Pulsar Y302 Specifications

Pulsar Y302 Specifications
DE
GB
FR
ES
IT
PT
NL
SE
DK
NO
FI
GR
RU
Gebrauchsanweisung
Instructions for use
Mode d’emploi
Instrucciones de uso
Istruzioni per l’uso
Instruções de uso
Gebruiksaanwijzing
Bruksanvisning
Brugervejledning
Bruksanvisning
Käyttöohjeet
Οδηγίες χρήσης
Инструкция по
применению
DE
GB
FR
ES
IT
PT
NL
SE
DK
NO
FI
GR
RU
HKG-Layout 99000943_01 Cover aussen 1 / 8
GBA Translux Wave EU
Dateiname: 00US_99000943_01_W11180_GBA TL Wave EU_COVER_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
572 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
Beschnitt rechts 10 mm
4.1 / 4.2.3 / 5.2
1
2
7
3
4
5
10
9
6
8
6a
6b
6c
HKG-Layout 99000943_01 Cover aussen KLAPPE 2 / 8
GBA Translux Wave EU
Beschnitt links 10 mm
4.2.1 / 4.2.2
1
2
3
4
5
5.4
3
1
2
X
HKG-Layout 99000943_01 Cover innen KLAPPE 3 / 8
GBA Translux Wave EU
5.5
4.2.2
5
6.2
8
HKG-Layout 99000943_01 Cover innen 4 / 8
GBA Translux Wave EU
HKG-Layout 99000943_01 Cover innen 5 / 8
GBA Translux Wave EU
Beschnitt rechts 10 mm
5.3
1
2
3
4
4.2.3
8.5
11
12
8.6.1
8.6.2
12
HKG-Layout 99000943_01 Cover innen KLAPPE 6 / 8
GBA Translux Wave EU
Beschnitt links 10 mm
14.1
FreeCall Deutschland
Heralab 0 800 / 43 72 522 – Herafax 0 800 / 43 72 329
Heraeus Kulzer GmbH
Sandie Gehrig
Grüner Weg 11
63450 Hanau
LAND / COUNTRY
Australien / Australia
NAME / ADDRESS
Tel.: 0 61 81 / 35 45 87
Fax: 0 61 81 / 16 45 87
[email protected]
Heraeus Dental Australia Pty Ltd, Rydecorp, Unit 6, 2 Eden Park Drive,
Macquarie Park NSW Australia 2113
Tel. / Phone +61 2-8422 6100, Fax +61 2-9888 1460
Heraeus Kulzer South America Ltda., CNPJ 48.708.010/0001-02,
Brasilien / Brazil
(America Sul / America del Sur / Rua Cenno Sbrighi, 27 – cj. 42, São Paulo – SP 05036-010
Tel. / Phone +55 11 3665-0506, Fax +55 11 3665-0521
South America)
China / China Shanghai
Heraeus Kulzer Dental Trading Co. Ltd., 1585 Gu Mei Road, 200233 Shanghai
Tel. / Phone +86 21 64 95 84 88, Fax +86 21 64 95 17 32
Heraeus S.A.S., Parc Silic – Bat.i.2, Villebon – BP 630, 12, Avenue du Québec,
Frankreich / France
91945 Courtaboeuf Cédex
Tel. / Phone +33 169 18 48 85, Fax +33 169 28 78 22
Großbritannien / United Kingdom Heraeus Kulzer Ltd., Heraeus House, Albert Road / Northbrook Street,
RG14 1DL Newbury, Berkshire
Tel. / Phone +44 163 53 05 00, Fax +44 163 53 06 06
Heraeus Kulzer S.r.l., Via Console Flaminio 5/7, 20134 Milano
Italien / Italy
Tel. / Phone +39 022 10 09 41, Fax +39 022 10 09 42 83
Heraeus Kulzer Japan Co. Ltd., 2F TSK Bldg., 8-13 Hongo 4-chome, Bunkyo-ku,
Japan / Japan
113-0033 Tokyo
Tel. / Phone +81 358 03 21 53, Fax +81 358 03 21 50
Heraeus Kulzer Mexico S.A. de C.V., Homero 527 – 301 y 302, Col. Pol.,
Mexiko / Mexico
11560 Mexico, D. F.
Tel. / Phone +52 55 31 55 49, Fax +52 55 52 55 16 51
Niederlande / The Netherlands Heraeus Kulzer Benelux B.V., Fustweg 5, 2031 CJ Haarlem
Tel. / Phone +31 235 43 42 50, Fax +31 235 43 42 55
Heraeus Kulzer, LLC, 300 Heraeus Way, South Bend, IN 46614-2517
Nordamerika / North America
Tel. / Phone 1 57 42 99 54 10, Fax 1 57 42 99 66 31
Heraeus Kulzer Austria GmbH, Nordbahnstraße 36 / Stg 2/4/4.5, A-1020 Wien
Österreich, Schweiz /
Tel. / Phone +43 (0) 14 08 09 41, Fax +43 (0) 14 08 09 41 70
Austria, Switzerland
Heraeus Dental, Heraeus Materials Singap. Pte.Ltd., #07-01 TechPlace II,
Singapur / Singapore
569881 Singapore
Tel. / Phone +65 65 71 75 69, Fax +65 65 71 75 77
Heraeus Kulzer Nordic AB, Hammarbacken 4B, 19149 SOLLENTUNA
Skandinavien / Scandinavia
Tel. / Phone +46 8 58 57 77 55, Fax +46 86 23 14 13
Heraeus S.A., C/ Forjadores, 16 (Prado del Espino), 28660 Boadilla – Madrid
Spanien / Spain
Tel. / Phone +34 913 58 03 75, Fax +34 913 58 03 68
Heraeus Kulzer Hungary Kft., Stefania ut 101-103, 1143 Budapest
Ungarn / Hungary
Tel. / Phone +36 17 88 42 22, Fax +36 17 88 42 33
HKG-Layout 99000943_01 Cover aussen KLAPPE 7 / 8
GBA Translux Wave EU
Made in Italy
Manufacturer:
Heraeus Kulzer GmbH
Grüner Weg 11
63450 Hanau (Germany)
Heraeus Kulzer, LLC
300 Heraeus Way
South Bend, IN 46614-2517
1-800-431-1785
Caution:
Federal law restricts this
device to sale by or on the
order of a dentist.
Importado e Distribuído por
Heraeus Kulzer South América Ltda.
CNPJ 48.708.010/0001-02
Rua Cenno Sbrighi, 27 – cj. 42
São Paulo – SP – CEP 05036-010
[email protected]
Resp. Técnica:
Dra. Regiane Marton – CRO 70.705
N° ANVISA: vide embalagem
HKG-Layout 99000943_01 Cover aussen 8 / 8
GBA Translux Wave EU
W11180 99000943/01 2014-03
Distributed in USA/Canada
exclusively by:
Inhaltsverzeichnis
1
1.1
1.2
1.3
Anwendung ______________________________________________________________________
Allgemeines ____________________________________________________________________
EG-Konformitätserklärung _________________________________________________________
Konformitätserklärung des Herstellers __________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Anleitung zur sicheren Verwendung des Gerätes _________________________________________
Erklärung von Symbolen und Begleitwort / Begleitwörtern __________________________________
Transportschaden – Auspacken und Inspektion __________________________________________
Eigentümerpflichten ______________________________________________________________
Gerätebuch ____________________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Bestimmungsgemäße Verwendung ____________________________________________________
Beschreibung des Gerätes _________________________________________________________
Sicherheitsanforderungen _________________________________________________________
Allgemeine Sicherheitshinweise zum Betrieb des Gerätes ___________________________________
Sicherheitshinweise ______________________________________________________________
AKKU – Sicherheitshinweise ________________________________________________________
AKKU – Informationen ____________________________________________________________
HAFTUNG _____________________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Gerätebeschreibung _______________________________________________________________ 8
Lieferumfang ___________________________________________________________________
8
Beschreibung der Steuer- und Bedienelemente __________________________________________
8
Handstück _____________________________________________________________________
8
Ausrichtungshilfe ________________________________________________________________
8
Ladegerät ______________________________________________________________________
8
Akustische Signale des Handstücks __________________________________________________
9
LED Information bezüglich ausgesendeter Strahlung ______________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installation und Inbetriebnahme ______________________________________________________
Sicherheitsanforderungen während der Installation _______________________________________
Anschluss des Ladegerätes an die Steckdose ____________________________________________
Einsetzen des Akkus in das Handstück ________________________________________________
Einsetzen des Lichtleiters in das Handstück ____________________________________________
Aufladen des Akkus ______________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Betrieb __________________________________________________________________________
Aktivieren und Deaktivieren des Belichtungszyklus _______________________________________
Messen der Lichtintensität _________________________________________________________
Ruhemodus ____________________________________________________________________
Weitere Informationen zum Betrieb des Gerätes _________________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Störungsmeldungen ________________________________________________________________
Defekter Akku __________________________________________________________________
Defekte LED ___________________________________________________________________
Überhitzungsschutz ______________________________________________________________
INTEGRIERTER Überhitzungssensor defekt _____________________________________________
Signal bei schwachem Akku ________________________________________________________
15
15
15
15
15
16
HINWEIS
Bitte benutzen Sie das Icon mit dem Buch,
um die Kapitelbilder oder weitere Informationen
auf dem aufklappbaren Umschlag zu finden.
HKG-Layout 99000943_01 GBA
1x /2x
Bitte den
vorderen Umschlag
aufklappen
Bitte den
hinteren Umschlag
aufklappen
01DE
Translux Wave EU
Dateiname: 01DE_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
DE
-1-
DE
-2-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Reinigung, Desinfizierung und Sterilisation _____________________________________________
Einzelteile entnehmen _____________________________________________________________
LICHTLEITER – Reinigung und Desinfektion _____________________________________________
LICHTLEITER – Inspektion vor der Sterilisation ___________________________________________
BLENDSCHUTZKEGEL – Reinigung und Desinfektion ______________________________________
BLENDSCHUTZKEGEL – Inspektion vor der Sterilisation _____________________________________
LICHTLEITER und BLENDSCHUTZKEGEL – Verpackung vor der Sterilisation ______________________
LICHTLEITER und BLENDSCHUTZKEGEL – Sterilisation _____________________________________
Sterilisationsverfahren ____________________________________________________________
Sterilisationsparameter ___________________________________________________________
HANDSTÜCK – Reinigung und Desinfektion _____________________________________________
LADEGERÄT – Reinigen des Gehäuses _________________________________________________
LADEGERÄT – Reinigen der Kontakte des Ladegerätes _____________________________________
LADEGERÄT – Ersatzkontakte für das Ladegerät __________________________________________
9
Lagerung ________________________________________________________________________ 19
10
Entsorgung ______________________________________________________________________ 19
11
Fehlerbehebung ___________________________________________________________________ 20
12
12.1
12.2
12.3
Technische Daten _________________________________________________________________
Elektromagnetische Kompatibilität gemäß EN 60601-1-2 __________________________________
Typenschild des Ladegerätes _______________________________________________________
Handstück-Seriennummer _________________________________________________________
13
Gewährleistung ___________________________________________________________________ 25
14
14.1
Service __________________________________________________________________________ 26
Servicepartner / Ansprechpartner in den Ländern _________________________________________ 26
15
Dokumentenhistorie ________________________________________________________________ 26
HINWEIS
Bitte benutzen Sie das Icon mit dem Buch,
um die Kapitelbilder oder weitere Informationen
auf dem aufklappbaren Umschlag zu finden.
16
16
16
16
16
17
17
17
17
17
17
18
18
19
22
23
25
25
1x /2x
Bitte den
vorderen Umschlag
aufklappen
Bitte den
hinteren Umschlag
aufklappen
1
Anwendung
1.1
Allgemeines
Translux Wave ist ein eingetragenes Warenzeichen der Heraeus Kulzer GmbH.
Diese Betriebsanleitung gilt für:
Bestell-Nr.
66055012
Typ und Ausstattung
Translux Wave – LED-Polymerisationsgerät
Ausgabe
2014-03 / 99000943/01
1.2
EG-Konformitätserklärung
Hiermit erklären wir, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, dass das nachfolgend bezeichnete Gerät
aufgrund seiner Konzipierung und Bauart sowie der von uns in Verkehr gebrachten Ausführung den einschlägigen
Sicherheits- und Gesundheitsanforderungen der EG-Richtlinie entspricht.
Bei einer nicht mit uns abgestimmten Änderung des Gerätes verliert diese Erklärung ihre Gültigkeit.
1.3
Konformitätserklärung des Herstellers
Hiermit bestätigen wir, dass das Translux Wave-Gerät den Richtlinien 93/42 EG und den Normen IEC 60601-1
und IEC 60601-1-2 entspricht.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Germany).
2
Anleitung zur sicheren Verwendung des Gerätes
Bitte lesen Sie dieses Handbuch und befolgen Sie die Anweisungen genau. Die Worte WARNHINWEIS, ACHTUNG
und HINWEIS tragen eine besondere Bedeutung und müssen sorgfältig überprüft werden (siehe folgender Absatz).
Sie sollten dieses Handbuch immer griffbereit haben.
2.1
Erklärung von Symbolen und Begleitwort / Begleitwörtern
Symbole
Begleitwort / Begleitwörter Erklärung
WARNHINWEIS
Bedeutet, dass Tod oder ernsthafte Verletzungen auftreten können,
wenn der Hinweis nicht befolgt wird.
ACHTUNG
Bedeutet, dass geringfügige Verletzungen oder Geräteschäden auftreten
können, wenn der Hinweis nicht befolgt wird.
HINWEIS
Bedeutet, dass der Hinweis sich nicht auf Gesundheitsschäden bezieht.
WARNUNG VOR
EXPLOSION
WARNUNG vor Explosion – Beachten Sie die Informationen und Warnhinweise in den Kapiteln und Abschnitten, die mit diesem Bildsymbol
gekennzeichnet sind.
WARNUNG vor Stromschlag.
Vor der Durchführung von Reinigungs- und Desinfektionsverfahren muss
die Ladestation von der Stromquelle getrennt werden!
MET-Symbol – UL / CSA Konformiät.
VOM NETZ TRENNEN
MET
WEEE / ElektroG
Entsorgung von Altgeräten nach WEEE (Europäische Richtlinie) oder
Elektro- und Elektronikgerätegesetz (Deutsches Gesetz ElektroG).
Anwendungsteil: Anwendungsteil des Typs B gemäß den technischen
Normen IEC 60601-1.
Doppelisolierung:
Gerät der Schutzklasse II.
Stromversorgung:
Wechselstrom.
Gleichstrom.
Schaltnetzteil Steckerpolarität – Mittelanschluss positiv.
Nur in geschlossenen Räumen betreiben.
DE
-3-
Symbole
Begleitwort / Begleitwörter Erklärung
Das Gerät wurde in Übereinstimmung mit der Richtlinie 93/42 EG,
einschließlich der technischen Normen IEC 60601-1 und
IEC 60601-1-2, hergestellt.
WARNSYMBOL „LED-Strahlung“.
Beachten Sie die in Kapitel 4.2.5 dargelegten Hinweise und Gefahren.
Lesen Sie die Gebrauchsanweisung.
ACHTUNG, lesen Sie die Begleitdokumente.
Betriebsschalter:
„Start / Stopp“.
DE
Zulassungszertifikat gemäß Gesundheitsministerium der Russischen
Föderation.
-4-
Von Regen und Feuchtigkeit fernhalten.
Lagertemperaturbegrenzung (–20°C (–4°F) bis 40°C (104°F)).
Luftfeuchtigkeit bei der Lagerung (45% – 85% RH).
Atmosphärendruck bei der Lagerung (500 – 1060 hPa).
2.2
Transportschaden – Auspacken und Inspektion
Das Gerät ist stoßempfindlich, da es elektronische Bauteile enthält. Daher ist sowohl beim Transport als auch bei
der Lagerung besondere Vorsicht geboten. Die von Heraeus Kulzer versandte Ware wurde vor dem Versand genau
kontrolliert. Das Gerät wird ordnungsgemäß geschützt und verpackt geliefert.
Bitte überprüfen Sie nach Erhalt der Lieferung das Gerät auf Transportschäden. Bei Feststellung von Schäden melden
Sie diese bis spätestens 24 Stunden nach Auslieferung dem Transportunternehmen. Sie sollten unter keinen Umständen
mit dem Gerät oder dem Zubehör arbeiten, wenn dieses beschädigt ist.
2.3
Eigentümerpflichten
Der Eigentümer hat über die Einhaltung der gesetzlichen Vorschriften hinaus die Pflicht, für die Einhaltung und Umsetzung der gesetzlichen Vorgaben am Arbeitsplatz zu sorgen, z. B. die Medizinische Betreiberverordnung (MedBetrV),
der Einweisungspflicht, des Arbeitsschutzgesetzes sowie aller weiteren geltenden Vorschriften und Gesetze.
Spezielle Sicherheitstechnische Kontrollen (STK) sind für dieses Gerät NICHT vorgeschrieben und auch seitens des
Herstellers nicht vorgegeben. Für die verbindlichen Wiederholungsprüfungen der elektrischen Sicherheit wird ein
Zeitraum von 1 Jahr festgesetzt.
Für die Arbeiten an und mit dem Gerät sind anhand der Betriebsanleitung und aufgrund der durchzuführenden Arbeiten
vom Eigentümer schriftliche Anweisungen in verständlicher Form zu erstellen und in der Sprache allen Beschäftigten
bekannt zu machen.
2.4
Gerätebuch
Wir empfehlen das Führen eines Gerätebuches, in dem alle Tests und umfangreicheren Arbeiten (z. B. Wartungen,
Änderungen) dokumentiert werden.
3
Bestimmungsgemäße Verwendung
Das Translux Wave-Gerät ist ein LED-Lichtgerät zur Verwendung in der Mundhöhle für die Polymerisation von
lichthärtenden Dentalmaterialien wie Adhäsiven und Füllungsmaterialien, die in einem Wellenlängenbereich
von 440 – 480 nm aktiviert werden.
HINWEIS
Die meisten lichthärtenden Dentalmaterialien werden in diesem Wellenlängenbereich aktiviert.
Kontaktieren Sie bei Unsicherheiten den Hersteller, um die Spezifikationen abzuklären.
WARNHINWEIS – Qualifiziertes Fachpersonal.
Das Gerät darf nur durch entsprechend geschultes Fachpersonal und den Zahnarzt betrieben werden
(siehe Kapitel 2.3 Eigentümerpflichten). Wenn das Gerät nach der Anleitung korrekt verwendet wird,
verursacht es keine bekannten Nebenwirkungen.
3.1
Beschreibung des Gerätes
Das Translux Wave-Gerät verwendet eine sehr effiziente mono-chromatische LED-Diode als Lichtquelle mit einer
Wellenlänge im Bereich zwischen 440 und 480 nm.
Das gesamte von dem Translux Wave-Gerät abgestrahlte Licht wird zur Aktivierung des Photoinitiators Campherchinon
verwendet. Dies führt zu exzellenten Polymerisationsergebnissen mit geringer Wärmeabgabe.
Das Translux Wave-Gerät wird zusammen mit einem um 360° drehbaren Lichtleiter mit einem Durchmesser
von 8 mm geliefert.
Das Translux Wave-Gerät besteht aus einer Ladestation und einem Handstück, das über einen herausnehmbaren
Lithium-Ionen-Akku mit Strom versorgt wird.
Das Handstück verfügt über einen „Ruhemodus“, um den Energieverbrauch des Gerätes gering zu halten.
Wenn das Handstück über einen Zeitraum von 5 Minuten nicht verwendet wurde, wechselt es in den „Ruhemodus“.
Das Translux Wave-Gerät kann mit zwei verschiedenen Belichtungszyklen betrieben werden:
• Belichtung mit konstanter Lichtleistung: Zyklusdauer 10 Sekunden.
• Belichtung mit langsam hochgeregelter Lichtleistung: „Soft-Start“ (Zyklusdauer 20 Sekunden).
Beim „Soft-Start“ steigt die Lichtleistung innerhalb von 2 Sekunden von 50% auf 100% an.
HINWEIS – Halten Sie sich an die vom Hersteller für die jeweiligen Materialien spezifizierten Belichtungszeiten.
Bei Materialien mit speziellen Belichtungszeiten (z. B. 30 / 40 Sekunden für dunkle Komposite) die Belichtung
ggf. mehrere Male wiederholen.
3.2
Sicherheitsanforderungen
Die Effektivität der Sicherheitshinweise bezüglich des Schutzes der Personen, des Umgangs mit dem Gerät und des
Umgang mit dem Bearbeitungsgut unterliegt wesentlich dem Verhalten der an diesem Gerät beschäftigten Personen.
WARNHINWEIS
Vor Inbetriebnahme diese Betriebsanleitung sorgfältig lesen, die Angaben beachten, um Fehler und dadurch
bedingte Schäden, insbesondere Gesundheitsschäden, zu vermeiden.
Für die Aufstellung und den Betrieb des Gerätes sind, außer den Angaben in dieser Betriebsanleitung,
die jeweils national gültigen Gesetze, Vorschriften und Richtlinien zu beachten.
3.2.1
Allgemeine Sicherheitshinweise zum Betrieb des Gerätes
WARNHINWEIS – VERWENDUNGSZWECK
Verwenden Sie das Gerät nur für den Zweck, für den es bestimmt ist (siehe Kapitel 3 Bestimmungsgemäße
Verwendung). Es wird dringend davon abgeraten, das Gerät zu einem anderen Zweck zu verwenden. Jede
Nichteinhaltung dieser Sicherheitsvorschrift kann zu schweren Verletzungen des Patienten oder Anwenders
des Gerätes sowie zu Schäden oder Defekten am Gerät führen. Heraeus Kulzer haftet nicht für Folgeschäden
aufgrund der Nichteinhaltung der vorgenannten Vorschrift!
WARNHINWEIS
Der Anwender ist dafür verantwortlich, dasTranslux Wave-Gerät auf seine Gebrauchstauglichkeit für die
beabsichtigten Zwecke zu prüfen.
Niemals das Licht in Richtung der Augen halten! Eine direkte oder indirekte Exposition von Licht in die Augen
muss immer durch das Tragen einer Schutzbrille, die blaues Licht herausfiltert, verhindert werden. Positionieren Sie beim Aushärten die Spitze des Lichtleiters direkt über dem auszuhärtenden Material und vermeiden Sie
jede unnötige Exposition des umliegenden Gewebes. Augen, Zahnfleisch, Weichgewebe und andere Körperteile
dürfen dem blauen Licht nicht ausgesetzt werden (diese Körperteile müssen ggf. mit einem Schutz abgedeckt
werden). Verwenden Sie zum Schutze des Weichgewebes, d. h. der Gingiva, während der Behandlung einen
Kofferdam. Die Belichtung muss auf den Bereich in der Mundhöhle beschränkt werden, in dem die Behandlung
durchgeführt wird.
WARNHINWEIS – KONTRAINDIKATIONEN
Das Translux Wave-Gerät nicht bei Patienten mit einem Herzschrittmacher oder anderen elektronischen
Implantaten verwenden. Dies gilt ebenso für den Anwender.
Das Gerät darf nicht von Kindern, Blinden oder Tauben verwendet werden und auch nicht von / bei Personen, die
möglicherweise epileptische Anfälle bekommen. Die vorgenannten Personen können möglicherweise nicht die
Risiken, die aus der Nutzung und dem Betrieb des Gerätes entstehen, erkennen. Aus Sicherheitsgründen ist Anwendern sowie bei Patienten mit potenziellem Risiko von epileptischen Anfällen die Bedienung des Gerätes untersagt.
WARNHINWEIS
Das Gerät darf nicht modifiziert werden.
DE
-5-
Der Eigentümer / Anwender muss sicherstellen, dass:
– das Gerät nicht bei Patienten mit einer positiven Anamnese nach einem Lichttest verwendet wird,
z. B. bei Patienten mit Urticaria solaris und / oder Porphyrie sowie Patienten, die mit fotosensibilisierenden
Medikamenten behandelt wurden.
– das Gerät bei Patienten, die aufgrund eines Katarakts operiert wurden und die besonders lichtempfindlich
sind, nur dann verwendet wird, wenn geeignete Schutzvorkehrungen getroffen werden, wie die Verwendung einer Schutzbrille / Brille, die blaues Licht herausfiltert.
– bei Patienten, deren Anamnese eine Netzhauterkrankung einschließt, der Augenarzt der Behandlung mit
dem Translux Wave-Gerät zustimmt.
– bei allen potenziellen Risikofällen ein Facharzt konsultiert wird.
WARNHINWEIS – Temperatur des Anwendungsteils
Max. Temperatur des Anwendungsteils (Lichtleiter und Blendschutz): 41°C (106°F).
Max. Temperatur des zum Anwendungsteil hinzugerechneten vorderen Metallkonus, da dieser mit dem
Patienten in Kontakt kommen kann: 46°C (115°F).
Heraeus Kulzer erklärt, dass, wenn das Gerät in Übereinstimmung mit den beiliegenden Anweisungen betrieben
wird, keine Gewebeerhitzung auftritt.
WARNHINWEIS – Infektionskontrolle.
Der Lichtleiter und der Blendschutzkegel müssen vor jeder Verwendung gereinigt, desinfiziert und sterilisiert
(Dampf) werden. Der Lichtleiter und der Blendschutzkegel werden in UNSTERILEM Zustand geliefert und
müssen vor der ersten Verwendung sterilisiert werden. Siehe Kapitel 8.4.1.2 Sterilisationsparameter.
DE
-6-
3.2.2
Sicherheitshinweise
WARNUNG – EXPLOSIONSGEFAHR
Das Gerät nicht bei Explosionsgefahr installieren. Das Gerät darf nicht in einer brennbaren Atmosphäre verwendet
werden (Anästhesiegase, Sauerstoff, Stickstoffoxid usw.). Verwenden Sie das Gerät in einem gut belüfteten Raum.
