&(&$575,'*(
‡³*/$'(3/8*,16´
Features metered spray valve that
DXWRPDWLFDOO\ GLVSHQVHV HTXLYD
OHQW RI GURS RI 1R 6.8
3URYLGHV DLU IUHVKQHVV
for months anywhere used.
No.
No.
AIR FRESHENERS
‡&21&(175$7('
‡³2'256$:$<´
Our No.
Our No.
24
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
00016
130 - Maintenance, Repair & Operations
AIR FRESHENERS
AIR FRESHNERS
OIL CANDLE HOLDERS
‡$8720$7,&635$<5(),//
‡³*/$'(´
‡35(66635$<67$57(5
.,7
‡³*/$'(´
‡'(&25$7,9(*/$66
‡³*/$'(´
)LWV *ODGH $LU :LFN )UHVKPDWLF
8OWUDDQGRWKHUDXWRPDWLFVSUD\V
Continuous freshness up to 60
days.
Our No.
No.
Size
Oz
Fragrance
Shf
Pk
Unit
SC JOHNSON
$HURVRO
(QMR\ WKH IUHVKHQLQJ SRZHU RI D
room spray in a discreet design.
7KH VDQG\ KROGHU EOHQGV ZLWK RQ
trend neutral tones.The black holder blends with con
WHPSRUDU\DQGPRGHUQGHFRU(DV\WRXVHQREDWWHULHV
RU HOHFWULFDO RXWOHWV QHHGHG MXVW SUHVV DQG VSUD\ 8VHV
6HQVH6SUD\UH¿OOV
302-0211
71773
6.2
&OHDQ/LQHQ
6
($
209-5685
71775
6.2
$SSOH&LQQDPRQ
6
($
064-1969
71776
6.2
/DYHQGHU9DQLOOD
6
($
Our No.
347-3154
71777
6.2
+DZDLLDQ%UHH]H
6
($
SC JOHNSON
835-1462
AIR FRESHENERS
Fragrance
Shf
Pk
Unit
Our No.
846-7516X
+DZDLLDQ%UHH]H
12
($
248-6454X
$SSOH&LQQDPRQ
12
($
136-8216
Shf
Pk
Our No.
Unit
4
($
(OHFWULFZDUPHUFRPHVLQDQDWWUDF
tive design that fragrances larger
rooms.
Scent
Shf
Pk
Unit
SC JOHNSON
136-8224
72046
&OHDQ/LQHQ
&OHDQ/LQHQ
8
($
6
992-3657
No.
Scent
Shf
Pk
Unit
&OHDQ/LQHQ
12
($
136-8240
72052
+DZDLLDQ%UHH]H
12
($
6FHQWHG RLO ZDUPHU SURYLGH6 IUD
grance that can make even larger
rooms more inviting. Just insert the
warmer unit upright into an outlet
E\ URWDWLQJ WKH ZDUPHU¶V HOHFWULFDO SOXJ LI QHHGHG DG
just the fragrance level and enjoy the perfect amount
of fragrance.
$XWRPDWLF DHURVRO GLVSHQVHU $F
WLYDWHV D PHWHUHG UH¿OO HYHU\ PLQXWHV KRXUV D GD\ IRU GD\V2SHUDWHVXSWRWZR\HDUVRQ
IUHVK'FHOO$ONDOLQHEDWWHULHV
Our No.
+DZDLLDQ%UHH]H
&RORU
Shf
Pk
Unit
&9
Beige
12
($
8VH WR SUHYHQW PLOGHZ DQG PROG
2GRUIUHH VSUD\ IRUPV DQ LQYLVLEOH
layer that prevents mold spores
form adhering to a surface and
JURZLQJ 6LQJOH DSSOLFDWLRQ FDQ
prevent stains for 6 months. Can be used on any sur
IDFH WKDW LVQW¶V VWDLQHG E\ ZDWHU )RU XVH LQGRRUV DQG
RXWGRRUV8VHRQGHFNVSRROVSDWLRIXUQLWXUHUXJVDQG
carpets, draperies, upholstered furniture, closet con
tents, shower curtains, tile and tubs, shingle and tile
roofs, driveways and sidewalks, boat canvases and sails,
WHQWVDQGFDPSLQJHTXLSPHQWDLUFRQGLWLRQLQJGXFWVDQG
vents, clothing and bedding.
Our No.
Shf
Pk
6
No.
Size
Oz
Shf
Pk
Unit
DAMP RID INC
027-9265X
Unit
SC JOHNSON
650-6257
No.
ENFORCER PRODUCTS
($
Scent
($
MILDEW AND MOLD
BLOCKER
136-8232
No.
4
MOISTURE CONTROL
SC JOHNSON
Our No.
72775
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
‡6&(17('2,/:$50(5
‡³*/$'(3/8*,1´
‡(/(&75,&:$50(5
67$57(5.,7
‡³*/$'('(&256&(176´
No.
Unit
AIR FRESHNERS
AIR FRESHNERS
Our No.
Shf
Pk
5H¿OOV IRU 'HFRU 6FHQWV (OHF
WULF :DUPHU 6WDUWHU .LW 6.8
DQG *ODVV +ROGHU 6WDUWHU .LW 6.8 5H¿OOV
last 30 days.
SC JOHNSON
$SSOH&LQQDPRQ
72048
Unit
SC JOHNSON
‡0(7(5('$8720$7,&
‡³7,0(0,67´
‡³*/$'('(&256&(176´
.LWVFRPHVZLWK$$EDWWHULHVSUH
LQVWDOOHG DQG UH¿OO ,QFOXGHV D
boost button for instant fragrance
anytime. There are 3 time settings.
/DVWXSWRGD\VRXQFH%R[HG
71812
Scent
Shf
Pk
No.
DISPENSER SYSTEMS
AIR FRESHNER
REFILLS
‡$8720$7,&67$57(5.,7
‡³*/$'(´
697-7003
No.
Our No.
101-8696
AIR FRESHENERS
Fragrance
($
SC JOHNSON
6 Ounce
No.
6
Unit
Glass holder comes in a stylish de
sign that complements any room.
SC JOHNSON
Our No.
&OHDQ/LQHQ
Shf
Pk
‡*/$66+2/'(567$57(5
.,7
‡³*/$'('(&256&(176´
$GMXVWDEOHKROGHU/RQJODVWLQJJHO
IRUPXOD/DVWVXSWRGD\V
No.
71815
Scent
AIR FRESHNERS
‡62/,'*(/
‡³*/$'(´
Our No.
No.
Glade scented oil candles contain a
XQLTXHZDUPLQJSODWHZKLFKPHOWV
the candle into a pool of scented
ZD[ TXLFNO\ UHOHDVLQJ IUDJUDQFH
into the air to create a warm and relaxing atmosphere.
:KHQWKHZD[LVJRQHWKHFDQGOHJRHVRXWOHDYLQJQR
PHVV EHKLQG (DFK FDQGOHKROGHU LV UH¿OODEOH ZLWK DQ\
*ODGH6FHQWHG2LO&DQGOHVIUDJUDQFH$SSUR[LPDWHO\±
hours of burning time.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
FG300
32
6
($
Maintenance, Repair & Operations - 131
DISPOSABLE
DEHUMIDIFIERS
‡3$&.
‡+$1*,1*
‡³.((3,7'5<´
+HOSV UHPRYH XQZDQWHG PRLVWXUH
in hanging storage environments,
and helps prevent stains. Can also be used for lockers
DQGFDELQHWV6SDFHVDYLQJDQGFRQYHQLHQW/DVWVXSWR
2 months.The product design includes a sturdy plastic
KDQJHUDWWDFKHGWRDPRLVWXUHSHUPHDEOHSRXFK0RLV
WXUHEHFRPHVDJHOVXEVWDQFHDVLWLVDEVRUEHG1RKHDY\
OLTXLGDQGQRULVNRIVSLOOVLQ\RXUFORVHWRUVWRUDJHDUHD
Bag.
Our No.
Size
Oz
No.
Shf
Pk
754.2X5T
2.1
10
63.6T
Shf
Pk
Tub
FG01K
6
($
Unit
5HPRYHVH[FHVVPRLVWXUHIURPDLU
prevents mildew, mold and musty
RGRUV (FRQRPLFDO DOWHUQDWLYH
when air conditioners or dehumidi
¿HUV DUH QRW SUDFWLFDO 8VH LQ FORVHWV EDVHPHQWV FDEL
nets, bathrooms, linen closets, recreational vehicles and
PRUH5H¿OOIRUWKHR]DQGR]'DPS5LGUH¿OODEOH
PLVWXUHDEVRUEHUFRQWDLQHUVRUQRQHOHFWULFPRLVWXUHDE
VRUEHUV3URYLGHVIRXUUH¿OOVIRUWKHR]DQGWZRDQG
DKDOIUH¿OOVIRUWKHR]
Our No.
Size
Oz
No.
Shf
Pk
Unit
DAMP RID INC
6
Our No.
5H¿OO
($
652-1231
MOISTURE & ODOR
ABSORBERS
FG30K
42
6
Shf
Pk
Unit
WILLERT HOME PRODUCTS
591-3819
8.46
7
6
($
STAINLESS STEEL
CLEANER
845-8069
Size
Oz
No.
ACUITY SPECIALTY PRODUCTS
‡³'$03*21(´
854-8810
For use in those small enclosed ar
eas where electric dehumidifers or
air conditioners can not be used.
For storage chests, small clos
ets, under sinks, in display cases,
gun cabinets, tool boxes lockers safes, laundry rooms,
EDWKURRPVDQGHWF$EVRUEVPRLVWXUHZLWKRXWGULSSLQJ
)RUPXODWHG PL[WXUH RI SHUFHQW DFWLYDWHG ZDWHU DE
VRUELQJ LQJUHGLHQWV $WWUDFWV DQG DEVRUEV ZDWHU GDPS
QHVV DQG KXPLGLW\ LQ VPDOO HQFORVHG VSDFHV (OLPLQDWH
problems with unhealthy and destructive musty odors
DQGZDUSLQJ5HPRYHVUXVWFDXVLQJGDPSQHVVIURPWKH
DLU(FRQRPLFDOZKHQGULHGDQGUHXVHGRYHUDQGRYHU
No.
Shf
Pk
Unit
RUTLAND INC
620
12
12
($
METAL POLISH
‡67$,1/(6667((/)2$0
‡&/($1(532/,6+
‡³6&27&+%5,7(´
Our No.
Shf
Pk
No.
Unit
3M
704-2062
6
+&'6%
($
METAL POLISH
‡³12;21´
(DV\WRXVH WKLFN IRUPXOD FOHDQV
and polishes copper, brass, bronze,
stainless steel,chrome.
No.
Size
Oz
Shf
Pk
Unit
12
12
($
RECKITT BENCKISER
613-5669
6233800117
16
=86767
Shf
Pk
Unit
12
($
Cleans and polishes brass, copper,
chrome, stainless steel, alumi
QXPEURQ]HDQGSHZWHU/HDYHVD
smooth polished surface and a bril
OLDQWVKLQH:LOOQRWVFUDWFKPHWDOVDVLWFRQWDLQVDORZ
level of abrasives.
Our No.
12
Size
Oz
No.
Shf
Pk
Unit
RECKITT BENCKISER
686-0654
2660076523
8
8
($
SILVER POLISH
‡³7$51,6+,(/'´
METAL POLISH
‡6,/9(5
‡³3,1(2/$´
+RZDUG 6LOYHU 3ROLVK FOHDQV DQG
polishes all sliver, silver plating, ap
SOLDQFHVDQGFKURPH¿WWLQJV3LQH
2OD EOHQG UHWDUGV WKH WDUQLVK DQG
keeps silver bright. Quickly cleans and polishes without
using acids or harsh abrasives.
Our No.
No.
Size
Oz
Shf
Pk
Unit
8
12
($
Clean, polish and protect in 1 step.
For silverware, candlesticks, chan
deliers, picture frames, serving
WUD\V FKD¿QJ GLVKHV MHZHOU\ DQG
fashion accessories. Keep tarnish
away for months.
Our No.
813-5238
63
No.
Size
Oz
$
10
Shf
Pk
Unit
3M
639-9992
HOWARD PRODUCTS
Boxed - Drip-Free, Hang-Up Bag
673-9981
8
‡%5$66&+520(&233(5
‡³%5$662´
Blend of solvents and polishing
agents. Cleans, polishes, and protects stainless steel,
FKURPH DQG DOXPLQXP 7KLQ ZDWHUUHVLVWDQW ¿OP SUH
YHQWVUXVWLQJFRUURVLRQDQGGLVFRORUDWLRQ5HPRYHV¿Q
JHUSULQWVDQGEXLOGXS
MOISTURE REMOVERS
Our No.
CB0008
METAL POLISH
‡352)(66,21$/675(1*7+
‡67$,1/(6667((/&+520(
$/80,180
‡³=(3´
Our No.
Size
Oz
Unit
METAL POLISHES
)RU FORVHWV RU GUDZHUV 1RQWR[LF
powerful odor absorbing charcoal, neutralizes mold, mil
dew, tobacco, perspiration, and shoe odors. Fragrance
IUHH/DVWVXSWRPRQWKV%DJ
No.
Shf
Pk
($
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
‡3$&.
‡&/26(7'5$:(5
'(2'25,=(5
‡³.((3,7'5<´
Our No.
Size
Oz
HOWARD PRODUCTS
Our No.
Size
Oz
No.
/RQJ ODVWLQJ VWUHDNIUHH VKLQH
5HPRYHV DQG UHVLVWV ¿QJHUSULQWV
)RDPLQJ FOHDQHU ZRQ¶W GULS $HUR
sol.
‡5(),//
‡³'$035,'´
Shf
Pk
Cleans and polishes all ornamental
copper, brass, bronze and stainless
VWHHO 3LQH2OD EOHQG UHWDUGV WKH
WDUQLVKIRUDORQJODVWLQJVKLQH1R
harsh chemicals or abrasives, and gentle on hands.
Unit
MOISTURE REMOVERS
WILLERT HOME PRODUCTS
344-7778
Size
Oz
No.
($
'XDO$FWLRQ RGRU DQG PRLVWXUH
absorbing packets with activated
FKDUFRDO $EVRUEV H[FHVV PRLVWXUH
DQGQHXWUDOL]HVRGRUVFDXVHGE\GDPSQHVV6PDOOPRLV
ture permeable packets can be used in compact and con
tained storage situations such as lockers, gym bags and
VKRHV(DFKSDFNHWQHWZHLJKWLVR]/DVWVXSWR
months. Fragrance Free. Bag.
No.
Our No.
652-1173
‡3$&.
‡³.((3,7'5<´
Our No.
‡&233(5%5$66
‡³3,1(2/$´
)RU EDWKURRPVODXQGU\ URRPV
bedrooms, closets, cabinets, of
¿FHVVXSSO\ FORVHWV J\P ORFNHUV
VWRUDJH VSDFHV DQG VWRUHG ERDWV
59VFODVVLF FDUV 5HPRYHV H[FHVV
PRLVWXUHIURPDLU(OLPLQDWHVPXVW\RGRUVDQGUHGXFHDO
lergens caused by moisture. Prevents mold and mildew
stains, protects against moisture damage and turns stag
QDQWDLULQWRIUHVKHUKHDOWKLHUDLU&DQEHUH¿OOHGDQGUH
XVHGWLPHDQGDJDLQ)RUVSDFHWKDWLVWRVTIW
DAMP RID INC
MOISTURE & ODOR
ABSORBERS
Size
Oz
METAL POLISH
‡³'$035,'´
Unit
WILLERT HOME PRODUCTS
951-6972
MOISTURE REMOVERS
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
6
($
132 - Maintenance, Repair & Operations
STAINLESS STEEL
CLEANER
SWEEPING
COMPOUNDS
Formulated for use on stainless
VWHHO ¿[WXUHV HTXLSPHQW RU WULP
Cleans, polishes, protects stainless
VWHHOZLWKRXWVFRXULQJ5HVLVWV¿Q
gerprints, grease, and water spat
WHU3UHVHUYHVIDFWRU\¿QLVK5HPRYHVROGRUKHDY\DFFX
PXODWLRQRIJUHDVH\¿OPIRRGVSDWWHURURLOVWDLQV1RW
for use on cooking utensils.
‡6$1'('2,/%$6(
Our No.
Size
Oz
No.
Shf
Pk
Unit
SPRAYWAY, INC.
Our No.
No.
Size
Lb
6:5(7$,/
($
Size
Oz
Shf
Pk
Unit
12
($
$HURVRO
12
698-6632
$
50
1
($
428-1705
$
100
1
BX
No.
Size
Lb
Shf
Pk
Unit
COTTO-WAXCO
7;
12
5
PK 12
24
PK 4
10
PK 6
5
3.
4.27” x 4’
76377
:KLWH
5HJXODU5ROOV
015-1324X
76437
:KLWH
'RXEOH5ROOV
76433
:KLWH
76171
:KLWH
G3
50
1
BATHROOM TISSUE
‡3/<
‡³48,/7('1257+(51´
6RIW DQG VWURQJ VHSWLF VDIH sheets per roll. 4 x 4.
Our No.
No.
&RORU
Shf
Pk
Unit
12
PK 4
10
PK 6
GEORGIA-PACIFIC CONSUMER PRODUCTS
($
'RXEOH5ROOV
426-7639X
:KLWH
'RXEOH5ROOV
SWEEPING
COMPOUNDS
³:LSH DQG ULQVH´ IRUPXOD IRU UH
moving tarnish from sterling silver
plate, platinum, copper, gold and
diamonds.
221-8311X
‡:$;%$6(
‡³12'8672´
Shf
Pk
Unit
JELMAR
672-6129
Unit
'RXEOH5ROOV
644-9342X
Compound is recommended for
SDLQWHGVXUIDFHVQRQZD[HGÀRRUV
DQGJODVVOLNHÀRRUVWKDWDUHUHVLO
ient to oil. Contains no grit or sand and will not scratch
ÀRRUVXUIDFH&RPSRXQGLVYHU\HIIHFWLYHIRUHQWUDSSLQJ
VLOLFHRXV VDQG OLNH GLUW DQG GXVW &RORU RI VZHHSLQJ
compound is green.
Our No.
‡³7$51;´
Size
Ozs.
Shf
Pk
'RXEOH5ROOV
TARNISH REMOVER
No.
&RORU
‡*5,7/(662,/%$6(
‡³9(/9(7´
698-6673
Our No.
No.
GEORGIA-PACIFIC CONSUMER PRODUCTS
094-4116X
SWEEPING
COMPOUNDS
TR INDUSTRIES
$&
Our No.
630-3820X
Cleans and shines stainless steel.
(DV\WRXVHVSUD\RQZLSHRII5H
PRYHVGLUWDQGJULPH1RQJUHDV\
ZLOO QRW VPXGJH VPHDU RU ¿QJHU
SULQW 3URYLGHV D ³TXLFN VKLQH´ DQG ³UDSLG SURWHFWLRQ´
:RQ¶WVWUHDNRUKD]H0LOGHQRXJKWREHXVHGHYHU\GD\
No.
6HSWLFVDIH1RVKHHWV
SHU UROO 1R¶V DQG
VKHHWVSHUUROO
Unit
GREEN
12
‡³*(/*/266´
718-7974
Shf
Pk
COTTO-WAXCO
STAINLESS STEEL
CLEANER
Our No.
‡3/<
‡³$1*(/62)7´
&RPSRXQG IRUPXODWHG RI ZRRG ¿
EHU VDQGJULW DQG RLO &RPSRXQG
creates an attractor for dust and
GLUW )RU UHPRYLQJ FOD\W\SH GLUW
DQGGXVWIURPÀRRUVXUIDFHV5HFRPPHQGHGIRUXVHRQ
XQ¿QLVKHG ZRRG DQG FRQFUHWH ÀRRUV LH ZDUHKRXVH
DQGIDFWRU\ÀRRUV
$HURVRO
913-7662X
BATHROOM TISSUE
6
($
Brooms, Mops & Trash Bags
Compound is recommended for
¿QH ¿QLVKHG ÀRRUV LH UHVLOLHQW
terrazzo, asphalt, rubber, cork,
PDUEOH DQG FRPSRVLWLRQ ,W LV VDIH WR XVH RQ ZD[HG
ÀRRUV &RPSRXQG GRHV QRW FRQWDLQ RLO RU VDQGJULW VR
LWZLOOQRWVFUDWFKRUGLVLQWHJUDWHÀRRUVXUIDFHV&RORURI
sweeping compound is gold.
Our No.
SWEEPING COMPOUNDS
No.
Size
Lb
Shf
Pk
Unit
COTTO-WAXCO
428-1713
SWEEPING
COMPOUNDS
:
:KLWH
BATHROOM TISSUE
‡3/<
‡³9(/9(7´
1HZ DQG LPSURYHG ZKLWH SO\
´[´
Our No.
Shf
Pk
No.
Unit
ORCHIDS PAPER
50
1
BX
6KHHWV3HU5ROO
988-9775X
24
PK 4
‡³=(3´
SWEEPING
COMPOUNDS
+ROGV GXVW GRZQ ZKLOH VZHHSLQJ
8VHLQZDUHKRXVHVVWRUHVJDUDJH
and shop areas.
Our No.
No.
Size
Lb
Shf
Pk
Unit
ACUITY SPECIALTY PRODUCTS
OIL-BASED
744-7576
+'6:((3
50
1
%$*
BATHROOM TISSUE
‡+20(2)),&(:$;
%$6(
‡³12'8672´
‡3/<72,/(77,668(
‡³&2/257(;´
)RUKRPHDQGRI¿FHXVHRQXQ¿Q
LVKHG FRQFUHWH DQG ZRRG ÀRRUV
&UHDWHVDQDWWUDFWRUIRUGXVWDQGGLUW)RUUHPRYLQJFOD\
W\SHGLUWDQGGXVWIURPÀRRUVXUIDFHV*RRGIRUJDUDJHV
and basements. Color of sweeping compound is gold.
Our No.
No.
Size
Lb
Shf
Pk
Unit
COTTO-WAXCO
898-6663
+3
10
4
BX
6KHHWVL]H´[´5ROOV
Our No.
No.
&RORU
Shf
Pk
Unit
8
3.
ORCHIDS PAPER
150 Sheet Count
497-3533X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
:KLWH
Maintenance, Repair & Operations - 133
BATHROOM TISSUE
BATHROOM TISSUE
‡816&(17('72,/(77,668(
‡³&+$50,1%$6,&´
SO\ VKHHWV SHU UROO VTXDUHIHHWSHUSDFNDJH
Our No.
No.
Shf
Pk
5ROOV
Per Pack
Unit
PROCTER & GAMBLE
FACIAL TISSUE
&RPIRUWDEOH WZRSO\ VKHHWV DUH
PDGH IURP UHF\FOHG SDSHU
ZLWKDPLQLPXPRISRVWFRQ
sumer content. They are whitened
using an oxygenating process that
UHSODFHVDQ\FKORULQHEOHDFKLQJ1R
SHUIXPHV G\HV RU LQNV 6WDQGDUG ´ [ ´ VL]H VKHHWV
ZLWKFRXQWRQHDFKUROO¿WVWDQGDUGKROGHUVIRXU
SDFNVSO\VKHHWVSHUUROO
White
474-5758X
4
PK 12
No.
Shf
Pk
Unit
24
PK
EARTH FRIENDLY PRODUCTS
820-7706X
BATHROOM TISSUE
3/
‡816&(17('72,/(77,668(
‡³&+$50,1%$6,&´
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
SO\ VKHHWV SHU UROO VTXDUHIHHWSHUSDFNDJH
No.
Unit
White
4
12
PK 4
432-1428X
Unit
34457
24
($
1
&6
‡3/<72,/(77,668(
‡³&/$66,&´
641-5210X
No.
35038
Unit
1
Shf
Pk
Unit
24
($
‡-80%252//72,/(7
7,668(
‡³&/$66,&´
PROCTER & GAMBLE
Lgth
Ft
&6
‡%,*52//
‡3/<
‡³%5$:1<´
Shf
Pk
No.
Unit
44512
24
($
PAPER TOWELS
‡3,&.$6,=(3/<
‡³%5$:1<´
No.
Shf
Pk
850-5323X
Shf
Pk
Unit
24
($
Unit
NORTH AMERICAN PAPER CO
3.74”W - White
675-4790
422806
1
2,000
1
&6
675-4808
2
1,000
1
&6
No.
&RORU
Shf
Pk
Unit
10
PK 3
GEORGIA-PACIFIC CONSUMER PRODUCTS
Unscented
724-1565X
/RQJODVWLQJ MXPER UROOV ´ GLDP
HWHU (DV\ WR LQVWDOO PDLQWDLQ DQG
VHUYLFH8VHZLWK1R6.8
GLVSHQVHUUROOVSHUFDVH
PLY
1
PAPER TOWELS
Our No.
SO\ ZKLWH WLVVXHV SHU ER[
'UDJRQÀLHV DQG OHDI GHVLJQ RQ
HDFKER[LQDVVRUWHGFRORUV'R1RW
6SHFLI\FRORU
&6
Our No.
No.
,+.6
617-8602X
‡:,7+/27,21
‡³38))63/86´
BATHROOM TISSUE
Our No.
Unit
FACIAL TISSUE
Shf
Pk
:KLWH
Shf
Pk
6RIW DQG VWURQJ SLFNDVL]H SDSHU
towels. 88 sheets per roll. 11 x 6.
NORTH AMERICAN PAPER CO
No.
GEORGIA-PACIFIC CONSUMER PRODUCTS
´[´VKHHWVVKHHWVSHU
UROOUROOVSHUFDVH
675-4782
6RIWDEVRUEHQWZKLWHWLVVXHLQDW
WUDFWLYHGHVLJQVKHHWV´[
´SHUER[
Our No.
PROCTER & GAMBLE
&RORU
‡3/<)/$7%2;
‡³&$5/</(´
6RIW DQG VWURQJ ZLWK ODUJH GH
signer print. 64 sheets per roll. 11
x10.5.
SO\FRXQWZKLWHIDFLDOWLVVXHV
1RQORWLRQ&XEH
Our No.
No.
($
PAPER TOWELS
‡³38))6´
BATHROOM TISSUE
Our No.
24
FACIAL TISSUE
Unit
FACIAL TISSUE
Shf
Pk
:KLWH
34864
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
Unscented
NORTH AMERICAN PAPER CO
Shf
Pk
No.
7H[WXUHGKLJKTXDOLW\´[´
VKHHWV VKHHWV SHU UROO rolls per case. 48,000 sheets per
&6 &DVH GLPHQVLRQV ´ / [
´:[´+
675-4766
Unit
PROCTER & GAMBLE
435-8966
SO\ ZKLWH WLVVXHV SHU ER[
Brushstrokes design on each box
LQ DVVRUWHG FRORUV 'R 1RW 6SHFLI\
color.
PROCTER & GAMBLE
&RORU
Shf
Pk
NORTH AMERICAN PAPER CO
‡%$6,&
‡³38))6´
‡3/<72,/(77,668(
‡³&$5/</(´
No.
No.
Our No.
FACIAL TISSUE
Our No.
BATHROOM TISSUE
Our No.
Our No.
FACIAL TISSUES
Shf
Pk
5ROOV
Per Pack
PROCTER & GAMBLE
848-8546X
SO\FRXQWZKLWHIDFLDOWLVVXHV
Cube.
125-4820X
12
Our No.
Our No.
‡:,7+/27,21
‡³38))63/86´
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
44514
:KLWH
134 - Maintenance, Repair & Operations
PAPER TOWELS
PAPER TOWELS
PAPER TOWELS
‡3/<
‡³63$5./(´
‡³%2817<´
‡3/<3(5)25$7('
‡³35()(5(1&(´
Paper towels with thirst pockets.
:LSHVGU\IDVWVKHHWVSHUUROO
11 x 11.
Our No.
No.
Shf
Pk
&RORU
Unit
GEORGIA-PACIFIC CONSUMER PRODUCTS
Our No.
21465
Print
262-3072X
21468
Print
174-8052X
Print
Unit
PROCTER & GAMBLE
5ROO
552-2073X
Shf
Pk
No.
Our No.
2QH3O\7RZHOV3HU5ROO
30
($
10
PK 3
4
PK 6
728-6404
81461
1
PK 15
5ROOV
‡3/<
‡³9(/9(7´
‡³%2817<%$6,&´
Our No.
1HZDQGLPSURYHGZKLWHSO\´
[´
Unit
No.
415-8325
28314
223-9614X
28318
Unit
ORCHIDS PAPER
Shf
Pk
Unit
1
PK 15
3ULQWHG6KHHWV3HU5ROO
30
($
7RZHOV3HU5ROO
30
1
:KLWH
&6
‡3/<1213(5)25$7('
‡³&/$66,&´
PROCTER & GAMBLE
Shf
Pk
825602
PAPER TOWELS
3ULQWHG6KHHWV3HU5ROO
Shf
Pk
PAPER TOWELS
PAPER TOWELS
988-9767X
&RORU
NORTH AMERICAN PAPER CO
675-4725
2QHSO\
No.
No.
7RZHOV5ROO5ROOV&DVH
5ROOV
Our No.
For cleaning and wiping in food
service, healthcare, laboratory and
FOLQLF VHWWLQJV 6WURQJ DQG DEVRU
EDQWIRUOLJKWGXW\FOHDQXS6XSHU
soft, highly absorbant, economical, sanitary, and conve
QLHQW´[´WRZHOV
($
+LJKTXDOLW\ KDUGZRUNLQJ PLQL
mizes waste and pilferage. For
DUHDVWKDWUHTXLUHWKHHFRQRP\RI
KLJKFDSDFLW\ GLVSHQVLQJ V\VWHPV
´FRUH
Our No.
No.
&RORU
Shf
Pk
Unit
NORTH AMERICAN PAPER CO
´[¶/5ROO5ROOV&DVH
675-4691
1DWXUDO
1
&6
675-4717
:KLWH
1
&6
PAPER TOWELS
‡+20('(&25
‡³%2817<´
PAPER TOWELS
UROO´[´VKHHWVL]H
Our No.
PAPER TOWELS
‡3/<52//
‡³725.´
0XOWLFRORU EULJKW JDUGHQ SULQW
RQ TXLOWHG VKHHWV 6KHHW VL]H ´
[´
‡%,*0233(5
‡3/<
‡³&2/257(;´
No.
&RORU
Our No.
Shf
Pk
No.
Shf
Pk
Unit
6RIWVWURQJDQGKLJKO\DEVRUEHQW
WKHSHUIHFWFRPELQDWLRQRITXDOLW\
SHUIRUPDQFHDQGYDOXH(PERVVLQJ
enhances hand free and maximum
DEVRUEHQF\ )RU XVH ZLWK 1R 6.8 7RUN,QWXLWLRQ7RZHO'LVSHQVHU
($
Our No.
PROCTER & GAMBLE
Unit
ORCHIDS PAPER
7ZR3O\7RZHOV3HU5ROO
710-8277X
81536
24
6KHHWV3HU5ROO
704-6527X
018888
:KLWH
24
($
828-5603
1DWXUDO
1
&6
‡6(/(&7$6,=(
‡³%2817<%,*52//´
860-2401
881600
:KLWH
1
&6
Shf
Pk
Unit
Our No.
&RORU
Unit
:KLWH
4
Unit
7ZR3O\7RZHOV3HU5ROO
072-3494X
6KHHWV3HU5ROO
18781
No.
Shf
Pk
PAPER TOWELS
PROCTER & GAMBLE
ORCHIDS PAPER
354-3402X
Unit
PAPER TOWELS
6KRUWHUTXLOWHGVKHHWOHQJWKVDOORZ
you to select the exact number of
sheets needed.
´[´VKHHWVL]H
No.
Shf
Pk
´[¶/5ROO
‡3/<
‡³9(/9(7´
Our No.
&RORU
NORTH AMERICAN PAPER CO
PAPER TOWELS
Shf
Pk
No.
PK 8
81538
24
($
‡3/<6,1*/()2/'
‡³(19,6,21´
)RU KLJK WUDI¿F DUHDV LQ VFKRROV
SODQWV JRYHUQPHQW EXLOGLQJV ,Q
terfolded for continuous dispens
LQJ´[´
Our No.
No.
&RORU
NORTH AMERICAN PAPER CO
7ZOV3NJ3NJ&DVH
675-4741
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
881400
1DWXUDO
1
&6
Maintenance, Repair & Operations - 135
PAPER TOWELS
SHOP TOWEL/RAGS
WIPING CLOTHS
‡3/<08/7,)2/'
‡³&/$66,&´
‡3/<:(7'5<
‡³6&277´
,QWHUIROGHGIRUFRQWLQXRXVGLVSHQV
LQJIRUKLJKWUDI¿FDUHDVWRFRQWURO
XVDJHDQGUHGXFH ZDVWH ´[
´
:RUNV OLNH FORWK FORWKOLNH IHHO
6WURQJ DEVRUEHQW IRU ZLSLQJ
VFUXEELQJ VWDLQSDLQW DQG KRXVH
KROG FOHDQLQJ /LQWIUHH DEVRUEV
FRDWLQJVSDLQWVDQGVWDLQV5HXVDEOHZDVKDEOH:KLWH
color.
‡(/(&7521,&685)$&(6
‡'5<
‡³:,1'(;´
Our No.
No.
Shf
Pk
&RORU
Unit
NORTH AMERICAN PAPER CO
Our No.
7ZOV3NJ3NJ&DVH
675-4659
:KLWH
1
&6
675-4667
1DWXUDO
1
&6
Size
In
No.
Shf
Pk
Unit
KIMBERLY CLARK
Easy Pop-up Dispenser Box
552-2917
671-4349
75240
11.2 x 10
1
BX 85
671-4356
75260
10 x 13
1
BX200
‡³6&277´
Shf
Pk
&RORU
Unit
NORTH AMERICAN PAPER CO
7ZOV3NJ3NJ&DVH
1
:KLWH
:RUNV OLNH FORWK FORWKOLNH
VWUHQJWK 6SRQJHOLNH DEVRUEHQF\
IRU KRPH GHFRUDWLQJ VWDLQLQJ
SDLQWLQJ ZDOOSDSHULQJ ODZQ DQG
JDUGHQ PRZHU WRROV EDUEHFXH
DQG KHDY\GXW\ FOHDQXS SOXPELQJ HOHFWULFDO JHQHUDO
¿[XS /LQWIUHH DEVRUEV FRDWLQJV SDLQWV DQG VWDLQV
5HXVDEOHZDVKDEOH:KLWHFRORU
&6
Our No.
Count
3HU5ROO
No.
Shf
Pk
671-4331X
0DGH ZLWK UHF\FOHG SDSHU
ZLWKDPLQLPXPRISRVWFRQ
VXPHU FRQWHQW :KLWHQHG WKURXJK
an oxygenating process, not by
EOHDFK1RSHUIXPHVG\HVRULQNV
XVHG VKHHWV WR D UROO DQG DUH
WZRSO\
Shf
Pk
Unit
EARTH FRIENDLY PRODUCTS
816-7199X
24
3/
($
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
,GHDOIRUDSSO\LQJSROLVKDQGFOHDQ
er to wood and smooth surfaces.
:KHQ VSUD\HG RU SRXUHG GLUHFWO\
onto cloth, polish distributes evenly
IRU EHWWHU UHVXOWV 1RQDEUDVLYH
FRWWRQ ÀDQQHO ZRQ¶W VFUDWFK ¿QLVKHG ZRRG VXU
IDFHV 0DFKLQHZDVKDEOH DQG UHXVDEOH &ORWKV HDFK
[´
863-3703
463100
55
30
($
11 x 11
12
($
Shf
Pk
Unit
12
($
Great for glass, mirrors and
FKURPH0DFKLQHZDVKDEOHDQGUH
VXDEOH+DQJ7DJ
Our No.
No.
Shf
Pk
Unit
3*&
12
($
3M
629-7360
‡0,&52),%(5*(1(5$/
385326(
BAG OF RAGS
‡32/<&27721%/(1'
‡³683(578))´
Our No.
No.
Size
Lb
Shf
Pk
Unit
10801
24
($
699-8587
10803
1
12
($
For tough jobs, repairs, outdoor
HTXLSPHQW DQG DXWRPRWLYH FOHDQ
XS 0DGH RI 'XSRQW 6RQWDUD ZLWK
K\GURHQWDQJOLQJ WHFKQRORJ\ (Q
gineered tough for rough, uneven
VXUIDFHV 5HXVDEOH DQG HFRQRPLFDO /RZ OLQW 6ROYHQW
resistant.
84075
12 x 16.5
Shf
Pk
Unit
TRIMACO
75 Count
746-7079
16 x 16
4*5
,+
6
($
‡$//385326(5(86$%/(
‡³'$1'<:,3(6´
Size
In
No.
Shf
Pk
Unit
24
($
BIRDWELL CLEANING
‡³21(78)):,7+'83217´
Size
In
Unit
WIPING CLOTHS
Our No.
WIPING RAGS
No.
Shf
Pk
Green
771-4298
680-6277
Our No.
Lgth x
Wdth In
No.
NEWELL RUBBERMAID COMMERCIAL
3UHFXW UDJV $EVRUEHQW 8VH
WKURXJKRXW WKH KRPH RI¿FH PD
ULQH DQG LQGXVWU\ 5HXVDEOH DQG
PDFKLQH ZDVKDEOH 8VH IRU VWDLQ
LQJSROLVKLQJFOHDQLQJDQGIDX[¿QLVKLQJ
&RORUHG%DJJHG
WOOD POLISHING
APPLICATOR CLOTHES
GUARDSMAN
75230
TRIMACO
WIPING CLOTHS
No.
'HOLYHUV VXSHULRU FOHDQLQJ SHUIRU
PDQFHDQGGXUDELOLW\'HQVHXOWUD
¿QHTXDOLW\¿EHUUHPRYHVGLUWGXVW
and bacteria.
Our No.
Our No.
Unit
WIPING CLOTHS
5ROO
PAPER TOWELS
No.
Shf
Pk
Unit
KIMBERLY CLARK
Our No.
Size
In
‡0,&52),%(5*(1(5$/
385326(
‡³6&27&+%5,7(´
SHOP TOWEL/RAGS
Better water absorption increases
VSHHGRIGU\LQJ'LVSHQVHGDWD
WLPH´[´
675-4675
No.
WIPING CLOTHS
‡3/<&)2/'
‡³&/$66,&´
No.
Our No.
SC JOHNSON
PAPER TOWELS
Our No.
For cleaning surfaces such as tele
visions, cell phones, computers
DQG PRUH 1R UHVLGXH VWUHDNIUHH
VKLQH 8VH GU\ RU ZLWK :LQGH[ HOHFWURQLF DHURVRO 1R
6.8&RQWDLQVGU\FORWKV
8
3DFN3RO\EDJJHG
694-3435
[
WIPING CLOTHS
‡*/$660,&52),%(5
'HQVH XOWUD¿QH TXDOLW\ ¿EHU UH
moves dust, dirt and bacteria de
livering superior cleaning perfor
mance and durability.
BX
Our No.
No.
Lgth x
Wdth In
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
%OXH
945-5288
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
,+6
4%/
16 x 16
6
($
136 - Maintenance, Repair & Operations
WIPING CLOTHS
WIPING CLOTHS
WIPING CLOTHS
‡0,;('.1,7
‡³683(578))´
‡3(5&(17&27721
‡³3523(5)(&7:,3(56´
‡63(&,$/7<&/27+6
‡3$&.
For cleaning, polishing, staining
DQGIDX[¿QLVKLQJ
7VKLUW PDWHULDO ORZ OLQW SUH
ZDVKHG UHXVDEOH VXSHUDEVRU
bent, in a reclosable box. Consis
WHQW VL]H ´ [ ´ IRU VWDLQLQJ
polishing, painting and cleaning.
0LFUR¿EHUFOHDQLQJFORWKVLGHDOIRU
all household cleaning and dusting.
&OHDQV ZLWKRXW FKHPLFDOV 8OWUD
soft, yet tough, washable up to 500
WLPHV$EVRUEVXSWRWLPHVPRUHWKDQDUHJXODUWHUU\
cloth. For use with kitchen, bathroom, nursery, laundry
URRPIDPLO\URRPERDWDQGWKHJ\P(YHQWUDSVÀHDV
DQGGLUWRQSHWVZLWKRXWZDWHU0XOWL3DFNLQFOXGHVVSH
cialty, 1 dust and polish, 1 stainless steel, and 1 mirror
and glass cloth.
Our No.
No.
Wt
Lb
Shf
Pk
Unit
TRIMACO
Our No.
10833
8
Size
In
80025
18 x 18
Shf
Pk
Unit
1
BX 25
TRIMACO
White
633-2753
No.
1
782-3321
BX
Our No.
Size
In
No.
WIPING CLOTHS
‡&2/25('.1,7
‡³683(578))´
‡$//385326(.1,7
‡³683(578))´
463-2139
3UHFXW UDJV $EVRUEHQW 8VH
WKURXJKRXW WKH KRPH RI¿FH PD
ULQH DQG LQGXVWU\ 5HXVDEOH DQG
PDFKLQH ZDVKDEOH 8VH IRU VWDLQ
LQJSROLVKLQJFOHDQLQJDQGIDX[¿QLVKLQJ
$OO SXUSRVH VPRRWK EOHDFKHG 7
shirt and polo knit rags are super
absorbent. For painting, staining,
polishing, cleaning and dusting.
/RZOLQW
WIPING CLOTHS
Our No.
No.
10805
4
Shf
Pk
699-8645
1
%OXH:KLWH<HOORZ*UHHQ&DUGHG
Our No.
BX
No.
Wt
Lb
10852
4
Shf
Pk
Unit
1
%$*
TRIMACO
White
630-7847
WIPING CLOTHS
‡3(5&(17&27721
7(55<72:(/6
‡³683(578))´
Our No.
No.
Size
In
10756
14 x 17
615-3902
‡76+,57.1,7
‡³683(578))´
Unit
30
($
TRIMACO
$OO SXUSRVH VPRRWK EOHDFKHG 7
shirt and polo knit rags are super
absorbent. for painting, staining,
polishing, cleaning, waxing and
GXVWLQJ5HXVDEOHDQGPDFKLQHZDVKDEOH/LQWIUHH
5ROORI
383-9115X
Our No.
619-2934
$OOSXUSRVH HFRQRPLFDO ZKLWH W
shirt and mixed knit rags are super
absorbent and soft.
Wt
Lb
4
1
Unit
BX
‡0,;(':+,7(.1,7
‡³683(578))´
TRIMACO
833-3627
$OOSXUSRVH HFRQRPLFDO ZKLWH W
shirt and mixed knit rags are super
absorbent and soft.
No.
Unit
24
($
45
Unit
12 x 12
15
($
‡0,&52),%(53$&.
‡³6&58%=21(´
8VHIRUFOHDQLQJVWRYHWRSVRUDQ\
surface that needs extra scrubbing
power without damaging the sur
IDFH7KHFORWKIHDWXUHVWZRVLGHV
RQH VLGH KDV 6FUXE =RQH DQG WKH RWKHU KDV WKH DEVRU
EHQF\RIPLFUR¿EHU0DFKLQHZDVKDEOH
Our No.
No.
Size
In
Shf
Pk
Unit
12 x 12
15
($
UNGER INDUSTRIAL
No.
Wt
Lb
Shf
Pk
Unit
10844
1
24
($
‡&200(5&,$/*5$'(
0LFUR¿EHU FORWK WKDW LV PDQXIDF
WXUHGWRZLWKVWDQGH[FHVVLYHXSWR
FRPPHUFLDOZDVKLQJF\FOHV
,W KDV WKH KLJKHVW TXDOLW\ JUDGH
textile and has maximum absor
EHQF\'HVLJQHGIRUIDFLOLWLHVWKDWFOHDQLQPXOWLSOHVKLIWV
DQG GD\V D ZHHN ([WHQGHG SURGXFW OLIH F\FOH HTXDOV
lower term cost. Perfect for healthcare and manufactur
ing facilities as well as food service.
No.
&RORU
Shf
Pk
Unit
UNGER INDUSTRIAL
16” x 16”
Shf
Pk
Unit
235-7572X
,+6
0)<
<HOORZ
10
($
325-9736X
,+6
0)%
Blue
10
($
White
10860
Our No.
TRIMACO
836-9233
Shf
Pk
MICROFIBER CLOTH
$OO SXUSRVH VPRRWK EOHDFKHG 7
shirt rags are super absorbent and
VRIW 8VH IRU FOHDQLQJ SROLVKLQJ
VWDLQLQJ DQG IDX[ ¿QLVKLQJ *UHDW
IRU KXQGUHGV RI XVHV DURXQG WKH KRPH RI¿FH PDULQH
DQGLQGXVWU\:DVKDEOHDQGUHXVDEOH
Our No.
Our No.
Shf
Pk
‡:+,7(76+,57.1,76
‡³683(578))´
WIPING CLOTHS
Size
Lb
Size
In
WIPING CLOTHS
Shf
Pk
Dispenser Box
10832
&'
WIPING CLOTHS
923-7447
TRIMACO
699-8637
10811
No.
White - Bagged
‡0,;('.1,7
‡³683(578))´
No.
Size
Lb
TRIMACO
WIPING CLOTHS
Our No.
No.
10
UNGER INDUSTRIAL
WIPING CLOTHS
Shf
Pk
13 x 13
$FWXDO ZRRG ¿EHUV DUH ZRYHQ WR
gether to provide an eco friendly
product and clean any surface
QHHGHG ,GHDO IRU FOHDQLQJ VWRYH
tops, counters or any hard surface.
+HOSVVRDNXSRLORUJUHDVHVSLOOVDQGUHGXFHVEDFWHULDE\
(DFKFORWKKDVDEXLOWLQ0LFUR¿EHU6FUXE=RQH&RU
ner to allow for extra scrubbing power on those stubborn
VSRWVZLWKRXWGDPDJLQJWKHVXUIDFH0DFKLQHZDVKDEOH
Our No.
([WUDDEVRUEHQWFRWWRQWHUU\WRZHOV
are washable and reusable. Terry
WRZHOVDUHSUHZDVKHGIRUVRIWQHVV
and absorbency.
‡:22'),%(53$&.
Unit
TRIMACO
Unit
UNGER INDUSTRIAL
WIPING CLOTHS
Wt
Lb
Shf
Pk
1
BX
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 137
MICROFIBER CLOTH
DUST CLOTHS
0LFUR¿EHU NLWFKHQ EDWKURRP
FORWK 1DWXUDO FOHDQLQJ SURSHUWLHV
RI PLFUR¿EHU ´ [ ´ FORWK VSH
FL¿FDOO\ GHVLJQHG IRU DOOSXUSRVH
tasks around the kitchen and
EDWKURRP +LJK TXDOLW\ PLFUR¿EHU
ZHDYHJUDPVVTPHWHUZLWKWH[WXUHGSDWWHUQHQ
KDQFHVWKHQDWXUDODELOLW\RIPLFUR¿EHUWRDEVRUEOLTXLGV
and excels at wiping and cleaning counter tops, applianc
es, bathroom surfaces, paintwork and furniture. Garment
WDJZLWKSUHIHUUHGVXUIDFHW\SHVHZQLQSRO\HVWHU
Q\ORQEOHQG0DFKLQHZDVKDEOH
Our No.
No.
Shf
Pk
Unit
72
($
QUICKIE MANUFACTURING
505-0216
Shf
Pk
Unit
72
($
QUICKIE MANUFACTURING
505-0224
Shf
Pk
Unit
72
($
QUICKIE MANUFACTURING
505-0232
0LFUR¿EHU GXVWLQJ SROLVKLQJ
FORWK 1DWXUDO FOHDQLQJ SURSHUWLHV
RI PLFUR¿EHU ´ [ ´ FORWK VSH
FL¿FDOO\ GHVLJQHG IRU GXVWLQJ DQG
SROLVKLQJ VPRRWK VXUIDFHV 8OWUD
KLJKTXDOLW\PLFUR¿EHUJUDPV
VT PHWHU KDV D KLJK SRO\HVWHU FRXQW SRO\HVWHU
Q\ORQDQGDQH[WUDVRIWGHHSZHDYHIRUVXSHULRU
dusting and polishing capability to bring out the natu
ral beauty and luster of wood furniture, cabinets, desks,
bookshelves, and other wooden or highly polished sur
IDFHV*DUPHQWWDJZLWKSUHIHUUHGVXUIDFHW\SHVHZQLQ
No.
Shf
Pk
Unit
72
($
QUICKIE MANUFACTURING
505-0240
474
Unit
14 x 18
12
($
DISPENSERS
Shf
Pk
No.
Unit
‡-80%252//
‡³6&$´
+LJKLPSDFW SODVWLF FRQVWUXFWLRQ
6HHWKURXJK JUD\ GRRUJUD\ EDFN
´+[´:[´'IRU´MXP
ERUROOFDSDFLW\¶/3O\1R6.8
RU¶/3O\1R
No.
Shf
Pk
926-8202
102220
1
($
PAPER TOWEL
DISPENSERS
‡&)2/'08/7,)2/')2/'
‡³&6$´
BATHROOM TISSUE
DISPENSERS
Our No.
Our No.
NORTH AMERICAN PAPER CO
462100
75
(DV\WRFOHDQVPRRWKKLJKLPSDFW
plastic cover with no recesses com
SOLPHQWV DOO GHFRUV 2SDTXH FRYHU
DOORZV IRU ³DW D JODQFH´ LQVSHFWLRQ IRU UH¿OOV DQG KLGHV
VFUDWFKHV´[´[´
Our No.
Shf
Pk
No.
Unit
NORTH AMERICAN PAPER CO
865-0657
1
($
Unit
1
($
‡+$5':281'52///(9(5
‡³725.´
+HOSVFRQWUROFRQVXPSWLRQDQGUH
GXFH PDLQWHQDQFH (DV\WRORDG
offers economical dispensing in
DGMXVWDEOH ´ ´ RU ´ LQFUHPHQWV 'XUDEOH OHYHU
mechanism rigorously tested to simulate 5 years of high
WUDI¿FDWDUDWHRI¶SHUGD\7UDQVIHUV\VWHPWUDQVIHUV
SDSHUÀRZIURPWKHVWXEUROOWRWKHPDLQUROOUHOLDEO\UH
GXFLQJZDVWH5ROOWUDQVIHULQGLFDWRUWRNQRZZKHQWRSXW
PDLQLQVWXESRVLWLRQDQGUHORDG6HHWKURXJKJUH\JUH\
FRYHUHGDQGNH\ORFNGHVLJQSURWHFWVDJDLQVWZDVWHDQG
SLOIHUDJHZKLOHPDNLQJUH¿OOLQJTXLFNDQGHDV\´
[´[´GXUDEOHKLJKFDSDFLW\KLJKLPSDFW
SODVWLFFRQVWUXFWLRQKROGVRYHU¶RISDSHUVWDQGVXS
WRFOHDQLQJFKHPLFDOVDQG/EVRIIRUFH&DQXVHZLWK
1RV6.8RUUROOV
No.
Shf
Pk
Unit
NORTH AMERICAN PAPER CO
675-7363
7+.6
75
PLASTIC TOWEL
DISPENSERS
‡(/(&7521,&
‡³725.,178,7,21´
PAPER TOWEL
DISPENSERS
Our No.
MICROFIBER CLOTH
Our No.
Shf
Pk
GUARDSMAN
675-7389
0LFUR¿EHU VWDLQOHVV VWHHO FORWK
1DWXUDO FOHDQLQJ SURSHUWLHV RI PL
FUR¿EHU´[´FORWKVSHFL¿FDOO\
GHVLJQHG IRU WKH XQLTXH FOHDQ
LQJ QHHGV RI VWDLQOHVV VWHHO +LJK
TXDOLW\ PLFUR¿EHU JUDPVVT
PHWHUZLWKDKLJKQ\ORQEOHQGSRO\HVWHUQ\
ORQLVWDLORUHGWRTXLFNO\DQGHDVLO\UHPRYH¿QJHUSULQWV
VPXGJHVDQGRWKHURLOEDVHGJULPHIURPVWHHOVXUIDFHV
LQFOXGLQJ UHIULJHUDWRUV RYHQV ZDVWHEDVNHWV ¿[WXUHV
and other appliances. Garment tag with preferred sur
IDFHW\SHVHZQLQ0DFKLQHZDVKDEOH
No.
Size
In
No.
6PDUWHI¿FLHQWFHQWHUSXOOVROXWLRQ
that is ideal for use in businesses
DQG KLJKWUDI¿F SXEOLF IDFLOLWLHV
such as manufacturing plants, educational facilities, sta
diums and travel facilities that demand greater capac
LW\ DQG JUHDWHU YDOXH 3ODVWLF VPRNH LQ FRORU ´ [
´ [ ´ 8VH FHQWHU SXOO WRZHO 1R 6.8
NORTH AMERICAN PAPER CO
MICROFIBER CLOTH
Our No.
Our No.
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
0LFUR¿EHU JODVV ZLQGRZ FORWK
1DWXUDO FOHDQLQJ SURSHUWLHV RI PL
FUR¿EHU´[´FORWKVSHFL¿FDOO\
designed to clean glass, windows,
/&'3ODVPDWHOHYLVLRQVFUHHQVDQG
RWKHU VPRRWK VXUIDFHV +LJK TXDO
LW\ PLFUR¿EHU JUDPVVT PHWHU KDV D YHU\ WLJKW
dense circular weave with very little pile to leave smooth
VXUIDFHVZLWKDVSDUNOLQJVWUHDNIUHH¿QLVK*DUPHQWWDJ
ZLWKSUHIHUUHGVXUIDFHW\SHVHZQLQSRO\HVWHU
Q\ORQEOHQG0DFKLQHZDVKDEOH
No.
‡&(17(538//
‡³9,67$´
6SHFLDOO\ WUHDWHG WR DWWUDFW DQG
bond dust to cloth for fast and easy
GXVWLQJ1RVSUD\VQHHGHG:DVKRYHUDQGRYHULQOXNH
ZDUPZDWHUZLWKPLOGGHWHUJHQWDLUGU\6DIHIRUDOOVXU
IDFHVLQFOXGLQJGHOLFDWHKRXVHKROGREMHFWV¿QHIXUQLWXUH
glass mirrors, auto interiors, appliances, electronics, etc.
Polybagged.
613-7327
MICROFIBER CLOTH
Our No.
PAPER TOWEL
DISPENSERS
‡3(5&(17&27721
5(86$%/(
‡³21(:,3(8/7,0$7(
'867(5´
1
($
8OWLPDWHLQKDQGGU\LQJWHFKQRORJ\
DQG K\JLHQH $ PLFURFKLS VHQVRU
detects your hand, dellivering a
SUHFLVH OHQJWK RI 7RUN UROO WRZHOLQJ LQ D WRXJKIUHH HQ
YLURQPHQW$%6SODVWLFZKLWHLQFRORU´[´[
´ 8VH 7RUN URRO WRZHO VWDQGDUG 1R 6.8
QDWXUDO WRZHO RU 1R 6.8 white towel.
Our No.
Shf
Pk
No.
Unit
NORTH AMERICAN PAPER CO
043-8648
,+.6
1
($
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
WIPES
LEATHER CLEANER
WIPES
5HMXYHQDWHV OHDWKHU¶V DSSHDUDQFH
and leaves a renewed feel. Gently,
yet thoroughly removes soil and
surface grime to keep leather and
YLQ\O ORRNLQJ WKHLU EHVW0DLQWDLQV
WKHRULJLQDODSSHDUDQFHKDQGOHDQGGXUDELOLW\/HDYHVQR
UHVLGXHZKLFKFDQKDUPOHDWKHU¶VÀH[LELOLW\&RQWDLQVQR
dulling waxes, oils, or additives. Convenient wipes in a
UHVHDODEOHSDFNDJH6DIHIRUDOOOHDWKHUV:LSHVHDFK
[´
Our No.
No.
Shf
Pk
Unit
GUARDSMAN
443-5517
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
470200
6
($
138 - Maintenance, Repair & Operations
LEATHER PROTECTOR
WIPES
Creates an invisible shield to pro
tect leather against premature
aging and irreversible damage
from penetrating stains. Protects
OHDWKHU¶V RULJLQDO IHHO DQG FRORU
and keeps it looking its best and feeling soft and supple.
0DNHV FOHDQLQJ HDVLHU DQG PRUH HIIHFWLYH &RQYHQLHQW
ZLSHV LQ D UHVHDODEOH SDFNDJH :LSHV HDFK [
´1RWLQWHQGHGIRUXVHRQVXHGHQXEXFNDQGEXIIHG
leathers.
Our No.
Shf
Pk
No.
470600
CLEANING WIPES
‡%/($&+)5((
‡³&/252;´
‡)/86+$%/(
‡³6&58%%,1*%8%%/(6´
$ TXLFN DQG HDV\ ZD\ WR GLVLQIHFW
and clean household surfaces. The
EOHDFKIUHHIRUPXODFOHDQVDQGNLOOV
SHUFHQW RI WKH EDFWHULD 7KH
wipes can be used throughout the house, kitchen, and
bathroom and disposed in trash after use.
/HDYHV VXUIDFH VDQLWDU\ &RQYH
nient cleaning for all your bath
URRP VXUIDFHV 8VH RQ WRLOHWV
VLQNVVKRZHUVDQGÀRRUV6DIHIRU
VHSWLFWDQNV0DGHRIELRGHJUDGDEOHFORWK&LWUXVDFWLRQ
scent.
Our No.
No.
6
($
Shf
Pk
Scent
Unit
CLOROX COMPANY
Our No.
No.
Count
Shf
Pk
Unit
SC JOHNSON
35 Count
Unit
GUARDSMAN
817-1571
DISINFECTING WIPES
Wet Wipes in Canister
649-8075
Fresh
12
($
658-2837
/HPRQ
12
($
627-8642
01665
Fresh
24
($
70614
684-4963X
28
($
To Go Pack
(UDVHVLQNDQGOLSVWLFNIURPOHDWKHU
and vinyl.
Our No.
DISINFECTING WIPES
Shf
Pk
No.
Unit
321700
12
Our No.
($
8VHWRFOHDQDQGGXVWDOO\RXUKDUG
surfaces. Cleans wood, blass and
PRUH $QWLVWDWLF IRUPXOD LV JUHDW
IRUHOHFWURQLFV5HPRYHVGXVWGLUW
smudges and common allergens from dust mites, pet
GDQGHUDQGSROOHQ6WUHDNIUHHFOHDQ/HDYHVQRVPHDU\
UHVLGXH3UH0RLVWHQHG
3UHPRLVWHQHG ZLWK FOHDQHUV DQG
GLVLQIHFWDQWV 8VH RQ PRVW KDUG
QRQSRURXV VXUIDFHV WKURXJKRXW
the house, at work or when travel
LQJ%OHDFKIUHH´[´6KHHWVL]H
GUARDSMAN
927-4143
No.
Shf
Pk
Scent
Unit
CLOROX COMPANY
COUNTERTOP
CLEANERS
No.
Count
21462
25
Shf
Pk
Unit
12
($
SC JOHNSON
856-7745X
698-3852
01628
/HPRQ)UHVK
6
($
950-1461
01656
Fresh
12
($
‡:,3(6
‡³6721(*/,'(´
CLEANING WIPES
For all kitchen countertop surfaces.
6WUHDNIUHHIRUPXODFOHDQVNLWFKHQ
FRXQWHUWRSV &RULDQ 6LOHVWRQH
Formica, marble vanities, concrete countertops, and all
brands of solid surfaces, engineered stone and lami
QDWHV 'LVSRVDEOH 6DIH IRU IRRGKDQGOLQJ VXUIDFHV DQG
WKHUHLVQRULQVLQJUHTXLUHGVKHHWVSHUER[
Shf
Pk
No.
‡.,7&+(1
6
For cleaning surfaces such as tele
visions, cell phones, computers
DQG PRUH 1R UHVLGXH VWUHDNIUHH
VKLQH5HVHDOSDFNDJH
3UHPRLVWHQHG ZLWK FOHDQHUV DQG
GLVLQIHFWDQWV 8VH RQ PRVW KDUG
QRQSRURXV VXUIDFHV WKURXJKRXW
WKH NLWFKHQ %OHDFK IUHH ´ [ ´
6KHHWVL]H
Our No.
00001
‡(/(&7521,&685)$&(6
‡:(7
‡³:,1'(;´
DISINFECTING WIPES
Unit
MAGIC AMERICAN
264-2767X
Our No.
7” x 10”
75 wipes in Canister
Our No.
CLEANING WIPES
‡08/7,685)$&(
‡³3/('*(´
INK SPOT REMOVER
No.
Shf
Pk
Scent
Our No.
Unit
CLOROX COMPANY
($
No.
Count
Shf
Pk
Unit
25
12
($
SC JOHNSON
820-7029
70227
35 Wet Wipes In Canister
895-2186
Shf
Pk
50333025
Unit
Our No.
30
6
SPONGES
‡$//385326(
‡32/<85(7+$1(
‡³($6<*5,3´
0RUH GXUDEOH WKDQ SDSHU WRZHOV
DQGPDFKLQHZDVKDEOH+DQJ7DJ
MAGIC AMERICAN
315-5835
SPONGES
‡.,7&+(1
‡*(1(5$/385326(
‡³6&27&+%5,7(´
)HDWXUHVD³QREXII´RQHVWHSZLSH
DQG JR DSSOLFDWLRQ 6WUHDN IUHH
VKLQH¿QJHUSULQWUHVLVWDQW:RUNV
great on aluminum and chrome surfaces, too.
Count
($
CLEANING WIPES
‡21(67(3$33/,&$7,21
‡³&203/(7(´
No.
12
2UDQJH
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
STAINLESS STEEL
CLEANER
Our No.
($
No.
Shf
Pk
For home, auto and marine wash
LQJFOHDQLQJ
Unit
3M
748-4850
Our No.
24
PK 5
No.
Size
In
Shf
Pk
Unit
24
($
ACME SPONGE & CHAMOIS CO
118-1031
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%6
[[
Maintenance, Repair & Operations - SPONGES
SPONGES
‡32/<(67(5
‡³$48$´
‡0,&52),%(5
)RU JHQHUDO ZDVKLQJFOHDQLQJ
+\GURSKLODWHG 3RO\HVWHU 'XUDEOH
6ROYHQWUHVLVWDQW$EVRUEHQW6WD\V
VRIW(DV\*ULS
Our No.
No.
Shf
Pk
Unit
24
($
ACME SPONGE & CHAMOIS CO
514-1478
+&
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
SCRUB SPONGES
0LFUR¿EHU NLWFKHQ VSRQJH 1DWXUDO
FOHDQLQJ SURSHUWLHV RI PLFUR¿EHU
Both sides incorporate soft, ab
VRUEHQW WLJKWO\ ZRYHQ PLFUR¿EHU
WKDWLVSHUIHFWIRUOLJKWHUGXW\XVH
³6OLPZDLVWHG´GHVLJQJLYHVWKHVSRQJHDFOHDQFRQWHP
porary look, while also being more comfortable to use.
Packaged as a 4 pack with 2 blue, 1 green and 1 yellow
PLFUR¿EHUVSRQJHV7DLORUHGIRUOLJKWGXW\XVDJH6SRQJ
es are machine washable.
Our No.
Shf
Pk
No.
Unit
989-4957
570
48
($
‡$//385326(
‡32/<(7+(5
‡³$48$´
For all home, auto and marine
FOHDQLQJ DSSOLFDWLRQV +RQH\FRPE
SRO\HWKHU'XUDEOH6WD\VVRIW6RO
vent reistant.
Our No.
No.
Size
In
Shf
Pk
Unit
24
($
ACME SPONGE & CHAMOIS CO
780-6706
+2
[[
Cleans delicate and bathroom
VXUIDFHV ZLWKRXW VFUDWFKLQJ ,GHDO
IRU VFUXEELQJ QRQVWLFN FRRNZDUH
glassware, china and stainless
steel.
Our No.
No.
Shf
Pk
Unit
527-0830
7
12
PK 2
KITCHEN SPONGES
SCRUBBING SPONGES
‡+286(+2/'/$5*(
‡³2&(/2´
‡'(/,&$7('87<
‡³6&27&+%5,7(´
)RUELJMREVOLNHZDVKLQJÀRRUVRU
FOHDQLQJXSODUJHVSLOOV5HVLVWWKH
JURZWKRIEDFWHULDORGRUVZLWKDQWL
microbial technology.
Provides safe, effective cleaning of
the most delicate surfaces. Perfect
for china and crystal.
Our No.
636-8096
No.
Shf
Pk
Unit
948-7976
435
12
($
301-1996
''
8
PK 3
No.
Size
In
Shf
Pk
Unit
Our No.
7
[[
12
($
3M
SPONGES
‡/,*+7'87<
‡³2&(/2´
3M
QUICKIE MANUFACTURING
SPONGES
SCRUBBING SPONGES
3M
‡/$5*(%21(
‡³6&27&+%5,7(´
KITCHEN SPONGES
SCRUBBING SPONGES
‡+$1'<6,=(
‡³2&(/2´
Our No.
No.
Shf
Pk
Unit
$%6%
12
($
3M
194-4164
‡78%6,1.
‡/,*+7'87<'(/,&$7(
‡³6&27&+%5,7(´
For washing dishes and wiping
FRXQWHUV5HVLVWVRGRUVNLOOVJHUPV
in the sponge.
Our No.
No.
Shf
Pk
Unit
7
12
PK 4
3M
692-6505
SPONGES
Features a sponge side that resists
RGRUVE\NLOOLQJRGRUFDXVLQJJHUPV
in the sponge. For light duty scrub
ELQJRIQRQVWLFNDQGRWKHUGHOLFDWHVXUIDFHV)LWVFRP
fortably in the hand.
Our No.
No.
Shf
Pk
Unit
12
($
3M
‡85(7+$1(
‡³6&27&+%5,7(´
Large
UTILITY SPONGES
948-2811
445
‡*(1(5$/+286(+2/'
‡³2&(/2´
Our No.
No.
Shf
Pk
Unit
85(2&2
12
PK 2
3M
047-3793
For general household chores like
ZDVKLQJ ZDOOV DQG ZRRGZRUN 5H
sists the growth of bacterial odors
XVLQJDQDQWLPLFURELDOWHFKQRORJ\
Our No.
SCRUBBING SPONGES
No.
Size
In
Shf
Pk
Unit
7
[[
12
PK 2
3M
613-4266
SPONGES
‡0,&52),%(5
0LFUR¿EHU GLVK JODVV VSRQJH
1DWXUDO FOHDQLQJ SURSHUWLHV RI PL
FUR¿EHU %RWK VLGHV LQFRUSRUDWH
soft, absorbent, tightly woven mi
FUR¿EHU WKDW LV SHUIHFW IRU OLJKWHU
GXW\ XVH ³6OLPZDLVWHG´ GHVLJQ JLYHV WKH VSRQJH D
clean, contemporary look, while also being more com
IRUWDEOHWRXVH(DFKSDFNFRPHVZLWKRQHJUHHQDQG
RQHEOXHVSRQJH6SRQJHVDUHPDFKLQHZDVKDEOH
Our No.
No.
Shf
Pk
Unit
511
Fast cleaning without scratching.
6DIH IRU 7HÀRQ 6LOYHUVWRQH DQG
&DOSKDORQ QRQVWLFN FRRNZDUH
&RPIRUWDEOHHDV\WRKROGVKDSH
Our No.
48
($
No.
Shf
Pk
Unit
COMMERCIAL
SPONGES
3M
415-4498
03
8
PK 3
‡+($9<'87<
142-2542
526
6
PK 6
No.
Size
In
Shf
Pk
Unit
613-4183
7
[[
24
($
610-7031
7
[[
24
($
Our No.
3M
QUICKIE MANUFACTURING
824-0293
‡08/7,385326(
‡1216&5$7&+
‡³6&27&+%5,7(´
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
140 - Maintenance, Repair & Operations
SCRUBBING SPONGES
SCRUBBING SPONGES
SCRUBBING SPONGES
‡+($9<'87<
‡³626´
‡0,&52),%(5
‡³/<62/´
‡0,&52),%(5
&XWV WKURXJK WRXJK PHVVHV $Q
JOHGVKDSHJHWVLQWRKDUGWRUHDFK
places.
'HHS FOHDQLQJ SRZHU 7RXJK RQ
GLUW JHQWOH RQ VXUIDFHV 5HGXFHV
RGRUV EHWZHHQ XVHV $QWLPLFURELDO
protection of the sponge and mi
FUR¿EHU SURKLELWV JURZWK RI JHUPV DQG EDFWHULD 'XDO
VLGHG IRU FRPELQHG FOHDQLQJ SRZHU 1RQVFUDWFKLQJ
VFUXEEHUVWULSV3DFN
Our No.
No.
Shf
Pk
Unit
12
($
CLOROX COMPANY
654-0181
Our No.
Shf
Pk
No.
Unit
QUICKIE MANUFACTURING
659-9419X
57520
3
($
SCRUBBING SPONGES
Our No.
824-0319
‡0(',80'87<
‡³6&27&+%5,7(´
No.
Shf
Pk
Unit
618-2430
425
12
($
221-8535X
+'
8
PK 3
761-3839
426
6
PK 6
3M
Our No.
No.
Size
In
Shf
Pk
Unit
74
[
20
($
3M
,.6
‡+($9<'87<
‡³2&(/2´
No.
Shf
Pk
Unit
6
0%
($
‡+($9<'87<+286(+2/'
‡³6&27&+%5,7(´
No.
Shf
Pk
Unit
7
12
PK 2
3M
SPONGE CLOTHS
For big jobs around the house and
outdoors. Can be used to clean
JULOOV WRROV JUDWHV DQG ZKLWHZDOO
tires.
Our No.
No.
$OOSXUSRVHFOHDQLQJVSRQJHVKHHWV
are perfect for tough jobs. Contains
2 natural cellulose sponge cloths.
Shf
Pk
Unit
12
($
3M
Large
618-2653
SCRUBBING SPONGES
455
Our No.
No.
Shf
Pk
Unit
6
PK 2
QUICKIE MANUFACTURING
236-0006X
‡67$<&/($1
‡³6&27&+%5,7(´
547
SCRUBBING SPONGES
5LQVHV FOHDQ (JJV DQG FKHHVH
ZRQ¶WVWLFN7ZRVLGHGIRUVFRXULQJ
and wiping, no scratch.
‡0,&52),%(5
No.
Shf
Pk
Unit
202
12
PK 2
3M
SCRUBBING SPONGES
‡&/27+
‡³6&27&+%5,7(´
0LFUR¿EHU QRQVWLFN FRRNZDUH
VSRQJH 1DWXUDO FOHDQLQJ SURSHU
WLHVRIPLFUR¿EHU'XDOVLGHGPLFUR
¿EHU VSRQJH %RWK VLGHV IHDWXUHV
VRIW\HWGXUDEOHPLFUR¿EHUZHDYH
while one side incorporates rows of polyester scrubbing
VWULSVWRWDFNOHWRXJKJUHDVHDQGJULPH³6OLPZDLVWHG´
design gives the sponge a clean, contemporary look,
ZKLOHDOVREHLQJPRUHFRPIRUWDEOHWRXVH(DFKSDFN
FRPHVZLWKRQHJUHHQDQGRQHEOXHVSRQJH6SRQJHVDUH
machine washable.
Our No.
No.
DISH SCRUBBERS
‡62$3',63(16,1*
',6+:$1'
‡+($9<'87<5(),//
‡³6&27&+%5,7(´
&OHDQV WRXJK EDNHGRQ PHVV
HV 5H¿OO IRU 1R 6.8
GLVKVFUXEEHUGLVKZDQG+DQJ7DJ
Our No.
824-0301
No.
Shf
Pk
Unit
12
PK 2
520
No.
Shf
Pk
Unit
7
PK 2
3M
Shf
Pk
Unit
48
($
408-0891
QUICKIE MANUFACTURING
6SRQJH FORWK LV JUHDW IRU NLWFKHQ
bath, around the house and out
GRRUV+DQJ7DJ
3M
806-6086
($
2 pack, soap dispensing dish
ZDVKHUUH¿OOVZLWKPLFUREDQWUHDW
ed with microban antimicrobial
product protection built into the
VSRQJH¿JKWVRGRUFDXVLQJEDFWHULDPROGDQGPLOGHZ
large sized, light duty scouring blue cellulene sponges.
576-9971X
SCRUBBING SPONGES
Tackles the toughest cleaning jobs.
,GHDO IRU EDNHGRQ PHVVHV DQG
FOHDQLQJFDVWLURQ
Our No.
48
QUICKIE MANUFACTURING
SCRUBBING SPONGES
792-2131
‡5(),//6
Our No.
Our No.
Unit
SOAP DISPENSING
SPONGES
$GXDODFWLRQFOHDQLQJSDGVSRQJH
for most common cleaning jobs.
Typical applications include walls,
WDEOHV ¿[WXUHV FRXQWHUWRSV DQG
ÀRRUV
650-6059X
160-6086
Shf
Pk
SCRUBBING SPONGES
5HPRYHVWRXJKEDNHGRQPHVVHV
Great for kitchen, garage and out
doors.
Our No.
No.
QUICKIE MANUFACTURING
‡+($9<'87<
‡³6&27&+%5,7(´
Our No.
0LFUR¿EHUSRWSDQVSRQJH1DWX
UDO FOHDQLQJ SURSHUWLHV RI PLFUR¿
EHU 'XDOVLGHG PLFUR¿EHU VSRQJH
2QH VLGH IHDWXUHV KHDY\GXW\ Q\
lon webbing to scrub and scour the
toughest messes, while the other side features micro
¿EHU ZLWK VFUXEELQJ VWULSV WR ZLSH DZD\ GLUW JULPH
³6OLPZDLVWHG´GHVLJQJLYHVWKHVSRQJHDFOHDQFRQWHP
porary look, while also being more comfortable to use.
(DFKSDFNFRPHVZLWKRQHJUHHQDQGRQHEOXHVSRQJH
6SRQJHVDUHPDFKLQHZDVKDEOH
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
56&
Maintenance, Repair & Operations - 141
DISH SCRUBBERS
SOAP PADS
SCOURING PADS
‡$//385326(
‡&(//8/(1(5(),//
‡³*22'+(/3´
‡67((/:22/
‡³626´
‡*(1(5$/385326(
6<17+(7,&
‡&200(5&,$/
‡³6&27&+%5,7(´
Contains 2 easy to change, su
per absorbent, natural Cellulene
VSRQJHV ,WV UHFWDQJXODU GHVLJQ LV
SHUIHFWIRUDOOSXUSRVHFOHDQLQJ5H¿OOIRU1R*RRG
+HOS%DVLF6XGVDQG6SRQJH
Our No.
Shf
Pk
No.
Cuts through grease and shines
PHWDO)RUKHDY\GXW\VFUXEELQJRI
SRWVDQGSDQV5XVWLQKLELWRUVDQG
interwoven design make pads last
longer.
Our No.
Unit
Shf
Pk
No.
Our No.
CLOROX COMPANY
QUICKIE MANUFACTURING
429-3882X
165CQ
12
($
550-0848
‡08/7,385326(
‡1216&5$7&+
‡³6&27&+%5,7(´
Fast cleaning without scratching.
6DIH IRU 7HÀRQ 6LOYHUVWRQH DQG
&DOSKDORQ QRQVWLFN FRRNZDUH
&RPIRUWDEOHHDV\WRKROGVKDSH
Our No.
No.
Shf
Pk
Unit
520
24
($
3M
Shf
Pk
Our No.
654-2625
12
($
8
PK 2
‡67((/:22/
‡³%5,//2´
Cuts through tough messes.
No.
Shf
Pk
Unit
23310
12
PK 10
947-7928
220
[
24
($
779-7798
7
PK 3
107-6918
228
6
PK 8
908-2868
0
8
PK 8
3M
214
12
($
0XOWLSXUSRVH IDVW DQG HIIHFWLYH
scouring for tough jobs without
VFUDWFKLQJ 6DIH IRU 7HÀRQ 6LOYHUVWRQH DQG &DOSKDORQ
QRQVWLFNFRRNZDUH
Our No.
866-0086
Shf
Pk
Unit
6
14
PK 3
SCOURING PADS
No.
Shf
Pk
Unit
213C
8
PK 3
‡3/$67,&0(6+
‡³/<62/´
+DQGVDYHU GHVLJQ NHHSV KDQGV
DZD\ IURP GLUW\ ZDWHU 'HVLJQHG
to deep clean while keeping hands
JULPHIUHH5HGXFHVRGRUVEHWZHHQ
XVHV$QWLPLFURELDOSURWHFWLRQRIWKHPHVKVFUXEEHUSUR
hibits growth of germs and bacteria.
Our No.
‡&200(5&,$/+($9<
'87<
‡³6&27&+%5,7(´
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
678-7253X
8VH LQ NLWFKHQ WR UHSODFH VFUDS
ers, steel wool and metal sponges.
7RXJK ¿EHUV DQG DEUDVLYHV PDNH
IDVW ZRUN RI MREV LQFOXGLQJ UHPRYDO RI EDNHGRQ IRRG
IURPNLWFKHQFRRNLQJHTXLSPHQWDQGRIVFXIIPDUNVRQ
ÀRRUV
No.
Size
In
Shf
Pk
Unit
86
[
12
($
3M
651-0895X
No.
3M
SCOURING PADS
Our No.
[
³6&27&+%5,7(´
ARMALY BRANDS
618-0533
Shf
Pk
Unit
3M
Our No.
Unit
Size
In
Shf
Pk
‡&233(5
‡³6&27&+%5,7(´
789-5261
($
No.
SCOURING PADS
Our No.
20
‡1216&5$7&+
‡³6&27&+%5,7(´
6SHFLDOO\ GHVLJQHG ZLWK ORQJ ODVW
ing copper edges that cut through
WRXJKVRLODQGEXUQWRQIRRG+DQJ
Tag.
SOAP PADS
[
SCOURING PADS
Unit
3M
No.
Our No.
3M
781-2589X
651-0937X
Unit
8VHWRFOHDQSRWVSDQVDQGEURLOHU
pans. Cleans large surface area
ZKLFKFXWVWKURXJKEXUQWRQIRRG
(DV\WRKROGZLOOQRWUXVW'XUDEOH
6FUXEELQJ ¿EHUV DUH PDGH IURP
QDWXUDO $JDYH SODQW 6SRQJH
PDGHIURPQDWXUDO¿EHUVRI
ZKLFKLVUHF\FOHGSDSHU
No.
Shf
Pk
No.
‡+($9<'87<67$,1/(66
67((/
‡³6&27&+%5,7(´
‡*5((1(5&/($1
‡1216&5$7&+
‡³6&27&+%5,7(´
Unit
&OHDQV WRXJK EDNHGRQ PHVVHV
For cast iron pots, stove burners,
broilers, garden tools, grills, white
wall tires and other household
items.
SCOURING PADS
SCRUBBING SPONGES
Shf
Pk
‡+($9<'87<
‡³6&27&+%5,7(´
CLOROX COMPANY
484-9501X
Size
In
SCOURING PADS
&XWV WKURXJK WKH WRXJKHVW EDNHG
on mess. Powers through greasy
problems. returns shine to your
SRWV DQG SDQV 5HPRYHV UXVW
stains.
SCRUBBING SPONGES
Our No.
($
SOAP PADS
SCOURING PADS
947-9023
12
No.
3M
18 Count
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
Our No.
Unit
For most common cleaning jobs,
including kitchen and cooking
HTXLSPHQW ZDOOV UDLOLQJV ÀRRU GHVNV VWDLUZD\V FRXQ
WHUVDQGPDLQWHQDQFHHTXLSPHQW
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
57544
3
($
142 - Maintenance, Repair & Operations
SCOURING PADS
SCRUBBING PADS
SCRUBBING PADS
([FHOOHQWIRUMREVWKDWUHTXLUHDEUD
sive cleaning. Contains 2 scourers.
‡*5,//+($9<'87<
+$1'/('
‡³6&27&+%5,7(´
‡5(),//
‡³6&27&+%5,7(´
Our No.
No.
Scrubber
Type
Shf
Pk
Unit
QUICKIE MANUFACTURING
5H¿OOIRU8QJHU1R&76.8
'LVSOD\%R[
/DUJH PLQHUDOFRDWHG VFUXEELQJ
KHDGWRUHPRYHEXUQWRQIRRGDQG
grease. For grills with steel racks
DQGRYHQJUDWHV6WURQJKDQGOHIRUJRRGOHYHUDJH
Our No.
044-8670X
503
Copper
3
($
3M
285-6920X
504
6WHHO
6
($
899-7801
No.
Head
Size In.
7721
[[
Shf
Pk
Our No.
Unit
Unit
3M
014-4402
4
Shf
Pk
No.
8
&7
($
($
SCRUBBING PADS
SCOURING PADS
SCRUBBING PADS
‡*5((1(5&/($1
‡1216&5$7&+
‡³6&27&+%5,7(´
‡)/22508/7,385326(
‡³6&27&+%5,7(´
‡67$,1/(6667((/
‡67$57(53$&.
‡³6&27&+%5,7(´
1R VFUDWFK UHPRYHV KHHO PDUNV
DQGZD[EXLOGXS+DQGOHSURYLGHV
good cleaning leverage while pro
WHFWLQJ KDQGV 8VH IRU SRUFHODLQ
grill racks, lawn furniture, whitewall tires, deck and alu
minum boats, rust and corrosion, ceramic tiles, canvas
and old wallpaper paste.
5HPRYHV DQG UHVLVWV VPXGJHV
DQG ¿QJHUSULQWV /HDYHV D EULOOLDQW
VWUHDNIUHH VKLQH .HHSV VXUIDFHV
ORRNLQJ EHWWHU ORQJHU :RQ¶W VFUDWFK VWDLQOHVV VWHHO VXU
faces. Flexible handle to get around corners, handles and
NQREV)RUUH¿OOXVH8QJHU1R666.8
Boxed.
1RQVFUDWFK VFUXEELQJ ¿EHUV DUH
PDGH IURP QDWXUDO $JDYH
plant. Packaging is made from
UHF\FOHGFRQWHQW
Our No.
Shf
Pk
No.
Unit
3M
696-7053
12
PK 2
Our No.
No.
Head
Size In.
7722
[[
Shf
Pk
Unit
3M
899-7819
4
($
Our No.
Shf
Pk
No.
Unit
3M
656-5378
4
66
($
SCOURING BRICK
‡+($9<'87<380,&(
‡-80%2
‡³380,(´
5HPRYHV OLPH VFDOH UXVW SDLQW
FDUERQ 5HVWRUHV WRRO SRROV DQG
barbecues. Contains no chemicals.
6DIHIRUKDQGV
Our No.
Shf
Pk
No.
Unit
US PUMICE CO
144-2078
12
-36
SCRUBBING PADS
SCRUBBING PADS
‡%$7+'(/,&$7('87<
‡³6&27&+%5,7(´
‡5(),//
‡³6&27&+%5,7(´
5HPRYHV VRDS VFXP DQG ZDWHU
spots without scratching delicate
VXUIDFHV +DQGOH SURYLGHV JRRG
cleaning leverage while protecting
KDQGV )RU VZLPPLQJ SRROV ¿EHUJODVV PDULQH WRSVLGH
DQGEULJKWZRUNFHUDPLFWLOHZRRGÀRRUVDQGWULPYLQ\O
and upholstery.
5H¿OOIRU8QJHU1R666.8
6WDLQOHVV 6WHHO 6WDUWHU
3DFN'LVSOD\%R[
($
Our No.
No.
Head
Size In.
7723
[[
Shf
Pk
Unit
Our No.
Shf
Pk
No.
Unit
3M
962-4966
8
66
($
3M
899-7827
SCOURING STICK
4
($
‡+($9<'87<380,&(
‡³380,(´
‡6<17+(7,&)$%5,&
Shf
Pk
No.
‡62$36&80(5$6(5
‡³6&27&+%5,7(´
Unit
US PUMICE CO
543-8668
12
+':
3OXVK PDFKLQHZDVKDEOH V\Q
thetic fabric with reinforced zigzag
VWLWFKHGHQGVHQVXUHVORQJOLIH0D
chine washable fabric. For cleaning
screens, dusting, and wood polish
ing.
SCRUBBING PADS
Cleans ceramic tile, porcelain,
PDVRQU\ FRQFUHWH LURQ 5HPRYHV
deep stains, hard water rings, rust,
SDLQW FDUERQ EXLOGXSV 5HVWRUHV
tools, pools, and barbecues.
Our No.
5HPRYHV VWXEERUQ VWDLQV ZLWKRXW
FKHPLFDOV(DVLO\UHPRYHVKDUGZD
ter spots and soap scum from just
DERXWDQ\ZKHUH+DQJ7DJ
Our No.
($
No.
Shf
Pk
Our No.
287-7819
%
8
Unit
(DV\WRKROG$OOSXUSRVHSDG8VH
RQQRQVWLFNFRRNZDUH+DQJ7DJ
No.
Shf
Pk
Unit
331-5058
6
Our No.
No.
644-4335
10
10
($
532-0296
14
10
($
Size
In
Shf
Pk
Unit
18
10
($
+ROGVPRUHZDWHUDQGLVPRUHDJ
JUHVVLYH0DFKLQHZDVKDEOHIDEULF
5HLQIRUFHG]LJ]DJVWLWFKHGHQGVHQ
VXUHORQJOLIH9HOFURIDVWHQHU
8QLTXH KDQGOH DQG SDG 5HPRYHV
EXUQW RQ IRRG 6FUXEV FOHDQV DQG
SROLVKHV )RU UH¿OO XVH 8QJHU 1R
&76.8
3M
Shf
Pk
Our No.
077-2608
&7
4
No.
UNGER INDUSTRIAL
Unit
458-0676
3M
($
Unit
‡352)(66,21$/
‡&22.723&/($1(5
‡67$57(5.,7
‡³6&27&+%5,7(´
‡³6&27&+%5,7('2%,(´
Shf
Pk
WINDOW SCRUBBERS
SCRUBBING PADS
SCRUBBING PADS
Size
In
PK 2
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
SCRUBBERS
No.
UNGER INDUSTRIAL
3M
Our No.
WINDOW SCRUBBERS
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 143
SHOWER & BATH
SCRUBBERS
‡1216&5$7&+
‡³6&27&+%5,7(´
5HPRYHV VRDS VFXP ZLWKRXW
VFUDWFKLQJ 5HSODFHDEOH FOHDQLQJ
KHDG +HDY\GXW\ KDQGOH H[WHQGV
XS WR IHHW +DQJ 7DJ 8VH UH¿OO QXPEHU 6.8
Our No.
No.
Shf
Pk
Unit
3M
525-4495
6
DISH SCRUBBERS
SCRUB BRUSHES
‡62$3',63(16,1*
',6+:$1'
‡1216&5$7&+5(),//
‡³6&27&+%5,7(´
‡67,))%5,67/(6
6WXUG\ IRDP EORFN LQFK RYHUDOO
OHQJWK ZLWK KDQJ KROH 6WLII SRO\
¿EHUV DQG TXDOLW\ ZLUH ZRXQG
FRQVWUXFWLRQ 0DGH RI KHDY\ GXW\
materials.
Cleans without scratching and is
VDIHIRUQRQVWLFNVXUIDFHV&DQEH
XVHGZLWK1R6.8+DQJ7DJ
Our No.
No.
Our No.
Shf
Pk
Unit
7
PK 2
3M
56&
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
SCRUB BRUSHES
‡122.&5$11<
‡1216&5$7&+
‡³6&27&+%5,7(´
:RRGKDQGOH3RO\SURS\OHQH¿EHU
Shf
Pk
Unit
3M
431-2534
1&6
12
($
999-1985
Our No.
No.
Shf
Pk
Unit
48
($
No.
Shf
Pk
Our No.
Unit
6
3012
8
($
No.
Shf
Pk
Shf
Pk
Unit
Unit
[
60
($
223-5505X
204
12
($
BIRDWELL CLEANING
SCRUB BRUSHES
1\ORQ ¿EHUV JHQWO\ VFUXE GLUW
JULP DURXQG QDLOV FXWLFOHV
$UFKHG SODVWLF KDQGOH DOORZV ¿Q
gers to easily hold brush.
SCRUB BRUSHES
‡*52877,/(
‡1</21%5,67/(6
+$1'/('
$VVRUWHGFRORUKDQGOHVZLWKVFUDSHU
WLS'R1RW6SHFLI\&RORU
6KDSHG WR JHW LQWR FRUQHUV DQG
WLJKW VSDFHV 5HPRYHV EDWKURRP
SURGXFWEXLOGXS6SHFLDODQJOHVUHDFKZKHUHRWKHUVFUXE
EHUVFDQ¶W%DJJHG
Our No.
Shf
Pk
Unit
16:
12
($
No.
Our No.
Shf
Pk
Unit
60
($
Our No.
Unit
12
($
No.
Size
In
Shf
Pk
Our No.
Unit
MINTCRAFT PRO
($
2042
614-1550
20
24
($
24
($
SHORT HANDLE
674-7646
2041
8.5
No.
Size
In
Shf
Pk
Unit
8x3
10
($
UNGER INDUSTRIAL
LONG HANDLE
828-1164
Shf
Pk
6
6WLII Q\ORQ EUXVKHV UHPRYH GLUW
ZLWKRXW VFUDWFKLQJ /RZ SUR¿OH
180 degree swivel head with easy
DWWDFKPHQWWRWHOHSROHV\VWHP'L
PHQVLRQV´/[´:[´++DQGOHQRWLQFOXGHG
*UHDWIRUELJVFUXEELQJMREV6WXU
dy foam block with long lasting
poly bristles.
No.
221
‡7,/(*5287
‡1</216:,9(/+($'
‡*21*67</(
+HDY\GXW\ VFUXEELQJ VXUIDFH IRU
tough, baked on messes. Control
the soap with dispensing pump.
8VH1R56&6.8IRUUH¿OO+DQJ7DJ
017-7451X
SCRUB BRUSHES
SCRUB BRUSHES
‡62$3',63(16,1*
',6+:$1'
‡³6&27&+%5,7(´
Unit
QUICKIE MANUFACTURING
3M
DISH SCRUBBERS
Shf
Pk
No.
BIRDWELL CLEANING
664-6137
No.
3M
No.
QUICKIE MANUFACTURING
Size
In
($
‡$1*/('
‡1216&5$7&+
‡³6&27&+%5,7(´
552-0135
Unit
SCRUB BRUSHES
Our No.
BATHROOM
SCRUBBERS
Our No.
Shf
Pk
No.
4XDOLW\ SRO\ EORFN ZLWK XQLTXH
VKDSHIRUDQRVOLSJULS%ORFNFUD
dles hand to allow extra pressure
IRU GHHSGRZQ FOHDQLQJ 3HUIHFW
for wood and garage scrubbing.
3RO\¿EHUVZLWKVWDQGVHULRXVFOHDQ
ing. Block is complete with convenient hang hole for
VSDFHVDYLQJFORVHDWKDQGVWRUDJH
3RO\SURS\OHQH KDQGOH DQG ´
SRO\SURS\OHQH EULVWOHV $VVRUWHG
FRORUKDQGOHV'R1RW6SHFLI\&RORU
664-6111
+
251
‡32/<3523</(1(
3M
266-6543
‡'(&.)/225
‡,1'225287'225
HOMEBASIX
HAND/NAIL BRUSHES
Conforms to the curves of your tub.
+DQGOH LV FRPIRUWDEOH OLJKWZHLJKW
DQG ZDWHU UHVLVWDQW /RQJ ODVWLQJ
+DQJ7DJ
Our No.
($
SCRUB BRUSHES
Our No.
222-1380
‡1216&5$7&+
‡³6&27&+%5,7(´
963-8586
24
BIRDWELL CLEANING
SHOWER & TUB
SCRUBBERS
Our No.
2043
100 percent recycled material in
EORFNEURRPDQG¿EHUV6WLIIEULV
WOHV IRU LQGRRURXWGRRU XVH ,GHDO
for cleaning tile, wood, or cement.
NAIL BRUSH
Cleans buildup in shower tracks
DQG EDWK WXE 5HPRYHV EXLOGXS
IURP¿[WXUHVIDXFHWVDQGRWKHUKDUGWRUHDFKVXUIDFHV
+DQJ7DJ
No.
Unit
($
SHOWER & BATH
SCRUBBERS
Our No.
Shf
Pk
MINTCRAFT PRO
845-9737
787-0108
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
144 - Maintenance, Repair & Operations
SCRUB BRUSHES
SCRUB BRUSHES
SCRUB BRUSHES
‡7,/(*5287
‡&251(5
‡*5287
‡³/<62/´
‡$872+$1'/('
6WLII GXUDEOH Q\ORQ EULVWOHV PRYH
JURXQGLQGLUWEUVKKKDVD9SUR
¿OHIRUKDUGWRUHDFKFRUQHUV6ZLY
eling, compact head enables use in
WLJKWSODFHV'LPHQVLRQV´/[´:[´+
/RQJODVWLQJ¿EHUVIRUGHHSFOHDQ
ing. Cleans tight corners and crev
LFHV %XLOWLQ VFUDSHU 5HIUHVKHV
JURXW ZLWKRXW KDUPLQJ $QWLVOLS
JULS 5HGXFHV RGRUV EHWZHHQ XVHV $WLPLFURELDO SURWHF
WLRQRIWKH¿EHUVSURKLELWVJURZWKRIJHUPVDQGEDFWHULD
Our No.
Size
In
No.
Shf
Pk
Unit
UNGER INDUSTRIAL
10
[
No.
905-8413X
($
3
Unit
($
SCRUB BRUSHES
SCRUB BRUSHES
‡$//385326(
‡³/<62/´
Cleans dirt and grime from the
JURXW OLQH /RQJ ODVWLQJ 1RQ
VFUDWFKFOHDQLQJ+DQJ7DJ
$OOSXUSRVH SRZHUIXO VFUXE EUXVK
ZLWK ORQJ ODVWLQJ ¿EHUV IRU GHHS
FOHDQLQJ %XLOWLQ VFUDSHU $QWLVOLS
JULS5HGXFHVRGRUVEHWZHHQXVHV
$QWLPLFURELDOSURWHFWLRQRIWKH¿EHUVSURKLELWVJURZWKRI
germs and bacteria.
Shf
Pk
No.
Unit
3M
488-2908
544
8
Our No.
($
%ULVWOH
Type
Shf
Pk
Unit
615-7697
Palmyra
24
($
616-3869
Polypropylene Fiber
24
($
615-7135
1DWXUDO7DPSLFR
24
($
%ULVWOH
Type
Shf
Pk
Unit
‡$872+$1'/('
Shf
Pk
No.
Unit
QUICKIE MANUFACTURING
244-1756X
No.
SCRUB BRUSHES
‡7,/(*5287
‡³6&27&+%5,7(´
Our No.
Our No.
BIRDWELL CLEANING
QUICKIE MANUFACTURING
+DQGOH1RW,QFOXGHG
050-7533
Our No.
Shf
Pk
)HQGHUZKHHO EUXVK ZLWK ´ SRO\
foam handle.
3
($
)HQGHUZKHHO EUXVK ZLWK ´ SRO\
foam handle.
Our No.
No.
BIRDWELL CLEANING
615-7853
Palmyra
24
($
607-8117
Polypropylene Fiber
24
($
616-3877
1DWXUDO7DPSLFR
24
($
SCRUB BRUSHES
‡³3$/0<5$´
SCRUB BRUSHES
'HFNVFUXEEUXVK
Our No.
No.
Shf
Pk
Unit
12
($
QUICKIE MANUFACTURING
506-9208X
7,+6
225
SCRUB BRUSHES
‡87,/,7<
‡+($9<'87<
‡³/<62/´
‡7$03,&2+$1'/('
‡³675$:%266´
/RQJODVWLQJ¿EHUVIRUGHHSFOHDQ
LQJ+HDY\GXW\IRUWRXJKMREV$Q
WLVOLSJULS5HGXFHVRGRUVEHWZHHQ
XVHV $QWLPLFURELDO SURWHFWLRQ RI WKH ¿EHUV 3URKLELWV
growth of germs and bacteria.
Our No.
Shf
Pk
No.
Unit
296-6257X
Our No.
No.
%ORFN
Size
No of
Tufts
[
60
Shf
Pk
Unit
WOOSTER BRUSH
QUICKIE MANUFACTURING
SCRUB BRUSHES
/RQJ KDQGOH ZLWK NQXFNOH JXDUG
JHWV LQWR KDUGWRUHDFK SODFHV
7ZRKDQGHGXVHE\DSSO\LQJSUHV
VXUHWRWKHODUJHRYDOKHDG´2$
/HQJWK
3
($
977-1429
1827
4
($
‡³7$03,&2´
4XDOLW\ 3RO\ %ORFN :LWK 7DPSLFR
)LEHU&RQYHQLHQW+DQJ8S)HDWXUH
Our No.
No.
Shf
Pk
Unit
12
($
QUICKIE MANUFACTURING
865-3784X
7,+6
213
Shf
Pk
Unit
OXO INTERNATIONAL
37481
Corner scrub brush uses long last
LQJ¿EHUVIRUGHHSFOHDQLQJ([WUD
:LGHUHDFK$QWLVOLSJULS5HGXFHV
RGRUV EHWZHHQ XVHV $QWLPLFURELDO
SURWHFWLRQ RI WKH ¿EHUV SURKLELWV JURZWK RI JHUPV DQG
bacteria.
+LJK SHUIRUPDQFH PL[ RI WZR ¿
EHUV WDPSLFR KROGV PRUH OLTXLG
polypropylene remains stiff, resists
FKHPLFDOV DQG VROYHQWV 5RXQGHG
KDQGOH UHGXFHV IDWLTXH FRPIRUWDEO\ ¿WV WKH KDQG DQG
DGGVFRQWURO´2$/HQJWK
443-0286X
1DUURZURZVRIEULVWOHVDOORZFOHDQ
ing grout between tiles as well as
medicine cabinet and shower door
WUDFNV8VHLWWRVFUXEEDWK¿[WXUHV
DQGEHKLQGVLQNIDXFHWV$EURDGVRIWKDQGOHNHHSV\RXU
hands comfortable.
194-4289X
‡+$1'/('
‡³683(56&58%%(5´
No.
Shf
Pk
Unit
6
($
57121
Our No.
No.
%ORFN
Size
No of
Tufts
[
68
Shf
Pk
Unit
WOOSTER BRUSH
QUICKIE MANUFACTURING
‡³*22'*5,36´
No.
‡&251(5
‡³/<62/´
Our No.
GROUT SCRUB
BRUSHES
Our No.
SCRUB BRUSHES
SCRUB BRUSHES
3
($
555-2336
1828
4
($
SCRUB BRUSHES
‡³/<62/´
Contoured scrub brush for comfort.
/RQJODVWLQJ¿EHUVIRUGHHSFOHDQ
LQJ $QWLVOLS JULS $QWLPLFURELDO
SURWHFWLRQ RI WKH ¿EHUV SURKLELWV
growth of germs and bacteria and
reduces odors between uses.
Our No.
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
135-3598X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
6
($
Maintenance, Repair & Operations - 145
SCRUB BRUSHES
SCRUB BRUSHES
SCRUB BRUSHES
‡3$,/,52167</(
‡,52167</(
‡³32:(56&58%´
‡08/7,385326(5(),//
‡³6&27&+%5,7(´
Polypropylene bristles and handle.
$VVRUWHG KDQGOH FRORUV 'R 1RW
6SHFLI\&RORU
1RVFUDWFK VFUXEEHU UH¿OO 6ZLWFK
DEOH FOHDQLQJKHDG)LWV 1RV DQGKDQGOHV+DQJ7DJ
3DLO EUXVK ZLWK SRO\SURS\OHQH ¿
EHU EULVWOHV DQG KDQGOH $VVRUWHG
KDQGOHFRORUV'R1RW6SHFLI\&RORU
Our No.
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
607-8166
Our No.
No.
Shf
Pk
Unit
BIRDWELL CLEANING
48
[
664-5980
($
Our No.
No.
Shf
Pk
560
6
48
($
018-8292
SCRUB BRUSHES
SCRUB BRUSHES
SCRUB BRUSHES
‡,521+$1'/(
‡³/<62/´
‡78%6+2:(5,521
67</(
‡32/<3523</(1(
‡0,1,%/2&.
/RQJODVWLQJ¿EHUVIRUGHHSFOHDQ
ing. Pointed tip cleans corners.
$QWLVOLSJULS$QWLPLFURELDOSURWHF
WLRQ RI WKH ¿EHUV SURKLELWV JURZWK
of germs and bacteria and reduces odors between uses.
1RQDEUDVLYH VFUXEEHU ZLWK SRO\
SURS\OHQH EULVWOHV DQG D ´
VTXDUHQ\ORQ¿EHUSDG
0LQLDWXUHVFUXEEUXVKZLWKSRO\SUR
pylene block and bristles. Curved
handle for easier grasp.
Our No.
Shf
Pk
No.
Unit
QUICKIE MANUFACTURING
205-4872X
Shf
Pk
Unit
No.
Shf
Pk
Unit
48
($
BIRDWELL CLEANING
12
($
615-7192
SCRUB BRUSHES
SCRUB BRUSHES
‡)/225,52167</(
‡³'<1$0,&'82´
‡7$03,&2%/2&.
7DPSLFR ¿EHU EULVWOHV VHW LQ D
wooden block.
3RO\SURS\OHQHEULVWOHVDQG´[
´Q\ORQ¿EHUSDG
'XUDEOHSODVWLFKDQGOHDQGEULVWOHV
Shf
Pk
Our No.
($
($
‡0,1,,52167</(
‡3/$67,&
No.
No.
BIRDWELL CLEANING
616-0576
3
SCRUB BRUSHES
Our No.
Our No.
Unit
3M
Our No.
Unit
TOOLBASIX
No.
Shf
Pk
Unit
BIRDWELL CLEANING
607-7697
Our No.
No.
Shf
Pk
Unit
48
($
BIRDWELL CLEANING
12
($
664-6004
6KHOI3DFN'LVSOD\-DU
402-7173X
20
-/:1%/
($
SCRUB BRUSHES
‡$1*/('
Our No.
SCRUB BRUSHES
‡+286(+2/'
‡³6&27&+%5,7(´
‡3$/0<5$%/2&.
Palmyra bristles, wooden block.
'XUDEOH VFUXEEHU EUXVK UHDFKHV
WRXJKWRFOHDQ DUHDV LQVLGH DQG
RXW8VH1RKRXVHKROGVFUXE
EHU EUXVK UH¿OO 6.8 +DQJ7DJ
No.
Shf
Pk
Our No.
Unit
HOMEBASIX
730-0981
SCRUB BRUSHES
<%/
554
6
Our No.
Unit
3M
987-2961
24
No.
Shf
Pk
<%/
Our No.
Unit
´
48
($
‡)/225/21*5($&+
)ORRUFDUSHWVFUXEEHUZLWKWDPSLFR
EULVWOHVVHWLQDZRRGHQEORFN´
handle.
No.
Shf
Pk
561
7
Our No.
Unit
3M
315-9944
24
SCRUB BRUSHES
‡5(),//
HOMEBASIX
806-6029
Unit
BIRDWELL CLEANING
626-4170
SCRUB BRUSHES
Shf
Pk
Shf
Pk
($
5H¿OOIRUKRXVHKROGVFUXEEHUEUXVK
1R 6.8 6ZLWFK
DEOH FOHDQLQJ KHDG $OVR ¿WV 1RV
DQGKDQGOHV+DQJ7DJ
No.
Lgth
In
($
SCRUB BRUSHES
Our No.
No.
No.
Shf
Pk
Unit
BIRDWELL CLEANING
607-8125
($
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
6
($
146 - Maintenance, Repair & Operations
DECK SCRUB BRUSHES
DECK SCRUB BRUSHES
‡3$/0<5$%5,67/(6
‡:$7(5)('6<67(0
‡$'-867$%/(
‡³:22'0$7(67(/(:$6+´
:RRG EORFN ZLWK WDSHUHG DQG threaded handle hole.
Our No.
Lgth
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
/HVV+DQGOH
626-4790
10
12
MICROFIBER
MITTS
‡6&58%'867
8VHDVDZRRGGHFNSUHSWRROIRU
cleaning wood, composite, brick,
concrete and other hard surfaces.
Chemical resistant, can be used with most deck cleaners
prior to staining. Cleans under rails and gets into cor
QHUV$WWDFKHVWRVWDQGDUGJDUGHQKRVHZLWKDQDGMXVW
DEOHRQRIIFRQWUROYDOXH6FXOSWHGQRQVOLSUXEEHUJULS
:DWHUIHGWHOHVFRSLQJH[WHQVLRQSROHH[WHQGVWRIHHW
($
Our No.
No.
Adjust
Lgth Ft
Shf
Pk
Unit
0DFKLQH ZDVKDEOH JUDEV GLUW DQG
GXVW ZLWKRXW FKHPLFDOV 2QH VLGH
has thick soft strands, ideal for
ZDVKLQJWKHRWKHUVLGHKDVORZRLOHPLFUR¿EHUZKLFKLV
LGHDOIRUGXVWLQJ'LPHQVLRQV´/[´:[´'
Our No.
No.
Size
In
Shf
Pk
Unit
[
10
($
UNGER INDUSTRIAL
737-5876
MR LONGARM
472-4936
DECK SCRUB BRUSHES
3 to 5
6
($
‡32/<3523</(1(%5,67/(6
KITCHEN BRUSHES
Blue bristles and wood block with
1 tapered and 1 threaded handle
hole.
Our No.
Lgth
In
No.
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
DECK SCRUB BRUSHES
Shf
Pk
Unit
12
($
BIRDWELL CLEANING
SCRUB BRUSHES
´ VXSHU VWLII GHFN VFUXE EUXVK
+DUGZRRG EORFN DQG KDQGOH 5XE
EHU JULS 6XSHU GXW\ )OH[ 6ZHHS
connector, connects head to han
dle. Great for heavy scrubbing.
‡6729(%5$66%5,67/(6
‡+$1'/('
Polypropylene handle with scraper
LQ DVVRUWHG FRORUV 'R 1RW 6SHFLI\
Color.
/HVV+DQGOH
632-2507
10
Our No.
Shf
Pk
No.
Unit
MINTCRAFT PRO
868-6008
DECK SCRUB BRUSHES
6
$)25
Our No.
No.
Shf
Pk
Unit
60
($
BIRDWELL CLEANING
607-7887
($
‡7$03,&2%5,67/(6
:RRG EORFN ZLWK WDSHUHG DQG threaded hole.
Our No.
Lgth
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
For vegetables and dishes. Poly
propylene bristles and handle.
$VVRUWHG FRORU KDQGOHV 'R 1RW
6SHFLI\&RORU
+DQJ7DJ
10
‡32/<3523</(1(
‡3$/0
‡62$3',63(16,1*
‡³6&27&+%5,7(´
/HVV+DQGOH
607-8430
VEGETABLE BRUSHES
DISHWASHING
BRUSHES
12
($
Our No.
No.
Shf
Pk
6
Unit
3M
205-9053
Our No.
No.
Shf
Pk
Unit
48
($
BIRDWELL CLEANING
694-3286
($
DECK SCRUB BRUSHES
‡32/<3523</(1(),%(5
DISHWASHING
BRUSHES
DISHWASHING
BRUSHES
´ %L/HYHO SRO\ IRDP EODFN
7KUHDGHGÀRZWKURXJKKROH
‡%277/(
Polypropylene bristles and handle.
$VVRUWHG KDQGOH FRORUV 'R 1RW
6SHFLI\&RORU
:KLWH SODVWLF ZLWK EOXH UXEEHU HU
gonomic handle.
Our No.
No.
Size
In
Shf
Pk
Unit
BIRDWELL CLEANING
/HVV+DQGOH
690-7364
10
Our No.
6
($
No.
Shf
Pk
Unit
16
($
HOMEBASIX
725-7231
<%/
Shf
Pk
Unit
48
($
DISHWASHING
BRUSHES
‡3273$1
‡5$',$/
Brass bristles. Polypropylene han
GOH ZLWK VFUDSHU $VVRUWHG FRORUV
'R1RW6SHFLI\&RORU
No.
Shf
Pk
Unit
16
($
HOMEBASIX
729-0992
No.
BIRDWELL CLEANING
664-6228
DISHWASHING
BRUSHES
Our No.
Our No.
<%/
Our No.
No.
Shf
Pk
Unit
48
($
BIRDWELL CLEANING
664-5105
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 147
DISHWASHING
BRUSHES
TOILET BOWL
BRUSHES
‡',6+6,1.
‡7$03,&2
Polypropylene bristles and handle.
+DQGOH ZLWK VFUDSHU $VVRUWHG FRO
RUV'R1RW6SHFLI\&RORU
7DPSLFR EULVWOHV +DQGOHV LQ DV
VRUWHGFRORUV'R1RW6SHFLI\&RORU
Our No.
No.
Shf
Pk
Unit
BIRDWELL CLEANING
664-5097
12
607-8083
($
TOILET BOWL BRUSHES
TOILET BOWL
BRUSHES
Unit
Premier bowl brush with rounded
head and polypropylene bristles
and handle.
48
($
‡:,7+&$''<
‡³/<62/´
664-6236
24
($
No.
Shf
Pk
Unit
48
($
Our No.
068-9869
Shf
Pk
Unit
No.
Finish
Shf
Pk
Unit
48
($
0<</
6DWLQ)LQLVK
24
($
BIRDWELL CLEANING
607-8109
709-7918X
‡32/<3523</(1(
7ZR7RQH FRORUHG HUJRQRPLF
KDQGH%ULJKWFDGG\ZLWKQRQVNLG
ring.
Polypropylene bristles and wooden
handle.
Our No.
No.
Shf
Pk
Unit
12
($
HOMEBASIX
No.
727-9847
Shf
Pk
Unit
48
($
<%/
57305
No.
57315
Our No.
452-2744
No.
Shf
Pk
Unit
12
($
HOMEBASIX
728-5562
Shf
Pk
Unit
24
($
BIRDWELL CLEANING
607-8042
Shf
Pk
Unit
6
($
No.
Shf
Pk
Unit
4
($
:KLWH SODVWLF ZLWK EOXH UXEEHU HU
gonomic handle.
Bowl scrubber with nylon scrub pad
and polypropylene handle.
No.
($
INTER-DESIGN
‡:,7+/,3
Our No.
3
‡/223
Our No.
TOILET BOWL
BRUSHES
TOILET BOWL
BRUSHES
Unit
TOILET BOWL
BRUSHES
BIRDWELL CLEANING
482-6541
Shf
Pk
QUICKIE MANUFACTURING
‡:,7+&$''<
Our No.
No.
/RQJODVWLQJ¿EHUVIRUGHHSFOHDQ
LQJ 3DWHQWHG XQGHUWKHULP ¿EHU
H[WHQVLRQ$QJOHGVWRUDJHIRUHDV\
UHDFK &RPIRUW JULS IRU H[WUD JULSSLQJ SRZHU $QWLVOLS
JULS5HGXFHVRGRUVEHWZHHQXVHV$QWLPLFURELDOSURWHF
WLRQRIWKH¿EHUVSURKLELWVJURZWKRIJHUPVDQGEDFWHULD
Our No.
TOILET BOWL
BRUSHES
TOILET BOWL
BRUSHES
Our No.
‡:,7+&$''<
‡³/<62/´
HOMEBASIX
No.
($
TOILET BOWL
BRUSHES
6WDLQOHVV VWHHO VDWLQ ¿QLVK ´+ [
´'
‡7$03,&2
Our No.
12
/RQJODVWLQJ¿EHUVIRUGHHSFOHDQ
ing. Compact design for smaller
spaces. Comfort grip for extra con
WURO$QWLVOLSJULS5HGXFHVRGRUVEHZHHQXVHV$QWLPL
FURELDOSURWHFWLRQRIWKH¿EHUVSURKLELWVJURZWKRIJHUPV
and bacteria.
807-3124X
‡:,7+67$1'
Tampico bristles and wooden han
dle.
Unit
QUICKIE MANUFACTURING
TOILET BOWL
BRUSHES
TOILET BOWL
BRUSHES
Shf
Pk
<%/
‡32/<3523</(1(
BIRDWELL CLEANING
694-3294
724-5293
TOILET BOWL
BRUSHES
BIRDWELL CLEANING
Unit
No.
TOILET BOWL
BRUSHES
Our No.
Shf
Pk
Our No.
HOMEBASIX
Bowl brush with polypropylene
EULVWOHV DQG KDQGOH $VVRUWHG FRO
RUV'R1RW6SHFLI\&RORU
‡32/<3523</(1(
No.
Shf
Pk
No.
BIRDWELL CLEANING
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
Our No.
Our No.
TOILET BOWL
BRUSHES
<%/
TOILET BOWL
BRUSHES
Contemporary design. Brushed
stainless steel handle and holder.
:LOO QRW UXVW (DV\ WR PDLQWDLQ
Brush is removable for replace
ment.
Our No.
No.
Shf
Pk
Unit
INTER-DESIGN
452-2793
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
2
($
148 - Maintenance, Repair & Operations
TOILET BOWL
BRUSHES
WINDOW SQUEEGEES
&ODVVLF $PHULFDQ VW\OH :KLWH FH
ramic with weighted chrome base.
Brush is removable for replace
ment.
Our No.
Unit
INTER-DESIGN
615-8323
‡+($9<'87<
‡&200(5&,$/*5$'(
6WDLQOHVVVWHHOVTXHHJHHZLWKQDWX
UDO PROGHG GRXEOHVLGHG UXEEHU
3URYLGHV VWUHDNIUHH UHVXOWV $W
WDFKHVWR7HOH3ROH
Shf
Pk
No.
WATER WAND
SQUEEGEE
‡67$,1/(6667((/
352)(66,21$/
Our No.
No.
Size
In
Shf
Pk
Unit
UNGER INDUSTRIAL
2
($
523-3846
8
10
($
340-1338
12
10
($
622-9454
16
10
($
TOILET BOWL
BRUSHES
270-2934
‡3/$67,&
‡*(1(5$/385326(
‡:,7+58%%(5%/$'(
‡³727$/5($&+´
Shf
Pk
No.
Unit
HOMEBASIX
1
0<<
($
No.
Size
In
Shf
Pk
Unit
UNGER INDUSTRIAL
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
SQUEEGEES
553-5588
12
10
($
319-9585
16
10
($
WINDOW SQUEEGEE/
SCRUBBER
‡,1352)(66,21$/
Size
In
Shf
Pk
Unit
10
10
($
(OLPLQDWHVWKHQHHGIRUDODGGHUDO
lowing safe cleaning of the 1st and
QGÀRRU0XVWEHXVHGZLWK8QJHU
H[WHQVLRQSROHDQGDGDSWHU¶LQ
VFUXEEHUVTXHHJHHDWWDFKHGWRD
¶ WRWDO UHDFK WHOHVFRSLF SROH 3ROH LV LQFOXGHG 2YHUDOO
'LPHQVLRQV´/[´:[´':HLJKWLVOE
Our No.
Shf
Pk
No.
Unit
UNGER INDUSTRIAL
WINDOW SQUEEGEE/
SCRUBBER
197-2660
6
($
‡1352)(66,21$/
No.
Size
In
Shf
Pk
Unit
14
10
($
UNGER INDUSTRIAL
823-8180
:KLWH SODVWLF ZLWK EOXH UXEEHU HU
gonomic handle.
($
Our No.
No.
Shf
Pk
Unit
36
($
Shf
Pk
Unit
35
18
10
($
Shf
Pk
Unit
‡*(1(5$/385326(
‡³352´
6RIWGRXEOHPRVVUXEEHUFRQIRUPV
WR XQHYHQ VXUIDFHV OHDYLQJ ÀRRUV
GU\ $GMXVWDEOH VRFNHW DFFHSWV
most handles.
Size
In
No.
+DQGOH1RW,QFOXGHG
Lgth
In
Shf
Pk
Unit
30
10
($
UNGER INDUSTRIAL
+0
Lgth
In
SQUEEGEE
18
6
($
SQUEEGEE
‡68&7,21
´OHQJWK
Our No.
No.
Shf
Pk
Unit
INTER-DESIGN
HOMEBASIX
<%/
No.
045-9347
428-7819
731-7738
10
0DGH RI VWDLQOHVV VWHHO WKH µ352¶
is lighter and stronger than brass.
)HDWXUHV D µ)DVW/RFN¶ KDQGOH IRU
TXLFN EODGH DQG FKDQQHO FKDQJHV 1RQVOLS UXEEHU JULS
handle is comfortable in all weather conditions. Coin
adjustable screws hold the channel at desired tension.
&OHDQVDQ\ÀDWVPRRWKVXUIDFH+DQGOHFDQEHXVHGZLWK
75,06&5$3(5 ,QFOXGHV µ6¶ &KDQQHO DQG FRPSOHWH
ZLWK8QJHUVRIWUXEEHUEODGH$WWDFKHVWRDOO8QJHUSROHV
ZLWKDSUHVV¿W
406-1016
‡+($9<'87<
‡&200(5&,$/*5$'(
952-3259
No.
22
UNGER INDUSTRIAL
7ZLQIRDPUXEEHUEODGHV5HPRYHV
standard volumes of water from
XQHYHQÀRRUVXUIDFHVJURXWHGWLOHV
RUQRQVOLSDQGEURDGFDVWJULGÀRRUV,W¶VUHLQIRUFHGKDQ
dle socket is secured to the galvanized steel frame with
VSRWZHOGVIRUKHDY\GXW\DSSOLFDWLRQV$YDLODEOHZLWK
VRFNHWFODPSRULQVWDOOHG$FPH,QVHUW
WINDOW SQUEEGEES
Our No.
Unit
‡:,7+*5,3
‡&200(5&,$/*5$'(
‡³352´
Our No.
WATER WAND
SQUEEGEE
Our No.
Shf
Pk
UNGER INDUSTRIAL
‡7(/(6&23,&
UNGER INDUSTRIAL
519-2778
Our No.
WINDOW SQUEEGEES
:RUN IDVWHU ZLWK VTXHHJHH DQG
VFUXEEHULQ:DVKDQGVTXHHJHH
house or car windows.
No.
Lgth
In
SQUEEGEE
For windows, mirrors and auto
glass. Cleans fast with less streak
LQJ&RPIRUWJULSKDQGOH0XVWEHXVHGZLWK8QJHUSROH
and adapter.
Our No.
Our No.
No.
WINDOW SQUEEGEES
5RXQG VKDSH DQG URXQG OLG 6L]H
´ + [ ´ ' 6WHHO 0DWH
ULDO 7KLFNQHVV PP 9HQHWLDQ
%URQ]H¿QLVK
093-6773
Our No.
UNGER INDUSTRIAL
‡:,7+67$1'
Our No.
&OHDQ DQG GU\ ÀRRUV ZLWK :DWHU
:DQG¶V WZLQ IRDP UXEEHU EODGHV
5HPRYHVVWDQGDUGYROXPHVRIZD
WHUIURPXQHYHQÀRRUVXUIDFHVJURXWHGWLOHVRUQRQVOLS
DQGEURDGFDVWJULGÀRRUV,W¶VUHLQIRUFHGKDQGOHVRFNHWLV
VHFXUHGWRWKHJDOYDQL]HGVWHHOIUDPHZLWKVSRWZHOGV
IRUKHDY\GXW\DSSOLFDWLRQV$YDLODEOHZLWKVRFNHWFODPS
RU LQVWDOOHG $FPH ,QVHUW &KRLFH RI QDWXUDO EODFN IRDP
UXEEHURURLODQGDFLGUHVLVWDQW5HG1HRSUHQH5XEEHU
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
,+.6
22300
6
($
Maintenance, Repair & Operations - ALUMINUM TAPER
HANDLES
‡'(*5((+$1'/(
‡&200(5&,$/*5$'(
7KH µ3UR $OXPLQXP¶ IHDWXUHV
D ÀXWHG DOXPLQXP KDQGOH ZLWK DQ
ergonomic grip.For use with Push
3XOO:DWHU:DQGVTXHHJHHVDQGRWKHUSURGXFWVZLWKD
1.5 taper socket.
Our No.
No.
FLOOR SQUEEGEES
SQUEEGEE RUBBER
‡026658%%(5
‡352)(66,21$/
6RIWGRXEOHPRVVUXEEHUFRQIRUPV
WR XQHYHQ VXUIDFHV OHDYLQJ ÀRRUV
GU\ $GMXVWDEOH VRFNHW DFFHSWV
most handles.
1DWXUDO PROGHG GRXEOHVLGHG UXE
EHU IRU VWUHDNIUHH UHVXOWV &XW WR
size.
Our No.
No.
Size
In
Shf
Pk
Unit
UNGER INDUSTRIAL
Lgth
In
Shf
Pk
Unit
56
10
($
019-8655
Our No.
No.
Size
In
Shf
Pk
Unit
18
10
($
UNGER INDUSTRIAL
18
10
($
753-7335
UNGER INDUSTRIAL
008-4004
$/
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
FLOOR SQUEEGEES
‡386+38//$/80,180
‡675$,*+7
‡³727$/5($&+´
ALUMINUM TAPER
HANDLES
‡7:2121(
‡&200(5&,$/*5$'(
'XDOWLSSHG KDQGOH ZLWK D FRPEL
QDWLRQ $FPH WKUHDG DQG D GH
JUHH FRQH WLS7KH GHJUHH FRQH
¿WV DOO WKH QHZ $TXDGR]HU PRGHOV ZLWKRXW DQ\ LQVHUWV
DQGLWDOVR¿WVDOOSURGXFWVZLWKDWDSHURUXQLYHUVDO
threaded socket.
Our No.
No.
Lgth
In
Shf
Pk
Unit
61
10
($
DUSTERS
Features a pivoting aluminum
channel with black rubber that is
exchangeable and can be used
IURP VLGHV +DQGOH VRFNHW SURYLGHV RSWLPXP FKDQQHO
SLYRWLQJ SXVKSXOO DFWLRQ DQG LV GHVLJQHG IRU XVH ZLWK
7RWDO5HDFKH[WHQVLRQSROHV
Our No.
No.
Size
In
Shf
Pk
Unit
UNGER INDUSTRIAL
403-4872
36
$/7
‡³727$/5($&+´
$WWUDFWV DQG KROGV GXVW ZLWKRXW
FKHPLFDOV:DVKDEOHDQGUHXVDEOH
,GHDO IRU JODVV ZRRG SDLQWZRUN
and all counter tops.
Our No.
5
($
UNGER INDUSTRIAL
631-4918
MICROFIBER
DUSTERS
No.
Size
In
Shf
Pk
Unit
16 x 16
10
PK 6
UNGER INDUSTRIAL
803-4951
FLOOR SQUEEGEES
SHOWER SQUEEGEES
For shower stalls, bathtubs, doors,
WLOH DQG JURXW VTXHDN\ FOHDQ LQ
VHFRQGV(DVLO\UHPRYHVZDWHUDQG
VRDSVFXP:LGWK´
‡,1'8675,$/675$,*+7
MICROFIBER DUSTERS
JDXJH JDOYDQL]HG VWHHO FRQ
VWUXFWLRQ ZLWK EODFN (3'0 UXEEHU
8VHZLWKWDSHUKDQGOH
‡*5((1&/($1,1*
0,&52),%(5
Our No.
Our No.
No.
No.
Size
In
Shf
Pk
Unit
UNGER INDUSTRIAL
Shf
Pk
Unit
12
($
813-4330
24
6
($
UNGER INDUSTRIAL
562-1586
FLOOR SQUEEGEES
‡386+38//$/80,180
‡&859('
‡³727$/5($&+´
Features a pivoting aluminum
channel with black rubber that is
exchangeable and can be used
IURP VLGHV +DQGOH VRFNHW SURYLGHV RSWLPXP FKDQQHO
SLYRWLQJ SXVKSXOO DFWLRQ DQG LV GHVLJQHG IRU XVH ZLWK
7RWDO5HDFKH[WHQVLRQSROHV
Our No.
No.
Size
In
Shf
Pk
1DWXUDO FOHDQLQJ SURSHUWLHV RI PL
FUR¿EHU 6SHFLDOO\ GHVLJQHG H[WUD
long head cleans and dusts large
surface areas with ease. Flexible
construction bends and can clean elevated and other
KDUG WR UHDFK DUHDV ZLWKRXW VWUDLQLQJ 6RIWWRXFK FRP
IRUWJULSKDQGOHLVUDLVHGIURPFOHDQLQJVXUIDFHWRNHHS
¿QJHUVDQGNQXFNOHVIURPVFUDSLQJ0LWWLVHDVLO\UHPRY
able and machine washable.
FLOOR SQUEEGEES
Our No.
‡48,&.&211(&738//
7<3(
‡$/80,180
505-0182
No.
7,+6
4</
Size
In
Shf
Pk
Unit
24
6
($
Unit
UNGER INDUSTRIAL
061-5641
24
5
($
FLOOR SQUEEGEES
715-3406
36
5
($
´KHDY\GXW\FXUYHGUXEEHUÀRRU
VTXHHJHH+DUGZRRGKDQGOHVWHHO
VTXHHJHH IUDPH 6WHHO EUDFH DGGV
extra strength.
Our No.
505-0208
No.
Size
In
Shf
Pk
Unit
MINTCRAFT PRO
874-7651
Our No.
No.
Shf
Pk
$25
4
($
Unit
UNGER INDUSTRIAL
075-5991
24
6
48
($
No.
Shf
Pk
Unit
48
($
QUICKIE MANUFACTURING
‡,1'8675,$/&859('
Our No.
466
0LFUR¿EHU TXLFN GXVWHU 1DWXUDO
FOHDQLQJ SURSHUWLHV RI PLFUR¿EHU
4XLFN DQG HDV\ PLQLPLFUR¿EHU
GXVWHU IHDWXUHV ODUJH VRIWORRSHG
PLFUR¿EHUZHDYHWRJUDEDQGKROG
GXVW DQG GLUW 6RIWWRXFK FRPIRUW
JULSKDQGOHLVHOHYDWHGIURPGXVWHUVXUIDFHWRNHHS¿Q
JHUVDQGNQXFNOHVIURPVFUDSLQJ0LWWLVHDVLO\UHPRYDEOH
and machine washable
FLOOR SQUEEGEES
JDXJH JDOYDQL]HG VWHHO FRQ
VWUXFWLRQ ZLWK EODFN (3'0 UXEEHU
8VHZLWKWDSHUKDQGOH
Unit
MICROFIBER DUSTERS
NEWELL RUBBERMAID COMMERCIAL
034-6775
Shf
Pk
QUICKIE MANUFACTURING
/LJKWZHLJKW FRQVWUXFWLRQ ÀDW
IUDPHSUR¿OHZLWKXQLTXHSXOOW\SH
VTXHHJHHIRUZDWHUDQGGHEULVFRO
OHFWLRQ5HSODFHDEOHKRRNDQGORRSVWULSV¶
Our No.
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
468
150 - Maintenance, Repair & Operations
MICROFIBER DUSTERS
Tool for removing dust and dirt
EXLOGXS IURP EOLQGVPLQLEOLQGV
6PDOO OLJKW KDQGOH ¿WV HDVLO\ WR
hand. Curved prongs closely follow
WKHFRQWRXUVRIEOLQGV3URQJVÀH[
easily, to tightly clamp onto blinds
VXUIDFH 0LFUR¿EHU PLWW IHDWXUHV D ORRVHU ZHDYH ZLWK
longer loop height to enhance the natural ability of mi
FUR¿EHUWRJUDEDQGKROGGLUWDQGGXVW0LWWLVPDFKLQH
washable.
Our No.
No.
Shf
Pk
Unit
48
($
MICROFIBER WOOL
DUSTERS
DUSTING WANDS
$WWDFKHVWRVWDQGDUGDFPHWKUHDG
ed poles to clean those hard to
reach areas. The head is bendable
WRUHDFKÀDWVXUIDFHVDERYHZLWKD
pole. The product simulates a natu
UDOZRROGXVWHU0LFUR¿EHUVOHHYHLVPDFKLQHZDVKDEOH
Our No.
Shf
Pk
No.
Unit
UNGER INDUSTRIAL
275-1048
6
($
QUICKIE MANUFACTURING
505-0273
‡48,&.&211(&7
)/(;,%/(
‡:,7+0,&52),%(56/((9(
(IIHFWLYHO\ H[WHQGV UHDFK DQG UH
moves soil from high and awkward
places while conforming to irregu
ODUVXUIDFHVIRUHDV\FOHDQLQJ4XLFNFRQQHFWPHFKDQLVP
FRQYHUWVKDQGKHOGGXVWHUWRKLJKUHDFKWRRO´/[
´+[´Z
Our No.
Shf
Pk
No.
Unit
NEWELL RUBBERMAID COMMERCIAL
306-8905
Q85000BK00
76
6
($
HANDY DUSTER
‡0$*1(7,&
FEATHER DUSTERS
‡2675,&+/21*5($&+
‡³727$/5($&+´
0DGH IURP SURIHVVLRQDO TXDOLW\
JUD\ IHDWKHUV :UDSDURXQG GHOL
cate objects for easy cleaning. For
chandeliers, track lighting, and
KDUGWRUHDFK FRUQHUV 8VH ZLWK 7RWDO5HDFK ¶ 7HOH
Pole.
Our No.
No.
Shf
Pk
6
‡0,&52),%(5
$WWDFKHVWRVWDQGDUGDFPHWKUHDG
ed poles to clean those hard to
reach areas and allows you to
clean delicate areas. The product
simulates a natural feather duster.
0LFUR¿EHU KHDG GHWDFKHV IURP WKH KDQGOH ZLWK D SXVK
button and is machine washable.
Our No.
No.
Unit
UNGER INDUSTRIAL
757-0906
6
6
24
($
<%/
Our No.
0LFUR¿EHUFKHQLOOH GXVWLQJ PLWW
1DWXUDO FOHDQLQJ SURSHUWLHV RI PL
FUR¿EHU'XDOVLGHGFOHDQLQJDFWLRQ
8OWUDVRIW XOWUDGHQVH PLFUR¿EHU
chenille side attracts dirt and dust
like a magnet, and is perfect for dusting and wiping.
7H[WXUHG WHUU\ ZHDYH PLFUR¿EHU KDV D WLJKWORRSHG PL
FUR¿EHU ZHDYH IRU FOHDQLQJ VPRRWK VXUIDFHV DQG OHDY
LQJDVWUHDNIUHHVKLQH(ODVWLFEDQGIRUFRPIRUWDEOH¿W
0DFKLQHZDVKDEOH
Our No.
No.
Shf
Pk
Unit
72
($
QUICKIE MANUFACTURING
505-0265
478
Unit
($
Shf
Pk
No.
Unit
BONAKEMI USA, INC
157-3252
6
:0
($
DUSTING SYSTEM
‡5(3/$&(0(176/((9(
‡³0,&523/86%,*%(1'´
5HSODFHPHQW RU DGGLWLRQDO VOHHYH
IRU 6NX (OHFWURVWDWLF
action attracts and traps dust, ani
PDO KDLUV DQG DOOHUJHQV 0DFKLQH
washable for over 300 washings.
350-3018
MICROFIBER DUSTING
MITT
UNGER INDUSTRIAL
241-7780
727-0556
Shf
Pk
No.
Unit
BONAKEMI USA, INC
1DWXUDO ODPEV ZRRO DWWUDFWV DQG
KROGV GXVW ZLWKRXW FKHPLFDOV 5H
move dust from vaulted ceilings,
ceiling fans, mini blinds, furniture,
DQG PRUH 'XVWLQJ KHDG EHQGV WR
FOHDQ KDUGWRUHDFK VXUIDFHV 7KUHDGV WR 8QJHU Q\ORQ
FRQH8VHZLWK7RWDO5HDFK¶7HOH3ROH
Shf
Pk
Unit
HOMEBASIX
For dry dusting ceiling fans, high
ledges, under low furniture on both
KDUGZRRGDQGKDUGVXUIDFHÀRRUV
%HQGDEOHH[WHQGDEOH GXVWHU'XVW
LQJKHDGPHDVXUHV´[´DQGLV
ÀH[LEOH EHQGV DQG KROGV LWV VKDSH DQG WKHQ UHVKDSHV
([WHQGDEOHSROHUHDFKHVXSWR¶'XVWLQJVOHHYHVDQG
dusting mitt are machine washable over 300 washings.
,QFOXGHVRQHRIHDFK0LFUR3OXV%LJ%HQGXVWLQJ:DQG
0LFUR3OXV %LJ %HQ GXVWLQJ VOHHYHV 0LFUR3OXV GXVWLQJ
PLWWDQGD0LFUR3OXVGXVWLQJFORWK´[´
Our No.
‡)/(;,%/(/21*5($&+
No.
Shf
Pk
($
LAMBS WOOL DUSTERS
Our No.
No.
MICROFIBER DUSTING
MITT
($
FEATHER DUSTERS
Shf
Pk
Our No.
‡³0,&523/86%,*%(1'´
Unit
UNGER INDUSTRIAL
794-0943
DUSTING SYSTEM
:KLWH SODVWLF ZLWK EOXH UXEEHU HU
gonomic handle.
0LFUR¿EHU GXVWLQJ PLWW 1DWXUDO
FOHDQLQJ SURSHUWLHV RI PLFUR¿EHU
'HVLJQ LQFRUSRUDWLQJ D VHSDUDWHG
LQGH[ ¿QJHU OHWV \RX FOHDQ ZLWK
more detail and tighter control.
8OWUDKLJKTXDOLW\PLFUR¿EHUJUDPVVTPHWHUKDVD
KLJK SRO\HVWHU FRXQW SRO\HVWHU Q\ORQ DQG
long, tall loop structure for superior dusting and polishing
FDSDELOLW\ 0LFUR¿EHU JUDEV WKHQ WUDSV GXVW 0LFUR¿EHU
RQERWKVLGHVIRUOHIWRUULJKWKDQGHGXVH&RPIRUWDEOH
VWD\SXWHODVWLFL]HGFXII8QLYHUVDO¿WRQHVL]H¿WVPRVW
0DFKLQHZDVKDEOH
Our No.
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
984-1933
($
8
($
DUSTER
‡&(,/,1*)$1
&HLOLQJ IDQ GXVWHU ZLWK PLFUR¿EHU
cleaning head reaches around fan
EODGHV IRU HDV\ TXLFN DQG VDIH
GXVWLQJ (DVLO\ DQG HIIHFWLYHO\
cleans all shapes and sizes of ceil
LQJIDQVLQFOXGLQJWKHQHZZLGHUEODGHV0LFUR¿EHUWUDSV
and holds dirt like a magnet and sleeve is removable and
PDFKLQHZDVKDEOH8VHKDQGKHOGRUDWWDFKWRWHOHSROH
IRUKLJKDFFHVVFOHDQLQJ
Our No.
72
$;
No.
Size
In
Shf
Pk
Unit
UNGER INDUSTRIAL
795-7871
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
11 x 8
6
&'
Maintenance, Repair & Operations - 151
DUSTER BRUSH
ELECTROSTATIC
DUSTERS
‡(/(&75267$7,&
‡³727$/5($&+´
For dusting ceilings, moldings and
FRUQHUV LQ RU RXWGRRUV 6RIW ¿EHUV
JHQWO\ FOHDU FREZHEV LQ KDUGWR
UHDFK DUHDV 6SOLWWLSSHG VRIW SRO\
¿EHUV IRU HIIHFWLYH GXVWLQJ ZLWKRXW VFUDWFKLQJ (OHFWUR
static energy attracts and holds dust, dirt and cobwebs.
8VH E\ KDQG RU ZLWK WRWDOUHDFK KLJK DFFHVV WHOHSROH
V\VWHP'LPHQVLRQV´/[´:[´+
Our No.
Shf
Pk
No.
984-8201
8VH DQ\ZKHUH \RX QRUPDOO\ GXVW
as well as on windowsills, blinds,
cabinets, leather, computer key
ERDUGV DQG PXFK PRUH 'XVW VSRQJHV KDYH VRIW ÀXII\
¿EHUVWKDWFDQFKDQJHVKDSHWR¿WZKHUHYHULWPXVWJR
$ÀH[LEOHSODVWLFKDQGOHDOORZVH[WUDUHDFKLQERWKVPDOO
SODFHV DQG ODUJH DUHDV $FFHSWV UH¿OO 1R 6.8
%R[RI
Our No.
6
For counters. Polystyrene solvent
resistant bristles.
‡)/(;,%/(6321*(6
‡³6:,))(5´
Unit
UNGER INDUSTRIAL
UTILITY DUSTERS
Shf
Pk
No.
949-5516
No.
Shf
Pk
Unit
24
($
BIRDWELL CLEANING
607-8364
Unit
PROCTER & GAMBLE
($
Our No.
($
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
DUSTPANS
UTILITY DUSTERS
DUSTER BRUSH
‡0,&52),%(5
‡³727$/5($&+´
MINI BLIND DUSTERS
‡:,7+'8673$1
‡0,&52),%(5
Grabs and holds dust like a mag
QHW 1R QHHG IRU FKHPLFDOV DQG
has a durable, washable sleeve.
For all surfaces.
$WWUDFWV GLUW DQG GXVW OLNH D PDJ
QHW:DVKDEOHDQGUHXVDEOHVOHHYH
Carded.
$VVRUWHG FRORUV 'R 1RW 6SHFLI\
Color.
Our No.
No.
Shf
Pk
Unit
16
($
UNGER INDUSTRIAL
353-1969
746-1577
Unit
16
($
Shf
Pk
Unit
6
Our No.
Our No.
Shf
Pk
No.
Unit
522-3169
24
Our No.
No.
Size
In
Shf
Pk
Unit
41767
10
6
Unit
60
($
8
12
($
6QDSRQGXVWSDQKROGVODUJHGH
EULV $OO SODVWLF FRQVWUXFWLRQ ZRQ¶W
rust or crack, convenient hang up
feature for easy storage.
Our No.
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
754-4018X
6
($
DQB INDUSTRIES
Unit
957-8865
08800
PROCTER & GAMBLE
471-5025
Shf
Pk
‡61$321
6RIW¿OORISXUHEODFNKRUVHKDLUUH
PRYHV WKH ¿QHVW GXVW WR OLJKW GLUW
IURP VPRRWK VXUIDFHV )LOO VWDSOH
VHW LQ KDUGZRRG ODFTXHUHG EORFN
KDQGOHZLWKKDQJKROH8VHIRUVKRSKRPHRURI¿FHV
´WULP
Shf
Pk
No.
($
‡+256(+$,5
6RIWÀXII\GXVWHUFORWKUH¿OOZLWK¿
bers that grab dirt and lock it away.
8VHZLWKGXVWHUNLW1RVNX
RU1RVNX
Count
($
BIRDWELL CLEANING
664-1070
BIRDWELL CLEANING
COUNTER DUSTER
BRUSHES
‡/21*5($&+5(),//
‡³6:,)7(5´
No.
12
DUSTPANS
($
ELECTROSTATIC
DUSTERS
Our No.
$QJOHG VQDSV WR EURRP KDQGOH
$VVRUWHG FRORUV 'R 1RW 6SHFLI\
Color.
)RUFRXQWHUVDQGZRUNVKRSV:KLWH
tampico bristles and poly foam
EORFN/EV´+[´:
[´/
PROCTER & GAMBLE
44750
Unit
‡61$321
‡³%5220%8''<´
COUNTER DUSTER
BRUSHES
6ZLIIHU GXVWHUV FRPELQHG ZLWK ¶
extendable handle to allow clean
LQJRIKDUGWRUHDFKDUHDV3LYRWLQJ
duster head adjusts and locks into 4 different positions
for cleaning angled surfaces like ceiling fans, cabinet
FRUQHUV DQG EDVHERDUGV $FFHSWV UH¿OO 1R 6.8
,QFOXGHVGXVWHUVDQGH[WHQVLRQKDQGOH
531-8241
Shf
Pk
BIRDWELL CLEANING
664-0916
No.
DUSTPANS
‡/21*5($&+
‡³6:,))(5´
No.
No.
UNGER INDUSTRIAL
ELECTROSTATIC
DUSTERS
Our No.
Our No.
Our No.
Shf
Pk
DUSTPANS
‡+286(+2/'
($
5LGJHVRQWKHVLGHVRIGXVWSDQIRU
FOHDQLQJ EURRP RU GXVWHU 5XEEHU
OLS FDWFKHV GLUW DQG GXVW WKH ¿UVW
time in one sweep. Conveniently
snaps onto broomhandle for stor
age. 100 percent recycled materials.
UTILITY DUSTERS
)RU FRXQWHUV +RUVH KDLU DQG SRO\
PL[VROYHQWUHVLVWDQWEULVWOHV
Our No.
Our No.
No.
Shf
Pk
Unit
24
($
HOMEBASIX
Size
In
Shf
Pk
Unit
8
24
($
924-0029
BIRDWELL CLEANING
616-2606
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7
152 - Maintenance, Repair & Operations
DUSTPANS
DUSTPANS
DUSTPANS
‡61$321
‡+($9<'87<
‡/21*+$1'/(
5XEEHUHGJHDOORZVHDV\FROOHFWLRQ
RI GLUW DQG GHEULV /DUJH PRXWK
RSHQLQJ IRU TXLFN DQG HDV\ FOHDQ
XS 'XVWSDQ VQDSV RQ WR EURRP
handle for easy storage.
+HDY\GXW\ LQMHFWLRQPROGHG SODV
WLF FRQVWUXFWLRQ LQ H[WUDODUJH VL]H
to accommodate large jobs for
TXLFNFOHDQXS
%ODFN HQDPHOHG KHDY\ JDXJH
VWHHO SDQ ZLWK ´ KDUGZRRG
handle for industrial and janitorial
ZRUN´[´
Our No.
Shf
Pk
No.
Unit
2033
6
DUSTPANS
Unit
Shf
Pk
Our No.
6
629-1280
12
Shf
Pk
Unit
601B
10
($
($
‡/21*+$1'/(+22'('
´ZRRGKDQGOHDOOVWHHOUXEEHU
edged pan. Baked enamel sandal
ZRRG¿QLVK´[´
Shf
Pk
(QDPHO
Finish
No.
Our No.
Unit
FULTON CORP
($
No.
DUSTPANS
Unit
WORLDWIDE INTEGRATED RE
Charcoal
‡+($9<'87<
‡+($9<*$8*(67((/
/REE\ GXVWSDQ ZLWK ZKHHOV LQFK KDQGOH ÀLSORFN PHFKDQLVP
secures dustpan while in use.
No.
&+$5
Our No.
FULTON CORP
DUSTPANS
‡/2%%</21*+$1'/(
028-1204
Shf
Pk
&RORU
12-1/4” x 8-1/4”
($
675-5409
Our No.
No.
NEWELL RUBBERMAID COMMERCIAL
MINTCRAFT PRO
848-9155X
Our No.
No.
Shf
Pk
Unit
10
($
FULTON CORP
629-1264
63.
7-1/2” x 12-3/4”
629-1256
%3.
Black
20
($
DUSTPANS
DUSTPANS
+RRGHG SDQ FROOHFWV GLUW HOLPL
QDWLQJ RYHUVSLOO DQG IXOO ³VSOLWWLS´
brush picks up every speck of dirt.
The soft lip is perfect for picking up
WKH ¿QHVW GLUW SDUWLFOHV 'HVLJQHG
ZLWK DQ H[FOXVLYH SDWHQWHG ³QR
VOLS´FRPIRUWJULSDQGFRQYHQLHQWKDQJXSIHDWXUH6QDSV
together for easy storage.
Our No.
Shf
Pk
No.
Unit
QUICKIE MANUFACTURING
465-7268X
410
‡/2%%</21*+$1'/(
DUSTPANS
)RU KRXVHKROG RU RI¿FH XVH 5XE
EHU IURQW IRU GHWDLO VZHHSLQJ ,Q
FOXGHV ORQJKDQGOHG GXVWSDQ DQG
VPDOODQJOHEURRP´/[´:
[´+%OXH
‡0(7$/+($9<'87<
Our No.
Our No.
Unit
245-8099
6
($
($
DUSTPANS
12
DUSTPANS
Unit
QUICKIE MANUFACTURING
441
Our No.
6
($
Shf
Pk
No.
Unit
BIRDWELL CLEANING
395-2579
12
Our No.
($
DUSTPANS
‡+($9<'87<
‡³528*+1(&.´
DUSTPANS
+HDY\ GXW\ SODVWLF FRQVWUXFWLRQ
)RU TXLFN FOHDQXSV +ROGV DPSOH
amounts of dirt and debris.
Size
In
‡/2%%<
Shf
Pk Unit
NEWELL RUBBERMAID COMMERCIAL
7,.6
%%/$
[[
6
($
'XUDEOHUHDUZKHHOVLPSURYHZHDU
resistance. For use in malls, res
WDXUDQWVDQGOREELHV:LOOQRWVWDLQ
GLVFRORU RU DEVRUE RGRUV ´ [
´[´
Our No.
No.
&RORU
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
675-5417X
%/$
Charcoal
6
No.
Shf
Pk
Unit
10
($
QUICKIE MANUFACTURING
505-0166
´[´´+DQGOH
616-2739
($
0LQLPL]HV EDFN VWUDLQ 6QDS ORFNV
for easy use and release. Perfect
IRU ODUJH FOHDQXSV DW WKH MREVLWH
KRPHJDUGHQRUZDUHKRXVH5HLQ
forced steel handle with ergonomically angled grip. Pan
VZLYHOV GHJUHHV WR KROG GHEULV LQ SODFH ZKLOH WUDQV
porting.
‡$/80,180,1'8675,$/
Shf
Pk
No.
No.
4
‡-80%2'(%5,6
‡:,7++$1'/(
([WUD ZLGH ´ EHYHOHG RSHQLQJ
6QDSVRQWRVWDQGDUGEURRPKDQGOH
± DOVR IHDWXUHV KROH LQ KDQGOH IRU
KDQJXS3ODVWLF
Our No.
G14804
*DXJH%ODFN
DUSTPANS
216-7005X
Unit
BIRDWELL CLEANING
607-8398
Our No.
Shf
Pk
NEWELL RUBBERMAID HOME
Shf
Pk
No.
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 153
Brooms, Mops & Trash Bags
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
‡62)7&/($1
‡³05&/($10$*,&
(5$6(5´
Shf
Pk
Unit
12
($
PROCTER & GAMBLE
804-2681X
43515
5HPRYHVOLJKWVFXIIPDUNVDQGGLUW
while producing a smooth, shining
¿QLVK5HG
‡:,7+7:23$'6
‡³'22'/(%8*´
$FWV OLNH DQ HUDVHU SHQHWUDWHV
VXUIDFH JURRYHV WR FOHDQ JURXQG
in dirt, grime, soap scum, tough
VFXIIPDUNVDQGFUD\RQPDUNV8VHIRUFOHDQLQJNLWFKHQ
EDWKURRP ÀRRUV ZDOOV DSSOLDQFHV VLQNV FDU ZKHHOV
FDU LQWHULRU IXUQLWXUH DQG PRUH 1R JORYHV EXFNHWV RU
FKHPLFDOVUHTXLUHGRQO\ZDWHU6SRQJHGLVVROYHVDOLWWOH
with each use.
No.
‡&200(5&,$//,*+7
%8)),1*
CLEANSING PAD
HOLDER
SCRUBBING PADS
Our No.
FLOOR MACHINE PADS
CLEANSING PADS
CLEANSING PADS
2UDQJH SODVWLF KROGHU ZLWK VSHFLDO
JULSSHUVWKDWKROG´[´0
'RRGOHEXJ FOHDQLQJ SDGV +ROGHU
swivels in all directions. The threaded socket attaches to
DQ\ VWDQGDUG WKUHDGHG 86 EURRP KDQGOH .LW LQFOXGHV
RQH 0 'RRGOHEXJ ZKLWH FOHDQLQJ SDG DQG RQH
0'RRGOHEXJ%URZQ6FUXEµQ6WULS3DG
Our No.
No.
Shf
Pk
6472
1
651-1869
($
3$'7./5
13
5
($
786-2220X
3$'7./5
17
5
($
456-0025X
3$'7./5
20
5
($
FLOOR MACHINE PADS
)RUWKHUPDOEXI¿QJDQGEXUQLVKLQJ
1DWXUDO RLOV FRPELQHG ZLWK EXU
nishing action produce a wet look
VKLQH1DWXUDO)LEHU
‡&200(5&,$/&/($1(5
)HDWXUHVWZRVLGHVZKLWHVLGHXVHV
water to penetrate surface grooves
WREUHDNXSWRXJKGLUWDQGJULPH
blue side is a soft absorbent layer that wipes up everyday
messes all over the house. The blue side also helps hold
on to the eraser as the white side disappears. Cleans
VFXIIPDUNVFUD\RQPDUNVDQGGLUWIURPZDOOVÀRRUVDQG
GRRUV%UHDNVXSWRXJKEDWKURRPVRDSVFXP5HPRYHV
VHWLQGLUWRQUHIULJHUDWRUVDQGRWKHUDSSOLDQFHV&OHDQV
JURXQGLQGLUWRQSDWLRIXUQLWXUH&RQWDLQVGLVSRVDEOH
´[´[´FOHDQLQJSDGV
Our No.
'HVLJQHG IRU ZHW VFUXEELQJ RU
KHDY\ GXW\ VSUD\ FOHDQLQJ 5H
moves heavy dirt and scuff marks.
Blue.
Our No.
Size
In
No.
104-5939X
Shf
Pk
Unit
LUNDMARK WAX CO.
3$'7./%/
13
5
($
183-2062X
3$'7./%/
17
5
($
641-9303X
3$'7./%/
20
5
($
837-7970X
7,.6
Pack of 2
12
($
Size
In
No.
Shf
Pk
Unit
LUNDMARK WAX CO.
Unit
PROCTER & GAMBLE
01277
269-9841X
FLOOR MACHINE PADS
‡,10$*,&(5$6(5
'82
‡³05&/($1´
629-6511
Unit
LUNDMARK WAX CO.
‡&200(5&,$/+,*+63(('
SCRUBBING PADS
Shf
Pk
Shf
Pk
3M
COMMERCIAL FLOOR
No.
Size
In
No.
Unit
)ORRU&DUH)ORRU3URWHFWLRQ
Our No.
Our No.
3$'7./1
20
5
($
FLOOR MACHINE PADS
‡&200(5&,$/
‡8/75$+,*+63(('
)RUWKHUPDOEXI¿QJDQGEXUQLVKLQJ
8VHGU\RUZLWKVSUD\EXIIVROXWLRQ
:LOO QRW EUHDN XQGHU SUHVVXUH RI
ultra high speed burnishing while
SURGXFLQJDZHWORRN¿QLVK%HLJH
Size
In
Shf
Pk
FLOOR MACHINE PADS
Our No.
‡&200(5&,$/675,33,1*
LUNDMARK WAX CO.
'HVLJQHGIRUKHDY\GXW\ZHWVWULS
SLQJ 5HPRYHV ZD[ GLUW DQG ¿Q
ish. Black.
851-4721X
3$'7./%(
17
5
($
813-1864X
3$'7./%(
20
5
($
No.
Unit
SCRUBBING PADS
‡(;75$32:(5
‡³05&/($10$*,&
(5$6(5´
Our No.
No.
Shf
Pk
Unit
16
($
PROCTER & GAMBLE
378-1150X
‡³'22'/(%8*´
1R GHVLJQHG IRU GHOLFDWH
VXUIDFH 1R GHVLJQHG IRU
PHGLXPGXW\ FOHDQLQJ DQG VFUXE
ELQJ1RGHVLJQHGIRUWRXJK
MREV OLNH UHPRYLQJ ¿QLVK DQG ZD[
EXLOGXSIURPEDVHERDUGVDQGÀRRUHGJHV)LWV1R
ÀRRUSDGFOHDQHUKROGHU
No.
Shf
Pk
Unit
FLOOR MACHINE PADS
‡1$785$/%/(1'%8)),1*
‡&200(5&,$/
‡³7$1´
&RORU
Shf
Pk
525-6334X
3$'7./%
13
5
($
579-2866X
3$'7./%
17
5
($
390-3556X
3$'7./%
20
5
($
FLOOR MACHINE PADS
FLOOR PAD CLEANERS
Our No.
Size
In
LUNDMARK WAX CO.
Cuts through tougher soils, on
WRXJK VRDS VFXP ÀRRU WLOH JURXW
DQG EDNHGRQ JUHDVH &RQWRXUHG
shape.
Our No.
No.
1DWXUDO KDLU DQG V\QWKHWLF ¿EHU
SDG)RUXVHZLWKXOWUDKLJKVSHHG
PDFKLQHV WR 530 RQ
KDUGHU ¿QLVKHV RU LQ KLJK WUDI¿F DUHDV )RU EHVW PDUN
removal.
‡&200(5&,$/32/,6+,1*
‡(;75$),1(
Our No.
)RU SROLVKLQJFOHDQ GU\ ÀRRUV 8VH
GU\RUZLWKD¿QHZDWHUPLVWWRSUR
GXFHDKLJKJORVVZHWORRN:KLWH
650-7370X
Our No.
No.
Size
In
Shf
Pk
Unit
3$'7./:
13
5
($
108-6594X
3$'7./:
17
5
($
967-9887X
3$'7./:
20
5
($
7,.6
Unit
3M
4-5/8” x 10” - Boxed
651-0887X
8541
Brown
5
Size
In
20
Shf
Pk
Unit
3M
LUNDMARK WAX CO.
226-8365X
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
,.
5
($
154 - Maintenance, Repair & Operations
FLOOR MACHINE PADS
FLOOR SIGNS
HOUSEHOLD BROOMS
‡&200(5&,$/683(5
32/,6+,1*
‡³:+,7(´
‡08/7,/,1*8$/&$87,21
‡32/<$1*/('
‡:,7+'8673$1
‡³'8670$7(´
)RU ZHW RU GU\ 0DLQWDLQV KLJK
JORVV VKLQH 8VH WR EXII YHU\ VRIW
¿QLVKHV DQG ORZHU WUDI¿F DUHDV RU
XVHIRUSROLVKLQJVRIWZD[HVRQZRRGÀRRUV)RUXVHRQ
VWDQGDUG PDFKLQHV IRU EXI¿QJ DQG DXWRPDWLF ÀRRU PD
FKLQHVIRUZHWFOHDQLQJWR530
Our No.
No.
Size
In
Shf
Pk
Unit
3M
671-3226X
K
08484
20
5
No.
12
($
NEWELL RUBBERMAID COMMERCIAL
6<(/
,6
PAPER PICKER/PICKUP TOOL
Unit
1
,GHDO IRU SLFNLQJ XS SDSHU GHEULV
DQG FDQV 0DGH RI OLJKWZHLJKW
VWHHO 5HSODFHPHQW SLQ SOXJV
DUHDYDLODEOH
Our No.
($
No.