WARNHINWEIS
Überprüfen Sie vor Verwendung des Gerätes das Netzkabel und den Stecker auf eventuelle Schäden.
Wenn diese beschädigt sind, das Gerät nicht an das Stromnetz anschließen.
Verwenden Sie nur Original-Ersatzteile oder Zubehörteile von der Heraeus Kulzer GmbH. Heraeus Kulzer bietet
einen für das Translux Wave-Gerät geeigneten Lichtleiter an. Andere Lichtleiter dürfen nicht verwendet werden.
Die Heraeus Kulzer GmbH übernimmt keinerlei Haftung für Schäden, die sich aus der Verwendung von Ersatzteilen oder Zubehör ergeben, die keine Originalteile von Heraeus Kulzer sind.
3.2.3 AKKU – Sicherheitshinweise
Die Heraeus Kulzer GmbH übernimmt keine Haftung für Probleme mit dem Akku, wenn die im untenstehenden Abschnitt
aufgeführten Sicherheitshinweise nicht sorgfältig eingehalten werden.
WARNHINWEIS
Durch falsche Verwendung des Akkus kann der Akku überhitzen, einen Riss bekommen oder sich entzünden
und schwere Verletzungen verursachen. Stellen Sie sicher, dass die im untenstehenden Abschnitt aufgeführten
Sicherheitshinweise befolgt werden.
Verwenden Sie nur Original-Akkus von Heraeus Kulzer!
Die Verwendung von Akkus eines anderen Herstellers als Heraeus Kulzer oder von nicht aufladbaren Batterien
und / oder Primärbatterien stellt eine potenzielle Gefahr dar und kann das Gerät beschädigen.
Den Akku außerhalb der Reichweite von Kindern aufbewahren!
Niemals den Akku öffnen, durchstechen oder zerdrücken – er enthält giftige Substanzen.
Bei Korrosion, ungewöhnlichem Geruch oder Flüssigkeitsaustritt den Akku sofort aus dem Handstück entfernen.
Setzen Sie den Akku niemals Wasser oder Salzwasser aus oder lassen ihn nass werden. Den Akku nicht in
hoher Luftfeuchtigkeit oder an einem Ort, an dem er Regen ausgesetzt sein könnte, lagern.
Falls der Akku ausläuft und Flüssigkeit ins Auge gelangt, nicht im Auge reiben. Spülen Sie das Auge gründlich
mit Wasser aus und suchen Sie sofort einen Arzt auf. Unbehandelt kann die Akkuflüssigkeit zu Schäden am
Auge führen.
WARNUNG – EXPLOSIONSGEFAHR
Verwenden Sie zum Aufladen des Akkus des Handstücks nur das mit dem Translux Wave-Gerät mitgelieferte
Ladegerät und das mitgelieferte Netzteil.
Versuchen Sie niemals, den Translux Wave-Akku mit einem anderen Ladegerät aufzuladen. Die Verwendung
eines anderen Ladegerätes kann zu Schäden am Akku führen und es besteht Explosions- und Brandgefahr!
Das Translux Wave-Ladegerät niemals zum Aufladen anderer Arten von Akkus oder anderer Geräte mit
wiederaufladbaren Batterien verwenden! Verwenden Sie nur Original-Akkus von Heraeus Kulzer.
Den Akku nicht mit scharfen Gegenständen gewaltsam öffnen, mit einem Hammer / Werkzeugen darauf
schlagen, auf den Akku treten oder ihn auf eine andere Weise starken Stößen oder Erschütterungen aussetzen.
Den Akku nicht ins Feuer legen und keiner Hitze aussetzen. Die Endelemente des Akkus niemals mit metallischen
Gegenständen kurzschließen, aufgrund des Risikos von Verbrennungen, Feuer- und Explosionsgefahr. Den Akku
niemals zusammen mit Halsketten, Haarnadeln oder anderen metallischen Gegenständen lagern oder tragen.
WARNHINWEIS – Den Akku niemals zerlegen oder modifizieren!
Die im Akku integrierten Sicherheitsmechanismen können bei Beschädigung zu einer Überhitzung, Rissen,
Explosion oder Entzündung des Akkus führen.
WARNHINWEIS – Den Akku nicht in oder in die Nähe von Feuer oder anderen Standorten mit hohen
Temperaturen legen.
Den Akku keinem direkten Sonnenlicht aussetzen. Dies könnte dazu führen, dass der Akku überhitzt, einen
Riss bekommt oder sich entzündet. Eine solche Verwendung kann auch zu einer Verringerung der Leistung
DE
und Verkürzung der Lebensdauer des Akkus führen.
WARNHINWEIS – Im Falle eines Feuers KEIN WASSER AUF DEN BRENNENDEN AKKU KIPPEN!
-7Es muss ein Feuerlöscher für die Brandklasse C (nach der europäischen Norm EN 3) verwendet werden.
WARNHINWEIS – Entsorgung von beschädigten oder verbrauchten Akkus.
Beschädigte oder verbrauchte Akkus sind zu entsorgen, nachdem die folgenden notwendigen Schritte
zur Verhinderung eines externen Kurzschlusses durchgeführt wurden:
Nach Isolierung der Pole des Akkus mit Isolierband, den Akku gemäß den gesetzlichen und lokalen
Bestimmungen entsorgen.
3.2.4 AKKU – Informationen
• AufladezeitfürleereoderneueAkkus:ca.3Stunden.
HINWEIS – NEUER Akku: erstes Aufladen
Die Aufladezeit beim ersten Aufladen beträgt rund 3 Stunden. Bei neuen Akkus oder Akkus, die lange
gelagert wurden, kann die Aufladezeit länger betragen. Der Akku erreicht seine volle Kapazität erst nach
einigen vollständigen Lade-/ Entladezyklen.
HINWEIS
Platzieren Sie das Handstück nach jeder Behandlung oder bei Nichtgebrauch im Ladegerät.
• Betriebszustand:
Betriebstemperatur: 10°C (50°F) bis 35°C (95°F).
Relative Luftfeuchtigkeit: 45% bis 85% RH.
Atmosphärischer Luftdruck: 800 hPa bis 1060 hPa.
ACHTUNG
Die Temperatur und die relative Luftfeuchtigkeit, in denen der Akku aufgeladen werden kann, reichen von
10°C (50°F) bis 35°C (95°F) bzw. 45% bis 85% RH. Ein Aufladen des Akkus bei Temperaturen außerhalb
dieses Bereichs kann zu Überhitzung oder Beschädigung des Akkus führen. Darüber hinaus kann ein Aufladen des Akkus bei Temperaturen außerhalb dieses Bereichs zu einer Beeinträchtigung der Akkuleistung
oder Reduzierung der Akku-Lebensdauer führen.
• Transport-undLagerbedingungenfürdenAkku:
Die empfohlene Temperatur und relative Luftfeuchtigkeit reicht von:
–20°C (–4°F) bis 40°C (104°F) bzw. 45% bis 85% RH.
Den Akku immer im aufgeladenen Zustand und nie länger als 5 Monate lagern.
Umgebungsluftdruck: 500 hPa bis 1060 hPa.
HINWEIS
Den Akku immer vor einem längeren Zeitraum der Inaktivität des Gerätes und mindestens einmal alle
5 Monate vollständig aufladen. Bei längerem Zeitraum ohne Betrieb ist die Batterie aus dem Handstück zu
entnehmen.
• Akkulebensdauer:
Der Translux Wave-Akku hat je nach Verwendung und den äußeren Bedingungen, unter denen er verwendet wird,
eine typische Lebensdauer von 300 bis 400 Ladezyklen.
HINWEIS
Akkus sind chemische Produkte, in denen chemische Reaktionen ablaufen. Daher vermindert sich die
Akku-Leistung nicht nur bei Verwendung, sondern auch mit der Zeit, wenn der Akku nicht benutzt wird.
3.2.5 HAFTUNG
Arbeiten an der elektronischen Ausrüstung des Gerätes dürfen nur durch Heraeus Kulzer, Heraeus Kulzer-Servicepartner oder geschultes Fachpersonal und nur im sicheren (spannungsfreien) Zustand durchgeführt werden.
Es dürfen nur zugelassene Originalersatzteile und -zubehöre verwendet werden.
Die Verwendung anderer Teile birgt unbekannte Risiken und ist in jedem Fall zu unterlassen.
Die Funktionstüchtigkeit und Sicherheit des Gerätes ist nur gewährleistet, wenn die notwendigen Prüfungen, Wartungsund Instandsetzungsarbeiten durch Heraeus Kulzer, Heraeus Kulzer-Servicepartner oder geschultes Fachpersonal
ausgeführt werden.
Für eventuelle aus einem Defekt / einer Fehlfunktion des Gerätes herrührende Schäden in Folge von unsachgemäßen
Instandsetzungen, welche nicht durch Heraeus Kulzer-Servicepartner oder durch von uns geschultes Personal durchgeführt wurden, oder im Falle, dass bei einem Teileaustausch nicht Originalersatz-/ Zubehörteile verwendet wurden,
haftet die Heraeus Kulzer GmbH nicht.
DE
4
Gerätebeschreibung
4.1
Lieferumfang
1 Ladegerät
2 Handstück
3 Lichtleiter, Ø = 8 mm
4 Blendschutzkegel
5 Lithium-Ionen-Akku
6 Universal-Netzteil (100 V – 240 V (
6a = Europa
Typ 1
6b = Großbritannien Typ 2
6c = USA / JP
Typ 3
-8-
4.2
4.2.1
1x
)) einschließlich internationaler Steckdosen-Adapter:
Beschreibung der Steuer- und Bedienelemente
Handstück
1 Schaltfläche „Start / Stopp”
2 LEDs der Aushärtungsmodi (GRÜN)
3 Akkustatus-LED (2-farbig: GRÜN / GELB)
4 Kontakte des Ladegerätes
5 Ausrichtungshilfe
2x
4.2.2 Ausrichtungshilfe
2x
Die Ausrichtungshilfe (5) befindet sich an der Rückseite am unteren Teil des Handstücks
und ermöglicht das korrekte Einsetzen des Handstücks in das Ladegerät.
Beim Einsetzen des Handstücks in das Ladegerät muss die Ausrichtungshilfe an der Führungsaussparung im Ladegerät ausgerichtet werden.
Durch einen Signalton wird bestätigt, dass sich die Kontakte in der richtigen Ladeposition befinden!
4.2.3
Ladegerät
1x
Ansicht der Elemente
1 Ladegerätabdeckung
7 Handstückhalter mit Ausrichtungshilfe und austauschbare Ladegerätkontakte
8 Lichtintensitätssensor
9
– GRÜNE LED
Funktion: Zeigt an, dass das Ladegerät mit Strom versorgt wird.
10
– 2-farbige LED (GRÜN / GELB)
Funktion: Informationen zur Lichtintensität.
GRÜN: Zeigt an, dass die Lichtintensität, die mit Hilfe des integrierten Lichtmessgerätes gemessen wird,
für eine effektive Behandlung geeignet ist.
GELB: Zeigt an, dass die Lichtintensität zu schwach ist.
Bodenansicht Ladegerät
11 Netzanschluss
12 Austauschbarer Ladekontakteinsatz
2x
4.2.4
Akustische Signale des Handstücks
Funktion /
Fehlermeldung
POLYMERISATIONSPROGRAMM:
10 Sekunden.
„SOFT-START“PROGRAMM:
20 Sekunden.
UNTERBRECHUNG DES
BELICHTUNGSZYKLUS
SIGNAL BEI
SCHWACHEM AKKU
Die verbleibende Akkuladung reicht noch für
einige Belichtungszyklen.
SIGNAL BEI LEEREM
AKKU
Ein weiterer Belichtungszyklus kann nicht
gestartet werden.
SIGNALTON BEI
DEFEKTEM AKKU
LED-Lichtquelle defekt
ÜBERHITZUNG
INTEGRIERTER
Überhitzungssensor
defekt
Die Ladeschaltung des
Handstücks ist defekt
Hinweis: Dieser Zustand
wird nur erfasst, wenn
sich das Handstück im
Ladegerät befindet.
Schaltflächenbedienung am Handstück
Abgegebene(s) akustische(s) Signal(e)
Anzeigen auf dem Handstück
• 1 Signalton beim Drücken der Schaltfläche
• Schaltfläche„START / STOPP“
kurz
„START / STOPP“.
drücken, um die Belichtung zu starten.
• 1 Signalton am Ende der Belichtung.
Die grüne LED leuchtet 10 Sekunden lang.
• 1 Signalton beim Drücken der Schaltfläche
• Schaltfläche„START / STOPP“
„START / STOPP“.
mindestens eine Sekunde lang drücken,
• 1 Signalton nach 1 Sekunde zur akustischen
um die Belichtung zu starten.
Anzeige, dass in den „Soft-Start“-Mode
gewechselt wurde.
• 1 Signalton nach 10 Sekunden Belichtungszeit.
• 1 Signalton am Ende der Belichtung.
Die grüne LED leuchtet 20 Sekunden lang.
• DerBelichtungszykluskannjederzeitund • 1 Signalton beim Drücken der Schaltfläche
bei jedem Programm vor Ablauf der Belich„START / STOPP“.
tungszeit unterbrochen werden, indem
die Schaltfläche „START / STOPP“
gedrückt wird.
• 2 Signaltöne am Ende des Belichtungszyklus.
• DasAkkusymbolblinktgrün.
Handstück in der Ladestation aufladen!
• 2 Signaltöne ohne Start eines Belichtungszyklus.
• DasAkkusymbolblinktgrün.
Handstück in der Ladestation aufladen!
Nur wenn sich das Handstück im Ladegerät
befindet.
• Über30SekundenwirdproSekunde
ein 1 Signalton abgegeben.
Die Akkustatus-LED leuchtet GELB.
Kein akustisches Signal wird abgegeben.
Die grüne LED des aktiven Belichtungszyklus
blinkt.
• 3 Signaltöne werden ausgegeben.
Die Elektronik lässt die Unterbrechung des
Belichtungszyklus zu.
• 4 Signaltöne beim Start eines Belichtungszyklus.
Zwei grüne LEDs (10 s / 20 s) auf dem Handstück blinken.
DE
-9-
4.2.5
DE
- 10 -
LED Information bezüglich ausgesendeter Strahlung
Das Gerät verwendet LED mit hoher Lichtstärke der Klasse 2M (IEC 60825-1).
LED-Strahlung.
Nicht in den Lichtstrahl blicken oder direkt mit optischen
LED RADIATION
Instrumenten ansehen.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• LEDProduktderKlasse2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Max. Leistung: < 5.00 mW.
• Dominante Wellenlänge: Min. 440 nm – Max. 465 nm.
WARNHINWEIS
Divergente Strahlen
Nicht mit optischen Instrumenten wie Monokeln, Vergrößerungsgläsern oder Mikroskopen aus einer Entfernung
von weniger als 100 mm in das LED-Licht blicken, da dies die Augen schädigen kann.
Kollimierte Strahlen
Nicht mit optischen Fernbeobachtungs-Instrumenten wie Teleskopen oder Ferngläsern in das LED-Licht
blicken, da dies die Augen schädigen kann.
Bei Auftreten eines Schadens der LED-Steuerschaltung wird der Wert der LED-Strahlungsemission im Vergleich
zum Wert bei normalem Gebrauch des Medizinproduktes nicht überschritten.
Aufkleber wie oben dargestellt befinden sich auf der Verpackung des Gerätes.
5
Installation und Inbetriebnahme
Die folgenden Abschnitte enthalten Informationen und Hinweise für einen erfolgreichen und fehlerfreien Betrieb
des Gerätes. Vor der Inbetriebnahme des Translux Wave-Gerätes sind die Anweisungen in der unten beschriebenen
Reihenfolge zu befolgen.
Das Medizinprodukt befindet sich nur dann in Übereinstimmung mit den Sicherheitsstandards, wenn es nach den hier
nachfolgend beschriebenen Anweisungen installiert wurde.
Das Gerät muss an einem für die Nutzung geeigneten Ort installiert werden. Das Ladegerät auf einer festen, trockenen,
flachen und horizontalen Fläche platzieren.
WICHTIG
Das Handstück ist gemäß seiner bestimmungsgemäßen Anwendung für den Einsatz in der Patientenumgebung
bestimmt. Hingegen sind Ladestation und Netzteil entsprechend ihrer bestimmungsgemäßen Anwendung für
den Einsatz außerhalb der Patientenumgebung bestimmt.
HINWEIS
Die Patientenumgebung ist definiert als Bereich von 1,5 m um den Patienten (siehe IEC 60601-1, 3. Ausgabe
und IEC 60601-1-1).
WARNHINWEIS
Überprüfen Sie vor der Installation immer das Gerät und die Komponenten auf eventuelle Schäden.
Bei offensichtlichen Schäden nicht mit der Installation des Gerätes fortfahren.
Der Anwender darf nicht gleichzeitig in Kontakt mit einem Gegenstand außerhalb der Patientenumgebung
(Ladestation und Netzteil) und dem Patienten treten.
Schließen Sie keine externen Komponenten an das medizinische System an.
5.1
Sicherheitsanforderungen während der Installation
WARNHINWEIS
Die Elektroinstallation in den Räumlichkeiten, in denen das Gerät installiert und verwendet wird, muss den
geltenden Rechtsvorschriften und sicherheitsrelevanten Vorgaben für Elektroanlagen entsprechen.
Das Gerät an einem Ort installieren, wo es vor Stößen und versehentlichen Wasserspritzern oder anderen
Flüssigkeiten geschützt ist. Das Gerät keiner direkten Sonneneinstrahlung, UV-Licht, aussetzen.
Das Gerät nicht auf oder nahe von Wärmequellen installieren. Bei der Installation darauf achten, dass eine ausreichende Luftzirkulation rund um das Gerät gewährleistet ist. Das Gerät nicht in der Nähe von Lösungsmitteln
oder brennbaren Flüssigkeiten installieren, da diese das Kunststoffgehäuse des Gerätes beschädigen könnten.
Der Stecker des Netzteils (Direktanschluss), Modell PSAC05R-050, dient der Isolierung des medizinischen
Gerätes gegenüber der Netzspannung. Wenn der Stecker eingesteckt wurde, muss das Netzteil einfach
erreichbar sein. Lassen Sie genügend Freiraum um das Gerät! Das medizinische Gerät sollte nicht so
positioniert werden, dass sich daraus Schwierigkeiten mit der Trennung der Spannungsversorgung ergeben
(Stecker zum Netzteil).
Die Endelemente des Akkus niemals mit metallischen Gegenständen kurzschließen, da dies zu Verbrennungen,
Brand und Explosion führen kann.
Das Gerät kann transportiert werden, muss jedoch mit Vorsicht gehandhabt werden. Das Gerät in einer horizontalen Position transportieren. Das Gerät keinen Erschütterungen oder Vibrationen aussetzen. Abmessungen und
Gewicht werden in Kapitel 12 beschrieben (Technische Daten).
WARNUNG – EXPLOSIONSGEFAHR
Das Gerät nicht an einem Ort installieren, an dem Explosionsgefahr besteht. Das Gerät darf nicht in einer
brennbaren Atmosphäre verwendet werden (Anästhesiegase, Sauerstoff, Stickstoffoxid usw.). Das Gerät in
einem gut belüfteten Raum installieren.
5.2
Anschluss des Ladegerätes an die Steckdose
1x
Das Translux Wave-Gerät wird mit einem separaten Universal-Netzteil (6) geliefert,
), 50 / 60 Hz akzeptiert.
das 100 bis 240 V (
WARNHINWEIS
Vor Anschluss des Ladegerätes (6) an das Stromnetz ist sorgfältig zu prüfen, dass die Spannung und Frequenz
des Stromnetzes den auf dem Typenschild des Gerätes angegebenen Werten entsprechen. Das Typenschild
befindet sich an der Unterseite des Ladegerätes.
Nur das Netzteil verwenden, welches mit dem Gerät geliefert wurde. Die Verwendung eines anderen Netzteils
kann eine Beschädigung der Batterie verursachen.
Verbinden Sie das Netzteil nicht über eine portable Mehrfachsteckdose mit der Netzspannung!
HINWEIS
Die Translux Wave-Stromversorgungseinheit (6) wird mit drei austauschbaren Adaptern geliefert:
Typ 1
Abb. (6 a) = Europa
Abb. (6 b) = Großbritannien Typ 2
Abb. (6 c) = USA / JP
Typ 3
1 Wählen Sie aus den verfügbaren Adaptern den passenden aus:
Europa – Typ 1, Großbritannien – Typ 2, USA / JP – Typ 3.
2 Jeder Adapter besitzt eine Aussparung, in die die Verriegelung am Netzteil passt.
3 Den Adapter so auf dem Netzteil platzieren, dass die Aussparung zum Netzteil zeigt und die Schienen auf dem
Adapter in die jeweiligen Aussparungen auf dem Netzteil passen.
4 Auf den Adapter und das Netzteil drücken und dabei den Adapter in das Netzteil schieben, bis ein Klicken zu hören
ist und der Adapter eingerastet ist.
HINWEIS
Durch Drücken auf den Adapter bei der Installation wird sichergestellt, dass alle Schienen von den Haltern
am Netzteil gehalten werden. Wenn sich der Adapter locker anfühlt, diesen entfernen und erneut installieren.
5 Zum Entfernen des Adapters vom Netzteil die Schaltfläche für den Halteriegel drücken (mit dem Wort „PUSH“
(DRÜCKEN) gekennzeichnet) und den Adapter vom Netzteil schieben und entfernen.
6 Bewahren Sie unbenutzte Adapter für eine spätere Verwendung auf.
7 Den Stecker des Stromkabels in die Buchse an der Unterseite des Ladegerätes stecken.
WARNHINWEIS
Das Netzkabel, das Netzteil und den Adapter regelmäßig prüfen, um sicherzustellen, dass sie in gutem
Zustand sind. Bei sichtbaren Schäden das Gerät nicht verwenden, bevor das beschädigte Teil ersetzt
wurde. Verwenden Sie nur Original-Ersatzteile oder Zubehörteile von Heraeus Kulzer.
8 Das Netzteil mit Adapter in die Steckdose stecken.
9 Die GRÜNE LED auf dem Ladegerät leuchtet (Symbol
).
5.3
Einsetzen des Akkus in das Handstück
Das Translux Wave-Gerät wird über einen leistungsstarken Lithium-Ionen-Akku mit Strom versorgt. Der Akku wird
separat in der Verpackung des Gerätes geliefert und muss vor Inbetriebnahme in das Handstück eingesetzt werden.
WARNHINWEIS
Alle im Kapitel 3.2.3 beschriebenen Sicherheitshinweise (AKKU – Sicherheitshinweise) sind genau zu befolgen.
DE
- 11 -
ACHTUNG
NIEMALS das Handstück in die Ladestation platzieren, wenn der Akku sich nicht im Handstück befindet.
Den Akku in der unten beschriebenen Reihenfolge in das Handstück einsetzen:
1 Den Akku aus der Verpackung nehmen.
WARNHINWEIS
Die Pole des Akkus niemals mit metallischen Gegenständen kurzschließen, da dies zu Verbrennungen,
Brand und Explosion führen kann.
2 Den Deckel des Akkufachs mit Hilfe eines flachen Werkzeugs (z. B. einer Münze) entgegen
dem Uhrzeigersinn vom Handstück lösen (Abb. 1 und 2 ).
3 Das Akkufach ist mit einem Pfeil gekennzeichnet (Abb. 3 ).
HINWEIS
Dieser Pfeil zeigt die Ausrichtung an, in der der Akku in das Handstück eingesetzt werden muss.
DE
- 12 -
2x
4 Langsam den Akku mit dem Pfeil in Richtung des Gehäuses bis zum Anschlag in das Handstück schieben (Abb. 4 ).
HINWEIS
Wenn der Akku in der falschen Ausrichtung (d. h. in entgegengesetzter Richtung des Pfeils) eingesetzt wird,
funktioniert das Handstück nicht. Das Einsetzen des Akkus in der falschen Ausrichtung beeinträchtigt nicht
die Elektronik des Handstücks.
WARNHINWEIS
Verwenden Sie nur Original-Akkus von Heraeus Kulzer. Die Verwendung von Akkus von anderen Herstellern
oder von nicht aufladbaren Batterien / Primärbatterien stellt eine potenzielle Gefahr dar und kann das Gerät
irreparabel beschädigen.
5 Den Deckel des Akkufachs am Handstück mit Hilfe eines flachen Werkzeugs (z. B. einer Münze) im Uhrzeigersinn
festdrehen.
HINWEIS
Das Gerät funktioniert nicht richtig, wenn der Deckel des Handstückes nicht richtig festgeschraubt ist.
5.4
Einsetzen des Lichtleiters in das Handstück
2x
• DenLichtleiterleichtdrehen(1) und in das Handstück einführen (2), bis die endgültige Position
erreicht ist. Die endgültige Position ist erreicht, wenn ein „Klicken“ zu hören ist.
• DenBlendschutzkegel(3) auf die Spitze des Lichtleiters setzen.
Positionieren des Lichtleiters
• DrehenSiedenLichtleiterindiegewünschtePositionfürdiePolymerisation.
• UmdieLichtintensitätinvollemUmfangnutzenzukönnen,denLichtleitermöglichstnaheamKompositplatzieren.
Direkten Kontakt mit dem Kompositmaterial vermeiden!
ACHTUNG – Damit die volle Lichtintensität erreicht wird, den Lichtleiter immer sauber halten.
Die Lichtintensität wird erheblich beeinträchtigt, wenn:
– der Lichtleiter nicht in einwandfreiem Zustand ist (zerkratzt oder abgesplittert).
– der Lichtleiter nicht richtig im Handstück eingesetzt ist.
– der Lichtleiter mit Kompositmaterial verschmutzt ist.