PPPP0
Lgth
In
Shf
Pk
Unit
42
10
($
114
Shf
Pk
Unit
Our No.
2
No.
FLOOR SIGNS
3,13
10
($
HOUSEHOLD BROOMS
Shf
Pk
No.
Unit
´[´+DQGOH
515-6203
2032
6
($
Unit
5
($
No.
Shf
Pk
Unit
HOMEBASIX
1
6
($
‡,1'225287'225
1DWXUDO¿EHUSLFNVXSGLUWDQGGXVW
indoors and outdoors, sturdy wire
wound construction with 4 sews,
metal handle with hang up cap.
6SOLW WLS SRO\SURS\OHQH ¿EHU EULV
WOHV+DQGOHLQDVVRUWHGFRORUV'R
1RW 6SHFLI\ &RORU 6QDSRQ DQJOHG
dust pan attached.
Our No.
No.
HOUSEHOLD BROOMS
‡32/<$1*/('
‡:,7+'8673$1
Shf
Pk
Our No.
516-6095
HOUSEHOLD BROOMS
HY-KO PRODUCTS
3)6
7,.6
HOUSEHOLD BROOMS
0DGH RI KHDY\GXW\ FRUUXJDWHG
SODVWLF &RPPHUFLDO VLJQ 0HVVDJH
SULQWHG RQ ERWK VLGHV ³&$87,21
6/,33(5<:+(1:(7´´+
671-8803
Unit
Brooms, Mops & Trash Bags
‡6,'('
No.
Shf
Pk
UNGER INDUSTRIAL
($
997-4619
Our No.
($
/DUJH DQJOH EURRP ZLWK ZLGH
VZHHSLQJ SDWK IRU TXLFN FOHDQ XS
6QDSRQ GXVW SDQ IRU FRQYHQLHQW
storage. Comfort grip handle re
duces user fatigue.
5HSODFHPHQW 3LQ 3OXJ IRU 3HRSOH¶V
3DSHU3LFNHU3LQ
CONTINENTAL COMMERCIAL
T
18
‡/$5*($1*/('
‡:,7+'8673$1
REPLACEMENT PIN
PLUGS
Four separate multilingual message
FHQWHUVEXLOWLQWRDVLQJOHVLJQÀLS
to the appropriate message center.
0HVVDJHVDUHLPSULQWHGLQUHGDQG
black for increased visibility and are
LQ(QJOLVK6SDQLVKDQG)UHQFK´LQKHLJKW<HOORZ
614-7730X
´[´+DQGOH3RO\EDJJHG
607-7705
HOUSEHOLD BROOMS
‡08/7,86(
No.
Unit
MINTCRAFT PRO
FLOOR SIGNS
Our No.
Shf
Pk
No.
BIRDWELL CLEANING
Our No.
UNGER INDUSTRIAL
612-9639
Our No.
+HDY\GXW\DQJOHEURRPZLWKODUJH
´ VZHHSLQJ UDQJH /RQJ ODVWLQJ
SRO\EULVWOHV6WXUG\´[´PHWDO
handle with comfort grip.
‡67((/
‡&200(5&,$/*5$'(
Shf
Pk
6SOLW WLS SRO\SURS\OHQH ¿EHU
EULVWOHV $VVRUWHG FRORUV 'R 1RW
6SHFLI\&RORU6QDSRQDQJOHGGXVW
pan attached.
‡32/<$1*/('
PAPER PICKER PIN
CHICKASAW & LITTLE ROCK BROOM WORKS
628
Unit
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
/LJKWZHLJKW 0HVVDJH SULQWHG
RQ ERWK VLGHV ³&$87,21 :(7
)/225´ DQG ³3,62 02-$'2´ ´
E\´RQWRSRIVLJQDQG´ORQJ
No.
Shf
Pk
($
‡6,'('
‡08/7,/,1*8$/
710-0373
Our No.
905-6052
FLOOR SIGNS
Our No.
3RS8S VDIHW\ FRQH ZLWK 0XOWL
OLQJXDO ³&DXWLRQ´ LPSULQW DQG ZHW
ÀRRU V\PERO &ROODSVLEOH DXWR
matically deployed cone is made
of durable material that withstands
DEXVH :DOOPRXQWHG VWRUDJH WXEH DOORZV IRU HDV\ DQG
FRPSDFWVWRULQJ´+<HOORZ
Shf
Pk
Our No.
No.
Shf
Pk
105
6
Unit
HOMEBASIX
505-4911X
($
Unit
BIRDWELL CLEANING
FLOOR SIGNS
´[´+DQGOH3RO\EDJJHG
680-3118
‡6,'('08/7,/,1*8$/
‡&$87,21
/LJKWZHLJKW DQG YHUVDWLOH LQMHF
WLRQPROGHG0DNHVDKHDY\VWDWH
PHQW DERXW VDIHW\ :DUQLQJ PHV
VDJH SULQWHG LQ (QJOLVK )UHQFK
*HUPDQ DQG 6SDQLVK IRU HIIHFWLYH FRPPXQLFDWLRQ WR
broad audiences. Folding design for convenient storage
RUWUDQVSRUWRQMDQLWRUVFDUW´+[´:[´'
ZKHQFORVHG´+[´:[´'RSHQ<HOORZ
Our No.
No.
Shf
Pk
Unit
4
($
HOUSEHOLD BROOMS
‡0$*1(7,&835,*+7
100 percent recycled material in
EURRPEORFNDQG¿EHUV)RU0DLQ
WHQFH 5LQVH WKH EULVWOHV DIWHU XVH
and for storage hang broom with
head up.
Our No.
<(/
1
Shf
Pk
2020
6
Unit
HOMEBASIX
994-0008X
NEWELL RUBBERMAID COMMERCIAL
675-5177
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
Maintenance, Repair & Operations - 155
HOUSEHOLD BROOMS
HOUSEHOLD BROOMS
TOY BROOMS
‡/2%%<&251
‡6(:1&2516272/
‡³285/($'(5´
‡6(:1&2516272/
3UHPLXP SHUFHQW FRUQ ¿EHU
picks up light dirt and dust, 3 sews
DQG TXDOLW\ ZLUH ZRXQG FRQVWUXF
WLRQ ´ [ ´ ORQJ ODFTXHUHG
wood handle.
Our No.
Shf
Pk
No.
Unit
Shf
Pk
No.
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
MINTCRAFT PRO
103-5948
Our No.
6
/
557-0957
($
00105
6
Our No.
($
´/+DQGOH
HOUSEHOLD BROOMS
$QJOHG WR UHDFK LQWR FRUQHUV DQG
DORQJ EDVHERDUGV 6SOLW WLS ¿EHU
SLFNV XS OLJKW GLUW DQG GXVW 0HWDO
handle with hang up cap, 100 per
cent recycled material in broom
EORFNDQG¿EHUV
Our No.
Our No.
No.
Unit
HOMEBASIX
099-5209
6
6
1
($
WAREHOUSE BROOMS
‡6(:1:,5(
‡&2516272//%
Unit
MINTCRAFT PRO
211-4536
2026
Shf
Pk
No.
12
WAREHOUSE BROOMS
Premium 100 percent corn broom,
TXDOLW\ ZLUH ZRXQG FRQVWUXFWLRQ
ZLWK VWLWFKHG URZV KHDY\GXW\
´PHWDOKDQGOHZLWKFRPIRUWJULS
Shf
Pk
#18
Brooms, Mops & Trash Bags
‡,1'225287'225
‡6(:1
‡$1*/('
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
784-6967
HOUSEHOLD BROOMS
Shf
Pk
No.
&RUQ DQG 6RWRO ¿EHU EULVWOHV rows of stitching with metal band.
&OHDUODFTXHUKDQGOH
($
Our No.
($
No.
Shf
Pk
Unit
BIRDWELL CLEANING
´[´+DQGOH3RO\EDJJHG
HOUSEHOLD BROOMS
HOUSEHOLD BROOMS
607-8406
‡,1'225287'225
‡3(5&(17&251
‡67$,1('/$&48(5('
+$1'/(
No.
Shf
Pk
&RORU
Our No.
Shf
Pk
No.
Unit
MINTCRAFT PRO
583-1334
6
($
Unit
6381
12
5HG
UTILITY BROOMS
($
No.
‡6(:1&251
‡08/7,385326(
URZV RI VWLWFKLQJ +DQGOH LQ DV
VRUWHGFRORUV'R1RW6SHFLI\&RORU
Our No.
Shf
Pk
No.
Unit
BIRDWELL CLEANING
Shf
Pk
´[´+DQGOH
Unit
616-3570
12
($
4
&RUQ DQG 6RWRO ¿EHU EULVWOHV rows of stitching with metal band.
Black handle.
Black and gold striped handle. 100
SHUFHQW ¿UVW TXDOLW\ EURRP FRUQ
YHOYHWFORWKDQGEULJKWZLUH¿QLVK
Our No.
Shf
Pk
No.
Unit
´[´+DQGOH
Unit
607-8505
12
7,.6
00111
6
($
4
($
($
‡6(:1:,5(
‡&2516272/
ZLUH EDQG DQG VHZQ ´
clear handle, broom corn and sotol
¿EHU
CHICKASAW & LITTLE ROCK BROOM WORKS
516-1146
Unit
WAREHOUSE BROOMS
BIRDWELL CLEANING
Shf
Pk
Shf
Pk
´[´+DQGOH3RO\EDJJHG
616-2382
&RUQ DQG 6RWRO ¿EHU EULVWOHV URZVRIVWLWFKLQJ5HGKDQGOH
‡6(:1&251
‡³%/$&.%($87<´
No.
BIRDWELL CLEANING
TOY BROOMS
($
HOUSEHOLD BROOMS
No.
($
‡6(:1:,5(
‡&2516272//%
Our No.
‡6(:1&2516272/
Our No.
4
WAREHOUSE BROOMS
´[´+DQGOH3RO\EDJJHG
Unit
´[´+DQGOH3RO\EDJJHG
607-7747
BIRDWELL CLEANING
664-1054
Shf
Pk
&RUQ DQG 6RWRO ¿EHU EULVWOHV URZVRIVWLWFKLQJ1DWXUDOKDQGOH
HOUSEHOLD BROOMS
No.
&RUQ DQG 6RWRO ¿EHU EULVWOHV rows of stitching with metal band.
Black handle.
BIRDWELL CLEANING
‡6(:1&2516272/
‡/2%%<
Our No.
($
‡6(:1:,5(&251
6272/
‡+($9<'87</%
Our No.
NEWELL RUBBERMAID COMMERCIAL
359-3118
4
WAREHOUSE BROOMS
'HVLJQHG IRU UXJJHG LQGRRURXW
GRRUFOHDQLQJQDWXUDOEURRP
FRUQ¿EHUVIRUORQJOLIHDQGHIIHFWLYHSLFNXS5HPRYH¿QH
GLUWIURPHYHQRUURXJKVXUIDFHV+DQGVHOHFWHGKHDY\
GXW\ODFTXHUHGSLQHKDQGOHV
Our No.
Our No.
No.
Shf
Pk
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
516-1856
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
00123
6
($
156 - Maintenance, Repair & Operations
WAREHOUSE BROOMS
PUSH BROOMS
PUSH BROOMS
‡,1'225287'225
‡6(:1&251
‡&2175$&725
‡+256(+$,5
‡%/(1'('),%(5
For indoor or outdoor use. 3 rows
of stitching and wire band for extra
VWUHQJWK +HDY\GXW\ ´ ODF
TXHUHGKDUGZRRGKDQGOH
´ / WULP EODFN WDPSLFR ¿EHU
+DUGZRRGEORFN
Our No.
Shf
Pk
No.
Unit
MINTCRAFT PRO
514-2849
502
6
Our No.
Size
In
No.
%ODFN KRUVHKDLU DQG WDPSLFR ¿EHU
EULVWOHV ´/ WULP %ODFN SRO\ IRDP
block.
Shf
Pk
Unit
BIRDWELL CLEANING
Our No.
Size
In
No.
Unit
BIRDWELL CLEANING
:LWK%UDFH+DQGOH
($
Shf
Pk
/HVV+DQGOH
842-4889
18
4
($
626-4659
18
12
($
306-4722
24
4
($
618-5029
24
12
($
Shf
Pk
Unit
WAREHOUSE BROOMS
‡-$1,725,1'225
287'225
‡6(:1'(/8;(&251
PUSH BROOMS
PUSH BROOMS
‡08/7,685)$&(&20%2
'HOX[H SUHPLPXP FRUQ
EURRP¿EHUV3LFNVXSGLUWDQGOLJKW
dust indoors and outdoors. Quality
wire wound construction with 5 rows of stitching and
PHWDOKDQGOHZLWKKDQJXSFDSDQGXQLTXHFRPIRUWJULS
‡&2175$&725
‡7$03,&2
´/ WULP SRO\ PL[ WDPSLFR ¿EHU
+DUGZRRGEORFN
Our No.
Shf
Pk
No.
Unit
HOMEBASIX
512-5398
Our No.
Size
In
No.
Center stiff black polystyrene and
ERUGHU SUHÀDJJHG EOXH SRO\VW\
UHQH VROYHQWUHVLVWDQW ¿EHUV ´/
trim. Black poly foam block.
Shf
Pk
Unit
BIRDWELL CLEANING
700
6
($
Our No.
Size
In
No.
BIRDWELL CLEANING
:LWK%UDFH+DQGOH
344-7604
24
/HVV+DQGOH
4
($
611-1801
18
12
($
611-2080
24
12
($
JANITOR BROOMS
‡6(:1&2516272/
PUSH BROOMS
%URRPFRUQDQGVRWRO¿EHUYHOYHW
FORWKDQGEULJKWZLUH¿QLVK´
black handle.
%ODFNKRUVHKDLUEODFNWDPSLFRPL[
¿EHU /DFTXHUHG ZRRGHQ EORFN ´
trim length.
Our No.
Shf
Pk
No.
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
516-1450
00112
Our No.
6
Size
In
No.
PUSH BROOMS
‡60227+685)$&(
´ ODFTXHUHG ZRRG EORFN ZLWK
JUD\ SUHÀDJJHG SRO\VW\UHQH VRO
YHQWUHVLVWDQW¿EHU´/WULP
Shf
Pk
Unit
BIRDWELL CLEANING
($
Our No.
36
Shf
Pk
Unit
BIRDWELL CLEANING
/HVV+DQGOH+DQJLQJ&DUG
470-1645
Size
In
No.
6
($
607-7010
36
6
($
JANITOR BROOMS
‡6(:1&2516272/
PUSH BROOMS
&RUQ DQG 6RWRO ¿EHU EULVWOHV URZV RI VWLWFKLQJ &OHDUODFTXHUHG
wood handle.
Our No.
Shf
Pk
No.
Our No.
´[´+DQGOH3RO\EDJJHG
4
‡60227+685)$&(
*UD\ SUHÀDJJHG KHDG ZLWK VRO
YHQWUHVLVWDQW SRO\VW\UHQH ¿EHU ´
trim length. Black poly foam block.
Unit
BIRDWELL CLEANING
615-9883
PUSH BROOMS
´ODFTXHUHGZRRGEORFNZLWKVWLII
EODFN SRO\VW\UHQH VROYHQWUHVLVWDQW
¿EHU´/WULP
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
($
Our No.
Brooms, Mops & Trash Bags
36
($
No.
18
12
($
611-2262
24
12
($
Size
In
3DOP\UD ¿EHU ´ WULP OHQJWK /DF
TXHUHGZRRGHQEORFN
Shf
Pk
Unit
BIRDWELL CLEANING
336-1490
‡3$/0<5$
´7ULP)ODJJHGSRO\¿EHUV:RRG
en block. For tile and hardware
ÀRRUV$FWVOLNHDGXVWPRS
Our No.
611-2247
PUSH BROOMS
‡62)76:((3
48
Our No.
No.
Size
In
Shf
Pk
Unit
BIRDWELL CLEANING
6
($
/HVV+DQGOH+DQJLQJ&DUG
268-0569
7,.6
Unit
/HVV+DQGOH+DQJLQJ&DUG
6
PUSH BROOMS
HOUSEHOLD BROOMS
Shf
Pk
BIRDWELL CLEANING
/HVV+DQGOH
607-7028
Size
In
No.
36
6
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 157
PUSH BROOMS
PUSH BROOMS
PUSH BROOMS
‡60227+685)$&(
‡&20%2
%ODFN WDPSLFR ¿EHU ´ WULP %ODFN
poly foam block.
Combination bristles center stiff
EODFN DQG ERUGHU SUHÀDJJHG EOXH
SRO\VW\UHQH VROYHQWUHVLVWDQW ¿
EHUV ´/ WULP %ODFN SRO\ IRDP
EORFN´[´/PHWDOKDQGOH
DWWDFKHG 1R 6.8 ZLWK Q\ORQ WKUHDGV
1R6.8ZLWKPHWDOWKUHDGV
‡+$5'32/<
‡08/7,685)$&(
Our No.
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
Our No.
/HVV+DQGOH
626-4709
18
12
($
626-4717
24
12
($
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
6WLII EODFN VROYHQWUHVLVWDQW SRO\V
WUHQH¿EHUEULVWOHV´/WULP%ODFN
SRO\ IRDP EORFN ´ [ ´/
PHWDO KDQGOH DWWDFKHG 1R
6.8 ZLWK Q\ORQ WKUHDGV 1R 6.8
ZLWKPHWDOWKUHDGV
Our No.
18
610-6967
Unit
+DQJLQJ&DUG:LWK1R+DQGOH
4
($
650-6687
:LWK1R+DQGOH
PUSH BROOMS
Shf
Pk
BIRDWELL CLEANING
:LWK1R+DQGOH
484-7109
Size
In
No.
24
18
4
($
+DQJLQJ&DUG:LWK1R+DQGOH
4
($
610-6660
24
4
($
‡+$5'32/<
+DUG SRO\ EODFN VROYHQW UHVLVWDQW
SRO\VW\UHQHEULVWOHV´WULPOHQJWK
Black poly foam block.
Our No.
Size
In
No.
PUSH BROOMS
Shf
Pk
Unit
BIRDWELL CLEANING
/HVV+DQGOH
607-8687
18
12
($
607-8695
24
12
($
PUSH BROOMS
‡528*+685)$&(
3UHÀDJJHG KHDG ZLWK VROYHQW
resistant, gray polystyrene bristles,
´/ WULP %ODFN SRO\ IRDP EORFN
´ [ ´/ PHWDO KDQGOH DW
WDFKHG 1R 6.8 ZLWK Q\ORQ WKUHDGV 1R 6.8
ZLWKPHWDOWKUHDGV
Our No.
No.
Size
In
Shf
Pk
3DOP\UD ¿EHU ´/ WULP %ODFN SRO\
IRDP EORFN ´ [ ´/ PHWDO
handle attached for push broom,
6.8 1R 6.8
ZLWK Q\ORQ WKUHDGV
6.8 1R 6.8 ZLWK PHWDO
threads.
Unit
Our No.
BIRDWELL CLEANING
18
4
626-4667
‡528*+685)$&(
18
4
($
+DQJLQJ&DUG:LWK1R+DQGOH
3DOP\UD¿EHU´WULPOHQJWK%ODFN
poly foam block.
No.
Unit
+DQJLQJ&DUG:LWK1R+DQGOH
($
PUSH BROOMS
Our No.
Shf
Pk
BIRDWELL CLEANING
+DQJLQJ&DUG:LWK1R+DQGOH
223-0845
Size
In
No.
Size
In
611-2999
PUSH BROOMS
Shf
Pk
Unit
*UD\)ODJJHG3RO\SUROHQH3RO\V
WUHQH0L[6ROYHQW5HVLVWDQW)LEHU
´7ULP%ODFN3RO\)RDP%ORFN´
+DQGOH$WWDFKHG
24
4
($
PUSH BROOMS
‡352023$/0<5$
BIRDWELL CLEANING
/HVV+DQGOH
611-2437
18
12
($
611-2353
24
12
($
Our No.
No.
Size
In
Shf
Pk
Unit
BIRDWELL CLEANING
+DQJLQJ&DUG:LWK1R+DQGOH
607-8729
24
4
($
Our No.
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
PUSH BROOMS
:LWK´+DQGOH
%ODFNKRUVHKDLUEODFNWDPSLFRPL[
¿EHU ´ WULP OHQJWK %ODFN SRO\
IRDP EORFN ´ [ ´/ PHWDO
handle attached for push broom
6.8 1R 6.8
ZLWK Q\ORQ WKUHDGV
6.8 1R 6.8 ZLWK PHWDO
threads.
Our No.
No.
Size
In
Shf
Pk
Unit
PUSH BROOMS
%ODFN WDPSLFR EULVWOHV ´/ WULP
%ODFN SRO\ IRDP EORFN ´
[ ´/ PHWDO KDQGOH DWWDFKHG
1R6.8ZLWKQ\ORQ
WKUHDGV 1R 6.8 with metal threads.
Our No.
18
4
($
676-3999
Shf
Pk
Unit
24
4
24
4
($
+DQJLQJ&DUG:LWK1R+DQGOH
+DQJLQJ&DUG:LWK1RKDQGOH
817-9814
Size
In
($
610-6686
18
4
($
‡&2175$&725
‡+($9<'87<&20%2
+DQJLQJ&DUG:LWK1R+DQGOH
+DQJLQJ&DUG:LWK1RKDQGOH
No.
14
PUSH BROOMS
BIRDWELL CLEANING
BIRDWELL CLEANING
051-6815
610-6595
4
($
6ROYHQWUHVLVWDQWJUD\ÀDJJHGSRO\
SURS\OHQH DQG SRO\VW\UHQH ¿EHU
PL[´WULPKDUGZRRGEORFN)XOO\
DVVHPEOHG ZLWK KHDY\GXW\ VWHHO
EUDFHDQGVORWWHGEROWRQ´[´KDQGOHIXOO\UH
versible handle for longer life.
Our No.
No.
Size
In
Shf
Pk
Unit
BIRDWELL CLEANING
:LWK%UDFH+DQGOH
596-7146X
678-1579X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7,+.
18
4
($
24
4
($
158 - Maintenance, Repair & Operations
PUSH BROOMS
PUSH BROOMS
PUSH BROOMS
‡&2175$&725
‡+($9<'87<
‡&20%,1$7,21%5,67/(6
‡&2175$&725:,7+
6&5$3(5
‡1(:&216758&7,21
‡,1'225287'225
&RPELQDWLRQEULVWOHV´/WULPFHQ
ter black polystyrene and border
EOXH ÀDJJHG VROYHQWUHVLVWDQW ¿
EHUV+HDY\GXW\VWHHOEUDFHZLWKKDUGZRRGEORFN)XOO\
DVVHPEOHGZLWKVORWWHGEROWRQ´[´/UHYHUVLEOH
handle for longer life.
6WLIIEODFNSRO\VW\UHQH¿EHUEULVWOHV
for new home construction, cleans
XS WH[WXUH PRUWDU SODVWHU ´
VFUDSHURQEDFNRIZRRGEORFN´[´VORWWHGEROW
RQZRRGKDQGOHZLWKKHDY\GXW\VWHHO
Our No.
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
7,.6
884-2429X
No.
Shf
Pk
Unit
BIRDWELL CLEANING
889-6938X
18
4
($
24
4
($
24
3
‡&2175$&725
‡+($9<'87<
‡32/<67<5(1(%5,67/(6
´/WULPEODFNSRO\VW\UHQHVROYHQW
UHVLVWDQW ¿EHU +HDY\GXW\ VWHHO
brace with hardwood block. Fully
DVVHPEOHG ZLWK VORWWHG EROW RQ ´ [ ´ DWWDFKHG
reversible handle for longer life.
Shf
Pk
Unit
BIRDWELL CLEANING
)RU VZHHSLQJ DOO VXUIDFHV 6TXHH
JHH IRU PRYLQJ KHDY\ OLTXLG RQ
smooth surfaces. Combo black
SRO\VW\UHQH ¿EHU LQVLGH ZLWK EOXH
ÀDJJHGVROYHQWUHVLVWDQW¿EHURXW
VLGH´WULPZRRGEORFN´[´[00VTXHHJHH
Our No.
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
18
4
($
423-6584X
24
4
($
:LWK%UDFH+DQGOH
116-3245
6028
24
3
‡,1'225287'225
835,*+7
‡&2175$&725
‡+($9<'87<
‡3$/0<5$%5,67/(6
´/ WULP SDOP\UD EULVWOHV +HDY\
duty steel brace with hardwood
block. Fully assembled with slotted
EROWRQ´[´/UHYHUVLEOHKDQGOHIRUORQJHUOLIH
Our No.
874-3197
18
4
($
022-9161X
24
4
($
Our No.
‡&2175$&725:,7+
6&5$3(5
‡75$,/(5%$51
‡³7+(5867/(5´
Unit
:LWK%UDFH+DQGOH
24
Unit
48
6
($
3
Shf
Pk
No.
Unit
MINTCRAFT PRO
:LWK´+DQGOH
3018PF
6
($
Shf
Pk
No.
Unit
MINTCRAFT PRO
:LWK´+DQGOH
521-3574
3024
6
($
PUSH BROOMS
‡60227+685)$&(
‡,1'225
‡³7$03,&2%8//'2=(5´
Size
In
No.
Shf
Pk
6RIW WDPSLFR ¿EHUV KHDY\GXW\
UHVLQEORFN´SRZHUFRDWHGVWHHO
WLJKWJULSKDQGOHZLWKKDQJXSIHD
ture. Good for smooth indoor surfaces.
Unit
($
24
4
($
54 inch handle with threaded metal
tip,stiff bristles for sweeping heavy
dirt and debris in wet or dry con
ditions. Great for use on driveway,
sidewalk, garage, and factory.
Size
In
Shf
Pk
Unit
MINTCRAFT PRO
6'
24
576-0699
Our No.
Unit
4
($
6
No.
Shf
Pk
Unit
MINTCRAFT PRO
842-8807
Hangtag
360-0152
Shf
Pk
´ DVVHPEOHG VRIW VZHHS SXVK
EURRP+HDY\GXW\EUDFHDQGFRQ
QHFWRU+DUGZRRGEURRPEORFNDQG
KDQGOH5XEEHUJULS
‡287'225528*+685)$&(
No.
No.
PUSH BROOMS
PUSH BROOMS
Our No.
Our No.
QUICKIE MANUFACTURING
:LWK%UDFH+DQGOH
567-6804
BIRDWELL CLEANING
7,+.
No.
Shf
Pk
BIRDWELL CLEANING
6WLIIEDFNSRO\VW\UHQH¿EHUEULVWOHV
´VFUDSHURQEDFNRIZRRGEORFN
´[´VORWWHGEROWRQKDQGOHZLWKKHDY\GXW\VWHHO
EUDFH 'HVLJQ LV EHVW VXLWHG IRU FOHDQLQJ WUDLOHUV DQG
barns.
546-9465X
Size
In
6WLII SRO\SURS\OHQH )LEHU ´
7ULP ´ [ ´ VORWWHG EROW RQ
handle with a heavy duty steel
EUDFH+DUGZRRGEORFN
PUSH BROOMS
Shf
Pk
Our No.
Our No.
PUSH BROOMS
732-6432X
Size
In
´RXWGRRUSXVKEURRPZLWKVWLII
natural Palmyra bristles for sweep
ing heavy dirt and debris. Great for
use on the driveway, sidewalk and
SDWLRGHFN6WXUG\´KDQGOHZLWK
threaded metal tip.
Unit
:LWK%UDFH+DQGOH
No.
($
´ LQGRRURXWGRRU SXVKEURRP
ZLWK GXDO ¿EHUV VRIW ¿EHUV IRU
sweeping dirt and debris as well
DVVWLII¿EHUVIRUSDWLRVGULYHZD\V
JDUDJHVGHFNVHWF´KDQGOHZLWKWKUHDGHGPHWDOWLS
BIRDWELL CLEANING
BIRDWELL CLEANING
Our No.
6
‡,1'225287'225
‡'8$/),%(56
+DUG SRO\ LQVLGH DQG ÀDJJHG SRO\
RXWVLGH:RRGHQEORFN6RIW¿EHUV
RQWKHRXWVLGHSLFNXSWKH¿QHGXVW
with the hard poly on the indside
picking up the larger particles.
Shf
Pk
18
($
PUSH BROOMS
PUSH BROOMS
Size
In
Hangtag
3018
PUSH BROOMS
No.
Unit
MINTCRAFT PRO
522-8176
:LWK%UDFH+DQGOH
293-2267X
Our No.
Shf
Pk
‡287'2253$/0<5$
‡:,7+648((*((
Size
In
Size
In
PUSH BROOMS
PUSH BROOMS
No.
No.
($
PUSH BROOMS
Our No.
Our No.
216-0422
:LWK%UDFH+DQGOH
:LWK%UDFH+DQGOH
604-2162X
Our No.
Size
In
54 inch handle with threaded met
DO WLS GXDO ¿EHUV VRIW ¿EHUV IRU
sweeping dirt and debris as well as
VWLII¿EHUVIRUSDWLRVGULYHZD\VJD
rages, and decks.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
$-25
4
($
Maintenance, Repair & Operations - PUSH BROOMS
PUSH BROOMS
´ DVVVHPEOHG LQGRRURXWGRRU
SXVKEURRP+HDY\GXW\EUDFHDQG
FRQQHFWRU +DUGZRRG EURRP EORFN
and handle.
´ DVVHPEOHG PHGLXP VWLII SXVK
EURRP ZLWK VFUDSHU +HDY\ GXW\
EUDFH DQG FRQQHFWRU +DUGZRRG
broom block and handle.
STREET BROOMS
5XEEHUJULS
5XEEHUJULS
‡3$/0<5$
3DOP\UD VWDON ¿EHU EULVWOHV ´
WULP +DUGZRRG EORFN ZLWK WD
pered hole.
Our No.
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
Our No.
No.
Shf
Pk
Unit
MINTCRAFT PRO
844-0638
Our No.
Shf
Pk
No.
Unit
MINTCRAFT PRO
4
$-25
859-1638
($
3
$6&25
/HVV+DQGOH
610-7320
16
6
($
($
STREET BROOMS
PUSH BROOMS
PUSH BROOMS
´ DVVHPEOHG PHGLXP VWLII SXVK
EURRP )RU RXWGRRU XVH +HDY\
GXW\ EUDFH DQG FRQQHFWRU +DUG
wood broom block and handle.
5XEEHUJULS
´ DVVHPEOHG LQGRRURXWGRRU
SXVKEURRP+HDY\GXW\VWUXFWXUDO
IRDP EURRP EORFN 6WHHO KDQGOH
ZLWK KDQJ FDS 6WHHO EUDFH DGGV
extra strength.
%OXH SRO\SURS\OHQH ¿EHU ´
7ULP +DUGZRRG EORFN ZLWK WD
SHUHG KROHV ´ [ ´ KDQGOH
:LWKKHDY\GXW\VWHHOEUDFH
Our No.
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
Our No.
No.
Shf
Pk
Unit
MINTCRAFT PRO
845-6741
Our No.
Shf
Pk
No.
Unit
MINTCRAFT PRO
4
$-25
862-9198
($
4
$25
:LWK%UDFH+DQGOH
594-4913
16
3
($
($
STREET BROOMS
PUSH BROOMS
PUSH BROOMS
´ DVVHPEOHG VXSHU VWLII RXWGRRU
SXVKEURRP+HDY\GXW\EUDFHDQG
FRQQHFWRU +DUGZRRG EURRP EORFN
and handle.
´ DVVHPEOHG VWLII SDOP\UD SXVK
EURRP +HDY\ GXW\ KDUGZRRG
EORFNDQGKDQGOH6WHHOEUDFHDGGV
extra strength. For outdoor use.
´ VXSHU VWLII VWUHHW DQG EDUQ
EURRP ´ SRO\ EULVWOH +DUG
ZRRGEORFNDQGKDQGOH6WHHOEUDFH
adds extra strength.
Our No.
5XEEHUJULS
Our No.
Our No.
No.
Shf
Pk
Shf
Pk
No.
Unit
MINTCRAFT PRO
Unit
866-0458
4
$25
$-25
4
867-8625
$25
($
WHISK BROOMS
DUSTPANS
´VPRRWKLQGRRUSXVKEURRP
PUSH BROOMS
‡:,7+%586+
´ DVVHPEOHG LQGRRURXWGRRU
SXVKEURRPZLWKVTXHHJHH+HDY\
GXW\ EUDFH DQG FRQQHFWRU +DUG
wood broom block and handle.
5XEEHUJULS
:KLWH SODVWLF ZLWK EOXH UXEEHU HU
gonomic handle.
Our No.
Shf
Pk
No.
Unit
MINTCRAFT PRO
No.
2
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
($
PUSH BROOMS
Our No.
Unit
MINTCRAFT PRO
($
MINTCRAFT PRO
846-3689
Shf
Pk
No.
Shf
Pk
324-7376
Our No.
6
69
($
Unit
No.
Shf
Pk
Unit
36
($
Shf
Pk
Unit
12
($
HOMEBASIX
727-2073
<%/
MINTCRAFT PRO
850-1637
$6425
3
($
STREET BROOMS
‡32/<3523</(1(
DUSTPANS
Blue
polypropylene
bristles,
´/WULP+DUGZRRGEORFNZLWK
2 tapered holes.
Our No.
No.
Size
In
‡:,7+%586+
:KLWH SODVWLF ZLWK EOXH UXEEHU HU
gonomic handle.
Shf
Pk
Unit
BIRDWELL CLEANING
Our No.
/HVV+DQGOH
618-3941
16
No.
HOMEBASIX
6
($
732-0633
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
<%/
160 - Maintenance, Repair & Operations
Brooms, Mops & Trash Bags
Brooms, Mops & Trash Bags
WHISK BROOMS
WHISK BROOMS
EXTENSION POLES
‡:,7+'8673$1
‡352)(66,21$/
‡³7(/(32/(´
%OXHSRO\SURS\OHQH¿EHUEULVWOHV
Our No.
Shf
Pk
No.
Unit
24
Our No.
($
‡0(7$/1</217+5($'('
For the professional janitorial
supply industry. Constructed of
anodized aluminum, strong yet
OLJKWZHLJKW (UJRQRPLF Q\ORQ FRO
ODU ORFNV DQG ORRVHQV LQ WXUQ 6QDSLQ V\VWHP FRQH
adapter with acme thread is included.
BIRDWELL CLEANING
694-4292
PUSH BROOM HANDLES
HANDLES
No.
Size
Ft
Shf
Pk
Unit
10
($
UNGER INDUSTRIAL
WHISK BROOMS
'3
8
No.
Lgth. x
Dia. In.
Shf
Pk
Unit
[
12
($
Lgth. x
Dia. In.
Shf
Pk
Unit
BIRDWELL CLEANING
607-8711
PUSH BROOM HANDLES
ALUMINUM
702-7121
Our No.
‡32/<
‡:22'(10(7$/
7+5($'('
0HWDOWLSSHG KDQGOHV KHOS UHGXFH
breakage and thread stripping.
EXTENSION POLES
Our No.
‡$/80,1807(/(6&23,&
‡³7(/(32/(727$/
5($&+´
Shf
Pk
No.
Unit
BIRDWELL CLEANING
607-7754
,.6
36
($
Our No.
BIRDWELL CLEANING
For dusting, bulb changing, and
RWKHU JHQHUDOSXUSRVH WDVNV 1RW
UHFRPPHQGHG IRU KHDY\GXW\ XVH
such as cleaning trucks, siding, or decks.
Our No.
No.
Adjust
Lgth Ft
Shf
Pk
Unit
2 to 4
10
($
UNGER INDUSTRIAL
WHISK BROOMS
006-0855
‡6(:1&2516272/
No.
610-9128
[
12
($
650-2785
[
12
($
610-9169
[
12
($
PUSH BROOM HANDLES
+HDY\ GXW\ KDUGZRRG KDQGOH
0HWDOWKUHDGHGKDQGOHWLS5XEEHU
grip.
VHZQ6RWRO¿EHUDQGFRUQEULVWOHV
EXTENSION POLES
Our No.
Size
In
No.
Shf
Pk
‡48,&.&211(&7
$/80,180
Unit
BIRDWELL CLEANING
634-6233
10
24
($
/LJKWZHLJKW DOXPLQXP FRQVWUXF
WLRQ4XLFN&RQQHFWVWUDLJKWH[WHQ
VLRQ KDQGOH 2QHVWHS FRQQHFWLQJ
mechanism speeds mop assembly
DQG FKDQJHRYHU 8VHUIULHQGO\ JULS PDNHV KDQGOH PRUH
comfortable to use.
Size
In
WHISK BROOMS
Our No.
‡6(:13$/0<5$
‡³3$5527:+,6.´
NEWELL RUBBERMAID COMMERCIAL
Cleans upholstery, carpet and in
WHULRUV 'RXEOH VWLWFK WULPPHG
&RUQ ´/ [ ´: 0HWDO
cap with hanging ring.
089-3669
Our No.
No.
Lgth
In
Shf
Pk
Unit
Shf
Pk
Unit
12
($
7,+6
4</
6
Size
In
Shf
Pk
Unit
[
12
($
[
12
($
[
12
($
60 x 1
12
($
[
12
($
12
($
626-4725
607-8414
618-5193
No.
/DFTXHUHG+DQGOH
Shf
Pk
Unit
3ODLQ+DQGOH
[
12
($
689-4356
BIRDWELL CLEANING
611-0290
Unit
682-8990
8VH ZLWK 1R 6.8 6.8 6.8
DQG 6.8
YHKLFOHZDVKEUXVKHV
No.
Shf
Pk
0HWDOWLSSHG KDQGOHV KHOS UHGXFH
breakage and thread stripping.
+DQJXSIHDWXUHIRUHDV\VWRUDJH
611-0233
($
Lgth. x
Dia. In.
BIRDWELL CLEANING
No.
12
BROOM & MOP
HANDLES
‡0(7$/)/2:7+58+26(
Our No.
*25
‡0(7$/0(7$/7+5($'('
Our No.
Unit
($
BIRDWELL CLEANING
VEHICLE WASH BRUSH
HANDLES
875-2578
Our No.
Lgth. x
Dia. In.
Shf
Pk
MINTCRAFT PRO
PUSH BROOM HANDLES
:D[HV3ROLVKHV$XWR$FFHVVRULHV
HANDLES
No.
‡:22'7+5($'('
<HOORZ
CHICKASAW & LITTLE ROCK BROOM WORKS
845-1254
No.
Our No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
[
Maintenance, Repair & Operations - 161
&KHPLFDOV&OHDQHUV&OHDQLQJ
,PSOHPHQWV
BROOM & MOP
HANDLES
ELECTROSTATIC SWEEPERS/ACCESS
‡:22'7$3(5('
SCRUBBING SPONGES
Our No.
Lgth. x
Dia. In.
No.
Shf
Pk
Unit
BIRDWELL CLEANING
/DFTXHUHG+DQGOH
610-8658
[
12
($
629-6271
[
12
($
0XOWL SXUSRVH VFUXEEHU VSRQJH
6XSHU DEVRUEHQW VSRQJH SURKLELWV
the growth of odor causing bac
WHULD DQG PROG 'XUDEOH DQG ORQJ
lasting, and will remain odor free
IRUWKHOLIHRIWKHVSRQJH'HVLJQHG
to be safe on most household surfaces. 2 pk.
Our No.
No.
Shf
Pk
Unit
12
($
QUICKIE MANUFACTURING
3ODLQ+DQGOH
681-9452
ELECTROSTATIC
SWEEPER KITS
‡67$57(5:(7-(7
‡)8//<$66(0%/('
‡³6:,))(5´
:LWK D GXDOQR]]OH VSUD\HU DQG
D VWURQJJULS SROH WKLV DOOLQRQH
cleaning system is designed to break up and dissolve
WRXJKPHVVHV,WVXQLTXHO\GHVLJQHGVROXWLRQSHQHWUDWHV
layers of dirt and grime and traps and locks it deep into
WKH :HW-HW SDG ,WV VFUXEE\ VWULS EUHDNV DSDUW WRXJK
GULHGRQVSRWVDQGPHVVHV*UHDWIRUZDOOWRZDOOZKROH
ÀRRUFOHDQLQJKLJKWUDI¿FDUHDVWRXJKVWDLQVRQ¿QLVKHG
KDUGZRRG FHUDPLF DQG WLOH VXUIDFHV ,QFOXGHV SRZHU
mop with screening strip, 2 cleaning pads and 1 bottle
PXOWLSXUSRVHFOHDQLQJVROXWLRQ+DQJ7DJ
676-7958
[
12
($
610-8195
[
12
($
Our No.
617-1003
[
12
($
PROCTER & GAMBLE
BROOM & MOP
HANDLES
‡:22'7+5($'('
&211(&725
+HDY\GXW\ZRRGKDQGOHZLWKVWDQ
dard threaded connector.
Our No.
No.
Lgth. x Dia.
Unit
12
($
QUICKIE MANUFACTURING
132-8608
[
SCRUBBING SPONGES
190-2154X
+HDY\ GXW\ VFUXEEHU VSRQJH 6X
per absorbent sponge prohibits the
growth of odor causing bacteria
DQG PROG 'XUDEOH DQG ORQJ ODVW
ing, and will remain odor free for
WKHOLIHRIWKHVSRQJH'HVLJQHGWR
tackle the toughest messes. 2 pk.
ELECTROSTATIC
SWEEPER KITS
Our No.
Shf
Pk
No.
Shf
Pk
Unit
12
($
QUICKIE MANUFACTURING
681-9460
Brooms, Mops & Trash Bags
ELECTROSTATIC
SWEEPERS
0HWDO KDQGOH ZLWK WKUHDGHG GXUD
tip. Can be used with push brooms,
paint rollers, or other devices re
TXLULQJ D VWDQGDUG WKUHDGHG KDQ
dle.
Our No.
‡5(),//6
‡³6:,))(5´
No.
Lgth. x
Dia. In.
Shf
Pk
Unit
54 x 1
12
($
HOMEBASIX
036-8258X
8QVFHQWHGGHJUHHGXVWHUVWUDS
and lock up to two times more dust
YHUVXVIHDWKHUGXVWHUV6ZLIIHU
GXVWHUV KDYH WKLFN ÀXII\ GXVWORFNLQJ ¿EHUV WKDW JR DOO
around the duster. Contains six disposable dusters.
Our No.
No.
Shf
Pk
4
Unit
($
‡67$57(5/,*+7:(,*+7
‡³6:,))(5´
ELECTROSTATIC SWEEPERS/ACCESS
MOP HANDLES
No.
Shf
Pk
Unit
(DV\WRXVH ZLWK ÀH[LEOH VZLYHO
KHDGIRUKDUGWRUHDFKDUHDV'LV
posable cloth folds over head and
LVSXVKHGLQWRJULSSRFNHWVIRUTXLFNDQGHDV\FOHDQLQJ
or can be used for hand dusting places the sweeper can
QRWJR&ORWK¿EHUVFUHDWHDQHOHFWURVWDWLFFKDUJHZKHQ
wiped across surfaces to attract dust, dirt, hair, and other
SDUWLFOHV ZKLOH FORWK /LIW /RFN 3RFNHWV WUDS DQG KROG
GLUWLQSODFH&OHDQVZRRGFHUDPLFWLOHYLQ\OÀRRUVZDOOV
FHLOLQJ HOHFWURQLFV FDU LQWHULRUV DQG SODQWV :HW FORWKV
are presoaked with an advanced cleaning solution that
FDQ EH DWWDFKHG WR GLVVROYH VWDLQV ,QFOXGHV VZHHSHU
XQLWDQGZHWDQGGU\UH¿OOFORWKV8VH1R6.8
FRXQWGU\UH¿OOV5HJXODU6FHQW1R
6.8 FRXQW GU\ UH¿OOV &LWUXV 6FHQW DQG
1R 6.8 FRXQW ZHW UH¿OOV 2SHQ
:LQGRZ)UHVK
Our No.
No.
Shf
Pk
Unit
PROCTER & GAMBLE
624-8140
($
PROCTER & GAMBLE
098-8808X
Brooms, Mops & Trash Bags
6
($
HANDLE BRACES
BROOM & MOP HANDLE
BRACES
ELECTROSTATIC
SWEEPERS
+HDY\GXW\SXVKEURRPEUDFH,Q
cludes screws and wing nuts.
‡³+20(352´
Our No.
No.
Shf
Pk
Unit
12
($
BIRDWELL CLEANING
611-0316
‡:(7-(7
‡)8//<$66(0%/('
‡³6:,))(5´
Treated with microban antimicro
bial product protection built into
WKHVFUXESDG)LJKWVRGRUFDXVLQJ
EDFWHULD PROG DQG PLOGHZ 2QH
tool cleans the entire bathroom. Flexible head, aggres
sive scrub pad willnot scratch surfaces, accepts wet or
GU\ ZLSHV &OHDQV ÀRRUV DQG ZDOOV +DQGOH H[WHQGV WR
´DQGFROODSHVWR´)LWVXQGHUYDQLW\IRUFRQYHQLHQW
VWRUDJH)LWVTXLFNLHPRGHODQG0%
Our No.
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
876-0191
0%&$1
ELECTROSTATIC
SWEEPER KITS
2 in 1 starter for sweeping and
PRSSLQJ ,QFOXGHV GU\ VZHHSLQJ
DQGZHWPRSSLQJUH¿OOV:LWKDGU\FORWKSLFNXS
more dirt, dust, and hair than a broom. Then use a wet
mopping cloth to dissolve dirt and grime. Great for wood,
WLOHRUYLQ\OÀRRUVLQVLGHFORVHWVXQGHUEHGVWDEOHVDQG
FDELQHWV &OHDQLQJ ZDOO EHIRUH SDLQWLQJ 2Q EDVHERDUGV
and shelving, pet areas and the top of the refrigerator.
+DQJ7DJ
Our No.
Shf
Pk
Unit
10
($
PROCTER & GAMBLE
396-5944X
4
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
162 - Maintenance, Repair & Operations
ELECTROSTATIC
SWEEPER KITS
ELECTROSTATIC
SWEEPER/VAC KIT
‡67$57(5
‡³6:,))(5´
‡67$57(5
‡³6:((3(5´
8QVFHQWHGGHJUHHGXVWHUVWUDS
and lock up to two times more dust
YHUVXVIHDWKHUGXVWHUV6ZLIIHU
GXVWHUV KDYH WKLFN ÀXII\ GXVWORFNLQJ ¿EHUV WKDW JR DOO
around the duster. Kit contains one handle and three un
VFHQWHGGLVSRVDEOHGXVWHUV5H¿OOV6.8
8VHVGU\FORWKSLFNXSIRU¿QHGH
bries like dirt, dust and pet hair,
and a vacuum to pick up larger
SDUWLFOHV8VHYDFXXPIRUZRRGWLOHRUYLQ\OÀRRUVODUJH
food objects like raisins, cereal and craft supplies such
DVEHDGVQRQFDUSHWHGVWDLUVXQGHUDSSOLDQFHVDQGIXU
QLWXUH8VHGU\FORWKIRUXQGHUEHGVWDEOHVFDELQHWVLQ
side closets, around pet areas, under appliances, getting
dust, hair and crumbs without turning on the vacuum.
/LJKWZHLJKW DQG FRPSDFW &OHDQV DURXQG IXUQLWXUH DQG
DSSOLDQFHV5HPRYDEOHFDQLVWHUWRGLVSRVHGLUWGXVWDQG
ODUJHUSDUWLFOHV,QFOXGHVUHFKDUJHDEOHYDFXXPVZHHSHU
disposable dry sweeping cloths and a battery recharger.
Our No.
No.
Shf
Pk
Unit
PROCTER & GAMBLE
996-3497
($
Our No.
ELECTROSTATIC
SWEEPER KITS
632-6094X
6ZLIIHU GHJUHHFOHDQLQJ GXVW
HUVUHGXFHXSWRRIDOOHUJHQV
'HVLJQHG VSHFL¿FDOO\ WR FOHDQ GLUW LQ JURRYHV DQG FUHY
LFHV 6ZLIIHU 'XVWHUV ([WHQGHU ZLWK GHJUHH GXVWHU
UH¿OOVH[WHQGVXSWRWKUHHIHHWZLWKDQH[WHQGDEOHKDQ
GOHWKDWSLYRWVDQGORFNVLQWRIRXUGLIIHUHQWSRVLWLRQV,W¶V
perfect for cleaning angled surfaces such as ceiling fans,
wood furniture, cabinet corners, baseboards and crown
PROGLQJ,QFOXGHVRQHKDQGOHDQGRQHXQVFHQWHGGXVWHU
+DQJ7DJ
No.
Shf
Pk
Unit
PROCTER & GAMBLE
131-1687X
12
($
56076
($
Our No.
Size
Liter
No.
Shf
Pk
Unit
PROCTER & GAMBLE
Cartridge
158-9274
23682
1
6
($
ELECTROSTATIC
SWEEPER CLEANING
SOLUTION
‡:(7-(708/7,385326(
‡5(),//
‡³6:,))(5´
‡)8//<$66(0%/('
‡³6:,))(5´
Clean messes both big and small
LQ RQH VWHS +DV D SRZHUIXO FRUG
less vacuum for grabbing crumbs,
OHDYHVSHWKDLUDQGFHUHDOSOXVDWH[WXUHG6ZLIIHU'U\
6ZHHSLQJ FORWK IRU WUDSSLQJ DQG ORFNLQJ ¿QH GLUW DQG
GXVW$OOLQRQHWRRO/LJKWZHLJKWDQGFRPSDFWLWZRUNV
JUHDW RQ YLUWXDOO\ DQ\ VXUIDFH LQ \RXU KRPH ,W GRHVQ¶W
UHTXLUHDQ\YDFXXPEDJV'LVSRVHRIGLUWGXVWDQGSDU
ticles for good by emptying the dirt bin and tossing the
GU\FORWK+DQJ7DJ
474-7549X
Shf
Pk
Unit
QUICKIE MANUFACTURING
989-4916
2
Shf
Pk
No.
5HDG\WRXVH FDUWULGJH GHVLJQHG
IRU XVH ZLWK 6ZLIIHU¶V :HW-HW
sweeper, will clean at least 8 large rooms. Cleans to
UHYHDO WKH QDWXUDO EHDXW\ RI \RXU ¿QLVKHG ZRRG ÀRRUV
,QYLWLQJKRPHVFHQW
Quickly dissolves tough, greasy
VWDLQV 'ULHV IDVW ZLWK YLUWXDOO\ QR VWUHDNV RU KD]LQJ
5HDG\WRXVH6DIHO\FOHDQVPRVWÀRRUVLQFOXGLQJZRRG
and laminate, marble, stone, ceramic tiles, vinyl, linoleum
DQG SHW DUHDV 'R QRW XVH RQ XQ¿QLVKHG RLOHG ZD[HG
ZRRGHQERDUGVQRQVHDOHGWLOHVRUFDUSHWHGÀRRUV7KLV
SURGXFWLVWKHOLTXLGUH¿OOIRUDQ\6ZLIIHU:HW-HW
Our No.
Size
Oz
No.
Shf
Pk
Unit
PROCTER & GAMBLE
Open Window Fresh Scent
812-1733
42.2
6
($
Unit
PROCTER & GAMBLE
&OHDQ)OLS 6ZHHSHU ER[ NLW &RQ
WDLQV DQ DQWLPLFURELDO DJHQW EXLOW
LQ WR WKH VSRQJH WKDW ZRQ¶W ZHDU
off over time, to provide continu
ous product protection against the
JURZWKRIRGRUFDXVLQJEDFWHULDPROGDQGPLOGHZ8VHV
WKHZKROHFORWK6DIHIRUYLUWXDOO\DOOKDUGVXUIDFHVLQFOXG
ing vinyl, laminate, wood and ceramic. Flip mechanism
for small spaces and baseboards. Can also be used with
UHJXODUZHWDQGGU\VZHHSHUUH¿OOV&RQWDLQVVZHHSHU
2 wet cloths, 2 dry cloths
No.
04815
‡:(7-(7)25:22'
‡³6:,))(5´
Unit
ELECTROSTATIC
SWEEPER/VAC
Our No.
ELECTROSTATIC
SWEEPER KITS
Our No.
Shf
Pk
No.
PROCTER & GAMBLE
‡'(*5((
‡)8//<$66(0%/('
‡³6:,))(5´
Our No.
ELECTROSTATIC
SWEEPER CLEANING
SOLUTION
6
($
2
($
ELECTROSTATIC
SWEEPER PADS
‡5(),//',6326$%/(
‡³6:,))(5:(7-(7´
REPLACEMENT FILTERS
8VHZLWK6ZLIIHU:HW-HWVZHHSHUV
6XSHUDEVRUEHQW SDGV DEVRUE DQG
WUDSGLUWDQGVROXWLRQWROHDYHÀRRU
clean and virtually dry.
‡³6:,))(5´
5HSODFHPHQW ¿OWHU IRU 6ZLIIHU
6ZHHSHU9DFSDFN
Our No.
No.
Count
Per Pack
Shf
Pk
Unit
8
BX 12
PROCTER & GAMBLE
Our No.
No.
Shf
Pk
Unit
12
($
796-9199
08441
12
PROCTER & GAMBLE
829-4209X
06174
ELECTROSTATIC
SWEEPER CLOTHS
‡',6326$%/(
‡³6:,))(5:(7´
ELECTROSTATIC
SWEEPER CLEANING
SOLUTION
‡:(7-(7$17,%$&7(5,$/
‡³6:,))(5´
Cleaning formula doubles as a
FOHDQHUDQGEDFWHULDNLOOHU6DQLWL]H
ÀRRUV DQG NLOOV RI EDFWHULD ZKLOH SURYLGLQJ JUHDW
RYHUDOOFOHDQLQJ6DIHIRUYLUWXDOO\DOOÀRRUV)UHVK&LWUXV
6FHQW
Our No.
No.
Size
Liter
Shf
Pk
Unit
PROCTER & GAMBLE
Our No.
Cartridge
077-8142
23681
5HPRYHV HYHU\GD\ GLUW DQG percent of common bacteria. Pre
soaked with an advanced cleaning
VROXWLRQWKDWGLVVROYHVVWDLQVRQFRQWDFWDQGGULHVTXLFNO\
ZLWKRXWVWUHDNVRUULQVLQJ6DIHRQDOO¿QLVKHGKDUGVXU
IDFHVVDYHVWLPHLQFOHDQLQJXSVPDOOVSLOOV8VHDVUH¿OOV
IRU 6ZLIIHU ZHW VZHHSHUV RU IRU KDQGGXVWLQJ IXUQLWXUH
NQLFNNQDFNVHOHFWURQLFVSODQWVDQGFDULQWHULRUVZKHUH
sweepers cannot go. Creates an electrostatic charge
when wiped across surfaces to attract dust, dirt, hair.
2SHQZLQGRZIUHVKVFHQW
1
No.
Count
Shf
Pk
Unit
12
12
($
PROCTER & GAMBLE
6
($
492-9253
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
35154
Maintenance, Repair & Operations - 163
ELECTROSTATIC
SWEEPER CLOTHS
‡'5<',6326$%/(
‡³6:,))(50$;´
7ZLFHWKHVL]HRIUHJXODU6ZLIIHUIRU
ODUJHUDUHDV5H¿OOVIRU6ZLIIHU0D[
VZHHSHUV RU XVH IRU KDQGGXVWLQJ
IXUQLWXUH NQLFNNQDFNV HOHFWURQLFV SODQWV DQG FDU LQ
WHULRUV ZKHUH VZHHSHUV FDQQRW JR &ORWK ¿EHUV FUHDWH
an electrostatic charge when wiped across surfaces to
DWWUDFWGXVWGLUWKDLUDQGRWKHUSDUWLFOHVZKLOHFORWK/LIW
/RFN3RFNHWVWUDSDQGKROGGLUWLQSODFH
Our No.
No.
Shf
Pk
Count
Unit
PROCTER & GAMBLE
FLOOR CARE SYSTEM
MOP COVER
‡+$5':22'
‡³6:(',6+)2508/$´
‡³0,&523/86´
7KH %RQD +DUGZRRG 6\VWHP FRQ
tains a durable 4 piece mop handle
ZLWK ´[´ PRS KHDG ZDVKDEOH
PLFUR¿EHUFOHDQLQJSDGDQGGXVW
LQJSDG7KHV\VWHPDOVRLQFOXGHV%RQD¶VSUHPLXPQR
UHVLGXHRXQFHKDUGZRRGÀRRUFOHDQHUZKLFKLVQRQ
WR[LFDQGELRGHJUDGDEOHDQGDRXQFHUH¿OOFRQFHQWUDWH
Our No.
Shf
Pk
No.
Unit
Our No.
Size
In
No.
Shf
Pk
Unit
BONAKEMI USA, INC
BONAKEMI USA, INC
215-7246
)LWV ´ [ ´ %RQD 0LFUR3OXV PRS
head or any other mop of the same
VL]H (OHFWURVWDWLF DFWLRQ DWWUDFWV
and traps dirt and allergens when
XVHG GU\ RU ZLWK %RQD 6ZHGLVK
)RUPXOD KDUGZRRG DQG KDUG VXUIDFH FOHDQHUV (ODVWLF
HGJHV VHFXUH WKH FRYHU WR WKH PRS :DVKDEOH IRU RYHU
300 uses.
6
:0
($
612-0521
8 x 15
:0
8
($
17.8” x 10”
975-4060
16
6
($
‡'5<',6326$%/(
‡³6:,))(5´
5H¿OOVIRU6ZLIIHUVWDQGDUGVZHHS
HUV RU IRU KDQGGXVWLQJ IXUQLWXUH
NQLFNNQDFNV HOHFWURQLFV SODQWV
and car interiors where sweepers cannot go. Creates an
electrostatic charge when wiped across surfaces to at
WUDFWGXVWGLUWKDLUDQGRWKHUSDUWLFOHVZKLOH/LIW/RFN
Pockets trap and hold dirt in place.
No.
‡6&58%%(5
‡+$5'685)$&(
‡³6:(',6+)2508/$´
ELECTROSTATIC
SWEEPER CLOTHS
Our No.
MICROFIBER PADS
FLOOR CARE SYSTEM
Shf
Pk
Scent
7KH %RQD 6WRQH 7LOH /DPLQDWH
6\VWHPFRQWDLQVDGXUDEOHSLHFH
PRSKDQGOHZLWK´[´PRSKHDG
ZDVKDEOH PLFUR¿EHU FOHDQLQJ SDG
DQGGXVWLQJSDG7KHV\VWHPDOVRLQFOXGHV%RQD¶VSUHPL
XPQRUHVLGXHRXQFH6WRQH7LOH/DPLQDWHFOHDQHU
ZKLFKLVQRQWR[LFDQGELRGHJUDGDEOHDQGDRXQFHUH
¿OOFRQFHQWUDWH
Our No.
Shf
Pk
No.
Unit
BONAKEMI USA, INC
206-9409
6
:0
Unit
624-8157
31821
8QVFHQWHG
12
($
773-9501
37362
/HPRQ
12
($
‡³0,&523/86´
For hardwood and hard surface
ÀRRU &RPHV ZLWK D RQH SLHFH ´
WHOHVFRSLQJKDQGOHDQGIXOOGH
JUHH VZLYHO KHDG EDVH ´ [ ´
cleaning pad attaches to base with
YHOFUREDFNLQJ(OHFWURVWDWLFDFWLRQDWWUDFWVDQGWUDSVGLUW
DQGDOOHUJHQVZKHQXVHGGU\RUZHW0DFKLQHZDVKDEOH
mop pad.
&OHDQ)OLS ZHW PRSSLQJ FORWK
´ [ ´ ZHW PRSSLQJ FORWK
that disinfects as it cleans. For
4XLFNLH 0RGHO 1RV DQG
56176. 12 count.
Shf
Pk
Our No.
No.
Size
In
Shf
Pk
Unit
6
Unit
993-8820
:0
4 x 15
6
56765
5 x 18
4</
6
($
‡48,&.&211(&7
‡:(7'5<$/80,180
Shf
Pk
Picks up moisture, dirt and bacte
ULD OHDYLQJ ÀRRUV FOHDQ ZLWK QR
GXOOLQJVFUDWFKHV8VHGU\WRDWWUDFW
dirt, microparticles, and common
KRXVHKROGDOOHUJHQV8VHZHWZLWK%RQDFOHDQHUVIRUHI
IHFWLYHQRQWR[LFFOHDQLQJ0DFKLQHZDVKDEOH
Our No.
Size
In
Shf
Pk
Unit
BONAKEMI USA, INC
864-3900
$;
4 x 15
8
($
/LJKWZHLJKW DOXPLQXP FRQVWUXF
WLRQ ÀDW IUDPH SUR¿OH 2QHVWHS
connecting mechanism speeds
mop assembly and changeover.
5HSODFHDEOH KRRNDQGORRS VWULSV¶ ´/ [ ´+ [
´:
Shf
Pk
Unit
Our No.
Shf
Pk
No.
Unit
NEWELL RUBBERMAID COMMERCIAL
($
154-6936
Unit
'XUDEOH SDG FRQVWUXFWLRQ ZLWK
stands more than 300 launderings.
'RXEOH ¿QLVKHG HGJHV UHWDLQ SDG
RYHUWLPH´+
Our No.
+6
4</
6
No.
Size
In
NEWELL RUBBERMAID COMMERCIAL
%OXH
589-8358
7,+6
4%/
[
12
($
417-8711
6
4%/
[
12
($
<HOORZ
6
No.
FLOOR MOP PAD
QUICKIE MANUFACTURING
989-4940
6
($
FLOOR MOP
&OHDQ)OLS GU\ VZHHSLQJ FORWK
´ [ ´ GU\ VZHHSLQJ FORWKV
picks up dust, dirt and hair. For
4XLFNLH 0RGHO 1RV DQG
56176. 16 count.
No.
<HOORZ
498-3607
‡0,&52),%(5:(7
($
ELECTROSTATIC
SWEEPER CLOTHS
Our No.
Unit
NEWELL RUBBERMAID COMMERCIAL
BONAKEMI USA, INC
QUICKIE MANUFACTURING
56762
Shf
Pk
‡³6:(',6+)2508/$
0,&523/86´
FLOOR MOP
ELECTROSTATIC
SWEEPER CLOTHS
989-4924
Size
In
No.
CLEANING PADS
&ORWKV
No.
Our No.
($
PROCTER & GAMBLE
Our No.
9HUWLFDO SRO\SURS\OHQH VFUXEEHU
stripes remove stubborn spots and
FOHDQLQWRWLOHJURXWOLQHV'HQVHXO
WUD¿QHTXDOLW\¿EHUUHPRYHVGXVW
GLUW DQG EDFWHULD +RRNDQGORRS
EDFNLQJGRXEOH¿QLVKHGHGJHV´+HLJKW
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
164 - Maintenance, Repair & Operations
FLOOR MOP PAD
DUST MOPS
‡(&2120<:(73$'
‡0,&52),%(5
'HQVH XOWUD¿QH TXDOLW\ ¿EHU UH
moves dust, dirt and bacteria.
'HOLYHUV VXSHULRU FOHDQLQJ SHUIRU
mance and durability.
Our No.
Size
In
No.
Shf
Pk
Unit
12
($
NEWELL RUBBERMAID COMMERCIAL
900-6966
,+6
5 x 18
4%/
DUST MOPS
‡6:,9(/+($'
´FRWWRQPRSZLWKZRRGHQKDQ
GOH 8VH 6.8 IRU UH¿OO
replacement.
Our No.
Shf
Pk
No.
Unit
MINTCRAFT PRO
975-7444
7006
6
($
'XVWDQGVFUXESOXVZLWKPLFUR¿EHU
cleaning head. Patented scrub zone
UHPRYHVVWXEERUQVFXIIPDUNV0L
FUR¿EHUWUDSVDQGKROGVGLUWOLNHD
magnet. 360 degree swivel head
DOORZVHDV\DFFHVVDURXQGIXUQLWXUH5HXVDEOHDQGPD
FKLQH ZDVKDEOH VOHHYH 5HPRYDEOH KDQGOH 8VHV 1R
UH¿OOGXVWPRSKHDG
Our No.
Size
In
No.
Shf
Pk
Unit
UNGER INDUSTRIAL
865-0269X
‡48,&.&211(&7
‡³6:,9(/)/(;´
/LJKWZHLJKWDOXPLQXPFRQVWUXFWLRQ
KDV RQHVWHS FRQQHFWLQJ PHFKD
QLVP 8VHUIULHQGO\ EHQG DQG JULS
make handle more comfortable to
use.
Patented 360 degree swivel con
nector. Flexible plastic frame to
get into corners and base boards.
100 percent virgin nylon yarn gath
HUV DQG FROOHFWV GXVW ´ SRZGHU
FRDWHGVWHHOKDQGOHZLWKKDQJXSIHDWXUH
Our No.
Size
In
No.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
Q760000000
6
Unit
QUICKIE MANUFACTURING
4
Our No.
655-2004
0624
Unit
BIRDWELL CLEANING
6
($
DUST MOP HEADS
APPLICATOR PAD
‡³0,&523/86´
Shf
Pk
No.
Unit
00205
6
($
6SHFLDOO\GHVLJQHGIRUXVHZLWKWKH
%RQDŠ +DUGZRRG DQG 6WRQH 7LOH
/DPLQDWH3ROLVK0DFKLQHZDVK
able and reusable up to 300 times.
8VH ZLWK %RQD 0LFUR¿EHU 0RS IRU
best application results.
Our No.
No.
DUST MOPS
BONAKEMI USA, INC
Blended yarn sewn onto mitt.
0HWDOIUDPHZLWKFRORUFRRUGLQDWHG
handle.
036-3358
Shf
Pk
No.
$7
Size
In
4 x 15
Shf
Pk
8
Unit
($
‡³0,&523/86´
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
%OLVWHU3DFNHG
363-0845
#25
6
($
Shf
Pk
Unit
12
($
5HDFKHV ZKHUHYHU GXVW VHWWOHV
8VHGZLWK%RQD)ORRU0RSVRQERWK
hardwood and stone, tile, and lami
QDWH ÀRRUV ³6XSHU (OHFWURVWDWLF
$FWLRQ´ DWWUDFWV DQG OLIWV GXVW SHW
hair, microparticles, and common household allergens
IURP\RXUÀRRUV¶VXUIDFH
Our No.
DUST MOPS
QUICKIE MANUFACTURING
Shf
Pk
No.
DUSTING PADS
0LFUR¿EHU KDUGZRRG ÀRRU PRS
UH¿OO )LWV 4XLFNLH *UHHQ &OHDQLQJ
0LFUR¿EHU +DUGZRRG )ORRU 0RS
6.8
753-8382
Our No.
Brooms, Mops & Trash Bags
($
FLOOR MOP REFILLS
No.
($
CHICKASAW & LITTLE ROCK BROOM WORKS
Our No.
Our No.
6
Cotton yarn double stitched to
heavy sanforized canvas backing.
5HSODFHDEOHUHPRYDEOHDQGZDVK
able head.
0LFUR¿EHU ÀRRU PRS IRU DOO KDUG
ÀRRU VXUIDFHV FDQ EH XVHG HLWKHU
ZHWRUGU\5HPRYDEOHDQGUHSODFH
DEOH PLFUR¿EHU PLWW LV PDFKLQH
ZDVKDEOH :RQ¶W VFUDWFK RU PDUN (VSHFLDOO\ EHQH¿FLDO
RQKDUGZRRGÀRRUV$OVRDFFHSWVZHWRUGU\GLVSRVDEOH
VKHHWV´KDQGOHZLWKGHJUHHVZLYHOKHDGFRQQHF
WRU UHDFKHV WLJKW VSDFHV DQG DOVR VQDSV ÀXVK WR KHDG
IRUHDVHLQVWRULQJ5H¿OOIDFWRU\6.8
062
065
‡:('*(6+$3('
‡*5((1&/($1,1*
0,&52),%(5
753-8374
Unit
DUST MOPS
FLOOR MOP
Shf
Pk
Shf
Pk
No.
5HPRYDEOH DQG ZDVKDEOH KHDG
$VVRUWHG FRORU KDQGOHV 'R 1RW
6SHFLI\&RORUV
687-1974
DUST MOPS
No.
&'
‡0,77
($
Brooms, Mops & Trash Bags
Our No.
Our No.
753-8358
<HOORZ
7+.6
4
DUST MOP HEADS
QUICKIE MANUFACTURING
ERGONOMIC ADJUSTABLE ALUMINUM HANDLE
132-7709
DUST MOPS
FLOOR MOP HANDLES
227-0957
1RQVOLS JULS KDQGOH $WWUDFWV DQG
traps dust like a magnet. Flexes to
FOHDQEDVHERDUGV6ZLYHOVWRFOHDQ
XQGHU IXUQLWXUH 7KLV ³/\VRO´ FOHDQLQJ WRRO FRQWDLQV DQ
antimicrobial agent that prohibits the growth of odor
FDXVLQJJHUPVEDFWHULDPROGDQGPLOGHZRQWKHPRS
¿EHUV IRU WKH OLIH RI WKH WRRO 8VH 1R 6.8
UH¿OO
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
950-8961X
57067
Size
In
Shf
Pk
Unit
4 x 15
12
($
BONAKEMI USA, INC
‡+$5':22')/225
‡0,&52),%(5
‡³/<62/´
Our No.
No.
4
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
:0
Maintenance, Repair & Operations - 165
DUST MOPS
DUST MOP HEADS
‡³6:,9(/)/(;´
‡0,&52),%(5'5<+$//
3$'
Patented 360 degree swivel con
nector. Flexible plastic frame to
get into corners and base boards.
100 percent virgin nylon yarn gath
HUV DQG FROOHFWV GXVW ´ SRZGHU
FRDWHGVWHHOKDQGOHZLWKKDQJXSIHDWXUH
Our No.
Shf
Pk
No.
Unit
QUICKIE MANUFACTURING
0654
567-1540
+LJKSLOH PLFUR¿EHU GHOLYHUV VX
perior cleaning performance and
GXUDELOLW\ 'HQVH XOWUD¿QH TXDOLW\
¿EHU UHPRYHV PRUH GXVW GLUW DQG
EDFWHULD WKDQ FRQYHQWLRQDO FOHDQLQJ SURGXFWV +RRN
DQGORRSEDFNLQJZLWKGRXEOH¿QLVKHGHGJHVUHWDLQSDG
VKDSH´+[´/[´:
Our No.
MOP REFILL
6
DUST MOP HEADS
Size
In
No.
Shf
Pk
Unit
12
($
NEWELL RUBBERMAID COMMERCIAL
($
7,6
5 x 36
4*5
No.
Size
In
Shf
Pk
Unit
BIRDWELL CLEANING
675-4832
5 x 24
12
($
607-8885
5 x 36
12
($
DUST MOP HEADS
DUST MOP HEADS
´ FRWWRQ PRS UH¿OO 8VH ZLWK
6.8 GXVW PRS KHDG
with wooden handle.
No.
7007
5HPRYDEOHUHSODFHDEOHDQGZDVK
DEOH 0DGH RI FRWWRQ )RU D FRP
SOHWH PRS RUGHU 1R PRS
KHDG 1R IUDPH 1R
ZRRGKDQGOH´[´
DUST MOP HEADS
‡&87(1'&27721
‡³.87$:$<´
Shf
Pk
Unit
12
($
MINTCRAFT PRO
986-7268
Our No.
Green
841-3411
Our No.
:DVKDEOH GXVW PRS KHDG
1R XVHV D ´ IUDPH
1RXVHVD´IUDPH
3UHODXQGHUHGDQGSUHVKUXQNPRS
for general purpose dust mopping.
(QYHORSHEDFNLQJVW\OH
Our No.
Size
In
No.
Our No.
Shf
Pk
No.
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
Shf
Pk
Unit
00224
613-2393
12
($
NEWELL RUBBERMAID COMMERCIAL
White
,.6
DUST MOP HEADS
123-8161
.:+
5 x 18
12
($
DUST MOP HEADS
396-5068
7,.6
.:+
5 x 24
12
($
‡+$5':22')/225
‡0,&52),%(55(),//
‡³/<62/´
975-4029
.:+
5 x 36
12
($
‡/223('(1'
‡³75$33(5´
5H¿OO IRU PLFUR¿EHU GXVW PRS IRU
KDUGZRRG ÀRRUV 1R 6.8
GXVWPRS
Our No.
DUST MOP HEADS
Shf
Pk
No.
Unit
570674
3
‡:,7+)5,1*(
‡+22.$1'/223
($
DUST MOP HEADS
‡7:,67('/223
32/<(67(5
Our No.
3UHODXQGHUHG GXVW PRS GHVLJQHG
for maximum durability and op
WLPDO FOHDQLQJ SHUIRUPDQFH 1R
snagging, fraying or unraveling.
6OLSRQVOLSWKURXJKEDFNLQJIRUHDV\VHWXS
284-3555
Our No.
No.
Size
In
Our No.
Size
In
No.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
Green
Shf
Pk
4*5
5 x 18
6
($
657-9403
+6
4*5
[
6
($
085-0230
7+
4*5
[
6
($
Unit
NEWELL RUBBERMAID COMMERCIAL
-%/
5 x 18
12
($
413-1934
-%/
5 x 24
12
($
065-3477
-%/
5 x 36
12
($
496-7576
+6
<HOORZ
6
-</
5 x 18
12
($
963-5061
,+6
-</
5 x 36
12
($
Shf
Pk
Unit
DUST MOP HEADS
‡7:,67('/223&27721
3UHODXQGHUHG GXVW PRS GHVLJQHG
for maximum durability and op
WLPDO FOHDQLQJ SHUIRUPDQFH 1R
snagging, fraying or unraveling.
6OLS RQVOLS WKURXJK EDFNLQJ IRU
easy set up.
033-9424
)LWVPRGHO1RGXVWPRS
411-7255
Shf
Pk
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
639-7012
00206
Size
In
No.
White
‡:('*(6+$3('
No.
Unit
NEWELL RUBBERMAID COMMERCIAL
DUST MOP HEADS
Our No.
Shf
Pk
981-9335
Our No.
%OXH
Size
In
No.
NEWELL RUBBERMAID COMMERCIAL
+LJKSLOH DQG ORRSHG IULQJH FRQ
struction grabs and holds larger
GXVW SDUWLFOHV DQG GHEULV 'HQVH
XOWUD¿QH TXDOLW\ ¿EHU UHPRYHV
more dust, dirt and bacteria than conventional cleaning
SURGXFWV 'RXEOH ¿QLVKHG HGJHV UHWDLQ SDG VKDSH ZLWK
XVHRYHUWLPH´+HLJKW
QUICKIE MANUFACTURING
473-4117X
3UHWUHDWHG SUHVKUXQN DQG IXOO\
launderable. Balanced blend dust
PRS IRU JHQHUDOSXUSRVH GXVW
PRSSLQJ(QYHORSHEDFNLQJVW\OH
12
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7,.6
.:+
5 x 24
12
($
.:+
5 x 36
12
($
166 - Maintenance, Repair & Operations
DUST MOP HEADS
DUST MOP HEADS
DUST MOP FRAMES
‡7:,67('/223
$17,0,&52%,$/
‡0,&52),%(5
‡48,&.&/($1&/27+6
‡61$321:,5(
‡32:(5&2$7('
3UHODXQGHUHG GXVW PRS GHVLJQHG
for maximum durability and op
WLPDO FOHDQLQJ SHUIRUPDQFH 1R
snagging, fraying or unraveling.
6OLSRQVOLSWKURXJKEDFNLQJIRUHDV\VHWXS
:DVKDEOH UHXVDEOH DQG FOHDQV
ZLWKRXW FKHPLFDOV 5HSODFHV GLV
posable cloths.
Corrosion resistant, powder coat
HG KHDY\GXW\ PHWDO IUDPH IRU
GXUDEOHSHUIRUPDQFH+DQGOHVWKDW
ZLOO ¿W GXVW PRS IUDPH DUH 6.8
1R 0 DQG 6.8 1R
0
Our No.
Size
In
No.
Shf
Pk
Our No.
Unit
No.
021-0849X
313-6579
,.6
-*5
5 x 18
12
($
953-8349
7,+6
-*5
5 x 24
12
($
5 x 36
-*5
Unit
Our No.
Pack of 2
Green
76
Shf
Pk
UNGER INDUSTRIAL
NEWELL RUBBERMAID COMMERCIAL
907-4667
Size
In
12
($
6x6
6
&'
DUST MOP HEADS
3UHODXQGHUHG GXVW PRS GHVLJQHG
for maximum durability and op
WLPDO FOHDQLQJ SHUIRUPDQFH 1R
snagging, fraying or unraveling.
6OLSRQVOLSWKURXJKEDFNLQJIRUHDV\VHWXS
Our No.
Size
In
No.
Our No.
Size
In
No.
502-7099
0
5 x 18
12
($
372-0349
0
5 x 24
12
($
814-9007
0
5 x 36
12
($
DUST MOP HANDLES
Shf
Pk
DUST MOP HANDLE/
CONNECTORS
Unit
UNGER INDUSTRIAL
+DQGOH LV PDNH SHUFHQW SLQH
´LQOHQJWK
Pack of 2
Shf
Pk
853-6922
6x6
6
&'
Unit
Our No.
NEWELL RUBBERMAID COMMERCIAL
493-5078
,+.6
-%/
5 x 24
12
($
728-2817
7,6
-%/
5 x 36
12
($
DUST MOP FRAMES
635-1001
7,.6
00715
(FRQRPLFDO FRWWRQ FXWHQG GXVW
PRSKDVIXOOWLHEDFNLQJVW\OH
Our No.
Shf
Pk
No.