WARNHINWEIS
Ein beschädigter Lichtleiter reduziert die Lichtintensität und muss unverzüglich durch einen neuen ersetzt
werden. Scharfe Kanten können schwere Verletzungen verursachen. Nur Original-Lichtleiter von Heraeus Kulzer
verwenden.
WARNHINWEIS – Infektionskontrolle:
Damit die Behandlung für die Patienten und Anwender so sicher wie möglich ist, müssen der Lichtleiter und
der Blendschutzkegel vor jeder Behandlung gereinigt, desinfiziert und sterilisiert werden. Befolgen Sie die
Anweisungen in Kapitel 8 (Reinigung, Desinfektion und Sterilisation) Schritt für Schritt.
5.5
Aufladen des Akkus
ACHTUNG – NEUER Akku: erstes Aufladen
Der Translux Wave-Akku wurde werkseitig teilweise aufgeladen. Deshalb muss der Akku vor der ersten Verwendung des Translux Wave-Gerätes vollständig aufgeladen werden.
HINWEIS – NEUER Akku: erstes Aufladen
Die Aufladezeit beim ersten Aufladen beträgt rund 3 Stunden. Bei neuen Akkus oder Akkus, die lange gelagert
wurden, kann die Aufladezeit länger betragen. Der Akku erreicht seine volle Kapazität erst nach einigen vollständigen Lade-/ Entladezyklen.
WARNUNG – EXPLOSIONSGEFAHR
Nur das Ladegerät verwenden, das mit dem Translux Wave-Gerät zum Aufladen des Akkus mitgeliefert wurde.
Versuchen Sie niemals, den Akku mit einem anderen Ladegerät oder einer anderen Stromquelle aufzuladen,
da Explosions- und Brandgefahr besteht.
Das Handstück mit dem Akku in das Translux Wave-Ladegerät einsetzen.
2x
Durch einen Signalton wird bestätigt, dass sich die Kontakte in der richtigen Ladeposition
befinden!
WICHTIGER HINWEIS – Ausrichtungshilfe
Die Ausrichtungshilfe (5) befindet sich an der Rückseite am unteren Teil des Handstücks und ermöglicht das
korrekte Einsetzen des Handstücks in das Ladegerät. Beim Einsetzen des Handstücks in das Ladegerät muss
die Ausrichtungshilfe an der Führungsaussparung im Ladegerät ausgerichtet werden.
Akkuladeprozess.
• DiegrüneAkkustatus-LEDaufdemHandstückfängtanzublinken.
• WennderLadevorgangabgeschlossenistundderAkkuvollständigaufgeladenist,leuchtetdiegrüneAkkustatusLED durchgehend.
WICHTIGER HINWEIS – Akku defekt
Wenn die Elektronik des Handstücks während des Ladevorgangs eine Fehlfunktion des Akkus feststellt,
wird der Ladevorgang unterbrochen und die Akkustatus-LED blinkt GELB.
In diesem Fall wird 30 Sekunden lang jede Sekunde ein „Signalton“ ausgegeben.
Den defekten Akku durch einen Neuen ersetzen!
WARNHINWEIS
Ausschließlich Akkus von Heraeus Kulzer verwenden!
HINWEIS
Die Funktionen des Handstücks sind nicht aktiv, wenn es sich im Ladegerät befindet. Die Schaltfläche
„Start / Stopp“
des Handstücks ist nicht funktionsfähig.
Das Handstück kann während des Ladevorgangs aus dem Ladegerät genommen werden, der Akku ist
dann jedoch u. U. nicht vollständig geladen und die Betriebszeit aufgrund dessen verkürzt.
6
Betrieb
WARNHINWEIS – Überprüfen Sie den Zustand des Gerätes vor Beginn der Behandlung.
Vor der Behandlung stets sicherstellen, dass das Gerät funktionstüchtig und das Zubehör (Lichtleiter und
Blendschutzkegel) einsatzfähig ist. Wird während der Behandlung etwas festgestellt, die Behandlung nicht
durchführen und Heraeus Kulzer oder den zuständigen Mitarbeiter des Kundendienstes informieren (siehe
Kapitel 14 Service). Bei sichtbaren Schäden dürfen Gerät und Zubehör nicht verwendet werden.
Vor der Verwendung des Translux Wave-Gerätes muss sichergestellt werden, dass die Intensität des ausgestrahlten Lichts für die Polymerisation ausreicht. Die Lichtintensität mit Hilfe des im Ladegerät integrierten
Lichtmessgerätes überprüfen (siehe Kapitel 6.2 Messen der Lichtintensität).
WARNHINWEIS – Infektionskontrolle
Erste Verwendung
Das Zubehör, Lichtleiter und Blendschutzkegel, wird UNSTERIL geliefert und muss vor der ersten
Verwendung sterilisiert werden.
Jede Verwendung
Nach Gebrauch muss das Zubehör, Lichtleiter und Blendschutzkegel, entsprechend den in Kapitel 8 (Reinigung,
Desinfektion und Sterilisation) beschriebenen Verfahren vor jeder Verwendung wieder aufbereitet werden.
6.1
Aktivieren und Deaktivieren des Belichtungszyklus
Das Translux Wave-Gerät kann mit zwei verschiedenen Belichtungszyklen betrieben werden:
– Belichtung mit konstanter Lichtleistung: Zyklusdauer 10 Sekunden.
– Belichtung mit langsam hochgeregelter Lichtleistung: „Soft-Start“ (Zyklusdauer 20 Sekunden).
Beim „Soft-Start“ steigt die Lichtleistung innerhalb von 2 Sekunden von 50% auf 100% an.
DE
- 13 -
• WennsichdasHandstückim„Ruhemodus“ befindet (alle Aushärtungsmodus-LEDs auf dem Handstück sind AUS),
kurz die Schaltfläche „Start / Stopp“
drücken, um das Handstück wieder in Betrieb zu nehmen.
(Nach Wiederinbetriebnahme leuchtet standardmäßig die 10-Sekunden-LED.)
Belichtung: 10-Sekunden-Polymerisation
Kurz die Schaltfläche „Start / Stopp“
drücken. Die Lichtemission wird eingeschaltet.
Die 10-Sekunden-LED leuchtet und zeigt an, dass dieses Programm ausgeführt wird.
Nach Beendigung des Belichtungszyklus schaltet das Gerät die Lichtquelle automatisch aus.
Akustisches Signal:
Die folgenden Signaltöne werden ausgegeben:
1 Signalton während die Schaltfläche „Start / Stop“ gedrückt wird.
1 Signalton am Ende der Belichtungszeit.
DE
- 14 -
Belichtung: 20-Sekunden-„Soft-Start“-Polymerisation
Schaltfläche „Start / Stopp“
mindestens eine Sekunde lang drücken. Die Lichtemission wird eingeschaltet.
Die 20-Sekunden-LED leuchtet und zeigt an, dass dieses Programm ausgeführt wird.
Nach Beendigung des Belichtungszyklus schaltet das Gerät die Lichtquelle automatisch aus und kehrt in den
10-Sekunden-Modus zurück (10-Sekunden-LED leuchtet).
Akustisches Signal:
Die folgenden Signaltöne werden ausgegeben:
1 Signalton während die Schaltfläche „Start / Stopp“ gedrückt wird.
1 Signalton nach 1 Sekunde zur akustischen Anzeige, dass in den „Soft-Start“-Mode gewechselt wurde.
1 Signalton nach 10 Sekunden Belichtungszeit.
1 Signalton am Ende der Belichtungszeit.
HINWEIS
Der Belichtungszyklus kann jederzeit vor Ablauf der Belichtungszeit unterbrochen werden,
indem die Schaltfläche „Start / Stopp“ erneut gedrückt wird.
Akustisches Signal:
Ein akustisches Signal (Signalton) wird ausgegeben, wenn die Schaltfläche „Start / Stopp“ zum Unterbrechen
des Belichtungszyklus gedrückt wird.
6.2
Messen der Lichtintensität
Das Ladegerät des Translux Wave-Gerätes ist mit einem integrierten Lichtmessgerät
2x
ausgestattet (8).
ACHTUNG
Vor jeder Behandlung die Lichtintensität mit Hilfe des Lichtmessgerätes überprüfen,
das im Ladegerät des Translux Wave-Gerätes integriert ist.
• DenLichtleiterflachundohneAusübungvonDruckdirektaufdemTestbereichplatzieren(8).
Das Gerät durch Drücken der Schaltfläche „Start / Stopp“
aktivieren (unabhängig von der ausgewählten
Belichtungszeit).
) angezeigt, die sich rechts
Die Messung der Lichtintensität wird sofort durch eine zweifarbige LED (Symbol
neben dem Lichtsensor befindet.
GRÜNE LED: Die Lichtintensität ist ausreichend für die Behandlung.
GELBE LED: Die Lichtintensität ist nicht ausreichend und der Patient darf nicht behandelt werden.
ACHTUNG
Wenn die Lichtintensität nicht ausreicht, die folgenden Kontrollen und Messungen durchführen:
– wurde der Lichtleiter nicht / oder nicht vollständig in das Handstück eingesetzt
(siehe Kapitel 5.4 Einsetzen des Lichtleiters in das Handstück).
– den Lichtleiter auf Kontamination oder Beschädigungen überprüfen.
– den Lichtleiter von Kontaminationen (siehe Kapitel 8 Reinigung, Desinfektion und Sterilisation)
befreien oder den beschädigten Lichtleiter durch einen Neuen austauschen.
Nur Original-Lichtleiter von Heraeus Kulzer verwenden!
WARNHINWEIS
Wenn die oben beschriebenen Maßnahmen keine Abhilfe schaffen, darf das Gerät nicht für eine Behandlung verwendet werden. Das Gerät ausschalten (trennen Sie das Ladegerät von der Stromquelle) und
sicherstellen, dass eine nicht autorisierte Reaktivierung des Gerätes nicht möglich ist. Einen Servicepartner
von Heraeus Kulzer oder eine technisch geschulte und von Heraeus Kulzer autorisierte Person kontaktieren
(siehe Kapitel 14 Service).
6.3
Ruhemodus
Das Handstück verfügt über einen „Ruhemodus“, um den Energieverbrauch des Gerätes gering zu halten.
Wenn das Handstück sich nicht im Ladegerät befindet, werden seine internen Funktionen nach 5 Minuten Inaktivität
automatisch ausgeschaltet („Ruhemodus“).
Im „Ruhemodus“ sind die Aushärtungsmodus-LEDs auf dem Handstück ausgeschaltet.
Zum Beenden des „Ruhemodus“ die Schaltfläche „Start / Stopp“
Das Handstück ist wieder betriebsbereit.
6.4
7
drücken.
DE
Weitere Informationen zum Betrieb des Gerätes
HINWEIS
Wenn das Handstück in das Ladegerät eingesetzt wird, bevor der Aushärtungszyklus beendet ist,
wird die Lichtemission automatisch ausgeschaltet.
Die Funktionen des Handstücks sind nicht aktiv, wenn es sich im Ladegerät befindet. Die Schaltfläche
„Start / Stopp“
ist nicht funktionsfähig.
Translux Wave ist mit einem Mikroprozessor ausgestattet, der zur kontinuierlichen Kontrolle der optimalen
Ladungsparameter des Akkus dient. Daher sollte das Handstück nach jeder Behandlung, unabhängig vom
Akkustand, in das Ladegerät eingesetzt werden.
Störungsmeldungen
7.1
Defekter Akku
Im Fall eines defekten Akkus blinkt die Akkustatus-LED auf dem Handstück
ununterbrochen GELB (Abb. a).
Parallel dazu wird über 30 Sekunden pro Sekunde ein „Signalton“ ausgegeben.
WICHTIG
Diese Störung wird nur erfasst, wenn sich das Handstück im Ladegerät befindet.
blinkt
7.2
Defekte LED
Wenn der Mikroprozessor eine defekte LED erkennt, fängt die zugehörige grüne
Aushärtungsmodus-LED „10s“ an zu blinken (Abb. b).
blinkt
a
b
7.3
Überhitzungsschutz
Wenn mehrere Aushärtungszyklen schnell hintereinander erfolgen (ca. 18 aufeinanderfolgende Zyklen, jeweils 20 Sekunden lang), kann der integrierte Überhitzungssensor aktiviert werden.
Sobald der Überhitzungsschutz auslöst, wird am Ende des Zyklus ein akustisches Signal (3 Signaltöne) ausgegeben.
Bei Aktivierung des Überhitzungsschutzes kann das Gerät einige Minuten lang nicht verwendet werden.
Das Handstück mindestens 4 – 5 Minuten lang abkühlen lassen. Danach den nächsten Belichtungszyklus
durch Drücken der Schaltfläche „Start / Stopp“
starten.
HINWEIS
Das Handstück ist nach dem Abkühlen automatisch wieder betriebsbereit – kein „Reset“ notwendig.
7.4
INTEGRIERTER Überhitzungssensor defekt
Im Falle eines defekten Überhitzungssensors ertönen „4 Signaltöne“ beim Start eines Belichtungszyklus.
HINWEIS
Tritt während des Belichtungszyklus ein Defekt des Überhitzungssensors auf, gestattet die Software
die Beendigung des laufenden Prozesses. Weitere Belichtungszyklen durch Betätigung der Schaltfläche
sind nicht mehr möglich und es ertönen „4 Signaltöne“.
„Start / Stopp“
Ein Betrieb mit defektem Überhitzungssensor ist nicht möglich.
- 15 -
7.5
Signal bei schwachem Akku
Wenn nach häufigem Gebrauch der Ladezustand des Akkus auf ein Minimum sinkt, ermöglicht der Translux WaveMikroprozessor noch einige Belichtungszyklen (in einem beliebigen Aushärtungsmodus) ohne erneute Aufladung.
Dieser Zustand wird am Ende jedes Zyklus durch „2 Signaltöne“ signalisiert.
Die Akkuanzeige blinkt grün. Akku aufladen!
Nach Abschluss von einigen Zyklen können aufgrund der geringen Akkuladung keine weiteren Belichtungszyklen
durchgeführt werden. Dieser Zustand wird durch „2 Signaltöne“ signalisiert.
Die Akkuanzeige blinkt grün. Akku aufladen!
8
Reinigung, Desinfizierung und Sterilisation
VOM NETZ TRENNEN
Vor der Durchführung von Reinigungs- und Desinfektionsverfahren muss die Ladestation von der Stromquelle
getrennt werden!
WARNHINWEIS
Infektionskontrolle
Der Lichtleiter und der Blendschutzkegel werden in UNSTERILEM Zustand geliefert und müssen vor
der ersten sowie jeder weiteren Verwendung gereinigt, desinfiziert und sterilisiert (Dampf) werden.
Das Handstück und Ladegerät nicht sterilisieren.
Den Akku NICHT sterilisieren!
DE
- 16 -
8.1
Einzelteile entnehmen
Den Blendschutzkegel vom Lichtleiter abnehmen.
Lichtleiter entfernen: Den Lichtleiter etwas drehen und aus dem Handstück ziehen.
8.2
LICHTLEITER – Reinigung und Desinfektion
ACHTUNG
Keine scharfen oder spitzen Gegenstände zum Reinigen des Lichtleiters verwenden. Die Oberfläche
des Lichtleiters könnte verkratzt werden und die Lichtübertragung könnte dadurch verschlechtert werden.
Keine Reinigungs-/ Desinfektionsmittel mit organischer, anorganischer und oxidierender Säure,
Wasserstoffperoxid, Chlorid, Iod, Bromid und Lösungsmitteln verwenden.
1) Nach der Verwendung müssen alle Rückstände (Kompositmaterial) von der Oberfläche des Lichtleiters entfernt
werden. Polymerisiertes Kompositmaterial und Rückstände müssen mit Ethanol und einem Kunststoffspatel oder
einer weichen Nylonbürste entfernt werden.
2) Den Lichtleiter mit einem sauberen, weichen, fusselfreien Tuch desinfizieren, das mit einer milden Desinfektionslösung mit mittlerem pH-Wert (pH 7) gemäß den Angaben des Herstellers befeuchtet ist. Die Desinfektionslösung
trocknen lassen.
8.2.1 LICHTLEITER – Inspektion vor der Sterilisation
Vor dem Sterilisieren den Lichtleiter sorgfältig auf Schäden an der Oberfläche, Verfärbungen und Kontamination prüfen.
WARNHINWEIS
Keinen beschädigten Lichtleiter verwenden.
Wenn Schäden sichtbar sind, den Lichtleiter durch einen Neuen ersetzen.
Wenn der Lichtleiter noch immer kontaminiert ist, den Reinigungs- und Desinfektionsvorgang wiederholen.
8.3
BLENDSCHUTZKEGEL – Reinigung und Desinfektion
ACHTUNG
Keine Reinigungs-/ Desinfektionsmittel mit organischer, anorganischer und oxidierender Säure,
Wasserstoffperoxid, Chlorid, Iod, Bromid und Lösungsmitteln verwenden.
Den Blendschutzkegel mit einem weichen Tuch reinigen und desinfizieren, dass mit einer milden Desinfektionslösung mit mittlerem pH-Wert (pH 7) gemäß den Angaben des Herstellers befeuchtet ist. Die Desinfektionslösung
trocknen lassen.
8.3.1 BLENDSCHUTZKEGEL – Inspektion vor der Sterilisation
Vor dem Sterilisieren den Blendschutzkegel sorgfältig auf Schäden an der Oberfläche,
Verfärbungen und Kontamination prüfen.
WARNHINWEIS
Keinen beschädigten Blendschutzkegel verwenden.
Wenn Schäden sichtbar sind, den Blendschutzkegel durch einen Neuen ersetzen.
Ein beschädigter Blendschutzkegel bietet nicht genug Schutz vor dem Licht des Gerätes.
Wenn der Blendschutzkegel noch immer kontaminiert ist, den Reinigungs- und Desinfektionsvorgang
wiederholen.
8.4
LICHTLEITER und BLENDSCHUTZKEGEL – Verpackung vor der Sterilisation
Der Lichtleiter und Blendschutzkegel können in einem medizinischen Einweg-Dampfsterilisationsbeutel in passender
Größe sterilisiert werden.
ACHTUNG
Der Lichtleiter und Blendschutzkegel müssen in zwei separate Beutel eingepackt werden.
Beim Sterilisieren mehrerer Instrumente in einem Autoklaven beachten, dass die maximale Ladekapazität
des Autoklavens nicht überschritten wird.
WARNHINWEIS
Sicherstellen, dass der innere Beutel groß genug für die einzelnen Instrumente ist, damit der Verschluss
nicht belastet und die Verpackung nicht reißen kann.
8.4.1 LICHTLEITER und BLENDSCHUTZKEGEL – Sterilisation
8.4.1.1 Sterilisationsverfahren
• DieSterilisationmiteinemDampfautoklaven(Vorvakuum)durchführen.
ACHTUNG
Nie ein anderes Sterilisationsverfahren anwenden, da das Material, aus dem der Lichtleiter hergestellt ist,
hierfür möglicherweise nicht geeignet ist.
KEINE der folgenden Sterilisationsverfahren anwenden: Ethylenoxid-Sterilisation, Heißluftsterilisation,
Schnellsterilisation, STERRAD-Sterilisation, STERIS-System oder ähnliche Sterilisationssysteme.
Den Lichtleiter und Blendschutzkegel NICHT mit folgenden Mitteln sterilisieren: Wasserstoffperoxid, Peroxyessigsäure, Formaldehyd und Glutaraldehyd.
8.4.1.2 Sterilisationsparameter
• Mindest-Sterilisationsparameter mit einem SAL-Wert von 10 –6 (Sterility Assurance Level).
Zyklusart
Vorvakuum
Mindesttemperatur
132°C + 3°C
(270°F + 5°F)
Mindestbehandlungszeit (Beutel)
4 Minuten
Mindesttrockenzeit
20 Minuten
ACHTUNG
Die Temperatur darf 135°C (275°F) nicht überschreiten.
8.5
HANDSTÜCK – Reinigung und Desinfektion
2x
WARNHINWEIS
Das Handstück ist nicht wasserdicht.
Keine Flüssigkeiten direkt auf die Oberfläche und die Kontakte des Handstücks sprühen.
Reinigungs- und Desinfektionsmittel dürfen nicht in das Innere des Handstücks gelangen!
Das Handstück NIE in Flüssigkeiten tauchen.
Das Handstück NIE unter fließendem Wasser reinigen.
Das Handstück nicht sterilisieren. Es können schwere Schäden, Elektroschock und Brand verursacht werden!
DE
- 17 -
Das Gehäuse des Handstücks mit einem sauberen, weichen, fusselfreien Tuch reinigen, das mit einem milden
Desinfektionsmittel (mit neutralem pH-Wert von pH 7 gemäß den Angaben des Herstellers) befeuchtet ist.
Das Desinfektionsmittel trocknen lassen oder die Rückstände des Desinfektionsmittels am Handstück mit einem
weichen, fusselfreien Tuch abwischen.
ACHTUNG
Keine Lösungsmittel wie Aceton, Isopropanol und Wasserstoffperoxid, Chlorid, Iod, Bromid, Phenol oder andere
aggressive Lösungen zum Reinigen und Desinfizieren der Kunststoffoberfläche des Handstücks verwenden.
Diese Substanzen können schädlich sein und zu Verfärbungen und / oder Schäden am Kunststoffmaterial des
Handstücks führen. Es dürfen keine Scheuermittel verwendet werden!
WICHTIG: Reinigen der Kontakte des Handstücks
Nach dem Reinigen / Desinfizieren des Kunststoffgehäuses des Handstücks immer die Kontakte reinigen,
die sich auf der Unterseite des Handstücks befinden. An den Kontakten des Handstücks dürfen sich keine
Verschmutzungen, Komposit- und Reinigungs-/ Desinfektionsmittelrückstände befinden.
WICHTIG
Die Kontakte des Handstücks müssen regelmäßig (mindestens einmal pro Woche) und immer nach dem
Reinigen und Desinfizieren des Kunststoffgehäuses des Handstücks gereinigt werden. Verschmutzte oder durch
Reinigungs- oder Desinfektionsmittel benetzte Kontakte können den Ladevorgang beeinträchtigen, so dass der
Akku nicht aufgeladen werden kann.
Die Kontakte des Handstück-Ladegerätes mit einem fusselfreien und mit Alkohol befeuchteten Tuch oder
Wattetupfer reinigen.
ACHTUNG
Keine scharfen oder spitzen Gegenstände zum Reinigen der Handstückkontakte verwenden. Die Oberfläche könnte
verkratzt und beschädigt werden, so dass die Leitfähigkeit der Kontakte des Ladegerätes beeinträchtigt würde.
Vor dem Wiederverwenden des Handstücks sicherstellen, dass die Oberfläche und die Kontakte des Ladegerätes vollständig trocken sind. Die Kontakte bei Bedarf mit Druckluft trocknen.
DE
- 18 -
8.6
LADEGERÄT – Reinigen des Gehäuses
VOM NETZ TRENNEN
Das Netzteil vor dem Reinigen / Desinfizieren vom Stromnetz und vom Ladegerät trennen.
WARNHINWEIS
Das Gehäuse des Ladegerätes ist nicht wasserdicht.
Keine Flüssigkeiten direkt auf die Oberfläche des Gehäuses des Ladegerätes sprühen.
ACHTUNG
Das Ladegerät darf NICHT sterilisiert werden. Das Gerät ist danach nicht mehr funktionstüchtig und kann
schwere Schäden, Elektroschock und Brand verursachen!
Keine Lösungsmittel wie Aceton, Isopropanol und Wasserstoffperoxid, Chlorid, Iod, Bromid, Phenol oder andere
aggressive Lösungen zum Reinigen der Kunststoffoberfläche des Ladegerätes verwenden. Diese Substanzen
können schädlich sein und zu Verfärbungen und / oder Schäden am Kunststoffmaterial des Ladegerätes führen.
Es dürfen keine Scheuermittel verwendet werden!
Das Gehäuse des Ladegerätes mit einem sauberen, weichen, fusselfreien Tuch reinigen, das mit einem milden
Oberflächenreinigungsmittel (mit neutralem pH-Wert von pH 7 gemäß den Angaben des Herstellers) befeuchtet ist.
Das Gehäuse des Ladegerätes mit einem sauberen, abriebfesten Tuch trocknen.
ACHTUNG
Das Ladegerät muss nach dem Reinigen unbedingt abgetrocknet werden. Feuchtigkeit im Inneren des Gerätes
kann Schäden verursachen.
WICHTIG
Nach Abschluss des Reinigungsvorgangs muss sichergestellt werden, dass die Kontakte des Ladegerätes im
Inneren vollständig trocken sind. Die Kontakte bei Bedarf mit Druckluft trocknen.
8.6.1
LADEGERÄT – Reinigen der Kontakte des Ladegerätes
WICHTIG
Nach dem Reinigen des Kunststoffgehäuses des Ladegerätes müssen immer die Kontakte
des Ladegerätes gereinigt werden. An den Kontakten des Ladegerätes dürfen sich keine
Verschmutzungen, Komposit- und Reinigungsrückstände befinden.
2x
Die Kontakte des Ladegerätes müssen regelmäßig (mindestens einmal pro Woche) und außerdem immer
nach dem Reinigen des Kunststoffgehäuses gereinigt werden. Verschmutzte oder durch Reinigungs- oder
Desinfektionsmittel benetzte Kontakte können den Ladevorgang beeinträchtigen, so dass der Akku nicht
aufgeladen werden kann.
Die Kontakte des Ladegerätes mit einem fusselfreien und mit Alkohol befeuchteten Tuch oder Wattetupfer reinigen.
ACHTUNG
Keine scharfen oder spitzen Gegenstände zum Reinigen der Kontakte des Ladegerätes verwenden.
Die Kontakte nicht mit Flüssigkeiten besprühen oder spülen!
Die Kontakte des Ladegerätes beim Reinigen nicht verbiegen oder verformen.
Sicherstellen, dass die Kontakte des Ladegerätes nach dem Reinigen trocken sind und nicht in Berührung mit
metallischen oder öligen Teilen kommen. Die Kontakte bei Bedarf mit Druckluft trocknen.
8.6.2 LADEGERÄT – Ersatzkontakte für das Ladegerät
Beschädigte oder stark verschmutzte Kontakte des Ladegerätes (die nicht durch Anwendung der oben beschriebenen
DE
Verfahren gereinigt werden konnten) können die Leitfähigkeit und damit das Aufladen des Akkus beeinträchtigen.
In diesem Fall können die beschädigten Kontakte des Ladegerätes durch neue ersetzt werden.
Weitere Informationen zum Austauschen der Kontakte am Ladegerät und zu Ersatzteilen können bei der Heraeus Kulzer- - 19 Niederlassung vor Ort eingeholt werden.
Arbeitsanweisungen:
Erforderliches Werkzeug: Schraubenzieher für Kreuzschlitzschraube, mittlere Größe.
1. Das Handstück aus dem Ladegerät entnehmen.
2. Das Ladegerät vom Netz trennen.
3. Das Anschlusskabel vom Ladegerät trennen.
4. Das Ladegerät umdrehen.
2x
5. Zwei Schrauben aus der Kontaktbrücke des Ladegerätes herausdrehen
(siehe aufklappbarer Umschlag hinten, Nr. 12).
6. Die Kontaktbrücke des Ladegerätes herausziehen.
7. Neue Kontaktbrücke einsetzen und in umgekehrter Reihenfolge anschließen / verbinden.
ACHTUNG
Die neue Kontaktbrücke darf nicht verbogen oder kontaminiert werden!
Beim Einsetzen und Anschließen genau arbeiten! Die Schrauben nicht zu stark festziehen!
9
Lagerung
Handstück bei längerer Nichtbenutzungszeit zusammen mit dem Akku lagern. Den Akku vor oder nach längerer
Nichtbenutzungszeit vollständig aufladen und im Ladegerät aufbewahren. Obwohl die integrierte Sicherungsschaltung
die vollständige Entladung des Akkus verhindert, wird dennoch empfohlen, den Akku bei längerer Nichtbenutzungszeit
mindestens alle 5 Monate vollständig aufzuladen.
10
Entsorgung
HINWEIS – WICHTIG
Das Gerät darf nicht über den normalen Haushaltsabfall entsorgt werden.
Zur Entsorgung von Ersatzteilen oder des Gerätes die Heraeus Kulzer-Niederlassung im jeweiligen Land
kontaktieren.
Betriebsunfähige Akkus und Lichtleiter sind gemäß den gesetzlichen Vorschriften des jeweiligen Landes
zu entsorgen.
WARNHINWEIS – Entsorgung von beschädigten oder verbrauchten Akkus
Beschädigte oder verbrauchte Akkus sind zu entsorgen, nachdem die folgenden notwendigen Schritte
zur Verhinderung eines externen Kurzschlusses durchgeführt wurden:
Nach Isolierung der Pole des Akkus mit Isolierband den Akku gemäß den lokalen Bestimmungen entsorgen.
Die Bedingungen und Vorsichtsmaßnahmen bei der Entsorgung des Gerätes richten sich nach den geltenden
gesetzlichen Bestimmungen für nicht länger brauchbare, elektronische Geräte.
Entsorgung von Altgeräten nach WEEE (Europäische Richtlinie) oder
Elektro- und Elektronikgerätegesetz (Deutsches Gesetz ElektroG).
11
Fehlerbehebung
WARNHINWEIS
Wenn das Problem nach der Durchführung der nachstehenden Schritte nicht behoben werden konnte, Heraeus
Kulzer oder den zuständigen Mitarbeiter des Kundendienstes informieren: Translux Wave NICHT VERWENDEN
und NICHT VERSUCHEN, das Gerät zu warten. Es besteht Verletzungsgefahr.
Wenn das Gerät nicht einwandfrei funktioniert, dieses Handbuch erneut lesen und folgende Tabelle heranziehen:
PROBLEM
Das Ladegerät lässt sich nicht
einschalten.
Die GRÜNE LED
am Ladegerät
leuchtet nicht.
DE
MÖGLICHE URSACHE
Das Netzteil ist nicht an die Steckdose
und / oder an das Ladegerät angeschlossen.
Die Steckdose führt keinen Strom.
Der austauschbare Adapter ist nicht
richtig in das Gehäuse des Netzteils
eingesteckt.
Das Netzkabel des Netzteils ist
beschädigt.
- 20 Das Netzteil ist defekt.
Das Ladegerät ist defekt.
Die Kontakte des Ladegerätes sind
kurzgeschlossen.
Handstück befindet sich NICHT im
Ladegerät.
Die Lichtemission wird nicht eingeschaltet, wenn die Schaltfläche
„Start / Stopp“
gedrückt ist,
und es werden keine Informationen
auf dem Handstück-Display angezeigt.
Handstück ohne Akku.
Handstück befindet sich im
„Ruhemodus“.
Akku leer.
Der Akku ist nicht ausreichend aufgeladen, um das Handstück einzuschalten.
Elektronik defekt.
Akku defekt.
„2 Signaltöne“ am Ende des
Belichtungszyklus.
Signal bei schwachem Akku.
MASSNAHME
Sicherstellen, dass das Netzteil vollständig an die Steckdose und / oder an das
Ladegerät angeschlossen ist.
Eine andere Steckdose verwenden.
In diesem Benutzerhandbuch Kapitel 5.2
sorgfältig durchlesen.
Das Netzteil durch ein neues ersetzen.
(Das Netzteil und das zugehörige Kabel
dürfen immer nur zusammen verwendet
werden.)
Das Netzteil durch ein neues ersetzen.
Heraeus Kulzer oder den zuständigen Mitarbeiter des Kundendienstes
informieren.
Die Ursache für den Kurzschluss
beseitigen.
Wenn der Kurzschluss weiterhin besteht,
die Kontakte des Ladegerätes durch
neue ersetzen. Kapitel 8.6.2 lesen.
Den Akku in das Handstück einlegen
(siehe Kapitel 5.3).
Drücken Sie die Schaltfläche
„Start / Stopp“, um den „Ruhemodus“
zu beenden. Kapitel 6.3 lesen.
Das Handstück in das Ladegerät
einsetzen, um den Akku aufzuladen
(siehe Kapitel 5.5).
Heraeus Kulzer oder den zuständigen
Mitarbeiter des Kundendienstes
informieren.
Das Handstück in das Ladegerät
einsetzen, um zu überprüfen, dass der
Akku defekt ist.
Eine „Pre-Qualifizierungssequenz“
startet, in welcher der Translux WaveMikroprozessor den Batteriezustand
prüft. Die Qualifizierungssequenz kann
bis zu 30 Minuten dauern.
Wenn innerhalb dieser Prüfsequenz
ein „Signalton“ jede Sekunde für die
Dauer von 30 Sekunden ertönt und das
Batteriesymbol auf dem Handstück
blinkt GELB, ist die Batterie defekt.
Den defekten Akku durch einen neuen
ersetzen (siehe Kapitel 5.3).
Die „2 Signaltöne“ weisen darauf hin,
dass die verbleibende Akkuladung nur
noch für wenige Belichtungszyklen
ausreicht.
Das Handstück in das Ladegerät
einsetzen, um den Akku aufzuladen
(siehe Kapitel 5.5).
PROBLEM
MÖGLICHE URSACHE
Das LED-Teil könnte defekt sein.
Die Lichtemission wird nicht eingeschaltet, wenn die Schaltfläche
„Start / Stopp“
gedrückt ist,
oder die Belichtung unterbricht mit
einem Signalton während dem Zyklus.
Die zugehörige AushärtungsmodusLED „10s“ auf dem Handstück fängt
GRÜN an zu blinken.
MASSNAHME
Überprüfen Sie die Funktion der LED
mit folgender Prozedur:
Das Handstück in die Ladestation
einsetzen und die Schaltfläche „Start /
Stopp“ 5 mal hintereinander betätigen.
Nehmen Sie das Handstück aus der
Ladestation. Die AushärtungsmodusLED „10s“ auf dem Handstück beendet
das Blinken, sie wurde zurückgesetzt.
Wenn bei Start des nächsten Belichtungszyklus die Aushärtungsmodus-LED „10s“
erneut blinkt, ein Signalton ertönt und
kein Licht emittiert wird, ist das LED-Teil
defekt.
blinkt
Bitte in diesem Fall Heraeus Kulzer oder
den zuständigen Mitarbeiter des Kundendienstes informieren.
Die Lichtemission wird nach mehreren Überhitzungsschutz.
Das Handstück mindestens 4 – 5
aufeinanderfolgenden BelichtungsMinuten lang abkühlen lassen. Danach
Das Handstück hat sich während der
zyklen nicht eingeschaltet, wenn die
Nutzung überhitzt und der Überhitzungs- den nächsten Belichtungszyklus durch
Drücken der Schaltfläche „Start /
sensor wurde aktiviert.
Schaltfläche „Start / Stopp“
Stopp“ starten.
gedrückt ist und „3 Signaltöne“
Bei Aktivierung des Überhitzungsschutzes
Hinweis: Das Handstück ist nach dem
ausgegeben werden.
kann das Gerät (einige Minuten lang)
Abkühlen automatisch wieder betriebsnicht verwendet werden.
bereit – kein „Reset“ notwendig.
Überhitzungsschutz.
Während eines Belichtungszyklus
Das Handstück mindestens 4 – 5
werden „3 Signaltöne“ ausgegeben.
Minuten lang abkühlen lassen. Danach
Das Handstück hat sich während der
Nutzung überhitzt und der Überhitzungs- den nächsten Belichtungszyklus durch
Drücken der Schaltfläche „Start /
sensor wurde aktiviert.
Stopp“ starten.
Bei Aktivierung des Überhitzungsschutzes
kann das Gerät (einige Minuten lang)
nicht verwendet werden.
Fehler während der Ladephase.
Während der Präqualifikationsphase
Den defekten Akku durch einen neuen
30 Sekunden lang wird jede Sekunde (Akkustand: vollständig leer, siehe Kapitel ersetzen (siehe Kapitel 5.3).
4.2.4
und
5.5).
ein „Signalton“ ausgegeben und die
Akkustatus-LED auf dem Handstück
Die Elektronik erkennt einen Fehler
2x
blinkt GELB.
oder eine Fehlfunktion des Akkus und
unterbricht den Ladevorgang.
blinkt
Das Handstück befindet sich im
Ladegerät, aber die Ladephase wird
nicht gestartet.
Die grüne Akkustatus-LED auf dem
Handstück ist ausgeschaltet.
Fehler: Ladekontakt unterbrochen.
Fehlerhafter Kontakt zwischen dem
Ladegerät und dem Handstück.
Siehe Kapitel 8.5 und 8.6.2.
Überprüfen, ob das Handstück mit der
richtigen Ausrichtung in das Ladegerät
eingesetzt wurde. Ausrichtungshilfe.
Kapitel 4.2.1, Punkt 4 und 5 lesen.
Die Kontakte des Ladegerätes und / oder Die Kontakte des Handstücks und des
des Handstücks sind verschmutzt.
Ladegerätes reinigen.
Kapitel 8.5 und 8.6.1 lesen.
Der Lichtleiter wurde nicht richtig in das Sicherstellen, dass der Lichtleiter komplett
Die Lichtintensität, die mit dem im
im Metallkonus des Handstücks steckt.
Ladegerät integrierten Lichtmessgerät Handstück eingesetzt.
gemessen wurde, reicht nicht aus.
Lichtleiteranschluss ist durch Fremdkörper Den Lichtleiteranschluss reinigen.
Kapitel 8.2 lesen.
am Ladegerät leuchtet oder Kompositrückstände verschmutzt,
Die LED
die den Lichtausgang beeinträchtigen.
GELB.
Den Lichtleiter durch einen neuen ersetzen.
Lichtleiter ist beschädigt oder veraltet.
DE
- 21 -
12
Technische Daten
Klasse I (eins)
Das Produkt wurde geprüft und die Übereinstimmung festgestellt nach
IEC 60601-1 (2. Ausgabe) und IEC 60601-1-1.
Das Produkt wurde geprüft und die Übereinstimmung festgestellt nach
IEC 60601-1 (3. Ausgabe) und IEC 60601-1-2 (3. Ausgabe für Elektromagnetische Verträglichkeit – EMV).
Das Handstück ist gemäß seiner bestimmungsgemäßen Anwendung
für den Einsatz in der Patientenumgebung bestimmt. Hingegen sind
Ladestation und Netzteil entsprechend ihrer bestimmungsgemäßen
Anwendung für den Einsatz außerhalb der Patientenumgebung bestimmt.
Hinweis: Die Patientenumgebung ist definiert als Bereich von 1,5 m um
den Patienten (siehe IEC 60601-1, 3. Ausgabe und IEC 60601-1-1).
Klassifizierung gemäß der Norm IEC 60601-1: Schutzklasse II; Typ B, Anwendungsteil: Lichtleitstab mit Blendschutz.
IP 20 (Ladegerät).
IP 20 (Translux Wave)
Ladegerät:
Translux Wave-Ladegerät
Stromversorgung des Ladegerätes:
Schaltnetzteil (Direktanschluss) hergestellt von:
Phihong Technology CO LTD – Modell: PSACO5R-050.
Eingangsspannung: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Ausgangsspannung: 5 V
– 1 A Max –
.
Gerät der Schutzklasse II
Stromversorgung des Handstücks:
Lithium-Ionen-Akku.
Hersteller: Panasonic. Modell: NCR-18500.
Nennspannung: 3,6 V.
Nennkapazität (mind.): 2000 mAh
Handstück:
Modell: Translux Wave.
Betrieb: intermittierender Betrieb: 120 Sekunden EIN –
40 Sekunden AUS – max. 2 Zyklen.
Lichtquelle:
LED mit hoher Leuchtstärke.
LED Produkt der Klasse 2M (IEC 60825-1).
Wellenlängenbereich: 440 – 480 nm.
Dominante Wellenlänge: Min. 440 nm – Max. 465 nm
Lichtleiter:
Bleifreier Mehrkernstab, 8 mm Durchmesser.
Sterilisierbar im Dampfautoklaven (Vorvakuum):
4 Minuten (mind.) bei Mindesttemperatur von 132°C + 3°C (270°F + 5°F).
Max. 500 Zyklen
Einstellbare Belichtungszyklen:
10 Sekunden Belichtungszeit.
– Normale Belichtung
Signaltöne:
1 Signalton zu Beginn der Belichtung.
1 Signalton am Ende der Belichtung
– „Soft-Start“-Belichtung
20 Sekunden Belichtungszeit. (Beim „Soft-Start“ steigt die
Lichtleistung innerhalb von 2 Sekunden von 50% auf 100% an.)
Signaltöne:
1 Signalton zu Beginn der Belichtung.
1 Signalton bei Aktivierung der „Soft-Start“-Belichtung.
1 Signalton nach 10 Sekunden Belichtungszeit.
1 Signalton am Ende der Belichtung
Aufladezeit bei leerem Akku:
ca. 3 Stunden
Äußere Bedingungen für das Gerät:
Betrieb
Transport und
Klassifizierung gemäß Richtlinie 93/42 EG:
Sicherheitsnormen:
DE
- 22 -
Temperatur
Relative Luftfeuchtigkeit
Atmosphärendruck
10°C – 35°C
(50°F – 95°F)
45% – 85%
800 – 1060 hPa
Lagerung
–20°C – 40°C
(–4°F – 104°F)
45% – 85%
500 – 1060 hPa
Gewicht und Abmessungen:
12.1
Ladegerät: 450 g.
Abmessungen: L 140 x B 58 x H 62 mm
Handstück: 150 g (mit Lichtleiter).
Abmessungen: L 275 mm, max. Ø 24 mm
Elektromagnetische Kompatibilität gemäß EN 60601-1-2
WARNHINWEIS
Das Gerät benötigt spezielle EMV-Maßnahmen, die entsprechend den Hinweisen in diesem Abschnitt installiert
und aktiviert sein müssen.
Tragbare und mobile Funkgeräte können die Funktionsfähigkeit des Gerätes beeinträchtigen.
Anleitung und Erklärung des Herstellers – Elektromagnetische Emissionen
Translux Wave ist nur für den Einsatz unter den nachfolgend beschriebenen elektromagnetischen Bedingungen ausgelegt.
Benutzer von Translux Wave müssen sicherstellen, dass diese Bedingungen bei der Nutzung des Gerätes erfüllt sind.
Emissionsprüfung
Konformität Elektromagnetische Umgebung – Anleitung
HF Emissionen CISPR 11
Gruppe 1
Die internen Funktionsabläufe von Translux Wave erfolgen über
Funkfrequenzsignale. Die Radiofrequenzbelastung ist daher sehr
gering. Störungen bei elektronischen Geräten in der Nähe sind
daher unwahrscheinlich.
HF Emissionen CISPR 11
Klasse B
Das Translux Wave ist für die Anwendung in allen Gebäuden
geeignet einschließlich Wohnungsbauten und solcher Gebäude,
Harmonische Emissionen
Klasse A
die direkt mit dem öffentlichen Stromnetz mit Niederspannung
IEC 61000-3-2
verbunden sind, das Gebäude für Privatnutzung versorgt.
Spannungsschwankungsemissionen / Konform
Flicker IEC 61000-3-3
Anleitung und Erklärung des Herstellers – Elektromagnetische Immunität
Translux Wave ist nur für den Einsatz unter den nachfolgend beschriebenen elektromagnetischen Bedingungen ausgelegt.
Benutzer von Translux Wave müssen sicherstellen, dass diese Bedingungen bei der Nutzung des Gerätes erfüllt sind.
Immunitätsprüfung
Prüfwert IEC 60601
Konformitätswert
Elektromagnetische Umgebung –
Anleitung
Elektrostatische
±6 kV bei Kontakt
Das Gerät funktioniert
Die Fußböden müssen aus Holz,
Entladungen (ESD)
weiterhin ordnungsgemäß
Beton oder Keramik bestehen. Sind
±8 kV in der Luft
IEC 61000-4-2
und sicher.
die Fußböden mit synthetischem
Material belegt, so sollte die
relative Feuchtigkeit mindestens
30% betragen.
Schnelle, transiente
±2 kV für LeistungsDas Gerät funktioniert
Die Qualität der Netzspannung
elektrische Störgrößen / zuleitungen
weiterhin ordnungsgemäß
muss die gleiche wie in einem
Bursts nach
und sicher.
typischen Geschäfts- oder
±1 kV für Eingangs-/
IEC 61000-4-4
Krankenhausumfeld sein.
Ausgangsleitungen
Impulse
±1 kV Differenzspannung
Das Gerät funktioniert
Die Qualität der Netzspannung
IEC 61000-4-5
weiterhin ordnungsgemäß
muss die gleiche wie in einem
±2 kV Gleichtaktspannung
und sicher.
typischen Geschäfts- oder
Krankenhausumfeld sein.
Spannungslöcher,
< 5% UT (> 95% Einbruch UT) Das Gerät darf zeitweise
Die Qualität der Netzspannung
für 0,5 Zyklen
kurze Spannungsvon den geforderten
muss die gleiche wie in einem
unterbrechungen
Immunitätswerten abweitypischen Geschäfts- oder
40% UT (60% Einbruch UT)
und Veränderungen
chen, solange das Gerät
Krankenhausumfeld sein.
für 5 Zyklen
an den Stromversicher funktioniert, keine
(30%
Einbruch
U
)
70%
U
T
T
sorgungsleitungen
Fehlfunktionen festgestellt
für 25 Zyklen
IEC 61000-4-11
werden und das Gerät durch
< 5% UT (> 95% Einbruch UT) Eingriff des Benutzers in
den Betriebszustand vor
in 5 sek
der Prüfung zurückversetzt
werden kann.
Magnetfeld bei Netz3A/m
Das Gerät funktioniert
Die Netzfrequenz-Magnetfelder
frequenz (50 / 60 Hz)
weiterhin ordnungsgemäß
müssen die charakteristischen
IEC 61000-4-8
und sicher.
Niveaus einer typischen Räumlichkeit in einem Geschäfts- oder
Krankenhausumfeld aufweisen.
ANMERKUNG: UT ist die Wechselstrom-Netzspannung vor der Anwendung des Prüfwertes.
DE
- 23 -
DE
- 24 -
Anleitung und Erklärung des Herstellers – Elektromagnetische Immunität
Translux Wave ist nur für den Einsatz unter den nachfolgend beschriebenen elektromagnetischen Bedingungen ausgelegt.
Benutzer von Translux Wave müssen sicherstellen, dass diese Bedingungen bei der Nutzung des Gerätes erfüllt sind.
ImmunitätsPrüfwert
Konformitäts- Elektromagnetische Umgebung – Anleitung
prüfung
IEC 60601
wert
Geleitete
3 Veff von
Das Gerät
Die tragbaren Hochfrequenz-Mobiltelefone dürfen nicht in der Nähe
Hochfrequenz 150 kHz bis
funktioniert
des Produkts oder eines Teils davon einschließlich der Kabel verwendet
IEC 61000-4-6 80 MHz
weiterhin ord- werden, es sei denn, es werden die empfohlenen Trennungsdistanzen
nungsgemäß
eingehalten, die mit der Gleichung berechnet werden, die für die
Gestrahlte
3 V / m von
und sicher.
Frequenz des Senders anwendbar ist.
Hochfrequenz 80 MHz bis
Empfohlene Trennungsdistanzen
IEC 61000-4-3 2,5 GHz
d = 1,2 √P
d = 1,2 √P von 80 MHz bis 800 MHz
d = 2,3 √P von 800 MHz bis 2,5 GHz
wobei (P) die maximale Ausgangsnennleistung des Senders in Watt (W)
laut Hersteller des Senders und (d) die empfohlene Trennungsdistanz in
Metern (m) ist. Die Feldstärke der feststehenden Hochfrequenzsender,
wie sie in einer elektromagnetischen Untersuchung des Ortes
bestimmt wird, muss geringer als der Konformitätswert in
jedem Frequenzintervall (b) sein. Interferenzen können in der
Nähe von Geräten auftreten, die mit dem folgenden Symbol
gekennzeichnet sind:
Anmerkungen:
(1) Bei 80 MHz und 800 MHz gilt der höhere Frequenzbereich.
(2) Es ist möglich, dass diese Richtlinien nicht in allen Situationen anzuwenden sind. Die elektromagnetische Ausbreitung
wird von der Absorption und der Reflexion von Strukturen, Gegenständen und Personen beeinflusst.
a) Die Feldstärke stationärer Sender wie z. B. Basisstationen von Funktelefonen und mobilen Landfunkgeräten, Amateurfunkstationen, AM- und FM-Rundfunk- und Fernsehsendern können theoretisch nicht genau vorherbestimmt werden.
Um die elektromagnetische Umgebung hinsichtlich der stationären Sender zu ermitteln, sollte eine Studie des Standorts
erwogen werden. Wenn die gemessene Feldstärke an dem Standort, an dem das Produkt benutzt wird, die obigen
Konformitätswerte überschreitet, sollte das Produkt beobachtet werden, um die bestimmungsgemäße Funktion nachzuweisen. Wenn ungewöhnliche Leistungsmerkmale beobachtet werden, können zusätzliche Maßnahmen erforderlich
sein, wie z. B. eine veränderte Ausrichtung oder ein anderer Standort des Produktes.
b) Im Frequenzbereich von 150 kHz bis 80 MHz sollte die Feldstärke geringer als 3 V / m sein.
Empfohlene Trennungsdistanzen zwischen tragbaren Funkgeräten und Mobiltelefonen und dem Translux Wave
Der Betrieb des Translux Wave ist in einer elektromagnetischen Umgebung vorgesehen, in der Störungen durch Hochfrequenzausstrahlungen unter Kontrolle stehen. Der Kunde oder der Bediener des Translux Wave können elektromagnetischen Interferenzen vorbeugen, indem sie eine Mindestdistanz zwischen den tragbaren Hochfrequenz-Funkgeräten
und -Mobiltelefonen (Sender) und dem Translux Wave nach den unten angegebenen Empfehlungen je nach der maximalen
Ausgangsleistung der Kommunikationsgeräte einhalten.
Schutzabstand abhängig von der Sendefrequenz (m)
Maximale Nennausgangsleistung des Senders (W)
von 150 kHz bis 80 MHz
von 80 MHz bis 800 MHz
von 800 MHz bis 2,5 GHz
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
Für die Sender mit einer oben nicht aufgeführten maximalen Nennausgangsleistung kann die empfohlene Entfernung (d) in
Metern (m) anhand der auf die Frequenz des Senders anzuwendenden Gleichung berechnet werden, wobei (P) die maximale
Nennausgangsleistung des Senders in Watt (W) laut dem Hersteller des Senders ist.
Anmerkungen:
(1) Bei 80 MHz und 800 MHz wird das höchste Frequenzintervall angewendet.
(2) Es ist möglich, dass diese Richtlinien nicht in allen Situationen anzuwenden sind. Die elektromagnetische Ausbreitung
wird von der Absorption und der Reflexion von Strukturen, Gegenständen und Personen beeinflusst.
12.2
Typenschild des Ladegerätes
Beschreibung der Symbole auf dem Typenschild
1 CE-Zeichen.
2 Achtung, lesen Sie die Begleitdokumente.
3 Lesen Sie die Gebrauchsanweisung.
4 Doppelisolierung (Gerät der Schutzklasse II).
5 Entsorgung von alten Elektro- und Elektronikgeräten
(in der EWG und sonstigen EU-Ländern im Rahmen der
einzelnen Sammelsysteme).
6 MET-Zeichen.
12.3
Handstück-Seriennummer
Die Handstück-Seriennummer ist auf der Unterseite des Gehäuses eingraviert.
Eingravierte
Seriennummer.