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
Size
In
Shf
Pk
635-0995
7,.6
20224
12
($
Unit
White
/:+
5 x 24
12
($
/:+
5 x 36
12
($
6QDSRQ8VHVKDQGOH1R
‡75,$1*8/$5
‡³'867($7(5´
Our No.
$WWUDFWV DQG KROGV GXVW FREZHEV
and more to clean drywall, ceil
LQJVZDOOVEDVHERDUGVDQGÀRRUV
Covers large surfaces and reaches
LQWRFRUQHUV6WDEOHGHJUHHSLYRWIRUIXOOVXUIDFHFRQ
WDFW6SHFLDOO\WUHDWHGPDWHULDOIRUSRZHUIXOORQJODVWLQJ
pickup.
No.
Size
In
Shf
Pk
1800
16
2
Lgth. x
Dia. In.
Shf
Pk
Unit
[
12
($
BIRDWELL CLEANING
No.
DUST MOP HANDLES
Size
In
Shf
Pk
Unit
$WWDFK WR WKH 6QDS2Q GXVW PRS
IUDPH6OLGLQJFROODUORFNVWKHKDQ
dle into position or allows for a full
GHJUHH VZLYHO DFWLRQ %RWK ¿W
2UJLOO6NX1R
BIRDWELL CLEANING
616-1574
5 x 24
12
($
607-8893
5 x 36
12
($
Our No.
Lgth
In
No.
Shf
Pk
Unit
12
($
12
($
NEWELL RUBBERMAID COMMERCIAL
HARDWOOD
838-4232
0
60
VINYL COVERED HARDWOOD
841-1456
Unit
WOOSTER BRUSH
733-5656
No.
DUST MOP FRAMES
DUST MOP HEAD
Our No.
Our No.
675-5110
NEWELL RUBBERMAID COMMERCIAL
613-0611
($
´ [ ´ PHWDO VQDSRQ GXVW
mop handle.
‡&87(1'',6326$%/(
7,6
12
DUST MOP HANDLES
DUST MOP HEADS
050-9877
Unit
DUST MOP FRAMES
)LWV1RPRSKHDG´[
´
No.
Shf
Pk
No.
CHICKASAW & LITTLE ROCK BROOM WORKS
Brooms, Mops & Trash Bags
%OXH
Our No.
Unit
Brooms, Mops & Trash Bags
:DVKDEOH UHXVDEOH DQG FOHDQV
ZLWKRXW FKHPLFDOV 5HSODFHV GLV
posable cloths.
‡7:,67('/223
6<17+(7,&
Shf
Pk
NEWELL RUBBERMAID COMMERCIAL
‡0,&52),%(5
‡48,&.&/($1:(73$'6
DUST MOP HEADS
Size
In
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7,6
0
60
Maintenance, Repair & Operations - 167
Brooms, Mops & Trash Bags
WET MOPS
WET MOP REFILLS
‡³+20(352´
0LFUR¿EHU WZLVW PRS UH¿OO 5H¿OO
IRU 4XLFNLH IDFWRU\ 0 6.8
WET MOPS
WET MOPS
‡&/27+
‡³0,/$'<¶6023´
‡+286(+2/'&87(1'
5$<21
5D\RQIRDPDEVRUEHQWVWULSV+DQ
GOHV LQ DVVRUWHG FRORUV '2 127
63(&,)<&2/25
0DGH IURP ZKLWH YLVFRVH KLJK
WHQVLOHVWUHQJWKUD\RQ\DUQ
/DFTXHUHG KDQGOHV ZLWK PHWDO
hanger.
Our No.
Our No.
Unit
BIRDWELL CLEANING
Shf
Pk
No.
Shf
Pk
No.
Unit
607-7796
8
($
543-8619
6.8 1R DQG
6.8 1R KHDY\
GXW\ FRWWRQ GHFN PRS 6.8
1RUD\RQPRS$V
VRUWHG&RORUV'R1RW6SHFLI\&RORUV´KDQGOH3RO\
bagged.
100 percent absorbent cotton yarn.
Quick change mop head for easy
UHSODFHPHQW 0HWDO KDQGOH ZLWK
hang up cap.
Shf
Pk
No.
Unit
HOMEBASIX
6001
6
Our No.
Shf
Pk
No.
Unit
607-8521
675-4949
6
($
6
($
607-8539
6
Size
Oz
Shf
Pk
12
Unit
EXTRA LARGE W\HANDLE
16
6
($
JUMBO W\HANDLE
20
6
Head
Wt Oz
No.
Head
Wt Oz
No.
¶¶[¶¶+DQGOH
00506
16
Shf
Pk
00502
8
6
($
00503
10
6
($
543-2711
00504
12
6
($
7,.6
0DGH IURP YHU\ DEVRUEHQW ZKLWH
FRWWRQWZLQH\DUQ/HDYHVQR
OLQW/DFTXHUHGKDQGOHVZLWKPHWDO
hanger.
00305
14
6
($
Our No.
524-2185
00306
16
6
($
CHICKASAW & LITTLE ROCK BROOM WORKS
7,.6
543-2109
543-2158
Unit
966-6835
1003
16
12
($
967-5109
1007
20
12
($
12
($
Head
Wt Oz
524-2177
543-2042
MINTCRAFT PRO
24
($
543-2703
Unit
No.
7,.6
Shf
Pk
Unit
¶¶[¶¶+DQGOH
543-2745
¶¶[¶¶+DQGOH
6XSHU DEVRUEHQW DQG ORQJ ODVWLQJ
heavy duty use, works all janito
rial screw type, spring lever or
clamp style handles. For use with
0LQWFUDIW 3UR 0RS KDQGOH 6.8
1011
6
¶¶[´+DQGOH
HEAVY-DUTY
Shf
Pk
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
‡-$1,725'(&.
‡&87(1'&277217:,1(
CHICKASAW & LITTLE ROCK BROOM WORKS
($
‡023+($'5(),//6
Size
Oz
Shf
Pk
WET MOPS
+HDG ZLWK SHUFHQW FRWWRQ DQG
SHUFHQW V\QWKHWLF \DUQ /DF
TXHUHG KDQGOHV ZLWK PHWDO KDQJ
ers.
Our No.
WET MOPS
967-6016
($
0DGH IURP YHU\ DEVRUEHQW ZKLWH
FRWWRQWZLQH\DUQ/HDYHVQR
OLQW/DFTXHUHGKDQGOHVZLWKPHWDO
hanger.
¶¶[´+DQGOH
No.
6
‡-$1,725'(&.&87(1'
&27721
MINTCRAFT PRO
Our No.
($
‡+286(+2/'
‡&87(1'&277217:,1(
543-2695
750P
00404
($
WET MOPS
973-2439
6
WET MOPS
543-2737
0DGH RI DEVRUEHQW FRWWRQ
yarn, metal handle.
650P
7,.6
Our No.
RAYON YARN
‡'(&.
970-5773
16
BIRDWELL CLEANING
COTTON YARN
($
WET MOPS
No.
00406
‡-$1,725'(&.&87(1'
<$51
‡'(&.023
Our No.
Unit
¶¶[´+DQGOH
WET MOPS
968-1685
7,.6
($
WET MOPS
Our No.
Shf
Pk
¶¶[´+DQGOH
544-0110
12
0
Head
Wt Oz
No.
CHICKASAW & LITTLE ROCK BROOM WORKS
QUICKIE MANUFACTURING
177-4892
Our No.
00307
20
6
($
543-2752
00308
24
3
($
543-2760
32
3
($
7,.6
7,.6
00507
20
6
($
00508
24
3
($
32
3
($
WET MOPS
‡+($9<'87<+286(+2/'
‡&87(1'<$51
WET MOPS
‡+286(+2/'&87(1'
&27721
+HDY\GXW\ FRWWRQ \DUQ ´ KDQ
GOH+DQGOHVDUHLQDVVRUWHGFRORUV
'R1RW6SHFLI\&RORUV
+HDG ZLWK SHUFHQW FRWWRQ
SHUFHQW V\QWKHWLF \DUQ /DFTXHUHG
handles with metal hangers.
Our No.
No.
Head
Wt Oz
Shf
Pk
Our No.
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
¶¶[¶¶+DQGOH
543-1713
00302
8
6
($
524-2169
00303
10
6
($
543-1853
00304
12
6
($
No.
Yarn
Type
Shf
Pk
Unit
BIRDWELL CLEANING
616-0154
Cotton
6
($
607-7804
5D\RQ
6
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
168 - Maintenance, Repair & Operations
WET MOPS
WET MOPS
WET MOP HEADS
‡+286(+2/'&87(1'
<$51
‡0,&52),%(5
‡³+20(352´
‡/226(&87(1'<$51
<DUQ ZHW PRS KHDG ZLWK DVVRUWHG
FRORUHGKDQGOHV'212763(&,)<
&2/25
0LFUR¿EHU WZLVW PRS 8OWUDVRIW
XOWUD DEVRUEHQW PLFUR¿EHU
PRS KHDG 0LFUR¿EHU¶V XQLTXH
properties allow it to clean effec
WLYHO\ HYHQ ZLWKRXW FKHPLFDOV 0RS KHDG LV HDVLO\ UH
PRYHGDQGLVPDFKLQHZDVKDEOH´VWHHOKDQGOHZLWK
VZLYHO HQG FDS FRQYHQLHQW KDQJ KROH 5H¿OO IDFWRU\ 6.8
Our No.
Yarn
Type
No.
Shf
Pk
Unit
BIRDWELL CLEANING
664-1005
Cotton
8
($
607-7788
5D\RQ
8
($
Our No.
Shf
Pk
No.
6HZQ ZLWK ´ WDSH EDQGV +RXVH
KROGPRSKHDGVZRUNZLWK1R
6.8 KDQGOHV MDQLWRU
KHDGV ZRUN ZLWK 1RV 6.8
DQG
KDQGOHV
Our No.
Wt
Oz
No.
100 PERCENT COTTON TWINE
Unit
4
0
($
Janitor
643-2868
7,.6
643-2892
WET MOPS
00557
24
12
($
00558
32
12
($
12
($
100 PERCENT RAYON
‡/223('(1'&27721
+RXVHKROG
WET MOPS
+RXVHKROGORRSHGHQG&RWWRQ\DUQ
ZLWK´KDQGOH
00455
643-3387
7ZLVWPRS$XWRUDWFKHWLQJ
643-3452
Shf
Pk
No.
Unit
643-3478
BIRDWELL CLEANING
607-7812
8
($
Our No.
6011
6
($
WET MOPS
‡6(/):5,1*,1*
+286(+2/'
‡/223('(1'&27721
No.
WET MOP HEADS
‡7:,67:5,1*5(),//
‡³/<62/´
Head
Size
Shf
Pk
5H¿OO IRU
1R
Unit
Our No.
¶¶/2YHUDOO
#22
12
/DUJH
WET MOPS
1RQVOLS JULS KDQGOH 'HHS FOHDQ
LQJ VXSHU DEVRUEHQW \DUQ +DQGV
stay dry during cleaning and wring
LQJ5HGXFHVRGRUVEHWZHHQXVHV
Built in spot scrubber. Cleans behind vanities, toilet and
RWKHU KDUG WR UHDFK SODFHV 7KLV ³/\VRO´ FOHDQLQJ WRRO
contains an antimicrobial agent that prohibits the growth
RIRGRUFDXVLQJJHUPVEDFWHULDPROGPLOGHZRQWKH
PRS¿EHUVIRUWKHOLIHRIWKHWRRO8VHUH¿OO1R
6.8
Shf
Pk
Unit
QUICKIE MANUFACTURING
989-4866X
57034
Shf
Pk
&RORU
($
12
($
00458
32
12
($
+RXVHKROG3O\
644-7015
00353
10
12
($
624-2234
00354
12
12
($
624-2242
00355
16
12
($
570342
4
($
624-2259
00356
20
12
($
624-2267
00357
24
12
($
624-2275
00358
32
12
($
WET MOP HEADS
Unit
Green
3
($
WET MOP HEADS
‡7:,67:5,1*
‡³/<62/´
No.
No.
QUICKIE MANUFACTURING
($
376-7019X
Our No.
12
24
6.8
CHICKASAW & LITTLE ROCK BROOM WORKS
142-2351
20
00457
-DQLWRU3O\
Plastic handle with black foam
comfort grip offers twist action for
HDV\VHOIZULQJLQJ
Our No.
00456
Unit
HOMEBASIX
014-7355
7,.6
50 PERCENT COTTON/50 PERCENT SYNTHETIC
Shf
Pk
No.
16
Janitor
643-3429
Our No.
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
QUICKIE MANUFACTURING
203-9931
Shf
Pk
‡6$''/(/223('(1'
4 Ply premium cotton blend yarn.
´PHVKEDQG´WDLOEDQG8VHV
6.8KDQGOH
Our No.
No.
Size
Shf
Pk
Unit
‡/226(+286(+2/'
&87(1'<$51
BIRDWELL CLEANING
490-9941
%/
0HGLXP
12
($
KHDG EDQG 0DGH LQ WKH
86$ 5H¿OO IRU ´ VSULQJOH
YHU PRS KDQGOH 1R 6.8
809-3817
%/
/DUJH
12
($
Our No.
Shf
Pk
No.
Unit
BIRDWELL CLEANING
4 PLY COTTON YARN
607-7820
12
($
4 PLY PREMIMUM RAYON YARN
607-7846
12
($
WET MOP HEADS
‡127$1*/(6$''/(
‡-$1,725/223('(1'
&27721
/RRSHG HQG SO\ SUHPLXP FRWWRQ
EOHQG FRORUHG \DUQ ´ KHDG
EDQG´WDLOEDQG8VHV1RV
6.8 RU 6.8 KDQGOHV %OXH
colored yarn.
Our No.
WET MOP HEADS
615-8950
SO\ FRWWRQ \DUQ ´ KHDG
EDQG 8VHV KDQGOH 1R 6.8
No.
Size #
Shf
Pk
Unit
24
12
($
BIRDWELL CLEANING
607-8844
Size
Shf
Pk
Unit
/DUJH
12
($
BIRDWELL CLEANING
‡6&5(:21-$1,725
‡&87(1'&27721
‡³(=&+$1*(´
Our No.
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%
Maintenance, Repair & Operations - WET MOP HEADS
WET MOP HEADS
WET MOP HEADS
‡127$1*/(6$''/(
/223('(1'&27721
‡&87(1'&27721
‡/223('(1'),1,6+023
‡7$3(/(667$,/%$1'
‡³6:,1*(5/223´
(FRQRPLFDOFXWHQGFRWWRQPRS
SO\ SUHPLXP FRWWRQEOHQG EOXH
FRORUHG \DUQ ´ PHVK EDVH EDQG
can act as scrubber for tougher
FOHDQLQJWDVNV´WDLOEDQG8VHV
1RV 6.8 RU 1R 6.8 handles.
Our No.
No.
%
No.
Mop
Size
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
Size
Shf
Pk
Unit
0HGLXP
12
($
BIRDWELL CLEANING
607-8786
Our No.
Our No.
White - 1” White Headband
329-6027
584-8189
7,+6
382-1246
7LJKWO\WZLVWHG SO\ \DUQ LQKLE
its linting and provides a smooth,
HYHQ DSSOLFDWLRQ RI ÀRRU ¿QLVK
Tapeless tailband aids in reducing streaking.
Shf
Pk
No.
Unit
NEWELL RUBBERMAID COMMERCIAL
9:+
#20
12
($
9:+
#24
12
($
967-9325
7,6
&:+
6
($
9:+
#32
12
($
004-2028
7,+6
&:+
6
($
White - White Headband
WET MOP HEADS
‡81,9(56$/+($'%$1'
‡5$<21/223('(1'
)LWV ERWK VLGHORDGLQJ DQG FODPS
VW\OHKDQGOHV/RRSHGHQGVUHGXFH
OLQWLQJDQGGHSO\LQJ,GHDOIRUÀRRU
¿QLVKDSSOLFDWLRQ
Our No.
Wt
Oz
No.
Shf
Pk
‡&87(1'35(0,80
‡&277215$<21
6<17+(7,&
Unit
Our No.
No.
Size
SO\ EOHQG IRU JRRG SHUIRUPDQFH
and durability.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
:KLWH%OXH+HDGEDQG
001-0900
(:+
16
12
($
627-5994
(:+
24
12
($
(:+
32
12
($
7,.6
WET MOP HEADS
‡7$,/%$1'('/223('(1'
‡&277216<17+(7,&<$51
SO\EDODQFHGEOHQGRIFRWWRQDQG
synthetic yarn is launderable for
long product life.
NEWELL RUBBERMAID COMMERCIAL
264-2734
WET MOP HEADS
Our No.
7,6
&*5
0HGLXP
7,+6
&*5
/DUJH
Unit
White - 1” Orange Headband
6
($
Green - 1” Red Headband
197-3171
Shf
Pk
NEWELL RUBBERMAID COMMERCIAL
Green - 1” Green Headband
618-0764
Wt
Oz
No.
891-3147
7.6
056-0029
6
($
6
($
683-8676
7,+6
):+
16
12
($
):+
20
12
($
):+
24
12
($
*UHHQ´<HOORZ+HDGEDQG
078-7473
WET MOP HEADS
‡81,9(56$/+($'%$1'
/223('(1'
‡&277216<17+(7,&
Wt
Oz
No.
Shf
Pk
7,+6
899-8528
(FRQRPLFDOFXWHQGPRS
Our No.
No.
Shf
Pk
Size #
Shf
Pk
Unit
BIRDWELL CLEANING
Unit
616-0139
12
12
($
616-2010
16
12
($
607-8745
20
12
($
16
12
($
(%/
24
12
($
T
9:+
#24
12
($
(%/
32
906-0724
($
616-1954
24
12
033-9283
9:+
12
($
7,+6
#32
($
616-1996
32
12
($
Shf
Pk
Unit
12
White - 1” White Headband
WET MOP HEADS
No.
Wt
Oz
WET MOP HEADS
‡6+5,1./(66/223('(1'
‡&277216<17+(7,&
‡³6:,1*(5/223´
)LWV ERWK VLGHORDGLQJ DQG FODPS
VW\OHKDQGOHV/RRSHGHQGVUHGXFH
IUD\LQJ DVVRFLDWHG ZLWK FXWHQG
PRSV&RWWRQV\QWKHWLF\DUQEOHQGIRUDOPRVWWZLFHWKH
absorbency of cotton.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
‡6$''/(-$1,725&87
(1'<$51
SO\EDODQFHGEOHQGRIFRWWRQDQG
V\QWKHWLF\DUQLVSUHODXQGHUHGDQG
SUHVKUXQN IRU DEVRUEHQF\ DQG
VWUHQJWK /RRSHGHQG WDLOEDQGHG IRU JUHDWHU ÀRRU FRY
erage.
Our No.
No.
Size
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
:KLWH%OXH+HDGEDQG
Green - 5” Green Headband
(:+
16
12
($
654-9315
(:+
24
12
($
683-4048
(:+
32
12
($
7,.6
Head
Size
No.
(%/
‡81,9(56$/+($'%$1'
/223('(1'
‡&27721
730-2623
SO\ FRWWRQ \DUQ ´ KHDG
EDQG 8VHV 1RV 6.8
RU handles.
NEWELL RUBBERMAID COMMERCIAL
WET MOP HEADS
Our No.
‡6$''/(-$1,725&87
(1'&27721
‡&87(1'5$<21
‡(&2120<
Our No.
%OXH%OXH+HDGEDQG
467-9841
6PDOO
WET MOP HEADS
Unit
NEWELL RUBBERMAID COMMERCIAL
823-1813
&*5
WET MOP HEADS
)LWV ERWK VLGHORDGLQJ DQG FODPS
VW\OHKDQGOHV/RRSHGHQGVUHGXFH
IUD\LQJ DVVRFLDWHG ZLWK FXWHQG
PRSV&RWWRQV\QWKHWLF\DUQEOHQGIRUDOPRVWWZLFHWKH
absorbency of cotton.
Our No.
,
827-6719
6
&*5
0HGLXP
6
($
6
($
6
($
XVHVSO\FRWWRQ\DUQ5
uses 4 ply premium rayon yarn.
´ KHDG EDQG 8VHV 1RV 6.8
Our No.
7,+6
&*5
/DUJH
615-8968
Cotton Blend
12
($
675-5029
5
3UHPLXP5D\RQ
12
($
*UHHQ´<HOORZ+HDGEDQG
162-6241
7,6
&*5
6PDOO
Yarn
Type
BIRDWELL CLEANING
Green - 5” Red Headband
488-8020
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
170 - Maintenance, Repair & Operations
Brooms, Mops & Trash Bags
MOP HANDLES
WET MOP HANDLES
‡+,1*('6,'(*$7(
-$1,725
3ODVWLFKHDGRQYLQ\OFRDWHGPHWDO
handle with hinged side lever for
HDV\VOLGHRQRIIRIPRSKHDGV
oz. and up.
Our No.
Size
In
No.
WET MOP HANDLES
MOP HANDLES
‡48,&.&+$1*(+,1*(
‡-$1,725
‡+,1*('6,'(*$7(
‡³,19$'(5´
0HWDOKHDGDQGKDQGOHZLWKKLQJHG
OHYHU ERWWRP IRU HDV\ VOLGH RQRII
of mop heads 20 oz. and up.
Contains antimicrobial product
protection, which inhibits growth
of bacteria that causes odors and
VWDLQV 0RS KDQGOH¶V WKXPE ZKHHO
FODPSVWKHPRS¿UPO\LQSODFH8VHV´KHDGEDQGPRSV
only.
Our No.
Shf
Pk
Size
In
No.
Shf
Pk
Unit
BIRDWELL CLEANING
616-1764
BIRDWELL CLEANING
Our No.
%ODFN
Unit
12
[
($
[
12
($
WET MOP HANDLES
0HWDO KHDG RQ PHWDO KDQGOH ZLWK
VSULQJORDGHG FODPS IRU HDV\ RQ
RII RI PRS KHDG +DQGOH IRU 1RV
6.8DQG6.8
DQGRWKHUPRSKHDGVR]DQGXS
Our No.
No.
Size
In
Unit
48
12
($
911-2111
6
[
+DUGZRRGZLWKHDV\WRORDGVSULQJ
and lever metal head and metal
KDUGZDUH $FFHSWV XS WR R]
mop heads.
Our No.
Our No.
Shf
Pk
No.
615-9545
1135
990-6298
Unit
12
($
($
MOP HANDLES
Green Lacquered
6
+DUGZRRGZLWKHDV\WRORDGVSULQJ
DQG OHYHU ´ PHWDO KHDG $FFHSWV
PRSKHDGVR]DQGXS
Our No.
No.
Size
In
Our No.
Shf
Pk
&OHDU/DFTXHUHG
624-2218
[
6
4
($
)OH[DFWLRQ SODVWLF VTXHH]H XQLW
0HWDO KDQGOH ZLWK SODVWLF VZLYHO
FDS IRU HDV\ VWRUDJH +DQGOHV DUH
LQ DVVRUWHG FRORUV 'R 1RW 6SHFLI\
&RORUV8VHV1R6.8UH¿OO
664-1021
Lgth. x
In.
Shf
Pk
No.
Shf
Pk
4
Unit
($
SPONGE MOPS
Unit
‡'(/8;(&(//8/26(
‡'5$,1(5+$1':5,1*(5
:HDUUHVLVWDQW ZLWK FHOOXORVH
sponge and pressure plate hand
wringer to remove more water with
less effort and to keep hands clean
DQGGU\8VHV1R6.8UH¿OO
NEWELL RUBBERMAID COMMERCIAL
CHICKASAW & LITTLE ROCK BROOM WORKS
00712
No.
*UD\$OXPLQXP&ODPS+DQGOH
Unit
BIRDWELL CLEANING
6LGHJDWHZHWPRSKDQGOH¶VKLQJHG
side gate allows mop to easily slide
on and off handle. Plastic yellow
KHDG 8VHV ´ KHDGEDQG PRSV
only.
‡635,1*/2$'('&/$03
‡+($9<'87<-$1,725
Unit
‡&(//8/26(
‡'5$,1(5+$1':5,1*(5
Our No.
‡3/$67,&
‡³*5,33(5´
WET MOP HANDLES
Shf
Pk
SPONGE MOPS
Shf
Pk
MINTCRAFT PRO
Unit
No.
BIRDWELL CLEANING
CHICKASAW & LITTLE ROCK BROOM WORKS
[
($
($
´&RPPHUFLDO-DQLWRUDOPRSKDQ
GOH6WXUG\´GLDPHWHUPHWDOKDQ
GOHZLWKKDQJXSFDS+HDY\UHVLQ
VFUHZW\SHTXLFNFKDQJHKHDG
‡635,1*/2$'('&/$03
‡+286(+2/'0$,'
00710
12
Cellulose sponge with deluxe scrub
ber end to remove tougher spots.
'XUDEOHPHWDOGUDLQHUKDQGZULQJ
HU$VVRUWHGFRORUPHWDOKDQGOHVZLWKVZLYHOFDS'2127
63(&,)<&2/258VHV1R6.8UH¿OO
&OHDU/DFTXHUHG
Shf
Pk
WET MOP HANDLES
624-2200
($
54
‡&(//8/26(:,7+
6&58%%(5
‡'5$,1(5+$1':5,1*(5
CHICKASAW & LITTLE ROCK BROOM WORKS
Lgth
In
Size
In
12
+
Unit
‡&200(5&,$/-$1,725$/
No.
60
989-1615
SPONGE MOPS
Shf
Pk
MOP HANDLES
Our No.
+
SPONGE MOPS
BIRDWELL CLEANING
675-4865
038-6284
Brooms, Mops & Trash Bags
+DUGZRRGZLWK´PHWDOKHDGWKDW
KDV KLQJHG TXLFNFKDQJH HQG IRU
easy, instant change replacement
RIPRSKHDGVR]DQGXS
‡635,1*/2$'('&/$03
‡+286(+2/'
No.
Unit
NEWELL RUBBERMAID COMMERCIAL
‡48,&.&+$1*(+,1*(
‡+($9<'87<-$1,725
WET MOP HANDLES
Our No.
Shf
Pk
<HOORZ
%ODFN
616-1061
Size
In
No.
238-3867
7,+6
+
54
12
($
792-5548
7,.6
+
60
12
($
($
Our No.
No.
Shf
Pk
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
636-9326
WET MOP HANDLES
‡:,1*187+($9<'87<
‡-$1,725
+DUGZRRG ZLWK ZLQJQXW ´ PHWDO
KHDG $FFHSWV RXQFH DQG XS
mop heads.
Our No.
No.
Size
In
Shf
Pk
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
&OHDU/DFTXHUHG
624-2226
00713
[
6
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
00201
6
($
Maintenance, Repair & Operations - 171
SPONGE MOPS
6WULS PRS ZLWK VFRXULQJ SDG 8VH
6.8 IRU UH¿OO UHSODFH
ment.
Our No.
Shf
Pk
No.
Unit
HOMEBASIX
974-2214
SPONGE MOPS
SPONGE MOPS
‡$8720$7,&
‡³'<1$0,&´
‡(=:5,1*
‡³/<62/´
&HOOXOLQHPRSPHWDOVTXHH]HXQLW
$VVRUWHG&RORU+DQGOHV8VHVUH¿OO
1R6.8
6HOI ZULQJLQJ PRS ZLWK QRQVOLS
KDQGOH 'HHS FOHDQLQJ VSRQJH
VWULSV ZLWK VFUXEEHU GRWV +DQGV
stay dry during cleaning and wring
LQJ 5HGXFHV RGRUV EHWZHHQ XVHV &OHDQV EHKLQG YDQL
WLHV WRLOHW DQG RWKHU KDUG WR UHDFK SODFHV 7KLV /\VRO
cleaning tool contains an antimicrobial agent that pro
hibits the growth of odor causing germs, bacteria, mold
PLOGHZRQWKHPRS¿EHUVIRUWKHOLIHRIWKHWRRO8VH
1R6.8IRUUH¿OO
Our No.
Shf
Pk
No.
Unit
BIRDWELL CLEANING
6007
6
($
12
($
083-7419
6
($
REFILL
975-2007
6008
Our No.
SPONGE MOPS
$EVRUEHQW GXUDEOH SRO\XUHWKDQH
sponge with scrubber strip side,
Q\ORQ UROOHUV $VVRUWHG FRORU PHWDO
KDQGOHV8VHV1R6.8
Our No.
No.
Shf
Pk
Unit
Our No.
BIRDWELL CLEANING
687-2006
6
993-6428X
1RQVOLS JULS KDQGOH 'XDO DFWLRQ
scrub brush. Pivoting brush for
JURXW DQG VSLOOV 8QLTXH ZDYHOLNH
sponge channels dirt and water for
HDV\ZULQJLQJ5HGXFHVRGRUVEHWZHHQXVHV7KLV³/\VRO´
cleaning tool contains an antimicrobial agent that pro
KLELWVWKHJURZWKRIRGRUFDXVLQJJHUPVEDFWHULDPROG
PLOGHZRQWKHEULVWOHVVSRQJHIRUWKHOLIHRIWKHWRRO
8VH1R6.8UH¿OO
‡32/<85(7+$1(:,7+
6&58%%(5
‡0,'+$1'/(52//(5
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
($
431-4639X
7,+6
57057
4
($
SPONGE MOPS
5HSODFHDEOH VFUXEELQJ SDG UH
PRYHV FDNHGRQ GLUW DQG VFXII
PDUNV 6RIW GXUDEOH ´ &HOOXOHQH
poly sponge, very easy to rinse
FOHDQ ´/ VWHHO KDQGOH ZLWK VZLYHO KDQJXS IRU HDV\
VWRUDJH +DQGOH VFUHZV RQ UH¿OO XVHV 7\SH 5 1R
6.8UH¿OO
1RQVOLSJULSKDQGOH3LYRWLQJEUXVK
IRUJURXWDQGVSLOOV5HGXFHVRGRUV
EHWZHHQ XVHV 7KLV /\VRO FOHDQ
ing tool contains an antimicrobial
agent that prohibits the growth
RI RGRU FDXVLQJ JHUPV EDFWHULD PROG DQG PLOGHZ RQ
WKHEULVWOHVDQGVSRQJHIRUWKHOLIHRIWKHWRRO8VH1R
6.8UH¿OO
6RIWDQGGXUDEOHDEVRUEHQW´&HO
lulene poly sponge, easy to rinse
clean, and replaceable scrubbing
SDG WR UHPRYH FDNHGRQ GLUW DQG
VFXII PDUNV ´/ VWHHO KDQGOH ZLWK VZLYHO KDQJXS
IRU HDV\ VWRUDJH 1\ORQ QXWV UHWDLQ UH¿OO 8VHV 7\SH 6
1R6.8DQGUH¿OO
Shf
Pk
No.
Unit
Our No.
597-6816X
QUICKIE MANUFACTURING
8
0
($
578-7502X
SPONGE MOPS
No.
57045
Shf
Pk
4
Unit
($
Unit
8
0
($
([WUHPHO\ DEVRUEHQW GXUDEOH
sponge for use with household
cleaners on glass, tile, vinyl and
ZRRG 1RQWR[LF JUHDVH DQG RLO
resistant sponge with vacuum
technology absorbs water to the center of the sponge,
OHDYLQJWKHÀRRUYLUWXDOO\GU\WRWKHWRXFK/LJKWZHLJKW
DGMXVWDEOHDOXPLQXPKDQGOHZLWKKDQJXSFDSIRUFRQ
venient storage.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
1
($
Shf
Pk
Unit
QUICKIE MANUFACTURING
881-1242X
0
5HSODFHDEOHVFUXEELQJSDGIHDWXUH
ZKLFK UHPRYHV FDNHGRQ GLUW DQG
VFXII PDUNV 7KH LQFK &HOOXOHQH
sponge is soft, yet durable, absor
bent and very easy to rinse clean.
,W KDV D LQFK VWHHO KDQGOH OHQJWK ZLWK VZLYHO KDQJ
XS IHDWXUH IRU HDV\ VWRUDJH 5H¿OO IDFWRU\ 6.8
683-5813
1RQVOLS JULS KDQGOH 'XDO DFWLRQ
scrub brush. Pivoting brush for
JURXW DQG VSLOOV 0LFUR¿EHU HQ
hanced sponge picks up and traps
GLUW OLNH D PDJQHW 5HGXFHV RGRUV EHWZHHQ XVHV 7KLV
/\VROFOHDQLQJWRROFRQWDLQVDQDQWLPLFURELDODJHQWWKDW
prohibits the growth of odor causing germs, bacteria,
PROG DQG PLOGHZ RQ WKH EULVWOHV DQG VSRQJH IRU WKH
OLIHRIWKHWRRO8VHV1R06.8UH¿OO
No.
‡³$8720$7,&´
No.
Shf
Pk
Unit
QUICKIE MANUFACTURING
‡0,&52),%(5:%586+
‡³/<62/´
Our No.
SPONGE MOPS
Our No.
SPONGE MOPS
‡39$52//(5
G78004
Shf
Pk
No.
‡'8$/$&7,21:%586+
QUICKIE MANUFACTURING
663-7821
($
‡0,'+$1'/(%877(5)/<
‡³$8720$7,&´
377-8842X
‡0,'+$1'/(52//(5
‡³$8720$7,&´
No.
4
QUICKIE MANUFACTURING
SPONGE MOP & REFILL
Our No.
Unit
SPONGE MOP & REFILL
Our No.
Our No.
Shf
Pk
QUICKIE MANUFACTURING
‡$8720$7,&52//(5
‡³/<62/´
SPONGE MOPS
No.
4
($
4
+30
($
SPONGE MOP REFILLS
‡'5$,1(5+$1':5,1*(5
‡&(//8/26(
)LWV GUDLQHUKDQG ZULQJHU VSRQJH
PRS %LUGZHOO 1R 6.8
DQG PRVW SRSXODU
brands.
Our No.
No.
Shf
Pk
Unit
24
($
BIRDWELL CLEANING
664-6087
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
172 - Maintenance, Repair & Operations
)ORRU&DUH)ORRU3URWHFWLRQ
SPONGE MOP REFILLS
SPONGE MOP REFILLS
‡'5$,1(5+$1':5,1*(5
‡&(//8/26(
‡0,&52),%(5
‡³/<62/´
6OLGH ¿W ZLQJQXW ¿WV GUDLQHU
KDQGZULQJHUVSRQJHPRS&KLFND
VDZ /LWWOH 5RFN 1R 6.8
&DQ UHSODFH VWDQGDUG
size cellulose sponges.
5H¿OO IRU 1R 0 6.8
PLFUR¿EHU VSRQJH PRS
with brush.
Our No.
No.
Shf
Pk
Our No.
Unit
CHICKASAW & LITTLE ROCK BROOM WORKS
636-9334
00203
12
‡+$1'+(/'
‡³',57'(9,/´
Shf
Pk
Unit
QUICKIE MANUFACTURING
059-3269X
3
0
($
SPONGE MOP REFILLS
Our No.
No.
618-8171
Shf
Pk
Shf
Pk
Unit
24
($
201-9388X
3
($
SPONGE MOP REFILLS
([WUHPHO\ DEVRUEHQW DQG GXUDEOH
for use with household cleaners
on vinyl, tile, wood, and glass.
9DFXXPWHFKQRORJ\DEVRUEVZDWHU
WR FHQWHU RI VSRQJH OHDYLQJ ÀRRU
YLUWXDOO\GU\WRWRXFK1RQWR[LFJUHDVHDQGRLOUHVLVWDQW
5H¿OOIRUUROOZULQJHU1R*6.8PRS
‡52//(581,9(56$/
‡32/<85(7+$1(
5H¿OO IRU UROO ZULQJHU 1R 6.8
PRS
Shf
Pk
Unit
BIRDWELL CLEANING
694-4367
12
5H¿OO IRU 1R 6.8
DXWRPDWLFUROOHUVSRQJH
mop.
Shf
Pk
Unit
QUICKIE MANUFACTURING
591-5483X
570572
3
Shf
Pk
Unit
QUICKIE MANUFACTURING
570442
7,+6
G78112
12
($
1
($
CORDLESS HAND VACS
CORDLESS HAND
VACS
$FFX5($&+ QR]]OH IRU H[WHQGHG
reach in tight spaces. Cyclonic ac
WLRQNHHSVVXFWLRQSRZHUVWURQJ(=FOHDQGLDOFOHDQV¿O
WHUWRUHFODLPVXFWLRQSRZHUVWDJH¿OWUDWLRQIRUFOHDQHU
DLU H[KDXVW 8VH WR FOHDQ WLJKW VSDFHV ODUJH DQG VPDOO
messes around the home, inside vehicles, stairs, furni
WXUHÀRRUVDQGFRXQWHUWRSVDLUZDWWVR]FDSDF
LW\,QFOXGHVFUHYLFHWRROXSKROVWHU\EUXVKZDVKDEOH¿O
WHUSODVWLF¿OWHUDQGZDOOPRXQWDEOHFKDUJLQJEDVH8VHV
9)UHSODFHPHQW¿OWHUV
Our No.
No.
Shf
Pk
Unit
BLACK & DECKER
535-5946
&+9
‡$8720$7,&
‡³'<1$0,&´
CORDLESS HAND
VACS
)LWV 1R 6.8 DQG
most standard automatic mops.
‡92/7
‡³'867%867(5´
Our No.
No.
Shf
Pk
Unit
12
($
BIRDWELL CLEANING
1
($
3
($
Our No.
No.
/DUJH WUDQVOXFHQW EDJOHVV GLUW
bowl makes it easy to see dirt and
HPSW\&RPSDFWDQGOLJKWZHLJKWIRUHDV\SRUWDELOLW\8VH
to clean tight spaces, large and small messes around the
KRPHYHKLFOHVVWDLUVIXUQLWXUHDQGÀRRUVDLUZDWWV
R]FDSDFLW\,QFOXGHVZDVKDEOH¿OWHUGLUWERZOZDOO
mount bracket, charging base and charging indicator
OLJKW8VHV9)ZDVKDEOH¿OWHU
Our No.
092-1601
Shf
Pk
Unit
12
($
QUICKIE MANUFACTURING
377-8867
+30
No.
Shf
Pk
Unit
BLACK & DECKER
7KLVUH¿OO¿WVWKH$XWRPDWLF6SRQJH
0RS 7\SH ³6´ (DV\ WR FKDQJH
LQFK ZLGH &HOOXOHQH VSRQJH LV
soft yet durable and very easy to
ULQVH FOHDQ ,QFOXGHV RQH VFUXE
EHUSDGWZRQ\ORQQXWVDQG¿WVDOO
7\SH³6´PRSV
5H¿OOIRUVSRQJHPRSZEUXVK1R
6.8
713-6013X
Unit
SPONGE MOP REFILLS
‡³/<62/´
No.
Shf
Pk
No.
NEWELL RUBBERMAID COMMERCIAL
264-5422
($
SPONGE MOP REFILLS
Our No.
4
SPONGE MOP REFILLS
‡$8720$7,&52//(5
‡³/<62/´
No.
Our No.
664-5956
($
SPONGE MOP REFILLS
Our No.
)';%
‡&<&/21,&92/7
‡³'867%867(5´
‡52//(539$
No.
Unit
QUICKIE MANUFACTURING
SPONGE MOP REFILLS
Our No.
Shf
Pk
&OHDQ
Path In.
)ORRU&DUH)ORRU3URWHFWLRQ
Unit
BIRDWELL CLEANING
664-5675
No.
ROYAL APPLIANCE MFG CO
5H¿OO IRU 1R 6.8
IRU(=:ULQJ0RS
)LWV GUDLQHUKDQGZULQJHU VSRQJH
PRS %LUGZHOO 1R 6.8
DQG PRVW SRSXODU
brands.
8VH RQ FDUSHWV XSKROVWHU\ VWDLUV
DQGFDUV5RWDWLQJSRZHUEUXVKIRU
deep, effective cleaning. Powerful
suction removes spills, spots, and
VWDLQV TXLFNO\ 7XUER GULYHQ EUXVKUROO URWDWLQJ EUXVKHV
R]FOHDQZDWHUFDSDFLW\R]GLUW\ZDWHUFDSDF
LW\ IW FRUG OHQJWK 6WDQGDUG JULS KDQGOH DPS
PRWRUYROW,QFOXGHVWULDOVL]HGLUWGHYLOFOHDQLQJVR
lution.
Our No.
‡(=:5,1*
‡³/<62/´
‡'5$,1(5+$1':5,1*(5
‡&(//8/26(:,7+
6&58%%(5
No.
SPOT SCRUBBER
($
SPONGE MOP REFILLS
Our No.
No.
STEAM VACS / EXTRACTORS
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
&+9
1
($
Maintenance, Repair & Operations - 173
CORDLESS HAND VACS
9DFXXP VWDLUV EDWKURRPV FDU
boat, or motor home. Filter keeps
hands from touching dirt when
HPSW\LQJ +LJK SRZHUHG IRU GHHS FOHDQLQJ 2QERDUG
WRROVWRUDJHDLUZDWWVR]FDSDFLW\8VHV9)
ZDVKDEOH¿OWHUV,QFOXGHVFUHYLFHWRROXSKROVWHU\EUXVK
ZDVKDEOH¿OWHUZDOOPRXQWKRRNDQGFKDUJLQJSOXJ
Our No.
)ORRU&DUH)ORRU3URWHFWLRQ
CORDLESS HAND VAC
FILTER BAGS
‡&203$&792/7
‡³'867%867(5'28%/(
$&7,21´
Shf
Pk
No.
Unit
VACUUM CLEANERS
‡³'867%867(5´
VACUUM CLEANERS
5HSODFHPHQW ¿OWHU IRU 2UJLOO 6NX
FRUGOHVVKDQGYDF$OVR
UHSODFHPHQW ¿OWHUV IRU 'XVWEXVWHU
PRGHO¶V &+9 DQG &+9
:KLWH
‡835,*+7%$*/(66
‡3(75(:,1'3/86
‡&<&/21,&),/75$7,21
‡³:,1'7811(/76(5,(6´
Our No.
Shf
Pk
No.
Unit
BLACK & DECKER
965-9715
1
9)
($
BLACK & DECKER
306-3963
1
&+99
($
CORDLESS HAND VAC
FILTER BAGS
‡³'867%867(5´
CORDLESS HAND VACS
‡:(7'5<5(&+$5*($%/(
‡92/7
For tough wet and dry pick up jobs.
(DV\ HPSW\ ERZO VR \RXU KDQGV
GRQ¶WWRXFKWKHGLUWVWDJH¿OWUD
tion provides clean air exhaust.
&RPHVZLWKFKDUJLQJSOXJ2QERDUGWRROVWRUDJHDLU
ZDWWVR]FDSDFLW\,QFOXGHV:HW'U\)LOWHU6\VWHP
XSKROVWHU\EUXVKVTXHHJHHFUHYLFHWRRO8VHV:)233
UHSODFHPHQW¿OWHUV
Our No.
Shf
Pk
No.
Unit
6HW RI SOHDWHG ¿OWHUV ¿WV 93
DOO+9DQG'%6HULHVFRUGOHVVKDQG
YDFXXPV (DVLO\ LQVHUWHG DQG UH
moved for disposal.
Our No.
1
&+9
($
Unit
BLACK & DECKER
410-5698
5
+9)
3LFNV XS GU\ GHEULV RU OLTXLG VSLOOV
RXW RI FDUSHW DQG EDUH ÀRRUV
)LQJHUWLS 2Q2II VZLWFK E\ HUJR
nomic handle. Bagless 8 oz.dirt
FXSLVHDV\WRHPSW\DQGFRPHVZLWKDZDVKDEOHUHXV
DEOH ¿OWHU :DOOPRXQWHG UHFKDUJLQJ VWRUDJH UDFN 8VHV
1R¿OWHU
Our No.
No.
Shf
Pk
Unit
HOOVER CO
372-0687
6
1
5HPRYHV GHHSO\ HPEHGGHG GLUW
from anywhere in your home or
FDU 8VH WR FOHDQ VWDLUV DQG DXWR
upholstery. Cleans with revolving
EUXVKUROO ZLWK 5LVHU 9LVRU D VWUHWFK KRVH DQG DWWDFK
PHQWVIRUJHWWLQJLQWRWLJKWVSDFHV5LVHU9LVRUEUXVKÀLSV
GRZQIRUYHUWLFDOVXUIDFHVDQGÀLSVXSIRUKRUL]RQWDOVXU
IDFHVDPSSRZHU¶FRUGDQG´[´[´FOHDQHU
GLPHQVLRQV8VHVEHOWDQG¿OWHU
Our No.
No.
Shf
Pk
Unit
EUREKA COMPANY
012-6235
71B
6HW UHSODFHPHQW ¿OWHU ¿WV DOO 9
6HULHVDQG93GU\YDFVRQO\
Our No.
No.
Shf
Pk
Unit
BLACK & DECKER
739-9447
9)
Our No.
No.
Shf
Pk
Unit
ROYAL APPLIANCE MFG CO
5
($
683-0038
05('
($
$OOHUJHQ PLFURQ ¿OWUDWLRQ UHWDLQV
100 percent of dust mites, grass
pollen and ragweed, plus particles
WLPHVVPDOOHUWKDQWKHGLDPHWHURIDKXPDQKDLU9L
EUD *URRPHU , EUXVK UROO VWHHO DVVHPEO\ ZLWK FOHDQLQJ
DFWLRQ WKDW YLEUDWHV RXW GHHSO\ HPEHGGHG GLUW SRVL
tion adjustable height offers optimal cleaning for multiple
FDUSHW DQG ÀRRU VXUIDFHV +HDGOLJKW LOOXPLQDWHV EHKLQG
DQGXQGHUIXUQLWXUH([WUDORQJ¶FRUGDPSPRWRU
+HDY\GXW\FORWKEDJ8VHV1R6.8
EHOWVDQG1R7\SH)DQG*EDJV
Our No.
Shf
Pk
No.
Unit
EUREKA COMPANY
1
&*
($
‡835,*+7%$*/(66
‡+(3$),/75$7,21
‡³&20)257&/($1´
Can be used for deep cleaning.
0RWRUL]HGEUXVKUROOFOHDQVHPEHG
ded dirt and pet hair better than
VXFWLRQDORQH%XLOWLQVWUHWFKKRVH
and crevice tool helps to clean those hard to reach areas
EHWZHHQVWDLUVDQGLQFDUV,QFOXGHVD¶FRUGVWDQGDUG
JULS KDQGOH ´ VWUHWFK KRVH DPS PRWRU ´ QR]]OH
width, on board tools, ready to use hose, upholstery
brush, and wand.
‡³'867%867(5'28%/(
$&7,21´
1
VACUUM CLEANERS
‡/,*+7:(,*+7
‡³',57'(9,/´
CORDLESS HAND VAC
FILTER BAGS
146-0963
($
CORDED HAND VACS
CORDLESS HAND VAC FILTER BAGS
13.5
Unit
HOOVER CO
685-3972
1
($
)ORRU&DUH)ORRU3URWHFWLRQ
8+
Shf
Pk
‡835,*+7%$**('
‡&200(5&,$/
‡$//(5*(1),/75$7,21
HAND VAC
‡/,*+7:(,*+7
‡³($6<&/($1´
‡:(7'5<5(&+$5*($%/(
‡92/7
&OHDQ
Path In.
VACUUM CLEANERS
CORDED HAND VACS
CORDLESS HAND VACS
No.
BX
)ORRU&DUH)ORRU3URWHFWLRQ
BLACK & DECKER
638-6601
Our No.
Shf
Pk
No.
8WLOL]HV WKUHH GLVWLQFW DLU FKDQQHOV
to lift and remove hidden, deep
GRZQ GLUW %RWWRPHPSW\ GLUW FRQWDLQHU VLPSOL¿HV GLUW
GLVSRVDO DQG UHGXFHV VSLOOV )LOWHU FOHDQLQJ FUDQN 1R
WRXFK ¿OWHU FOHDQLQJ V\VWHP HQKDQFHV YDFXXPV SHUIRU
PDQFH(PEHGGHGGLUW¿QGLQJVHQVRUJHWVXQVHHQGLUW
&RPSOHWHRQERDUGWRRONLWZLWKSHWKDLUWRRO+(3$PH
GLD WUDSV SHUFHQW RI GXVW DQG SROOHQV ¶ SRZHU
FRUG¶VWUHWFKKRVHSRVLWLRQKHLJKWDGMXVWPHQW,Q
cludes brushed edge cleaning, rotating pet power brush,
dusting brush, headlight, on board tools, turbo tools,
upholstery brush, wand, dirt cup, powered hand tool,
UHSODFHDEOH¿OWHUDQGFUHYLFHWRRODPSPRWRU0RWRU
L]HG EUXVK W\SH 6* EXPSHU W\SH + ¿OWUDWLRQ 'VKDSH
KDQGOH6KRVHW\SH:7QR]]OHW\SH
1
7HOHVFRSLFFRPIRUWJULSRYDOKDQGOH
reduces strain and offers an adjust
DEOHKHLJKWIRUHDFKXVHU$XWRPDW
ic cord rewind contracts cord with one easy touch. Con
WUROÀRRUVHWWLQJVZLWK\RXUIRRWWRPRYHWKURXJKRXWWKH
URRP DPS SRZHU ¶ FRUG 8VHV 6W\OH 8 ([WHQGHG
/LIH%HOW8%HOWDQG6W\OH+)+(3$)LOWHU
Our No.
No.
&OHDQ
Path In.
Shf
Pk
Unit
EUREKA COMPANY
400-7928
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
$=
14
1
($
174 - Maintenance, Repair & Operations
VACUUM CLEANERS
VACUUM CLEANERS
VACUUM CLEANERS
‡835,*+7%$*/(66
‡0,&52),/75$7,21
‡³/,*+763(('´
‡835,*+7%$**('
‡0,&52)5(6+),/75$7,21
‡³',57'(9,/
)($7+(5/,*+7´
‡835,*+7
‡%$*/(66
‡³(/(&752/8;1,0%/(´
/LJKWZHLJKW HTXLSSHG ZLWK DPS SRZHU TXDUW GXVW FXS D
PLFUR¿OWUDWLRQ V\VWHP WR UHGXFH
allergens and pet dander, extra long crevice tool and ex
WUDZLGHLQWHJUDWHGKRVHIRUKDUGWRUHDFKDUHDVDWÀRRU
OHYHO¶FRUG8VHV6W\OH8([WHQGHG/LIH%HOW%
8%HOW%DQG'XVW&XS¿OWHU'&)
Our No.
&OHDQ
Path In.
No.
Shf
Pk
Unit
EUREKA COMPANY
275-6468
13
'
1
($
(DV\ WR SXVK DQG HDV\ WR FDUU\
from room to room or up and down
VWDLUV3LFNVXSGXVWDQGGLUWTXLFNO\2QERDUGKRVHDQG
WRROVPDNHLWHDV\WRFOHDQVWDLUVDQGXSKROVWHU\6WUHWFK
KRVHDOORZV\RXWRUHDFKIDUWKHUWR¿QGGLUWDQ\ZKHUH
8VHVVWDQGDUGDLUV\VWHP0LFURIUHVK¿OWUDWLRQ0RWRUL]HG
EUXVKUROO%UXVKHGHGJHFOHDQLQJ6WDQGDUGEXPSHUW\SH
6LGH GLUW SDWK $XWRPDWLF KHLJKW DGMXVWPHQW ¶ FRUG
OHQJWKDPSPRWRU,QFOXGHVFUHYLFHWRROUHDG\WRXVH
hose, wand, dusting brush, blow molded hose, comfort
grip handle and headlight.
Our No.
380-3988
‡835,*+7%$*/(66
‡$//(5*(1),/75$7,21
‡³683(5/,7(´
&OHDQ
Path In.
Shf
Pk
Unit
EUREKA COMPANY
329-7504
443B
11
1
($
VACUUM CLEANERS
‡835,*+7%$**('
‡+(3$),/75$7,21
‡³%26660$579$&´
6HDOHG+(3$¿OWHUFDSWXUHV
of dust, allergens, and pet dander.
)HDWXUHV RQRII EUXVKUROO 3RZHU
3DZ ZLWK 5LVHU 9LVRU WXUER QR]]OH FRPIRUWDEOH RYDO
handle, height adjustment, and suction control switch.
,QFOXGHVGHOX[HXSKROVWHU\GXVWLQJDQGFUHYLFHWRROV
IWFRUGOHQJWK8VHV6W\OH55¿OWHUDLUHEDJDQG6W\OH5
extended life belt. 12 amps.
Our No.
No.
&OHDQ
Path In.
Shf
Pk
Unit
0
12.5
1
($
Shf
Pk
Unit
VACUUM CLEANERS
580-0669
‡835,*+7%$*/(66+(3$
‡48,&.9$&/,*+7:(,*+7
‡³',57'(9,/'<1$0,7(´
6WXUG\ PRWRU ZLWK D UHYROYLQJ
brush attacks messes and lifts
dirt more completely than suction
DORQH8QLTXHVFDWWHUJXDUGQR]]OHWUDSVGHEULVRQKDUG
surfaces. Can be used on both carpeted and hard sur
IDFHV ZLWKRXW VFUDWFKLQJ GHOLFDWH ¿QLVKHV IRRW FRUG
DOORZVYDFXXPWRFOHDQXSWRVTIWIURPRQHRXW
OHW8VHWKHLQQRYDWLYH&OLFN/RFNWRUHOHDVHWKH7HOHVFRSLF
0HWDO+DQGOHDQGZDWFKLWVOLGHGRZQIRUVWRUDJHLQWLJKW
linen closets, under the sink, bed or in the laundry room.
2IIHUV +(3$ ¿OWUDWLRQ ZKLFK WUDSV SHUFHQW RI SRO
OHQ DQG UDJZHHG DQG SHUFHQW RI GXVW DQG DOOHU
JHQV,QFOXGHVRQERDUGWRROVVXFKDV´EORZPROGHG
stretch hose, dust brush, ready to use hose, replaceable
¿OWHUZDQGDQGFUHYLFHWRRO,QFOXGHV(=HPSW\GLUWFXS
scatter guard nozzle, ready to grip stair cleaning handle
DQGVWDQGDUGDLUV\VWHPDPSPRWRU&HQWHU'LUW3DWK
+(3$¿OWUDWLRQ$XWRPDWLFKHLJKWDGMXVWPHQW7HOHVFRS
ing handle.
Our No.
&OHDQ
Path In.
No.
05('
11
0=
15
1
Shf
Pk
1
8+
13.5
Shf
Pk
Unit
HOOVER CO
099-6868
1
($
($
AIR MOVERS/CARPET DRYERS
AIR MOVER
‡0,1,63(('
'HVLJQHG WR GU\ ZHW FDUSHWV DQG
ÀRRUVZLWKVHFRQGDQGWKLUGSRVL
tion for drying walls and ceilings.
+DVDWKUHHVSHHGDLUÀRZFRQWURO
motor. Built in outlets to connect
multiple units together, and are stackable for easy stor
DJH&RUGOHQJWKLV¶KDVDFDUU\KDQGOHIRUHDV\PRELO
LW\DQGRQERDUGFRUGZUDSV$LU)ORZ&)09
+]$PSV:HLJKVSRXQGV<HOORZ
Our No.
Shf
Pk
No.
Unit
SHOP VAC CORP
021-4106
1032000
1
($
Brooms, Mops & Trash Bags
($
COMMERCIAL CAN LINERS
‡+($9<'87<%/$&.
‡:,7+7,(6
‡835,*+7
‡%$*/(66
‡³$,563(('*2/'´
)HDWXUHV FRUG UHZLQG ZLWK ¶
SRZHU FRUG ULQVDEOH ¿OWHU DQG D
+(3$¿OWHUSRVLWLRQFDUSHWKHLJKW
DGMXVWPHQW¶VWUHWFKKRVHV\VWHPFKHFNLQGLFDWRUQR
scuff bumper, easy belt change system and brushroll
DFFHVV ,QFOXGHV DLUSRZHUHG KDQG WRRO ´ H[WHQVLRQ
ZDQG FUHYLFH WRRO DQG XSKROVWHU\GXVWLQJ EUXVK DPSV8//LVWHG
&OHDQ
Path In.
1
Unit
VACUUM CLEANERS
‡835,*+7%$*/(66
‡³:,1'7811(/76(5,(6
5(:,1'´
No.
14
(/$
DRUM LINERS
($
VACUUM CLEANERS
Our No.
Unit
)ORRU&DUH)ORRU3URWHFWLRQ
ROYAL APPLIANCE MFG CO
636-2354
Shf
Pk
&OHDQ
Path In.
No.
EUREKA COMPANY
EUREKA COMPANY
513-4176
2QERDUGWRROVWRUDJHWRNHHSDFFHVVRULHVHDVLO\DFFHV
VLEOH8/F8/&HUWL¿FDWLRQIRUVDIHW\DQGUHOLDELOLW\
Our No.
)RU YDFXXPLQJ TXLFNO\ DQG HI¿
ciently. Brushroll can be turned on
and off so you can conveniently
PRYHEHWZHHQFDUSHWVDQGEDUHÀRRUV(DV\HPSW\GXVW
FXS¶FRUGOHQJWKDPSV8VHVGXVWFXS¿OWHU'&)
17.
No.
&OHDQ
Path In.
ROYAL APPLIANCE MFG CO
VACUUM CLEANERS
Our No.
No.
6PRRWK VZLYHO VWHHULQJ 3RZHUIXO
12 amp cyclonic technology pro
vides a deep clean and with no
ORVV RI VXFWLRQ 9HUVD7RRO LQ WRRO FOHDQV VWDLUV DQG
FUHYLFHV ZLWK HDVH &OHDQV FDUSHW DQG EDUH ÀRRUV IDVW
ZLWK WKH RQHWRXFK ÀRRU VHOHFWRU 6HDOHG +(3$ ¿OWUD
WLRQZLWKZDVKDEOH¿OWHUV%DJOHVVFRQYHQLHQFHZLWKRQH
TXDUWGXVWFDSDFLW\HDV\WRHPSW\FRQWDLQHU&RQYHQLHQW
KDQGOH GHVLJQ SXWV WKH VXFWLRQ FRQWUROV DW \RXU ¿QJHU
WLSV (DV\ UHOHDVH RQERDUG FRUG ZUDS IRU TXLFN DQG
compact storage.
6XSHUVWURQJIRUWRXJKFOHDQXSV
'HHSFOHDQLQJUHPRYHVPRUHWKDQ
MXVW WKH GLUW \RX VHH $LU6SHHG
7HFKQRORJ\¶V VKRUWHU DLU SDWK DQG
ZLGHU WXEHV LQFUHDVH WKH DPRXQW RI DLUÀRZ IRU SRZHU
IXOVXFWLRQIHHWRI([WHQGHG5HDFKZLWKIWKRVH
SOXVIWRIFRUG3RZHUDPSV&OHDQHUGLPHQVLRQV
´:[³/[³+
Our No.
No.
&OHDQ
Path In.
Shf
Pk
Our No.
Cap
*DO
No.
Shf
Pk
Unit
1
BX 40
Shf
Pk
Unit
PRIMROSE PLASTICS
´[´[0LO%R[HG
793-9374
55040
55
Unit
EUREKA COMPANY
989-0245
$6$
14
1
($
DRUM LINERS
‡+($9<'87<%/$&.
‡:,7+7,(6
6XSHUVWURQJIRUWRXJKFOHDQXSV
Our No.
No.
Cap
*DO
PRIMROSE PLASTICS
´[´[0LO3RO\EDJJHG
237-5228
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
55010
55
10
PK 10
Maintenance, Repair & Operations - 175
Brooms, Mops & Trash Bags
DRUM LINERS
TRASH BAGS
TRASH & YARD BAGS
‡21(%<21(',63(16,1*
‡758(7,()/$36
‡³+86.<´
‡)25<$5'6%/$&.
‡%<',63(16,1*
‡(;75(0(675(1*7+
‡³+86.<´
TRASH BAGS
‡+($9<'87<
‡%/$&.:,7+7,(6
¶´[¶´[0LO
¶´[¶´[0LO
6XSHUVWURQJIRUWRXJKFOHDQXSV
Our No.
Cap.
Gals.
No.
Shf
Pk Unit
Color
Our No.
POLY-AMERICA INC
60 Bags - Boxed
534-2902
55
+.:&&
Our No.
1
&OHDU
%;
Cap
Gal
No.
Cap
Gal
No.
Shf
Pk
Unit
6
%;
Shf
Pk
Unit
6
%;
POLY-AMERICA INC
Shf
Pk
Unit
740-2357
1
%;
TRASH BAGS
+.%
MINTCRAFT
33” x 40” x 1.25 Mil. - Boxed
290-8044
CAN LINERS
‡&200(5&,$/
‡,1'8675,$/'87<
‡³3/$678))´
TRASH BAGS
5HVLVWV SXQFWXUHV WHDUV DQG ]LS
SHUVSURYLGHVXQLIRUPEDJTXDOLW\
1R VLGH VHDPV RU VHDOV WR EUHDN
VSOLW RU WHDU %RWWRP VHDO IRU DGGHG VWUHQJWK *DO
PHDVXUHV ¶´ [ ¶´ WR *DO PHDVXUHV ¶´ [
¶´DQG*DOPHDVXUHV¶´[¶´
Our No.
Cap
Gal
No.
Shf
Pk
Unit
6XSHUVWURQJIRUWRXJKFOHDQXSV
Our No.
POLY-AMERICA INC
Cap
Gal
No.
Shf
Pk
2’ 9” x 3’ 4” x .8 Mil.
Unit
709-1366
3.
TRASH BAGS
1
&7
1
&7
699-9098
/65+%
699-9130
/65;*
WR
1
&7
699-9072
/65;*
1
&7
Gray 1.3 Mil - Boxed
White .74 Mil - Boxed
699-9106
/65;:
WR
1
&7
699-9056
/65;:
1
&7
TRASH BAGS
0LFUREDQ LQKLELWV WKH JURZWK RI
RGRUFDXVLQJEDFWHULD'UDZVWULQJ
IRUHDV\FORVLQJ8OWUDVWURQJ3O\
ODPLQDWHG EDJ 6SDFH VDYLQJ VHOI
GLVSHQVLQJ SDFNDJLQJ (QYLURQPHQWDOO\ IULHQGO\ PDGH
IURP UHF\FOHG PDWHULDO 7RQH EDJ EODFN RQ WKH
RXWVLGHZKLWHRQWKHLQVLGH
‡)25<$5'6%/$&.
‡:,7+'5$:675,1*6
‡³+86.<´
Cap
Gal
No.
Shf
Pk
Unit
POLY-AMERICA INC
512-0639
‡,1'8675,$/
‡³+86.<´
&OHDUFRORUSODVWLFGUXPOLQHUV,Q
GXVWULDOXVDJHPLOWKLFNQHVV
Cap
Gal
+:<
55
Shf
Pk
Unit
1
%;
TRASH
COMPACTOR BAGS
‡³.,7&+(10$67(5´
)LWV PRVW EUDQGV RI UHFWDQJXODU
VKDSHG WUDVK FRPSDFWRUV 0DGH
ZLWK ZHWVWUHQJWK GUDIW SDSHU DQG
D SRO\ OLQHU 3UHFXIIHG WRS SURYLGHV VQXJ ¿W IRU HDV\
LQVHUWLRQ DQG UHPRYDO 6WURQJ SXQFWXUHUHVLVWDQW ZHW
VWUHQJWKSDSHUFRPELQHGZLWKDSODVWLFOLQHU\LHOGVDVX
SHULRUEDJLPSHUYLRXVWRPRLVWXUHDQGHYHQUDLQ
Unit
SMURFIT-STONE
231-4367
Cap
Gal
No.
Shf
Pk
Unit
+.'6%
6
%;
327-5716
12
($
Cap
Gal
No.
+.'6%
Our No.
No.
Cap
Gal
Shf
Pk
Unit
24
($
Shf
Pk
Unit
24
($
ALUF PLASTICS
327-5666X
%
TRASH BAGS
‡-80%2
‡³8/75$6$&´
Shf
Pk
4XDOLW\ EDJV ZLWK YDOXH SULFLQJ
0DGH ZLWK SUHPLXP YLUJLQ UHVLQV
([WUDVWURQJ(DV\WRVWRUHLQGUDZ
HUVFDPSHUVJORYHFRPSDUWPHQWV
HWF
Unit
Our No.
No.
Cap
Gal
ALUF PLASTICS
2’ 9” x 3’ 2” x .8 Mil.
329-3305
Unit
ALUF PLASTICS
18 Count
‡/$5*(%/$&.
‡:,7+'5$:675,1*6
‡³+86.<´
3.
Shf
Pk
4XDOLW\ EDJV ZLWK YDOXH SULFLQJ
0DGH ZLWK SUHPLXP YLUJLQ UHVLQV
([WUDVWURQJ(DV\WRVWRUHLQGUDZ
HUVFDPSHUVJORYHFRPSDUWPHQWV
HWF
POLY-AMERICA INC
Cap
Gal
‡³8/75$6$&´
TRASH BAGS
Our No.
No.
TRASH BAGS
2’9” x 3’2” x .9 Mil.
259-1998
Shf
Pk
%;
POLY-AMERICA INC
TRASH COMPACTOR BAGS
No.
6
‡/$5*(%/$&.
‡:,7+'5$:675,1*6
‡³+86.<´
Our No.
Brooms, Mops & Trash Bags
Our No.
TRASH BAGS
POLY-AMERICA INC
613-5842
+.'6%
Our No.
20 Count
2’9” x 3’5” x 1 Mil
DRUM LINERS
No.
‡/$5*('5$:675,1*
‡³+$5021<;´
Our No.
Our No.
+.%
33” x 40” x 1.25 Mil. - Polybagged
461-4400
Black .65 Mil - Boxed
Cap
Gal
No.
PRIMROSE PLASTICS
Black .45 Mil - Boxed
/65+%
‡+($9<'87<
‡%/$&.:,7+7,(6
Our No.
TYCO PLASTICS
699-9114
‡/$5*(%/$&.
‡%<',63(16,1*:,7+
7,(6
‡³+86.<´
3.
5 Count
327-5674X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%
45
176 - Maintenance, Repair & Operations
LAWN & LEAF BAGS
LAWN & LEAF
BAGS
*DOORQEDJ´[´[´(Q
YLURQPHQWDOO\IULHQGO\
Our No.
Shf
Pk
No.
Unit
Cap
Gal
No.
327-5682
12
%
EXVKHOFDSDFLW\
Our No.
Unit
1
%;
LAWN & LEAF BAGS
Cap
Gal
No.
Shf
Pk
Unit
POLY-AMERICA INC
Our No.
+.'6&0
377-6721
1
%;
780-2630
1
%;
1
%;
Cap
Gal
Shf
Pk
Unit
ALUF PLASTICS
´[´[´
)LWVLQQDUURZVSDFHV/LGFRQFHDOV
JDOORQJDUEDJHEDJV
715-8843
Shf
Pk
Unit
Our No.
7
1
%;
Shf
Pk
Unit
12
646-8375
/:+7
52
6
($
Our No.
No.
Color
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
7 Bushel - 32” x 50” x 3 Mill. Polybagged
Unit
NEWELL RUBBERMAID HOME
2SHQZDVWHEDVNHWZLWKEDJ/DWFK
HV
PRIMROSE PLASTICS
975-2965
Shf
Pk
‡23(1
6XSHUVWURQJIRUWRXJKFOHDQXSV
No.
Size
Qt
No.
WASTEBASKETS
‡+($9<'87<%/$&.
‡:,7+7,(6
Our No.
%;
‡/,1(5/2&.635,1*723
Cap.
Bushel
1
WASTEBASKETS
3.
18 Count
Brooms, Mops & Trash Bags
CONTRACTOR TRASH
BAGS
0LFUREDQ LQKLELWV WKH JURZWK RI
RGRUFDXVLQJEDFWHULD'UDZVWULQJ
IRUHDV\FORVLQJ8OWUDVWURQJ3O\
ODPLQDWHG EDJ 6SDFH VDYLQJ VHOI
GLVSHQVLQJ SDFNDJLQJ (QYLURQPHQWDOO\ IULHQGO\ PDGH
IURP UHF\FOHG PDWHULDO 7RQH EDJ EODFN RQ WKH
RXWVLGHZKLWHRQWKHLQVLGH
327-5724
+.'6%8
WASTEBASKETS
No.
Unit
2’ 6” x 2’ 10” x 1.50 Mil.
851-0471
‡+($9<'87<%/$&.
‡:,7+7,(6
Our No.
Shf
Pk
POLY-AMERICA INC
3.00 MIL - Boxed
‡'5$:675,1*
‡³+$5021<;´
No.
Cap
Gal
No.
PRIMROSE PLASTICS
LAWN & LEAF BAGS
Our No.
Unit
PRIMROSE PLASTICS
2’ 9” x 3’ 4” x 1 Mil.
763-8778
%;
RECYCLING BAGS
CONTRACTOR TRASH
BAGS
‡&/($5:,7+
'5$:675,1*6
‡³+86.<´
1
‡%/8(:,7+
'5$:675,1*6
‡³+86.<´
32” x 50” x 3 Mil
33” x 48” x 1.25 Mil. - Boxed
,19&%,
RECYCLING BAGS
Shf
Pk
No.
MINTCRAFT
Unit
Brooms, Mops & Trash Bags
6XSHUVWURQJIRUWRXJKFOHDQXSV
No.
Shf
Pk
($
CONTRACTOR TRASH
BAGS
Shf
Pk
No.
107-1760
24
‡+($9<'87<%/$&.
‡:,7+7,(6
Cap
Gal
Our No.
TEX-TRUDE
‡+($9<'87<
‡%/$&.:,7+7,(6
Our No.
Unit
3.
LAWN & LEAF BAGS
542-5962
Shf
Pk
6 Count
50 Lb. - Wet-Strength
Our No.
)RUWRXJKFOHDQXSVJDOORQ´
[ ´ [ PLO ,QFOXGHV WZLVW WLHV
EDJV
ALUF PLASTICS
DURO BAG MFG CO
659-0137
‡³;75(0(´
4XDOLW\ EDJV ZLWK YDOXH SULFLQJ
0DGH ZLWK SUHPLXP YLUJLQ UHVLQV
([WUDVWURQJ(DV\WRVWRUHLQGUDZ
HUVFDPSHUVJORYHFRPSDUWPHQWV
HWF
‡3/<.5$)73$3(5
‡648$5(%27720
‡³*$5%$;´
Our No.
CONTRACTOR TRASH
BAGS
‡³8/75$6$&´
32 Quart Capacity
625-3868
/:+7
:KLWH
6
($
Shf
Pk
Unit
($
CONTRACTOR TRASH
BAGS
WASTEBASKETS
‡67(36/,0),7
‡+($9<'87<%/$&.
‡³+86.<´
Our No.
Cap
Gal
No.
,QFOXGHV VWHSRQ PHFKDQLVP DO
ORZLQJOLGWRVWD\RSHQIRUIRRWIUHH
RSHUDWLRQRUVZLQJFORVHGOLNHWUD
GLWLRQDOVWHSFDQV´[´[´
Shf
Pk
Unit
POLY-AMERICA INC
+.%
42
No.
Color
NEWELL RUBBERMAID HOME
2’ 9” x 4’ x 3 Mil.
219-9818
Our No.
1
%;
45 Quart Capacity
361-6679X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
:+7
:KLWH
2
($
Maintenance, Repair & Operations - 177
WASTEBASKETS
WASTEBASKETS
GARBAGE PAILS
‡3/$67,&
‡9$1,7<3/$67,&
Tapered design creates a mod
HUQORRN5LPKROGVZDVWHEDJVLQ
SODFH'RHVQ¶WUXVWOLNHPHWDOZDVH
EDVNHWV 5HVLQ IDFLOLWDWHV FOHDQOL
QHVV FRPSDUHG WR PHWDO /
'LPHQVLRQ´/[´:[´+$'LPHQVLRQ
´/[´:[´+
$WWUDFWLYH FRQWHPSRUDU\ VW\OLQJ LQ
DQHDV\WRFOHDQPDWHULDOIRUVDQL
WDU\KRXVHNHHSLQJ´[[
´
‡:,7+723
‡0(7$/
Our No.
No.
Color
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
/:+7
:KLWH
No.
Shf
Pk
Color
Unit
NEWELL RUBBERMAID HOME
:+7
($
646-5751
8QLTXH VKDSH DGGV VW\OH WR DQ\
URRP´[´[´
Our No.
Color
Unit
NEWELL RUBBERMAID HOME
&OHDU
6
No.
646-6551
Shf
Pk
Color
:+7
($
Our No.
Unit
%LVTXH
6
($
:KLWH
6
($
73%,648
%LVTXH
6
($
625-7000
1791162
$TXDPDULQH
6
($
607-1153X
73:+7
:KLWH
6
($
643-4641
No.
No.
:%
Unit
6
($
6
($
Cap
Qt
Color
:KLWH
Shf
Pk Unit
6
($
TRASH CANS
JDO FDQV PHDVXUH ´ WRS
GLDPHWHU [ ´+ JDO FDQV
PHDVXUH ´ WRS GLDPHWHU [
´+
‡0(',803/$67,&
5ROOHGULPVIRUGXUDELOLW\DQGHDV\
FOHDQLQJ $OOSODVWLF FRQVWUXFWLRQ
ZLOO QRW FKLS UXVW RU GHQW (DVLO\
¿WVXQGHUVWDQGDUGGHVN´/
[´:[´+
No.
Color
Our No.
675-5219
'XUDEOHOLJKWZHLJKW6WDQGVXSWR
DEXVH ZLWK H[WUDWRXJK ULP DQG
VLGHV 6WHSRQ PHFKDQLVP DOORZV
IRUKDQGVIUHHGLVSRVDOLQ
[LQ[LQ
Color
Shf
Pk
33 Quart Capacity
6
%ODFN
Shf
Pk
Unit
Unit
693-1166
6
($
693-1190
6
($
Hot Dipped
1
($
693-1455
6
($
623-1484
6
($
Cap
Gal.
Shf
Pk
Unit
2
TRASH CANS
Unit
NEWELL RUBBERMAID HOME
:KLWH
%/$
Cap
Gal
Galvanized Sheetware
Shf
Pk
28-1/8 Quart Capacity
‡3/$67,&67(321
No.
DOVER PARKERSBURG
NEWELL RUBBERMAID COMMERCIAL
WASTEBASKETS
:+7
[
WASTEBASKETS
878-1585X
Shf
Pk
COMMERCIAL
WASTEBASKETS
Our No.
674-7323
‡0(7$/
625-7042
No.
($
INTER-DESIGN
Shf
Pk
36 Quart Capacity
Our No.
6
UNITED PLASTICS
21 Quart Capacity
:+7
[
&RPHVZLWK'XDO$FWLRQOLGVZLQJV
GRZQ RU OLIWV XS )LWV VWDQGDUG
NLWFKHQSRO\EDJV
NEWELL RUBBERMAID HOME
607-1112X
($
TRASH CANS
6
:KLWH
Our No.
Color
6
Brooms, Mops & Trash Bags
6 Quart Capacity
&ODVV $PHULFDQ VW\OH :KLWH SRZ
GHUFRDWHG ¿QLVK ZLWK FKURPH
EDVH
'XUDEOH OLJKWZHLJKW IHDWXUHV H[
WUDWRXJKULPDQGVLGHVWKDWVWDQG
XS WR DEXVH TW PHDVXUHV ´/
[ ´: [ ´+ TW PHDVXUHV
´/[´:[´+
[
‡'8$/$&7,21/,'
‡+20(3/$67,&
5(&7$1*8/$5
625-6705
&
Unit
($
WASTEBASKETS
No.
($
6 Gallon Capacity
WASTEBASKETS
Our No.
6
10 Gallon Capacity
623-1450
NEWELL RUBBERMAID HOME
626-2588
9 Quart Capacity
&/5
[
HOT DIPPED
$WWUDFWLYH FRQWHPSRUDU\ VW\OLQJ LQ
DQHDV\WRFOHDQPDWHULDOIRUVDQL
WDU\ KRXVHNHHSLQJ ´ [ ´ [
´
‡9$1,7<
‡³63$:25.6´
845-7525X
&
6 Gallon Capacity
WASTEBASKETS
No.
Unit
10 Gallon Capacity
($
‡9$1,7<3/$67,&
Shf
Pk
Shf
Pk
GALVANIZED SHEETWARE
6
:KLWH
623-1500
Dia x
Ht In
No.
DOVER PARKERSBURG
WASTEBASKETS
Our No.
Our No.
14 Quart Capacity
626-7074
12 Quart Capacity
386-4030
Our No.
5HLQIRUFLQJ ULPV WRS DQG ERWWRP
)UHHVZLQJLQJ EDLO ORFNV ZKHQ LQ
XSULJKWSRVLWLRQ
($
‡$8720$7,&728&+)5((
%ODFN $%6 OLG DQG VWDLQOHVV VWHHO
EUXVKHG¿QLVK6WUDLJKWERG\ZLWK
RQRIIVZLWFK'LPHPVLRQV´'[
´+7DNHV³'´VL]HEDWWHU
LHV1RW,QFOXGHG
Our No.
No.
HOMEBASIX
437-3593
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
=<6/3
($
- Maintenance, Repair & Operations
TRASH CANS
COMMERCIAL
RECYCLE CONTAINERS
‡$872728&+/(66
TRASH CANS
‡3/$67,&5281'
‡61$321/,'
‡³528*+58**('´
‡67$&.$%/(
‡³+86.((´
Our No.
Cap
Gal
No.