1
2
3
4
5
DE
6
- 25 -
13
Gewährleistung
Jedes Heraeus Kulzer-Gerät wird vor der Auslieferung einer strengen Prüfung und Endkontrolle unterzogen, um einen
einwandfreien Betrieb der Geräte zu gewährleisten. Heraeus Kulzer gewährt auf alle bei einem Heraeus Kulzer-Wiederverkäufer oder -Importeur neu gekauften Heraeus Kulzer-Produkte eine Gewährleistung von 2 (zwei) Jahren ab dem
Kaufdatum für Material- und Produktionsfehler. Heraeus Kulzer verpflichtet sich, während der Gewährleistungszeit
die seines Erachtens schadhaften Teile der Produkte kostenlos instandzusetzen (oder nach freier Entscheidung zu
ersetzen). Ein Gesamtersatz von Heraeus Kulzer-Produkten ist nicht vorgesehen.
Heraeus Kulzer haftet auf keinen Fall für etwaige direkte oder indirekte Personen- und oder Sachschäden in den
folgenden Fällen:
• DasGerätwurdenichtfürseinenvorgesehenenVerwendungszweckeingesetzt.
• DasGerätwurdenichtgemäßdenindiesemHandbuchbeschriebenenAnweisungenundVorschriftenbenutzt.
• DieElektroinstallationindenRäumen,indenendasGerätbetriebenwird,entsprichtnichtdengeltendenGesetzen
und den diesbezüglichen Vorschriften.
• Zusammensetzung,Zusätze,Einstellungen,ÄnderungenoderInstandsetzungenwurdennichtvonHeraeusKulzerFachpersonal vorgenommen.
• DieRaumbedingungenzurAufbewahrungundLagerungdesGerätesentsprechennichtdenimKapitel12
(Technische Daten) aufgeführten Vorschriften.
Von der Gewährleistung ausgeschlossen sind Transportschäden, durch unsachgemäßen Gebrauch oder Nachlässigkeit
verursachte Schäden, durch Anschluss an eine andere als die vorgesehene Netzspannung entstandene Schäden sowie
die Kontrollleuchten, Taster und sämtliches Zubehör. Die Gewährleistung verfällt, wenn das Gerät von anderen Personen
als dem Kundendienst verändert oder instandgesetzt wird. Zur Inanspruchnahme der Gewährleistung stellt der Kunde das
beschädigte Gerät dem Wiederverkäufer oder dem Heraeus Kulzer-Importeur, bei dem er das Gerät gekauft hat, auf seine
Kosten zu. Das Gerät einschließlich der Zubehörteile ist gut verpackt (möglichst in der Originalpackung) einzusenden.
Bei der Rückgabe des Gerätes muss eine Karte mit folgenden Daten beigelegt werden:
a) Name, Adresse und Telefonnummer des Besitzers.
b) Name und Adresse des Wiederverkäufers / Importeurs.
c) Fotokopie des Lieferscheins / Kaufbelegs des Gerätes durch den Besitzer, auf dem außer dem Datum die Bezeichnung des Gerätes und die Seriennummer angegeben sind.
d) Beschreibung der Betriebsstörung.
Es besteht keine Haftung für den Transport und etwaige Transportschäden.
Im Falle von Schäden, die durch Unfälle oder unsachgemäßen Gebrauch verursacht werden oder nach Ablauf der
Gewährleistung eintreten, werden die Instandsetzungen nach den effektiven Material- und Arbeitskosten berechnet.
14
Service
14.1
Servicepartner / Ansprechpartner in den Ländern
15
Dokumentenhistorie
1x
2012-08 Vorläufige Fassung für Prototypen.
2013-09 Erstausgabe.
2014-03 Redaktionelle Änderungen Kapitel 2.1, 3.2.1, 7.2, 10, 11, 12 und 12.2.
DE
- 26 -
Änderungen vorbehalten.
Stand: 2014-03
Table of contents
1
1.1
1.2
1.3
Application _______________________________________________________________________
In general ______________________________________________________________________
EC – Declaration of Conformity ______________________________________________________
Manufacturer’s declaration __________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Instructions on using the unit safely ___________________________________________________
Explanation of symbols and accompanying word(s) _______________________________________
Transport damage – Unpacking and inspection __________________________________________
Owner’s obligations ______________________________________________________________
Machine journal _________________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Intended use _____________________________________________________________________
Description of the device ___________________________________________________________
Safety requirements ______________________________________________________________
General safety instructions on operating the device _______________________________________
Safety Precautions _______________________________________________________________
BATTERY – Safety precautions _______________________________________________________
BATTERY – Information ____________________________________________________________
LIABILITY ______________________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Unit description ___________________________________________________________________ 8
Delivery contents ________________________________________________________________
8
Description of the control and operating elements ________________________________________
8
Hand piece _____________________________________________________________________
8
Allignment key __________________________________________________________________
8
Charging unit ___________________________________________________________________
8
Acoustical signals hand piece _______________________________________________________
9
LED information concerning the radiation emitted _________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installation and putting into initial operation _____________________________________________
Safety requirements during Installation ________________________________________________
Connection of the charging unit to the mains power outlet __________________________________
Inserting the battery into the hand piece _______________________________________________
Inserting the fibre optic into the hand piece _____________________________________________
Battery charging _________________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Operation ________________________________________________________________________
Activating and deactivating the exposure cycle ___________________________________________
Measurement of the Light Intensity ___________________________________________________
Sleep Mode ____________________________________________________________________
Additional information on the unit operations ____________________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Alarm conditions __________________________________________________________________
Faulty battery ___________________________________________________________________
Faulty LED _____________________________________________________________________
Overheat protection ______________________________________________________________
BUILT-IN Temperature overload sensor defective _________________________________________
Battery-low signal _______________________________________________________________
15
15
15
15
15
16
NOTE
Please use the book icon to find the chapter images
or further information on the fold-out cover.
1x /2x
Please
fold-out front
cover
Please
fold-out rear
cover
HKG-Layout 99000943_01 GBA
Translux Wave EU
Dateiname: 02B_99000943_01_W11180_GBA TL Wave EU_V06_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V06, 5.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
GB
-1-
GB
-2-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Cleaning, disinfection and sterilisation _________________________________________________
Disassembly ____________________________________________________________________
LIGHT GUIDE – Cleaning and disinfection _______________________________________________
LIGHT GUIDE – Inspection before the sterilisation _________________________________________
PROTECTIVE LIGHT CONE – Cleaning and disinfection _____________________________________
PROTECTIVE LIGHT CONE – Inspection before the sterilisation ________________________________
LIGHT GUIDE and PROTECTIVE LIGHT CONE – Packaging before the sterilisation __________________
LIGHT GUIDE and PROTECTIVE LIGHT CONE – Sterilisation __________________________________
Sterilisation method ______________________________________________________________
Sterilisation parameters ___________________________________________________________
HAND PIECE – Cleaning and disinfection _______________________________________________
CHARGING UNIT – Cleaning Casing ___________________________________________________
CHARGING UNIT – Cleaning charging contacts____________________________________________
CHARGING UNIT – Replaceable charging contacts ________________________________________
9
Shelf storage _____________________________________________________________________ 19
10
Disposal _________________________________________________________________________ 19
11
Troubleshooting ___________________________________________________________________ 20
12
12.1
12.2
12.3
Technical specifications _____________________________________________________________
Electromagnetic compatibility EN 60601-1-2 ____________________________________________
Charging unit identification plate _____________________________________________________
Hand piece serial number __________________________________________________________
13
Warranty ________________________________________________________________________ 25
14
14.1
Service __________________________________________________________________________ 26
Service agents / Contact in the countries _______________________________________________ 26
15
Document history __________________________________________________________________ 26
NOTE
Please use the book icon to find the chapter images
or further information on the fold-out cover.
16
16
16
16
16
17
17
17
17
17
17
18
18
19
22
23
25
25
1x /2x
Please
fold-out front
cover
Please
fold-out rear
cover
1
Application
1.1
In general
Translux Wave is a registered trademark of Heraeus Kulzer GmbH.
These operating instructions apply to:
Order no.
66055012
Type Features
Translux Wave – LED Light curing unit
Date
2014-03 / 99000943/01
1.2
EC – Declaration of Conformity
We, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, hereby declare that the design, structure and version
introduced to the market of the unit described below correspond to the relevant safety and health requirements of the
EU Directive.
This declaration shall become invalid in the event of an alteration made to the unit without our prior authorisation.
1.3
Manufacturer’s declaration
We hereby confirm that the unit Translux Wave complies with the directive 93/42 EC and the standards IEC 60601-1
and IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Germany).
2
Instructions on using the unit safely
Please read this manual and follow its instructions carefully. The words WARNING, CAUTION and NOTE carry special
meanings and must be carefully reviewed (see the following paragraph). Always keep this manual within easy reach.
2.1
Explanation of symbols and accompanying word(s)
Symbols
Accompanying word(s)
Explanation
WARNING
Implies that death or serious injury could occur if the advice is not followed.
CAUTION
Implies that minor injury or device damage could occur if the advice is not
followed.
NOTE
Implies advice that is not related to harm.
WARNING OF
EXPLOSION
WARNING of explosion – observe information and warnings in the chapters
and sections marked with the following pictorial symbols.
DISCONNECT FROM
MAINS
WARNING of electric shock.
Before carrying out the cleaning and disinfection procedures disconnect
the charging base from the electrical power source!
MET mark – UL / CSA conformity.
MET
WEEE / ElektroG
Disposal of old equipment according to WEEE (European Directive) or
Electrical and Electronic Equipment Act (German Law ElektroG).
Applied part:
Type B applied part-in conformity with technical standards IEC 60601-1.
Double insulation:
Class II device.
Power supply:
Alternate current.
Direct current.
Switching power supply plug polarity – Centre positive.
Use in closed spaces only.
GB
-3-
Symbols
Accompanying word(s)
Explanation
Device manufactured in conformity with directive 93/42/EEC
including technical standards IEC 60601-1 and IEC 60601-1-2.
WARNING symbol “LED radiation”.
Observe the information and dangers in the paragraph 4.2.5.
Consult instructions for use.
CAUTION, consult accompanying documents.
Operating switch:
“Start / Stop”.
Registration certificate according to the ministry of health of the Russian
federation.
GB
Keep away from rain.
-4-
Storage temperature limitation (–20°C (–4°F) to 40°C (104°F)).
Storage humidity limitation (45% – 85% RH).
Storage atmospheric pressure limitation (500 – 1060 hPa).
2.2
Transport damage – Unpacking and inspection
The unit is sensitive to shock, because it contains electrical components. Particular care must therefore be taken during
transportation as well as storage. The equipment shipped by Heraeus Kulzer was checked thoroughly prior to shipment.
The unit is correctly protected and packed when delivered.
Check the unit for damage after receiving it. If it is damaged, report this to the transportation company within 24 hours
of delivery. Under no circumstances, install or work with a damaged unit and / or accessories.
2.3
Owner’s obligations
In addition to complying with the statutory regulations specified, the owner must ensure that statutory requirements
are observed and implemented in the workplace, i.e. he must train his personnel and comply with industrial safety
legislation and all further valid regulations or laws in force.
For work on and with the unit, written instructions in an understandable form and in the relevant language of the
respective employees must be provided by the owner using the operating instructions and on the basis
of the work to be carried out.
2.4
Machine journal
We recommend that you keep a “machine journal” and document all tests and major work (e.g. servicing, changes) in it.
3
Intended use
The Translux Wave is a LED dental curing light unit intended for use in the oral cavity for the polymerisation
of light curing dental materials such as adhesives and filling materials that are activated in the 440 – 480 nm wavelength range.
NOTE
Although most light curing dental materials are activated within this wavelength range, in case of uncertainty,
verify the manufacturer’s specifications or contact the manufacturer.
WARNING – Qualified specialists.
The unit must only be operated by appropriately trained specialist personnel and the dentist (see paragraph 2.3
Owner’s obligations). If the unit is used correctly it will not cause any known side effects.
3.1
Description of the device
The Translux Wave uses a source of light consisting of a very-efficient mono-chromatic LED diode with a wavelength
comprised between 440 and 480 nm.
The entire light radiated by the Translux Wave is used to activate the camphorquinone photoinitiator. This produces
excellent polymerisation results with low heat emission.
The Translux Wave is shipped with a 360° rotating light guide with 8 mm diameter.
The Translux Wave consists of a charging unit and a hand piece, powered by a removable rechargeable
Lithium-ion battery.
The hand piece is equipped with a “Sleep Mode” to minimise the unit’s energy consumption.
The hand piece switches to “Sleep Mode” if it is not used for a period of about 5 minutes.
The Translux Wave can operate with two different exposure cycles:
• Exposure with constant output: cycle duration 10 seconds.
• Exposure with slowly increasing output: “Soft-Start” (cycle duration 20 seconds).
The “Soft-Start” means increase of light intensity from 50% up to 100% within 2 seconds.
NOTE – Observe the exposure times of the materials specified by the manufacturer.
For materials with specific exposure times (e.g. 30 / 40 seconds for dark composites) repeat the exposure
several times if necessary.
3.2
Safety requirements
The effectiveness of the safety instructions with regard to personnel protection, handling the unit and handling the
processed product is to a large degree dependent on the behaviour of the staff working with the equipment.
WARNING
Prior to initial operation, carefully read through these Operating Instructions and observe the information in
order to avoid errors and subsequent damage, particularly damage to health. In addition to the instructions
in this operating manual, comply with the national laws, regulations, and directives in your country when
setting up and operating the unit.
3.2.1
General safety instructions on operating the device
WARNING – INTENDED USE
Use the unit only for the purpose for which it is intended (see paragraph 3 Intended use). Any other uses are
strongly contra-indicated. Any non-compliance of this regulation can result in serious injury of the patients
or operators of the unit as well as damage or faults to the unit. Heraeus Kulzer is not liable for consequential
damages due to the non-observance of the aforementioned provision!
WARNING
The user is responsible for testing the Translux Wave for its use and suitability for the intended purposes.
Never point the light towards the eyes! Direct or indirect exposure of light into the eyes must always be
prevented by wearing protective goggles that filter out blue light. When curing, position the light guide tip
directly over the material that needs to be cured and avoid extraneous exposure to soft tissues. Eyes, gums,
soft tissue and other body parts must not be exposed to the blue light (if necessary, these parts must
be covered with protection). Use a rubber dam to protect the soft tissues, i.e. gingiva during treatment.
Exposure must be restricted to the area of the oral cavity in which clinical treatment is executed.
WARNING – CONTRA-INDICATIONS
Do not use the Translux Wave on patients fitted with a pacemaker or other implantable electronic devices.
This also applies to the operator.
The unit must not be used by children, the blind or the deaf and also not by / on persons who are prone
to possible epileptic seizures. The above pre-named persons may not recognise the risks of use and operation.
Due to safety reasons for the operator and the patients with potential risk of epileptic seizures, use and
operation of the device is prohibited.
WARNING
No modification of this equipment is allowed.
The owner / user must ensure that:
– The unit is not used on patients with a positive anamnesis after light testing, for example with urticaria
solaris and / or porphyria as well as on patients who have been treated with photosensitising medication.
– The unit is not used on patients that have had surgery for eye cataracts, which are particularly sensitive
to light, unless they use suitable protective measures, such us the use of eye protectors / spectacles that
filter out blue light.
GB
-5-
–
Patients whose anamnesis includes retinal diseases must have treatment with Translux Wave authorised
by their ophthalmologist.
– A specialist doctor is consulted in all potential risk cases.
WARNING – Temperature of applied parts
Max. temperature of the applied parts (light guide and protective light cone): 41°C (106°F).
Max. temperature of the part considered as applied part (metal front cone) as it can come into contact with the
patient: 46°C (115°F).
Heraeus Kulzer declares that if the device is used in conformity with the instructions contained in this manual,
no tissue heating will occur.
WARNING – Control of infections.
The light guide and the protective light cone must be cleaned, disinfected and sterilised (steam) before every
use. The light guide and the protective light cone are delivered in NON STERILE condition and must be sterilised
before being used for the first time. See paragraph 8.4.1.2 Sterilisation parameters.
3.2.2
GB
-6-
Safety Precautions
WARNING – RISK OF EXPLOSION
Do not install the device where there is the risk of explosions. The device must not be used where an
inflammable atmosphere is present (anaesthetic mixtures, oxygen, nitrous oxide, etc.). Use the device in a well
ventilated area.
WARNING
Before using the unit, check the mains power cable and plug for damage. If they are damaged, do not connect
the unit to the mains.
Use only original spare parts or accessories from Heraeus Kulzer GmbH. Heraeus Kulzer provides a light guide
suitable for use with the Translux Wave. Other light guides must not be used. Heraeus Kulzer GmbH will not
accept any liability for damage resulting from the use of non original Heraeus Kulzer spare parts or accessories.
3.2.3 BATTERY – Safety precautions
Heraeus Kulzer GmbH assumes no liability for battery problems that occur when the Safety Precautions listed in the
paragraph below are not carefully adhered.
WARNING
Misusing the battery may cause the battery to get hot, rupture, or ignite and cause serious injury.
Be sure to follow the safety rules listed in the below paragraph.
Use original Heraeus Kulzer batteries only!
The use of non Heraeus Kulzer batteries or non-rechargeable batteries and / or primary batteries is a potential
danger and can damage the device.
Keep the battery out of the reach of children!
Never open, puncture or crush the battery – it contains poisonous substances.
If the battery shows corrosion, emits an unusual smell, or loss of fluids, remove the battery from the hand piece
immediately.
Do not expose the battery to water or salt water, or allow the battery to get wet. Do not store the battery in high
humidity or in a place which may expose the battery to rain.
In the event that the battery leaks and the fluid gets into one’s eye, do not rub the eye. Rinse well with water
and immediately seek medical care. If left untreated the battery fluid could cause damage to eye.
WARNING – RISK OF EXPLOSION
Use only the Translux Wave charging unit and the input power supply, which are provided with the unit,
to charge the hand piece’s battery. Never attempt to charge the Translux Wave battery by using any
other charging unit. The use of any other charging unit can result in the damage of the battery, risk of explosion
and fire!
Never use the Translux Wave recharging unit to charge other types of battery or other units with
a rechargeable battery! Use only original batteries from Heraeus Kulzer.
Do not pierce the battery with any sharp objects, strike the battery with a hammer / tools, step on the battery,
or otherwise subject it to strong impacts or shocks.
Do not place the battery in fire or apply heat to the battery. Never short circuit the end elements of the battery
with any metal objects due to the risk of burns, fire and explosion. Never carry or store the battery together
with necklaces, hairpins, or other metal objects.
WARNING – Do not disassemble or modify the battery!
Safety mechanisms are incorporated in the battery which if damaged may cause the battery to generate heat,
rupture, explode or ignite.
WARNING – Do not place the battery on or near fires, or other high-temperature locations.
Do not place the battery in direct sunshine. Doing so may cause the battery to generate heat, rupture or ignite.
Using the battery in this manner may also result in a loss of performance and shortened life expectance.
WARNING – In case of fire, DO NOT THROW WATER ON A BURNING BATTERY!
A class C fire extinguisher (according to European Regulation EN 3) must be used.
WARNING – Damaged or exhausted battery disposal.
Dispose a damaged or exhausted battery after taking the necessary steps to prevent external short circuit
by the following method:
After having insulated the terminals of the battery with insulating tape, dispose off under the law or in
accordance with the local council.
3.2.4 BATTERY – Information
• Timetochargeemptyornewbattery:approx.3hours.
NOTE – NEW Battery: first charging
For the first charge, this process will take about 3 hours. New batteries or batteries stored for
a long time may take more time to charge. The battery will reach its full capacity after a few full
charge / discharge cycles.
NOTE
Place the hand piece into the charging unit after each treatment, or when not in use.
• Operatingcondition:
Operating temperature: 10°C (50°F) up to 35°C (95°F).
Relative humidity: 45% to 85% RH.
Atmospheric pressure: 800 hPa to 1060 hPa.
CAUTION
The temperature and relative humidity ranges over which the battery can be charged is 10°C (50°F) to
35°C (95°F), and 45% to 85% RH. Charging the battery at temperatures outside of this range may cause
the battery to become hot or damaged. Charging the battery outside this temperature range may also harm
the performance of the battery or reduce the battery’s life expectancy.
• Batterytransportationandstorageconditions:
Recommended temperature and relative humidity ranges:
–20°C (–4°F) to 40°C (104°F) and 45% to 85% RH.
Always store the battery charged and not for longer than 5 months.
Ambient air pressure: 500 hPa to 1060 hPa.
NOTE
Always fully charge the battery before an extended period of inactivity of the device and at least once
every 5 months.
In case of extended period of inactivity replace the battery from the hand piece.
• BatteryTypicalLifeCharacteristics:
The Translux Wave battery has a typical life expectancy of 300 – 400 charging cycles depending on the application
and environmental conditions in which it is used.
NOTE
The battery is a chemical product utilising a chemical reaction, so the performance will deteriorate not only
through use but also with the passage of time even if it left unused.
GB
-7-
3.2.5 LIABILITY
Work on electronic equipment in the unit must be carried out by Heraeus Kulzer, Heraeus Kulzer service partners or
qualified, specialist personnel only and when the equipment is in a safe status (de-energised).
Only use authorised original spare parts and accessories. Avoid other parts as they hide unknown risks.
The operability and safety of the unit is only guaranteed if the necessary tests, maintenance and repair work is carried
out by Heraeus Kulzer, Heraeus Kulzer service partners or trained, specialist personnel.
For possible damage coming from a fault / malfunction of the unit due to improper repair, which was not carried out
by Heraeus Kulzer service partners or by personnel trained by us or in cases where original spare / accessory parts
were not used during a part replacement, Heraeus Kulzer GmbH is not liable.
4
Unit description
4.1
Delivery contents
1 Charging unit
2 Hand piece
3 Light guide, Ø = 8 mm
4 Protective light cone
5 Rechargeable Lithium-ion battery pack
6 Universal input power supply (100 V – 240 V (
6a = Europe type 1
6b = UK
type 2
6c = US / JP type 3
GB
-8-
4.2
4.2.1
1x
)) including international mains socket adapters:
Description of the control and operating elements
Hand piece
1 “Start / Stop” button
2 Curing modes LEDs (GREEN)
3 Battery status LED (2-colour: GREEN / YELLOW)
4 Charging unit contacts
5 Alignment key
4.2.2 Alignment key
The alignment key (5), located at the back bottom part of the hand piece’s case, allows the correct
insertion of the hand piece in the charging unit holder.
When inserting the hand piece into the charging unit, the alignment key must be aligned with the
guiding slot positioned inside the charging unit.
A beep confirms that the contacts are in the correct charging position!
4.2.3
2x
2x
Charging unit
1x
Top view elements
1 Charging unit cover
7 Hand piece holder with alignment key and replaceable charging unit contacts
8 Light intensity sensor
9
– GREEN colour LED
Function: It indicates the charging unit is powered up.
10
– 2-colour LED (GREEN / YELLOW)
Function: Light intensity information.
GREEN: Indicates that the light intensity, measured with the built-in light meter is suitable for
effective treatment.
YELLOW: Indicates that the light intensity is insufficient.
Bottom view charging unit
11 Power supply socket
12 Replaceable charging contact insert
2x
4.2.4
Acoustical signals hand piece
Function /
Error Condition
POLIMERISATION
PROGRAM: 10 seconds.
Hand piece Button operation
Acoustic signal/s emitted
Indications on the hand piece
• Pressthe“START / STOP” button
briefly to start the exposure.
“SOFT-START”
PROGRAM: 20 seconds.
• Pressthe“START / STOP” button
for at least one second to start the
exposure.
INTERRUPTION OF THE
EXPOSURE CYCLE
• Theexposurecyclecanbeinterruptedat
any time and program in use by pressing
.
the “START / STOP” button
• 1 beep when pressing the
“START / STOP” button.
• 1 beep at the end of exposure time.
The green LED 10 second light on.
• 1 beep when pressing the
“START / STOP” button.
• 1 beep after 1 second for acoustic indication
of “Soft-Start“-mode activation.
• 1 beep after 10 seconds of exposure time.
• 1 beep at the end of exposure time.
The green LED 20 second light on.
• 1 beep when pressing the
“START / STOP” button.
BATTERY-LOW SIGNAL
The residual charge level
of the battery is sufficient
for a few exposure cycles.
SIGNAL WHEN BATTERY
EMPTY
Following exposure cycle
can’t be activated.
DEFECTIVE
BATTERY SIGNAL
LED Light source
defective
OVERHEATING
CONDITION
BUILD-IN Temperature overload sensor
defective
Charging circuit of the
hand piece defective
Note: This condition is
detected only with hand
piece placed inside the
charging unit.
• 2 beeps at the end of the exposure cycle.
• Batteryiconisblinkinggreen.
Place hand piece into charger base for
charging!
• 2 beeps without activation of exposure cycle.
• Batteryiconisblinkinggreen.
Place hand piece into charger base for
charging!
Only with hand piece placed into the charging
unit.
• 1 beep every second for a period of
30 seconds.
The battery status LED lights YELLOW.
No acoustical signal emitted.
The green exposure cycle LED in use blinks.
• 3 beeps, and the electronics allows
termination of the exposure cycle in use.
• 4 beeps at the start of an exposure cycle.
Two green LED (10 s / 20 s) on the hand piece
blinking.
GB
-9-
4.2.5
GB
- 10 -
LED information concerning the radiation emitted
This device uses high-luminosity LEDs, Class 2M (IEC 60825-1).
LED Radiation.
Do not stare into the beam or view directly with optical
LED RADIATION
instruments.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• Class2MLEDProduct.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Max. power: < 5.00 mW.
• Dominant wavelength: Min. 440 nm – Max. 465 nm.
WARNING
Diverging beams
Do not observe the emission of light from the LED using optical instruments such as monocles, magnifying
glasses or microscopes from a distance of less than 100 mm as this could cause a risk of damage to your eyes.