Shf
Pk
Unit
HOMEBASIX
021-0112
9
=<6/0
4
($
0ROGHG RI HQJLQHHUHG UHVLQV
)URP IRRG SUHS WR IRXQGULHV WR
ELRKD]DUG ZDVWH WKHVH UHFHSWDFOHV NHHS RQ ZRUNLQJ
1HVWDEOHZLWKOLGRII³5(&<&/(´ZULWWHQRQIURQWRIFDQ
/,'6 62/' 6(3$5$7(/< 1R 2UJLOO 6.8 1R
Our No.
Cap
Gal
No.
Color
Shf
Pk
TRASH CANS
6
%OXH
Our No.
No.
Cap
Gal
($
Shf
Pk
Unit
UNITED PLASTICS
Black
Unit
CONTINENTAL COMMERCIAL
706-3456
8VHIRUWUDVKVWRUDJHODZQJDU
GHQXVHVVHHGFKHPLFDOVWRUDJH
RUGRJIRRGVWRUDJH0ROGHGRIGXUDEOHSRO\SURS\OHQH
036-0198X
7%
26
5
($
165-9655X
7%
6
($
‡67(3
5RXQGVKDSHÀDWOLG6L]H´+[
´ ' 7KLFNQHVV PP 9H
QHWLDQ%URQ]H¿QLVK
Our No.
No.
Cap
Gal
RECYCLE TRASH CANS
Shf
Pk
Unit
HOMEBASIX
091-6536
/<3
7
1
($
509-6995X
COMMERCIAL
RECYCLE CONTAINER
LIDS
Shf
Pk Unit
Color
7%
6
5HF\FOH%OXH
($
RECYCLE CONTAINERS
/LG LV PDGH IURP HQJLQHHUHG UHV
LQV DQG KDV VHDPOHVV FRQVWUXFWLRQ PDNLQJ LW HDV\WR
FOHDQGXUDEOHDQGORQJODVWLQJ/LGV¿WVQXJO\WRFRQWDLQ
DQG FRQFHDO WUDVK DQG RGRUV :LWK OLGV RQ UHFHSWDFOHV
FDQEHVWDFNHG)LWV1R%/JDOORQUHF\FOHFRQ
WDLQHU6.8&$1621/<LVZULWWHQRQWKHOLG
Shf
Pk
Unit
Cap
Gal
No.
78
19
Shf
Pk Unit
Color
6
5HF\FOH%OXH
($
CONTINENTAL COMMERCIAL
029-8984
6
:KLWH
No.
Cap
Gal.
Shf
Pk
Unit
UNITED PLASTICS
300-1849X
7%
6
($
0ROGHG RI GXUDEOH SRO\SURS\OHQH
+HDY\GXW\FRQVWUXFWLRQ
UNITED PLASTICS
112-5764X
Our No.
‡3/$67,&5281'
‡61$321/,'
‡³528*+58**('´
3RO\ URSH KDQGOHV LQ ZKLWH /D
EHOV LQFOXGHG IRU SDSHU JODVV DQG
SODVWLF'XUDEOHFRQVWUXFWLRQ(&2
6HQVHFRQVWUXFWLRQ
Our No.
,QFOXGHVODUJHZKHHOVIRUSRUWDELO
LW\KRRNORFNLQJKDQGOHIRUSUR
WHFWLQJFDQIURPURGHQWVDQGRWKHUDQLPDOV%ORZ0ROGHG
FRQVWUXFWLRQIRUDGGHGVWUHQJWKDQGGXUDELOLW\
TRASH CANS
‡5(&7$1*8/$578%
‡+($9<'87<
‡³+86.((´
Color
Cap
Gal
No.
UNITED PLASTICS
RECYCLING CONTAINERS
No.
‡3/$67,&5(&7$1*8/$5
‡:+((/('
‡³528*+58**('´
5XJJHG ZKHHOV DQG VWXUG\ KDQGOH
IRU HDV\ WUDQVSRUW 6QDS RQ OLG
ORFNVVHFXUHO\'XUDEOHEORZPROG
HGZHDWKHUUHVLVWDQWFRQVWUXFWLRQ
(&26HQVH&RQVWUXFWLRQ
Our No.
Brooms, Mops & Trash Bags
Our No.
TRASH CANS
‡61$321/,'
‡:+((/('
Our No.
Cap
Gal.
Shf
Pk
Unit
UNITED PLASTICS
Black
308-6014X
($
No.
7,
6
($
Brooms, Mops & Trash Bags
REFUSE CONTAINERS
COMMERCIAL
RECYCLE CONTAINERS
5HLQIRUFHGEDVHWDNHVURXJKFRP
PHUFLDOXVHDQGUROOHGULPSURYLGHV
VWUHQJWKDVZHOODVDFRQYHQLHQWDUHDWROLIWRUSXOO
SHUFHQW PRUH FDSDFLW\ HTXDWHV WR ODERU DQG SRO\ OLQHU
VDYLQJV)RUXVHZLWK1R7:+6NX7LS
WRSOLG
Our No.
No.
Shf
Pk
Unit
CONTINENTAL COMMERCIAL
7,.6
25
/LGSURYLGHVDVHFXULW\ORFNLQJIHD
ture that locks in odors and locks
RXWURGHQWV5XJJHGJULSKDQGOHV
5XJJHG KHDY\ZDOO FRQVWUXFWLRQ ZLWKVWDQGV LQWHQVH
VXQOLJKW DQG IUHH]LQJ WHPSHUDWXUHV 0HDVXUHV ´ [
´[´
Our No.
No.
Color
Shf
Pk
Unit
,QFOXGHVODUJHZKHHOVIRUSRUWDELO
LW\KRRNORFNLQJKDQGOHIRUSUR
WHFWLQJFDQIURPURGHQWVDQGRWKHUDQLPDOV%ORZ0ROGHG
FRQVWUXFWLRQIRUDGGHGVWUHQJWKDQGGXUDELOLW\
Our No.
904-5592X
NEWELL RUBBERMAID HOME
4
011-8588
%/$
%ODFN
6
No.
Cap
Gal.
Shf
Pk
Unit
UNITED PLASTICS
20 Gallon Capacity
Blue
374-2095
‡3/$67,&5(&7$1*8/$5
‡:+((/('
‡³528*+58**('´
‡3/$67,&5281'
‡61$321/,'
‡52//('5,0
‡³6:,1*/,1(´
Cap
Gal
TRASH CANS
TRASH CANS
($
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7%
45
4
($
Maintenance, Repair & Operations - 179
TRASH CANS
‡5281':,7+:+((/6
‡7:,67/2&.,1*/,'
‡³528*+58**('´
3RUWDEOH RQ SDYHPHQW JUDYHO RU
ODZQ/RFNLQJOLGNHHSVRXWURGHQWV
DQGRWKHUDQLPDOV'XUDEOHFRQVWUXFWLRQ
Our No.
Cap
Gal
No.
Shf
Pk
Unit
UNITED PLASTICS
086-7564X
7%
4
($
REFUSE
CONTAINERS
REFUSE
CONTAINERS
‡3/$67,&:+((/('
61$321/,'
‡³528*+1(&.´
‡3/$67,&:+((/('
)5,&7,21/,'
‡³528*+1(&.´
+HDY\GXW\ ZKHHOV SURYLGH HDV\
WUDQVSRUW RYHU JUDYHO DQG RWKHU URXJK VXUIDFHV 5XJ
JHG KHDY\ZDOO FRQVWUXFWLRQ VWDQGV XS WR LQWHQVH VXQ
OLJKW DQG VXEIUHHH]LQJ WHPSHUDWXUHV ZLWKRXW FUDFNLQJ
GHQWLQJRUUXVWLQJ6QDSRQOLGPDLQWDLQVVKDSH´
[´[´
6QDS¿W OLG ZLWK KDQGOHV WKDW ORFN
GRZQSURYLGHVVHFXULW\DQGH[WUDSURWHFWLRQDJDLQVWUR
GHQWV SHWV HWF +HDY\GXW\ ZKHHOV SURYLGH HDV\ SRU
WDELOLW\IRUODUJHORDGV'XUDEOHFRQVWUXFWLRQZLWKVWDQGV
LQWHQVHVXQOLJKWDQGIUHH]LQJWHPSHUDWXUHV´[´
[´
Our No.
No.
Color
Shf
Pk
Unit
UNITED PLASTICS
680-4975X
+ROGV WZR JDO FDQV 'XUDEOH
´ WXEXODU DOXPLQXP IUDPH ZLWK
´ ZKHHOV RQ KHDY\GXW\ D[OH ´/[´:[´+
Shf
Pk
No.
Unit
DOVER PARKERSBURG
646-5090
1
($
+HOSVSUHYHQWVDQLPDOVIURPSU\LQJ
WKHOLGRIIRIWKHWUDVKFDQNHHSLQJ
FRQWHQWV VHFXUH +HDY\GXW\ KDQGOH DQG TXLFN UHOHDVH
ODWFK([WUDWKLFNZDOOVDUHEXLOWZLWKWRXJKKLJKGHQVLW\
SRO\HWK\OHQHSODVWLF
625-2647X
Color
Shf
Pk
Unit
32 Gallon Capacity
2OLYH6WHHO
6
6
($
Shf
Pk
Unit
REFUSE CONTAINERS
‡121:+((/('61$321
/,'
‡+($9<'87<
No.
Color
Shf
Pk
,QGXVWULDO VWUHQJWK ZLWK H[FHS
WLRQDOO\ VWURQJ HDV\ JULS KDQGOHV
'XUDEOH FRQVWUXFWLRQ ZLWKVWDQGV
LQWHQVHVXQOLJKWDQGIUHH]LQJWHPSHUDWXUHV
Our No.
Cap
Gal
No.
NEWELL RUBBERMAID HOME
Black With Gray Lid
Unit
472-2658
%/$
4
%ODFN
($
REFUSE CONTAINERS
%/$
6
($
‡3/$67,&61$3),7/,'
‡³528*+1(&.´
REFUSE CONTAINERS
6QDS¿W OLG SURYLGHV VHFXULW\ ORFN
LQJIHDWXUHVWKDWORFNLQRGRUVDQG
ORFN RXW URGHQWV 5XJJHG JUDE
through handles make transport
HDVLHU'XUDEOHFRQVWUXFWLRQVWDQGVXSWRLQWHQVHVXQOLJKW
DQGVXE]HURWHPSHUDWXUHV
No.
Cap
Gal
Shf
Pk
Our No.
Unit
Black
Color
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
50 Gallon Capacity
(*51
50
(YHUJUHHQ
4
($
946-0932
%.
2
($
REFUSE CONTAINERS
Color
Shf
Pk
32 Gallon Capacity
840-3727X
(*51
(YHUJUHHQ
($
625-8438X
%/$=%
%OXH
($
0ROGHG LQ KDQGOHV UXJJHG VW\OLQJ
DQG LQFOXGHV EDJ FLQFK DQG OLG DW
WDFKPHQWDUHD
Our No.
(YHUJUHHQ
Shf
Pk
Unit
Black
626-9674X
6
Cap
Gal
NEWELL RUBBERMAID HOME
30 Gallon Capacity
(*51
No.
Unit
NEWELL RUBBERMAID HOME
938-9388X
Unit
NEWELL RUBBERMAID HOME
‡³528*+1(&.´
5HFWDQJXODU WR VDYH VSDFH 5XJ
JHGJUDEWKURXJKKDQGOHVIRUHDV
LHU WUDQVSRUW6QDSRQOLGSURYLGHV
VHFXULW\ORFNLQJIHDWXUHWKDWORFNVLQRGRUVDQGORFNVRXW
URGHQWV
No.
Shf
Pk
REFUSE
CONTAINERS
‡3/$67,&5(&7$1*8/$5
‡61$321/,'
‡³528*+1(&.´
Our No.
Color
Base/Lid
No.
CONTINENTAL COMMERCIAL
,QGXVWULDO VWUHQJWK 6QDS¿W OLG
6WURQJPROGHGLQKDQGOH'XUDEOH
VKDWWHUSURRI PDWHULDO ZLWKVWDQGV
VHYHUHZHDWKHUFRQGLWLRQV+HDY\
GXW\UXEEHUL]HGZKHHOVPDNHWUDVKGD\OHVVVWUHQXRXV
´[´[´
No.
839-9099
35 Gallon Capacity
Our No.
‡,1-(&7,2102/'('
:+((/('
569-4831X
($
3ODVWLF FRQWDLQHU ZLWK D KLQJHG
GRXEOH ZDOOHG OLG DQG VWDQGDUG ´
QRQPDUNLQJZKHHOV
($
REFUSE CONTAINERS
Our No.
Black
4
‡³7,/71¶:+((/´
50)
Unit
NEWELL RUBBERMAID HOME
UNITED PLASTICS
500-5954
(YHUJUHHQ
‡3/$67,&:+((/('
61$321/,'
‡³528*+1(&.´
Our No.
No.
50
REFUSE
CONTAINERS
‡/2&.,1*/,'
‡³$1,0$/67233(5´
Shf
Pk
UNITED PLASTICS
+HDY\GXW\ ZKHHOV SURYLGH HDV\
WUDQVSRUW RYHU JUDYHO DQG RWKHU URXJK VXUIDFHV 5XJ
JHG KHDY\ZDOO FRQVWUXFWLRQ VWDQGV XS WR LQWHQVH VXQ
OLJKW DQG VXEIUHHH]LQJ WHPSHUDWXUHV ZLWKRXW FUDFNLQJ
GHQWLQJRUUXVWLQJ6QDSRQOLGPDLQWDLQVVKDSH´
[´[´
REFUSE
CONTAINERS
Our No.
Cap
Gal
No.
45 Gallon Capacity
REFUSE CADDY
Our No.
Our No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
- Maintenance, Repair & Operations
Wild Bird, Pet Care & Farm Supplies
REFUSE CONTAINERS
REFUSE
CONTAINERS
‡52//287&217$,1(5
‡³5(&<&/(´
:LWKOLG&RQVWUXFWHGRI'XU[UHVLQ
IRUVWUHQJWKDQGGXUDELOLW\+HDY\
GXW\ ´ ZKHHOV IRU HDV\ PRELOLW\ 0DQ\ XVHV LQFOXGLQJ
JHQHUDO UHIXVH FROOHFWLRQ WRZHO RU OLQHQ FROOHFWLRQ DQG
PLVFHOODQHRXVSDUWVVWRUDJHWUDQVSRUW
Our No.
Capacity
Gallons
No.
Shf
Pk
Unit
CONTINENTAL COMMERCIAL
641-6556
%/8(
1
REFUSE CONTAINER
LIDS
COMMERCIAL REFUSE
CONTAINERS
‡3/$67,&61$321
5281'
‡³%587(´
‡3/$67,&5281'
‡³%587(´
7LJKW¿WWLQJ ZLWK QHVWLQJ KDQGOHV
WR DOORZVHFXUH ¿W IRU VLGHE\VLGH
FRQWDLQHU XVH 5RXQGHG FRUQHUV DQG VPRRWK FRQWRXUV
IRUHDV\FOHDQLQJ´GLDPHWHU[´+¿WVJDO
%UXWH1RDQG0RELOH%UXWH1RURXQGFRPPHU
FLDOUHIXVHFRQWDLQHUV´[´¿WVJDO%UXWH
1RDQG0RELOH%UXWH1RDQG´[´¿WV
JDO1R
Our No.
Dia x
Ht In
No.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
($
Gray
Brooms, Mops & Trash Bags
COMMERCIAL REFUSE CONTAINERS
675-5896
*5$<
[
6
($
675-5904
%/.
[
4
($
675-5912
*5$<
[
($
REFUSE CONTAINERS
‡7,/7758&.
‡67$1'$5''87<
,QGXVWULDO VWUHQJWK FRQVWUXFWLRQ
WUDQVSRUWV KHDY\ ORDGV ZLWK HDVH
(DV\ WR KDQGOH DQG PDQHXYHU
WKURXJKFRPPHUFLDOGRRUZD\VDQG
RQWR HOHYDWRUV &RQVWDQW IRUFH GHVLJQ DOORZV IRU FRQ
WUROOHGGXPSLQJE\RQHSHUVRQ,QVHWZKHHOVRQFX
\GPDQGFX\GPPRGHOVSURWHFWZDOOV
¿[WXUHV DQG SDWURQV 6PRRWK VXUIDFH LV HDV\ WR FOHDQ
DQGUHVLVWVSLWWLQJDQGFRUURGLQJ
Our No.
Cap
lb
No.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
%/.
(DV\WRPDQHXYHU
KHDY\GXW\
ZKHHOV UROO HDVLO\ HYHQ RYHU VWHSV
RU FXUELQJ )LWV JDO 1R
JDO 1R JDO 1R DQG JDO 1R
%UXWHURXQGFRPPHUFLDOUHIXVHFRQWDLQHUV
Our No.
Dia x
Ht In
No.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
675-5920
1
Our No.
Cap
Gal
No.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
Gray
675-5862
*5$<
6
($
675-5870
*5$<
44
4
($
675-5888
*5$<
55
($
‡7:,67212))5281'
‡³%587(´
Black
Black - 1/2 Yard
802-2634
REFUSE CONTAINER
DOLLIES
$OOSODVWLF SURIHVVLRQDOJUDGH FRQ
VWUXFWLRQZLOOQRWUXVWFKLSRUSHHO
DQG UHVLVWV GHQWV 5HLQIRUFHG ULPV
DGGVWUHQJWKDQGGXUDELOLW\%XLOWLQKDQGOHVDOORZHDV\
QRQVOLSOLIWLQJDQGDQWLMDPQHVWLQJ'RXEOHULEEHGEDVH
LQFUHDVHVVWDELOLW\DQGGUDJJLQJFDSDFLW\86'$0HDW
3RXOWU\ (TXLSPHQW *URXS /LVWHG DVVLVWV LQ FRPSO\LQJ
ZLWK+$&&3JXLGHOLQHV&HUWL¿HGWR16)6WGDQG6WG
&6)0DSSURYHGZKHQXVHGDVFRQWDLQHUOLGFRPER
OLGVDQGGROOLHVVROG
VHSDUDWHO\ JDO PHDVXUHV ´ GLDPHWHU [ ´+ JDO PHDVXUHV ´ GLDPHWHU [ ´+
JDOPHDVXUHV´GLDPHWHU[´+JDO´[
´+DQGJDO´[´+
%/$
[
2
($
($
COMMERCIAL
REFUSE CONTAINER
LIDS
‡³6:,1*/,1(´
*UDYLW\ KDQGVIUHH RSHQLQJ DXWR
PDWLFDOO\ FORVHV WR KLGH WUDVK 1R
PHWDOSDUWVWRUXVWRUEUHDN)LWV1R6.8
DQG1REDVH
Our No.
Shf
Pk
No.
Unit
CONTINENTAL COMMERCIAL
REFUSE CONTAINERS
‡7,/7758&.
‡87,/,7<'87<
,QGXVWULDO VWUHQJWK FRQVWUXFWLRQ
WUDQVSRUWV KHDY\ ORDGV ZLWK HDVH
(DV\ WR KDQGOH DQG PDQHXYHU
WKURXJKFRPPHUFLDOGRRUZD\VDQG
RQWR HOHYDWRUV &RQVWDQW IRUFH GHVLJQ DOORZV IRU FRQ
WUROOHG GXPSLQJ E\ RQH SHUVRQ ,QVHW ZKHHOV SURWHFW
ZDOOV ¿[WXUHV DQG SDWURQV 6PRRWK VXUIDFH LV HDV\ WR
FOHDQDQGUHVLVWVSLWWLQJDQGFRUURGLQJ
Our No.
No.
Cap
lb
Shf
Pk
Unit
)DFWRU\0XWXDODQG&DOLIRUQLD6WDWH
)LUH0DUVKDODSSURYHGIRU¿UHVDIH
W\7H[WXUHG¿QLVKKHOSVPLQLPL]HDSSHDUDQFHRIVXUIDFH
VFUDWFKHV ,QFOXGHV UHWDLQHU KDUGZDUH IRU VHFXULQJ DQG
FRQFHDOLQJSRO\OLQHUEDJV´GLDPHWHU[´+
Our No.
No.
'URS DQG VZLQJ GHVLJQ ¿WV JDO
1R DQG JDO 1R UH
IXVHEDVHVIRUK\JLHQLFKDQGVIUHH
UHIXVHGLVSRVDODQGDQHDWDSSHDUDQFH&RQWUROVZDVWH
RGRUVDQGVPRNLQJGHEULV
No.
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
7,+6
%/.
16 x 4
‡$6+75$<723
‡3/$67,&&+520(
)LWV1R%(6.8&R
ORVVXV5HFHSWDFOHV
Shf
Pk
No.
Unit
CONTINENTAL COMMERCIAL
1
($
033-8947
T
1
%.
($
COMMERCIAL REFUSE
CONTAINERS
‡3/$67,&648$5(
‡³81728&+$%/(´
‡+($9<'87<
‡³683(5.$1´
)RUKRWHOOREELHVUHVWURRPVVKRS
SLQJ PDOOV UHVWDXUDQWV DQG VQDFN
DUHDV'XUDEOHDQGFUDFNUHVLVWDQW
HYHQ XQGHU WRXJK LQGRRURXWGRRU FRQGLWLRQV 8VH ZLWK
1R VZLQJ WRS WR NHHS WUDVK RXW RI VLJKW OLG VROG
VHSDUDWHO\´VTXDUH[´+
$OVR FRPSDWLEOH ZLWK +XVNHH
5RXQG 'ROO\ &DGG\ %DJ 0DLG
&DGG\)RUW\IRXUJDO+XVNHHOLGV
5RXQG/LG+XVNHH'RPH)XQQHO7RSOLGV
Our No.
No.
Cap
Gal
Shf
Pk
Unit
NEWELL RUBBERMAID COMMERCIAL
4
($
675-5227
7,+6
*5$<
Our No.
4
No.
Cap
Gal
Shf
Pk
Unit
CONTINENTAL COMMERCIAL
Black
252-6945
Gray
Gray
675-5235
%HLJH
($
COMMERCIAL REFUSE
CONTAINER LIDS
Our No.
COMMERCIAL REFUSE
CONTAINERS
‡648$5(
‡³81728&+$%/(´
Our No.
%(,*
4
7:+
($
REFUSE CONTAINER
LIDS
Sq x
Hght In
,
7,.6
Unit
NEWELL RUBBERMAID COMMERCIAL
675-5169
1
Color
Shf
Pk
15 Gallon Capacity
Gray - 1 Yard
%/$
180-8153
‡5281'&/$66,&6:,1*
/,'
‡³0$56+$/´
NEWELL RUBBERMAID COMMERCIAL
315-6528
White
COMMERCIAL REFUSE
CONTAINERS
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%.
44
4
($
Maintenance, Repair & Operations - Gas Cans, Lubricants & Electrical Accs
COMMERCIAL REFUSE
CONTAINERS
COMBUSTIBLE WASTE CONTAINERS
‡3/$67,&
‡³:$//+8**(5´
COMBUSTIBLE WASTE
CANS
'XUDEOH HQJLQHHUHG SODVWLF UHFHS
WDFOHV KDYH D VPRRWK VHDPOHVV
FRQVWUXFWLRQIRUHDV\FOHDQLQJDQG
SURORQJHGOLIHDQGDUHYHU\HI¿FLHQWLQWLJKWVSDFHV3UR
WUXGHVOHVVWKDQ¶IURPWKHZDOODQGVWDQG´WDOO&RP
SDWLEOHZLWK1R3XVKGRRUOLG1R7LSWRSOLG
DQG1RPRXQWLQJEUDFNHW
‡(/(9$7('%27720
*$/9$1,=('67((/
‡5(17$/
Our No.
Cap
Gal
No.
Shf
Pk
Unit
CONTINENTAL COMMERCIAL
Beige
130-2900
,+.
%(
1
($
COMMERCIAL REFUSE
CONTAINERS
‡)28523(1,1*6+($9<
'87<
‡³&2/26686´
Cap
Gal
No.
Shf
Pk
Unit
JUSTRITE MFG COMPANY
'HVLJQHGIRUKLJKYROXPHDSSOLFD
WLRQV &RQWRXUHG OLG¶V WRS VXUIDFH
SUHYHQWVDFFXPXODWLRQRIGHEULVDQGZDWHUZKLOHSURYLG
LQJDXQLTXHDQGYLVXDOO\DSSHDOLQJVW\OH(DVLO\DFFRPR
GDWHVEXON\GHEULVOLNHSL]]DER[HVR]FXSVDQGIRRG
VHUYLFHWUD\V7ZRODUJHIURQWRSHQLQJV´ZLGH[
´KLJKDQGWZRODUJHVLGHRSHQLQJV´ZLGH
[´KLJK
Our No.
Cap
Gal
No.
Shf
Pk
Unit
947-0824
1
‡3/$67,&87,/,7<
+HDY\GXW\ GXUDEOH ZLUH EDLO ZLWK
KDQGOH JULS GHVLJQHG IRU FRPIRUW
DEOH FDUU\LQJ 5HFHVVHG JULS RQ
ERWWRPIRUHDV\FRQWUROOHGSRXULQJ
6SRXW JXLGHV ZDWHU ÀRZ ´ [
´[´
26+$ FRPSOLDQW HVVHQWLDO ZKHQ
HYHUVROYHQWFORWKVDQGZLSLQJUDJV
DUH XVHG 2QHSLHFH FRYHU RSHQV QR PRUH WKDQ GH
JUHHV DQG VWD\V FORVHG ZKHQ QRW LQ XVH LVRODWLQJ FRQ
WHQWVIURP¿UHVRXUFHVDQGOLPLWLQJR[\JHQVRVSRQWDQH
RXVFRPEXVWLRQULVNLVYLUWXDOO\HOLPLQDWHG&RYHUVQDSV
VKXWZKHQSHGDOLVUHOHDVHG5RXQGFRQVWUXFWLRQDQGHO
HYDWHGERWWRPHQFRXUDJHFLUFXODWLRQRIDLUDURXQGFDQWR
GLVSHUVHKHDWDQGUHGXFHPRLVWXUHEXLOGXSDQGUXVWLQJ
´[´OHDGIUHHJDOYDQL]HGVWHHOERG\ZLWKUH
LQIRUFLQJULEVSURWHFWVLGHVIURPGHQWVDQGDEXVH&DUU\
KDQGOHIRUSRUWDELOLW\%ULJKWUHGZDUQLQJFRORU'XUDEOH
SRZGHU SDLQW ¿QLVK IRU ORQJ OLIH 7ULOLQJXDO VDIHW\ ODEHO
UHGXFHV PLVFRPPXQLFDWLRQ )DFWRU\ 0XWXDO WHVWHG DQG
DSSURYHG8/OLVWHG
Our No.
BUCKETS
($
Our No.
COMBUSTIBLE WASTE CONTAINERS
15 Quart Capacity
52<%/
%OXH0LVW
6
($
625-9295
%,648
%LVTXH
6
($
BUCKETS
‡3/$67,&87,/,7<
‡³528*+1(&.´
+HDY\GXW\ ZLUH EDLOV RIIHU H[
WUD GXUDELOLW\ IRU KHDY\ XVH 7ZLQ
VSRXWV JXLGH ZDWHU ÀRZ IURP HL
WKHU VLGH 5HFHVVHG JULSV RQ ERW
WRPIRUHDV\FRQWUROOHGSRXULQJ+DQGJULSVGHVLJQHGIRU
FRPIRUW
No.
56
%(
12-QUART CAPACITY
11-1/2” x 12-1/2” x 10”
‡0(7$/
625-9022
52<%/
%OXH0LVW
6
($
625-8776
%,648
%LVTXH
6
($
15-QUART CAPACITY
1
14-1/2” x 12-1/4” x 9”
($
Our No.
Brooms, Mops & Trash Bags
Dia x
Ht In
No.
‡6(/)(;7,1*8,6+,1*
)/$0(5(7$5'$17
‡32/<(7+</(1(:,7+
/,1(53$,/
‡³602.(56&($6(),5(´
3HZWHU*UD\
6
($
038-9122
/W3ODWLQXP
6
($
6
[
($
BUCKETS
‡3/$67,&87,/,7<
‡³528*+1(&.´
+HDY\GXW\ ZLUH EDLOV RIIHU H[
WUD GXUDELOLW\ IRU KHDY\ XVH 7ZLQ
VSRXWVJXLGHZDWHUÀRZIURPHLWKHU
VLGH5HFHVVHGJULSVRQERWWRPIRU
HDV\ FRQWUROOHG SRXULQJ +DQG JULSV GHVLJQHG IRU FRP
IRUW´[´[´
BUCKETS
BUCKETS
Shf
Pk
Unit
JUSTRITE MFG COMPANY
959-0241
%OXH0LVW
Unit
Brooms, Mops & Trash Bags
6HOIH[WLQJXLVKLQJ GHVLJQ VDIHO\ FROOHFWV XQVLJKWO\ FLJD
UHWWHEXWWVDQGUHGXFHVWKHULVNRI¿UH0DGHRIÀDPH
UHWDUGDQWVWXUG\KLJKGHQVLW\SRO\HWK\OHQHORZPDLQWH
QDQFHZRQ¶WUXVWGHQWFUDFNRUSHHODQGUHVLVWVIDGLQJ
´GLDPHWHU[´KHLJKW/DUJHLQWHUQDOQHFNFDYLW\
PLQLPL]HV ³FORJJLQJ´ 0ROGHGLQ JUDSKLFV HDVLO\ LGHQWLI\
RSHQLQJ IRU FLJDUHWWH EXWW GLVSRVDO ([WLQJXLVKLQJ VQXII
VSRW &RYHUHG RSHQLQJ NHHSV UDLQ RXW DQG GLVFRXUDJHV
RWKHU WUDVK 6LPSO\ OLIW RII OLG WR HPSW\ ELJ JDOYDQL]HG
VWHHO SDLO LQVLGH 7LHGRZQ QRWFKHV RIIHU VHFXULW\ DQG
JUHDWHU VWDELOLW\ XQGHU VHYHUH ZHDWKHU FRQGLWLRQV ,Q
KLJK KXPLGLW\ HQYLURQPHQWV XQLTXH ³GULSOLS´ LQWHUQDO
FRQVWUXFWLRQ SUHYHQWV WDU FRQGHQVDWLRQ IURP HVFDSLQJ
)DFWRU\0XWXDO¿UHWHVWHGDQGDSSURYHG
Color
%$48$0%%)5
2.5 Bushel
646-2659
CIGARETTE
RECEPTACLES
No.
Shf
Pk
625-7257
DOVER PARKERSBURG
SMOKING URNS
Our No.
Shf
Pk Unit
Color
NEWELL RUBBERMAID HOME
Beige
+
Unit
625-9311
REFUSE BURNERS
CONTINENTAL COMMERCIAL
767-9228
Shf
Pk
Color
NEWELL RUBBERMAID HOME
Our No.
Brooms, Mops & Trash Bags
No.
1
($
‡3/$67,&:,7+63287
‡0(7$/+$1'/(
Our No.
Cap
Qt
No.
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
Bisque
Our No.
No.
Cap
Qt
Shf
Pk
Unit
6
24
($
420-9607
%,648
14
6
($
ENCORE PLASTICS
561-7691
BUCKETS
‡+($9<'87<
5(&7$1*8/$5
‡:,7+*5$'8$7,216
BUCKETS
‡5281'3/$67,&
‡:,7+*5$'8$7,216
‡³%587(´
+ROGV JDOORQV RI OLTXLG DQG DF
FRPPRGDWHVXSWRDQ´VFUXEEHU
0DGH RI KHDY\GXW\ SRO\HWK\OHQH
+LJKO\YLVLEOH PHDVXUHPHQW PDUNV DFFHSWV FDVWHUV IRU
HDV\SRUWDELOLW\
0ROGHGLQJUDGXDWLRQVIRUDFFXUDWH
PHDVXULQJ :LWK SRXULQJ VSRXW
´GLDPHWHU[´+
Our No.
Cap
Qt
No.
Shf
Pk
Our No.
Unit
NEWELL RUBBERMAID COMMERCIAL
7,+6
*5$<
14
040-7635
6
Cap
Gal
Shf
Pk
Unit
($
UNGER INDUSTRIAL
Gray
675-5433X
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
'%
6
- Maintenance, Repair & Operations
Brooms, Mops & Trash Bags
PAILS
Cap
Qt
No.
3$
Shf
Pk Unit
Color
12
'HVLJQHG IRU KHDY\GXW\ XVH 7RS
UHLQIRUFHGZLWKKLJKVWUHQJWKZLUH
&RUUXJDWHGERWWRPSUHYHQWVUXVW
‡$//385326(
UNITED PLASTICS
731-3539X
‡5281'0(7$/
CARRY CADDIES
)HDWXUHDGXUDEOHFDUU\KDQGOHZLWK
JULSDQGDVSRXWIRUHDV\SRXULQJ
0DGHIURPSRO\SURS\OHQH
Our No.
UTILITY TUBS
SPECIALTY BUCKETS
‡3/$67,&08/7,86(
‡³25*$1,=(<285+20(´
24
%OXH
($
For carrying tools or cleaning sup
SOLHV IRU WRXFKXS PDLQWHQDQFH
8VH DORQH RU WR FRPSOLPHQW ;7UD
KRXVHNHHSLQJ FDUWV ´ [ ´ [
´
Our No.
Our No.
BUCKETS
693-1281
7,+.
($
623-1237
‡$//385326(
623-1245
623-1211
Shf
Pk
Unit
Our No.
No.
Color
Shf
Pk
Unit
/DSLV
12
($
STERILITE CORP
Red
536-7339X
12
7,+.
($
UTILITY TUBS
WATER BUCKETS
‡0(7$/
UTILITY TUBS
1R*3 PHDVXUHV ´GLD [
´+1R*3´[´+
1R´[´+1RVDQG
´[´+1R
´ [ ´+ 1R ´ [
´+DQG1R´[´+
‡2%/21*0(7$/
Cap
Qt
Shf
Pk
Unit
Our No.
No.
2
15
12
($
693-1232
612
12
12
($
698-1849
*3
2
12
($
622-8548
*3
4
12
($
623-1377
12
($
623-1385
12
($
623-1393
12
12
12
($
623-1401
14
14
12
($
688-7236
Cap
Gal
Shf
Pk
Unit
6
($
6
($
6
($
Shf
Pk
Unit
DOVER PARKERSBURG
‡3/$67,&
‡³528*+58**('´
Cap
Gal.
No.
Shf
Pk
Unit
78
6
($
SCRUB TUBS
)RUKRXVHKROGDQGXWLOLW\XVH'RX
EOHVHDPHGERWWRPUHLQIRUFHGWRS
(DV\FDUU\H[WUDKHDY\EDLOKDQGOH
´[´+
No.
Finish
Shf
Pk
Unit
DOVER PARKERSBURG
+RUL]RQWDOVZHGJHVDGGVWXUGLQHVV
+HDY\ VWHHO GURS KDQGOHVVHFXUHO\
ULYHWHGXQGHUWRSZLUHGEHDG
623-1195
$
+RW'LSSHG
6
($
693-1273
$6
*DOYDQL]HG6KHHWZDUH
6
($
Shf
Pk
Unit
623-1252
)RUKRPHIDFWRU\DQGIDUP'HHSO\
GUDZQ ERWWRP GRXEOH VHDPHG WR
WKH ERG\ +HDY\ VLGH KDQGOH DQG
FOLSVULYHWHGWRERG\
UTILITY TUBS
Our No.
No.
Cap
Gal
4 Gallon Capacity
Shf
Pk
Unit
WASH TUBS
11-1/8” x 20-1/2”
‡0(7$/1(67$%/(
‡648$5(0(7$/+27
',33('
DOVER PARKERSBURG
UTILITY BASKETS
62
6
($
‡29$/0(7$/
Our No.
No.
Cap
Gal
DOVER PARKERSBURG
17-1/2’’ Top Dia. x 11-3/4’’H
1
($
‡0(7$/
UTILITY TUBS
Our No.
($
Blue
Hot Dipped
646-3996
6
17
+',3
520-7220X
23’’W x 42L x 11’’H
693-1208
Cap.
Bushel
6
UNITED PLASTICS
DOVER PARKERSBURG
Galvanized Sheetware
No.
17
6
Our No.
+XQGUHGV RI XVHV DURXQG WKH
KRPH IDUP DQG VKRS %RWWRP
VSHFLDOO\ VWDPSHG IRU H[WUD GXUD
ELOLW\
DOVER PARKERSBURG
Our No.
($
8VH LQ DQG DURXQG WKH KRPH
+HDY\ZHLJKW GXUDEOH WXE KDV
URSHKDQGOHVIRUWUDQVSRUWLQJ
Brooms, Mops & Trash Bags
No.
6
Hot Dipped - 8-1/8 H x 17-1/4 D
NEWELL RUBBERMAID COMMERCIAL
Our No.
Hot Dipped - 10-3/4 H x 23-3/4 D
'LPHQVLRQV ´/ [ ´: [
´+
Cap
Qt
5('
6
Hot Dipped - 10-1/4 H x 21-1/2 D
CARRY CADDIES
5XJJHG LQMHFWLRQPROGHG SODVWLF
5HVLVWV DFLGV DONDOLHV SDLQW DQG
KDUVK FKHPLFDOV 1R ´ GL
DPHWHU[´KHLJKW1R
´GLDPHWHU[´KHLJKW
641-6804X
637-7170
693-1299
‡3/$67,&5281'
‡³%587(´
No.
($
Galvanized - 10-3/4 H x 23-3/4 D
FARM BUCKETS
Our No.
6
Galvanized - 10-1/8 H x 20 D
6
%/$
15
6
Platinum
675-5482
Unit
Galvanized - 10-1/4 H x 21-1/2 D
Unit
NEWELL RUBBERMAID COMMERCIAL
Wild Bird, Pet Care & Farm Supplies
Shf
Pk
DOVER PARKERSBURG
Shf
Pk
No.
Cap
Gal
No.
Hot Dipped
6
($
583-9535
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
29
1
6
($
Maintenance, Repair & Operations - UTILITY TUBS
MOP BUCKET/
WRINGER
‡/$5*(+($9<'87<
‡32/<(7+</(1(
Cap
Gal
No.
+HDY\GXW\ SODVWLF ZLWK ZRRG UROO
HUV6WHSRQRSHUDWLRQ
Shf
Pk
Unit
MACCOURT PRODUCTS
67
642-1671
1
‡+($9<'87<3/$67,&
‡+286(+2/'
Cap
Gal
No.
Cap
Qt
No.
14
3/
Shf
Pk
1
Unit
‡29$/6+$3('+27
',33('
+HDY\JDXJH VWHHO FRQVWUXFWLRQ
ZLWK QRQPDUNLQJ ´ EDOO EHDULQJ
FDVWHUV:HOGHGVSLGHUKRWGLSSHG
JDOYDQL]HG H[WUD KHDY\ ERWWRP
+HDY\ZLUHEDLOKDQGOHVKHDY\GXW\VTXHH]HUV7RSGL
PHQVLRQV´[´KHLJKW´
Shf
Pk
7,6
%&
26
1
Our No.
Cap
Qt
No.
Shf
Pk
Unit
3751
No.
922-1821
627
Unit
($
Cap
Qt
Shf
Pk
Unit
1
Our No.
1
($
Shf
Pk
No.
Unit
NEWELL RUBBERMAID COMMERCIAL
637-6834
7+.6
6
67/
($
MOP BUCKET/
SQUEEZERS
‡67((/
$OO VWHHO LQFOXGHV 1R%& RYDO
PRSSDLODQG1R6(VTXHH]HU
No.
Cap
Qt
Our No.
Shf
Pk
Unit
025-2957
1
No.
Pail
Cap. Qt.
Shf
Pk
Unit
DOVER PARKERSBURG
623-8075
.&
26
1
($
($
‡6,'(35(663/$67,&
‡³:$9(%5$.(´
+LJK HI¿FLHQF\ ZULQJHU IRU TW
:DYH%UDNHEXFNHWVLVPDGHRISUH
PLXP WXEXODU VWHHO DQG VWUXFWXUDO
ZHEPROGHGSODVWLF/DVWVWLPHV
ORQJHU WKDQ FRPSDUDWLYH ZULQJHUV 7HVWHG WR H[FHHG
ZULQJLQJF\FOHV
/DUJH REORQJ VL]H DFFHSWV ODUJH
PRSV DQG RU EUXVKHV 9DULHW\ RI
XVHVZLWKPRSVVFUXEVRUVWRUDJH
RIWRROV5HF\FOHGSODVWLFV
‡³:$9(%5$.(´
)RUTW:DYH%UDNHEXFNHWFRP
ERV ZLOO QRW ¿W TW 6HSDUDWHV
GLUW\ZDWHUIURPFOHDQZDWHU(DV\
WR HPSW\ UHGXFHV ULVN RI FURVV
FRQWDPLQDWLRQ
Cap
Qt
Our No.
No.
Cap
Qt
Shf
Pk
Unit
HOMEBASIX
022-8650X
Shf
Pk
Unit
Our No.
11
12
6
Shf
Pk
Unit
Yellow
($
028-2889X
Red
Cap
Qt
No.
NEWELL RUBBERMAID COMMERCIAL
NEWELL RUBBERMAID COMMERCIAL
&5('
<(//2:
($
MOP BUCKET
MOP WRINGER
BUCKETS
401-2555
Unit
MOP SQUEEZERS
2
WR
No.
Shf
Pk
5HLQIRUFHG SODVWLF EXFNHW DQG GH
WDFKDEOH ZHW PRS ZULQJHU (DV\
JULSQRVSLOOGHVLJQ0HWDOKDQGOH
´[´[´
‡08/7,385326(
Our No.
Cap
Qt
No.
‡3/$67,&
DOVER PARKERSBURG
6(
($
MOP BUCKET/
WRINGER
CHICKASAW & LITTLE ROCK BROOM WORKS
Our No.
680-7812
12
($
&RPHV ZLWK GLYLGHU WR NHHS GLUW\
DQG FOHDQ ZDWHU VHSDUDWH 'RZQ
ZDUG SUHVVXUH ZULQJHU ZRUNV ZHOO
IRUR]PRSVRUVPDOOHU
Our No.
Our No.
637-7055
1
WORLDWIDE INTEGRATED RE
Shf
Pk
NEWELL RUBBERMAID COMMERCIAL
,QWHJUDWHGVLGHSUHVVZULQJHUZLWK
EXFNHWSODVWLFEXFNHWLVVWURQJGX
UDEOHDQGHDV\WRFOHDQKHDY\GXW\
VWHHO FDVWHUV FRPPHUFLDO TXDOLW\
FRQVWUXFWLRQUXVWUHVLVWDQW
‡6,'(35(66=,1&3/$7('
Cap
Oz
5HGXFHVVSODVKLQJ+LJKHI¿FLHQF\
VLGH SUHVV ZULQJHU 7HVWHG WR H[
FHHG ZULQJLQJ F\FOHV 3UH
PLXPWXEXODUVWHHODQGVWUXFWXUDOZHEPROGHGSODVWLF
MOP BUCKET/
WRINGER
($
MOP SQUEEZERS
No.
021-5129X
‡6758&785$/)2$0
‡³:$9(%5$.(´
‡352)(66,21$/
Our No.
Unit
Unit
DOVER PARKERSBURG
680-7671
Shf
Pk
‡+286(+2/'
MOP BUCKET/
WRINGER
MOP PAILS
Cap
Qt
Cap
Qt
MOP BUCKET/
WRINGER
642-1655
($
MOP BUCKETS & WRINGERS
No.
No.
MOP BUCKET/
WRINGER
Hot Dipped
12
Brooms, Mops & Trash Bags
Our No.
($
DOVER PARKERSBURG
%ODFN
Our No.
HOMEBASIX
26” x 20” x 6” - Black
$7
Unit
)RRW RSHUDWRU ZULQJHU SUHYHQWV
RYHUÀRZ :ULQJHU LV ULYHWHG WR
EUDFNHW3ODWHGVWHHOEDLOZLUH/RQJ
ODVWLQJJDOYDQL]HGVWHHOVKHHW6RO
GHUHGVHDPOHDNSURRIKDUGZRRGUROOHUV
MACCOURT PRODUCTS
651-4327
Shf
Pk
($
STORAGE TUBS
Our No.
Our No.
DOVER PARKERSBURG
36” x 24” x 8” - Black
194-3497
+DQGRQERWWRPJULSGHVLJQHGIRU
HDVLHUSRXULQJ6WXUG\ZLUHKDQGOH
JULS
‡29$/
0L[LQJ WXE GHVLJQHG FRQWUDFWRU
WRXJK IRU ORQJ WHUP VHUYLFH 89
VWDELOL]HGZLOOQRWUXVWRUGHQW
Our No.
MOP BUCKET
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
7,.6
<(/
2
($
- Maintenance, Repair & Operations
Gadgets & Cutlery
PAPER TOWEL
HOLDERS
PAPER TOWEL HOLDERS
‡³*22'*5,36´
PAPER TOWEL
HOLDERS
‡67$1',1*62/,'%5$66
6ROLGEUDVVSROHVDQGVWDLQOHVVVWHHO
EDVHIRUGXUDELOLW\
Our No.
No.
Finish
Shf
Pk
Unit
($
HOMEBASIX
13-1/2”H x 6-1/2” Dia.
776-2222
PAPER TOWEL
HOLDERS
/0
6DWLQ1LFNHO
*UDEVDSLHFHRISDSHUWRZHOZLWK
RXW SXOOLQJ RII PRUH VKHHWV WKDQ
QHHGHG $ VSULQJDFWLYDWHG DUP
KROGV WKH UROO VHFXUHO\ $UP DXWR
PDWLFDOO\DGMXVWVWRWKHZLGWKRIWKHUROO$UPNHHSVWKH
SDSHUWRZHOHGJHDFFHVVLEOHDWDOOWLPHV'HVLJQHGZLWK
LQWHUQDOUHVLVWDQFHWRSUHYHQWWKHSDSHUWRZHOUROOIURP
VSLQQLQJRXWRIFRQWURODQGXQUDYHOLQJ$UPSLYRWVDZD\
IURPWKHFHQWHUSROHDQGORFNVRSHQDOORZLQJWKHSDSHU
WRZHOUROOWRVOLSRYHUWKHFHQWHUSROH:HLJKWHGVWDLQOHVV
VWHHO EDVH DQG QRQVOLS ULQJ 0DGH RI EUXVHG VWDLQOHVV
VWHHOZLWKEODFNSODVWLFDFFHQWV'LVKZDVHUVDIH
Our No.
No.
Shf
Pk
636-4467
4
($
Our No.
No.
PAPER TOWEL
HOLDERS
Shf
Pk
Finish
Unit
CHEF CRAFT
647-5248
12
:KLWH
:KLWH SODVWLF SDSHU WRZHO KROGHU
FDQ EH PRXQWHG XQGHU FDELQHW RU
RQ ZDOO ZLWK FRQFHDOHG KDUGZDUH
LQFOXGHG
($
Our No.
No.
Shf
Pk
Shf
Pk
No.
Unit
INTER-DESIGN
914-2597
6
($
Brooms, Mops & Trash Bags
TURNTABLES
LAZY SUSAN
TURNTABLES
6SLQV HDVLO\ PDNLQJ KDUG WR UHDFK
LWHPVPRUHDFFHVVLEOH8VHLQEDVH
FDELQHWV RU RQFRXQWHUWRSV UDLVHG
HGJHFRQWDLQVVSLOOVIRUHDV\FOHDQ
XS ,PSURYHV HI¿FLHQF\ RI FXS
ERDUGV´[´
‡3/$67,&
:LWKKHDGHU
Our No.
Unit
OXO INTERNATIONAL
PAPER TOWEL
HOLDERS
:LUH GHVLJQ ZLWK EULJKW FKURPH
¿QLVK+DQGOHPDNHVFDUU\LQJHDV\
DQGKROGVSDSHULQSODFHRQVWDQG
Our No.
No.
Shf
Pk
Color
Unit
NEWELL RUBBERMAID HOME
614-8654
5':+7
6
:KLWH
($
Unit
INTER-DESIGN
615-6616
PAPER TOWEL
HOLDERS
6
($
‡7:,1
‡³($6<&+$1*(´
No.
Color
‡³)250$´
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
723-6888
5':+7
:KLWH
6SLQV HDVLO\ PDNLQJ KDUG WR UHDFK
LWHPV PRUH DFFHVVLEOH ,PSURYHV
HI¿FLHQF\ RI FXSERDUGV ´ [ ´
[´
PAPER TOWEL
HOLDERS
0RXQWV XQGHU FDELQHWV RU RQ DQ\
GRRU RU ZDOO VXUIDFH ZLWK MXVW WZR
VFUHZV 6SULQJORDGHG FOLSV VH
FXUHO\ JULS HDFK HQG RI UROO ´ [
´[´
Our No.
LAZY SUSAN
TURNTABLES
4
($
1RQDEVRUEHQW IRDP EDFNLQJ SUR
WHFWVFDELQHWV+DQJRQRXWVLGHRU
LQVLGH RI FDELQHW GUDZHU RU GRRUV
*UHDW IRU NLWFKHQ ODXQGU\ URRP
EDWKURRPJDUDJHDQGPRUH
Our No.
No.
Shf
Pk
Our No.
PAPER TOWEL
HOLDERS
No.
957-5168
Unit
:+7
5':+7
6
:KLWH
($
Brooms, Mops & Trash Bags
STORAGE CONTAINERS
($
Color
Shf
Pk
:KLWH
6
‡$//385326(
‡³528*+58**('´
PAPER TOWEL
HOLDERS
Unit
NEWELL RUBBERMAID HOME
694-7584
4
Unit
CARRY CADDIES
+ROGV UHJXODU WR MXPER SDSHU
WRZHOV *ULSV WRZHO UROO ¿UPO\ DQG
GLVSHQVHVHDVLO\ZLWKDVWHDG\SXOO
&DQ EH PRXQWHG KRUL]RQWDOO\ RU
YHUWLFDOO\ RQ DQ\ GRRU FDELQHW RU
ZDOOVXUIDFH7ZRPRXQWLQJVFUHZVDUHLQFOXGHG
Our No.
Shf
Pk
Color
NEWELL RUBBERMAID HOME
INTER-DESIGN
615-6665
No.
($
8VHWRNHHSFOHDQLQJODZQJDU
den or garage tools handy and
RUJDQL]HG +ROG D IXOO UROO RI SD
SHU WRZHOV &RPIRUW JULS KDQGOH
:HLJKWHGERWWRPNHHSVFDGG\IURPWLSSLQJRYHU
%ULJKW FKURPH ¿QLVK SDSHU WRZHO
KROGHU FDQ EH PRXQWHG XQGHU
FDELQHW RU RQ ZDOO ZLWK FRQFHDOHG
KDUGZDUH LQFOXGHG 3DFNDJHG RQ
SHJDEOHFDUG
Our No.
No.
Shf
Pk
Our No.
Unit
UNITED PLASTICS
($
586-6496X
4
PAPER TOWEL
HOLDERS
%UXVKHG¿QLVKVWDLQOHVVVWHHOVZLYHO
SDSHUWRZHOKROGHUFDQEHPRXQW
HG XQGHU FDELQHW RU RQ ZDOO ZLWK
LQFOXGHG KDUGZDUH 3DFNDJHG RQ
SHJDEOHEOLVWHUFDUG
Our No.
No.
Shf
Pk
Unit
INTER-DESIGN
642-9948
Unit
Taupe/Black Handle
INTER-DESIGN
615-6673
Shf
Pk
No.
4
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
&'
6
($
Maintenance, Repair & Operations - STORAGE CONTAINERS
STORAGE CONTAINERS
‡-80%2%2;67$&.$%/(
‡³528*+727(´
‡%2;67$&.$%/(
‡³528*+727(´
/DUJH FRPIRUWDEOH LQWHJUDWHG
KDQGOHV RIIHU HDV\ OLIWLQJ DQG SRU
WDELOLW\ 6WDFNDEOH ZKHQ IXOO DQG
QHVWDEOH ZKHQ HPSW\ IRU VSDFH
HI¿FLHQF\
'XUDEOH SODVWLF FRQVWUXFWLRQ VKDW
WHU UHVLVWDQW GRZQ WR GHJUHHV
)DKUHQKHLW6WXUG\EXLOWLQKDQGOHV
IRU HDV\ FDUU\LQJ 6QDSRQ VWD\
WLJKW OLGV KHOS NHHS FRQWHQWV GU\ DQG GXVWIUHH 6WDFN
DEOH GHVLJQ VDYHV VWRUDJH VSDFH GLPHQVLRQV
´ [ ´ [ ´+ GLPHQVLRQV ´ [ ´ [
´+127(1R&3&</1'6.8;LVF\O
LQGHUFRORUQRWVKDSH
Our No.
No.
Shf
Pk
Color
Unit
NEWELL RUBBERMAID HOME
50 Gallon Capacity
626-3362X
&3&</1'
+XQWHU.KDNL
Our No.
($
No.
Color
STORAGE/UTILITY
CONTAINERS
Cap.
Galo
624-7217
',0
%OXH0LVW 12 ($
926-8251X
&3',0
%OXH0LVW 14
12 ($
‡67$&.$%/(
‡³528*+1(&.727(´
Our No.
‡67$&.$%/(
‡³67$&.19,(:´
No.
9
152-8488
‡-80%2%2;67$&.$%/(
‡³528*+727(´
/DUJH FRPIRUWDEOH LQWHJUDWHG
KDQGOHV RIIHU HDV\ OLIWLQJ DQG SRU
WDELOLW\ 6WDFNDEOH ZKHQ IXOO DQG
QHVWDEOHZKHQHPSW\IRUVSDFHHI
¿FLHQF\´[´[´
Cap
Gal
No.
Shf
Pk
Unit
22 Gallon Capacity
',0
'DUN%OXH
3&/$4%
6
($
3&/$4%
29
4
($
‡67$&.$%/(
‡³528*+1(&.´
Shf
Pk
6
($
012-5906
‡%2;67$&.$%/(
‡³528*+727(´
5XJJHG VWRUDJH ER[HV DUH VKDWWHU
UHVLVWDQW 6WXUG\ EXLOWLQ KDQGOHV
IRU HDV\ FDUU\LQJ 6QDSRQ VWD\
tight lids help keep contents dry
DQGGXVWIUHH6WDFNDEOHGHVLJQVDYHVVWRUDJHVSDFH´
[´[´+
No.
Color
Unit
18 Gallon Capacity
Cap
Gal
No.
Shf
Pk
Unit
',0
45
4
($
STORAGE CONTAINERS
‡61$3&$6(67$&.$%/(
6WDFNDEOH GHVLJQ VDYHV VSDFH IRU
VWRULQJSHULRGLFDOVDQGPDJD]LQHV
RU DUWV DQG FUDIWV 6QDS¿W OLGV
VKXW VHFXUHO\ 6HHWKURXJK FODULW\
IRU HDV\ LGHQWL¿FDWLRQ RI FRQWHQWV
+LQJHGOLG
No.
Color
&367((/
6WHHO
Shf
Pk
Unit
($
Unit
)&/5
6
($
STORAGE CONTAINERS
&OHDU EDVH DQG OLG SURYLGH HDV\
YLHZLQJRIFRQWHQWV
Our No.
‡67$&.$%/(
‡³528*+1(&.´
No.
Cap.
Qts.
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
'XUDEOH UXJJHG VWRUDJH ER[HV
DUHVKDWWHU UHVLVWDQWGRZQWR]HUR
GHJUHHV 6WXUG\ EXLOWLQ KDQGOHV
DOORZ IRU HDV\ FDUU\LQJ 6QDSRQ
VWD\WLJKWOLGVKHOSNHHSFRQWHQWVGU\DQGGXVWIUHH
624-7522X
&3',0
%OXH0LVW
12
($
Our No.
624-7506X
&367((/
6WHHO
12
($
NEWELL RUBBERMAID HOME
No.
Color
Shf
Pk
884-8475
4&/5
15
($
299-3194
4&/5
($
276-7127
4&/5
41
6
($
480-1304
4&/5
71
4
($
954-2994
4&/5
95
4
($
Unit
31 Gallon Capacity
7,.6
Shf
Pk
‡121/$7&+,1*
STORAGE CONTAINERS
718-7131
Cap
Gal
No.
14” x 10.5” x 4”H. - Clear
022-0061
10 Gallon Capacity
STORAGE CONTAINERS
NEWELL RUBBERMAID HOME
($
NEWELL RUBBERMAID HOME
NEWELL RUBBERMAID HOME
Our No.
6
‡:+((/('67$&.$%/(
‡³528*+727(´
Our No.
6KDWWHU UHVLVWDQW 6WXUG\ EXLOWLQ
KDQGOHV DOORZ IRU HDV\ FDUU\LQJ
6QDSRQ VWD\WLJKW OLGV KHOS NHHS
FRQWHQWVGU\DQGGXVWIUHH´[
´[´
Our No.
Shf
Pk
:KLWH
Unit
STORAGE CONTAINERS
NEWELL RUBBERMAID HOME
625-6168X
%$
STORAGE CONTAINERS
960-8738
30”L x 20”W x 20”H
STORAGE CONTAINERS
Color
24
Shf
Pk Unit
NEWELL RUBBERMAID HOME
23.40”L x 18.40”W x 15.40”H
No.
Color
NEWELL RUBBERMAID HOME
($
675-8957
Our No.
Cap
Qt
Dk. Indigo Metalic/Steel
Our No.
22 Gallon Capacity
&3&</%/&
886-0009X
Unit
NEWELL RUBBERMAID HOME
935-3962X
No.
UNITED PLASTICS
Our No.
5HG ]RQH FOHDU EDVH ZLWK DTXDWLF
EOXHOLG
Shf
Pk
Our No.
/DUJH FRPIRUWDEOH LQWHUJUDWHG
KDQGOHV RIIHU HDV\ OLIWLQJ DQG SRU
WDELOLW\ 6WDFNDEOH ZKHQ IXOO DQG
QHVWDEOHZKHQHPSW\IRUVSDFHHI
¿FLHQF\6WXUG\ZKHHOVIRUHDV\SRUWDELOLW\
STORAGE CONTAINERS
'XUDEOH ODWFKHV NHHS FRQWHQWV
VHFXUH /RZ GHQVLW\ SRO\HWK\OHQH
EDVH DQG OLG DUH VKDWWHU UHVLVWDQW
WR GHJUHHV )DKUHQKHLW [
[&RORU%OXHEHUU\)URVW
(DV\VQDSRQEOXHOLGZLWKGRXEOH
FDWFKDQGFRPIRUWDEOHKDQGOHV
Shf
Pk Unit
NEWELL RUBBERMAID HOME
STORAGE CONTAINERS
‡61$321/,'
‡67$&.$%/(
&367((/
6WHHO
9
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
STORAGE CONTAINERS
STORAGE CONTAINERS
STORAGE CONTAINERS
‡%$6,&/$7&+
‡³=,5&21,$´
‡0(',$
&OHDU OLG DQG EDVH SURYLGH HDV\
YLHZLQJRIFRQWHQWV%OXHODWFKHV
1RQ ODWFKLQJ FOHDU WRWH ZLWK EOXH
OLG
+ROGV XS WR ODUJH SKRWR HQYH
ORSHV9+6WDSHV'9'¶VRU
&'¶V+ROGVXSWR´[´JUHHW
LQJFDUGV%RRNHQGVXSSRUWVLWHPV
/DWFKLQJOLGNHHSVFRQWHQWVVHFXUH
&RQWHQWVYLHZHGHDVLO\´[´[´
Our No.
Cap.
Qts.
No.
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
798-7134
Cap.
Qts.
No.
Shf
Pk
Unit
Our No.
NEWELL RUBBERMAID HOME
95
4&/0&%
Our No.
4
626-1416
15
4&/&%/
Clear
($
502-7750X
STORAGE CONTAINERS
STORAGE CONTAINERS
‡67$&.$%/(61$3723
‡³61$3723´
Our No.
Cap
Qt
No.
Shf
Pk
Unit
NEWELL RUBBERMAID HOME
610-8716
)*4&/0&%
12
($
201-8117
4&/0&%
29
($
281-5694
4&/0&%
41
6
($
Our No.
No.
Shf
Pk
698-3001
Cap
Gal
No.
Shf
Pk
4
No.
&3',0
72
4
($
‡678))727(
‡³25*$1,=(<285+20(´
Caps.
Gals.
No.
Cap
Qt
Shf
Pk
Unit
Shf
Pk
72
2
($
Unit
($
STORAGE CONTAINERS
‡81'(57+(%('
‡3/$67,&
‡³25*$1,=(<285+20(´
8VHWRRUJDQL]H\RXUKRPH6WDFN
DEOH/LGLQFOXGHG'LPHQVLRQV
´[´[´
Our No.
No.
Cap
Qt
Shf
Pk
Unit
UNITED PLASTICS
Clear
Shf
Pk
Unit
Our No.
($
921-2333X
No.
Cap
Gal
Shf
Pk
581-3902X
72
4
($
Unit
NEWELL RUBBERMAID HOME
Clear
Clear/Blue Lid
4&/&%/
Unit
Clear
/RFNDEOHOLG6WXUG\ODWFKHV6SDFH
HI¿FLHQW´/[´:[´
+
NEWELL RUBBERMAID HOME
654-1965
168-4406X
339-8765X
‡&$5*2%2;
6WDFNDEOH IRU H[WUD VWRUDJH VSDFH
6HFXUH ¿W OLG 6HHWKURXJK FODULW\
IRUHDV\FRQWHQWLGHQWL¿FDWLRQ
Size
Qt.
Shf
Pk
UNITED PLASTICS
STORAGE CONTAINERS
‡6+2(%2;67$&.$%/(
‡³61$37233(5´
No.
Cap
Qt
UNITED PLASTICS
Our No.
([WUDODUJH FDSDFLW\ IRU VWRULQJ
EXON\ LWHPV 'XUDEOH ODWFKHV VQDS
KLQJHGOLGVKXW(DV\JULSFRPIRUW
DEOHKDQGOHV
389-2155
($
STORAGE CONTAINERS
Our No.
($
NEWELL RUBBERMAID HOME
Black & Charcoal Gray
24
1
‡+,1*('%2;
‡³528*+1(&.´
Our No.
No.
STORAGE CONTAINERS
Unit
RUBBERMAID HOME
622-0537X
Our No.
8VHWRRUJDQL]H\RXUKRPH6WDFN
DEOH/LGLQFOXGHG
:DWHUUHVLVWDQWLQWHUORFNLQJOLGDV
VXUHVDWLJKWVHDO'RXEOHZDOOHGOLG
IRUDGGHGVWUHQJWK'XUDEOHVWDFN
DEOHFRQVWUXFWLRQZLWKWRXJKORFNDEOHODWFKHVORFNQRW
LQFOXGHG (DV\ EXQJHH FRUG WLHGRZQ FDQ EH VHFXUHG
WRDXWRERDWRUWUXFN'LPHQVLRQV´/[´:[
´+RYHUDOO
Our No.
8VHWRRUJDQL]H\RXUKRPH6WDFN
DEOH /LG LQFOXGHG &OHDU 'LPHQ
VLRQV´+[´:[´/
STORAGE CONTAINERS
Black & Charcoal Gray
‡:$7(55(6,67$17
‡/2&.$%/(67$&.$%/(
‡³$&7,213$&.(5´
($
Unit
RUBBERMAID HOME
STORAGE CONTAINERS
6
‡-80%2
‡³25*$1,=(<285+20(´
0ROGHGLQ ¿QJHU DQG KDQG JULSV
&DQEHYHQWHGWRSUHYHQWPROGDQG
PLOGHZ 8OWUDYLROHW SURWHFWHG WR UHVLVW IDGLQJ :HDWKHU
DQGFRUURVLRQUHVLVWDQWKDUGZDUH&RQFHDOHGKLQJHVIRU
VHFXULW\'XUDEOHFRQVWUXFWLRQVWXUG\HQRXJKWREHXVHG
DV D VHDW :DWHUUHVLVWDQW WLJKW¿WWLQJ OLG KDV GRXEOH
ZDOOV&DQEHEROWHGWRGHFN7RXJKORFNDEOHODWFKORFN
QRWLQFOXGHG´/[´:[´+RYHUDOO
Cap
Gal
)*52<%/
STORAGE CONTAINERS
‡&$5*2%2;
‡%2/702817$%/(
‡:($7+(55(6,67$17
‡³$&7,213$&.(5´
6WDFNDEOH IRU H[WUD VWRUDJH VSDFH
6HFXUH¿WOLGZLWKVQDSVKXWODWFK
6HHWKURXJK FODULW\ IRU HDV\ FRQ
WHQW LGHQWL¿FDWLRQ &OHDU OLG ZLWK
EOXHODWFK
Unit
NEWELL RUBBERMAID HOME
Clear/Blue Lid
($
Shf
Pk
No.
&/5
16
6
($
STORAGE CONTAINERS
‡)/,3/,'
0ROGHG IURP KLJKGHQVLW\ SODVWLF
)HDWXUHV ÀLSOLG ZLWK VWXUG\ KLQJH
GHVLJQ$FFRPPRGDWHVKDQJLQJ¿OH
IROGHUV 8QLW LV VWDFNDEOH DQG KDV
EXLOWLQ KDQGOHV IRU HDV\ FDUU\LQJ
'LPHQVLRQV´+[´:[´'
Our No.
No.
Cap.
Gals.
Shf
Pk
Unit
UNITED PLASTICS
474-7531X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
72
6
($
Maintenance, Repair & Operations - STORAGE CONTAINERS
STORAGE BOXES
STORAGE BAGS
‡&$19$6
‡0$*,&&8%(
‡81'(5%('
´[´[´
8VH WR VWRUH WR\V FORWKLQJ DQG
RWKHU LWHPV &ROODSVLEOH ZKHQ QRW
LQXVH
Our No.
No.
Color
Shf
Pk
Unit
ENVISION THIS!,LLC
Size
In
No.
Shf
Pk
Unit
HOMEBASIX
10-1/2” x 8-1/4” x 5-1/4”
827-6198
616-2366
%
%OXH
12
($
616-2374
3
3XUSOH
12
($
616-2424
1
Tan
12
($
595-8210
%
%OXH
12
($
598-0875
3
3XUSOH
12
($
599-4405
1
Tan
12
($
0&1:/
14 x 14 x 14
($
Shf
Pk
Unit
ENVISION THIS!,LLC
16” x 12” x 8”
%
%OXH
12
($
616-2713
3
3XUSOH
12
($
616-2754
1
Tan
12
($
8VH WR VWRUH WRZHOV DFFHVVRULHV
DQGRWKHULWHPV
‡/$5*(
‡³25*$1,=(<285+20(´
Size
In
No.
Shf
Pk
Unit
788-6500
0<-)
[[
6
($
837-0462
0=-)/
[[
6
($
STORAGE BASKETS
‡&$19$6
‡'28%/(0$*,&&8%(
8VH WR VWRUH WR\V FORWKLQJ DQG
RWKHU LWHPV &ROODSVLEOH ZKHQ QRW
LQXVH
No.
&,$(&/
Our No.
Size
In
Shf
Pk
Unit
[[
24
($
Color
Shf
Pk
Unit
615-6400
%ODFN
6
($
615-6475
&OHDU
6
($
No.
White
‡81'(5%('&$19$6
8VH WR FUXVK FRNH FDQV +ROGV FDQV1HYHUKDQGOHDZHWPHVV\RU
VKDUSHGJHGFDQ)LYHEDJRIFDQV
FUXVKWRRQH1RHOHFWULFLW\RUEDW
WHULHV QHHGHG 1R SDLQW FKLSSLQJ RU UXVWLQJ +DUGZDUH
LQFOXGHG
Our No.
&-)
[[
Unit
DIAL INDUSTRIES
647-0157
6
0
($
‡)/(;,%/(727(
‡³=,3/2&´
Color
Shf
Pk
Unit
615-6368
%ODFN
6
($
615-6483
&OHDU
6
($
0DGHIURP0LOWKLFNVHPLWUDQV
SDUHQW ÀH[LEOH SODVWLF ¿OP ,Q
FOXGHV]LSSHUFORVXUHDQGKDQGOHV
IRUFDUU\LQJ$ÀH[LEOHVWRUDJHVROX
WLRQWKDWKHOSVRUJDQL]HDQGPD[LPL]HVSDFH6WDFNDEOH
DQG¿WVLQWLJKWVSDFHV
Our No.
No.
Size
Gal
Shf
Pk
Unit
SC JOHNSON
Shf
Pk
Unit
HOMEBASIX
682-5459
Shf
Pk
No.
XL - Box of 1
STORAGE BASKETS
No.
($
STORAGE CONTAINERS
8VH WR VWRUH VZHDWHUV EODQNHWV
DQGFORWKLQJXQGHU\RXUEHG)UHHV
XSFORVHWVSDFH
Our No.
6
&5
STORAGE BAGS
INTER-DESIGN
STORAGE BOXES
Unit
Brooms, Mops & Trash Bags
'XUDEOH PHGLXP SODVWLF EDVNHW
ZLWK KDQGOH FDQ VHUYH PDQ\ VWRU
DJHDQGRUJDQL]DWLRQXVHVWKURXJK
RXWWKHKRPH
Our No.
Size
In
($
Shf
Pk
No.
735-6561X
STORAGE BASKETS
HOMEBASIX
832-4782
12
ALUMINUM CAN
CRUSHER
'XUDEOHSODVWLFEDVNHWZLWKLQWHJUDO
KDQGOHV FDQ VHUYH PDQ\ VWRUDJH
DQG RUJDQL]DWLRQ XVHV WKURXJKRXW
WKHKRPH
Our No.
STORAGE BOXES
No.
Unit
UNITED PLASTICS
INTER-DESIGN
Our No.
Shf
Pk
NESTING/STACKING
CRATES
HOMEBASIX
616-2648
578-6660
‡&$19$6
Our No.
‡:,7++2/(6
Color
No.
8VH IRU HYHU\ URRP LQ WKH KRPH
'LPHQVLRQV´[´[´
STORAGE CONTAINERS
No.
Our No.
ENVISION THIS!,LLC
STORAGE BASKETS
15” x 15” x 15”
Our No.
Our No.
12
($
16” X 13” X 10.9”
'XUDEOH VPDOO FOHDU SODVWLF EDVNHW
ZLWK KDQGOH FDQ VHUYH PDQ\ VWRU
DJHDQGRUJDQL]DWLRQXVHVWKURXJK
RXWWKHKRPH
161-6457
Our No.
No.
9
1
($
1
($
26” X 16” X 12”
Unit
INTER-DESIGN
615-8406
XXL - Box of 1
102-6459
Shf
Pk
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
22
- Maintenance, Repair & Operations
STORAGE BAGS
STORAGE BAGS
‡7:,677,(&/2685(
‡³&29(5$//%$1$1$
%$*6´
‡68,7'5(663527(&725
2YHUVL]HG WR VHDO XS ELJ REMHFWV
ZLWK D VLPSOH H[WUDORQJ WZLVW WLH
3URWHFWV DJDLQVW EXJV GLUW GXVW
PRLVWXUHDQGVSLGHUV8VHIXOLQZDUHKRXVHVEDVHPHQWV
JDUDJHVDQGRWKHUVWRUDJHDUHDV7RXJKDQGGXUDEOH
PLO SODVWLF VHHWKURXJK WR VKRZ FRQWHQWV DQG KHDY\
ZHLJKWWRUHVLVWWHDUVRUSXQFWXUHV7ZLVWWLHVLQFOXGHG
´[´UHJXODU¶VL]HIRUKLJKFKDLUVDQGPRUH´[
´ODUJH¶VL]HIRUFKDLUVRUNHWWOHJULOOV´[´JLDQW
¶VL]HIRUODZQFKDLUVRUELNHVDQG´[´MXPER¶
VL]HIRUVPDOOHUPDWWUHVVHVRUFKULVWPDVWUHHV
Our No.
No.
Size
In
Shf
Pk
Our No.
&%
[
12
3.
841-4161
&%
[
12
3.
841-4211
&%
45 x 96
12
3.
810-6213
&%
[
12
3.
ENVISION THIS!,LLC
576-7983
Unit
ALLBOXES DIRECT
24
[
($
732-2761
$%6+(/
Shf
Pk
Unit
6
[
($
FLOOR MATS
‡5(&<&/('58%%(5
‡:(/&20(
:LWK 'DLV\ 6L]H ´ [ ´
Our No.
No.
624-9882
$%
($
‡32/<(7+</(1(
‡³$6752785)´
‡08/7,86(
‡³67$&.9$&3$&.0$7(´
415-6386
12
FLOOR MATS
GRASSWORX
No.
Size
In
No.
HOMEBASIX
STORAGE BAGS
8VHWRFUHDWHPRUHVSDFHIRUVWRU
DJHRIEXON\OLQHQVVHDVRQDOFORWK
LQJ RU ORQJWHUP VWRUDJH +DV D
JXVVHWWHG ERWWRP 3UHYHQWV PRLV
WXUHDQGPLOGHZSHQHWUDWLRQ)LWVLQWRSODVWLFWRWHVDQG
ER[HV)RUXVHZLWKDQ\VWDQGDUGYDFXXPZLWKDKRVH
:DWHUSURRIUHXVDEOHDLUWLJKW
Our No.
Floor Care & Floor Protection
Our No.
Shf
Pk
Unit
DOOR MATS
841-4138
Size
In
Shf
Pk
No.
Unit
WARP BROTHERS
Our No.
FLOOR MATS
‡5(&<&/('58%%(5
‡&580%
´[´
Unit
6
6SUXFH*UHHQ
Shf
Pk
Unit
HOMEBASIX
Shf
Pk
Color
Size
In
No.
704-2799
$%6+(
[
6
($
Shf
Pk
Unit
($
FLOOR MATS
‡58%%(5*5$7(
DOOR MATS
5LEEHG SRO\SURS\OHQH
ERQGHGWRUXEEHU
‡)/$,5
‡³$6752785)´
5HVLVWV PROG VWDLQV IDGLQJ DQG
VKHGGLQJ 'XUDEOH HDV\ WR FOHDQ
DQGIDVWGU\LQJ6OLSUHVLVWDQWEDFN
6L]H´[´
Our No.
No.
Our No.
Size
In
No.
HOMEBASIX
Shf
Pk
Color
&DUSHW
Unit
751-6560
$%6+(/
6
[
($
GRASSWORX
STORAGE BAGS
611-2544
6SUXFH*UHHQ
6
($
679-8599
&LQGHU
6
($
‡08/7,86(
‡³9$&86$&3$&.0$7(´
8VHWRFUHDWHPRUHVSDFHIRUVWRU
DJHRUIRUWUDYHO3UHYHQWVPRLVWXUH
DQG PLOGHZ SHQHWUDWLRQ )LWV LQWR
SODVWLF WRWHV DQG ER[HV RU XQGHU
DEHG)RUXVHZLWKDQ\VWDQGDUGYDFXXPZLWKDKRVH
:DWHUSURRIUHXVDEOHDLUWLJKW
Our No.
No.
Size
In
Shf
Pk
FLOOR MATS
‡58%%(5
5LEEHGSRO\SURS\OHQHFDUSHWERQG
HGWRUXEEHU
$%
24
[
Our No.
Unit
Our No.
($
No.
Color
Size
In
%OXH
[
Shf
Pk Unit
$%6+(/
6 ($
742-9665
$%6+(/
´[´[´
($
FLOOR MATS
FLOOR MATS
‡5(&<&/('58%%(5
‡+$/)&,5&/(
Our No.
Shf
Pk
12
Unit
($
No.
Size
Ft
Shf
Pk
2x5
6
Unit
MULTY INDUSTRIES
ENVISION THIS!,LLC
6
[
1HXWUDO KXHV WR FRRUGLQDWH ZLWK
any decor; indoor use only; ma
FKLQHZDVKDEOHQRQVOLSEDFNLQJ
‡*2:13527(&725
567-3298
Unit
‡<25.7$83(,1'225
STORAGE BAGS
No.
Shf
Pk
HOMEBASIX
741-5409
Our No.
Size
In
No.
HOMEBASIX
ALLBOXES DIRECT
423-1700
FLOOR MATS
‡5(&<&/('58%%(5
‡)/2&.'<(&87
Our No.
No.
Size
In
Shf
Pk
236-9577
Unit
HOMEBASIX
742-3957
$%6+(/
[
4
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
($
Maintenance, Repair & Operations - FLOOR MATS
No.
Size
In
Shf
Pk
Unit
14 x 25
24
400-2416
($
Size
Ft
Shf
Pk
Unit
[
Our No.
No.
249-3401
Unit
MULTY INDUSTRIES
[
1
52//
FLOOR MATS
702-3161
$%6+(
6
12
($
Size
In
No.
Shf
Pk
Unit
$%6+(
6
[
($
DOOR MATS
‡58%%(5+($9<'87<
‡&$3,7$/
*UDEV KROGV DQG KLGHV GLUW 'XUD
EOHEODFNUXEEHUIUDPHDQGSODVWLF
EODGHV:LOOQRWEORZDZD\&LQGHU
*UDVV
Size
Ft
Shf
Pk
Unit
25
($
Our No.
[
590-7936
2x6
16
($
243-3191
[
12
($
No.
Size
In
Shf
Pk
Unit
GRASSWORX
044-3044
908-5960
[
($
DOOR MATS
5HF\FOHGUXEEHUPDWHULDO
Shf
Pk
2x5
6
Our No.
Unit
6
($
Our No.
($
Shf
Pk
No.
Unit
HOMEBASIX
Shf
Pk
No.