Collimated beams
Do not observe the emission of light from the LED using optical instruments designed for use at a distance,
such as telescopes or binoculars, since this could cause a risk of damage to your eyes.
In the event of the LED control circuit failure, the LED radiation emission cannot exceed the value in the normal
use condition of the medical equipment.
Labels are provided on the packaging of the device, as indicated in the figure here above.
5
Installation and putting into initial operation
The following sections of this paragraph contain the information and instructions which must be followed to ensure
successful and faultless operation of the device. Before operating the Translux Wave follow the instructions in the
sequence described below.
The medical system is in compliance with the safety standards only if it is installed by following the instructions
described here below.
The device must be installed in a suitable place that is handy for its use. Place the charging unit on a sturdy,
dry, flat and horizontal surface.
IMPORTANT
The hand piece is intended for use within the patient environment whereas the charger unit and the
Switching Power Supply adapter are not intended for use within the patient environment.
NOTE
The patient environment is defined as an area 1.5 m from the patient (as per IEC 60601-1, third edition
and IEC 60601-1-1).
WARNING
Always inspect the unit and its components for any damage before installation.
If damage is apparent, do not proceed with the installation of the device.
The operator must not come simultaneously into contact with the elements outside the patient environment
(charger units and switching power supply adapter) and the patient.
Do not connect other external components to the medical system.
5.1
Safety requirements during Installation
WARNING
The electrical installation of the premises where the device is installed and used must comply with existing
legislation and the safety specifications relevant to power systems.
Install the device in a place where it will be protected from blows and from accidental splashes of water
or other liquids. Do not expose the device to direct sunlight, UV light.
Do not install the device on top or close to sources of heat. When installing, make sure that there is adequate
air circulating around the device. Do not install the device close to solvents or flammable liquids as they could
damage the plastic casings of the device.
The plug of the Switching Power Supply (Direct Plug-In), model PSAC05R-050, is considered the mean of
isolating of the medical equipment from supply mains. When the plug is connected, the power supply adapter
must be easily accessible. Leave sufficient free space around it. The medical equipment shall not be positioned
to make difficult to operate on the disconnection device (so on the plug of the Switching Power Supply).
Never short circuit the end elements of the battery with any metal object as it could cause a risk of burns,
fire and explosion.
The device is transportable but it must be handled with care. Transport the device in a horizontal position.
Do not let the device be exposed to shaking or vibrations. For sizes and weight see paragraph 12 (Technical
specifications).
WARNING – RISK OF EXPLOSION
Do not install the device where there is the risk of explosions. The device must not be used where an
inflammable atmosphere is present (anaesthetic mixtures, oxygen, nitrous oxide, etc.). Install the device
in a well ventilated area.
5.2
Connection of the charging unit to the mains power outlet
1x
The Translux Wave is supplied with a separated universal-input unit (6) that accepts
), 50 / 60 Hz.
100 to 240 V (
WARNING
Before connecting the charging unit (6) to the mains network, check carefully that the voltage and frequency
of the mains network correspond to the values stated on the rating plate of the device. The rating plate is
fitted to the bottom of the charging unit.
Use only the switching power supply adapter which is provided with the device. The use of any other power
supply adapter can result in damage of the battery.
Do not connect the switching power supply adapter to the mains socket by using a multiple portable socketoutlet.
NOTE
The Translux Wave power supply unit (6) is supplied with
three interchangeable adapters:
Fig. (6 a) = Europe type 1
Fig. (6 b) = UK
type 2
Fig. (6 c) = US / JP type 3
1 Select the correct adapter between the ones available: Europe – Type 1, UK – Type 2, US / JP – Type 3.
2 Each adapter has a slot into which the retaining latch on the power supply unit fits.
3 With the slot oriented toward the power supply unit, place the adapter onto the power supply unit so that the slides
on the adapter are aligned with their respective slots on the power supply unit.
4 Pressing down on the adapter and power supply unit, slide the adapter into the power supply unit until a click
is heard and the adapter is locked in place.
NOTE
Pressing down on the adapter during installation ensures that all the slides are held by the retainers on the
power supply unit. If the adapter feels loose, remove it and re-install.
5 To remove the adapter from the power supply unit, press the latch retainer button (marked with the word “PUSH”)
and slide the adapter away from the power supply unit and remove the adapter.
6 Retain unused adapters for future use.
7 Connect the plug of the power cord into the socket on the underside of the charging unit.
WARNING
Check the power cable, the power supply unit and the adapter regularly to make sure that they are in good
condition. If damage is apparent do not use damaged part until it is replaced. Use original Heraeus Kulzer
spare parts and accessories only.
8 Plug the power supply unit with its adapter into the mains power outlet.
9 The GREEN LED on the charger unit will light up (icon
).
5.3
Inserting the battery into the hand piece
The Translux Wave is supplied with a powerful Lithium-ion rechargeable battery.
The battery is supplied separately in the device packaging and must be inserted into the hand piece before initial
operation.
WARNING
Carefully follow all the safety precautions described in the paragraph 3.2.3 (BATTERY – Safety precautions).
GB
- 11 -
CAUTION
NEVER place the hand piece in the charging unit without the battery inserted in the hand piece.
Insert the battery into the hand piece in the sequence described below:
1 Remove the battery from its packaging.
WARNING
Never short circuit the terminals of the battery with any metal object as it could cause
a risk of burns, fire and explosion.
2 Use a flat tool (for example a coin) to unscrew counter-clockwise the battery cap of the
hand piece (Fig. 1 and 2 ).
3 An arrow is marked on the battery case (Fig. 3 ).
NOTE
This arrow indicates the orientation with which the battery must be inserted into the hand piece.
GB
- 12 -
2x
4 Slowly slide the battery with the arrow oriented toward the housing into the hand piece until it stops (Fig. 4 ).
NOTE
If the battery is inserted in the wrong way (i.e. in the opposite direction of the arrow),
the hand piece will not function. In case the battery is inserted in the wrong way,
no damage is caused to the hand piece’s electronics.
WARNING
Use original Heraeus Kulzer batteries only. The use of other manufacturer batteries or non-rechargeable
batteries / primary batteries is a potential hazard and can cause irreversible damage to the unit.
5 Use a flat tool (for example a coin) to screw clockwise the battery cap of the hand piece.
NOTE
The unit will not function properly if the cap of the hand piece is not screwed on completely.
5.4
Inserting the fibre optic into the hand piece
2x
• Rotatethelightguideslightly(1) and insert it into the hand piece (2) until final positioning
is reached. The final position is reached when you hear a “click”.
• Mounttheprotectivelightcone(3) on the top end of the light guide.
Positioning the light guide
• Rotatethelightguideintothedesiredpositionforthepolymerisation.
• Tomakefulluseofthelightintensityprovided,placethelightguideasclosetothecompositeaspossible.
Avoid direct contact with the composite material!
CAUTION – Keep the light guide clean at all times to obtain full light intensity.
The light intensity is considerably reduced if:
– The light guide is not in perfect condition (scratched or chipped).
– The light guide is not correctly placed in the hand piece.
– The light guide has composite stains.
WARNING
A damaged light guide reduces the light intensity and must be replaced with a new one immediately.
Sharp edges may cause serious injury. Use original Heraeus Kulzer light guides only.
WARNING – Infection control:
To make treatment as safe as possible for patients and operators, the light guide and the protective light cone
must be cleaned, disinfected and sterilised before each treatment. Follow the instructions listed in paragraph 8
(Cleaning, disinfection and sterilisation) step by step.
5.5
Battery charging
CAUTION – NEW Battery: first charging
The Translux Wave battery has been partially charged at the factory. Therefore the battery must be fully
charged before using the Translux Wave for the first time.
NOTE – NEW Battery: first charging
For the first charge, this process will take about 3 hours. New batteries or batteries stored for a long time may
take longer to charge. The battery will reach its full capacity after a few full charge / discharge cycles.
WARNING – RISK OF EXPLOSION
Use only the charging unit, supplied with the Translux Wave, to charge the battery. Never attempt to charge the
battery using another battery charging unit or power source, due to risk of explosion and fire.
Insert the hand piece with the battery into the Translux Wave charging unit.
2x
A beep confirms that the contacts are in the correct charging position!
IMPORTANT NOTE – Alignment key
The alignment key (5), located at the back bottom part of the hand piece’s case, allows the correct insertion
of the hand piece in the charging unit. When inserting the hand piece into the charging unit, the alignment key
must be aligned with the slot positioned inside the charging unit.
Battery charging process.
• TheGreenbatterystatusLED,onthehandpiece,startsblinking.
• Whenthechargingphaseiscomplete,batteryfullycharged,theGreenstatusLEDispermanentlylightedup.
IMPORTANT NOTE – Defective battery
In case, during the charging phase, the hand piece electronics detects a battery malfunction, the changing
process is interrupted and the status battery LED will blink YELLOW in colour.
In this condition, a beep signal is emitted every second for a period of 30 seconds.
Replace the defective battery with a new one!
WARNING
Use Heraeus Kulzer batteries only!
NOTE
When the hand piece is placed in the charging unit its functioning is inactive. The operativeness of the
“Start / Stop” button
is prevented.
The hand piece can be removed from the charging unit during the charging process; however, the battery
may not be fully charged and may shorten the operational duration.
6
Operation
WARNING – Check the condition of the device before starting the treatment.
Before each treatment, always make sure that the device is in proper working order and that the accessories
(light guide and protective light cone) are efficient. If anything is noted during treatment, do not carry out the
treatment and contact Heraeus Kulzer or a local authorised Customer Service agent (see paragraph 14 Service).
Do not use the device and its accessories if damage is apparent. Prior to each use of the Translux Wave
ensure that the emitted light intensity is sufficient to guarantee the polymerisation. Check the light intensity by
using the light meter integrated into the charging unit (see paragraph 6.2 Measurement of the Light Intensity).
WARNING – Control of infections
First use
The accessories, light guide and protective light cone, are delivered in NON STERILE condition and must be
sterilised before being used for the first time.
Every use
Once used, the accessories, light guide and protective light cone, must be reprocessed prior to reuse,
according to the procedures described in the paragraph 8 (Cleaning, disinfection and sterilisation).
6.1
Activating and deactivating the exposure cycle
The Translux Wave can operate with two different exposure cycles:
– Exposure with constant output: cycle duration 10 seconds.
– Exposure with slowly increasing output: “Soft-Start” (cycle duration 20 seconds).
The “Soft-Start” means increase of light intensity from 50% up to 100% within 2 seconds.
• Ifthehandpieceisin“Sleep Mode” (all the curing mode LEDs on the hand piece are OFF),
briefly press the “Start / Stop” button
to make the hand piece operative.
(After restarting, the 10 second LED will light up by default).
GB
- 13 -
Exposure 10 seconds polymerisation
Briefly press the “Start / Stop” button
. The light emission will turn on.
The 10 second LED is on showing that this program is running.
Once the curing cycle is complete, the unit will automatically turn the light off.
Acoustical signal:
The following acoustical signals (beep) are emitted:
1 beep while press the “Start / Stop” button.
1 beep at the end of the exposure time.
GB
- 14 -
Exposure 20 seconds “Soft-Start” polymerisation
Press and keep pressed for at least one second the “Start / Stop” button
. The light emission will turn on.
The 20 second LED is on showing that this program is running.
Once the curing cycle is complete, the unit will automatically turn the light off and the unit returns to the 10 second
mode (10 second LED on).
Acoustical signal:
The following acoustical signals (beep) are emitted:
1 beep while press the “Start / Stop” button.
1 beep after 1 second for acoustic indication of “Soft-Start“-mode activation.
1 beep after 10 seconds of exposure time.
1 beep at the end of the exposure time.
NOTE
The exposure cycle can be interrupted at any time, before the exposure time is over,
by pressing again the “Start / Stop” button.
Acoustical signal:
An acoustical signal (beep) is emitted, when the “Start / Stop” button is pressed to interrupt the cycle.
6.2
Measurement of the Light Intensity
The charging unit of the Translux Wave is equipped with an integrated light intensity meter (8).
2x
CAUTION
Before each treatment always check the light intensity by using the light intensity meter
integrated in the Translux Wave charging unit.
• Withoutapplyingpressure,placethelightguideflatanddirectlyonthetestingarea(8).
Activate the unit by pressing the “Start / Stop” button
(whichever exposure time selected).
The light intensity measuring is immediately indicated by the 2-colour LED (Symbol
) placed at the bottom right
of the testing area.
GREEN LED: The light intensity is sufficient for the treatment.
YELLOW LED: The light intensity is insufficient and patient/s must not be treated.
CAUTION
If the light intensity is insufficient, please carry out the following controls and measures:
– The light guide has not been inserted into the hand piece (see paragraph 5.4 Inserting the fibre optic
into the hand piece).
– Check the light guide for contamination or defects.
– Clean the light guide of any contamination (see paragraph 8 Cleaning, disinfection and sterilisation)
or replace the damaged light guide with a new one.
Use original Heraeus Kulzer light guides only.
WARNING
If the measures described above do not result in any improvement, do not use the device for any treatment.
Switch off the unit (disconnect the charging unit from the electrical power source) and ensure that
unauthorised unit re-activation is not possible. Contact a Heraeus Kulzer’s service partner, or technically
trained personnel authorised by Heraeus Kulzer (see paragraph 14 Service).
6.3
Sleep Mode
The hand piece is equipped with a “Sleep Mode” to minimise the unit’s energy consumption.
Outside the charging unit, all internal functions of the hand piece are automatically turned off (“Sleep Mode”)
if it is not used for approximately 5 minutes.
In “Sleep Mode” the curing modes LEDs on the hand piece are turned off.
To terminate the “Sleep Mode” press the “Start / Stop” button
The hand piece is ready for operation.
6.4
.
Additional information on the unit operations
NOTE
If the hand piece is placed in the charging unit before the curing cycle is terminated, the light emission
automatically switches off.
When the hand piece is placed in the charging unit its functioning is inactive. The operativeness of the
“Start / Stop” button
is prevented.
The Translux Wave is equipped with microprocessors which continuously check the optimum charging
parameters of the battery. After every treatment, the hand piece should therefore be inserted in the charging
unit for storage irrespective of the battery level.
GB
- 15 -
7
Alarm conditions
7.1
Faulty battery
In the case of a defective battery, the battery status LED on the hand piece will
continuously blink YELLOW (Fig. a).
A “beep” sound is emitted every second for a period of 30 seconds.
IMPORTANT
This error condition is detected only when the hand piece is placed in the charging unit.
blinking
7.2
Faulty LED
When a malfunction LED condition is detected by the microprocessor,
the green curing mode LED “10s” which is in use starts blinking (Fig. b).
blinking
a
b
7.3
Overheat protection
If multiple curing cycles in rapid succession occur (normally after 18 consecutive cycles,
each lasting 20 seconds), the built-in temperature overload sensor may activate.
Once the overheat protection activates, an acoustical signal (3 beeps) is emitted at the end of the exposure cycle.
The activation of the overheat protection temporarily stops the use of the unit for a few minutes.
Allow the hand piece to cool down for at least 4 – 5 minutes, then start the next exposure
by pressing the “Start / Stop” button
.
NOTE
The hand piece becomes operational upon reaching operational temperature. No “manual reset” required.
7.4
BUILT-IN Temperature overload sensor defective
In case of a defective temperature overload sensor, “4 beeps” are emitted at the start of an exposure cycle.
NOTE
If the temperature overload sensor fault occurs during an exposure cycle, the software allows
completing the exposure. No further exposure cycle is allowed by pressing the “Start / Stop” button
“4 beeps” are emitted.
Any further operation with defect temperature overload sensor is prevented.
and
7.5
Battery-low signal
When after frequent use the battery charge drops to the minimum level, the Translux Wave microprocessor permits
another few cycles in any curing mode, without re-charging the battery.
This condition is signalled at the end of each cycle by “2 beeps”.
Battery icon is blinking green. Charge the battery!
At the end of a few cycles the remaining battery charge does not allow any further exposure cycle.
This condition is signalled by “2 beeps”.
Battery icon is blinking green. Charge the battery!
8
Cleaning, disinfection and sterilisation
DISCONNECT FROM MAINS
Before carrying out the cleaning and disinfection procedures disconnect the charging base from the electrical
power source!
WARNING
Control of infections
The light guide and the protective light cone are delivered in NON STERILE condition and must be cleaned,
disinfected and sterilised (steam) before being used for the first time as well as before every use.
Do not sterilise the hand piece and the charging unit!
Do not sterilise the battery!
GB
- 16 -
8.1
Disassembly
Remove the protective light cone from the light guide.
Remove the light guide: Rotate the light guide slightly and pull it out from the hand piece.
8.2
LIGHT GUIDE – Cleaning and disinfection
CAUTION
Do not use sharp or pointed instruments to clean the light guide, since they could scratch the surface of the
light guide and thus decrease light transmission.
Do not use cleaning / disinfectant agents containing organic, mineral and oxidising acids, hydrogen peroxide,
chloride, iodine, bromide and solvents.
1) Immediately after use, any possible residue, such as composite material, must be removed from the end surface
of the light guide. Any polymerised composite should be removed by using ethanol and a plastic spatula or soft
nylon brush may help in removing the material residue.
2) Disinfect the light guide with a clean, soft lint free cloth dampened with a mild disinfectant solution, featuring a mild
pH (pH 7), according to the manufacturer’s specifications. Allow the disinfectant solution to dry.
8.2.1 LIGHT GUIDE – Inspection before the sterilisation
Before proceeding with the sterilisation process, carefully check the light guide for damaged surfaces, discolouration
and contamination.
WARNING
Do not use a damaged light guide. If damage is apparent, replace the light guide with a new one.
If the light guide is still contaminated, repeat the cleaning and disinfection procedure.
8.3
PROTECTIVE LIGHT CONE – Cleaning and disinfection
CAUTION
Do not use cleaning / disinfectant agents containing organic, mineral and oxidising acids, hydrogen peroxide,
chloride, iodine, bromide and solvents.
Clean and disinfect the protective light cone with a soft cloth wetted with a mild disinfectant solution, featuring
a mild pH (pH 7), according to the manufacturer’s specifications. Allow the disinfectant solution to dry.
8.3.1 PROTECTIVE LIGHT CONE – Inspection before the sterilisation
Before proceeding with the sterilisation process, carefully check the protective light cone for damaged surfaces,
veins discolouration and contamination.
WARNING
Do not use a damaged protective light cone. If damage is apparent, replace the protective light cone with
a new one.
A damaged protective light cone cannot provide enough protection from the unit light.
If the protective light cone is still contaminated, repeat the cleaning and disinfection.
8.4
LIGHT GUIDE and PROTECTIVE LIGHT CONE – Packaging before the sterilisation
The light guide and the protective light cone can be sterilised by using a single-use medical steam sterilisation pouch
of the appropriate size.
CAUTION
The light guide and the protective light cone must be packed individually in a single pouch.
When sterilising multiple instruments in one autoclave, ensure that the autoclave maximum load
is not exceeded.
WARNING
Ensure that the inner pouch is large enough to contain the single instruments, without stressing the seals
or tearing the packaging.
8.4.1 LIGHT GUIDE and PROTECTIVE LIGHT CONE – Sterilisation
8.4.1.1 Sterilisation method
• Carryoutthesterilisationbymeansofapre-vacuumsteamautoclaving.
CAUTION
Never use any other sterilisation method, because of potential incompatibility with the materials with which
is made the light guide.
DO NOT USE the following sterilisation methods: Ethylene oxide sterilisation, hot air sterilisation,
flash autoclaving, STERRAD sterilisation, STERIS system or comparable sterilisation systems.
DO NOT sterilise the light guide and the protective light cone by using: Hydrogen peroxide, peracetic acid
system, formaldehyde and glutaraldehyde sterilisation.
8.4.1.2 Sterilisation parameters
• Minimum sterilisation parameters that provide a 10 –6 sterility assurance level – (SAL).
Cycle Type
Pre-vacuum
Minimum Temperature
132°C + 3°C
(270°F + 5°F)
Minimum Exposure Time (pouch)
4 minutes
Minimum Dry Time
20 minutes
CAUTION
Do not exceed 135°C (275°F).
8.5
HAND PIECE – Cleaning and disinfection
WARNING
The hand piece is not protected against the penetration of liquids.
Do not spray liquids directly onto the surface and charging contacts of the hand piece.
Cleaning and disinfectant agents must not enter the hand piece!
NEVER immerse the hand piece in liquids.
NEVER clean the hand piece under running water.
Do not sterilise the hand piece. Risk of serious damage, electrical shock and fire!
2x
GB
- 17 -
Clean and wipe the hand piece casing with a clean, soft lint free cloth dampened with a mild surface disinfection
agent, featuring a neutral pH (pH7) according to the manufacturer’s specifications.
Allow the disinfectant solution to dry or dry the residual disinfectant on the hand piece casing with
a soft lint free cloth.
CAUTION
Do not use solvents such as acetone, isopropyl alcohol, and hydrogen peroxide, chloride, iodine, bromide,
phenol or other aggressive solutions to clean and disinfect the plastic surface of the hand piece. These substances may be harmful, causing discolouration and / or damage to the plastic materials of the hand piece.
Do not use abrasive cleaners!
IMPORTANT: Cleaning of the charging contacts of the hand piece
After having carried out the cleaning / disinfection of the hand piece’s plastic casing, always clean the charging
contacts which are positioned in the bottom part of the hand piece. The charging contacts of the hand piece
must always be free from possible soil, composite and cleaning / disinfectant residues.
IMPORTANT
The hand piece charging contacts must be cleaned regularly (at least once a week) and always after having
carried out the cleaning and disinfection of the hand piece plastic casing. Dirty charging contacts or contacts
exposed to liquids, like cleaner or disinfectants, can negatively affect the charging process and prevent the
battery of being charged.
Clean the charging contacts of the hand piece with an alcohol dampened soft lint free cloth or cotton swab.
CAUTION
Do not use sharp or pointed instruments to clean the hand piece contacts, since they could scratch and
damage their surface and thus worsen the conductivity with the charging contacts.
Before re-using the hand piece make sure that the hand piece’s surface and the charging contacts are perfectly
dried. If necessary, dry the contacts by blowing air onto them with compressed air.
GB
- 18 -
8.6
CHARGING UNIT – Cleaning casing
DISCONNECT FROM MAINS
Disconnect the input power supply from the power outlet and charging unit prior to cleaning / disinfection.
WARNING
The charging unit casing is not protected against the penetration of liquids.
Do not spray liquids directly onto the surface of the charging unit casing.
CAUTION
DO NOT sterilise the charging unit. It will no longer function and may cause a risk of serious damage,
electrical shock and fire!
Do not use solvents such as acetone, isopropyl alcohol, and hydrogen peroxide, chloride, iodine, bromide,
phenol or other aggressive solutions to clean the plastic surface of the charging unit. These substances may be
harmful, causing discolouration and / or damage to the plastic materials of the charging unit.
Do not use abrasive cleaners!
Clean and wipe the charging unit casing with a clean, soft, lint free cloth dampened with a mild surface cleaning
agent, featuring a neutral pH (pH7) according to the manufacturer’s specifications.
Dry the charging unit casing with a clean, non-abrasive cloth.
CAUTION
Be sure to dry the charging unit after cleaning. Moisture inside the unit could cause damage.
IMPORTANT
Upon completion of the cleaning procedure, make sure that the charging contacts inside the charging unit are
perfectly dry. If necessary, dry the contacts by blowing air onto them with compressed air.
8.6.1
CHARGING UNIT – Cleaning charging contacts
2x
IMPORTANT
After having carried out the cleaning of the charger’s plastic casing, always clean the charging
unit contacts. The charging contacts of the charging unit must always be free from possible soil,
composite and cleaning residues.
The charging unit contacts must be cleaned regularly (at least once a week) and, in any case, always after
having carried out the cleaning of the plastic casing. Dirty contacts or contacts exposed to liquids, like cleaner
or disinfectants, can negatively affect the charging process and prevent the battery of being charged.
Clean the contacts of the charging unit with an alcohol dampened soft lint free cloth or cotton swab.
CAUTION
Do not use pointed or sharp objects to clean the charging unit contacts!
Do not spray or flood the contacts with liquids!
Do not bend or modify the shape of the charging unit contacts during cleaning.
Make sure that the charge contacts remain dry after cleaning and are not contacted by metallic and greasy
parts. If necessary, dry the contacts by blowing air onto them with compressed air.
8.6.2 CHARGING UNIT – Replaceable charging contacts
Damaged or highly soiled charging unit contacts (that cannot be cleaned by following the procedures described in the
above paragraph) can prevent the contacts’ conductivity and consequently the battery charging.
In this case it is possible to replace the damaged charging unit contacts with new ones.
For additional information regarding replacement of charging unit contacts and spare part supply please contact your
local Heraeus Kulzer subsidiary.
Working instructions:
GB
Required tool: screwdriver for Phillips-Screws, mid-size.
1. Remove hand piece out of charger base.
2. Disconnect charger from mains.
- 19 3. Unplug connecting wire from charger.
2x
4. Turn charger upside down.
5. Remove 2 screws from the charging contact bridge (see rear fold-out cover, point 12).
6. Pull out charging contact bridge.
7. Insert new contact bridge and fix / connect in reverse way.
CAUTION
Do not bend or contaminate the new contact bridge!
Do care about perfect insert and fixation! Do not over tight the screws!
9
Shelf storage
Storage of the hand piece with battery during extended periods of non-use. Before or after a long inactivity period, fully
charge the battery or store it in the operating charging unit. Although the built-in safety circuit of the battery prevents
the full discharge, it is strongly recommended to fully charge the battery at least once every 5 months after inactivity.
10
Disposal
NOTE – IMPORTANT
The device must not be disposed off in normal domestic waste.