Unit
HOMEBASIX
$%6+(/
6
18” x 30”
002-6187
6
'0
($
($
DOOR MATS
FLOOR MATS
‡:$/187
‡,1'225287'225
DOOR MATS
8SJUDGH XWLOLW\ UXQQHU GHVLJQ IRU
KLJKWUDI¿FDUHDVVXUIDFHSURYLGHV
D JUHDW VFUDSLQJ VXUIDFH IRU IRRW
ZHDU KHDY\ ZHLJKW WRS VXUIDFH
KHDY\GXW\YLQ\OEDFNIRUH[WUDGX
UDELOLW\3ODWLQXP&KDUFRDO
‡,1'225287'225
:DOQXWZLWKJROGHQHGJH5HF\FOHG
UXEEHUPDWHULDO
5HF\FOHGUXEEHUDQWLVNLGEDFNLQJ
VSHFLDOO\ GHVLJQHG ZLWK D VXSH
ULRUVFUDSLQJDFWLRQWRFOHDQVKRHV
3RO\SURS\OHQH FDUSHW ERQGHG WR
UXEEHU
Our No.
No.
($
HOMEBASIX
646-7344
MULTY INDUSTRIES
461-3063
Our No.
6
[
´[´&RFRQXW
Size
Ft
[
Our No.
Unit
MULTY INDUSTRIES
654-1387
647-5495
5HF\FOHGUXEEHUDQWLVNLGEDFNLQJ
GXUDEOH ÀRFNHG WRS VFUDSHV VKRHV
FOHDQ
FLOOR MATS
7RXJKDQGGXUDEOHXWLOLW\ÀRRUSUR
WHFWLRQ ZLWK D WULULE WLS VXUIDFH
QRQVOLSJHOEDFNLQJ&KDUFRDO
No.
No.
Unit
‡)/2&.,1*
‡,1'225287'225
‡&21&25'87,/,7<35(
&876
Our No.
Our No.
Shf
Pk
‡,1'225287'225
FLOOR MATS
Shf
Pk
Size
In
No.
DOOR MATS
Shf
Pk
1HXWUDO KXHV WR FRRUGLQDWH ZLWK
DQ\ GHFRU PDFKLQH ZDVKDEOH
QRQVOLSEDFNLQJ
($
Size
Ft
3URWHFWV KHDY\ WUDI¿F DUHDV IURP
GLUWZHWQHVVDQGZHDUPDGHIURP
UHF\FOHG PDWHULDOV LGHDO IRU ORZ
SLOHFDUSHWV&OHDU
722-9222
4
[
‡0217$1$,1'225
Size
In x Ft
Our No.
HOMEBASIX
‡9,1</,1'225
No.
Unit
MULTY INDUSTRIES
($
FLOOR MATS
Our No.
Shf
Pk
3UHFXW ORZ SLOH FOHDUQULE 3UR
WHFWVKHDY\WUDI¿FDUHDVIURPGLUW
ZHWQHVVDQGZHDUPDGHIURPUH
F\FOHGPDWHULDOVLGHDOIRUORZSLOH
FDUSHWV&OHDU
MULTY INDUSTRIES
Size
In
‡9,1</,1'225
,QWHUORFN$QWLIDWLJXHUXEEHUPDWV
SURYLGHVWUHVVUHOLHIIRUORZHUEDFN
IHHWDQGOHJVPXOWLSOHPDWVFDQEH
linked together to accommodate
ODUJHUZRUNVSDFHV%ODFN
749-8660
No.
FLOOR MATS
‡,1'225287'225
No.
Our No.
MULTY INDUSTRIES
FLOOR MATS
Our No.
5HF\FOHGUXEEHUDQWLVNLGEDFNLQJ
VSHFLDOO\ GHVLJQHG ZLWK D VXSHULRU
VFUDSLQJDFWLRQWRFOHDQVKRHV
/LQNGXUDEOHPDGHIURPUHF\FOHG
UXEEHU%ODFN
MULTY INDUSTRIES
984-7526
‡,1'225287'225
‡287'225
6WDQGDUGERRWWUD\'XUDEOHZDVK
DEOH%ODFN
Our No.
DOOR MATS
FLOOR MATS
‡%22775$<
Size
Ft
Shf
Pk
Unit
MULTY INDUSTRIES
406-6338
[
6
($
758-9328
[
6
($
Our No.
No.
Size
In
Shf
Pk
$%6+(
Unit
18” x 30”
003-7176
[
4
Unit
HOMEBASIX
HOMEBASIX
649-3050
Shf
Pk
No.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
'0
6
($
- Maintenance, Repair & Operations
DOOR MATS
RUG RUNNER DISPLAY
FLOOR RUNNERS
‡)/2&.,1*:(/&20(
35,17
‡5,%%('
‡³3/$6720$7´
‡,1'225287'225
5HF\FOHGUXEEHUPDWHULDO
/D\V ÀDW 3URWHFWV FDUSHWV IURP
PXG DQG WUDFNLQJ 5LEV KROG GLUW
XQWLOLWFDQEHZLSHGXSRUFDUULHG
DZD\&DQDOVRXVHGWROLQHVKHOYHV
DQG GUDZHUV &OHDQV HDVLO\ 'LVSOD\ FRQWDLQV UROOV RI
´[¶ÀRRUUXQQHUDQGGLVSOD\FDUWRQ
Our No.
Shf
Pk
No.
Unit
HOMEBASIX
Our No.
18” x 30”
004-6805
6
'0
No.
Our No.
Color
Shf
Pk
Unit
&OHDU
24
52//
WARP BROTHERS
($
450-4387X
7,.6
30
‡+$5')/2253527(&725
‡,1'225
Our No.
3URWHFWV KHDY\ WUDI¿F DUHDV IURP
GLUWZHWQHVVDQGZHDUPDGHIURP
UHF\FOHG PDWHULDOV LGHDO IRU KDUG
ÀRRUVXUIDFHV&OHDU
Shf
Pk
Unit
HOMEBASIX
Our No.
23” x 35”
009-9291
4
'0
No.
980-2778
Shf
Pk
Unit
[
1
52//
Size
In x Ft
Shf
Pk
Unit
27 x 75
1
52//
Shf
Pk
Unit
($
($
MULTY INDUSTRIES
‡,1'225
3URWHFWV KHDY\ WUDI¿F DUHDV IURP
GLUWZHWQHVVDQGZHDUPDGHIURP
UHF\FOHG PDWHULDOV LGHDO IRU PH
GLXPSLOHFDUSHWV
Our No.
Size
In x Ft
Shf
Pk
Unit
[
1
52//
MULTY INDUSTRIES
($
Size
In x Ft
FLOOR RUNNERS
FLOOR RUNNERS
6DQGHG ¿QLVK 5HF\FOHG UXEEHU
PDWHULDO
No.
No.
421-3195
DOOR MATS
‡6$1'(':(/&20(35,17
8SJUDGH XWLOLW\ UXQQHU GHVLJQ IRU
KLJKWUDI¿FDUHDVVXUIDFHSURYLGHV
D JUHDW VFUDSLQJ VXUIDFH IRU IRRW
ZHDU KHDY\ ZHLJKW WRS VXUIDFH
KHDY\GXW\YLQ\OEDFNIRUH[WUDGX
UDELOLW\3ODWLQXP&KDUFRDO
No.
MULTY INDUSTRIES
067-4804
STAIR TREADS
SHOE/BOOT SCRAPERS
Our No.
7RXJKDQGGXUDEOHXWLOLW\ÀRRUUXQ
QHU ZLWK D VLQJOH ULE WLS VXUIDFH
QRQVOLSJHOEDFNLQJ*UH\
Our No.
Unit
GRASSWORX
119-8381
4
3URYLGHV WUDFWLRQ ZKLOH SURWHFWLQJ
VWDLUVIURPZHDUDQGWHDUEXOOQRVH
HGJLQJ ¿WV RYHU VWDLU SURYLGLQJ D
¿QLVKHGORRN
‡,1'225287'225
Shf
Pk
No.
‡%8//126(
FLOOR RUNNERS
5HPRYHV GLUW JUDVV DQG PRUH E\
VOLGLQJ VKRHV RU ERRWV DFURVV WKH
VXUIDFH 6WLII SRO\HWK\OHQH EULVWOHV
ZRQ¶W ZHDU RXW 'XUDEOH ZHDWKHU
UHVLVWDQW IUDPH ZLWK QRQ VOLG ERW
WRP +RVH RII IRU HDV\ FOHDQLQJ
´+[´:[´+
Our No.
Shf
Pk
Unit
MULTY INDUSTRIES
812-9504
($
No.
Size
In x Ft
[
1
52//
MULTY INDUSTRIES
Black
258-2260
7,+6
FLOOR RUNNERS
‡:,7+)2/',1*67(33$'
‡,1'225287'225
6L]H ´ [ ´ [ ´ 6WHS SDG
VL]H´[´:RRGSDGVWHHO
IUDPH DQG SRO\SURS\OHQH WRXJK
EULVWOH
7RXJKDQGGXUDEOHXWLOLW\ÀRRUUXQ
QHUZLWKDWULULEWRSVXUIDFHQRQ
VOLSJHOEDFNLQJ%ODFN
Our No.
Shf
Pk
No.
Unit
HOMEBASIX
053-0360
1
=-
Our No.
CANDLES
EMERGENCY CANDLES
Size
In x Ft
Shf
Pk
Unit
[
1
52//
+RXVHKROG HPHUJHQF\ FDQGOHV
ZKLWHIUDJUDQFHIUHHER[RI&DQ
EHXVHGIRUDYDULHW\RISXUSRVHV
Our No.
RUG RUNNERS
‡,1'225
(DVLO\FXWWRVL]HZLWKUHJXODUVFLV
VRUV:LSHVFOHDQZLWKGDPSFORWK
/D\VÀDW
3URWHFWV KHDY\ WUDI¿F DUHDV IURP
GLUWZHWQHVVDQGZHDUPDGHIURP
UHF\FOHG PDWHULDOV LGHDO IRU KDUG
ÀRRUVXUIDFHV%ODFN
Our No.
No.
Color
Shf
Pk
Unit
532-3399
30” x 100’
7,+6
30
No.
&OHDU
1
52//
441-2060
,.6
Shf
Pk
Unit
6
3.
Size
In
Shf
Pk
Unit
5
($
5
PLUMBERS CANDLES
Size
In x Ft
Shf
Pk
Unit
27 x 75
1
52//
)RUSDWLRVKXUULFDQHODPSVDQGD
YDULHW\ RI RWKHU SXUSRVHV :KLWH
IUDJUDQFHIUHH
30” x 50’
418-7555
Size
In
Boxed
076-7988
MULTY INDUSTRIES
WARP BROTHERS
441-2078
Our No.
No.
CANDLE-LITE CO
FLOOR RUNNERS
‡5,%%('+($9<:(,*+7
‡³3/$6720$7´
24 x 9
Chemicals,Cleaners & Cleaning
Implements
MULTY INDUSTRIES
562-1578
($
No.
24 x 9
Brown
214-9839
SHOE/BOOT SCRAPERS
Size
In
No.
30
&OHDU
1
52//
Our No.
30:
:KLWH
1
52//
CANDLE-LITE CO
088-3710X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
No.
5416595
Maintenance, Repair & Operations - 191
Gadgets & Cutlery
CANDLES
CANDLE LAMP SETS
‡3,(&(/,48,',1'225
‡³&2'((0(5*(1&<´
1DWXUDO ÀDPH SUH¿OOHG FDUWULGJH
+RXUV RI VDIH LOOXPLQDWLQJ UHDV
VXULQJ ODPSOLJKW 6KDWWHU UHVLVWDQW
OLJKW GLIIXVLQJ FKLPQH\V %XUQV XS
WRKRXUV&RQWDLQVFDQGOHV
Our No.
Ht
In
No.
SIDEWALK SCRAPERS
PNEUMATIC TIRES
‡)25*('67((/
‡<$5'&$57
)RUJHG KHDG KHDY\ GXW\ VLGHZDON
VFUDSHU ,GHDO IRU VFUDSLQJ LFH DQG
GHEULVIURPÀDWVXUIDFHV
+HDY\ GXW\ EDOO EHDULQJV ´
ERUH1RWIRUKLJKZD\XVH
Our No.
Blade
Size In
No.
Shf
Pk
Unit
MINTCRAFT PRO
Shf
Pk
Our No.
No.
Size
In
Shf
Pk
Unit
TRICAM INDUSTRIES INC
54” HANDLE WITH D-GRIP
082-4383
)5
4
($
829-0017
)5
4
($
Unit
913-3331
35
SIDEWALK SCRAPERS
CART PARTS
‡)25*('+($9<'87<
‡67((/
3DUWV IRU FX IW SRO\ FDUW VNX
6&5'
14 x 7
6
($
LAMPLIGHT FARMS
Boxed
610-3840
6
Garden Tools
)RUJHG KHDG KHDY\ GXW\ VLGHZDON
VFUDSHU ,GHDO IRU VFUDSLQJ LFH DQG
GHEULVIURPÀDWVXUIDFHV
SCRAPERS/EDGERS
LANDSCAPING EDGER
‡67((/
‡³+281''2*´
Our No.
Our No.
No.
Shf
Pk
+'3
4
Unit
6&5
($
6
OE FDSDFLW\ ´ [ ´ VWHHO
PHVKGHFN
Shf
Pk
Our No.
Unit
MINTCRAFT PRO
‡35(0,80&+2,&(
‡+$/)0221('*(5
($
‡:,7+)2/''2:16,'(6
Blade
Size In
No.
1
STEEL CARTS
‡)25*('+($'+($9<
'87<
‡67((/
Our No.
Unit
($
)RUJHG KHDG KHDY\ GXW\ VLGHZDON
VFUDSHU ,GHDO IRU VFUDSLQJ LFH DQG
GHEULVIURPÀDWVXUIDFHV
SIDEWALK/GARDEN
EDGERS
Shf
Pk
No.
089-1200
7x2
SIDEWALK SCRAPERS
Unit
Our No.
UNION TOOLS (WHEELBARROWS)
54” WOOD HANDLE
125-7062
AMES TRUE TEMPER, INC.
422-9696
Shf
Pk
MINTCRAFT PRO
%RUGHU HGJHU ZLWK DUFKHG EODGH
GHVLJQWKDWFXWVVWUDLJKWRUFXUYHG
WUHQFKHV IRU XQLTXH VKDSHG EHGV
)RRWSODWH SURYLGHV FRQVLVWHQW FXW
WLQJGHSWKZLWKGXUDEOHVKDUSHQHGVWHHOEODGH
Lgth
In
Blade
Size In
No.
Shf
Pk
No.
Unit
TRICAM INDUSTRIES INC
264-5497
1
)5
($
42” ASH WOOD HANDLE WITH D-GRIP
074-6966
6&5'
4x2
6
($
GARDEN CARTS
Our No.
Shf
Pk
No.
Unit
SIDEWALK SCRAPERS
+HDY\GXW\ SDLQWHG ZRRGFKLS
ERDUG EHG DQG UHPRYDEOH IURQW
SDQHO7XEXODUVWHHOKDQGOHLQFK
GLDPHWHU VHPLSQHXPDWLF ZKHHO
WLUHV8SWRSRXQGVFDSDFLW\KHDS
‡:(/'('
MINTCRAFT
48’’ PREMIUM ASH HANDLE
651-3683
‡:22'
‡³7+(+($9<:(,*+76´
6
:HOGHGVLGHZDONVFUDSHU´EODGH
($
SCRAPERS
Our No.
Our No.
Shf
Pk
No.
Unit
MINTCRAFT
%ODFNKHDG
No.
Cu
Ft Cap
Shf
Pk
Unit
AGRI-FAB INC
271-7643
7
1
($
54” PREMIUM WOOD HANDLE
980-5003
6
($
GARDEN CARTS
Our No.
No.
Shf
Pk
Unit
YARD CARTS
MINTCRAFT PRO
6
+HDY\GXW\ SDLQWHG ZRRGFKLS
ERDUG EHG 5HPRYDEOH IURQW SDQHO
DOORZVIRUHDV\GXPSLQJ%HGVL]H
´+ [ ´: [ ´/ 7XEXODU
VWHHO KDQGOH LQFK GLDPHWHU VHPLSQHXPDWLF ZKHHO
WLUHV8SWRSRXQGVFDSDFLW\KHDS
NO-FLAT TIRES
48” LAQUERED ASH HANDLE
051-4778
‡:22'
‡³7+(+($9<:(,*+76´
Garden Tools
($
‡<$5'&$57
+HDY\ GXW\ EDOO EHDULQJV ´
ERUH1RWIRUKLJKZD\XVH
Our No.
No.
Cu
Ft Cap
Shf
Pk
Unit
AGRI-FAB INC
Our No.
No.
Size
In
Shf
Pk
Unit
991-0191
TRICAM INDUSTRIES INC
356-5769
)5
4
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
.
14
1
($
192 - Maintenance, Repair & Operations
GARDEN CARTS
LAWN CARTS
LAWN CARTS
‡32/<
‡³7+(+($9<:(,*+76´
‡32/<
‡³($6<52//(5´
‡32/<
+HDY\GXW\ VHDPOHVV SRO\ EODFN
WUD\ZLWKKHDY\JDXJHWXEXODUVWHHO
KDQGOHLQFKGLDPHWHUSQHXPDW
LF ZKHHOWLUHV 8S WR SRXQGV
FDSDFLW\KHDS
$OO SRO\ ODZQ FDUW ZLWK WXEXODU
VWHHOD[OH([WUDZLGHZKHHOEDVH
ÀDWERWWRPDQGUHFHVVHGWRROWUD\
LQFK IURQW ZKHHOV LQFK UHDU
ZKHHOVDQGSRXQGFDSDFLW\
Our No.
No.
Cu
Ft Cap
Shf
Pk
Unit
AGRI-FAB INC
682-4189
Our No.
No.
1
Our No.
Unit
LAWN CARTS
+HDY\JDXJHVWHHOFRQVWUXFWLRQIRU
JUHDWHU VWUHQJWK *UHHQ SRZGHU
FRDW IRU UXVW UHVLVWDQW ¿QLVK ´
SQHXPDWLF ZKHHOV ZLWK VWHHO ULPV
OE ORDG FDSDFLW\ ´ [ ´
GLDPHWHUVWHHOSXOOKDQGOHZLWKFRPIRUWJULS´[´
PHVKERG\
‡³528*+1(&.´
Shf
Pk
No.
Unit
VULCAN
587-3005
4
1
Our No.
1
<7/
Cu
Ft Cap
No.
Shf
Pk
Unit
RUBBERMAID COMMERCIAL
($
1
($
Unit
($
GARDEN CARTS
)XOO\ DVVHPEOHG )ODW ERWWRP IRU
HDV\ORDGLQJXQORDGLQJDQGWUDQV
SRUW/DUJH´'LDPHWHU[´:LGH
ZKHHOV IRU HDV\ KDQGOLQJ RYHU
URXJKXQHYHQWHUUDLQDQGVWDELOLW\
7UD\IRUJDUGHQWRROVZLWKPROGHGLQWRROKROGHUVIRUORQJ
KDQGOHG JDUGHQ WRROV DQG D FXS KROGHU 6WDNH VORWV IRU
DGGLWLRQDOFDSDFLW\VXSSRUWLQJODZQDQGOHDIEDJV8OWUD
YLROHWVWDELOL]HGPDWHULDOWRSUHYHQWFRORUIDGLQJVWUHQJWK
GHWHULRUDWLRQ/RDGUDWHGSRXQGFDSDFLW\6L]H´/
[´:[´+
Our No.
‡67((/
Cu
Ft Cap
No.
Shf
Pk
Unit
RUBBERMAID COMMERCIAL
OEV NJV ORDG FDSDFLW\
´ [ ´ GLD VWHHO SXOO KDQGOH
´ SQHXPDWLF ZKHHOV ZLWK VWHHO
ULP +HDY\ JDXJH VWHHO FRQVWUXF
WLRQZLWKUHLQIRUFHGVLGHVIRUJUHDW
HU VWUHQJWK (DV\ WR RSHUDWH SLQV DOORZ WKH VLGHV WR EH
ORFNHGXSULJKWIROGHGGRZQRUUHPRYHGIRUWUDQVSRUWLQJ
RYHUVL]HGLWHPV0HVKERG\EHG
Size
In. Bed
Shf
Pk
Unit
1
[
($
GARDEN CART WHEELS
7LUH6L]H´[´:LWKWXEH$[OH
6L]H ´ 'LD ´ FP KXE
OHQJWKOEVNJVORDGUDW
LQJ .QREE\ WUHDG SDWWHUQ 3QHX
PDWLF EDOO EHDULQJ 5HSODFHPHQW
ZKHHOIRU0LQW&UDIW*DUGHQ&DUW
Shf
Pk
Evergreen
614-5767
1
($
‡%,*:+((/
‡³)$50728*+´
)XOO\DVVHPEOHG2QHSLHFHVPRRWK
VHDPOHVV ERG\ FRQVWUXFWLRQ IRU
VWUHQJWK DQG GXUDELOLW\ &DUULHV XS
WRSRXQGVFXELFIHHWOHYHO
DQGFXELFIHHWKHDSHG5HVLVWDQFHWRPRVWIDUPDQG
ODZQJDUGHQFKHPLFDOVDQGVXEVWDQFHVDQGLWVODUJHUD
GLXVLQWHULRUDOORZVIRUHDV\FOHDQLQJ/DUJH´[´
SQHXPDWLFZKHHOVUROOVPRRWKO\RYHUDQ\VXUIDFHV6L]H
´/[´:[´+
Cu
Ft Cap
Shf
Pk
Unit
Gray
%/$
1
($
LAWN CARTS
‡/2:352),/(
‡³)$50728*+´
No.
Cu
Ft Cap
Shf
Pk
Unit
RUBBERMAID COMMERCIAL
Gray
641-6549
7,.
%/$
1
($
FARM UTILITY CARTS
‡%,*:+((/
‡³)$50728*+´
8QDVVHPEOHG2QHSLHFHERG\FRQ
VWUXFWLRQFDUULHVXSWRSRXQGV
¿OOVPRVWDJULFXOWXUHDQGODZQJDU
GHQ QHHGV 6HPLSQHXPDWLF ´ [
´ZKHHOVSURYLGHHDV\PRELOLW\RYHUPRVWVXUIDFHV
&RPIRUWDEOH PROGHG KDQG JULS 6PRRWK VHDPOHVV ERG\
IRU HDV\ XVH DQG FOHDQLQJ 5HVLVWDQW WR PRVW IDUP DQG
ODZQJDUGHQ FKHPLFDOV 5HLQIRUFHPHQW ULEV DGG LPSDFW
UHVLVWDQFH´/[´:[´+
Our No.
No.
Cu
Ft Cap
Shf
Pk
Unit
RUBBERMAID COMMERCIAL
Gray
Unit
641-5863
5
No.
RUBBERMAID COMMERCIAL
641-5384
Our No.
MINTCRAFT
35
1
%/$
FARM UTILITY CARTS
Our No.
($
8QDVVHPEOHG 2QH SLHFH VWXUG\
VWUXFWXUDO IRDP FRQVWUXFWLRQ ZRQ¶W
UXVWGHQWFKLSRUSHHO$OOSODVWLF
seamless pan design resists leaking
DQGFUDFNLQJ:LGH³ZKHHOEDUURZW\SH´WLUHVIRUVRIWXQ
HYHQWHUUDLQ&RPIRUWDEOHPROGHGKDQGJULS8VHIRUPRVW
OLJKW KDXOLQJ FKRUHV /RDG UDWHG FDSDFLW\ SRXQGV
6L]H´/[´:[´+
VULCAN
079-4016
($
‡CC528*+1(&.´
1
<7/
712-6485
LAWN CARTS
Shf
Pk
No.
No.
1
%/$
45-1/4 x 25-7/8 x 33-1/4 - 500-Ib. Capacity
VULCAN
Our No.
Unit
39-1/4 x 17-7/8 x 33-1/4 - 500-Ib. Capacity
641-7950
*UHHQ SRZGHU FRDW ¿QLVK IRU UXVW
UHVLVWDQFH ´ SQHXPDWLF WLUHV
ZLWK VWHHO ULPV OE ORDG FD
SDFLW\ ´ [ ´ PHVK ERG\ ´
[ ´ GLDPHWHU VWHHO SXOO KDQGOH
ZLWKFRPIRUWJULS
7&(*
Shf
Pk
No.
NEWELL RUBBERMAID COMMERCIAL
‡0(6+%2'<
895-2004
(DV\ WR PDQHXYHU PD[LPXP
ZHLJKW FDSDFLW\ OEV OEV
SHU VKHOI 8VH IRU WUDQVSRUWLQJ
HTXLSPHQWDQGKHDY\ORDGVLQDQ\
HQYLURQPHQW6WXUG\VWUXFWXUDOIRDPFRQVWUXFWLRQZRQ¶W
UXVW GHQW FKLS RU SHHO 5RXQGHG FRUQHUV SURWHFW ZDOOV
DQG IXUQLWXUH /LJKWZHLJKW DQG PDQHXYHUDEOH /DUJH
QRQPDUNLQJ FDVWHUV 0ROGHGLQ KDQGOHV DQG OHDNSURRI
WRSV 3ODVWLF FRQVWUXFWLRQ UHVLVWV EDFWHULD DQG HDV\ WR
FOHDQ
Our No.
GARDEN CARTS
No.
($
‡+($9<'87<
‡6+(/)
6WURQJ RQHSLHFH PROGHG KDQGOH
ZLGH ZKHHOV IRU HDV\ KDQGOLQJ
)XOO\DVVHPEOHGQRWRROVUHTXLUHG
0ROGHGLQ WRRO KROGHU NHHSV JDU
GHQLQJ WRROV ZLWKLQ HDV\ UHDFK
'HQWDQGVFUDWFKUHVLVWDQWZLOOQRWUXVW(DV\WROLIWDQG
GXPSSRXQGFDSDFLW\6L]H´/[´:[´+
655-1378
Our No.
1
7&&$57
($
Grey
978-1436
Unit
UNION TOOLS (WHEELBARROWS)
UTILITY CARTS
‡0(6+%2'<
Our No.
Shf
Pk
No.
Gray
($
GARDEN CARTS
978-1956
Shf
Pk
AMES TRUE TEMPER, INC.
6
033-2908
Our No.
Cu
Ft. Cap.
$OOZHDWKHU UXJJHG SRO\ FRQVWUXF
WLRQ /LJKWZHLJKW HDV\ WR OLIW DQG
GXPS
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%/$
1
($
Maintenance, Repair & Operations - YARD CARTS
6WHHO IUDPH ZLWK UXVW UHVLVWDQW
SRZGHU FRDW ¿QLVK :HDWKHU UH
VLVWDQW ZRRG FRPSRVLWH ER[ ´
SQHXPDWLF WLUHV IRU HDV\ PDQHX
YHULQJ RQ DQ\ VXUIDFH 5HPRYDEOH
IURQW SDQHO IRU HDV\ ORDGLQJ DQG
XQORDGLQJOEFDSDFLW\FXELFIW%HGVL]H´/
[´+[´:
Our No.
Shf
Pk
No.
Unit
VULCAN
976-0612
1
<7/
($
DUMP CARTS
PLATFORM CARTS
‡32/<*$5'(1
‡³*25,//$&$57´
‡$/80,180
,GHDO IRU \DUG DQG ODQGVFDSLQJ
SURMHFWV DV ZHOO DV ZRUN DURXQG
WKHJDUGHQ3DWHQWHGRQHVWHSSLQ
UHPRYDO TXLFNO\ FRQYHUWV WKH SXOO
KDQGOHWRDWUDLOHUKLWFKLQVHFRQGV'XUDEOHPROGHGEHG
ZRQ¶WUXVWFOHDQVHDVLO\DQGLVPDLQWHQDQFHIUHH6LP
SOHEDODQFHGGXPSLQJPLQLPL]HVVWUDLQZKHHOGHVLJQ
PD[LPL]HVVWDELOLW\RQDQ\WHUUDLQ'LPHQVLRQV´/
[´:[´+´SQHXPDWLFWLUHV
Our No.
No.
Cap
Lbs
Shf
Pk
´UXEEHUFDVWHUV5HDUVZLYHOFDVW
HUV IRU HDV\ VWHHULQJ 5HPRYDEOH
KDQGOH IRU HDV\ VWRUDJH 3ODWIRUP
6L]H´/[´:2YHUDOO
6L]H´/[´:[´+
/RDGFDSDFLW\OEVNJV
Our No.
Shf
Pk
No.
Unit
VULCAN
895-8720
1
3+$/
($
Unit
TRICAM INDUSTRIES INC
168-8647
*25%
1
($
DUMP CARTS
‡67((/60$//
‡386+72:7<3(
8VH IRU JHWWLQJ ULG RI \DUG UHIXVH
KDXOLQJ ¿UHZRRG PRYLQJ VDQG RU
GXPSLQJJUDYHO´GLDPHWHUD[OH
DQG WLUH ´ [ ´ SQHXPDWLF ULE
ZKHHOV SLHFH SRO\ EHG LV TXLHW
DQGUHVLVWVUXVW%HG´:[´/[´+(DV\FRQ
YHUWVIURPDSXVKFDUWWRDWRZGXPSFDUWE\XQIROGLQJ
WKHKLWFK
Our No.
No.
Cap
Lbs
Shf
Pk
1
Unit
AGRI-FAB INC
152-4966
7,.6
($
DUMP CARTS
‡*$5'(132/<
,GHDOIRUODZQDQGJDUGHQSURMHFWV
ODQGVFDSLQJ RU \DUG ZRUN 4XLFN
UHOHDVHGXPSLQJPHFKDQLVPDOORZV
IRUEDODQFHGDQGHDV\GXPSLQJRI
ORDGVXSWROEV3DWHQWHGRQH
VWHS SLQ UHPRYDO TXLFNO\ FRQYHUWV WKH SXOO KDQGOH WR D
WUDLOHU KLWFK WR KDXO WKH FDUW EHKLQG \RXU ODZQ WUDFWRU
DQG$79'XUDEOHSRO\EHGLVPDLQWHQDQFHIUHHHDV\WR
FOHDQDQGZRQ¶WUXVWZKHHOGHVLJQPD[LPL]HVVWDELOLW\
RQDQ\WHUUDLQ´SQHXPDWLFWLUHV'LPHQVLRQV´/[
´:[´'
Our No.
No.
DUMP CARTS
TRICAM INDUSTRIES INC
‡87,/,7<
317-2384
+HDY\GXW\VWHHOFRQVWUXFWLRQZLWK
UXVW UHVLVWDQW SRZGHU FRDW ¿QLVK
2YHUVL]H ´ SQHXPDWLF WLUHV IRU
HDV\PDQHXYHULQJRQDQ\VXUIDFH
5HPRYDEOH WDLOJDWH IRU HDV\ ORDG
LQJDQGXQORDGLQJ(DV\WLOWGXPSPHFKDQLVP%HGVL]H
´/[´+[´:
DUMP CARTS
Our No.
No.
Shf
Pk
Unit
VULCAN
975-8269
<7/
1
($
250-6061
‡87,/,7<
‡386+38//
'XUDEOHOLJKWZHLJKWDQGUXVWSURRI
SRO\ GXPS FDUW +HDY\ GXW\ VWHHO
IUDPH 5XVW UHVLVWDQW SRZGHU FRDW
¿QLVK2YHUVL]H´SQHXPDWLFWLUHV
IRU HDV\ PDQHXYHULQJ RQ DQ\ VXUIDFH %XLOW LQ KDQGOH
TXLFNO\FRQYHUWVIURPDWRZEHKLQGWRDSXVKFDUW
Shf
Pk
Unit
VULCAN
976-6403
<7/
Shf
Pk
1
Unit
($
1
($
Unit
($
896-7069
1
3+
($
SERVICE CARTS
‡67((/6+(/)
´UXEEHUFDVWHUV5HDUVZLYHOFDVW
HUV IRU HDV\ VWHHULQJ +HDY\ GXW\
DOOVWHHOFRQVWUXFWLRQ2YHUDOO6L]H
´/ [ ´: [ ´+
6KHOI 6L]H ´/ [ ´: [
´+/RDGFDSDFLW\OEVNJV
Shf
Pk
No.
Unit
1
7&
($
HAND TRUCKS
PLATFORM CARTS
‡67((//$5*(
´SQHXPDWLFUXEEHUFDVWHUV5HDU
VZLYHO FDVWHUV IRU HDV\ VWHHULQJ
+DQGOHIROGVIRUHDV\VWRUDJH3ODW
IRUP6L]H´/[´:2YHUDOO
6L]H´/[´:[´+
/RDGFDSDFLW\OEVNJV
+DXOV DQG GXPSV \DUG PDWHULDOV
VRLOZRRGHWF6PRRWKEODFNSRZ
GHUFRDWSDLQW¿QLVKFXELFIHHW
FDSDFLW\ EHG 0DGH RI JDXJH
VWHHO ´ VWXG WUHDG WLUHV (DV\
GXPSUHOHDVH
Our No.
No.
Shf
Pk
Unit
VULCAN
940-6521
No.
Cap
Lbs
Shf
Pk
6&0&
1
1
3+*;
($
Unit
AG SOUTH
726-5838
Unit
Garden Tools
TRAILER/DUMP CARTS
Our No.
Shf
Pk
No.
VULCAN
896-9115
1
<7/
Our No.
VULCAN
Shf
Pk
No.
´ 38 FDVWHUV 5HDU VZLYHO FDVWHUV
IRUHDV\VWHHULQJ+DQGOHIROGVÀDW
IRUHDV\VWRUDJH3ODWIRUP6L]H
´ / [ ´: 2YHUDOO 6L]H
´/ [ ´: [ ´+
/RDGFDSDFLW\OEVNJV
Our No.
VULCAN
DUMP CARTS
No.
*25'6&
Cap
Lbs
+HDY\GXW\VWHHOFRQVWUXFWLRQZLWK
UXVW UHVLVWDQW SRZGHU FRDW ¿QLVK
2YHUVL]H´[´SQXH
PDWLF WLUHV ZLWK RIIURDG NQREE\
WUHDG 5HPRYHDEOH WDLOJDWH DQG
HDV\WLOWGXPSPHFKDQLVPOE
PD[FDSDFLW\´[´[´
Our No.
Our No.
PLATFORM CARTS
($
HAND TRUCKS
‡5(6,'(17,$/
OEFDSDFLW\+HDY\GXW\´GL
DPHWHUVWHHOIUDPH´[´ÀDW
IUHHVROLGUXEEHUWLUHV+HDY\GXW\
´ D[OH 7RH SODWH ´ : [ ´
'2YHUDOOVL]H´+[´:
[´'
Our No.
No.
Shf
Pk
Unit
MINTCRAFT
Matte Black Powder Coated Finish
001-1049
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
<<
1
($
194 - Maintenance, Repair & Operations
HAND TRUCKS
HAND TRUCKS
HAND TRUCK TIRES
‡+($9<'87<
‡$33/,$1&(
‡62/,'58%%(5
OE FDSDFLW\ +HDY\ GXW\ ´
D[OH+HDY\GXW\´GLDPHWHUVWHHO
IUDPH ´ [ ´ SQHXPDWLF
WLUHV +HDY\ GXW\ EDOO EHDULQJV
6WHHO ULPV 7RH SODWH ´ : [ ´
' 9HUVDWLOH 3KDQGOH GHVLJQ 2YHUDOO VL]H ´ + [
´:[´'
OE FDSDFLW\ 6WHHO VWDLU FOLPE
HU ZLWK UXEEHU WUHDGV 3URWHFWLYH
SODVWLF SDGV KHOS DYRLG VFUDWFKHV
´ [ ´ 735 WLUHV 7RH SODWH ´
: [ ´ ' +DQGOH GULYHQ EHOW
UHOHDVH PHFKDQLVP 7ZR ´ ZLGWK ZHEEHG VWUDSV
([WHQVLRQ ER[ OLIWHU 2YHUDOO VL]H ´ + [ ´ : [
´´'
3ODVWLF ULPPHG ´ PP
KXEOHQJWKOEVNJVORDG
UDWLQJ 5LEEHG WUHDG SDWWHUQ 6ROLG
EDOO EHDULQJ 5HSODFHPHQW ZKHHO
IRUKDQGWUXFNQR´
D[OH
Our No.
Shf
Pk
No.
Unit
MINTCRAFT
+7
1
No.
Unit
MINTCRAFT
Matte Black Powder Coated Finish
001-1056
Our No.
Shf
Pk
Our No.
No.
Tire
Size In
Shf
Pk
Unit
&::3
[
($
MINTCRAFT
900-3518
Blue Powder Coated Finish
($
002-0057
1
+73(1%
($
HAND TRUCK TIRES
‡62/,'58%%(5
HAND TRUCKS
‡+($9<'87<
OEFDSDFLW\+HDY\GXW\´GL
DPHWHU VWHHO IUDPH ´ [ ´
ÀDW IUHH VROLG UXEEHU WLUHV 7RH
SODWH ´ : [ ´ ' 9HUVDWLOH 3
KDQGOH GHVLJQ +HDY\ GXW\ ´
D[OH 6WUDLJKW ZKHHO IHQGHUV 2YHUDOO VL]H ´ + [
´:[´'
Our No.
Shf
Pk
No.
Unit
($
Our No.
Matte Black Powder Coated Finish
1
<<'
‡/(9(/,1'8675,$/
+($9<
‡³/$''(5.$57´
/LJKWZHLJKW DQG ÀDW IROGLQJ IRU
HDV\VWRUDJHDQGWUDQVSRUW)UDPHIROGVWR´ÀDW
OEZHLJKWFDSDFLW\IRUVWHSODGGHUOEZHLJKWFDSDF
LW\ IRU KDQG WUXFN 6PRRWK UROOLQJ ´ GLDPHWHU UXEEHU
ZKHHO 6SDFHDJH SRO\SURS\OHQH H[WUD VWXUG\ ´ : [
´'VWHSV
MINTCRAFT
001-1908
3ODVWLF ULPPHG ´ PP
KXEOHQJWKOEVNJVORDG
UDWLQJ 5LEEHG WUHDG SDWWHUQ 6ROLG
EDOO EHDULQJ 5HSODFHPHQW ZKHHO
IRUKDQGWUXFNQR´
D[OH
ALUMINUM
STEPLADDER/HAND
TRUCK
Shf
Pk
No.
1
76/+7
($
HAND TRUCKS
OE KRUL]RQWDO SRVLWLRQ FDSDF
LW\OEYHUWLFDOSRVLWLRQFDSDF
LW\ +HDY\ GXW\ ´ GLDPHWHU VWHHO
IUDPH )XOO VL]H ZKHHO IHQGHUV ´
[´735FDVWHUV´[´
SQHXPDWLF WLUHV +HDY\ GXW\ EDOO EHDULQJV 6WHHO ULPV
7RH SODWH ´ : [ ´ ' $GMXVWDEOH KHLJKW KDQGOH
ZLWKSRVLWLRQV+HDY\GXW\´D[OH2YHUDOOVL]HYHUWL
FDOSRVLWLRQ´´+[´:[´
'2YHUDOOVL]HKRUL]RQWDOSRVLWLRQ´+[´
:[´'
Shf
Pk
No.
Unit
MINTCRAFT
1
<<
Garden Tools
HAND TRUCK TIRES / WHEELS
HAND TRUCK TIRES
‡)/$7)5((6$:7227+
75($'
6WHHO ULPPHG ´ RIIVHW KXE
DQG ´ VKLHOGHG EDOO EHDULQJV
0DGH RI OLJKWZHLJKW SRO\XUHWKDQH
IRDP)ODWIUHHIHHOVOLNHDLU¿OOHG
8VHGIRUKDQGWUXFNVSUHVVXUHZDVKHUVJHQHUDWRUVDQG
ZDONEHKLQGEORZHUV
Our No.
Matte Black Powder Coated Finish
001-7749
No.
Tire
Size In
Shf
Pk
Unit
($
‡&200(5&,$/
[
12
[
5
($
Power Lawn Care
BLOWER VAC ACCESSORIES
LEAF COLLECTION
SYSTEM
Unit
TOOLBASIX
Red Powder Coated Finish
1
899-4816
No.
Shf
Pk
Unit
:$
1
($
5HSODFHPHQW VKRXOGHU EDJ IRU
%9 7ZR EXVKHO FDSDFLW\
5HGXFHGGXVWFRQVWUXFWLRQDGMXVW
DEOH VWUDS 5HSODFHV DOO %ODFN 'HFNHUEORZHUYDFEDJV
Our No.
No.
Tire
Size In
Shf
Pk
Unit
&:*6
[
($
No.
Shf
Pk
Unit
BLACK & DECKER LAWN
273-9035
MINTCRAFT
($
Our No.
‡5(3/$&(0(17%$*
6WHHOULPPHG´PPKXE
OHQJWK OE NJV ORDG UDW
LQJ %LJ VDZWRRWK WUHDG SDWWHUQ
3QHXPDWLF EDOO EHDULQJ 5HSODFH
PHQW ZKHHO IRU KDQG WUXFN QR
DQG´D[OH
Our No.
'HVLJQHG WR ZRUN ZLWK WKH :RU[
:* 7UL9DF 0XOFKHU%ORZHU
9DFXXP $WWDFKHV WR WKH EORZHU
ZLWK KRVH DQG VHFXUHV DURXQG
VWDQGDUGWRJDOORQVURXQGWUDVKFDQV&RQYHUWVWKH
7UL9DFLQWRDKLJKFDSDFLW\OHDIFROOHFWRU(DVLO\PXOFKDQG
FROOHFWJDOORQVRIOHDYHVGRZQWRVPDOOHQRXJKVL]H
WKDWDOORZVWKHPWR¿WLQWRDJDOORQWUDVKFDQ
PXOFKUDWLR´KRVHGLDPHWHU¶ORQJKRVHH[SDQGVXS
WR¶DOORZLQJ\RXWRYDFXXPDVTIWVXUIDFHDUHD
75$6+&$1127,1&/8'('
BLOWER/VAC
ATTACHMENTS
‡:,7+78%(
Shf
Pk
<<
&::3
Unit
($
HAND TRUCK TIRES
OE FDSDFLW\ 2YHUDOO VL]H
´+[´:[ ´' +HDY\
GXW\ ´ GLDPHWHU VWHHO IUDPH
)ODW IUHH VROLG UXEEHU WLUHV ´[
´ +HDY\ GXW\ D[OH 7RH SODWH
´:[´'
016-3584
900-6198
793-9234
10-1/2” Diameter
HAND TRUCKS
No.
Shf
Pk
WORX
ARNOLD CORP
865-3453
Our No.
Tire
Size In
‡)2575,9$&
‡&219(57,%/(
Our No.
No.
MINTCRAFT
Unit
FRANZUS CO
239-7347
Our No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
%9
($
Maintenance, Repair & Operations - 195
BLOWER/VAC
ATTACHMENTS
COMPRESSION
SPRAYERS
COMPRESSION
SPRAYERS
‡*877(5
‡³:(('($7(5´
‡75,32;<
‡67((/<$5'*$5'(1
&OHDQ OHDYHV DQG GHEULV IURP JXW
WHUV ZKLOH VWDQGLQJ VDIHO\ RQ WKH
JURXQG $WWDFKHV WR JDV DQG HOHF
WULF EORZHUYDFV 3LYRWLQJ WXEH GLUHFWV DLU ÀRZ $VVHP
EOHGIHHWOHQJWK
<DUG *DUGHQ 7ULSR[\ 6WHHO 3OXV
VSUD\HU 7ULSR[\ FRDWLQJ SUHYHQWV
FRUURVLRQ FUDFNLQJ DQG SLWWLQJ ´
IXQQHOWRSRSHQLQJIRUSRXULQJ´SRO\H[WHQVLRQZDQG
DQG DGMXVWDEOH QR]]OH ´ UHLQIRUFHG KRVH IRU ORQJHU
UHDFK
‡32/<:,7+21%2$5'
0($685(&836+,(/'
‡³685(635$<6(/(&7´
Our No.
Shf
Pk
No.
Unit
POULAN
694-4268
1
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
($
Sprayers & Watering
510-4682
1
1
($
400-1087
2
1
($
Our No.
287-9401
1
($
CHAPIN MFG
TANK SPRAYERS
COMPRESSION
SPRAYERS
COMPRESSION
SPRAYERS
‡&/($1,1*'(*5($6,1*
$FLG DQG FKHPLFDO UHVLVWDQW VHDOV
DQG JDVNHWV :LGH RSHQLQJ IRU
HDV\ ¿OOLQJ DQG FOHDQLQJ $XWR
PDQXDO KLJK SUHVVXUH UHOLHI YDOYH
³/RFNRII´ IHDWXUH WR SUHYHQW DFFLGHQWDO GLVFKDUJH $G
MXVWDEOHSRO\FRQHQR]]OHVSUD\VFRQHWRVWUHDP
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
174-8656
2
1
($
478-4229
1
($
‡32/<:,7+21%2$5'
0($685(&83
‡³685(635$<´
$QWLFORJ ¿OWHU KHOSV SUHYHQW FORJ
JLQJ 'U\ KDQGV PHDVXUH FXS IRU
GU\KDQGVFKHPLFDOPL[LQJ(DV\WR¿QGRQERDUGVWRUDJH
PHDVXUHFXSORFNVRQWRERWWOH)XQQHOWRSRSHQLQJIRUQR
PHVV¿OOLQJ$GMXVWDEOHQR]]OHDQGWUDQVOXFHQWERWWOHIRU
HDVHLQFKHFNLQJÀXLGOHYHO&XUYHGZDQGDQGUHLQIRUFHG
KRVH)RUZHHGFRQWUROSHVWFRQWURODQGIHUWLOL]HUV
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
COMPRESSION
SPRAYERS
028-9132
1
1
($
172-5654
2
1
($
534-5848
1
($
‡,1'8675,$/+($9<'87<
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
520-5745
1
($
COMPRESSION
SPRAYERS
´ Q\ORQ UHLQIRUFHG KRVH 0RGX
ODUGHVLJQDOORZVQR]]OHWREHXVHG
ZLWK RU ZLWKRXW ZDQG &OHDQDEOH
SRO\VKXWRIIZLWKEXLOWLQZUHQFK3RO\DGMXVWDEOHQR]]OH
IRU¿QHPLVWWRVWUHDP
252-9998
‡+($9<'87<
352)(66,21$/
‡³635$<'2&´
3RO\ WDQN LQGXVWULDO VSUD\HU IHD
tures a discharge and pressure
UHOLHIYDOYHFRQVWUXFWHGRI,VRSODVW5LJLGWKHUPRSODVWLF
SRO\XUHWKDQH UHVLQ SRO\HWK\OHQHOLQHG KRVH .LQN UHVLV
WDQWVSULQJDWWDQNFRQQHFWRUÀH[LEOHSRO\ZDQGDGMXVW
DEOHDQGIDQVSUD\WLSV,QOLQH¿OWHU9LWRQFKHFNYDOYHV
DQG 2ULQJV IRU GHSHQGDELOLW\ DQG ORQJHU OLIH 1RQFRU
URVLYH SRO\PHU SXPS $GMXVWDEOH WLS EUDVV QR]]OHV ([
WUDZLGHPRXWK´1RV+'3,DQG+'3,´
SXPS´KRVHDQG´H[WHQVLRQ
Operating
Cap. Gal.
Shf
Pk
Unit
GILMOUR MFG
696-4019
+'3,
No.
Cap
Gal
Shf
Pk
1
Unit
CHAPIN MFG
COMPRESSION
SPRAYERS
No.
1
Cap
Gal
Shf
Pk
Unit
304-2934
1
1
($
930-4536
2
1
($
710-5810
1
($
COMPRESSION
SPRAYERS
‡32/<:,7+21%2$5'
0($685(&836+,(/'
‡³685(635$<'(/8;(´
$QWLFORJ ¿OWHU KHOSV SUHYHQW FORJ
JLQJ 'U\ KDQGV PHDVXUH FXS LV
HDV\WR¿QGRQERDUGDQGORFNVRQWRERWWOH)XQQHOWRS
RSHQLQJ IRU QR PHVV ¿OOLQJ $GMXVWDEOH QR]]OH 7UDQV
OXFHQW ERWWOH IRU HDVH LQ FKHFNLQJ ÀXLG OHYHO $XWR KLJK
SUHVVXUH UHOLHI YDOYH 6SUD\ VKLHOG SURWHFWV SODQWV DQG
ORFNVRQERDUG/RFNLQJVSUD\KDQGOHIRUHDVHRIVSUD\
LQJ&XUYHGZDQGDQGUHLQIRUFHGKRVH)RUZHHGFRQWURO
SHVWFRQWURODQGIHUWLOL]HUV
Our No.
No.
Cap
Gal
Shf
Pk
Unit
1
($
202-1822
1
1
($
707-4834
2
1
($
152-5583
1
($
‡32/<
‡³685(635$<´
Our No.
Our No.
No.
CHAPIN MFG
,QWDQN DQWLFORJ ¿OWHU IRU ZRUU\
IUHHVSUD\LQJ:LGHPRXWKIRUQR
PHVV ¿OOLQJ DQG FOHDQLQJ %UDVV
VSUD\ KDQGOH ZLWK ³ORFNRQ´ IRU
IDWLJXHIUHHFRQWLQXRXVVSUD\LQJ%UDVVIDQWLSQR]]OHIRU
PXOWLSXUSRVHDSSOLFDWLRQV
Our No.
$QWLFORJ ¿OWHU KHOSV SUHYHQW FORJ
JLQJ'U\KDQGPHDVXUHFXSIRUGU\
KDQGV FKHPLFDO PL[LQJ (DV\ WR ¿QG RQ ERDUG VWRUDJH
PHDVXUHFXSORFNVRQWRERWWOH)XQQHOWRSRSHQLQJIRUQR
PHVV¿OOLQJ3RO\EUDVVIDQQR]]OH7UDQVOXFHQWERWWOHIRU
HDVHLQFKHFNLQJÀXLGOHYHO,QWHJUDOVSUD\VKLHOGSURWHFWV
SODQWV6SUD\KDQGOHIRUHDVHRIVSUD\LQJ&XUYHGZDQG
DQGUHLQIRUFHGKRVH)RUZHHGFRQWUROSHVWFRQWURODQG
IHUWLOL]HUV
($
COMPRESSION
SPRAYERS
No.
Cap
Gal
‡32/<'(&.)(1&(6
‡:,7+21%2$5'6+,(/'
‡³&/($116($/´
)XQQHO WRS RSHQLQJ IRU QR PHVV
¿OOLQJ 7UDQVOXFHQW ERWWOH IRU HDVH
LQ FKHFNLQJ ÀXLG OHYHO 6SUD\ VKLHOG SURWHFWV VLGLQJ DQG
ORFNVRQERDUGDQGJSPIDQQR]]OHV/RFN
LQJVSUD\KDQGOHIRUHDVHRIVSUD\LQJ&XUYHGZDQGDQG
UHLQIRUFHGKRVH)RUGHFNVEULFNVPDVRQU\DQGIHQFHV
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
‡32/<
‡352027,21$/
Our No.
COMPRESSION
SPRAYERS
Shf
Pk
070-3595
1
1
($
758-6795
2
1
($
Unit
CHAPIN MFG
061-4107
1
1
($
103-1517
2
1
($
821-1138
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
196 - Maintenance, Repair & Operations
COMPRESSION
SPRAYERS
COMPRESSION
SPRAYERS
COMPRESSION
SPRAYERS
‡'(&.)(1&(3$7,2
‡352)(66,21$/75,32;<
67((/
‡³60$57635$<´
‡,1'8675,$/*(1(5$/
'87<
&OHDQ¶Q (DV\ GHVLJQ )XQQHO WRS
RSHQLQJIRUQRPHVV¿OOLQJ7UDQV
OXFHQWERWWOHIRUHDVHLQFKHFNLQJÀXLGOHYHO6SUD\VKLHOG
SURWHFWVVLGLQJDQGORFNVRQERDUG/RFNLQJVSUD\KDQGOH
IRUHDVHRIVSUD\LQJ&XUYHGZDQGDQGUHLQIRUFHGKRVH
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
381-4670
1
1
Shf
Pk
Unit
CHAPIN MFG
2
1
($
COMPRESSION
SPRAYERS
‡:(('&21752/3(67
&21752/)(57,/,=(56
‡³35(0,(5352´
Shf
Pk
Unit
CHAPIN MFG
613-4100
Cap
Gal
1
)RU SURIHVVLRQDO DSSOLFDWLRQV VXFK
DV IHUWLOL]HUV ZHHG NLOOHUV SHV
WLFLGHV DQG DOO DURXQG XVH 75,
32;< FRDWHG VWHHO IRU PD[LPXP FKHPLFDO UHVLVWDQFH
´ KHDY\GXW\ Q\ORQ UHLQIRUFHG KRVH UHVLVWV FKHPLFDO
(SR[\ FRDWHG ]LQF VKXWRII ZLWK /RFNRQ IRU FRQWLQXRXV
VSUD\:LGHRSHQLQJIRUHDV\¿OOLQJ7HÀRQFRDWHGVHDOV
DQGJDVNHWV
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
)RU VWDLQLQJ VHDOLQJ DQG ZDVK
LQJ 7UDQVOXFHQW ERWWOH IRU HDVH LQ
FKHFNLQJ ÀXLG OHYHO 6SUD\ GHFNV
VLGLQJIHQFHVDQGFRQFUHWHZLWKHDVH
Cap
Gal
No.
($
‡35202
‡³&/($116($/´
No.
Our No.
636-0663
2
COMPRESSION
SPRAYERS
Our No.
$QWLFORJ ¿OWHU KHOSV SUHYHQW FORJ
JLQJ 6SUD\ VKLHOG SURWHFWV VLGLQJ
DQG ORFNV RQ ERDUG 0HDVXUH FXS
IRUPL[LQJ$GMXVWDEOHEUDVVQR]]OH
(UJR SXPSFDUU\ KDQGOH 1R EHQG ZDQG 3UHVVXUH UH
OHDVHVSODVKJXDUG
)RUZHHGFRQWUROSHVWFRQWURODQG
IHUWLOL]HUV6XUH6SUD\DQWLFORJ¿OWHU
KHOSVSUHYHQWFORJJLQJ'U\KDQGVSUHVVXUHUHOLHIYDOYH
RQSRO\XQLWV´ODUJHRSHQLQJRQSRO\VSUD\HUV7UDQV
OXFHQWERWWOHIRUHDVHLQFKHFNLQJÀXLGOHYHO$GMXVWDEOH
EUDVVQR]]OHVSUD\VFRQHDQGVWUHDPSDWWHUQV,QFOXGHV
KHDY\GXW\PHWDOVSUD\KDQGOHGURSLQDQGORFNLQZDQG
KROGHUDQGEUDVVZDQG
($
Our No.
No.
Cap
Gal
640-1574
7,+.
1
($
640-1590
,.6
1941
1
($
COMPRESSION
SPRAYERS
‡,1'8675,$/
‡+($9<'87<
Unit
´ KHDY\GXW\ Q\ORQ UHLQIRUFHG
KRVH UHVLVWV FKHPLFDOV 9LWURQ
HTXLSSHG DQG VHDOV JDVNHWV 75,
32;<FRDWHGPHWDOIRUH[WUDSURWHFWLRQIURPFRUURVLYHV
6HUYLFHDEOHSXPSV%UDVVIDQWLSQR]]OHIRUPXOWLSXUSRVH
DSSOLFDWLRQV%UDVVVKXWRIIZLWK/RFNRQIRUIDWLJXHIUHH
FRQWLQXRXVVSUD\LQJ´FXUYHGEUDVVZDQG
1
($
Our No.
Shf
Pk
CHAPIN MFG
COMPRESSION
SPRAYERS
‡35(0,(5352
258-7756
1
855-0154
2
1
($
611-4540
1
($
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
640-3588
1
($
6SUD\HU ZLWK 9LWRQ VHDOV KHDY\
GXW\VKXWRIIDQGZDQG
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
418-6649
2
1
($
452-1423
1
($
(DV\WRJULSKDQGOHDQGDGMXVWDEOH
EUDVVQR]]OH/RFNLQJVZLWFKDOORZV
FRQWLQXRXVVSUD\LQJ
533-1756
‡32/<:,7+&+(0,&$/
‡,1&/8'(621%2$5'
0($685,1*&83
‡³685(635$<´
Shf
Pk
Unit
CHAPIN MFG
392-7456
1
Cap
Qt
Shf
Pk
Unit
6;/
15
($
'HVLJQHG IRU SURIHVVLRQDO DSSOL
FDWLRQV VXFK DV IHUWLOL]HUV ZHHG
NLOOHUV SHVWLFLGHV DQG DOO DURXQG
XVH 75,32;< FRDWHG VWHHO IRU PD[LPXP FKHPLFDO UH
VLVWDQFH ´ KHDY\ GXW\ Q\ORQ UHLQIRUFHG KRVH UHVLVWV
FKHPLFDOV)XQQHOWRSIRUHDV\¿OOLQJ(SR[\FRDWHG]LQF
VKXWRII ZLWK /RFNRQ IRU FRQWLQXRXV VSUD\ ´ FXUYHG
EUDVVZDQG7HÀRQFRDWHGVHDOVDQGJDVNHWV
Our No.
$QWLFORJ ¿OWHU KHOSV SUHYHQW FORJ
JLQJ 'U\ KDQGV PHDVXUH FXS IRU GU\ KDQGV FKHPLFDO
PL[LQJ(DV\WR¿QGRQERDUGVWRUDJHPHDVXUHFXSORFNV
RQWRERWWOH)XQQHOWRSRSHQLQJIRUQRPHVV¿OOLQJ$G
MXVWDEOHQR]]OHDQGWUDQVOXFHQWERWWOHIRUHDVHLQFKHFN
LQJ ÀXLG OHYHO &XUYHG ZDQG DQG UHLQIRUFHG KRVH )RU
ZHHGFRQWUROSHVWFRQWURODQGIHUWLOL]HUV´Q\ORQUHLQ
IRUFHGKRVH,QFOXGHGLVR]%RQLGHFKHPLFDOSHVWLFLGH
No.
No.
MINTCRAFT
COMPRESSION
SPRAYERS
Our No.
‡,1'8675,$/*(1(5$/
'87<
‡08/7,385326(
Our No.
Cap
Gal
COMPRESSION
SPRAYERS
COMPRESSION
SPRAYERS
1
($
No.
Cap
Gal
Shf
Pk
1
Unit
CHAPIN MFG
COMPRESSION
SPRAYERS
640-2846
($
‡)25&21&5(7(
,1'8675,$/
:LGH PRXWK IRU HDV\ ¿OOLQJ DQG
FOHDQLQJ 75,32;< OLQHG VWHHO IRU
WULSOH SURWHFWLRQ DJDLQVW FRUURVLRQ
UXVWDQGGDPDJHIURPGHQWLQJ%UDVVVSUD\KDQGOHZLWK
/RFNRQ DQG TXLFN UHOHDVH GHVLJQ 7KUHDGHG FRXSOLQJ
IRUHDV\UHPRYDO+RVHUHLQIRUFHGZLWKQ\ORQEUDLGDQG
YLQ\O FRUH WR UHVLVW FKHPLFDO DWWDFN FULPSLQJ FUDFNLQJ
DQG OHDNLQJ %UDVV IDQ VSUD\ QR]]OH IRU HYHQ FRYHUDJH
*30 GHJUHH 92& &RPSOLDQW 237,21$/ )($
785(0RGHO,QWDQNDQWLFORJ¿OWHU3DUW
9,721702ULQJVDQGJDVNHWVIRUPD[LPXPUHVLVWDQFH
WRFKHPLFDOFRUURVLRQ
Our No.
No.
Cap
Gal
Shf
Pk
1
Unit
CHAPIN MFG
640-5344
1949
COMPRESSION
SPRAYERS
‡³35(0,(56(5,(6´
)RUKRXVHKROGRUEXVLQHVVDSSOLFD
WLRQV 75,32;< WDQN RIIHUV WULSOH
SURWHFWLRQDJDLQVWFRUURVLRQFUDFN
LQJDQGSLWWLQJDOVRULQVHVFOHDQHU
$OO EUDVV H[WHQVLRQ ZDQGV URWDWH GHJUHHV ´ ZLGH
IXQQHOWRSIRUHDV\¿OOLQJ)DQQR]]OHSDFNZLWK¿OWHULQ
FOXGHG/LIHWLPH:DUUDQW\
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
640-2564
($
1
1
($
With Shoulder Strap
640-2598
2
1
($
640-2820
1
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 197
COMPRESSION
SPRAYERS
‡67$,1/(6667((/
,1'8675,$/
2SHQKHDGVWDLQOHVVVWHHOVSUD\HUV
IRU SURIHVVLRQDO DSSOLFDWLRQV VXFK
DV IHUWLOL]HUV ZHHG NLOOHUV SHVWL
FLGHVDQGDOODURXQGXVH:LGHRSHQLQJGHVLJQIRUHDV\
¿OOLQJDQGFOHDQLQJ´UHLQIRUFHGKRVHIRUHDVLHUUHDFK
$GMXVWDEOHEUDVVFRQHQR]]OHVSUD\V¿QHPLVWWRFRDUVH
VWUHDP0HWDOVKXWRIIZLWK/RFNRQIHDWXUHIRUIDWLJXH
IUHHVSUD\LQJ:LGHEDVHWDQNKHOSVSUHYHQWWLSSLQJRYHU
0HWDOWDQNVULQVHFOHDQHUIRUPXOWLXVH&RQYHQLHQWFDU
U\LQJVWUDSQRKRVHDVVHPEO\UHTXLUHGRQPHWDOWDQNV
(DV\SXPSDFWLRQIRUTXLFNSUHVVXUL]LQJ0RGHOQR
KDV´ FXUYHG EUDVV ZDQG PRGHO QR KDV ´
FXUYHGEUDVVZDQG9LWRQVHDOVDQGJDVNHWVIRUPD[LPXP
SURWHFWLRQDJDLQVWFKHPLFDOFRUURVLRQ
Our No.
No.
Cap
Gal
Shf
Pk
Unit
CHAPIN MFG
With Shoulder Strap
640-1178
2
1
($
640-1376
1749
1
($
‡67$,1/(6667((/
‡³35(0,(56(5,(6´
)XQQHOWRSWDQNIRUHDV\¿OOLQJ´
UHLQIRUFHGKRVHIRUORQJUHDFK´
EUDVVZDQG$GMXVWDEOHEUDVVFRQH
QR]]OHVSUD\V¿QHPLVWWRFRDUVHVWUHDP0HWDOVKXWRII
ZLWK/RFNRQIHDWXUHIRUIDWLJXHIUHHVSUD\LQJ:LGHEDVH
PHWDOWDQNKHOSVSUHYHQWWLSSLQJRYHU0HWDOWDQNVULQVH
FOHDQHUIRUPXOWLXVH&RQYHQLHQWFDUU\LQJVWUDS1RKRVH
DVVHPEO\UHTXLUHGRQPHWDOWDQNV(DV\SXPSDFWLRQIRU
TXLFNSUHVVXUL]LQJ7HÀRQFRDWHGVHDOVDQGJDVNHWV
No.
Cap
Gal
Shf
Pk
2
1
($
2
Shf
Pk
Shf
Pk
4
1
Unit
($
Sprayers & Watering
SPRAY BOTTLES
No.
Size
Gal
-
1
-
14
12
($
No.
Cap
Oz
Shf
Pk
Unit
535-9336
6;$/
($
538-8129
6;/
($
Our No.
CHAPIN MFG
036-4323
631-4504
8VH IRU FOHDQHUV SHVWLFLGHV DQG
OLTXLGV $GMXVWDEOH QR]]OH PLVW
VSUD\VWUHDP
+DQGV IUHH VSUD\HU IRU ODUJH MREV
/DUJH SXPS PDNHV SUHVVXUL]LQJ
TXLFN ZLWK OHVV SXPSLQJ ,QWHUQDO
SRVLWLRQ VSUD\ YDOYH IRU H[SHUW SUHVVXUH FRQWURO IURP
SVLWRSVL3DGGHGFDUU\LQJVWUDSVIRUIDWLJXHIUHH
RSHUDWLRQ(DV\RSHUDWLQJVSUD\KDQGOHZLWKFRQWLQXRXV
VSUD\IHDWXUH0XOWLXVHQR]]OHWLSVLQFOXGHG3RVLWLRQDEOH
SXPSKDQGOHIRUULJKWRUOHIWKDQGXVH´ZLGHRSHQLQJ
3RO\VKXWRII$GMXVWDEOHFRQHDQGIDQQR]]OH)RUZHHG
FRQWUROSHVWFRQWURODQGIHUWLOL]HUV
No.
Unit
SPRAYCO
‡$//385326(
COMPRESSION
SPRAYERS
Our No.
Shf
Pk
TRIGGER SPRAYERS
BACK-PACK SPRAYERS
Cap
Gal
Size
Oz
($
MINTCRAFT
TRIGGER SPRAYERS
‡3/$17$1'*$5'(1
&/($5
6SUD\HU WKDW FRYHUV \RXU ODZQ
DQG JDUGHQ QHHGV 8VH IRU ZDWHU
LQJ SODQWV VSUD\ LQVHFWLFLGHG DQG
NLOO ZHHGV %RWWOH KDV JUDGXDWLRQ
PDUNV IRU H[DFW PHDVXULQJ 5LEEHG QHFN IRU HDV\ KDQ
GOLQJDQGLVLGHDOIRULQGRRUDQGRXWGRRUQHHGV
Our No.
No.
Cap
Oz
Shf
Pk
Unit
-
16
24
($
SPRAYCO
638-1347
TRIGGER SPRAYERS
‡,1'8675,$/675(1*7+
Shf
Pk
Unit
1
6
($
+HDYLHU FRQVWUXFWLRQ H[WUD ORQJ
WULJJHU DQG IXOO\ DGMXVWDEOH VSUD\
QR]]OH IRU WKH LGHDO LQGXVWULDO
VSUD\HU
Our No.
No.
Size
Ozs.
Shf
Pk
Unit
;5
12
($
Shf
Pk
Unit
($
SPRAYCO
614-5023
Unit
TRIGGER SPRAYERS
($
‡635$<%277/(
TRIGGER SPRAYERS
For multiple applications includ
LQJ ZDWHULQJ SODQWV LURQLQJ DQG
KRXVHKROGFOHDQLQJSDFNRIWULJ
JHUVSUD\ERWWOHV
Our No.
No.
Size
Ozs.
‡352)(66,21$/
‡³=(3´
Shf
Pk
Unit
3URIHVVLRQDO VSUD\ ERWWOH 8VH WR
DSSO\ FOHDQHUV SHVWLFLGHV DQG
RWKHUOLTXLGV
SPRAYCO
,QFOXGHV 6XUH6SUD\ DQWLFORJ ¿OWHU
VSUD\ VKLHOG PHDVXULQJ FXS DQG
DGMXVWDEOHVSUD\QR]]OH
No.
6
No.
Trigger Sprayer
‡/$:1*$5'(1
‡³63(&75$&,'(´
Our No.
Sprayers & Watering
638-1479
COMPRESSION
SPRAYERS
Cap
Gal
532-7713
SPRAYCO
CHAPIN MFG
091-2360
6;%/
Unit
MINTCRAFT
Our No.
0DGH ZLWK KLJK JUDGH VWDLQOHVV
VWHHO ´ IXQQHO WRS RSHQLQJ IRU
SRXULQJ ´ SRO\ H[WHQVLRQ ZDQG
DQG DGMXVWDEOH QR]]OH ´ UHLQ
IRUFHGKRVHIRUORQJHUUHDFK
Cap
Gal
No.
Shf
Pk
3RUWDEOH WDQN ZLWK HDV\ WR FDUU\
KDQGOH ,GHDO IRU ODUJH MREV ,Q
FOXGHV D ¶ ÀH[LEOH KRVH WKDW DO
ORZV\RXWRUHDFKPRUHSODFHV)RU
VSUD\LQJ LQVHFWLFLGHV KHUELFLGHV
DQGIHUWLOL]HUVRQODZQVWUHHVDQGVKUXEV
‡67$,1/(6667((/
No.
Our No.
Cap
Gal
Our No.
‡08/7,385326(
COMPRESSION
SPRAYERS
Our No.
3(7 VSUD\HU LQ DVVRUWHG GHVLJQHU
FRORUV$GMXVWDEOHVSUD\QR]]OHIRU
PXOWLSOHDSSOLFDWLRQVLQFOXGLQJZD
WHULQJ SODQWV KRXVHKROG FOHDQLQJ
LURQLQJDQGVSULW]LQJKDLU
‡+,*+7(&+&/($5
TRIGGER SPRAYERS
With Shoulder Strap
,GHDOIRUZDWHUKHUELFLGHVIHUWLOL]
HUVDQGSHVWLFLGHV3RZHUIXOSXPS
SUHVVXUL]HVHDVLHUDQGIDVWHU3UHV
VXUHUHOHDVHYDOYHWRVDIHO\UHOHDVH
H[FHVV SUHVVXUH /LJKWZHLJKW SRO\
WDQNIRUHDV\FDUU\LQJ,QFOXGHVFDUU\LQJVWUDS´SODV
WLFUXEEHUKRVH
Unit
CHAPIN MFG
640-3554
TRIGGER SPRAYERS
‡%$&.3$&.67</(
‡³3526(5,(6´
COMPRESSION
SPRAYERS
Our No.
COMPRESSION
SPRAYERS
Our No.
Pack of 3
175-4761
Shf
Pk
%
1
($
739-1766
CHAPIN MFG
1
1
($
550-3529
2
1
($
927-2899
1
($
Size
ACUITY SPECIALTY PRODUCTS
Unit
734-7958
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
+'352
2XQFH
- Maintenance, Repair & Operations
Bagged Goods
MULTI-PURPOSE
SPRAYERS
Our No.
No.
/9
.LOOV ÀHDV DQG WLFNV RQ FRQWDFW
1HXWUDOL]HV SHW RGRUV 6SUD\ GL
rectly on pets and around the
KRPH1RQVWDLQLQJ)RUWUHDWPHQW
RI FDUSHWLQJ EHGGLQJ DQG XSKROVWHU\ $FWLYH LQJUHGLHQW
3UDOOHWKULQ
‡08/7,385326(
‡³,00812;3/86´
Shf
Pk
Unit
SPRAYCO
638-1438
‡)/($7,&./,&(
‡³+276+27´
INSECT/DISEASE
CONTROL
0XOWLSXUSRVH VSUD\HU LV LGHDO IRU
KRXVHKROG JDUGHQ LURQLQJ DQG
SHUVRQDOXVH%RWWOHKDVJUDGXDWLRQ
PDUNV IRU H[DFW PHDVXULQJ DQG D
ULEEHGQHFNIRUHDV\KDQGOLQJ,GH
DOIRULQGRRUDQGRXWGRRUXVHV
Size
Oz
INSECT KILLER
PUMP/AEROSOL
12
($
3UHYHQWV DQG NLOOV LQVHFWV DQG
GLVHDVHV RQ URVHV ÀRZHUV DQG
VKUXEV 3URYLGHV ZHHN SURWHF
WLRQ:DWHUEDVHG
Our No.
Size
Ozs.
No.
Shf
Pk
Our No.
Unit
SPECTRUM GROUP
Sprayers & Watering
640-5583
HAND SPRAYERS
14
12
‡5($'<7286(
‡³&$37$,1-$&.'($'%8*
%5(:´
Shf
Pk
Unit
CHAPIN MFG
640-6334
16
6
($
850-9739
Shf
Pk
Unit
CHAPIN MFG
640-6953
16
Shf
Pk
Size
6
($
HAND SPRAYERS
Quart
($
‡,1'225
‡5($'<7286(635$<
‡³257+2(&26(16(´
‡*(1(5$/385326(
No.
Size
Oz
Shf
Pk
Unit
15
12
($
SPECTRUM GROUP
111-7050
5416
'HVLJQHGWRUHOHDVHD¿QHSDUWLFOH
PLVWIRUVXSHULRUÀ\LQJLQVHFWFRQ
WURO )DVW DFWLQJ IRUPXOD NLOOV RQ
FRQWDFW 6DIH IRU XVH DURXQG FKLO
GUHQDQGSHWV.LOOVÀLHVDQGPRV
TXLWRHV /HDYHV QR PHVV\ RU RLO\ UHVLGXH 6SUD\V XS WR
¶&RQWDLQVWKHQDWXUDODFWLYHLQJUHGLHQWOHPRQJUDVVRLO
H[WUDFW
Our No.
Size
Oz
No.
Shf
Pk
Unit
12
($
SPECTRUM GROUP
Size
Ozs.
Shf
Pk
Aerosol Can
Unit
639-5909
($
FLYING INSECT KILLER
+*
14
Bottle
201-3415
T
24
6
‡³5$,'´
Shf
Pk
Unit
CHAPIN MFG
663-4232
No.
SCOTTS COMPANY
)RU KRXVHKROG DQG FOHDQLQJ XVH
IHDWXUHVDGMXVWDEOHSRO\FRQHVSUD\
QR]]OH IRU YDU\LQJ DSSOLFDWLRQV
7UDQVOXFHQW OLJKWZHLJKW SRO\ WDQN
HDV\ JULS KDQGOH ZLWK WULJJHU DQG
HDV\SXPSRQVSUD\HUKDQGOH
Our No.
No.
Our No.
‡³+276+27´
12
INSECT KILLER
Our No.
.LOOV IDVW .HHSV NLOOLQJ IRU XS WR ZHHNV)RULQGRRUDQGRXWGRRUXVH
1RQVWDLQLQJ 1R XQSOHDVDQW RGRU
(DV\WRXVHVSUD\WKURXJKFDS$F
WLYHLQJUHGLHQW7UDORPHWKULQ
FLYING INSECT KILLER
.LOOVEXJVRQFRQWDFW
Cap
Oz
($
Unit
Bottle
3RZHUIXO FRPSUHVVLRQ DQG ¿QHO\
DWRPL]HG VSUD\LQJ LQ OLJKWZHLJKW
PRGHOIRUKRPHDSSOLFDWLRQV(DV\
¿OOLQJ R] SRO\ WDQN ZLWK D ÀDW
VWDEOHEDVH
Cap
Oz
No.
BONIDE PRODUCTS
‡6,1*/($&7,210,67
No.
&DSWDLQ -DFN¶V GHDGEXJ EUHZ NLOOV
EDJZRUPV ERUHUV EHHWOHV FDWHU
SLOODUV WKULSV FRGOLQJ PRWK J\SV\ PRWK ORRSHUV OHDI
PLQHUVVSLGHUPLWHVWHQWFDWHUSLOODUVDQGPRUH8VHRQ
IUXLWV YHJHWDEOHV EHUULHV FLWUXV JUDSHV QXWV DQG RU
QDPHQWDOV$SSURYHGIRUXVHLQRUJDQLFJDUGHQLQJ&RQ
WDLQV6SLQRVDGVSLQ2+VLG
Our No.
HAND SPRAYERS
Our No.
6
‡$(5262/
‡³+276+27´
INSECT KILLER
,GHDO IRU IDUPV KRPHV JDUGHQV
DQGSHVWFRQWURO*HQHUDOSXUSRVH
OLJKWZHLJKWFRQWLQXRXVVSUD\RQUH
WXUQ DFWLRQ 7UDQVOXFHQW SRO\ WDQN
KROGVR]RIOLTXLG
Cap
Oz
Aerosol Can
14
+*
FLYING INSECT KILLER
‡&217,18286$&7,21
No.
Unit
($
HAND SPRAYERS
Our No.
Shf
Pk
SPECTRUM GROUP
203-1839
Aerosol
Size
Oz
No.
6
($
.LOOVÀLHVPRVTXLWRHVJQDWVDVLDQ
ODG\ EHHWOHV DQG RWKHU À\LQJ LQ
VHFWVDVWKH\À\WKURXJKWKHPLVW
&OHDQ SOHDVDQW VFHQW ZLWK QR OLQ
JHULQJFKHPLFDORGRU
INSECT KILLER
‡,1'225$(5262/
‡³257+20$;´
)O\LQJ LQVHFW NLOOHU .LOOV ÀLHV PRV
TXLWRHV JQDWV DQG RWKHU À\LQJ
SHVWV
Our No.
No.
Size
Ozs.
Our No.
15
Shf
Pk
Unit
12
($
Aerosol
Shf
Pk
Unit
12
($
696-0298
Can
Size
Ozs.
SC JOHNSON
SCOTTS COMPANY
719-4277
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
15
Maintenance, Repair & Operations - 199
FLYING INSECT KILLER
FLYING INSECT KILLER
ANT/ROACH KILLER
‡:$63+251(7
‡)2$0,1*&$1
‡:$63+251(7
‡³63(&75$&,'(´
‡³5$,'´
$ ZDWHUEDVHG VSUD\ ZLWK WKH IXU
WKHUDGYDQWDJHWKDWLVQRWKDUPIXO
WR YLQ\O VLGLQJ VKLQJOHV SODQWV
VKUXEV RU ODQGVFDSH ,W RIIHUV D
TXLFNNQRFNGRZQDQGDIRDPLQJDFWLRQWKDWHQFDSVXODWHV
WKHQHVWDQGDQ\LQVHFWVFDXJKWRQLW7KHEXJVDUHLQ
FDSDEOHIURPHVFDSLQJWKHGHDGO\IRDP6LQFHLWFRQWDLQV
ZDWHUWKLVSURGXFWFDQQRWEHXVHGDURXQGHOHFWULFDOER[
HVRUZLUHV-HWVSUD\UHDFKHV¶.LOOVLQVHFWVRQFRQWDFW
3RZHUIXO¶MHWVSUD\EODVWNLOOVRQ
FRQWDFW :LOO QRW VWDLQ PRVW HDYHV
RU VLGLQJ .LOOV ZDVSV UHWXUQLQJ WR
WUHDWHG DUHD :DWHU EDVHG &RQ
WDLQV SHUFHQW 3UDOOHWKULQ SHUFHQW /DPEGD
&\KDORWKULQ
Our No.