For the disposal of spare parts, or the unit, please contact the Heraeus Kulzer subsidiary directly in your
country.
Dispose unserviceable batteries and light guides according to the corresponding legal requirements in your
country.
WARNING – Damaged or exhausted battery disposal
Dispose a damaged or exhausted battery after taking the necessary steps to prevent external short circuit
by the following method:
After having insulated the terminals of the battery with tape dispose off in accordance with your local council.
The conditions and precautionary measures for disposing of the device are subject to the valid legal provisions similar
to any other electronic device which has become unusable.
Disposal of old equipment according to WEEE (European Directive) or
Electrical and Electronic Equipment Act (German Law ElektroG).
11
Troubleshooting
WARNING
If the below steps do not solve the problem, contact Heraeus Kulzer or a local authorised Customer Service
agent: DO NOT USE the Translux Wave and DO NOT ATTEMPT to service the unit as it may cause serious injury.
If the device does not seem to be working properly, read this user manual again and then check the
following table:
PROBLEM
The charging unit does not power on.
on the
The GREEN LED
charging unit is switched off.
POSSIBLE CAUSE
The input power supply is not connected
to electrical supply outlet and / or to the
charging unit power socket.
Power outlet carries no voltage.
The interchangeable adapter is not
properly inserted into the input power
supply casing.
The power cable of the input power
supply is damaged.
GB
- 20 -
Hand piece NOT inserted into the
charging unit.
The light emission does not start
when the “Start / Stop” button
is pressed and no information
appears on the hand piece’s display.
Replace the input power supply with a
new one. (The input power supply and
its cord cannot be separated from each
other.)
The input power supply is defective.
Replace the input power supply with
a new one.
The charging unit is defective.
Contact Heraeus Kulzer or local authorised Customer Service agent.
The charging unit contacts are shortEliminate the cause of short circuit.
circuited.
If the short circuit condition persists,
replace the charging unit contacts with
new ones.
Make reference to paragraph 8.6.2.
Hand piece without battery.
Insert the battery into the hand piece
(see paragraph 5.3).
Press the “Start / Stop” button to bring
Hand piece in “Sleep Mode”.
the hand piece out of the “Sleep Mode”.
Make reference to paragraph 6.3.
Empty battery.
Place the hand piece in the charging
There is not enough charge in the battery unit and re-charge the battery
(see paragraph 5.5).
to turn on the hand piece.
Electronics malfunction.
Defective battery.
“2 beeps” are emitted at the end of
the exposure cycle.
REMEDY
Make sure that the input power supply
is securely connected to electrical
supply outlet and to the charging unit
power socket.
Use a different power outlet.
Carefully read paragraph 5.2 of this user
manual.
Low battery charge.
Contact Heraeus Kulzer or local authorised Customer Service agent.
To verify if the battery is defective, place
the hand piece in the charging unit.
A “prequalification sequence” starts in
which Translux Wave micro-processor
checks the battery status.
This prequalification sequence can last
up to max. 30 minutes.
If, during this check sequence, a “beep”
signal is emitted every second for a period of 30 seconds and the battery icon
on the hand piece is blinking YELLOW,
the battery is detected to be defective.
Replace the battery with a new one
(see paragraph 5.3).
The “2 beeps” signal that the residual
charge level of the battery is adequate
only for a few subsequent exposure
cycles.
Place the hand piece in the charging
unit and re-charge the battery
(see paragraph 5.5).
PROBLEM
The light emission does not start
when the “Start / Stop” button
is pressed or during an exposure
cycle the light exposure is interrupted
with a beep sound. The curing LED
“10s” on the hand piece starts
blinking GREEN.
POSSIBLE CAUSE
The LED pack could be defective.
blinking
Overheating protection.
The hand piece has become overheated
in the course of use and the temperature
overload sensor has activated.
The activation of the overheat protection
temporarily prevents (for a few minutes)
the use of the unit.
Overheating protection.
During an exposure cycle “3 beeps”
are emitted.
The hand piece has become overheated
in the course of use and the temperature
overload sensor has activated.
The activation of the overheat protection
temporarily prevents (for a few minutes)
the use of the unit.
Malfunctions during charging phase. During the battery pre-qualification
phase (battery condition: completely
A “beep” signal is emitted every
second for a period of 30 seconds and empty ref. paragraph 4.2.4 and 5.5).
the battery status LED on the hand
The electronics detects a defective or
piece blinks YELLOW.
malfunction status of the battery and
interrupts the charging process.
After several consecutive exposure
cycles, the light emission does not
turn on, when the “Start / Stop”
is pressed, and “3 beep”
button
signals are emitted.
blinking
Hand piece placed in the charging
unit but the charging phase does
not start.
The green battery status LED on the
hand piece is off.
Defect: interrupt of charging contacts.
Improper contact between the charging
base and the hand piece.
Charging and / or hand piece contacts
are soiled.
The light intensity measured with the
meter integrated in the charging unit
is insufficient.
on the charging unit
The LED
lights YELLOW.
Light guide not properly inserted into the
hand piece.
Light guide output contaminated by
foreign material or composite residues
that can interfere with light output.
Light guide damaged or aged.
REMEDY
Verify the LED pack functionality by
means of the following procedure:
Insert hand piece into the charger and
press the “Start / Stop” button consecutively for 5 times.
Remove the hand piece from the charger unit. The curing LED “10s” on the
hand piece stops blinking GREEN, the
hand piece has been reset.
If the curing LED “10s” on the hand
piece appears again blinking at start
of the next exposure cycle and no
light emission starts, the LED pack is
defective. In this case please contact
Heraeus Kulzer or local authorised
Customer Service agent.
Allow the hand piece to cool down
for at least 4 – 5 minutes, then start
the next exposure by pressing the
“Start / Stop” button.
Note: The hand piece becomes operational upon reaching operational temperature. No “manual reset” required.
Allow the hand piece to cool down for
at least 4 – 5 minutes, then start the
next exposure by pressing the “Start /
Stop” button.
Replace the battery with a new one
(see paragraph 5.3).
2x
See paragraph 8.5 and 8.6.2.
Check if the hand piece has been
inserted in the correct orientation into
the charging unit.
Alignment key. Make reference to the
paragraph 4.2.1, points 4 and 5.
Clean the hand piece and the charging
unit contacts. Make reference to the
paragraphs 8.5 and 8.6.1.
Check light guide for complete insertion
in metal cone of the hand piece.
Clean the light guide output.
Make reference to paragraph 8.2.
Replace the light guide with a new one.
GB
- 21 -
12
GB
- 22 -
Technical specifications
Classification according to Directive 93/42/EEC: Class I (one)
Safety Standards:
The product has been tested and found to comply to IEC 60601-1
(second edition) and to IEC 60601-1-1.
The product has been tested and found to comply to IEC 60601-1
(third edition) and to IEC 60601-1-2 (third edition – for electromagnetic compatibility – EMC).
The hand piece is intended for use within the patient environment
whereas the charger unit and the power supply adapter are not
intended for use within the patient environment.
Note: The patient environment is defined as an area 1.5 m from the
patient (as per IEC 60601-1, third edition and IEC 60601-1-1).
Classification according to IEC 60601-1:
Class II, Type B, Applied Part: Light guide with protective cone.
IP 20 (Charging unit).
IP 20 (Translux Wave)
Charging unit:
Translux Wave Charging unit
Power supply for the charging unit:
Switching Power Supply (Direct Plug-In) manufactured by:
Phihong Technology CO LTD – Model: PSACO5R-050.
Input: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Output: 5 V
– 1 A Max –
.
Class II equipment
Power supply for the hand piece:
Rechargeable Lithium-ion battery.
Manufacturer: Panasonic.
Model: NCR-18500.
Nominal Voltage: 3.6 V.
Nominal capacity (Typical): 2000 mAh
Hand piece:
Model: Translux Wave.
Operation: Intermittent service: 120“ ON – 40“ OFF – max 2 times
running
Light source:
High-luminosity LED.
Class 2M LED Product (IEC 60825-1).
Wavelength range: 440 – 480 nm.
Dominant wavelength: Min. 440 nm – Max. 465 nm
Light guide:
Lead-free multi core rod, 8 mm diameter.
Sterilisable in pre-vacuum steam autoclave:
4 minutes (minimum) at minimum temperature of 132°C + 3°C
(270°F + 5°F). Max. 500 cycles
Settable exposure cycles:
10 seconds of exposure time.
– Normal exposure
Acoustical signals:
1 beep at the start of exposure.
1 beep at the end of exposure
– “Soft-Start” exposure
20 seconds of exposure time. (The “Soft-Start” means increase
of light intensity from 50% up to 100% within 2 seconds.)
Acoustical signals:
1 beep at the start of exposure.
1 beep after 1 second for indication of “Soft-Start”-mode activation.
1 beep after 10 seconds of exposure.
1 beep at the end of exposure
Charging time of empty battery:
Approx. 3 hours
Environmental conditions of unit:
Operation
Transportation and
Temperature
Relative humidity
Atmospheric pressure
10°C – 35°C
(50°F – 95°F)
45% – 85%
800 – 1060 hPa
storage
–20°C – 40°C
(–4°F – 104°F)
45% – 85%
500 – 1060 hPa
Charging unit: weight 450 g.
Dimensions: L 140 x W 58 x H 62 mm
Hand piece: weight 150 g (incl. light guide).
Dimensions: L 275 mm, max. Ø 24 mm
Weight and dimensions:
12.1
Electromagnetic compatibility EN 60601-1-2
WARNING
The device requires specific EMC precautions and must be installed and started up in accordance with the
EMC information given in this paragraph.
Portable and mobile radio communication appliances may affect the correct function of the device.
Guidance and manufacturer’s declaration – Electromagnetic emissions
The Translux Wave is intended for use in the electromagnetic environment specified below.
The customer or the user of the Translux Wave should ensure that it is used in such an environment.
Emissions test
Compliance Electromagnetic environment – Guidance
RF emissions CISPR 11
Group 1
The Translux Wave uses RF energy only for its internal function.
Therefore it’s RF emissions are very low and are not likely to cause
any interference in nearby electronic equipment.
RF emissions CISPR 11
Class B
The Translux Wave is suitable for use in all establishments,
including domestic establishments and those directly connected
Harmonic emissions IEC 61000-3-2
Class A
to the public low-voltage power supply network that supplies
Voltage fluctuations / flicker emissions Complies
buildings used for domestic purposes.
IEC 61000-3-3
Guidance and manufacturer’s declaration – Electromagnetic immunity
The Translux Wave is intended for use in the electromagnetic environment specified below.
The customer or the user of the Translux Wave should ensure that it is used in such an environment.
Immunity test
IEC 60601 test level
Compliance level
Electromagnetic environment –
Guidance
Electrostatic discharge ±6 kV contact
The device continues to
Floors should be wood, concrete or
(ESD) IEC 61000-4-2
±8 kV air
work regularly and in safety. ceramic tile. If floors are covered
with synthetic material, the relative
humidity should be at least 30%.
Electrical fast transient ±2 kV for power supply lines The device continues to
Mains power quality should be that
/ burst IEC 61000-4-4 ±1 kV for input / output lines work regularly and in safety. of a typical commercial or hospital
environment.
Surge IEC 61000-4-5
±1 kV differential mode
The device continues to
Mains power quality should be that
±2 kV common mode
work regularly and in safety. of a typical commercial or hospital
environment.
The device can vary from
Mains power quality should be that
Voltage dips, short in- < 5% UT (> 95% dip in UT)
the required levels of immu- of a typical commercial or hospital
terruptions and voltage for 0.5 cycle
nity with a duration for as
environment.
variations on power
40% UT (60% dip in UT)
long as the device remains
supply input lines IEC
for 5 cycle
in safety; no malfunctions
61000-4-11
70% UT (30% dip in UT)
have been detected and
for 25 cycle
can be restored to pre-test
status with the intervention
< 5% UT (> 95% dip in UT)
of the operator.
for 5 sec
Power frequency
(50 / 60 Hz) magnetic
field IEC 61000-4-8
3A/m
The device continues to
Power frequency magnetic fields
work regularly and in safety. should be at levels characteristic of
a typical location in a typical commercial or hospital environment.
NOTE: UT is the a.c. mains voltage prior to application of the test level.
GB
- 23 -
GB
- 24 -
Guidance and manufacturer’s declaration – Electromagnetic immunity
The Translux Wave is intended for use in the electromagnetic environment specified below.
The customer or the user of the Translux Wave should ensure that it is used in such an environment.
Immunity
IEC 60601
Compliance
Electromagnetic environment – Guidance
test
test level
level
Conducted RF 3 Veff 150 kHz The device
Portable and mobile RF communications equipment should be used no
IEC 61000-4-6 to 80 MHz
continues to
closer to any part of the disposal including cables, than the recommenwork regularly ded separation distance calculated from the equation applicable to the
Radiated RF
3 V / m 80 MHz and in safety.
frequency of the transmitter.
IEC 61000-4-3 to 2.5 GHz
Recommended separation distance
d = 1.2 √P
d = 1.2 √P 80 MHz to 800 MHz
d = 2.3 √P 800 MHz to 2.5 GHz
where (P) is the maximum output power rating of the transmitter in
watts (W) according to the transmitter manufacturer and (d) is the
recommended separation distance in metres (m). Field strengths from
fixed RF transmitters, as determined by an electromagnetic site survey,
should be less than the compliance level in each frequency
range (b). Interference may occur in the vicinity of equipment
marked with the following symbol:
Notes:
(1) At 80 MHz and 800 MHz, the higher frequency range applies.
(2) These guidelines may not apply in all situations. Electromagnetic propagation is affected by absorption and reflection
from structures, objects and people.
a) Field strengths from fixed transmitters, such as base stations for radio (cellular / cordless) telephones and land mobile
radios, amateur radio, AM and FM radio broadcast and TV broadcast cannot be predicted theoretically with accuracy.
To assess the electromagnetic environment due to fixed RF transmitters, an electromagnetic site survey should be
considered. If the measured field strength in the location in which the Translux Wave is used exceeds the applicable
RF compliance level above, the Translux Wave should be observed to verify normal operation. If abnormal performance is
observed, additional measures may be necessary, such as re-orienting or relocating the Translux Wave.
b) Over the frequency range 150 kHz to 80 MHz field strengths should be less than 3 V / m.
Recommended separation distances between portable and mobile RF communications equipment and
the Translux Wave
The Translux Wave is intended for use in an electromagnetic environment in which radiated RF disturbances are controlled.
The customer or the user of the Translux Wave can help prevent electromagnetic interference by maintaining a minimum
distance between portable and mobile RF communications equipment (transmitters) and the Translux Wave as recommended below, according to the maximum output power of the communications equipment.
Rated maximum output
Separation distance according to frequency of transmitter (m)
power of transmitter (W)
150 kHz to 80 MHz
80 MHz to 800 MHz
800 MHz to 2.5 GHz
d = 1.2 √P
d = 1.2 √P
d = 2.3 √P
0.01
0.12
0.12
0.23
0.1
0.38
0.38
0.73
1
1.2
1.2
2.3
10
3.8
3.8
7.3
100
12
12
23
For transmitters rated at a maximum output power not listed above, the recommended separation distance (d) in metres (m)
can be estimated using the equation applicable to the frequency of the transmitter, where (P) is the maximum output power
rating of the transmitter in watts (W) according to the transmitter manufacturer.
Notes:
(1) At 80 MHz and 800 MHz the separation distance for the higher frequency range applies.
(2) These guidelines may not apply in all situations. Electromagnetic propagation is affected by absorption and reflection
from structures, objects and people.
12.2
Charging unit identification plate
Description of the symbols on the identification plate
1 CE mark.
2 Caution, consult accompanying documents.
3 Consult instructions for use.
4 Double insulation (device complies with safety class II).
5 Disposal of old electrical and electronic equipment.
(Applicable in the European Community and other European
countries with separate collection systems.)
6 MET mark.
12.3
Hand piece serial number
The hand piece serial number is engraved
on the bottom part of its casing.
Engraved
serial number.
1
2
3
4
5
6
GB
13
Warranty
Each Heraeus Kulzer unit is subject to a stringent check and final inspection prior to delivery to guarantee perfect
operation of the equipment. For all new Heraeus Kulzer products purchased from a Heraeus Kulzer retailer or importer,
Heraeus Kulzer offers a warranty of 2 (two) years from the day of purchase for material and production faults.
During the warranty period, Heraeus Kulzer undertakes to repair (or replace, if it chooses) parts of the products
deemed by Heraeus Kulzer to be faulty, free of charge. No provision has been made for complete replacement of the
Heraeus Kulzer products.
Under no circumstances shall Heraeus Kulzer be liable for any direct or indirect personal injury
or damage in the following cases:
• Theunitwasnotusedforitsintendedpurpose.
• Theunitwasnotusedaccordingtotheinstructionsandspecificationsdescribedinthismanual.
• Theelectricalinstallationintheroomsinwhichtheunitisuseddoesnotcomplywithexistinglegislationand
relevant specifications.
• Theassembly,additions,setting,alterationandrepairwasnotperformedbyHeraeusKulzerspecialistpersonnel.
• Theconditionsforstoringtheunitdonotcomplywiththespecificationslistedinparagraph12
(Technical specifications).
Excluded from the warranty are transportation damage, damage caused by improper use or negligence, damage
caused by connection to a power supply other than that specified for the equipment and damage to the control lamps,
buttons and all accessories. The warranty shall become invalid if the unit is altered or repaired by personnel not
belonging to Customer Service. When making a warranty claim, the customer forwards the damaged unit, at his own
cost, to the retailer or Heraeus Kulzer importer where he bought the unit. The unit, including the accessories, must be
well packed before shipping (if possible, in the original packaging).
A card containing the following information must be enclosed with the unit if returning the unit:
a) Name, address and telephone number of owner.
b) Name and address of retailer / importer.
c) Photocopy of the delivery note / purchase receipt for the unit by the owner which shows the date,
designation and serial number of the unit.
d) Description of malfunction.
The warranty does not cover transportation or any transportation damage.
In the event of damage caused by an accident or improper use, or which occurs after expiration of the warranty period,
repairs will be invoiced according to effective material and labour costs.
- 25 -
14
Service
14.1
Service agents / Contact in the countries
15
Document history
1x
2012-08 Draft version for Prototypes.
2013-09 First edition.
2014-03 Editorial changes paragraph 2.1, 3.2.1, 7.2, 10, 11, 12 and 12.2.
GB
- 26 -
Subject to modifications.
Dated: 2014-03
Table des matières
1
1.1
1.2
1.3
Application ______________________________________________________________________
Remarques d’ordre général ________________________________________________________
Déclaration de conformité CEE ______________________________________________________
Déclaration du fabricant ____________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Instructions pour utiliser l’appareil en toute sécurité ______________________________________
Explication des symboles et des mentions complémentaires qui les accompagnent ________________
Dommages pendant le transport – Déballage et inspection __________________________________
Obligations du propriétaire _________________________________________________________
Journal de l’appareil ______________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Usage prévu _____________________________________________________________________
Description de la lampe ___________________________________________________________
Consignes de sécurité ____________________________________________________________
Consignes de sécurité générales pour l’utilisation de la lampe _______________________________
Mesures de sécurité ______________________________________________________________
BATTERIE – Mesures de sécurité ____________________________________________________
BATTERIE – Informations __________________________________________________________
ENGAGEMENT __________________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Description de la lampe ____________________________________________________________ 8
Contenu de la livraison ____________________________________________________________
8
Description des éléments de contrôle et de commande ____________________________________
8
Pièce à main ___________________________________________________________________
8
Touche d’alignement _____________________________________________________________
8
Chargeur ______________________________________________________________________
8
Signaux sonores de la pièce à main __________________________________________________
9
Informations sur les LED relatives au rayonnement émis ___________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installation et mise en service initiale __________________________________________________
Consignes de sécurité pour l’installation _______________________________________________
Raccordement du chargeur à l’alimentation secteur _______________________________________
Insertion de la batterie dans la pièce à main ____________________________________________
Insertion de la fibre optique dans la pièce à main ________________________________________
Charge de la batterie _____________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Fonctionnement __________________________________________________________________
Activation et désactivation du cycle d’exposition _________________________________________
Mesure de l’intensité lumineuse _____________________________________________________
Mode Veille ____________________________________________________________________
Informations complémentaires sur les fonctions de la lampe ________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Conditions d’alerte ________________________________________________________________
Batterie défectueuse ______________________________________________________________
LED défectueuse ________________________________________________________________
Protection contre la surchauffe ______________________________________________________
Capteur de surcharge thermique INTÉGRÉ défectueux _____________________________________
Signal de batterie faible ___________________________________________________________
15
15
15
15
15
16
REMARQUE
Veuillez vous reporter à l’icône du manuel pour accéder
aux illustrations des chapitres ou à des informations
complémentaires sur le rabat déplié.
HKG-Layout 99000943_01 GBA
1x /2x
Veuillez déplier
le rabat avant
Veuillez déplier
le rabat arrière
03FR
Translux Wave EU
Dateiname: 03FR_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
FR
-1-
FR
-2-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Nettoyage, désinfection et stérilisation _________________________________________________
Démontage ____________________________________________________________________
CONDUCTEUR DE LUMIÈRE – Nettoyage et désinfection ____________________________________
CONDUCTEUR DE LUMIÈRE – Inspection avant la stérilisation ________________________________
CÔNE DE PROTECTION OCULAIRE – Nettoyage et désinfection _______________________________
CÔNE DE PROTECTION OCULAIRE – Inspection avant la stérilisation ___________________________
CONDUCTEUR DE LUMIERE et CÔNE DE PROTECTION OCULAIRE – Conditionnement avant la stérilisation
CONDUCTEUR DE LUMIERE et CÔNE DE PROTECTION OCULAIRE – Stérilisation ___________________
Méthode de stérilisation ___________________________________________________________
Paramètres de stérilisation _________________________________________________________
PIÈCE À MAIN – Nettoyage et désinfection ______________________________________________
CHARGEUR – Nettoyage du boîtier ____________________________________________________
CHARGEUR – Nettoyage des contacts de charge _________________________________________
CHARGEUR – Contacts de charge remplaçables __________________________________________
9
Stockage ________________________________________________________________________ 19
10
Mise au rebut ____________________________________________________________________ 19
11
Dépannage ______________________________________________________________________ 20
12
12.1
12.2
12.3
Caractéristiques techniques _________________________________________________________
Compatibilité électromagnétique EN 60601-1-2 _________________________________________
Plaque signalétique du chargeur _____________________________________________________
Numéro de série de la pièce à main __________________________________________________
13
Garantie ________________________________________________________________________ 25
14
14.1
Service Clients ____________________________________________________________________ 26
Partenaires agréés / Interlocuteurs dans les différents pays _________________________________ 26
15
Historique du document ____________________________________________________________ 26
REMARQUE
Veuillez vous reporter à l’icône du manuel pour accéder
aux illustrations des chapitres ou à des informations
complémentaires sur le rabat déplié.
16
16
16
16
16
17
17
17
17
17
17
18
18
19
22
23
25
25
1x /2x
Veuillez déplier
le rabat avant
Veuillez déplier
le rabat arrière
1
Application
1.1
Remarques d’ordre général
Translux Wave est une marque déposée de Heraeus Kulzer GmbH.
Cette notice d’utilisation est valable pour :
Référence
66055012
Type et équipement
Translux Wave – Lampe à photopolymériser à LED
Edition
2014-03 / 99000943/01
1.2
Déclaration de conformité CEE
Nous soussignés, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, déclarons par la présente que l’appareil
désigné par la suite respecte par sa conception et sa construction ainsi que par sa version mise sur le marché par
nos soins les exigences en vigueur en matière de sécurité et de santé de la directive CEE.
Cette déclaration perd sa valeur en cas de modification de l’appareil sans accord préalable de notre part.
1.3
Déclaration du fabricant
Nous confirmons par la présente déclaration que la lampe Translux Wave est conforme à la directive 93/42 CEE et aux
normes IEC 60601-1 et IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Allemagne).
2
Instructions pour utiliser l’appareil en toute sécurité
Veuillez lire ce manuel et vous conformer strictement aux instructions qu’il contient. Les termes AVERTISSEMENT,
MISE EN GARDE et REMARQUE ont des significations spéciales et doivent être lus attentivement (reportez-vous au
paragraphe qui suit). Gardez toujours ce manuel à portée de main.
2.1
Explication des symboles et des mentions complémentaires qui les accompagnent
Symboles
Mention(s) complémentaire(s) Explication
AVERTISSEMENT
Implique que la mort ou des blessures graves pourraient survenir si le
conseil n’est pas suivi.
MISE EN GARDE
Implique que de petites blessures ou des dommages à l’appareil
peuvent survenir si le conseil n’est pas suivi.
REMARQUE
Implique que le conseil n’est pas afférent à un préjudice.
AVERTISSEMENT
D’EXPLOSION
AVERTISSEMENT d’explosion : conformez-vous strictement
aux informations et aux avertissements qui figurent dans
les chapitres et les sections dans lesquels ce symbole apparaît.
AVERTISSEMENT de décharge électrique.
Avant d’effectuer toute procédure de nettoyage et de désinfection,
débranchez le chargeur de l’alimentation électrique !
Marquage MET – Conformité UL / CSA.
DÉBRANCHER DU SECTEUR
MET
WEEE / ElektroG
Elimination des équipements usagés selon la WEEE (Directive
Européenne) ou la législation relative aux équipements électriques et
électroniques (Loi allemande ElektroG).
Pièce appliquée :
pièce appliquée de type B, en conformité avec les normes techniques
IEC 60601-1.
Double isolation :
appareil de classe II.
Alimentation :
courant alternatif.
Courant continu.
Polarité de la prise de l’adaptateur de courant électrique – Centre
positif.
FR
-3-
Symboles
Mention(s) complémentaire(s) Explication
A n’utiliser qu’en espaces clos.