No.
Size
Oz
Shf
Pk
97119
12
Shf
Pk
Our No.
Unit
SPECTRUM GROUP
15
+*
12
Unit
SCOTTS COMPANY
17
17
No.
Size
Ozs.
Shf
Pk
12
16
12
($
‡635$<
‡,1'225287'225
‡³3/86+276+27´
FLYING INSECT
KILLER
‡:$63+251(7
6SUD\V ¶ DQG HOLPLQDWHV ZDVSV
DQG KRUQHWV RQ FRQWDFW &)& IUHH
DQGVDIHIRUXVHLQRUJDQLFJDUGHQ
LQJ&RQWDLQVDFRPELQDWLRQRILQVHFWLFLGDOVRDSRUJDQLF
S\UHWKULQDQGGOLPRQHQH
Our No.
No.
Shf
Pk
Unit
Our No.
No.
Size
Ozs.
6
Our No.
Size
Ozs.
Shf
Pk
Unit
14
12
($
SC JOHNSON
12
($
Shf
Pk
Unit
6
No.
Size
Ozs.
SC JOHNSON
683-7900
14
($
‡1$785$/
‡³+276+27´
Size
Oz
No.
Shf
Pk
Unit
12
($
SPECTRUM GROUP
Aerosol Can
335-7142
+*
14
‡)5(6+)/25$/6&(17
‡³+276+27´
Our No.
No.
Size
Oz
Shf
Pk
Unit
6
3.
SPECTRUM GROUP
Aerosol Twin Pack
Shf
Pk
530-0165
Unit
WOODSTREAM
254-8675X
.LOOV RQ FRQWDFW .HHSV NLOOLQJ IRU
XS WR ZHHNV 1RQVWDLQLQJ QR
RLO\ UHVLGXH QR PHVV $FWLYH ,Q
JUHGLHQWV 3UDOOHWKULQ DQG /DPEGD
&\KDORWKULQ
.LOOVRQFRQWDFW1ROLQJHULQJFKHP
LFDORGRU6DIHIRURUJDQLFJDUGHQ
LQJ
.LOOV ZDVSV KRUQHWV DQG \HOORZ
MDFNHWV LQVWDQWO\ .LOOV ZDVSV ZLWK
UHVLGXDO DFWLRQ NLOOLQJ RQHV WKDW
PD\UHWXUQWRWKHQHVW6SUD\VXS
WRIW
696-0280
16
No.
ANT/ROACH KILLER
ANT/ROACH
KILLER
‡:$63+251(7
‡³5$,'´
No.
Our No.
Unit
SPECTRUM GROUP
673-7126
($
FLYING INSECT KILLER
Our No.
Shf
Pk
Aerosol
14
Size
Ozs.
3URYLGHVUHOLHIIURPHYHQWKHKHDYL
HVWLQIHVWDWLRQVRIURDFKHVDQGDQWV
IRUXSWRPRQWKV.LOOVLQVWDQWO\
$OVR NLOOV UHVLVWDQW URDFKHV WKRVH
LPPXQH WR RUGLQDU\ LQVHFWLFLGH
&RQWDLQV&\ODWKULQ
Our No.
.LOOV IDVW RQ FRQWDFW 3OXV NHHSV
NLOOLQJXSWRZHHNV,QGRRUDQG
RXWGRRUXVH/HDYHVQRXQSOHDVDQW
RGRUDQGQRQVWDLQLQJ:DWHUEDVHG&RQWDLQVSHU
FHQW7UDORPHWKULQSHUFHQWGWUDQV$OOHWKULQ
WOODSTREAM
759-5507X
($
6DIHIRUXVHDURXQGSHWVDQGFKLO
GUHQ 1R OLQJHULQJ SHVWLFLGHV .LOOV
DQWVURDFKHVVSLGHUVDQGFULFNHWV
)DVWDFWLQJIRUPXODNLOOVRQFRQWDFW
/HDYHVQRPHVV\UHVLGXH&RQWDLQVWKHQDWXUDODFWLYHLQ
JUHGLHQWOHPRQJUDVVRLOH[WUDFWV
($
ANT KILLER
Size
Ozs.
12
ANT/ROACH KILLER
Spray Can
($
070-4676
72
Unit
SPECTRUM GROUP
Display
154-2117X
.LOOVH[SRVHGGU\ZRRGGDPSZRRG
DQGVXEWHUUDQHDQWHUPLWHVRQFRQ
WDFW 6SHFLDO QR]]OH GLUHFWV VSUD\
WUHDWLQJ DUHDV WKDW RWKHU VSUD\V FDQ¶W UHDFK )RDPLQJ
IRUPXODH[SDQGVLQWRDUHDVVXFKDVYRLGVDQGFKDQQHOV
LQ GDPDJHG ZRRG EHKLQG YHQHHUV DQG LQ FUDFNV DQG
FUHYLFHV1RQVWDLQLQJIRUPXODOHDYHVQRRGRUV
Our No.
Can
142-6535
‡³5$,'0$;´
‡)2$0578
‡,1'225$1'287'225
‡³7(50,1$7(´
)RDPLQJ EDUULHU KHOSV WUDS LQVHFWV
LQWKHQHVW.LOOVRQFRQWDFW5HDFK
HVRQHVWRU\HDYHV
No.
Unit
ANT/ROACH KILLER
‡:$63+251(7
‡+20('()(16(0$;
‡$(5262/
‡³257+2´
Our No.
Shf
Pk
($
($
FLYING INSECT KILLER
Shf
Pk
Size
Ozs.
SC JOHNSON
637-2221
TERMITE KILLER
Size
Ozs.
No.
Aerosol
632-9650
No.
Unit
BENGAL CHEMICAL
914-6234
Our No.
Size
Ozs.
.LOOV RQ FRQWDFW ZLWK QR OLQJHULQJ
FKHPLFDORGRU.LOOVEXJVIRUXSWR
IRXUZHHNV8VHVEURDGVSUD\SDW
WHUQV IRU JRRG VXUIDFH FRYHUDJH
8VHGLUHFWO\RQURDFKHVDVZHOODV
LQWKHLUKLGLQJSODFHV2XWGRRU)UHVK6FHQWV
6
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
+*
- Maintenance, Repair & Operations
ANT/ROACH KILLER
BED BUG/FLEA KILLER
BUG KILLER
‡$(5262/&$1
‡³+276+27´
‡:$7(5%$6('
‡³+276+27´
.LOOVRQFRQWDFW.HHSVNLOOLQJIRUXS
WRZHHNV1RQVWDLQLQJQRRLO\
UHVLGXHRUPHVV(DV\WRXVHVSUD\
WKURXJK FDS &RQWDLQV WKH DFWLYH
LQJUHGLHQWVSUDOOHWKULQDQGODPEGDF\KDORWKULQ
.LOOV EXJV RQ FRQWDFW $OVR NLOOV
ÀHDVOLFHDQGEURZQGRJWLFNV1R
FKHPLFDO UHVLGXH RU RGRU 7UHDWV
PDWWUHVVHVIXUQLWXUHFXUWDLQVDQG
EHGGLQJDQ\ZKHUH\RXVHHEHGEXJV'ULHVIDVWKRXUV
VR PDWUHVV FDQ EH XVHG WKDW QLJKW 6SUD\ YDOYH DOORZV
FDQWRVSUD\DWDQ\DQJOHHYHQXSVLGHGRZQ
‡635$<
‡.,7&+(1
‡³+276+27´
Our No.
No.
Size
Oz
Shf
Pk
Unit
SPECTRUM GROUP
Our No.
Floral Scented
706-7879
12
($
12
($
Size
Ozs.
Shf
Pk
Unit
12
($
252-8990
+*
‡,1'225287'225
‡)5$*5$1&()5((
‡³5$,'0$;´
.LOOV RQ FRQWDFW .LOOV KRXVHKROG
VSLGHUV EODFN ZLGRZ VSLGHUV DQG
VFRUSLRQV &RQWDLQV WKH DFWLYH LQJUHGLHQWV ,PLSURWKULQ
SHUFHQWDQG'HOWDPHWKULQSHUFHQW
Size
Oz
Shf
Pk
Unit
.LOOV EXJV ZKHUH WKH\ KLGH DQG
WKHLU HJJV $OVR NLOOV GXVW PLWHV
OLFH DQG WLFNV &DQ EH XVHG IRU
VSRW WUHDWPHQWV RU UHLQIHVWDWLRQV
&RQWDLQV WKH DFWLYH LQJUHGLHQW
SKHQR[\EHQ]\OGLPHWK\O F\GRSURSDQHFDUER[\O
DWHSHUFHQW
Our No.
No.
Shf
Pk
Unit
12
12
650-6265
12
($
($
BED BUG KILLER
FLEA KILLER
.LOOV EHG EXJV ZKHUH WKH\ KLGH
VXFKV DV PDWWUHVVHV KHDGERDUGV
GUHVVHU GUDZHUV EHG IUDPHV ZDOO
KDQJLQJV UXJV GUDSHV DQG RWKHU
VXUIDFHV FUDFNV DQG FUHYLFHV QHDU EHG $OVR NLOOV ÀHDV
WLFNVGXVWPLWHVDQGOLFH1RQVWDLQLQJ&DQEHXVHGRQ
ZRRG WLOH DQG FDUSHWHG VXUIDFHV &RQWDLQV WKH DFWLYH
LQJUHGLHQWV 3KHQR[\EHQ]\O GLPHWK\OPHWK\O
SURSHQ\O&\FORSURSDQHFDUER[\ODWHDQGQ2FW\OELF\
FORKHSWHQHGLFDUER[LPLGH
‡3/86
‡³5$,'´
.LOOVÀHDVRQFRQWDFWSOXVLWVHJJ
VWRS IRUPXOD NLOOV KDWFKLQJ ÀHD
HJJVIRUXSWRWKUHHPRQWKV6DIH
IRU XVH RQ GRJV DV ZHOO DV XSKRO
VWHU\DQGRWKHUKRXVHKROGVXUIDFHV
Size
Ozs.
No.
Shf
Pk
Unit
Our No.
SC JOHNSON
51656
16
6
320-3957X
($
STINK BUG KILLER
‡,1'225287'225
‡$(5262/
‡³7(552´
.LOOV VWLQN EXJV FDUSHQWHU DQWV
WHUPLWHVEHHWOHVDQGERUHUV4XLFN
NLOO DFWLRQ ZD\ VSUD\HU VSUD\
DQGVWUHDP1RQVWDLQLQJ1RXQSOHDVDQWRGRU$FWLYHLQ
JUHGLHQWV7HWUDPHWKULQSHUFHQWDQG3HUPHWKULQ
Our No.
No.
Size
Oz
No.
Shf
Pk
Unit
16
Shf
Pk
Unit
12
($
($
Our No.
No.
12
($
Size
Ozs.
Shf
Pk
Unit
11
12
($
Size
Ozs.
Shf
Pk
Unit
12
12
($
SC JOHNSON
SPIDER KILLER
$GGUHVVHV$PHULFD¶VSHVWSURE
OHP.LOOVVSLGHUVIDVW.HHSVNLOOLQJ
XS WR PRQWKV ([FOXVLYH VSUD\HU
JHWVLQKDUGWRUHDFKSODFHV
Our No.
No.
SPECTRUM GROUP
663-7433
+*
SPIDER KILLER
/RQJ ODVWLQJ FRQYHQLHQW DHURVRO
IRUPXOD RI 6ELRDOOHWKULQ SOXV GHO
WDPHWKULQ IRU TXLFN NQRFNGRZQ
DV ZHOO DV UHVLGXDO DFWLRQ .LOOV RQ
FRQWDFW:DWHUEDVHGZLOOQRWVWDLQ
FDUSHWVRUÀRRUV
Size
Oz
Our No.
‡+20(
‡³63(&75$&,'(%8*6723´
BONIDE PRODUCTS
058-3666
.LOOVIDVW/DVWVXSWRZHHNV.LOOV
ERWK À\LQJ DQG FUDZOLQJ LQVHFWV
:DWHUEDVHG&RQWDLQVSHUFHQW
3\UHWKULQVSHUFHQW3%2SHU
FHQW3HUPHWKULQ
Our No.
No.
Size
Ozs.
Shf
Pk
Unit
SPECTRUM GROUP
912-5790
+*
16
12
No.
15
Shf
Pk
Unit
12
($
Shf
Pk
Unit
12
($
WASP & HORNET
KILLER
Aerosol
12
14
'HVLJQHG WR NLOO FUDZOLQJ À\LQJ
DQG JDUGHQ LQVHFWV )RUPXOD ZLOO
QRW KDUP KRXVH RU JDUGHQ SODQWV
8VHDURXQGFDUSHWVGUDSHULHVQR
ZD[ÀRRUVKRXVHSODQWVDQGJDUGHQSODQWV
BUG KILLER
SENORET CHEMICAL
420-7973
‡,1'225287'225
Size
Oz
SCOTTS COMPANY
Aerosol
611-1116
626-6316
‡635$<
‡³+276+27´
‡$(5262/
‡³257+2´
Our No.
Unit
SC JOHNSON
Aerosol Can
Shf
Pk
SPECTRUM GROUP
696-0256
Size
Oz
SC JOHNSON
348-3468
Size
Ozs.
‡+286(*$5'(1
‡³5$,'´
‡³5$,'0$;´
SPIDER/SCORPION
KILLER
No.
No.
BUG KILLER
BEDBUG/FLEA KILLER
Our No.
Our No.
SPECTRUM GROUP
Unscented
472-5065
No.
.LOOV IDVW 0DGH ZLWK ERWDQLFDO LQ
VHFWLFLGH )RU XVH LQ NLWFKHQV DQG
RWKHUIRRGSUHSDUDWLRQDUHDV
($
‡)2$0635$<
)RDPVSUD\FRDWVQHVWIRUFRPSOHWH
NLOO -HW VSUD\ UHDFKHV QHVWV XS WR
¶ :DWHU EDVHG IRUPXOD $FWLYH
LQJUHGLHQWV7HWUDPHWKULQSHU
FHQWDQG6XPLWKULQSHUFHQW
Our No.
No.
Size
Oz
SENORET CHEMICAL
420-7981
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - WASP/YELLOW JACKET
KILLER
‡)2$0
‡³67,1*(5´
-HW IRDPLQJ VKRRWV ¶ DERYH
JURXQG(QYHORSVELWLQJDQGVWLQJ
LQJ LQVHFWV LQ DQ HQWUDSSLQJ IRDP
DQG GURSV WKHP LQVWDQWO\ &RDWV QHVW IRU FRPSOHWH NLOO
5HVLGXDO DFWLRQ NLOOV LQVHFWV UHWXUQLQJ WR QHVW :DWHU
EDVHG IRUPXOD 0D\ EH XVHG LQGRRUV LQ SODFHV OLNH DW
WLFVZKHUHQHVWVDUHFRPPRQO\EXLOW$OVRNLOOVKRUQHWV
¿UHDQWVVSLGHUVLQFOXGLQJEODFNZLGRZVSLGHUVVFRU
SLRQV FULFNHWV DQWV ÀHDV WLFNV FHQWLSHGHV HDUZLJV
ÀLHV DQG PRVTXLWRHV &RQWDLQV WKH DFWLYH LQJUHGLHQWV
7HWUDPHWKULQF\FORKH[HQHGLFDUER[LPLGRPHWK\O
GLPHWK\O DQG 6XPLWKULQ 3KHQR[\EHQ]\O GLPHWK\O
Our No.
No.
Size
Oz
Shf
Pk
Unit
12
($
BONIDE PRODUCTS
617-6895
629
15
)DVW HIIHFWLYH UHOLHI IURP LQVHFW
ELWHV DQG VWLQJV 0XOWLDFWLRQ IRU
PXOD DQHVWKHWLF DQG DQWLVHSWLF
(DV\WRXVHDQGFDUU\3ODVWLFYLDO
)RU FDPSHUV JROIHUV ¿VKHUPHQ
DQGJDUGHQHUV
%,7(
12
($
Our No.
Pouch Of 15
513-3707
($
No.
+*
659-3958
Unit
SC JOHNSON
6
+*
12
($
Size
Ozs.
Shf
Pk
6
Unit
($
‡5(3(/6$//*5$18/(6
‡³*2$:$<´
$FRQYLHQWJUDQXODUIRUPXODWLRQRI
RXUDOOQDWXUDODQGSRSXODU5HSHOV
DOO OLTXLG 7ULJJHUV JHQHWLFDOO\ DQG ELRORJLFDOO\ LQJUDLQHG
IHDUDQGÀLJKWUHVSRQVHVLQDPXOWLWXGHRIDQLPDOLQWUXG
HUV ZLWKRXW KDUP /DVWV XS WR WZR PRQWKV SURWHFWV
SODQWVDQGSURSHW\\HDUURXQG
Our No.
No.
Size
Lb
Shf
Pk
Unit
12
($
Shf
Pk
Unit
12
($
BONIDE PRODUCTS
INSECT REPELLENT
INSECT REPELLENT
Our No.
Size
Oz
No.
Shf
Pk
Unit
3URYLGHV XS WR KRXUV RI SURWHF
WLRQ DJDLQVW PRVTXLWRHV 3URWHFWV
DJDLQVW WLFNV FKLJJHUV JQDWV QR
VHHXPV DQG ELWLQJ ÀLHV :DWHU
UHVLVWDQWVSRUWIRUPXODSHUFHQW'((7
Our No.
SPECTRUM GROUP
797-9388
‡816&(17('
‡³&877(5´
+*
6
($
Size
Ozs.
No.
SPECTRUM GROUP
Aerosol
6
INSECT REPELLENT
‡3803
($
INSECT REPELLENT
5HSHOV PRVTXLWRHV WLFNV JQDWV
ELWLQJÀLHVFKLJJHUVDQGÀHDV3UR
WHFWV XS WR KRXUV )RU VHYHUH
FRQGLWLRQVZLWKKHDY\LQVHFWDFWLY
LW\&RQWDLQVSHUFHQW'HHW
INSECT REPELLENT
‡02,6772:(/(77(6
‡³'((3:22'62))´
Our No.
5HSHOV PRVTXLWRHV WKDW PD\ FDUU\
:HVW 1LOH 9LUXV /RQJ ODVWLQJ SUR
WHFWLRQ IURP PRVTXLWRHV WLFNV
ELWLQJ ÀLHV JQDWV FKLJJHUV ÀHDV
&RQWDLQV SHUFHQW '((7 &RQYHQLHQW WR WRVV LQ \RXU
FDUSXUVHEDFNSDFNZDOOHW:RQ¶WGU\RXW
No.
Count
Shf
Pk
Unit
54996
12
12
($
SC JOHNSON
Unit
INSECT
REPELLENT
696-9810
Shf
Pk
Shf
Pk
Hang Tag
12
+*
3RFNHWWULDO VL]H &DS SUHYHQWV
OHDNV DQG ORVV 7KH ULJKW DPRXQW
RI SURWHFWLRQ IURP WLFNV FKLJJHUV
PRVTXLWRHV DQG JQDWV 8S WR VSUD\V 6PDOO VL]H LGHDO IRU EDJV MDFNHWV ¿VKLQJ YHVWV
HWF&RQWDLQVSHUFHQW'HHW
Fan circulated repellent lasts up to
KRXUV IRU KHDG WR WRH SURWHF
WLRQ 2GRUOHVV DQG UH¿OODEOH )RU
XVHRXWGRRUV,QFOXGHVUHSHOOHQW
XQLWUH¿OODQG$$$EDWWHULHV&RQWDLQVWKHDFWLYHLQ
JUHGLHQWPHWRÀXWKULQ
Size
Ozs.
No.
SPECTRUM GROUP
‡3(1
‡38036325760(1
‡&/,32167$57(581,7
‡³2))´
303-7892X
3RFNHW VL]H RQ WKH JR SURWHFWLRQ
UHSHOV PRVTXLWRHV WKDW PD\ FDUU\
:HVW1LOHYLUXVIRUXSWRKRXUV
,GHDO IRU SXUVHV EDE\ EDJV EDFNSDFNV DQG SRFNHWV
6ZHDWUHVLVWDQW8SWRVSUD\V&RQWDLQVSHUFHQW
'HHW
070-4270
Unit
INSECT REPELLENT
Our No.
Unit
SPECTRUM GROUP
418-3836
Shf
Pk
Shf
Pk
No.
SPECTRUM GROUP
PIC
419-9113
Our No.
Our No.
No.
No.
,GHDO IRU WKH HQWLUH IDPLO\ KRXU
SURWHFWLRQ IURP PRVTXLWRHV WLFNV
FKLJJHUV DQG ÀLHV 1RW JUHDV\ RU
RLO\ &RQWUROOHG DSSOLFDWLRQ IRU XVH
RQIDFHDQGQHFN=LSORFNFORVXUHSUHYHQWVGU\LQJRXW
6RIWSRXFKIRUHDV\SODFHPHQWLQEDE\EDJVEDFNSDFNV
DQGJORYHER[HV&RQWDLQVSHUFHQWGHHW
3RFNHWWULDOVL]H8SWRVSUD\V
&DSSUHYHQWVOHDNVDQGORVV6PDOO
VL]HLGHDOIRUEDJVMDFNHWV¿VKLQJ
YHVWV HWF 3URWHFWV IRU XS WR KRXUV7KHULJKWDPRXQWRISURWHFWLRQIURPWLFNVFKLJ
JHUVPRVTXLWRHVDQGJQDWVSHUFHQW'HHW
INSECT BITE RELIEF
Our No.
‡3803%$&.:22'6
‡816&(17('
‡³&877(5´
‡3(1
‡380332&.(76,=(
Bagged Goods
611-1272X
INSECT REPELLENT
‡02,67:,3(6
‡³&877(5´
INSECT REPELLENT
INSECT REPELLENTS
Our No.
INSECT REPELLENT
No.
Size
Ozs.
‡'5<
‡'((3:22'6
‡³2))´
Shf
Pk
Unit
SPECTRUM GROUP
494-7628
1
6
($
/RQJ ODVWLQJ SURWHFWLRQ DJDLQVW
PRVTXLWRHV WLFNV ELWLQJ ÀLHV
JQDWV DQG FKLJJHUV 1RW RLO\ RU
JUHDV\ .LOOV PRVTXLWRHV WKDW PD\ FDUU\ WKH :HVW 1LOH
YLUXV&RQWDLQVSHUFHQW'HHW
Our No.
No.
Size
Oz
Shf
Pk
Unit
4
12
($
SC JOHNSON
INSECT REPELLENT
999-8329
‡³+285´
2QH DSSOLFDWLRQ SURWHFWV \RX IURP
ELWLQJ LQVHFWV LQFOXGLQJ PRVTXL
WRHV FKLJJHUV DQG WLFNV IRU XS
WR IXOO KRXUV 1R VFHQW DGGHG
)RUPXODWHG QRW WR VZHDW RII SHUFHQW'HHW
Our No.
No.
Size
Oz
Shf
Pk
Unit
12
($
GRABBER PERFORMANCE GRO
383-1377
)*
2
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
71764
- Maintenance, Repair & Operations
INSECT REPELLENT
INSECT REPELLENT
INSECT REPELLENT
‡816&(17('
‡³'((3:22'62))´
‡)5(6+6&(17
‡³&877(56.,16$7,216´
‡³&877(5$'9$1&('´
3URYLGHVSURWHFWLRQIURPELWLQJLQ
VHFWVHVSHFLDOO\LQKHDYLO\ZRRGHG
DUHDV3URWHFWVDJDLQVWGLVHDVHFDU
U\LQJWLFNVPRVTXLWRHVEODFNÀLHV
VDQGÀLHVFKLJJHUVJQDWVDQGQRVHHXPV&RQWDLQV
SHUFHQW'((7
1RQJUHDV\ SHUFHQW '((7 IRU
PXOD JRHV RQ GU\ &RQWDLQV $ORH
DQG9LWDPLQ(0HHWVWKH$PHULFDQ
$FDGHP\ RI 3HGLDWULFV UHFRPPHQ
GDWLRQIRUXVHRQFKLOGUHQ:DWHUEDVHG
Our No.
No.
Our No.
Shf
Pk
Unit
SPECTRUM GROUP
674-5699
SC JOHNSON
Size
Ozs.
No.
Size
Ozs.
Shf
Pk
Unit
12
($
Pump Spray
604-7252
6
12
($
604-7245
9
12
($
6
2GRUOHVV IRUPXOD IHHOV OLJKW DQG
FOHDQ
'HUPDWRORJLVW
WHVWHG
IUDJUDQFHIUHH :LOO QRW GDPDJH
plastics or other synthetic materi
DOV 'RHV QRW QHHG WR EH ZDVKHG
RIIZKHQUHWXUQLQJLQGRRUV5HSHOVPRVTXLWRVFKLJJHUV
ELWLQJ ÀLHV QRVHHXPV JQDWV DQG ÀHDV &RQWDLQV 3L
FDULGLQDQHIIHFWLYHDOWHUQDWLYHWR'((73LFDULGLQLVQRZ
UHFRPPHQGHG E\ WKH &HQWHUV IRU 'LVHDVH &RQWURO DQG
3UHYHQWLRQ
Our No.
‡&/27+,1**($5
‡³5(3(/´
‡60227+'5<)$0,/<
&$5(
‡³6.,17$67,&2))´
&RUQVWDUFK IRUPXOD GULHV RQ FRQ
WDFW OHDYLQJ \RXU VNLQ IHHOLQJ
VPRRWKDQGGU\5HSHOVPRVTXLWRHV
WKDWPD\FDUU\:HVW1LOH9LUXV/RQJODVWLQJSURWHFWLRQ
IURPPRVTXLWRHVWLFNVELWLQJÀLHVJQDWVFKLJJHUVDQG
ÀHDV3RZGHUGU\IRUPXOD&RQWDLQVSHUFHQW'((7
No.
Shf
Pk
Unit
SC JOHNSON
22154
4
12
Our No.
Size
Ozs.
No.
Shf
Pk
Unit
879-9751X
6
6
($
Our No.
‡6:($75(6,67$17
‡³2))´
Shf
Pk
Unit
6
Our No.
No.
Size
Ozs.
Shf
Pk
Unit
6
12
+*
12
($
3URYLGHV SURWHFWLRQ IURP ELWLQJ
VWLQJLQJLQVHFWV$OOQDWXUDOIRUPXOD
ZLWK QR SHVWLFLGHV +HOSV UHSHOV
PRVTXLWRHVIRUKRXUV
Our No.
Shf
Pk
No.
Unit
PIC
6
7:,67,7
($
MOSQUITO REPELLENT
‡:5,67%$1'
‡³%8*$%/(6´
‡/(021(8&$/<3786
‡³5(3(/´
5HSHOV WLFNV DQG PRVTXLWRHV IRU
XSWRKRXUV3OHDVDQWOHPRQIUD
JUDQFH SHUFHQW RLO RI /HPRQ
(XFDO\SWXV
0HHWV WKH $PHULFDQ $FDGHP\ RI
3HGLDWULFVUHFRPPHQGDWLRQIRUXVH
RQ FKLOGUHQ SHUFHQW '((7 IRU
PXODSURYLGHVKRXUVRISURWHFWLRQ
)UDJUDQFHIUHHZLWK$ORH9HUD:DWHUEDVHG
Size
Ozs.
Shf
Pk
Our No.
Unit
12
Size
Ozs.
Shf
Pk
Unit
+*
4
:RUNV E\ HPLWWLQJ D VFHQW RI DOO
QDWXUDO SODQW EDVHG HVVHQWLDO RLOV
6FHQW PDVNV WKH RGRUV KXPDQV
HPLW WKDW DWWUDFW LQVHFWV (IIHF
WLYHO\ PDNHV \RX VPHOO OLNH D SODQW DQG LQYLVLEOH WR LQ
VHFWV /DVWV IRU KRXUV :ULVWEDQG SURWHFWV DQ DUHD
RI¶5HSHOOHQWLVIRUPXODWHGZLWKSHUFHQWQDWXUDO
RLOV /HPRQJUDVV *HUDQLRO DQG &LWURQHOOD ZULVWEDQG
SHUSDFNDJH
Our No.
Water Based
487-1943X
Pump Spray
6
No.
SPECTRUM GROUP
SPECTRUM GROUP
Unit
($
($
‡-867)25.,'6
‡³&877(5´
664-1443
Shf
Pk
‡7:,67,7
‡³&,7521(//$3/86´
681-8553
SC JOHNSON
367-4678
12
INSECT REPELLENT
No.
Size
Oz
MOSQUITO REPELLENT
6ZHDWUHVLVWDQW IRUPXOD OHWV \RX
ZRUNXSDVZHDWZLWKRXWEHFRPLQJ
PRUH DSSHDOLQJ WR KXQJU\ SHVWV
.HHSVELWLQJLQVHFWVDZD\3URWHFWV
DJDLQVWPRVTXLWRHVWKDWPD\FDUU\WKH:HVW1LOH9LUXV
ELWLQJÀLHVJQDWVWLFNVDQGQRVHHXPV&RQYHQLHQWDQG
HDV\WRXVH3URYLGHVSURWHFWLRQIRUXSWRKRXUV$FWLFH
LQJUHGLHQWSHUFHQW'HHW
INSECT REPELLENT
Our No.
No.
Aerosol Can
Aerosol
($
2Q WKH JR SURWHFWLRQ IURP PRV
TXLWRHV WKDW PD\ FDUU\ :HVW 1LOH
9LUXV 8S WR VSUD\V ,GHDO IRU
SXUVHVEDE\EDJVDQGEDFNSDFNV
&OHDQIUHVKVFHQW&RQWDLQV$ORHDQG9LWDPLQ(WRPRLV
WXUL]HVNLQ&RQWDLQVSHUFHQW'HHW
SPECTRUM GROUP
SPECTRUM GROUP
674-5707
12
INSECT REPELLENT
0DNHV\RXLQYLVLEOHWREXJV0HHWV
WKH $PHULFDQ $FDGHP\ RI 3HGLDW
ULFV UHFRPPHQGDWLRQ IRU XVH RQ
FKLOGUHQ:DWHUEDVHG3URWHFWVXS
WRKRXUVDJDLQVWPRVTXLWRHVWLFNVELWLQJÀLHVJQDWV
QRVHHXPVFKLJJHUVDQGÀHDV
Size
Ozs.
6
‡3(13803
‡³&877(5´
870-5550
($
‡816&(17('
‡³&877(5´
No.
SPECTRUM GROUP
INSECT REPELLENT
Our No.
Unit
INSECT REPELLENT
5HSHOV DQG NLOOV WLFNV DQG PRVTXL
WRHV IRU XS WR WZR ZHHNV /DVWV
WKURXJKVHYHUDOZDVKLQJV8VH)RU
6KRHV &ORWKLQJ 1HWV *HDU DQG
7HQWV :$51,1* 1RW WR EH DSSOLHG WR VNLQ SHUFHQW
3HUPHWKULQ:DWHU%DVHG
Aerosol
356-9183X
Shf
Pk
INSECT REPELLENT
INSECT REPELLENT
Our No.
Size
Ozs.
SPECTRUM GROUP
381-6345X
Size
Ozs.
No.
6
($
No.
Shf
Pk
Unit
:%
12
($
PIC
681-8520X
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - MOSQUITO REPELLENT
MOSQUITO REPELLENT
‡67,&.(56
‡³%8*$%/(6´
‡$(5262/
:RUNV E\ HPLWWLQJ D VFHQW RI DOO
QDWXUDO SODQW EDVHG HVVHQWLDO RLOV
6FHQW PDVNV WKH RGRUV KXPDQV
HPLWWKDWDWWUDFWLQVHFWV(IIHFWLYHO\
PDNHV \RX VPHOO OLNH D SODQW DQG LQYLVLEOH WR LQVHFWV
/DVWVIRUKRXUV(DFKVWLFNHUSURWHFWVDQDUHDRI¶
5HSHOOHQW LV IRUPXODWHG ZLWK SHUFHQW QDWXUDO RLOV
/HPRQJUDVV*HUDQLRODQG&LWURQHOOD&RQWDLQVVWLFNHUV
Our No.
No.
Shf
Pk
Unit
%8*
12
&'
MOSQUITO REPELLENT
LANTERN
‡3$7,2
5HSHOV PRVTXLWRHV WKDW PD\ FDUU\
WKH:HVW1LOH9LUXV$OVRUHSHOVELW
LQJÀLHVJQDWVFKLJJHUVÀHDVDQG
WLFNV2QHWUHDWPHQWODVWVKRXUV
$FWLYH,QJUHGLHQW'HHWSHUFHQW
Our No.
No.
Size
Oz
Shf
Pk
Unit
6
12
($
BENGAL CHEMICAL
147-1648
PIC
891-5712X
MOSQUITO REPELLENT
‡+26((1'635$<(5
.LOOV DQG UHSHOV PRVTXLWRHV JQDWV
DQG RWKHU LQVHFWV IRU XS WR IRXU
ZHHNV6SUD\RQ\DUGSDWLRSODQWV
DQGÀRZHUV&DQEHXVHGDURXQG
KRPHV ODZQV SRRO DQG SDWLR DU
HDVZDWHUJDUGHQVWHQQLVFRXUWVSLFQLFVDQGFDPSVLWHV
Our No.
No.
Size
Ozs.
Shf
Pk
Unit
12
($
SUMMIT CHEMICAL
728-8905
No.
Shf
Pk
Unit
12
($
SC JOHNSON
282-1734
Size
Lb
Shf
Pk
Unit
WOODSTREAM
Our No.
No.
Size
Lb
Shf
Pk
Unit
SENORET CHEMICAL
307-5058
2
6
($
Our No.
5
3RFNHWVL]H VLOHQW DQG SRUWDEOH
ZLWK QR RSHQ ÀDPH *RHV HYHU\
ZKHUH SURYLGLQJ D PRVTXLWR IUHH
]RQHDURXQGDGHFNFDPSVLWHWUHH
VWDQG WXUNH\ EOLQG RU VPDOO ERDW
$OVRJUHDWIRUEDFN\DUGVDQGVSHFWDWRUVSRUWV5HSHOVXS
WRSHUFHQWRIPRVTXLWRHVEODFNÀLHVDQGQRVHHXPV
RYHUD¶[¶DUHD&RQWDLQVUHXVDEOHDSSOLDQFHEX
WDQHFDUWULGJHÀR]DQGLQVHFWUHSHOOHQWVPDWV
$FWLYHLQJUHGLHQW'FLVWUDQVDOOHWKULQSHUFHQW
6
($
Shf
Pk
No.
Unit
&DPRXÀDJH
Shf
Pk
Unit
,5'
12
($
678-6636
6
05)-
($
CITRONELLA CANDLES
‡%8&.(7287'225
‡³&877(5´
)RU KROLGD\ %%4V SLFQLFV DQG
RWKHU FHOHEUDWLRQV RXWVLGH 3DWUL
RWLF ÀDJ GHVLJQ 5HSHOV PRVTXLWRV
DQGRWKHUÀ\LQJLQVHFWV&RQWDLQV
SHUFHQW&LWURQHOODRLO
Our No.
No.
Size
Ozs.
Burn
Time
17
+RXUV
Shf
Pk Unit
SPECTRUM GROUP
)RU RXWGRRU XVH 'ULYHV PRVTXL
WRHV WLFNV DQG JQDWV DZD\ IRU
KRXUV 8VH RQ SDWLRV FDPSLQJ
VLWHV SRROV EHDFKHV SLFQLF EDU
EHFXHDUHDVSRUFKHVDQGRQERDUGSULYDWHERDWV(DFK
FRLOEXUQVIRUKRXUV&RQWDLQVWKHDFWLYHLQJUHGLHQW
'&,67UDQV$OOHWKULQSHUFHQW
No. of
Coils
($
THERMACELL/SCHAWBEL
No.
No.
‡3257$%/(&25'/(66
Our No.
PIC
Our No.
05/
Unit
MOSQUITO REPELLER
Shf
Pk
Unit
PIC
891-5704
&
4
12
($
891-5837
&
12
($
858-4054
+*
6
($
CITRONELLA CANDLES
‡&,752*8$5'
‡%8&.(7
‡³&877(5´
5HSHOV PRVTXLWRHV IRU XS WR KRXUV &DQGOH EXUQV IRU XS WR KRXUV 0DGH ZLWK SHUFHQW FLWUR
QHOODRLO
Our No.
Jug
'7
(DV\WRXVHJUDQXOHVPDGHIURPD
EOHQGRIQDWXUDOERWDQLFDORLOV
SHUFHQWQDWXUDO&RQVLGHUHGVDIHWR
XVH DURXQG SHRSOH DQG SHWV 5H
SHOV PRVTXLWRHV JQDWV DQG RWKHU À\LQJ LQVHFWV OE
FRQWDLQHUFRYHUVDSSUR[LPDWHO\VTXDUHIHHW/DVWV
XSWRWKUHHZHHNV3OHDVDQWVFHQW
‡&2,/6
$OOQDWXUDOQRQSRLVRQRXVFRQWURO
'U\JUDQXODUSURGXFWWKDWLVHDVLO\
DSSOLHG IURP LWV EXLOWLQ VSULQNOHU
FDS RU IURP D IHUWLOL]HU VSUHDGHU
&UHDWHV DQ LQVWDQW EDUULHU IURP
PRVTXLWRHV&DQEHXVHGDURXQGKRPHVODZQVSRRODQG
SDWLRDUHDVZDWHUJDUGHQVWHQQLVFRXUWVSLFQLFVFDPS
VLWHV RU DQ\ZKHUH PRVTXLWR FRQWURO LV UHTXLUHG $FWLYH
LQJUHGLHQWV DUH /HPRQ JUDVV RLO 0LQW RLO DQG *DUOLF RLO
%LRGHJUDGDEOH 3URWHFWV XS WR VTXDUH IHHW /DVWV
XSWRZHHNV
629-6461
289-3162X
MOSQUITO REPELLENT
COILS
‡*5$18/(6
No.
‡*5$18/(6
‡³7(552´
821-2409
MOSQUITO REPELLENT
Our No.
THERMACELL/SCHAWBEL
8QLW UHSHOV PRVTXLWRHV DQG RWKHU
À\LQJ DQG ELWLQJ LQVHFWV IRU KRXUV 5HSHOOHQW IRUPXODWHG ZLWK
SHUFHQWQDWXUDORLOV/HPRQJUDVV&LWURQHOODDQG*H
UDQLXP
5H¿OO IRU &OLS 2Q 6WDUWHU SURYLGHV
XS WR KRXUV RI KHDG WR WRH
SURWHFWLRQ 2GRUOHVV 1R VNLQ DS
SOLFDWLRQ $FWLYH LQJUHGLHQW SHUFHQW0HWKRÀXWKULQ
Shf
Pk
No.
MOSQUITO REPELLENT
‡³&,7521(//$3/86
)2508/$7,21´
‡&/,3215(),//
‡³2))´
Our No.
Our No.
MOSQUITO REPELLENT
DIFFUSER
MOSQUITO REPELLENT
)HDWXUHV D ZURXJKW LURQ ORRN IRU
FODVVLF DSSHDO +DV QR RSHQ ÀDPH
DQG OLJKW LV JHQHUDWHG E\ /('V
KLGGHQLQWKHEDVH5HSHOVXSWR
SHUFHQWRIPRVTXLWRHVEODFNÀLHVDQGQRVHHXPVRYHU
D¶[¶DUHD3URYLGHVSURWHFWLRQLQPLQXWHVDQGODVWV
IRUKRXUV6LOHQWSRUWDEOHDQGFRUGOHVV)RUGHFNVSDWLRV
DQGRXWGRRUSDUWLHV&RQWDLQVUHXVDEOHODQWHUQEX
WDQHFDUWULGJHÀR]DQGLQVHFWUHSHOOHQWPDWV
$FWLYH,QJUHGLHQW'FLVWUDQVDOOHWKULQSHUFHQW
No.
Size
Oz
Shf
Pk
Unit
SPECTRUM GROUP
049-1142
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
+*
17
6
($
- Maintenance, Repair & Operations
Bagged Goods
CITRONELLA CANDLES
No.
‡)2*,16(&7,&,'(578
‡287'225
‡³%/$&.)/$*´
Size
Ozs.
Shf
Pk
Unit
LAMPLIGHT FARMS
483-4719X
17
6
($
CITRONELLA CANDLES
Shf
Pk
6
Size
Ozs.
Shf
Pk
Unit
17
12
($
Our No.
No.
Size
Ozs.
Our No.
($
Size
Ozs.
No.
Shf
Pk
Unit
12
($
BENGAL CHEMICAL
Aerosol
Shf
Pk
Unit
(%0)2*
2
12
3.
675-6118
7,.6
17
No.
Shf
Pk
Unit
12
3.
INSECT KILLER
‡)80,*$725)2**(5
‡,1'225'(/$<('$&7,21
12167$,1,1*
‡³5$,'´
'HHW IUHH EUDFHOHW KHOSV UHSHO
PRVTXLWRHV ÀLHV JQDWV DQG RWKHU
SHVWV/DVWVWRZHHNV
No.
Shf
Pk
Unit
%$1'
12
($
PIC
No.
Size
Ozs.
Shf
Pk
Unit
16
12
($
SC JOHNSON
696-0264
INSECT KILLER
‡,16(&7)2*
‡287'225
‡³02648,72%($7(5´
)RUXVHLQDQ\RXWGRRUIRJJHU.LOOV
PRVTXLWRHVJQDWVÀLHVDQGRWKHU
LQVHFWV RQ FRQWDFW 5HDG\ WR XVH
QRPL[LQJUHTXLUHG)RJGLVVLSDWHVTXLFNO\DQGSURYLGHV
KRXUV RI PRVTXLWRIUHH HQMR\PHQW JDOORQV FRYHUV
VTXDUHIHHW
No.
Size
Shf
Pk
Unit
BONIDE PRODUCTS
Shf
Pk
Unit
6
3.
599-9677
7,.6
552
*DO
6
($
489-4903
7,.6
*DO
6
($
SC JOHNSON
634-5185
No.
Our No.
'U\ IRJZKLWH VPRNH SHQHWUDWHV
KLGGHQDUHDVEHKLQGZDOOVDQGVXU
IDFHVWRNLOORQFRQWDFWPRUHEXJVZLWKOHVVPHVVWKDQ
DHURVROIRJJHUV/HDYHVDFOHDQIUHVKVFHQWZLWKQRRLO\
UHVLGXH .LOOV URDFKHV SDOPHWWR EXJV ZDWHUEXJV DGXOW
ÀHDV WLFNV PRVTXLWRHV ÀLHV DQWV DQG VSLGHUV 8VH LQ
NLWFKHQVOLYLQJDUHDVJDUDJHVDWWLFVEDVHPHQWVDQGSHW
DUHDV2QHXQLWWUHDWVDURRPRIXSWR¶[¶
Our No.
‡287'225)2**(5
‡<$5'*8$5'
‡³5$,'´
Our No.
Aerosol
INSECT KILLER
2XWGRRUXVHRQO\)RUXVHLQEDFN
\DUGV SDWLRV DQG SLFQLF DUHDV
3RZHUIXO IRJJLQJ DFWLRQ SURYLGHV
KRXUVRIEXJIUHHSURWHFWLRQ.LOOVEXJV¶DZD\
SC JOHNSON
696-0108
‡12172;,&
896-7994
12
4XLFNNQRFNGRZQDQGNLOOVPRVTXL
WRHVÀLHVJQDWVPRWKVDQWVVSL
GHUVVFRUSLRQVDQGURDFKHVIRUXS
WRKRXUV.LOOVDQGUHSHOVVSLGHUV
IRUXSWRGD\V1R&)&V*XDUDQWHHGWRZRUN
1RQVWDLQLQJ DQG OHDYHV QR UHVL
GXH +DV D SOHDVDQW RXWGRRU IUHVK VFHQW .LOOV URDFKHV
ÀHDV DQWV DQG D YDULHW\ RI RWKHU LQVHFWV &OHDU FRORU
0DLQ$FWLYH&\SHPHWKULQ3DFNFRQWDLQVWKUHHRXQFH
FDQV
CITRONELLA PLUS
WRISTBAND
Our No.
‡287'225)2**(5
‡<$5'$1'3$7,2)2**(5
‡,1'225)2**(5
‡&21&(175$7(''((3
5($&+
‡+286(<$5'
‡³5$,'´
LAMPLIGHT FARMS
INSECT KILLER
($
INSECT KILLER
($
&RORUHG JODVV ZD[ FDQGOH ZLWK
ZKLWH FLWURQHOOD ZD[ LQVLGH %XUQ
WLPH RI XS WR KRXUV $VVRUWHG
FRORUVEOXHSLQNJUHHQ
706-6764X
($
6
Unit
‡*/$66
No.
6
64
3 Cans
CITRONELLA CANDLES
Our No.
5
619-9459
Shf
Pk
ENFORCER PRODUCTS
SPECTRUM GROUP
+*
Unit
Aerosol
938-1021
488-6859
Our No.
:LGHVWDEOHEDVHSUHYHQWVWLSSLQJ
:LQGUHVLVWDQW GHVLJQ (DUWK WRQH
FRORUVEOHQGHDVLO\LQDQ\EDFN\DUG
5HSHOV PRVTXLWRHV IRU XS WR KRXUV0DGHZLWKSHUFHQW&LWURQHOODRLO
810-8573
Shf
Pk
BENGAL CHEMICAL
‡,1'225)2**(5
‡75,3/(:,&.
‡³&877(5´
No.
Size
Ozs.
.LOOV XS WR ZHHNV (DFK FDQ
WUHDWVXSWRIW.LOOVURDFKHV
ÀHDV WLFNV DQG ÀLHV &RQWDLQV &\
SHUPHWKULQ %R[ FRQWDLQV R]
FDQV
Size
Oz
No.
272-2981
INSECT KILLER
($
CITRONELLA CANDLES
Our No.
Unit
Unit
6
&/
Shf
Pk
Our No.
Bottle
MINTCRAFT
285-2614
No.
Size
Ozs.
1RQÀDPPDEOH GU\ SHQHWUDWLQJ
IRJLVFOHDQRGRUOHVVDQGOHDYHVQR
UHVLGXH .LOOV URDFKHV ÀHDV WLFNV
DQWVPRVTXLWRHVVSLGHUVÀLHVJQDWVDQGFULFNHWV6DIH
UHWXUQ DIWHU KRXU 7UHDWV XS WR FXELF IHHW 1R
&)&V*XDUDQWHHGWRZRUN
BURGESS PRODUCTS
&LWURQHOOD DQG JROG FRORU ZD[
/LJKWVXS\DUGRUSDWLR6L]H´
KHLJKW[´GLDPHWHU
No.
)RJ GLVDSSHDUV TXLFNO\ DQG OHDYHV
QR UHVLGXH 2GRUOHVV V\QWKHWLF 3\
UHWKURLG .LOOV PRVTXLWRHV ÀLHV
JQDWV KRUQHWV ZDVS DQG RWKHU LQVHFWV 8VH ZLWK SUR
SDQH DQG HOHFWULF IRJJHUV )RU \DUGV SDWLRV DURXQG
VZLPPLQJ SRROV GULYHLQ DQG EDUQV :LOO ZRUN ZLWK DOO
%XUJHVVDQG%ODFN)ODJIRJJHUV/DVWVXSWRKRXUV$F
WLYH,QJUHGLHQWSHUFHQW5HVPHWKULQ
Our No.
‡:,7+7(55$&277$%2:/
Our No.
‡'5<)2**(5
‡121)/$00$%/('5<
3523(//$17
INSECT KILLER
*DOYDQL]HGPHWDOEXFNHWZLWKZKLWH
FLWURQHOODZD[LQVLGH&RPHVZLWKD
FDUU\KDQGOHDQGSODVWLFOLGWRFRYHU
ZKHQQRWLQXVH
Our No.
INSECT KILLER
FOGGERS
‡%8&.(7
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - ROACH/FLEA KILLER
FLEA KILLER
INSECT FOGGER
‡)2**(5
‡)2**(5
‡³(1)25&(5´
‡3257$%/(3523$1(
‡%8*.,//(5
‡³%/$&.)/$*´
7KUHH HDFK RXQFH FDQV 'U\
SHQHWUDWLQJ IRJ LV FOHDQ RGRUOHVV
DQGOHDYHVQRUHVLGXH.LOOVURDFK
HV ÀHDV WLFNV DQWV PRVTXLWRHV
VSLGHUVÀLHVJQDWVOLFHDQGFULFN
HWV (DFK FDQ WUHDWV XS WR FXELF IHHW 1R &)&V
*XDUDQWHHGWRZRUN
Our No.
Size
Ozs.
No.
Shf
Pk
Unit
BENGAL CHEMICAL
7,.6
Our No.
6
No.
Size
Ozs.
Shf
Pk
Unit
12
3.
ENFORCER PRODUCTS
Aerosol
637-4177
Aerosol
675-6134
.LOOV ÀHDV DQG SUHYHQWV UHLQIHV
WDWLRQ IRU PRQWKV :LWK LQVHFW
JURZWK UHJXODWRU 2QH FDQ WUHDWV
VTIHHW
())
2
)DVWHDV\DQGHIIHFWLYHZD\WRHF
RQRPLFDOO\FRQWUROPRVTXLWRHVDQG
RWKHU À\LQJ LQVHFWV 8VH IRU \DUG
GHFNSDWLRDQGSRROHVSHFLDOO\ZKHQSUHSDULQJIRUSLF
QLFV VSHFLDO HYHQWV DQG RXWGRRU HQWHUWDLQLQJ )HDWXUHV
LQFOXGH DQ XQEUHDNDEOH R] FRQWDLQHU WULJJHU ORFN WR
SUHYHQWDFFLGHQWDOGLVSHQVLQJRILQVHFWLFLGHSXVKEXWWRQ
VWDUWHU DQG TW RGRUOHVV LQVHFWLFLGH 8VHV D VWDQGDUG
SURSDQH F\OLQGHU 62/' 6(3$5$7(/< :RUNV XS WR KRXUV)RUEHVWUHVXOWVIRJZKHQZLQGLVPSKRUOHVV
Our No.
‡635$<
‡'5<3523(//$17
'U\ SURSHOODQW SHQHWUDWLQJ YDSRU
ÀXVKHV URDFKHV DQG RWKHU LQVHFWV
RXW RI KLGLQJ WR GLH 2GRUOHVV DQG
QRQVWDLQLQJ .LOOV URDFKHV ÀHDV
WLFNVDQWVPRVTXLWRHVVSLGHUVÀLHVJQDWVDQGFULFNHWV
1R&)&V*XDUDQWHHGWRZRUN&RQWDLQV3HUPHWKULQ
Size
Ozs.
No.
418-2143
‡3/86)2**(5
‡³5$,'´
ROACH KILLER
Shf
Pk
Unit
.LOOVÀHDVSOXVKDWFKLQJHJJV/DVWV
IRU XS WR PRQWKV &RQWDLQV WKH
DFWLYHLQJUHGLHQW3\UHWKULQV
Our No.
No.
Size
Oz
Shf
Pk
5
Unit
6
($
BENGAL CHEMICAL
4XLFNO\ FROODSHV WKH PRVLTXLWR
SRSXODWLRQJLYLQJ\RXKRXUVRIPR
VLTXLWRIUHH HQMR\PHQW (DV\ HI
IHFWLYHDQGSRUWDEOHWKLVPDFKLQH
FDQEHXVHGDOPRVWDQ\ZKHUH)RJ
GLVVLSDWHVTXLFNO\DQGOHDYHVQRUHVLGXH&RPHVZLWKRQH
TXDUWRIÀ\LQJLQVHFWIRJ5HTXLUHVDSURSDQHFDQLVWHU
Aerosol
942-6586
7,.6
16
6
($
Our No.
BUG KILLER
‡)2**(5
.LOOV ÀHDV WLFNV DQWV VSLGHUV
FULFNHWVDQGOLFH.LOOVWLFNVWKDWPD\
FDUU\/\PHGLVHDVH/HDYHVQRXQ
SOHDVDQWRGRU$ZDWHUEDVHGSURG
XFWGHYHORSHGIRUEHWWHUFRQWURORI
ÀHDVÀHDHJJVDQGRWKHUSHVWVWKDWOLYHRQ\RXUFDUSHW
DQGIXUQLWXUH7UHDWVFXELFIHHW$FWLYH,QJUHGLHQW
3HUPHWKULQSHUFHQW%R[FRQWDLQVR]FDQV
Our No.
Size
Oz. Can
No.
Shf
Pk
Unit
6
3.
‡)2**(5
‡,16(&7,&,'(,*5
$ SRZHUIXO FRPELQDWLRQ RI 1\ODU
LQVHFW JURZWK UHJXODWRU 3\UHWKULQ
3HUPHWKULQDQG0*.SURYLGHV
XS WR PRQWKV RI LQVHFW FRQWURO
8VHLQKRPHVDSDUWPHQWVGRUPLWRULHVFRQGRPLQLXPV
DWWLFVEDVHPHQWVNLWFKHQVDQGNHQQHOVWRFRQWUROÀHDV
WLFNV URDFKHV DQWV OLFH EHHWOHV JUDLQ DQG SDQWU\ LQ
VHFWV EHG EXJV DQG EHHV 6LPSO\ VKDNH FDQ DQG ORFN
YDOYHIRUDXWRPDWLFGLVFKDUJH7UHDWVFX)WZDWHU
EDVHGIRUQRVWDLQVDQGHDV\FOHDQXS
No.
Size
Ozs.
Shf
Pk
Unit
12
3.
BONIDE PRODUCTS
041-6289
6
7,.6
554
Size
Ozs.
Shf
Pk
Unit
16
12
($
SPECTRUM GROUP
911-9173
+*
‡(/(&75,&%8*.,//(5
Our No.
No.
Shf
Pk
7,.6
1
($
INSECT FOGGER
‡3523$1(%8*.,//(5
,GHDO IRU EDFN\DUG FDPSLQJ DQG
SLFQLFV (OLPLQDWHV DQQR\LQJ ÀLHV
DQG PRVTXLWRV .HHSV À\LQJ LQ
VHFWVDZD\IURPSLFQLFVDQGEDUEH
FXHV IRU XS WR KRXUV (QMR\ WKH
RXWGRRUVPRUHDURXQGSRROSDWLRDQGGHFN$VHDV\DV
VWUROOLQJWKH\DUG&RPSOHWHO\SRUWDEOH,QFOXGHVTXDUW
(3$UHJLVWHUHGLQVHFWLFLGH
Our No.
No.
Shf
Pk
INSECT KILLER
‡)25/$:16
‡61$3&$575,'*(
‡³61$33$&´
$SSO\DW¿UVWVLJQRILQVHFWGDPDJH
RUDFWLYLW\.LOOVDQWVPROHFULFNHWV
FKLQFK EXJV DQG FXWZRUPV DS
SOLFDWLRQNLOOVLQVHFWVIRUPRQWKV6HOIFRQWDLQHG6QDS
3DF &DUWULGJH FRQQHFWV GLUHFWO\ WR WKH 6QDS DSSOLFDWRU
VSUHDGHUVR\RXUKDQGVQHYHUKDYHWRWRXFKWKHSURG
XFW 6LPSO\ VQDS ORFN DQG JR )RU XVH ZLWK 6QDS 3DF
6SUHDGHU
Our No.
1
No.
Size
Lb
Coverage
Sq Ft
Shf
Pk Unit
SCOTTS COMPANY
682-0856
$
($
Unit
INSECT KILLER
‡62,/$1'785)
*5$18/$5
‡³75,$=,&,'(´
5HSODFHV 6SHFWUDFLGH 'LD]LQRQ
&RQWUROV LQVHFWV LQ KRPH ODZQV
VSRW WUHDWPHQW DQG DV D EDUULHU
WUHDWPHQWDURXQGWKHKRPH.LOOVRYHULQVHFWVLQFOXG
LQJ DSKLGV DQWV GHHU WLFNV ÀHDV JUXEV DQG VRG ZHE
ZRUPV/RQJODVWLQJDQGIDVWDFWLQJZRUNVLQKRXUV
$FWLYH,QJUHGLHQW/DPEGD&\KDORWKULQSHUFHQW
Our No.
No.
Size
Lb
Shf
Pk
Unit
12
($
SPECTRUM GROUP
Canister
988-6177X
BURGESS PRODUCTS
617-4460
($
Unit
BURGESS PRODUCTS
617-4544
DRY
(DV\HIIHFWLYHRXWGRRULQVHFWSHVW
HOLPLQDWLRQDWWKHSXVKRIDEXWWRQ
(QMR\ WKH RXWGRRUV PRUH DURXQG
WKH SRRO SDWLR DQG GHFN .HHSV
À\LQJ LQVHFWV DZD\ IURP SLFQLFV
DQGEDUEHFXHVIRUXSWRKRXUV,QFOXGHVTXDUW(3$
UHJLVWHUHGLQVHFWLFLGH
FLEA KILLER
Our No.
No.
Unit
Bagged Goods
INSECT FOGGER
BENGAL CHEMICAL
627-2256
960-4620
5HSHOV DQG NLOOV PRVTXLWRHV DQG
RWKHUDQQR\LQJLQVHFWVRQFRQWDFW
3HUIHFW IRU EDFN\DUGV GHFNV SD
WLRVDQGSLFQLFDUHDV&RQWDLQV
SHUFHQW7HWUDPHWKULQDQGSHUFHQW3KHQRWKULQ
Our No.
Shf
Pk
No.
BONIDE PRODUCTS
‡%$&.<$5')2**(5
‡³&877(5´
FLEA/TICK KILLER
($
‡0%3523$1(
Box Of 3
41654
Unit
INSECT FOGGER
SC JOHNSON
148-0961
No.
BURGESS PRODUCTS
FLEA KILLER
Our No.
Shf
Pk
3.
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
1
- Maintenance, Repair & Operations
INSECT KILLER
ANT KILLER
ROACH KILLER
‡62,/$1'785)
*5$18/$5
‡³75,$=,&,'(´
‡6+,(/'*5$18/(6
‡³63(&75$&,'(´
‡7$%/(76
5HSODFHV 6SHFWUDFLGH 'LD]LQRQ
&RQWUROV LQVHFWV LQ KRPH ODZQV
VSRW WUHDWPHQW DQG DV D EDUULHU
WUHDWPHQWDURXQGWKHKRPH.LOOVRYHULQVHFWVLQFOXG
LQJ DSKLGV DQWV GHHU WLFNV ÀHDV JUXEV DQG VRG ZHE
ZRUPV/RQJODVWLQJDQGIDVWDFWLQJZRUNVLQKRXUV
$FWLYH,QJUHGLHQW/DPEGD&\KDORWKULQSHUFHQW
Our No.
Size
Lb
No.
Shf
Pk
Unit
SPECTRUM GROUP
Our No.
4
Size
Lb
No.
Shf
Pk
Unit
12
16
Shf
Pk
Unit
12
($
Our No.
FIRE ANT KILLER
Shf
Pk
Unit
SPECTRUM GROUP
Resealable Poly Bag
912-4546X
Unit
1
12
($
6
8VHDQ\ZKHUHDQWVDUHDSUREOHP
.LOOV WKH TXHHQ DQG GHVWUR\V WKH
HQWLUH FRORQ\ (IIHFWLYH DJDLQVW D
YDULHW\RIKRXVHKROGDQWVDQG¿UHDQWV&KLOGUHVLVWDQW
WUDSV
Our No.
($
Shf
Pk
No.
855-2051
ANT KILLER
‡287'22508/7,
385326(
‡³7(552´
Size
Lb
Shf
Pk
Unit
12
($
SENORET CHEMICAL
207-7824
Size
Ozs.
Shf
Pk
Unit
16
12
($
($0%6
12
3.
‡32:'(5
‡³52$&+358)(´
7KH SRZGHU LV DSSOLHG ZLWK D WHD
spoon under kitchen appliances
DQG LQ RWKHU KLGGHQ DUHDV 2GRU
OHVVQRQHYDSRUDWLQJQRQVWDLQLQJ
DQG QRQÀDPPDEOH 7KH HOHFWURVWDWLFDOO\ FKDUJHG SRZ
GHU VWLFNV WR WKH URDFKHV ERG\ DQG LV FDUULHG EDFN LQWR
WKHZDOOVDQGVSUHDGDPRQJWKHRWKHUURDFKHVNLOOVQRW
RQO\WKHURDFKHV\RXVHHEXWDOVRWKRVHKLGLQJDQGPXO
WLSO\LQJLQWKHZDOOV.LOOVURDFKHVDQWVDQGVLOYHU¿VK
Our No.
No.
Size
Lb
Shf
Pk
Unit
12
($
COPPER BRITE INC
610-0135
1
1
SHUFHQW ERULF DFLG IRUPXOD
RGRUOHVV QRQVWDLQLQJ SRZGHU
/RQJ ODVWLQJ SURWHFWLRQ (DV\ WR
XVHDSSOLFDWRU
Our No.
No.
ENFORCER PRODUCTS
915-9831
7,.6
55
ROACH KILLER
‡%25,&$&,'
Our No.
No.
Size
Ozs.
%$
16
Shf
Pk
Unit
12
($
PIC
Bottle
891-6231
ROACH KILLER
ROACH KILLER
For perimeter treatment around
KRPHIRXQGDWLRQ.LOOVRQFRQWDFW
DQG SURYLGHV ORQJ ODVWLQJ LQVHFW
FRQWURO.LOOVDQWVFRFNURDFKHVVSLGHUVÀHDVWLFNVDQG
RWKHULQVHFWV8QLTXHO\GHVLJQHGVKDNHUEDJDOORZV\RX
WR WUHDW WKH SHULPHWHU RI \RXU KRPH ZLWKRXW KDQGOLQJ
WKH SURGXFW 5HVHDODEOH $FWLYH ,QJUHGLHQW 3HUPHWKULQ
SHUFHQW
No.
%;
Unit
ENFORCER PRODUCTS
4 Bait Packs
Our No.
12
6
:LWKVSUD\VSRXW.LOOURDFKHVZD
WHUEXJV DQG SDOPHWWR EXJV 6DIH
IRU XVH LQ KRPHV KRWHOV DSDUW
PHQWVVFKRROVPRELOHKRPHVUHV
WDXUDQWV DQG ZDUHKRXVHV 6SHFLDO
LQJUHGLHQWVWRSUHYHQWKDUGHQLQJLQERWWOH
‡%$,767$7,21
‡&+,/'5(6,67$17
‡³(1)25&(5´
.LOOVTXHHQDQGFRORQ\LQKRXUV
1RRGRU 'HHS UHDFKLQJ IRUPXOD
/LPLWVQHZPRXQGIRUPDWLRQV$S
SO\RYHUDQGDURXQGPRXQG
Size
Lb
Shf
Pk
ANT KILLER
‡*5$18/$5
No.
No.
Size
Lb
SENORET CHEMICAL
713-0453
Our No.
+57
‡%25,&$&,'
‡³52$&+5,''´
(DV\ WR XVH SHULPHWHU WUHDWPHQW
.LOOV RQ FRQWDFW (IIHFWLYH XS WR
PRQWKV /HDYHV QR XQSOHDVDQW
RGRU.LOOVDQWVEHHVFHQWLSHGHVFRFNURDFKHVFULFNHWV
VLOYHU¿VKVOXJVDQGRWKHUUHVLGHQWLDOSHVWV0DLQ$FWLYH
SHUFHQW'HOWDPHWKULQ
P.F. HARRIS MANUFACTURI
+63
Unit
($
‡,1'225287'225
‡'867
‡³7(552´
%RULFDFLGURDFKSRZGHUZLWKOXUH
.LOOV VLOYHU¿VK URDFKHV SDOPHWWR
EXJV DQG ZDWHUEXJV 3XIIHU ERWWOH
SXIIV SRZGHU LQWR KDUG WR UHDFK
SODFHV
099-0846
Shf
Pk
ROACH KILLER
‡32:'(5
Size
Oz
Size
Oz
P.F. HARRIS MANUFACTURI
617-4593
($
SILVERFISH KILLER
No.
No.
Canister
ANT KILLER
Our No.
5RDFK NLOOHU WDEOHWV ZLWK DGGHG
OXUH0DGHZLWKERULFDFLG5RDFKHV
WDNH WKH ERULF DFLG EDFN WR WKH
QHVW .LOOV WKH HQWLUH SRSXODWLRQ
(FRQRPLFDO ER[ FRQWDLQV RYHU WDEOHWV&RQWDLQVSHUFHQWERULFDFLG
Our No.
SPECTRUM GROUP
673-7134
Bag
676-3882
+RPH EDUULHU JUDQXOHV 3UHYHQWV
DQWVIURPLQYDGLQJ\RXUKRPH$OVR
VWRSV VSLGHUV URDFKHV ÀHDV WLFNV
DQG PRUH .LOOV RQ FRQWDFW /RQJ
ODVWLQJ XS WR ZHHN FRQWURO 7UHDWV WKH DYHUDJH KRPH
WZLFH&RQWDLQVSHUFHQW3HUPHWKULQ
‡32:'(5
5RDFKHV FDUU\ WKH ¿QH SRZGHU
EDFN WR WKHLU QHVW .LOOV WKH HQWLUH
LQIHVWDWLRQ (DV\ WR XVH DSSOLFDWRU
VWUDZWRDSSO\SRZGHULQWRKDUGWR
UHDFK DUHDV &RQWDLQV SHUFHQW
%RULFDFLGSRZGHUZLWK³+DUULV6SHFLDO/XUH´
Our No.
No.
Size
Oz
Shf
Pk
Unit
12
($
P.F. HARRIS MANUFACTURI
788-6393
+53
16
ROACH KILLER
‡32:'(5
‡³+276+27´
.LOOV FRFNURDFKHV DQWV VLOYHU¿VK
SDOPHWWR EXJV DQG ZDWHUEXJV
/HDYHVQRRGRU
Our No.
No.
Size
Ozs.
Shf
Pk
Unit
16
12
($
SPECTRUM GROUP
626-8890
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - ROACH KILLER
TERMITE KILLER
ANT KILLER
‡%$,7
‡³0$;$775$;+276+27´
‡67$.(6
‡'(7(&7,21.,//,1*
‡³63(&75$&,'(´
‡%$,7
.LOOV URDFKHV LQ KRXUV ([FOX
VLYHDWWUDFWDQWJHWVURDFKHVWRWKH
EDLWIDVWVRWKH\GLHIDVW.LOOVDOVR
WKHHJJVWKH\FDUU\/DVWVXSWR
PRQWKV&RQWDLQV&KORUS\ULIRV
Our No.
No.
Shf
Pk
Unit
6
%;
SPECTRUM GROUP
673-7100
:
6WDNHV FRQWDLQ EDLW WKDW WHUPLWHV
¿QG DQG WDNH EDFN WR WKH FRORQ\
,QVWDOOV LQ PLQXWHV 3RSXS LQGL
FDWRU DOHUWV KRPHRZQHU LI VWDNHV KDYH EHHQ DWWDFNHG
6WDNHJRHVGHHSLQWRVRLOZKHUHWHUPLWHVIRUDJH'HWHFWV
DQG NLOOV DOO VXEWHUUDQHDQ WHUPLWHV WKDW HDW WKH EDLW
6WDNHVODVWXSWR\HDU&RQWDLQVWKHDFWLYHLQJUHGLHQW
6XOÀXUDPLG
Our No.
No.
Shf
Pk
Unit
6
%;
SPECTRUM GROUP
SLUG/SNAIL
KILLER
‡%$,7
‡³*$5'(16$)(´
&DQ EH XVHG DURXQG SHWV ZLOGOLIH
DQG LQ YHJHWDEOH JDUGHQV 3URYHQ
VOXJDQGVQDLONLOOHU%LRGHJUDGHVLQWRDVRLOFRPSRQHQW
$FWLYHLQJUHGLHQWSHUFHQWLURQSKRVSKDWH
Our No.
Size
Lb
No.
Shf
Pk
Unit
SPECTRUM GROUP
427-1433X
2
6
($
+*
‡67$.(6287'225
‡³63(&75$&,'(´
:RUNVLQKRXUV.LOOVWKHTXHHQ
DQG GHVWUR\V WKH FRORQ\ PRQWK
FRQWURO&KLOGUHVLVWDQWVWDNHV&RQ
WDLQVSHUFHQW,QGR[DFDUE
No.
No.
Shf
Pk
Unit
3/$6%21
12
3.
PIC
891-7437
‡%$,767$7,21
‡+276+27
‡³0$;$775$;´
.LOOVDQWVIDVWLQKRXUV([FOXVLYH
DWWUDFWDQWJHWVDQWVWRWKHEDLWIDVW
VRWKH\GLHIDVW.LOOVDOVRWKHHJJV
WKH\FDUU\/DVWVXSWRPRQWKV&RQWDLQVSHUFHQW
6XOIXUDPLG
ANT KILLER
Our No.
Our No.
ANT KILLER
Box Of 15
865-3438
.LOOVVZHHWDQGJUHDVHHDWLQJDQWV
SDYHPHQW DQWV RGRURXV DQWV DQG
OLWWOHEODFNDQWV(IIHFWLYHDQGHDV\
WRXVH&RQWDLQVSODVWLFFKLOGUH
VLVWDQWDQWEDLWWUD\V
Our No.
No.
Shf
Pk
Unit
12
3.
SPECTRUM GROUP
Boxed
Shf
Pk
Unit
673-7092
($
ANT KILLER
:
SPECTRUM GROUP
Box Of 6
INSECT REPELLENT
723-4628
+*
‡$//1$785$/
‡³6:$03*$725´
3URYLGHV SURWHFWLRQ IRU KRXUV 5H
SHOVPRVTXLWRHVJQDWVÀLHVWLFNV
DQG QRVHHXPV IRU KRXUV 1R
GHHWDOFRKRORUSHVWLFLGHV8QLTXH
GHJUHHVSUD\HUHYHQVSUD\VXSVLGHGRZQ3OHDVDQW
VFHQW)DPLO\VDIHDQGFDQEHXVHGDURXQGSHWV
Our No.
Size
Oz
No.
Shf
Pk
Unit
12
($
P.F. HARRIS MANUFACTURI
076-5677
6
+6*
‡%$,767$7,21
‡,1'225287'225
‡³$17%*21´
ANT KILLER
‡/,48,'
‡³&20%$7´
.LOOV VZHHW DQG SURWHLQ IHHGLQJ
DQWV $OVR NLOOV URDFKHV 1R PHVV
)RU LQGRRU DQG RXWGRRU XVH %R[
FRQWDLQV SUH¿OOHG EDLW VWDWLRQV
$FWLYH ,QJUHGLHQW 'LVRGLXP RFWDERUDWH WHWUDK\GUDWH SHUFHQW
Our No.
No.
Shf
Pk
Unit
12
($
DIAL CORPORATION
Bagged Goods
200-8993X
INSECT TRAPS/BAIT
‡123(67675,3
‡³+276+27´
ANT KILLER
.LOOV À\LQJ DQG FUDZOLQJ EXJV ZLWK
DQ RGRUOHVV YDSRU (QFORVHG KRRN
to hang unit up or simply stand unit
XSRQDVXUIDFHIRUXSWRPRQWK
SURWHFWLRQ DJDLQVW LQVHFWV 8VH LQ FORVHWV EDVHPHQWV
JDUDJHVVWRUDJHDUHDVXWLOLW\DUHDVDWWLFVVWRUHGERDWV
VWRUHG59¶VDQGRWKHUQRQOLYLQJVSDFHV
1HZ LPSURYHG IRUPXOD NLOOV WKH
TXHHQ DQG WKH FRORQ\ .LOOV 3KD
UDRK$UJHQWLQH&RUQ¿HOGDQG&DU
SHQWHU DQWV &RQWDLQV IRXU FKLOG
UHVLVWDQWEDLWVWDWLRQV
No.
Shf
Pk
Unit
SPECTRUM GROUP
640-5757
‡%$,767$7,21
‡³5$,'´
Our No.
No.
($
696-0231
No.
Shf
Pk
Unit
24
3.
SCOTTS COMPANY
293-1178
ANT KILLER
‡%$,7
Our No.
No.
Shf
Pk
Unit
SENORET CHEMICAL
822-0964
Shf
Pk
Unit
12
3.
SC JOHNSON
12
Our No.
$OO QDWXUDO 205, &HUWL¿HG DQW
EDLW :HDWKHU UHVLVWDQW &KLOGUHQ
DQGSHWVPD\UHHQWHUWKHWUHDWHG
DUHD LPPHGLDWHO\ DIWHU WUHDWPHQW
$OVRHIIHFWLYHRQFULFNHWVURDFKHV
VQDLOVDQGVOXJV
INSECT KILLER
Our No.
.LOOVHQWLUHFRORQ\%DLWNLOOVJUHDVH
HDWLQJ DQG VZHHW HDWLQJ DQWV $F
WLYH,QJUHGLHQWSHUFHQW0HWK
\OHQWKR[\SKHQ\OPHWK\OFDUEDPDWH
6
($
ROACH KILLER
‡%$,7
‡+,'($:$<67$7,21
‡³&20%$7´
.LOOV URDFKHV DW WKHLU VRXUFH .LOOV
ODUJH DQG VPDOO URDFKHV 1HZ GH
VLJQ¿WVEHKLQGDSSOLDQFHVDQGXQ
GHUFDELQHWV&RQWDLQVEDLWVWDWLRQV
Our No.
No.
Shf
Pk
Unit
12
($
DIAL CORPORATION
279-7298X
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
ROACH KILLER
BUG/SLUG KILLER
‡%$,767$7,21
Our No.
No.
Shf
Pk
Unit
5&6
12
3.
PIC
681-8652
JAPANESE BEETLE
KILLER
‡3(//(76
5RDFKHVJRLQWRHDWDQGFRPHRXW
WRGLH&RQYHQLHQWFOHDQDQGKLJK
O\ HIIHFWLYH IRUPXODWLRQ &RQWDLQV
SODVWLFEDLWWUD\V
)RUYHJHWDEOHIUXLWDQGEHUU\JDU
GHQV .LOOV FXWZRUPV DQWV HDU
ZLJV VOXJV VQDLOV VRZEXJV SLOO
EXJV FULFNHWV DQG RWKHU FRPPRQ
JDUGHQSHVWV(DV\WRXVH/XUHVSHVWVIURPSODQWVDQG
KLGLQJSODFHV/DVWVXSWRZHHNV7UHDWVVTXDUH
IW
Our No.
No.
Size
Lb
Shf
Pk
Unit
12
($
BONIDE PRODUCTS
905-3943
ROACH KILLER
‡%$,78/75$/,48,'
‡³+276+27´
.LOOVURDFKHVZKHUHWKH\EUHHG$W
WUDFWVIDVWDQGNLOOVIDVWLQDVOLWWOH
DVKRXUV1RVSLOOVDQGQRPHVV
WR FOHDQ XS (DFK VWDWLRQ FRQWDLQV
ERWKIRRGDQGZDWHU)RULQGRRUXVHRQO\&DUWRQFRQWDLQV
EDLWVWDWLRQV&RQWDLQVWKHDFWLYHLQJUHGLHQWGLQRWHIX
UDQ
Our No.
Shf
Pk
No.
Unit
SPECTRUM GROUP
,PPHGLDWHO\VWRSVVOXJVDQGVQDLOV
IURP HDWLQJ +LJKO\ DWWUDFWLYH EDLW
LQWHUIHUHV ZLWK VOXJ DQG VQDLO¶V
GLJHVWLYH SURFHVV DQG NLOOV WKHP
ZLWKLQGD\V6DIHWRXVHDURXQG
NLGVSHWVZLOGOLIHDQGHGLEOHFURSV7UHDWVXSWR
VTIW
6
+*
3.
No.
(DV\WRXVH'LVSRVDEOH%DJVKROG
PRUH EHHWOHV &RQWDLQV %DJV
%H VXUH WR UHSODFH WKH WUDS EDLW ZKHQ FDWFK VWDUWV WR
GLPLQLVK
Our No.
Shf
Pk
No.
Size
Lb
Shf
Pk
Unit
12 Packs of 2 Bags
796-4588X
,6
24
($
‡*/8(
‡³7(552´
7UDSV DQG NLOOV EODFN ZLGRZV
EURZQ UHFOXVH VFRUSLRQV DQWV
FRFNURDFKHVFULFNHWVDQGRWKHUXQ
ZDQWHG LQVHFWV 7UDS FDQ EH XVHG
ÀDWRUIROGHG3UHEDLWHGDQGPRLVWXUHUHVLVWDQW
Our No.
No.
Shf
Pk
Unit
16
3.
SENORET CHEMICAL
WOODSTREAM
Pack Of 4
Cannister
396-5878
Unit
WOODSTREAM
SPIDER/INSECT TRAPS
‡³'57¶6
Our No.
Carton
552-8211
SLUG/SNAIL KILLER
‡5(3/$&(0(17%$*
‡³6$)(5´
'7
1
6
($
784-1356
ROACH KILLER
‡%$,7
‡³&20%$7´
Our No.
Shf
Pk
No.
6
Unit
($
6HWV WUDS DW W\SLFDO EHHWOH ÀLJKW
KHLJKW IRU FDSWXULQJ WKH PRVW LQ
VHFWV $VVHPEOHV LQ VHFRQGV +HOSV FRQWURO -DSDQHVH
EHHWOHVZLWKRXWWKHXVHRIKDUPIXOFKHPLFDOV&RQVWUXFW
HG RI ORQJ ODVWLQJ JDOYDQL]HG VWHHO WR KHOS \RX SURWHFW
\RXU RUQDPHQWDO SODQWV WUHHV DQG VKUXEV VHDVRQ DIWHU
VHDVRQ
FLEA KILLER
Our No.
‡75$3,1'225
‡³9,&7257+(8/7,0$7(´
SPECTRUM GROUP
189-0961
'HWHFWV DQG FRQWUROV LQGRRU ÀHD
SUREOHPV 1R SRLVRQV 8QLTXH
GRPHGHVLJQDWWUDFWVÀHDVIURPDOO
GLUHFWLRQV ³6XSHU *UDEEHU´ JOXH
KROGVWKHPIDVW/XUHVÀHDVIURP¶DZD\(OHFWULFDOGH
YLFHHPLWWLQJDJHQWOHKHDWWKDWDWWUDFWVÀHDV
Our No.
Shf
Pk
No.
Unit
WOODSTREAM
678-5034
6
0
‡75$35(),//',6&6
‡³9,&7257+(8/7,0$7(´
)RU 0 ÀHD WUDS 'HWHFWV DQG
FRQWUROV LQGRRU ÀHD SUREOHPV 1R
SRLVRQV 8QLTXH GRPH GHVLJQ DW
WUDFWVÀHDVIURPDOOGLUHFWLRQV³6X
SHU*UDEEHU´JOXHKROGVWKHPIDVW
No.
No.
7,.6
Shf
Pk
Unit
24
($
5HDG\WRXVH1RQSRLVRQRXVDQG
GLVSRVDEOH 3UHEDLWHG ZLWK LQVHFW
DWWUDFWDQW )RU FUDZOLQJ KRSSLQJ
MXPSLQJ DQG VOLWKHULQJ SHVWV 'H
VLJQHGVSHFL¿FDOO\IRUFDWFKLQJVSLGHUVLQFOXGLQJSRLVRQ
RXV VSLGHUV VXFK DV WKH +RER VSLGHU DQG DOO VSHFLHV RI
FULFNHWV0DGHZLWKIDPRXV67,&.(0JOXH/DUJH´
[´WUDSVWUDSVSHUSDFNDJH
Our No.
‡75$3
‡³6$)(5´
No.
Shf
Pk
Unit
12
($
Our No.
3.
3.
7,.6
No.
Shf
Pk
Unit
16
3.
Box Of 2
093-8423
2 Pack
399-2716
24
12
SENORET CHEMICAL
Package
0
.HHSV JUDLQ ORYLQJ SHVW RXW RI
WKH SDQWU\ 1RQWR[LF DQG SHVWL
FLGHIUHH7UDSVJUDLQPRWKVÀRXU
PRWKV PHDO PRWKV VHHG PRWKV
DQGWKHLUODUYDH
WOODSTREAM
678-5018
Unit
‡³7(552´
JAPANESE BEETLE
KILLER
WOODSTREAM
Unit
Shf
Pk
PANTRY MOTH TRAPS
Our No.
Shf
Pk
No.
J.T. EATON & CO., INC.
360-6837
8VHV SDWHQWHG %LROXUH FRQWUROOHG
release pheromone system to
OXUH LQVHFWV LQWR WKH WUDS DQG GLVUXSW WKH PDWLQJ F\FOH
&RQWUROOHG UHOHDVH V\VWHP PD[LPL]HV WKH XVHIXO OLIH RI
WKH SKHURPRQH DQG SURWHFWV WKH SKHURPRQH IURP WKH
HQYLURQPHQW5HDG\WRXVHLQFOXGHVWUDSMXPEREDJV
DQGEDLW%DLWFRQWDLQV-DSDQHVHEHHWOHVH[SKHURPRQH
&ROODSVLEOH´JDOYDQL]HGVWHHOVWDQGKDQJVWUDSDWLGHDO
KHLJKW
($
FLEA KILLER
Our No.
‡³3(67&$7&+(56´
‡75$3
‡%$*$%8*
‡³63(&75$&,'(´
DIAL CORPORATION
696-0462
SPIDER/CRICKET GLUE
TRAPS
JAPANESE BEETLE
KILLER
(DV\WRXVHEDLWGLVNVZLWKQRYD
SRUIXPHVRURGRU7ZHOYHPRQWKV
VXSSO\ZLWKQRPHVVRGRURUFRQ
WDPLQDWLRQZRUU\
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - YELLOW JACKET/WASP
TRAPS
‡%$*
(DV\ WR XVH 6LPSO\ HPSW\ WKH
FRQWHQWV RI WKH OXUH SRXFK LQWR
WKH EDJ DGG ZDWHU WR WKH ¿OO OLQH
DQG KDQJ WKH WUDS IURP D WUHH RU
VWDQGLWRQDVXUIDFHDZD\IURPWKHKRXVHRUSDWLRWR
DYRLGDWWUDFWLQJZDVSVWRRFFXSLHGDUHDV8VHV3KHUR
PRQHWHFKQRORJ\3HVWLFLGHIUHH$WWUDFWVQHDUE\ZDVSV
DQG \HOORZ MDFNHWV DQG FDSWXUHV WKHP ZLWKLQ WKH EDJ
:RUNVLPPHGLDWHO\&DWFKHVWKHTXHHQLQVSULQJEHIRUH
WKH\EXLOGQHVWV&DWFKHVIRUDJLQJZRUNHUVIURPVXPPHU
WRIDOO:LOOQRWFDWFKEHQH¿FLDOKRQH\EHHV
Our No.
No.
Our No.
No.
Shf
Pk
Unit
12
($
WOODSTREAM
663-8696
0
($
‡%$*:,7+%$,7
‡',6326$%/(
‡³<(//2:-$&.(70$*1(7´
Our No.
Shf
Pk
No.
Unit
WOODSTREAM
Unit
6
:753
929-8092
0
6
Size
Lb
Shf
Pk
Unit
FARNAM COMPANIES
001-2898
1
24
($
052-1617
5
6
($
‡)/<0$*1(7
‡³9,&725´
%DLWFDQEHXVHGZLWKDOORWKHUWUDSV
DQGLVQRQWR[LF7UDS¶V³GLDPRQG´
OLGGHVLJQDWWUDFWVPRUHÀLHV
Our No.
No.
Size
Shf
Pk
Unit
12
&'
WOODSTREAM
REFILLS
601-2835
0
12 Grams
($
FLY BAIT
($
‡$775$&7$17
‡78%(5(),//
‡³7(50,1$725´
YELLOW JACKET
TRAPS
YELLOW JACKET/WASP
TRAPS
‡)/<,1*,16(&76
‡³9,&725´
‡',6326$%/(
&DWFKHV PXOWLSOH VSHFLHV RI \HOORZ
MDFNHWV DQG ZDVSV (FR VHQVLWLYH
GHVLJQEOHQGVZLWKQDWXUDOHQYLURQ
PHQW (DV\ WR XVH ,QFOXGHV IRRG
EDVHGOXUH)HDWXUHVVODWVZKLFKZLOOOHWWKHOLJKWLQEXW
ZLOODOVRDOORZWKHDWWUDFWDQWWRÀRZRXWWKHUHE\DWWUDFW
LQJPRUHLQVHFWV&RQWDLQVWUDSV
Our No.
No.
Hang Tag
Shf
Pk
PIC
680-5543
Our No.
FLY BAIT
(DV\WRXVH-XVWDGGZDUPZDWHU
WR WKH EDJ DQG KDQJ LQ D WUHH RU
RWKHUVXLWDEOHORFDWLRQ+DQJHUIRU
WKHEDJLVLQFOXGHG1RSRLVRQVQRPHVV<HOORZMDFNHW
PDQJHWWUDSDWWUDFWDQWLVLQFOXGHGZLWKEDJ6DIHIRUWKH
HQYLURQPHQWFKLOGUHQDQGSHWV(DV\GLVSRVDOOLGVQDSV
WLJKWIRUDOHDNIUHHDQGFOHDQGLVSRVDO
6L[ HQWU\ WXQQHOV DWWUDFW IURP DOO
GLUHFWLRQV 6SHFLDO GHVLJQ OXUHV
LQVHFWV RQFH LQQHYHU RXW :RUNV
DOOGD\HYHU\GD\1RFKHPLFDOVQR
SRLVRQV'XUDEOHXVHLWDJDLQDQG
DJDLQ
No.
%DLW LQFOXGHG ,QGRRU2XWGRRU
(DV\ WR XVH 1R SRLVRQLQJ GLVSRV
DEOH
YELLOW JACKET TRAPS
$WWUDFWV DQG NLOOV ÀLHV 6WDQGDUG
SDUWLFOH VL]H WR UHGXFH GXVW &RQ
WDLQVPXVFDPRQH&DQEHXVHGDV
DVFDWWHUEDLWRULQEDLWVWDWLRQV
‡³9,&725´
Unit
YELLOW JACKET/WASP
TRAPS
Our No.
‡)/<$775$&7$17
Shf
Pk
TANGLEFOOT COMPANY
615-8877
FLY BAIT
YELLOW JACKET
TRAPS
No.
Shf
Pk
Unit
3:753
12
($
&RQWUROV ÀLHV DQG \HOORZ MDFNHWV
outside and annoying insects in
GRRUV DQG RXWGRRUV %RWWOH¶V VOHHYH FRQFHDOV FDSWXUHG
LQVHFWVDQGFRQWDLQVEDLWLQJVXJJHVWLRQV6LWVRUFDQEH
KXQJDQGXVHVQDWXUDOIRRGSURGXFWDVEDLW
Our No.
No.
Shf
Pk
Unit
12
($
WOODSTREAM
670-0215
0
)RU RXWGRRU XVH ,QVHFWLFLGH IUHH
$WWUDFWV KRXVH ÀLHV ÀHVK ÀLHV
EORZ ÀLHV EOXH DQG JUHHQ ERWWOH
ÀLHVH\HJQDWVGXQJÀLHVDQGPRUH)RUXVHZLWK)DU
QDP0LON-XJJ7UDS&DSWLYDWRU)O\7HUPLQDWRU0DJQXP
)O\7UDSDQGRWKHUERWWOHVÀ\WUDSV&RQWDLQVWZRPO
WXEHV
Our No.
No.
Shf
Pk
Unit
12
3.
FARNAM COMPANIES
083-9001
PIC
681-8645
FLY TRAPS
YELLOW JACKET
BAIT
YELLOW JACKET/WASP
TRAPS
‡/,48,'
‡³9,&725´
‡³6$)(5´
&RQWDLQV FDUERK\GUDWHV DQG SUR
WHLQXVHGWRDWWUDFW\HOORZMDFNHWV
ZDVSV DQG KRUQHWV (IIHFWLYH LQ DOO JHRJUDSKLF UHJLRQV
8VH ZLWK 1R0 6.8 DQG 1R0 6.8
\HOORZ-DFNHW7UDSV
3HVWLFLGHIUHH$WWUDFWV\HOORZMDFN
HWVDQGZDVSVWRWKHWUDSXOWLPDWH
O\WUDSSLQJWKHP3DFNRI
Our No.
No.
Size
Oz
Shf
Pk
Unit
24
&'
WOODSTREAM
428-6522
‡-80%2
‡³)/<67,&.´
Our No.
No.
Shf
Pk
Unit
12
3.
3UHEDLWHG QR YDSRUV DQG FRQ
WDLQV QR FKHPLFDOV *OXH ODVWV IRU
PRQWKV (IIHFWLYHO\ DWWUDFWV DQG
WUDSV ÀLHV PRVTXLWRHV PRWKV JQDWV DQG RWKHU À\LQJ
LQVHFWV
Our No.
0
Shf
Pk
Unit
)67,.
12
&'
PIC
651-3261
WOODSTREAM
609-6093
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
- Maintenance, Repair & Operations
FLY TRAPS
FLY TRAPS
%ULJKW\HOORZFRORUDQGSDQHODQJOH
DWWUDFWDQGWUDSÀLHVDQGRWKHUÀ\
LQJ LQVHFWV VXFK DV DSKLGV ZKLWHÀLHV OHDIKRSSHUV DQG
PRUH1RKDUPIXOFKHPLFDOVLQVHFWLFLGHIUHHRGRUIUHH
/RQJODVWLQJUDLQSURRIDGKHVLYH+DQJVWDQGRUVWDFNRQ
JDUGHQVWDNH&RPSDFWGHVLJQIRUNHQQHOV
Our No.
No.
&DWFKHV PXOWLSOH VSHFLHV RI \HOORZ
MDFNHWV DQG ZDVSV (FR VHQVLWLYH
GHVLJQEOHQGVZLWKQDWXUDOHQYLURQ
PHQW (DV\ WR XVH ,QFOXGHV IRRG
EDVHG OXUH )HDWXUHV VODWV ZKLFK
ZLOOOHWWKHOLJKWLQEXWZLOODOVRDOORZWKHDWWUDFWDQWWR
ÀRZ RXW WKHUHE\ DWWUDFWLQJ PRUH LQVHFWV &RQWDLQV WUDSV
Our No.
Shf
Pk
Unit
12
3.
FARNAM COMPANIES
557-0213
FLY TRAPS
‡',6326$%/(
‡,1'225287'225
‡,16(&7,&,'()5((
‡³(=75$3´
No.
Shf
Pk
Unit
PIC
891-7411
12
3)7
‡&$7&+(55,%%216
7UDSVÀ\LQJLQVHFWV6DIHHIIHFWLYH
QR SROOXWLRQ QR IXPHVRGRU 1R
FKHPLFDOV
Our No.
No.
Shf
Pk
Unit
3.
PIC
Bulk Pak
430-2998X
)5
($
FLY TRAPS
‡&$7&+(5
‡%$51$1'67$%/(
‡³$(52;21´
FLY TRAPS
‡%$*:,7+%$,7
‡',6326$%/(
‡³)/<0$*1(7´
FLY TRAPS
‡)/<0$*1(7
‡:,7+%$,7
‡³9,&725´
$WWUDFWV DQG WUDSV ÀLHV ,GHDO IRU
UHGXFLQJ DGXOW À\ SRSXODWLRQ %DLW
LVLQFOXGHGZLWKHDFKWUDS3DWHQWHGQRQSRLVRQXVEDLW
,QWHQGHGIRUXVHRXWGRRUV4XDUWVL]HSODVWLFMDUZLWKOLG
Our No.
No.
Shf
Pk
Size
Unit
WOODSTREAM
663-8704
0
Quart
12
$WWUDFWV KRXVH EDUQ DQG ERWWOH
ÀLHV (DV\ WR XVH -XVW DGG ZDUP
ZDWHU WR WKH EDJ DQG KDQJ LQ D
WUHHRURWKHUVXLWDEOHORFDWLRQ+DQJHUIRUWKHEDJLVLQ
FOXGHG1RSRLVRQVQRPHVV)O\PDQJHWWUDSDWWUDFWDQW
LVLQFOXGHGZLWKEDJ6DIHIRUWKHHQYLURQPHQWFKLOGUHQ
DQG SHWV (DV\ GLVSRVDO OLG VQDSV WLJKW IRU D OHDN IUHH
GLVSRVDO
Our No.
($
Shf
Pk
No.
/DUJH WUDSSLQJ DUHD RI XS WR VTXDUH IHHW SHUFHQW QDWXUDO
JOXH WKDW¶V YHU\ VWLFN\ DQG ORQJ
ODVWLQJ 3URYHQ HFRIULHQGO\ ZD\ WR KDQGOH ÀLHV 2GRU
OHVV LQVHFWLFLGHIUHH DQG QRQWR[LF $OVR ZRUNV LQ NHQ
QHOV+DQJLQJFRUGLQFOXGHG
Our No.
No.
Shf
Pk
Unit
3.
TANGLEFOOT COMPANY
Pack of 2
Unit
261-1960
6
WOODSTREAM
Hang Tag
885-9696
6
0
($
FLY TRAPS
FLY TRAPS
‡6+(/)',63/$<6
‡,1'225
‡³9,&725´
‡)/<0$*1(7
‡:,7+%$,7
‡³9,&725´
FLY TRAPS
$WWUDFWV DQG WUDSV ÀLHV ,GHDO IRU
UHGXFLQJ DGXOW À\ SRSXODWLRQ %DLW
LVLQFOXGHGZLWKHDFKWUDS3DWHQWHGQRQSRLVRQXVEDLW
,QWHQGHGIRUXVHRXWGRRUV*DOORQVL]HSODVWLFMDUZLWKOLG
,QVHFWLFLGH IUHH 5HXVDEOH $WWUDF
WDQW GUDZV ÀLHV WR WKH FDSWLYDWRU
)RURXWGRRUXVH
Our No.
No.
‡&$37,9$725
Shf
Pk
Capacity
601-8543
0
Our No.
Unit
Our No.
WOODSTREAM
Gallon
4
3UHEDLWHG7KHQRQSRLVRQRXVZD\
WRJHWULGRIÀLHVZLWKRXWGDQJHUWR
FKLOGUHQSHWVDQGWKHHQYLURQPHQW
No.
No.
Shf
Pk
Unit
12
($
WOODSTREAM
Shf
Pk
Unit
12
($
678-4995
0
FARNAM COMPANIES
($
863-2986
FLY RIBBON
FLY TRAPS
‡',6326$%/(:,7+%$,7
‡³9,&725´
‡)25:,1'2:6
‡³$(52;21´
$WWUDFWVDQGWUDSVÀLHV,GHDOIRUUH
GXFLQJDGXOWÀ\SRSXODWLRQ%DLWLV
LQFOXGHG ZLWK HDFK WUDS 3DWHQWHG
QRQSRLVRQXVEDLW,QWHQGHGIRUXVHRXWGRRUV3LQWVL]H
SODVWLFMDUZLWKOLG
Our No.
No.
Shf
Pk
Unit
12
($
WOODSTREAM
663-8688X
0
‡',6326$%/(
FLY TRAPS
$GKHUHV WR ZLQGRZSDQH $WWUDFWV
ÀLHV WR LWV LQVHFWLFLGH (3$ DS
SURYHG FRQWDLQV ,PLGDFORSULG 1R
UHOHDVHRIIXPHVRUYDSRULQWKHDLU
)OLHV GR QRW VWLFN WR WKH VXUIDFH DIWHU LQJHVWLQJ LQVHFWL
FLGH8QLTXHGHVLJQZRUNVHIIHFWLYHO\DQGRGRUOHVVO\,Q
GRRUXVHRQO\,GHDOLQNLWFKHQOLYLQJDUHDVDQGJDUDJH
1RUHVLGXHQHDWDQGHDV\WRUHPRYH
Our No.
Shf
Pk
No.
Unit
TANGLEFOOT COMPANY
Our No.
No.
Shf
Pk
Unit
)5%
12
3.
PIC
430-3004X
FRUIT FLY TRAPS
‡12172;,&
‡5($'<7286(
Pack of 2
741-9088
(IIHFWLYHO\UHPRYHVSHVN\À\LQJLQ
VHFWVOLNHÀLHVEHHVZDVSVPRWKV
DQGJQDWV1RSROOXWLRQQRIXPHV
RU FKHPLFDO RGRU &RQWDLQV ULE
ERQV
3.
)DVW DFWLQJ 3UHYHQWV ÀLHV IURP
EUHHGLQJ DQG PXOWLSO\LQJ 6DIH WR
XVHLQWKHNLWFKHQDURXQGIRRG)RU
XVH LQGRRUV RU RXWGRRUV $OO QDWX
UDO7UDSVÀ\ZKHUHWKH\FDQQRWJHWRXW
Our No.
No.
Shf
Pk
Unit
12
($
SENORET CHEMICAL
291-8944
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
Maintenance, Repair & Operations - 211
MOSQUITO MAGNET
TRAPS
MOSQUITO
REPLACEMENT NET
‡³3$75,27´
‡/,%(57<
‡³5,*,'%8*%$*´
7UDS FRYHUV XS WR DFUH (DV\
VWHSDVVHPEO\
Our No.
No.
00
‡*/8(%2$5'
‡35(%$,7('
‡³67,&.(0´
5HSODFHPHQW QHW IRU 0RVTXLWR
0DJQHWWUDSV
Shf
Pk
Unit
WOODSTREAM
866-1126
RAT/MOUSE TRAPS
Our No.
Shf
Pk
No.
Unit
WOODSTREAM
1
Our No.
Pack Of 3
($
218-3697
5DW DQG PRXVH JOXH WUDS 3UH
EDLWHG DQG VFHQWHG SURIHVVLRQDO
VWUHQJWKJOXHWUD\V0DGHZLWKUH
F\FOHGSODVWLF
No.
6
SWATTERS
)RUODUJHU\DUGVXSWRDFUH5XQV
RQ³&´EDWWHULHVWKDWODVWDOOVHD
son long so no external electrical
SRZHU LV QHHGHG &RQYHQLHQW IHDWXUH DOORZV SODFHPHQW
RIWKHXQLWDZD\IURPWKHIDPLO\DUHD\HWVWLOOQHDUWKH
PRVTXLWRHV¶EUHHGLQJDQGUHVWLQJDUHDV
Shf
Pk
Unit
WOODSTREAM
007-2090
00
1
(DV\WRUHDG/&'SDQHORQWKHIURQW
RI WKH XQLW RIIHUV HQKDQFHG GLDJ
QRVWLFVDQGGLIIHUHQWXVHUIULHQGO\
VHWWLQJ RSWLRQV ,QFOXGLQJ IXHO
VDYLQJPRGHVWKDWH[WHQGWKHOLIHRI\RXUSURSDQHWDQN
³/HDUQV´WRGLIIHUHQWLDWHGD\VDQGQLJKWVDQGIHDWXUHVD
WHPSLQGLFDWRUWKDWZLOODXWRPDWLFDOO\VWDUWXSRUSRZHU
GRZQWKHWUDSZKHQWKHWHPSHUDWXUHUHDGLQJLVDERYH
GHJUHHV&RYHUVXSWRDFUH
Shf
Pk
‡*/8(75$<
‡³9,&725´
3ODVWLF EODGH WZLVWHG ZLUH KDQGOH
,QDVVRUWHGFRORUV
Our No.
607-8224
‡³(;(&87,9(´
No.
No.
7UD\GHVLJQDQGJOXHVXUIDFHFDWFK
HV PLFH DQG UDWV DQG KROGV WKHP
VHFXUHO\ 3UHEDLWHG DQG UHDG\ WR
XVH1RSRLVRQV
Shf
Pk
Unit
12
($
Our No.
No.
RAT/MOUSE TRAPS
‡3/$67,&
‡³5$0,.´
O.A.
Lgth. In.
5
Shf
Pk
24
00
Unit
Our No.
No.
1
($
785-8442X
6FUHHQ FORWK EODGH VL]H ´ [
´ 5XVW UHVLVWDQW JDOYDQL]HG
ZLUHKDQGOH
Our No.
116221
3.
Shf
Pk
6
No.
823-5772X
5
Unit
O.A.
Lgth. In.
Shf
Pk
Unit
22
24
($
Bagged Goods
6
($
‡*/8(75$<6
‡352)(66,21$/675(1*7+
‡³5$0,.´
3UHEDLWHG WUDS IRU UDWV PLFH DQG
VQDNHV 5HDG\ WR XVH 1R VSULQJV
RU VQDSV 1RQ WR[LF 6DIH IRU XVH
DURXQG FKLOGUHQ DQG SHWV 'LVSRVDEOH 8QLTXH VFHQWHG
IRUPXODDWWUDFWVURGHQWV&RQWDLQVJOXHWUDSV
Our No.
MOUSE/RAT TRAPS
($
785-8418X
‡*/8(%2$5'
‡³'28%/(-(23$5'<´
*OXH ERDUG FRQWDLQV VFHQW WKDW
DWWUDFWV PLFH URDFKHG DQG DQWV
&RQWDLQVWUDSV
No.
Shf
Pk
Unit
72
($
J.T. EATON & CO., INC.
426-8991X
%
No.
Shf
Pk
Unit
12
3.
NEOGEN
MOUSE/ROACH/ANT
TRAPS
Our No.
RAT TRAPS
WILLERT HOME PRODUCTS
WOODSTREAM
00
12
MOUSE
785-8434X
FLY SWATTERS
($
8VH WR UHFKDUJH \RXU 0RVTXLWR
0DJQHW¶V EDWWHU\ SDFN %ULQJ EDW
WHU\ LQVLGH DQG FKDUJH DZD\ IURP
WUDS8VHZLWK/LEHUW\3OXVDQG([HFXWLYHWUDSPRGHOV
932-0706
Unit
RAT
‡%$77(5<3$&.
‡5(&+$5*($%/(
No.
Shf
Pk
NEOGEN
Unit
MOSQUITO MAGNET
CHARGER
Our No.
3.
'XUDEOHSODVWLFWUDSZLWKKLJKWHQ
VLRQVSULQJDQGEDLWUHVHUYRLU(DV\
WRVHW1RSRLVRQ5HXVDEOH
WILLERT HOME PRODUCTS
823-6036X
12
0
3ODVWLFEODGH´[´5XVW
UHVLVWDQW JDOYDQL]HG ZLUH KDQGOH
$VVRUWHGFRORUVRUDQJHJUHHQSLQN
DQGSXUSOH
No.
Unit
Boxed
677-9714
FLY SWATTERS
Our No.
Shf
Pk
WOODSTREAM
WOODSTREAM
853-4976
($
RAT/MOUSE TRAPS
FLY SWATTERS
BIRDWELL CLEANING
($
MOSQUITO MAGNET
TRAPS
Our No.
1
Bagged Goods
‡&25'/(66
‡³,1'(3(1'(1&(´
No.
12
2 Pack
($
405-6149X
Our No.
Unit
J.T. EATON & CO., INC.
001(7
MOSQUITO MAGNET
TRAPS
Shf
Pk
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
212 - Maintenance, Repair & Operations
RAT TRAPS
RAT TRAPS
MOUSE TRAPS
‡³9,&725´
‡($6<726(761$375$3
‡³-$:=´
‡*/8(%2$5'
‡³5$0,.´
6HW ZLWK \RXU IRRW RU \RXU KDQG
5HXVDEOH 1HYHU JHW \RXU KDQG
VQDSSHGLQDWUDSDJDLQ0DGHIURP
UHF\FOHGSODVWLF
7UDSVPLFHDQGDYDULHW\RIKRXVH
KROG FUDZOLQJ LQVHFWV 6SHFLDO
VFHQWHG IRUPXOD (DV\ WR XVH DQG
GLVSRVDEOH 1RQ WR[LF &KLOG DQG
SHWVDIH3DFNFRQWDLQVJOXHERDUGV
3RZHUIXO UDW WUDSV QR 1RUZD\ RU
DQ\ RWKHU NLQG RI UDW FDQ HVFDSH
6WXUG\PHWDOSHGDOEDLW
Our No.
Shf
Pk
No.
Unit
WOODSTREAM
No.
Shf
Pk
Unit
12
($
J.T. EATON & CO., INC.
Bulk Pack Shelf Display
026-6437X
Our No.
0
12
968-2121X
($
Our No.
No.
Shf
Pk
Unit
($
NEOGEN
703-2766X
Polybagged Shelf Display
670-0207X
0
12
($
RAT TRAPS
RAT TRAPS
‡³9,&725´
No.
Shf
Pk
‡*/8(
‡1232,6216
‡³9,&725´
WRXFK VHW ZLWK 6HFXUH FDWFK GH
VLJQ &RQWDLQV UDW WUDS &RQYH
QLHQWJUDEWDEIRUHDV\GLVSRVDO
(DV\ WR VHW MXVW SXOO EDFN DQG
FOLFN 7KH ODUJH SHGDO LV LGHDO IRU
UXQZD\ WUDSSLQJ 4XLFN KXPDQH
NLOOLQJWUDSLVKLJKO\HIIHFWLYH(DV\
WRFOHDQ
Our No.
MOUSE TRAPS
‡6(&85(.,//
‡+20('()(16(0$;
‡³257+2´
Our No.
No.
Shf
Pk
Unit
($
SCOTTS COMPANY
Unit
646-5348X
WOODSTREAM
703-0026X
0
6
($
No.
Shf
Pk
Our No.
Unit
J.T. EATON & CO., INC.
157-3161X
12
Shf
Pk
Unit
WOODSTREAM
0
6
&'
‡*/8(75$<
‡³9,&725´
+LJK YROWDJH VKRFN NLOOV UDWV DQG
PLFHLQVHFRQGV(DV\WRXVHEDLW
SODFH DJDLQVW D ZDOO DQG WXUQ RQ
$XWRUHVHWRFFXUVDOORZVWUDSWRDO
ZD\VEHUHDG\WRNLOO3DWHQWHGGHVLJQSUHYHQWVHVFDSHV
6PDUW FLUFXLW WHFKQRORJ\ VHQVHV URGHQW WR WULJJHU HOHF
WURQLFVKRFN1RQWR[LFSRLVRQIUHH%OLQNLQJJUHHQOLJKW
LQGLFDWHVURGHQWKDVEHHQNLOOHG%OLQNLQJUHGOLJKWLQGL
FDWHVORZEDWWHU\(DV\UHPRYDO5RGHQWVFDQEHGXPSHG
GLUHFWO\LQWRWKHWUDVKIRUQRWRXFKQRYLHZPRXVHFRQ
WURO5HTXLUHV³&´EDWWHULHV1RW,QFOXGHG.LOOVUDWV
SHUHDFKVHWRI&EDWWHULHV
120-0476
0
MOUSE TRAPS
‡(/(&7521,&
‡³9,&725´
No.
Unit
($
RAT TRAPS
Our No.
No.
Shf
Pk
WOODSTREAM
677-9656
1
($
Shf
Pk
No.
(DVLO\ DVVHPEOHG ³ORFN WDE´ WHQW
design appeals to mouse’s curios
LW\3HDQXWEXWWHUVFHQWDSSHDOVWR
D PRXVH DSSHWLWH 3UHEDLWHG DQG
QRQSRLVRQRXV /D\V ÀDW ZLWK QR OLS IRU SHVWV WR FUDZO
RYHU RU DURXQG 5HWDLQV VXSHULRU WDFNLQHVV RYHU ZLGH
WHPSHUDWXUHUDQJHWRGHJUHHV)DKUHQKHLW
Shf
Pk
No.
Unit
24
0
3.
Unit
MOUSE TRAPS
24
3.
‡*/8(
‡35(%$,7('
‡³67,&.(0´
3UHEDLWHG VFHQWHG DQG IRDPHG
SURIHVVLRQDO VWUHQJWK JOXH WUD\V
IRUVXSHUKROG0DGHZLWKUHF\FOHG
SODVWLF
‡*/8(75$<6
‡³5$0,.´
Our No.
3UHEDLWHG WUDS IRU PLFH 1R
VSULQJV RU VQDSV 'LVSRVDEOH 1RQ
WR[LF 6DIH WR XVH DURXQG FKLOGUHQ
DQG SHWV 8QLTXH VFHQWHG IRUPXOD
DWWUDFWVPLFH&RQWDLQVJOXHERDUGV
No.
Shf
Pk
Unit
24
($
24
($
J.T. EATON & CO., INC.
2 Pack
215-1389X
1
4 Pack
No.
Shf
Pk
Unit
12
3.
893-7435X
NEOGEN
785-8400X
3.
Four Pack - Polybag
MOUSE TRAPS
Our No.
‡*/8(
‡³9,&725´
604-4069X
Boxed
0
0&
WOODSTREAM
WOODSTREAM
677-9615
Unit
MOUSE TRAPS
Our No.
7UD\GHVLJQDQGJOXHVXUIDFHFDWFK
HV PLFH DQG KROGV WKHP VHFXUHO\
3UHEDLWHG DQG UHDG\ WR XVH 1R
SRLVRQV
Our No.
Shf
Pk
Boxed
220-8189
(DV\ PRXVH WUDS WR VHW DQG EDLW
6HWVDQGUHOHDVHVZLWKRQHVLPSOH
FOLFN 4XLFN NLOO FRQWDLQV D SRZHU
EDU GHVLJQHG IRU D TXLFN KXPDQH NLOO &DQ EH XVHG
DURXQGIRRGZDWHUFKLOGUHQDQGSHWV
5DW VL]H ZRRG VQDS WUDS ZLWK
H[SDQGHG WULJJHU 3URIHVVLRQDO
VWUHQJWK VSULQJ DQG KLJK TXDOLW\
ZRRG
No.
WOODSTREAM
‡48,&.6(7
‡6+(/)',63/$<
‡³9,&725´
‡:22'
Our No.
Our No.
MOUSE TRAPS
RAT TRAPS
1RVHWWLQJQREDLWLQJDQGQRSRL
VRQV -XVW SODFH DQG FDWFK :LWK
DQ SSHDOLQJ V\QWKHWLF SHDQXW EXW
WHUVFHQWGLVSHUVHGWKURXJKRXWWKHJOXHWKHPRXVHWUDS
OXUHV WKH URGHQW DQG FDWFKHV LW ZLWK WKH ORFNWDE WHQWV
WKDW KLGH PLFH PDNLQJ GLVSRVDO TXLFN DQ GHDV\ /DUJH
JOXH VXUIDFH KHOSV FDWFK DQG KROG HYHQ KHDY\ URGHQWV
DQGLQVHFWVRQFRQWDFW&RQWDLQVJOXHWUDSV(DV\VHW
XSLQVWUXFWLRQV
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
1
Maintenance, Repair & Operations - MOUSE TRAPS
MOUSE TRAPS
MOUSE TRAPS
‡0(7$/%$,73('$/7<3(
‡³9,&725´
‡(/(&7521,&
‡³9,&725´
‡.,//$1'&217$,1
‡³257+2´
5HOLDEOHPHWDOEDLWSHGDOWRKDQGOH
JXPGURSV SHDQXW EXWWHU FKHHVH
RURWKHUQDWXUDOPRXVHDWWUDFWDQWV
'HOLYHUV HOHFWULFDO VKRFN WR NLOO
PRXVH LQ VHFRQGV SHUFHQW
NLOO UDWH ZLWK QR SRLVRQ RU JOXH
8QLTXH WXQQHO GHVLJQ HQJLQHHUHG
WRSUHYHQWPRXVHIURPHVFDSLQJ%XLOWLQVDIHW\IHDWXUH
GHDFWLYDWHVXQLWLIGRRULVDFFLGHQWDOO\RSHQHG$$EDW
WHULHVNLOODSSUR[LPDWHO\PLFH,QGLFDWRUOLJKWZLOOEOLQN
UHGZKHQEDWWHULHVQHHGWREHUHSODFHG
6DIH VLPSOH DQG FOHDQ .LOOV PLFH
&DQEHXVHGDURXQGNLGVDQGSHWV
WRXFK VHW DQG HDV\ YLHZ LQGLFD
WRU OHWV \RX NQRZ ZKHQ D PRXVH
LV FDXJKW &RQWHPSRUDU\ GHVLJQ JUHDW IRU WLJKW VSDFHV
1RVHHQRPHVVGLVSRVDO&RQWDLQVGLVSRVDEOHWUDSV
Our No.
Shf
Pk
No.
Unit
WOODSTREAM
Bulk Pack
926-6339X
0
826-6322
0
72
($
3.
Our No.
Twin Pack
871-0972
4
0
($
Shf
Pk
No.
Unit
WOODSTREAM
Twin Pack - Polybagged
0
3.
/LYHWUDSLVLGHDOIRUFDWFKLQJPLFH
ZLWKRXWKDYLQJWRVHHWRXFKRUNLOO
WKHP0XOWLSOHFDWFKDOORZV\RXWR
FDWFK DQG UHOHDVH WKH PLFH HDVLO\
7UDSFDWFKHVDQGKROGVXSWRPLFH,GHDOIRUDQ\ZKHUH
LQGRRUV'LVSRVDEOHRUUHXVDEOHGHSHQGLQJRQ\RXUSUHI
HUHQFH &DQ EH XVHG DURXQG IRRG ZDWHU FKLOGUHQ DQG
SHWV1RSRLVRQV
Our No.
Unit
SCOTTS COMPANY
Box
361-1613
($
‡12728&+%$,767$7,21
‡³257+2´
‡08/7,&$7&+
‡³9,&725´
6ZLVV FKHHVH SHGDO UHTXLUHV QR
EDLWLQJ 7ULJJHU LV LQIXVHG ZLWK D
VFHQWPLFH¿QGLUUHVLVWLEOH
Shf
Pk
No.
MOUSE TRAPS
MOUSE TRAPS
‡($6<6(7
‡³9,&725´
825-9061
Unit
WOODSTREAM
MOUSE TRAPS
Our No.
Shf
Pk
No.
Our No.
Shf
Pk
No.
Unit
1R QHHG WR WRXFK WKH EDLW 0LFH
HQWHU DQG IHHG LQVLGH &RQWDLQV EDLWVWDWLRQV
Our No.
Shf
Pk
No.
Unit
SCOTTS COMPANY
Box
794-9514
($
WOODSTREAM
681-8728
6
0
($
MOUSE TRAPS
‡($6<6(7
‡³9,&725´
MOUSE TRAPS
1RQSRLVRQRXV QRQWR[LF 'LVSRV
DEOH
‡($6<726(7
‡³-$:=´
Our No.
Shf
Pk
No.
Unit
WOODSTREAM
CLIP STRIP ITEM
670-0181X
0
12
3.
‡35(66µ16(7
‡³257+2´
6DIH VLPSOH DQG FOHDQ VROXWLRQ WR
FRQWUROURGHQWV5HDG\WRXVH1RQ
WR[LF 2QH WRXFK VHW *UDE WDE IRU
HDV\GLVSRVDO3DFNRI
6HW ZLWK \RXU IRRW RU \RXU KDQG
5HXVDEOH 1HYHU JHW \RXU KDQG
VQDSSHGLQDWUDSDJDLQ0DGHIURP
UHF\FOHGSODVWLF
Our No.
Twin Pack - Polybagged
No.
Our No.
Shf
Pk
Unit
12
($
2 Pack
Our No.
No.
825-8691
0
6
‡6,03/(6(7
7
($
MOUSE TRAPS
‡&29(5('*/8(75$3
‡³257+2´
5HXVDEOH1RSRLVRQVRUFKHPLFDOV
Our No.
No.
Shf
Pk
Unit
($
SCOTTS COMPANY
Box
Unit
Our No.
($
891-7445
WOODSTREAM
216-0224X
&RYHUHG QR WRXFK GHVLJQ &RQYH
QLHQW JUDE WDE IRU HDV\ GLVSRVDO
.LOOVPLFH&RQWDLQVWUDSV
MOUSE TRAPS
Shf
Pk
Unit
SCOTTS COMPANY
MOUSE TRAPS
1HYHU KDYH WR VHH WRXFK RU NLOO D
PRXVHDJDLQWRUHPRYHLWRUKDYH
WRNHHSGDQJHURXVSRLVRQVDURXQG
6LPSO\RSHQWKHGRRUEDLWWKHWUDS
DQGSODFHLWLQDUHDZKHUHPLFHKDYHEHHQVHHQ$QLQ
JHQLRXVORFNLQJGHYLFH
Shf
Pk
No.
J.T. EATON & CO., INC.
947-4297X
‡+$9$+$57
‡³9,&725´
MOUSE TRAPS
No.
Shf
Pk
Unit
307
12
($
494-9020
PIC
MOUSE TRAPS
‡5(3($7,1*
‡³7,1&$79,&725´
)RUKRPHRUIDUPXVH+DVVOHIUHH
UHSHDWLQJ PRXVH WUDS +ROGV XS
WR PLFH ZLWKRXW UHZLQGLQJ RU
UHVHWWLQJ +HDY\GXW\ JDOYDQL]HG
FRQVWUXFWLRQIRU\HDUVRIUHOLDEOHVHUYLFH
Our No.
No.
Shf
Pk
Unit
WOODSTREAM
694-7931
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
0
6
($
214 - Maintenance, Repair & Operations
RODENT REPELLENT
MOUSE TRAPS
RAT/MOUSE KILLER
‡621,&
‡%$,767$7,21,1'2256
‡',6326$%/(
‡3(//(76
‡3/$&(1¶.,//
‡³9,&725´
'ULYHVDZD\PLFHDQGUDWV1RSRL
VRQVRUWUDSV
Our No.
No.
Shf
Pk
55
6
Unit
0RLVWXUHUHVLVWDQW+RXVHPLFHFDQ
FRQVXPHDOHWKDOGRVHLQRQHIHHG
LQJ.LOOVWKHPZLWKLQRUGD\V
(IIHFWLYH DJDLQVW DQWLFRDJXODQW
UHVLVWDQW PLFH 5HVLVWDQW WR WDPSHULQJ E\ FKLOGUHQ %R[
FRQWDLQVUHDG\WRXVHEDLWVWDWLRQV
($
Our No.
PIC
681-8710
No.
Shf
Pk
Unit
12
($
J.T. EATON & CO., INC.
157-3187
RODENT CHASERS
‡621,&3/8*,1
‡³9,&725´
5HSHOV URGHQWV 0LQLDWXUH XOWUD
VRQLF WHFKQRORJ\ RIIHUV GLVFUHHW
FRYHUDJH(DFKXQLWFRYHUVDQXQ
REVWUXFWHG VT IW 7KUHH XQLWV
IRUURRPV
Our No.
Shf
Pk
No.
6
06
Our No.
‡%$,767$7,21
‡5(),//$%/(
‡,1'2256287'2256
982-2255X
($
Our No.
No.
Shf
Pk
Unit
12
($
J.T. EATON & CO., INC.
157-3195
RODENT CHASERS
‡621,&3/8*,1
‡³9,&725´
MOUSE KILLER
5HSHOV URGHQWV 0LQLDWXUH XOWUD
VRQLF WHFKQRORJ\ RIIHUV GLVFUHHW
FRYHUDJH(DFKXQLWFRYHUVDQXQ
REVWUXFWHGVTIW7ZRXQLWVIRU
URRPV
Our No.
Shf
Pk
No.
Unit
629-6347
6
06
Unit
SCOTTS COMPANY
($
Bag
480-7657
5
($
Bagged Goods
MOUSE/RAT POISON
RAT/MOUSE KILLER
MOUSE BAIT STATIONS
‡3/$&(3$&.6
‡³&<.,//´
‡75$3
‡³5$0,.0286(5´
3UHEDLWHG DQG GLVSRVDEOH 7ZR
RSHQLQJV IRU PLFH WR HQWHU DQG
IHHG RQ EDLW LQVLGH 8VH LQGRRUV
RQO\ LQ DUHDV LQDFFHVVLEOH WR FKLO
GUHQ DQG SHWV 1R QHHG WR WRXFK EDLW ZKHQ DSSO\LQJ
&RQWDLQV SUH ORDGHG EDLW VWDWLRQV ZLWK HDFK VWDWLRQ
FRQWDLQLQJRXQFHRIEDLW&RQWDLQVWKHDFWLYHLQJUHGL
HQW'LSKDFLQRQH'LSKHQ\ODFHW\O,QGDQGLRQH
5HSODFHPHQWLWHPIRUVNXQR
Our No.
No.
Shf
Pk
Unit
12
3.
NEOGEN
703-2758
+.
($
Shf
Pk
No.
Unit
($
RAT/MOUSE KILLER
‡3(//(76%$,73$&.6
‡³+$92&´
5DSLGR%DLW6\VWHP$OOZHDWKHUQR
ZD[ IRUPXODWLRQ ZLWK VSHFLDO DW
WUDFWDQWV DQG EDLW LQJUHGLHQWV IRU
UDSLGDFWLRQZLWKRQO\DVLQJOHIHHG
&DQEHXVHGLQDQGDURXQGDJULFXOWXUDOEXLOGLQJV[
JUDPEDLWSDFNV
No.
Shf
Pk
Unit
24
%;
NEOGEN
No.
Size
Grams
Shf
Pk
Unit
12x14
24
3.
NEOGEN
644-3642
(DV\ WR XVH 6LPSO\ SODFH D EDLW
EORFNZKHUHURGHQWVDUHDSUREOHP
,GHDOIRUKDUGWRUHDFKDUHDVVXFK
DVEDVHPHQWVJDUDJHVEHKLQGDSSOLDQFHVDQGLQDWWLFV
$OVR ZRUNV LQ GDPS FRQFHDOHG HQYLURQPHQWV &DQ NLOO
URGHQWVLQRQHIHHGLQJ&RQYHQLHQWUHVHDODEOHEDJFRQ
WDLQVEORFNVIRUVHYHUDOIHHGLQJV
Our No.
For indoor and outdoor rodent
FRQWURO 0RLVWXUH DQG ZHDWKHU UH
VLVWDQW.LOOV1RUZD\UDWVURRIUDWV
DQG KRXVH PLFH 3HVWV FDQ FRQ
VXPHDOHWKDOGRVHLQDVLQJOHQLJKW¶VIHHGLQJ(IIHFWLYH
DJDLQVWDQWLFRDJXODQWUHVLVWDQWPLFHDQGUDWV
Our No.
0
‡%$,7%/2&.6,,
‡:$7(55(6,67$17
‡³'&21´
330-7105
Shf
Pk
No.
Unit
RECKITT BENCKISER
(DV\ WR XVH MXVW SODFH DQG ZDLW
0LFHZLOOHDWWKURXJKWKHZUDSSHU
1R PHVV SDVWH IRUPXOD &RQWDLQV
¿YHRXQFHEDLWSDVWHSDFNV
Our No.
Card of 2
Shf
Pk
RAT/MOUSE KILLER
Our No.
‡12728&+%$,73$67(
‡³257+2´
WOODSTREAM
No.
WOODSTREAM
Unit
Card of 3
293-7506
MOUSE TRAPS
0RLVWXUHUHVLVWDQW+RXVHPLFHFDQ
FRQVXPHDOHWKDOGRVHLQRQHIHHG
LQJ.LOOVWKHPZLWKLQRUGD\V
(IIHFWLYHDJDLQVWDQWLFRDJXODQWUHVLVWDQWPLFH5HVLVWDQW
WR WDPSHULQJ IURP FKLOGUHQ ZHDWKHU DQG SHWV &RPHV
ZLWKEDLWVWDWLRQDQGEDLWEORFNV
WOODSTREAM
0DGH ZLWK D SRZHUIXO VLQJOH IHHG
QRQDQWLFRDJXODQW &RQWUROV UR
GHQW SRSXODWLRQV LQ GD\V DQG
LQVRPHFDVHVRQO\DFRXSOHRIKRXUV(FRQRPLFDODQG
TXLFNNQRFNGRZQ%DLWVWDWLRQVDUHHDV\WRXVH6LPSO\
SODFHWKHSUH¿OOHGGLVSRVDEOHEDLWVWDWLRQQHDUVLJQVRI
URGHQW DFWLYLW\ <RXU KDQGV QHYHU FRPH LQ FRQWDFW ZLWK
WKHSRLVRQ5RGHQWVZLOOHQWHUWKHEDLWVWDWLRQDQGFKHZ
WKH EDLW EORFN 5RGHQWV VWRS IHHGLQJ DIWHU HDWLQJ D OH
WKDO GRVH 7KHUH LV QR ULVN RI VHFRQGDU\ SRLVRQLQJ VR
SHWVZRQ¶WEHKDUPHGLIWKH\DFFLGHQWDOO\HDWDSRLVRQHG
URGHQW
Box
534-6218
+
RAT/MOUSE KILLER
‡3(//(7%$,73$&.
‡)$50$1'5$1&+
‡³+$92&´
)RU FRQWURO RI 1RUZD\ UDWV URRI
rats and house mice in and around
KRPHVLQGXVWULDOFRPPHUFLDODJ
ULFXOWXUDO DQG SXEOLF EXLOGLQJV DQG VLPLODU PDQPDGH
VWUXFWXUHV 0D\ DOVR EH XVHG LQ WUDQVSRUW YHKLFOHV DQG
LQDQGDURXQGUHODWHGSRUWRUWHUPLQDOEXLOGLQJV6ROG%\
7KH%XFNHW1RW%\7KH3DFN5HSODFHPHQWLWHPIRUVNX
QRVDQG
Our No.
Shf
Pk
No.
Unit
NEOGEN
Pail
119-0214
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
4
($
Maintenance, Repair & Operations - 215
RAT/MOUSE KILLER
RAT/MOUSE KILLER
RAT/MOUSE KILLER
‡%$,73$&.$//:($7+(5
‡/$5*(52'(17,&,'(
18**(76
‡³5$0,.*5((1´
‡%$56
‡³-86721(%,7(´
‡3(//(73$&.6
‡³-86721(%,7((;´
.LOOV 1RUZD\ UDWV URRI UDWV ZDU
IDULQ UHVLVWDQW 1RUZD\ UDWV DQG
KRXVHPLFH)RUXVHLQDQGDURXQG
DJULFXOWXUDO EXLOGLQJV RQO\ 3HVWV
PD\FRQVXPHDOHWKDOGRVHLQRQHVLQJOHQLJKW¶VIHHGLQJ
ZLWK¿UVWGHDGURGHQWVDSSHDULQJRUGD\VDIWHUIHHG
LQJ EHJLQV 7UHDWHG ZLWK 6PHWKRSUHQH WR SURWHFW WKH
EDLW IURP LQIHVWDWLRQ E\ LQVHFWV &RQWDLQV LQGLYLGXDOO\
ZUDSSHG SRXQG EDUV &RQWDLQV WKH DFWLYH LQJUHGLHQW
%URPDGLROHQH
(IIHFWLYH FRQWURO LQGRRUV RU RXW
.LOOV 1RUZD\ UDWV URRI UDWV DQG
KRXVH PLFH )RU XVH ZLWKLQ IW
LQDQGDURXQGDJULFXOWXUDOSRUWRU
WHUPLQDOVEXLOGLQJVRULQVLGHRIWUDQVSRUWYHKLFOHVVKLSV
WUDLQV DQG DLUFUDIW RQO\ 3HVWV PD\ FRQVXPH D OHWKDO
GRVHLQRQHVLQJOHQLJKW¶VIHHGLQJZLWK¿UVWGHDGURGHQWV
DSSHDULQJRUGD\VDIWHUIHHGLQJEHJLQV6WRSIHHGDF
WLRQFDXVHVURGHQWVWRFHDVHIHHGLQJDIWHUFRQVXPLQJD
WR[LFGRVH(IIHFWLYHDJDLQVWDQWLFRDJXODQWUHVLVWDQWPLFH
DQG UDWV &RQWDLQV SHOOHW SDFNV &RQWDLQV WKH DFWLYH
LQJUHGLHQW%URPHWKDOLQ&$61R
LQFK QXJJHW IRUPXODWHG ZLWK
PXOWLSOH JUDLQV VZHHWHQHUV DQG
¿VKÀDYRULQJVIRUKLJKDFFHSWDQFH(TXDOO\HIIHFWLYHLQ
GRRUDQGRXWGRRU(IIHFWLYHFRQWURORI1RUZD\UDWVURRI
UDWVDQGKRXVHPLFH$FWLYH,QJUHGLHQW'LSKDFLQRQH
Our No.
No.
Size
Ozs.
4
Shf
Pk
Unit
1
3.
NEOGEN
953-9016
+.
Our No.
Size
Oz
No.
Shf
Pk
Unit
CENTRAL LIFE SCIENCES
999-7651
16
4
%;
RAT/MOUSE KILLER
‡3(//(73$&.6
‡³-86721(%,7(,,´
No.
Size
Lb
Shf
Pk
Unit
76
76
($
NEOGEN
No.
Size
Oz
Shf
Pk
Unit
1
3$,/
CENTRAL LIFE SCIENCES
999-7669
‡3$,/$//:($7+(5
‡/$5*(52'(17,&,'(
18**(76
‡³5$0,.*5((1´
‡&+81.6
‡³-86721(%,7(,,´
No.
Size
Ozs.
Shf
Pk
Unit
1
3$,/
NEOGEN
.LOOV1RUZD\UDWVURRIUDWVZDUID
ULQUHVLVWDQW1RUZD\UDWVDQGKRXVH
PLFH )RU XVH LQ DQG DURXQG DJUL
FXOWXUDO EXLOGLQJV RQO\ 3HVWV PD\
FRQVXPHDOHWKDOGRVHLQRQHVLQJOHQLJKW¶VIHHGLQJZLWK
¿UVWGHDGURGHQWVDSSHDULQJRUGD\VDIWHUIHHGLQJEH
JLQV7UHDWHGZLWK6PHWKRSUHQHWRSURWHFWWKHEDLWIURP
LQIHVWDWLRQE\LQVHFWV&RQWDLQVR]FKXQNV&RQWDLQVWKH
DFWLYHLQJUHGLHQW%URPDGLROHQH
Our No.
Size
Lb
No.
‡&2/'(;758'('%$56
$//:($7+(5
‡³5$0,.´
0ROGDQGPRLVWXUHUHVLVWDQWIRUXVH
LQ ZHW RU GU\ FRQGLWLRQV IRXQG LQ
GRRUV RU RXWGRRUV R] EDU FDQ
EH VHSDUDWHG LQWR WKUHH R] EDUV RU WZHOYH R] EDUV
(IIHFWLYHDJDLQVW1RUZD\UDWVURRIUDWVDQGKRXVHPLFH
&RQWDLQV'LSKDFLQRQH
3$,/
‡0,1,%$56
‡$//:($7+(5
‡³5$0,.´
.LOOV 1RUZD\ UDWV URRI UDWV DQG
KRXVH PLFH LQ ZHW RU GU\ DUHDV
&RQWDLQV WKH DFWLYH LQJUHGLHQW 'L
SKDFLQRQH5HSODFHPHQWLWHPIRUVNXQR
Our No.
No.
Size
Lb
4
Shf
Pk
Unit
4
%$*
NEOGEN
524-3670
No.
Size
Ozs.
Shf
Pk
Unit
12
($
.LOOV:DUIDULQUHVLVWDQW1RUZD\UDWV
DQG KRXVH PLFH 5DWV DQG PLFH
may consume a lethal dose in one
IHHGLQJZLWK¿UVWGHDGURGHQWVDS
SHDULQJ IRXU RU ¿YH GD\V DIWHU IHHGLQJ EHJLQV )RU XVH
LQ DQG DURXQG DJULFXOWXUDO EXLOGLQJV RQO\ &RQWDLQV WKH
DFWLYHLQJUHGLHQWV%URGLIDFRXPDQG%LWUH[5HSODFHPHQW
LWHPIRUVNXQR
Our No.
No.
Size
Lb
Shf
Pk
Unit
4
%$*
NEOGEN
Unit
682-1029
1
3$,/
RAT/MOUSE KILLER
1
3$,/
‡0,1,%$,73$&.6
‡:($7+(55(6,67$17
‡³5$0,.´
64 CHUNKS
999-7677
12
.LOOVDQGFRQWUROV1RUZD\UDWVURRI
UDWV DQG KRXVH PLFH *UHHQ ¿VK
ÀDYRUHG ZHDWKHU UHVLVWDQW URGHQ
WLFLGH&RQWDLQVWKHDFWLYHLQJUHGLHQW'LSKDFLQRQH6ROG
%\7KH%XFNHW1RW%\7KH3DFN5HSODFHPHQWLWHPIRU
VNXQR
Our No.
No.
Size
Lb
Shf
Pk
Unit
4
3$,/
NEOGEN
917-2057
NEOGEN
+
1
CENTRAL LIFE SCIENCES
999-7685
RAT/MOUSE KILLER
051-2046
Shf
Pk
96 CHUNKS
Our No.
‡%$,7%/2&.6
‡³+$92&;7´
RAT/MOUSE KILLER
)RU FRQWURO RI 1RUZD\ UDWV URRI
rats and house mice in and around
KRPHVLQGXVWULDODQGDJULFXOWXUDOEXLOGLQJVDQGVLPLODU
PDQPDGH VWUXFWXUHV 6XLWHG IRU XVH LQ ZHW RU GDPS
DUHDV LQFOXGLQJ ULYHU EDQNV JXOOLHV LUULJDWLRQ GLWFKHV
UDLOURDG WUDFNV ORDGLQJ DUHDV XQGHU JUDQDULHV DORQJ
IHQFHV JDUEDJH GXPSV DQG ODQG¿OOV [ R] SDFNV
SDFNHG LQ D OE SDLO &RQWDLQV WKH DFWLYH LQJUHGLHQW
'LSKDFLQRQH6ROG%\7KH%XFNHW1RW%\7KH3DFN
658-9816
Unit
RAT/MOUSE KILLER
RAT/MOUSE KILLER
Our No.
Shf
Pk
RAT/MOUSE KILLER
.LOOV1RUZD\UDWVURRIUDWVZDUID
ULQUHVLVWDQW1RUZD\UDWVDQGKRXVH
PLFH )RU XVH LQ DQG DURXQG DJUL
FXOWXUDO EXLOGLQJV RQO\ 3HVWV PD\
FRQVXPHDOHWKDOGRVHLQRQHVLQJOHQLJKW¶VIHHGLQJZLWK
¿UVWGHDGURGHQWVDSSHDULQJRUGD\VDIWHUIHHGLQJEH
JLQV7UHDWHGZLWK6PHWKRSUHQHWRSURWHFWWKHEDLWIURP
LQIHVWDWLRQE\LQVHFWV&RQWDLQVQRWRXFKSHOOHWSDFNV
&RQWDLQVWKHDFWLYHLQJUHGLHQW%URPDGLROHQH
Our No.
+.
Size
Oz
RAT/MOUSE KILLER
)RU FRQWURO RI 1RUZD\ UDWV URRI
rats and house mice in and around
KRPHVLQGXVWULDODQGDJULFXOWXUDOEXLOGLQJVDQGVLPLODU
PDQPDGHVWUXFWXUHV6XLWHGIRUXVHLQZHWRUGDPSDU
HDVLQFOXGLQJULYHUEDQNVJXOOLHVLUULJDWLRQGLWFKHVUDLO
URDGWUDFNVORDGLQJDUHDVXQGHUJUDQDULHVDORQJIHQF
HVJDUEDJHGXPSVDQGODQG¿OOV[SRXFKHVSDFNHG
LQDJDOORQFRQWDLQHU$FWLYHLQJUHGLHQW'LSKDFLQRQH
658-9584X
No.
CENTRAL LIFE SCIENCES
999-7693
‡%$,73$&.$//:($7+(5
‡/$5*(552'(17,&,'(
18**(76
‡³5$0,.´
Our No.
Our No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
216 - Maintenance, Repair & Operations
RAT/MOUSE KILLER
RAT/MOUSE KILLER
‡18**(76
‡:($7+(55(6,67$17
‡³5$0,.%587(´
‡%$,7%,763$&.
‡*5$9,7<)(('(5
‡³'&21´
8OWLPDWH DOO ZHDWKHU URGHQWLFLGH
IRU NLOOLQJ DQG FRQWUROOLQJ 1RUZD\
UDWV URRI UDWV DQG KRXVH PLFH LQ
GRRUVDQGRXW(VSHFLDOO\VXLWHGIRUXVHLQZHWDQGGDPS
DUHDV *UHHQ ¿VK ÀDYRUHG QXJJHWV UHWDLQ LWV IUHVKQHVV
DQG HIIHFWLYHQHVV HYHQ LQ GLI¿FXOW FRQGLWLRQV &RQWDLQV
WKHDFWLYHLQJUHGLHQW'LSKDFLQRQH5HSODFHPHQWLWHPIRU
VNXQR
%DLW SHOOHWV ,, $GYDQFHG IRUPXOD
VLQJOH IHHGLQJ SDFNV 5RGHQWV HDW
WKURXJK SDFN 7RVV LQ WLJKW DUHDV
VXFK DV WKH DWWLF JDUDJH DQG FUDZO VSDFHV .LOOV ZDU
IDULQUHVLVWDQWUDWVDQGPLFH+DQG\VHOIIHHGLQJJUDYLW\
GLVSOD\FDUWRQ$FWLYH,QJUHGLHQWSHUFHQW%URGLID
FRXP(DFKSDFNLVRXQFH
Our No.
No.
Size
Lb
[/EV
Shf
Pk
No.
Shf
Pk
Unit
RECKITT BENCKISER
1
3$,/
647-1080
NEOGEN
953-9057
Our No.
MOUSE
REPELLENT
Unit
Box of 120
1
%;
‡0286(0$*,&
‡$//1$785$/
‡(6&$3($92,'$1&(
‡³12(6&$3(´
7ULJJHUVHVFDSHDYRLGDQFHEHKDYLRUVLQURGHQWVGULYLQJ
WKHP IURP KRPHV VKHGV SDWLRV HWF 1HZ PHWKRG RI
URGHQWFRQWUROFRPELQHVWKHHIIHFWLYHQHVVRIQDWXUDOHV
VHQWLDORLOVZLWKWKHFRQYHQLHQFHRI³SODFHSDFNV´WHFK
QRORJ\ 6LPSO\ ORFDWH ³SODFH SDFNV´ ZKLFK H[XGH WKH
UHSHOOLQJ DTXDOLW\ RI WKH HVVHQWLDO RLOV DQ\ ZKHUH PLFH
HQWHUIHHGRUQHVW9HUVDWLOHH\HSRSSLQJSDFNDJLQJDO
ORZVSURGXFWWREHPHUFKDQGLVHGRQVKHOYHVDQGFRXQWHU
WRSVRUWREHSHJKRRNHG/DVWVRYHUGD\VLQODERUD
WRU\WHVWV&RQWDLQVR]SDFNDJHV
Our No.
RAT/MOUSE KILLER
‡%$56
‡:($7+(55(6,67$17
‡³5$0,.´
No.
Size Oz
Bars
Shf
Pk
Unit
[R]
4
%;
NEOGEN
958-7114
&DQ NLOO UDWV LQ D VLQJOH IHHGLQJ
:HDWKHU UHVLVWDQW 1HZ HDV\ WR
HDW VKDSH )RU FRQWURO RI 1RUZD\
rats and house mice in and around
LQGXVWULDO FRPPHUFLDO DJULFXOWXUDO
DQGSXEOLFEXLOGLQJV0D\DOVREHXVHGLQWUDQVSRUWYH
KLFOHV VXFK DV VKLSV WUDLQV DLUFUDIW DQG LQ DQG DURXQG
UHODWHG SRUW RU WHUPLQDO EXLOGLQJV 0D\ DOVR EH XVHG LQ
DOOH\VDQGVHZHUEORFNVSHUSDLO
Our No.
No.
Size
Grams
Shf
Pk
Unit
NEOGEN
913-7514
7+.
5
($
RAT/MOUSE KILLER
‡18**(76
‡$//:($7+(5
‡³5$0,.´
RODENT BAIT
STATIONS
0ROGDQGPRLVWXUHUHVLVWDQWJUHHQ
QXJJHWVNLOO1RUZD\UDWVURRIUDWV
DQG KRXVH PLFH LQ ZHW RU GU\ DU
HDV &RQWDLQV WKH DFWLYH LQJUHGLHQW 'LSKDFLQRQH 5H
SODFHPHQWLWHPIRUVNXQR
Our No.
No.
Size
Lb
4
Shf
Pk
Unit
4
%$*
NEOGEN
953-9032
‡%$,73$&.
‡³08/7,3/(;´
Our No.
Shf
Pk
No.
Unit
NEOGEN
6
($
RAT/MOUSE KILLER
ANIMAL REPELLENTS/BARRIERS
%DLWNLOOVDQGFRQWUROV1RUZD\UDWV
URRIUDWVDQGKRXVHPLFHLQGRRUVRU
RXWGRRUV*UHHQ¿VKÀDYRUHGQXJ
JHWVUHWDLQLWVHIIHFWLYHQHVVHYHQLQGLI¿FXOWFRQGLWLRQV
%DJ FRQWDLQV R] EDLW SDFNV &RQWDLQV WKH DFWLYH
LQJUHGLHQW 'LSKDFLQRQH 5HSODFHPHQW LWHP IRU VNX QR
Size Oz
Packs
Shf
Pk
Unit
NEOGEN
953-9065
4
4
3.
SLUG/SNAIL KILLER
‡7$3(
12
($
)RU XVH LQ DYHUDJH VL]HG URRPV
NLWFKHQVJDUDJHVDWWLFVDQGEDVH
PHQWV(PLWVKLJKIUHTXHQF\VRXQGZDYHVWKDWHIIHFWLYH
O\UHSHOURGHQWV6RXQGLVFRPSOHWHO\LQDXGLEOHWRSHRSOH
DQG QRQURGHQW SHWV 9DU\LQJ XOWUDVRQLF VRXQG ZDYHV
SUHYHQWV URGHQWV IURP JHWWLQJ XVHG WR WKH 9LFWRU 6RQLF
3HVW&KDVHU6LQFHWKHVRXQGLVLQDXGLEOHDUHG/('OLJKW
VKRZVXQLWLVZRUNLQJSURSHUO\5HGXFWLRQLQURGHQWDFWLY
LW\VKRXOGRFFXUZLWKLQGD\V0XOWLSOHXQLWVUHTXLUHG
IRUPXOWLSOHURRPV
7,+6
No.
Shf
Pk
Unit
WOODSTREAM
861-3036
03
1
($
RODENT
REPELLENT
‡3/8*,13(7&+$6(5
‡³9,&725´
No.
Shf
Pk
Unit
WOODSTREAM
196-5557
No.
Lgth
Ft
Shf
Pk
Unit
715
15
12
($
AMBRANDS
387-7909
2]
‡(/(&7521,&3(7&+$6(5
‡³9,&725´
Our No.
)RUPVDSURWHFWLYHEDUULHUWRUHSHO
VOXJVDQGVQDLOV7DSHLVVHOIDGKH
VLYHDQGLVZUDSSHGDURXQGWKHULP
RISODQWSRWVRUFRQWDLQHUVWRSUR
WHFWSODQWVIURPXQZDQWHGSHVWV
Our No.
6LQJOHVSHDNHUXQLWSOXJVLQWRZDOO
DQG FRYHUV DYHUDJH WR ODUJH VL]H
URRPV WR UHSHO URGHQWV IURP D ODUJH DUHD 3URSHU KLJK
IUHTXHQF\ VRXQG WR HIIHFWLYHO\ UHSHO URGHQWV *UHDW IRU
NLWFKHQVJDUDJHVDQGEDVHPHQWV6RXQGLVLQDXGLEOHWR
SHRSOHDQGQRQURGHQWSHWV
Bagged Goods
‡%$,73$&.6
‡:($7+(55(6,67$17
‡³5$0,.´
No.
Unit
RODENT
REPELLENT
Our No.
(IIHFWLYH ZD\ WR FRQWURO PLFH LQ
WKH KRXVH RU LQ EXLOGLQJV 6HOI
FRQWDLQHG DQG UHDG\ WR XVH +LJK
GHQVLW\ EDLWLQJ 6XSHULRU VWUHQJWK WDPSHU UHVLVWDQW
+DVVOHIUHHFRYHU
703-2741
Our No.
Shf
Pk
Packaged
‡³+$92.;7%/2.6´
0ROG DQG PRLVWXUH UHVLVWDQW EDUV
NLOO 1RUZD\ UDWV URRI UDWV DQG
KRXVH PLFH LQ ZHW RU GU\ DUHDV
&RQWDLQV WKH DFWLYH LQJUHGLHQW 'LSKDFLQRQH 5HSODFH
PHQWLWHPIRUVNXQR
953-9024
Size
BONIDE PRODUCTS
RAT/MOUSE KILLER
Our No.
No.
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
06
1
($
Maintenance, Repair & Operations - 217
MOLE/GOPHER
REPELLENT
ANIMAL REPELLENT
MOLE REPELLENT
‡5($'<7286(
‡³5(3(/6$//´
‡;&21&(175$7(
‡³6:((1(<¶6´
‡5($'<72635$<
‡³02/(0$;´
3URWHFWV \RXU ODZQ IURP PROHV
JRSKHUV YROHV DUPDGLOORV DQG
RWKHU EXUURZLQJ DQLPDOV 6DIH QR
SRLVRQV RQO\ QDWXUDO LQJUHGLHQWV &RYHUV VT IW
$FWLYH LQJUHGLHQWV &DVWHU RLO SHUFHQW 6DZGXVW SHUFHQWDQG*UDQLWHSHUFHQW
5HSHOVPROHVYROHVJRSKHUVUDE
ELWV DUPDGLOORV VNXQNV DQG RWKHU
EXUURZLQJ DQLPDOV 2QH TXDUW
WUHDWVVTIWDQGODVWVGD\VRUPRUH
Our No.
No.
Size
Lb
Shf
Pk
Unit
SENORET CHEMICAL
854-1047
4
Shf
Pk
Unit
12
($
Hose End
7,.6
%$*
1
'ULYHV PROHV DQG JRSKHUV DZD\
XQKDUPHG DQG ZLWKRXW WKH XVH RI
FKHPLFDOVSRLVRQVRUJDVHV3HQH
WUDWLQJVRQLFSXOVHVLUULWDWHEXUURZ
ing rodents and send them scurry
LQJDZD\'HVLJQHGZLWKDFRQYHQLHQWEDWWHU\VOHHYHIRU
WURXEOHIUHH EDWWHU\ UHSODFHPHQW (QYLURQPHQWDOO\ VDIH
DQG HIIHFWLYH &DQ EH XVHG DURXQG FKLOGUHQ DQG SHWV
$OVRZRUNVRQPROHVYROHVJURXQGVTXLUUHOVDQGRWKHU
EXUURZLQJURGHQWVVSLNHVFRYHUXSWRVTIW
Shf
Pk
(IIHFWLYHO\ UHSHOV PROHV IURP
ODZQV JROI FRXUVHV SOD\JURXQGV
DQG FHPHWHULHV %LRGHJUDGDEOH
QRQ WR[LF DOO QDWXUDO DQG LGHDO IRU XVH DURXQG SHRSOH
SHWV DQG SODQWV $WWDFKHV WR KRVH HQGV $FWLYH LQJUHGL
HQWVSHUFHQW&DVWHURLO
Our No.
Size
Ozs.
No.
Coverage
Ft
Shf
Pk
Unit
12
($
WOODSTREAM
Jug
'7
Box of 1
6
($
BIRD SPIKES
MOLE/GOPHER
SPIKES
‡62/$532:(5('
‡³621,&63,.(´
2IIHUV D FKHPLFDO DQG SRLVHQIUHH
DOWHUQDWLYH IRU GULYLQJ PROHV JR
SKHUVDQGRWKHUURGHQWVRXWRI\RXUODZQ6RQLFSXOVHV
SHQHWUDWLQJWKURXJKWKHVRLOHYHU\VHFRQGVVHQGLQJ
EXUURZLQJ URGHQWV VFXUU\LQJ DZD\ 1R EDWWHULHV DUH UH
TXLUHG 2QH VRODU FKDUJH ZLOO ODVW XS WR GD\V :DWHU
SURRI%XLOWZLWKDPRZRYHUGHVLJQ:LOOQRWKDUPSHWV
Our No.
No.
Shf
Pk
Unit
SENORET CHEMICAL
531-4836
12
6WRSV ELUG LQIHVWDWLRQV 'XUDEOH
8VHRQEXLOGLQJVDQGVWUXFWXUHVWR
eliminate the roosting and nesting
VXUIDFHRIELUGV6SLNHVDUHQRWOH
WKDOMXVWLUULWDWLQJLQWLPLGDWLQJDQG
XQLQYLWLQJ/LJKWZHLJKW3URYLGHVD
ORZ SUR¿OH PHWKRG IRU NHHSLQJ ELUGV RII \RXU SURSHUW\
)OH[LEOH EDVH VR VSLNHV FDQ EH LQVWDOOHG RQ FXUYHG VXU
IDFHV XVLQJ QDLO JOXH RU WLH %OHQGV ZLWK VXUURXQGLQJV
0DLQWHQDQFH IUHH ZRQ¶W FRUURGH RU GHFD\ $OVR VWRSV
FOLPELQJDQLPDOV´+[´:EDVH
Our No.
Lgth
Ft
No.
Shf
Pk
Unit
12
($
12
($
BIRD-X, INC.
POLYCARBONATE PLASTIC
201-2391
6315
STAINLESS STEEL
($
201-2383
6765
MOLE/GOPHER KILLER
3RLVRQ PROH ZRUPV ORRN DQG IHHO
OLNH UHDO HDUWK ZRUPV ,QFOXGHV DFWLYHWXQQHOORFDWRUÀDJV3DFNDJH
FRQWDLQVZRUPV$FWLYHLQJUHGL
HQW%URPHWKDOLQSHUFHQW
No.
Shf
Pk
Unit
6
3.
SENORET CHEMICAL
115-1034
Shf
Pk
Unit
464-7632
Qt
12
($
464-7624
Gal
4
($
ANIMAL
REPELLENT
‡&21&(175$7(
‡³5(3(/6$//´
$OOQDWXUDOLQJUHGLHQWVEXWUHSXOVLYH
WR YHUPLQ DQG RWKHU XQGHVLUDEOHV
5HSHOVWKUHHZD\VE\VHQVHRIWRXFKWDVWHDQGVPHOO
3UHYHQWVQLEEOLQJFKHZLQJQDZLQJDQGEURZVLQJGDP
DJHWRSODQWVDQGSURSHUW\IRUXSWRPRQWKVSHUDS
SOLFDWLRQ 5DLQ IDVW DIWHU KRXUV 0D\ EH XVHG DURXQG
HGLEOHV:RQ¶WKDUPSODQWVRUDQLPDOV(IIHFWLYHO\UHSHOV
GHHUUDEELWVVTXLUUHOVFKLSPXQNVGRJVFDWVUDWVPLFH
UDFFRRQV SRUFXSLQHV DUPDGLOORV ELUGV PLFH EHDYHU
VNXQNVDQGRWKHUXQGHVLUDEOHFULWWHUVDZD\IURPWUHDWHG
DUHDV%LRGHJUDGDEOH&RQWDLQVJDUOLFGULHGEORRGZKROH
HJJVROLGVFORYH¿VKRLORQLRQDQGZLQWHUJUHHQ
Our No.
No.
932-3486
Unit
Quart
12
($
‡5($'<7286(
‡³&5,77(55,''(5´
5HSHOV FDWV GRJV VTXLUUHOV
JURXQGKRJVVNXQNVDQGUDFFRRQV
5HSHOVE\VFHQWDQGWDVWHZKLFKLU
ULWDWHV WKH DQLPDO LI WKH\ WRXFK RU
WDVWHWKHVSUD\HGDUHD,WDOVRKHOSVNHHSDQLPDOVIURP
GDPDJLQJ RUQDPHQWDOODQGVFDSH SODQWLQJ DQG GLVFRXU
DJHVVTXLUUHOVIURPELUGIHHGHUV5HSHOVIRUXSWRGD\V
$FWLYH LQJUHGLHQWV SHUFHQW 2LO RI %ODFN 3HSSHU
SHUFHQW3LSHULQHDQGSHUFHQW&DSVDLFLQDQG
UHOHDWHG&DSVDLQLQRLGV
No.
WOODSTREAM
‡*5$18/(6
‡³61$.(67233(5´
740-0534
Size
Ozs.
Shf
Pk
Unit
12
($
Bottle
$ SRWHQW EOHQG RI DOO QDWXUDO DQG
86'$ UHFRPPHQGHG LQJUHGLHQWV
FORYH RLO FHGDU RLO FLQQDPRQ RLO VXOIXU FRPELQH WR HI
IHFWLYHO\UHSHOVQDNHVIURP\DUGVJDUGHQVVKHGVFDPS
VLWHVSDWLRVGHFNVDQ\ZKHUHXQGHVLUDEOH7KLVSURGXFW
GRHVQRWKDUPVQDNHVLWVLPSO\GULYHVWKHPDZD\QDWX
UDOO\6DIHIRUXVHZKHUHFKLOGUHQDQGSHWVSOD\
No.
Shf
Pk
ANIMAL REPELLENT
ANIMAL
REPELLENT
Our No.
Size
In
BONIDE PRODUCTS
Our No.
‡32,621:2506
‡³6:((1(<¶6´
Our No.
Size
‡&21&(175$7(
‡$//1$785$/
813-3019
No.
BONIDE PRODUCTS
Unit
SENORET CHEMICAL
531-4851
Our No.
MOLE REPELLENT
‡621,&
No.
Size
Qt
No.
BONIDE PRODUCTS
129-7480
MOLE/GOPHER SPIKES
Our No.
Our No.
3URWHFWV SODQWV DQG SURSHUW\ LQ
FOXGLQJVWUXFWXUHVIURPDZLGHYD
ULHW\ RI SHVWV LQFOXGLQJ UDFFRRQV
VNXQNV GHHU UDEELWV FDWV GRJV
ELUGV PROHV YROHV PLFH EHDYHU DQG RWKHU QXLVDQFH
DQLPDOV/DVWVXSWRPRQWKV:LOOQRWKDUPDQLPDOVRU
SODQWV6DIHWRXVHDURXQGFKLOGUHQ&RQWDLQVDOOQDWXUDO
LQJUHGLHQWVGULHGEORRGSXWUHVFHQWZKROHHJJVROLGVDQG
JDUOLFRLO
Size
Lb
Shf
Pk
Unit
BONIDE PRODUCTS
873-0277
12
($
048-9419
4
12
($
This logo next to our product heading indicates items that are Green Friendly
,WHPQXPEHUVZLWKVXI¿[³;´DUHVROGLQVKHOISDFNTXDQWLWLHVRQO\
16
- Maintenance, Repai
Download PDF