Appareil fabriqué conformément à la directive 93/42/CEE,
et notamment aux normes techniques IEC 60601-1 et IEC 60601-1-2.
Symbole d’AVERTISSEMENT de « rayonnement LED ».
conformez-vous aux informations et aux dangers indiqués au
paragraphe 4.2.5.
Consultez les instructions d’utilisation.
MISE EN GARDE, consultez les documents joints.
Interrupteur :
« Marche / Arrêt ».
Certificat d’enregistrement conforme aux exigences du ministère
de la santé de la Fédération de Russie.
FR
Protégez de la pluie.
-4-
Limites de température de stockage :
de –20°C (–4°F) à 40°C (104°F).
Limites d’humidité de stockage : de 45 % à 85 % HR.
Limites de pression atmosphérique de stockage :
de 500 à 1060 hPa.
2.2
Dommages pendant le transport – Déballage et inspection
L’appareil contenant des composants électroniques est sensible aux chocs. Il convient de le transporter et de le stocker
avec précaution. Les produits Heraeus Kulzer ont été soigneusement contrôlés avant leur expédition. L’appareil a été
expédié avec un emballage correct.
Vérifiez dès la réception de l’appareil la présence de dommages éventuels dus au transport. Si vous détectez de tels
dommages, informez le transporteur au plus tard 24 heures après la livraison. Vous ne devez en aucun cas installer ni
utiliser un appareil et / ou des accessoires endommagés.
2.3
Obligations du propriétaire
Outre le respect des dispositions légales, le propriétaire est tenu d’assurer le respect et l’application de ces dispositions
légales sur le lieu de travail telles que l’obligation de formation, la loi sur les conditions de travail ainsi que tous les
autres règlements et lois en vigueur.
Pour les tâches à effectuer sur ou avec l’appareil, le possesseur de la lampe doit, sur la base du mode d’emploi et en
fonction des tâches à effectuer, rédiger des consignes écrites facilement compréhensibles et les diffuser dans une
langue connue de l’ensemble de son personnel.
2.4
Journal de l’appareil
Nous vous recommandons de tenir un « journal de l’appareil », dans lequel vous documenterez l’ensemble des tests et
les principales interventions effectuées sur l’appareil (opérations de maintenance, modifications, par exemple).
3
Usage prévu
La Translux Wave est une lampe à photopolymériser dentaire à diode électroluminescente (LED) destinée à la cavité
buccale. Elle permet la polymérisation des matériaux dentaires photopolymérisables, tels que les adhésifs et les
matériaux d’obturation, qui sont activés dans une plage de longueurs d’ondes comprise entre 440 et 480 nm.
REMARQUE
Bien que la plupart des matériaux dentaires photopolymérisables soient activés dans cette plage de longueurs
d’ondes, veuillez vérifier les caractéristiques ou contacter le fabricant en cas de doute.
AVERTISSEMENT – Spécialistes qualifiés.
Seuls des spécialistes dûment formés et le dentiste sont habilités à utiliser la lampe (reportez-vous au
paragraphe 2.3 relatif aux obligations du propriétaire). Si l’appareil est utilisé correctement, il ne provoque pas
d’effets secondaires connus.
3.1
Description de la lampe
La Translux Wave utilise une source lumineuse reposant sur une diode électroluminescente (LED) monochromatique
ultra-performante, d’une longueur d’onde comprise entre 440 et 480 nm.
Le rayonnement émis par la Translux Wave permet d’activer le photo-initiateur camphoroquinone. Elle produit
d’excellents résultats de polymérisation, avec une réduction des émissions de chaleur.
La Translux Wave est livrée avec un conducteur de lumière de 8 mm de diamètre, permettant une rotation à 360°.
La Translux Wave comprend un chargeur et une pièce à main, alimentée par une batterie ion-lithium rechargeable
amovible.
La pièce à main dispose d’un « Mode Veille » permettant de réduire la consommation électrique de l’appareil.
La pièce à main passe en « Mode Veille » si elle n’est pas utilisée pendant une période d’environ 5 minutes.
La Translux Wave propose deux cycles d’exposition différents :
• Exposition avec débit constant : durée de cycle de 10 secondes.
• Exposition avec débit progressif : « Démarrage progressif » (durée de cycle de 20 secondes).
Le « Démarrage progressif » permet une augmentation de l’intensité lumineuse de 50 % jusqu’à 100 %
dans un délai de 2 secondes.
REMARQUE – Respectez les temps d’exposition spécifiés par le fabricant des matériaux.
Dans le cas de matériaux nécessitant des temps d’exposition spécifiques (30 / 40 secondes pour les
composites foncés, par exemple), répétez plusieurs fois l’exposition, si nécessaire.
3.2
Consignes de sécurité
L’efficacité des consignes de sécurité concernant la sécurité des personnes, le maniement de l’appareil et le maniement du matériau à travailler dépend essentiellement du comportement des personnes qui utilisent cet appareil.
AVERTISSEMENT
Avant la mise en service, lire attentivement cette notice d’utilisation et tenir compte des indications afin d’éviter
des erreurs et des dommages, en particulier des lésions.
Pour la mise en place et le fonctionnement de l’appareil, respecter outre les indications dans cette notice
d’utilisation les lois, règlements et directives nationaux en vigueur.
3.2.1
Consignes de sécurité générales pour l’utilisation de la lampe
AVERTISSEMENT – USAGE PRÉVU
L’appareil doit exclusivement être utilisé pour l’usage prévu (reportez-vous au paragraphe 3 relatif à l’usage
prévu). Toute autre utilisation est formellement contre-indiquée. Le non-respect de cette consigne est
susceptible d’entraîner des blessures graves pour les patients ou les utilisateurs de l’appareil, ou encore
d’endommager ou de détériorer l’appareil. Heraeus Kulzer décline toute responsabilité en cas de dommages
résultant du non-respect de la disposition qui précède !
AVERTISSEMENT
L’utilisateur est tenu de s’assurer du bon fonctionnement de la Translux Wave et de son adéquation
à l’usage prévu.
Ne dirigez jamais la lumière vers les yeux ! L’exposition directe ou indirecte de lumière dans les yeux doit
toujours être évitée par le port de lunettes de protection qui filtrent la lumière bleue. Lors de la polymérisation,
positionnez l’extrémité du conducteur de lumière directement sur le matériau à polymériser et évitez toute
exposition étrangère sur les tissus mous. Les yeux, les gencives, les tissus mous et autres parties du corps
ne doivent pas être exposés à la lumière bleue (si nécessaire, ces parties doivent être recouvertes d’une
protection). Protégez les tissus mous à l’aide d’une digue (autrement dit, les gencives pendant le traitement).
L’exposition doit être limitée à la zone de la cavité buccale faisant l’objet du traitement clinique.
AVERTISSEMENT – CONTRE-INDICATIONS
N’utilisez jamais la Translux Wave sur des patients porteurs d’un pacemaker ou d’autre dispositif
électronique implantable. Cette restriction s’applique également à l’utilisateur.
La lampe ne doit pas être utilisée par des enfants, des personnes atteintes de cécité ou de surdité ni
par / sur des personnes sujettes à des crises d’épilepsie. Les personnes précitées risquent de ne pas identifier
les risques liés à l’utilisation et à la manipulation de l’appareil. Par mesure de sécurité à l’égard de l’utilisateur
et des patients sujets à d’éventuelles crises d’épilepsie, l’utilisation et la manipulation de l’appareil sont
formellement interdites.
AVERTISSEMENT
Aucune modification n’est autorisée sur cet appareil.
FR
-5-
FR
-6-
Le propriétaire / l’utilisateur de la lampe doit s’assurer que :
– La lampe n’est pas utilisée sur des patients dont les antécédents font apparaître une réaction positive
à un test de polymérisation (urticaire solaire et / ou porphyrie, par exemple) ni chez des patients ayant reçu
un traitement photosensibilisant.
– La lampe n’est pas utilisée sur des patients ayant subi une chirurgie de la cataracte, lesquels sont tout particulièrement sensibles à la lumière, à moins qu’ils ne recourent à des mesures de protection appropriées,
telles que protections oculaires/lunettes qui filtrent la lumière bleue.
– Chez les patients présentant des antécédents de maladies de la rétine, le traitement avec la Translux Wave
doit être préalablement autorisé par leur ophtalmologiste.
– Un médecin spécialiste devra être consulté dans tous les cas présentant un risque potentiel.
AVERTISSEMENT – Température des parties exposées
Température maximum des parties exposées (conducteur de lumière et protection oculaire) : 41°C (106°F).
Température maximum de la partie considérée comme partie exposée (cône métallique antérieur) car elle peut
entrer en contact avec le patient: 46°C (115°F).
Heraeus Kulzer déclare que si la lampe est utilisée conformément aux instructions contenues dans ce manuel,
aucun échauffement de tissu ne se produira.
AVERTISSEMENT – Prévention des infections.
Le conducteur de lumière et le cône de protection oculaire doivent être désinfectés et stérilisés (vapeur) avant
chaque utilisation. Le conducteur de lumière et le cône de protection oculaire sont fournis NON STÉRILES et
doivent être stérilisés avant la première utilisation. Reportez-vous au paragraphe 8.4.1.2 relatif aux paramètres
de stérilisation.
3.2.2 Mesures de sécurité
AVERTISSEMENT – RISQUE D’EXPLOSION
N’installez jamais la lampe dans des environnements présentant des risques d’explosion.
La lampe ne doit pas être utilisée en présence d’une atmosphère inflammable (mélanges d’anesthésiques,
oxygène, protoxyde d’azote, etc.). La lampe doit être utilisée dans un endroit convenablement aéré.
AVERTISSEMENT
Avant d’utiliser la lampe, assurez-vous que la fiche et le cordon d’alimentation sont en bon état.
S’ils sont endommagés, ne raccordez pas la lampe au secteur.
Utilisez uniquement des pièces de rechange ou des accessoires Heraeus Kulzer GmbH d’origine. Heraeus Kulzer
fournit un conducteur de lumière conçu pour une utilisation avec la Translux Wave. Aucun autre conducteur
de lumière ne doit être utilisé. Heraeus Kulzer GmbH décline toute responsabilité en cas de dommage résultant
de l’utilisation de pièces de rechange ou d’accessoires autres que d’Heraeus Kulzer.
3.2.3 BATTERIE – Mesures de sécurité
Heraeus Kulzer GmbH décline toute responsabilité pour les problèmes de batterie qui se produisent lorsque les
consignes de sécurité énumérées dans le paragraphe ci-dessous ne sont pas scrupuleusement respectées.
AVERTISSEMENT
En cas de mauvaise utilisation, la batterie est susceptible de chauffer, de se rompre ou de s’enflammer
et de provoquer de graves blessures. Veillez à respecter les consignes de sécurité indiquées dans le
paragraphe qui suit.
Utilisez uniquement des batteries Heraeus Kulzer d’origine !
L’utilisation de batteries autres que d’Heraeus Kulzer ou de batteries non-rechargeables et / ou de batteries
primaires présente un danger potentiel susceptible d’endommager l’appareil.
Conservez la batterie hors de portée des enfants !
Vous ne devez jamais ouvrir, percer ou écraser la batterie : elle contient des substances toxiques.
Si la batterie montre des traces de corrosion, émet une odeur inhabituelle ou fuit, retirez-la immédiatement
de la pièce à main.
N’exposez pas la batterie à l’eau ou à l’eau salée et veillez à ce qu’elle ne se mouille pas. Ne stockez pas la
batterie dans un lieu présentant un taux d’humidité élevé ou susceptible d’exposer la batterie à la pluie.
Dans l’éventualité d’une fuite de la batterie et que du liquide aille dans un œil, ne vous frottez jamais l’œil.
Rincez abondamment à l’eau et consultez immédiatement un médecin. Sans traitement adéquat, le liquide de
la batterie risque d’endommager l’œil.
AVERTISSEMENT – RISQUE D’EXPLOSION
Utilisez uniquement le chargeur et le bloc d’alimentation Translux Wave fournis avec la lampe pour recharger
la batterie de la pièce à main. N’essayez jamais de charger la batterie Translux Wave avec un autre type
de chargeur. L’utilisation de tout autre chargeur peut entraîner une détérioration de la batterie, un risque
d’explosion et un incendie !
N’utilisez jamais le chargeur Translux Wave pour charger d’autres types de batterie ou d’autres appareils
équipés d’une batterie rechargeable ! Utilisez uniquement des batteries Heraeus Kulzer d’origine.
Ne percez jamais la batterie avec des objets pointus, ne tapez pas sur la batterie avec un marteau ou d’autres
outils, ne marchez pas sur la batterie et ne la soumettez jamais à des impacts ou à des chocs violents.
Ne jetez pas la batterie au feu et ne la placez pas à proximité d’une source de chaleur. Ne court-circuitez
jamais les extrémités de la batterie avec des objets métalliques pour prévenir tout risque de brûlures,
d’incendie et d’explosion. Retirez colliers, épingles à cheveux ou autres objets métalliques avant le transport
ou le stockage de la batterie.
AVERTISSEMENT – La batterie ne doit jamais être démontée ni modifiée !
Lorsque les mécanismes de sécurité intégrés à la batterie sont endommagés, la batterie est susceptible
de chauffer, de se rompre, d’exploser ou de s’enflammer.
AVERTISSEMENT – Éloignez la batterie du feu et des environnements à température élevée.
N’exposez pas la batterie à la lumière directe du soleil. Elle risquerait de générer de la chaleur, de se rompre
ou de s’enflammer. Une telle utilisation de la batterie peut également entraîner une diminution de ses
performances et une réduction de sa durée de vie.
AVERTISSEMENT – En cas d’incendie, NE JETEZ JAMAIS D’EAU SUR UNE BATTERIE EN FEU !
Un extincteur de classe C (conformément à la réglementation européenne EN 3) doit être utilisé.
AVERTISSEMENT – Mise au rebut d’une batterie endommagée ou en fin de vie.
Après avoir pris les mesures nécessaires pour éviter un court-circuit externe, procédez comme suit pour
la mise au rebut d’une batterie endommagée ou en fin de vie :
Après avoir isolé les bornes de la batterie avec un adhésif isolant, mettez-la au rebut conformément
à la législation ou aux réglementations locales.
3.2.4 BATTERIE – Informations
• Tempsdecharged’unebatterievideouneuve:3heuresenviron.
REMARQUE – Batterie NEUVE : première charge
Pour la première charge, cette opération demande environ 3 heures. Les batteries neuves ou stockées
pendant une longue période peuvent nécessiter une charge prolongée. La batterie atteint sa capacité
optimale après quelques cycles de charge/décharge complets.
REMARQUE
Placez la pièce à main dans le chargeur après chaque traitement, ou lorsque vous ne l’utilisez pas.
• Conditionsdefonctionnement:
Température de fonctionnement : de 10°C (50°F) à 35°C (95°F).
Humidité relative : de 45 % à 85 % d’humidité relative.
Pression atmosphérique : 800 hPa à 1060 hPa.
MISE EN GARDE
Les plages de température et d’humidité relative dans lesquelles la batterie peut être chargée sont
comprises entre 10°C (50°F) et 35°C (95°F) et 45 % et 85 % HR. La charge de la batterie en dehors de
cette plage de températures peut entraîner la chauffe ou la détérioration de la batterie. Elle risque aussi
de nuire à ses performances ou de réduire sa durée de vie.
• Transportdelabatterieetconditionsdestockage:
Plages de température et d’humidité relative recommandées :
de –20°C (–4°F) à 40°C (104°F) et de 45 % à 85 % HR.
La batterie doit toujours être chargée avant son stockage, lequel ne doit jamais excéder 5 mois.
Pression de l’air ambiant : de 500 hPa à 1060 hPa.
REMARQUE
Rechargez toujours complètement la batterie avant une période d’inactivité prolongée de l’appareil et au
minimum une fois tous les 5 mois. En cas de période prolongée d’inactivité, remplacer la batterie de la
pièce à main.
• Caractéristiquesdeduréedevietypedelabatterie:
La durée de vie type de la batterie de la Translux Wave est de 300 à 400 cycles de charge, selon l’application
et les conditions environnementales dans lesquelles elle est utilisée.
REMARQUE
La batterie est un produit chimique qui utilise une réaction chimique. Ses performances se détériorent par
conséquent avec ses utilisations et avec le temps, même si elle n’est pas en service.
FR
-7-
3.2.5 ENGAGEMENT
Faire effectuer les travaux sur l’équipement électronique de l’appareil uniquement par Heraeus Kulzer, des partenaires
de Heraeus Kulzer ou un personnel formé et uniquement hors tension.
Utiliser uniquement des pièces de rechange et accessoires d’origine autorisés.
L’utilisation d’autres pièces comporte des risques inconnus et est interdite.
Le caractère opérationnel et la sécurité de l’appareil sont uniquement assurés si les contrôles, travaux de maintenance
et de remises en état sont effectués par Heraeus Kulzer, des partenaires de Heraeus Kulzer ou un personnel formé.
La société Heraeus Kulzer GmbH ne répond pas de dommages éventuels résultant d’un défaut / d’un dysfonctionnement de l’appareil suite à des remises en état incorrectes qui n’ont pas été effectuées par des partenaires de
Heraeus Kulzer ou par un personnel formé par nos soins ou résultant du fait que des pièces de rechange ou des
accessoires non d’origine ont été utilisés lors d’un remplacement de pièces.
4
Description de la lampe
4.1
Contenu de la livraison
1 Chargeur
2 Pièce à main
3 Conducteur de lumière, Ø = 8 mm
4 Cône de protection oculaire
5 Bloc batterie ion-lithium rechargeable
6 Alimentation universelle (100 V – 240 V (
6a = Europe type 1
6b = UK
type 2
6c = USA / JP type 3
FR
-84.2
4.2.1
1x
)) incluant les adaptateurs secteur internationaux suivants :
Description des éléments de contrôle et de commande
Pièce à main
1 Touche « Marche / Arrêt »
2 Témoins des modes de polymérisation (VERTS)
3 Témoin d’état de la batterie (bicolore : VERT / JAUNE)
4 Contacts du chargeur
5 Touche d’alignement
4.2.2 Touche d’alignement
La touche d’alignement (5), située dans la partie arrière inférieure du boîtier de la pièce à main,
permet l’insertion correcte de la pièce à main dans le support du chargeur.
Lors de l’insertion de la pièce à main dans le chargeur, la touche d’alignement doit être alignée avec
la fente de guidage positionnée à l’intérieur du support du chargeur.
Un bip confirme que les contacts sont en position de charge correcte !
4.2.3
2x
2x
Chargeur
1x
Vue des éléments de dessus
1 Capot du chargeur
7 Support de la pièce à main avec clé d’alignement et contacts remplaçables du chargeur
8 Capteur (testeur) d’intensité lumineuse
9
– Témoin de couleur VERTE
Fonction : indique que le chargeur est sous tension.
10
– Témoin bicolore (VERT / JAUNE)
Fonction : informations d’intensité lumineuse.
VERT : indique que l’intensité lumineuse, mesurée au moyen du luxmètre intégré, est adaptée
à un traitement efficace.
JAUNE : indique que l’intensité lumineuse est insuffisante.
Vue de dessous du chargeur
11 Fiche d’alimentation
12 Contacts remplaçables du chargeur
2x
4.2.4
Signaux sonores de la pièce à main
Fonction / Condition
d’erreur
PROGRAMME DE
POLYMÉRISATION :
10 secondes.
Fonctionnement des touches de la pièce
à main
• Appuyezbrièvementsurlatouche
« MARCHE / ARRÊT »
pour démarrer
l’exposition.
PROGRAMME
« DÉMARRAGE
PROGRESSIF » :
20 secondes.
• Appuyezsurlatouche
« MARCHE / ARRÊT »
pendant
une seconde au moins pour démarrer
l’exposition.
INTERRUPTION DU
CYCLE D’EXPOSITION
• Lecycled’expositionpeutàtoutmoment
être interrompu, indépendamment
du programme en cours, au moyen
de la touche « MARCHE / ARRÊT »
.
SIGNAL DE BATTERIE
FAIBLE
Le niveau de charge
restante de la batterie est
suffisant pour
permettre quelques
cycles d’exposition
supplémentaires.
SIGNAL DE BATERIE
DECHARGEE
Il n’est pas possible
de démarrer un cycle
d’exposition supplémentaire.
SIGNAL DE BATTERIE
DÉFECTUEUSE
Source lumineuse LED
défectueuse
SURCHAUFFE
Capteur de surcharge
thermique INTÉGRÉ
défectueux
Circuit de charge
de la pièce à main
défectueux
Remarque : cette
condition n’est détectée
que si la pièce à main
est introduite dans
le chargeur.
Signaux sonores émis
Indications de la pièce à main
• 1 bip lors de la sélection de la touche
« MARCHE / ARRÊT ».
• 1 bip à la fin du temps d’exposition.
Le témoin vert « 10 secondes » s’allume.
• 1 bip lors de la sélection de la touche
« MARCHE / ARRÊT ».
• 1 bip après 1 seconde pour signal
acoustique d’activation du mode
« Démarrage progressif ».
• 1 bip après un temps d’exposition
de 10 secondes.
• 1 bip à la fin du temps d’exposition.
Le témoin vert « 20 secondes » s’allume.
• 1 bip lors de la sélection de la touche
« MARCHE / ARRÊT ».
• 2 bips à la fin du cycle d’exposition.
• L’icônedelabatterieclignoteenvert.
Placer la pièce à main en charge dans
le chargeur !
• 2 bips sans activation de cycle d’exposition.
• L’icônedelabatterieclignoteenvert.
Placer la pièce à main en charge dans
le chargeur !
Uniquement lorsque la pièce à main est placée
dans le chargeur.
• 1 bip est émis toutes les secondes, sur une
durée de 30 secondes.
Le témoin d’état de la batterie s’allume
en JAUNE.
Aucun signal sonore n’est émis.
Le témoin vert du cycle d’exposition en cours
d’utilisation clignote.
• 3 bips, et le dispositif électronique permet
l’interruption du cycle d’exposition en cours.
• 4 bips au début d’un cycle d’exposition.
Deux diodes vertes (10 s / 20 s) clignotent sur
la pièce à main.
FR
-9-
4.2.5
FR
- 10 -
Informations sur les LED relatives au rayonnement émis
Le dispositif utilise un LED à haute luminosité Classe 2M (IEC 60825-1).
Rayonnement de LED.
Ne pas regarder le faisceau et ne pas regarder
LED RADIATION
directement avec des instruments optiques.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• ProduitàLEDdeclasse2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Puissance maxi : < 5.00 mW.
• Longueur d’onde dominante :
mini. 440 nm – maxi. 465 nm.
AVERTISSEMENT
Rayons divergents
Ne pas regarder la lumière de la LED avec des instruments optiques tels que des monocles, loupes ou microscopes à une distance inférieure à 100 mm pour éviter toute lésion oculaire.
Rayons parallèles
Ne pas regarder la lumière de la LED avec des instruments optiques d’observation à distance tels que des
téléscopes ou des jumelles pour éviter toute lésion oculaire.
En cas de défaillance du contrôle du circuit de la LED, le rayonnement émis par la LED ne peut excéder
la valeur de condition d’utilisation normale de l’équipement médical.
Une étiquette autocollante telle que celle représentée ci-dessus se trouve sur l’emballage de l’appareil.
5
Installation et mise en service initiale
Il convient d’observer les informations et les instructions fournies dans les sections suivantes du présent paragraphe
pour garantir le bon fonctionnement de la lampe. Avant d’utiliser la Translux Wave, suivez les instructions dans l’ordre
indiqué ci-dessous.
L’équipement médical est en conformité avec les normes de sécurité uniquement s’il est installé en suivant les
instructions stipulées ci-dessous.
La lampe doit être installée à un endroit approprié qui facilite son utilisation. Posez le chargeur sur une surface plane,
sèche et horizontale.
IMPORTANT
La pièce à main est prévue pour un usage dans l’environnement du patient alors que le chargeur
et l’adaptateur de courant ne sont pas destinés à un usage dans l’environnement du patient.
REMARQUE
L’environnement du patient est défini comme étant une zone à 1,5 m du patient (selon l’IEC 60601-1 troisième
édition et l’IEC 60601-1-1).
AVERTISSEMENT
Avant l’installation, vérifiez que l’appareil et ses composants ne sont pas endommagés.
En présence de dommages apparents, n’installez pas l’appareil.
L’opérateur ne doit pas toucher simultanément les éléments situés en dehors de l’environnement du patient
(chargeur et adaptateur de courant électrique) et le patient.
Ne pas raccorder d’autres éléments externes avec l’équipement médical.
5.1
Consignes de sécurité pour l’installation
AVERTISSEMENT
L’installation électrique du local dans lequel l’appareil est installé et utilisé doit être conforme à la législation
en vigueur et aux consignes de sécurité applicables aux systèmes électriques.
Installez l’appareil dans lieu permettant de le protéger des coups et des éclaboussures accidentelles d’eau
ou autres liquides. N’exposez pas l’appareil à la lumière directe du soleil ni aux UV.
N’installez pas l’appareil au-dessus ou à proximité de sources de chaleur. Lors de l’installation, assurez-vous
que la circulation de l’air est suffisante autour de l’appareil. N’installez pas l’appareil à proximité de solvants
ou de liquides inflammables qui risqueraient d’endommager son boîtier en plastique.
La prise de l’adaptateur de courant électrique (prise directe), modèle PSAC05R-050, est considérée comme
moyen d’isolation de l’équipement médical par rapport au réseau. Quand la prise est connectée, l’adaptateur
doit être facilement accessible. Laisser suffisamment d’espace autour de lui. L’équipement médical ne doit pas
être positionné de manière telle qu’il soit difficile de procéder au débranchement de l’appareil (et donc de la
prise de l’adaptateur de courant électrique).
Ne court-circuitez jamais les bornes de la batterie avec des objets métalliques pour prévenir tout risque
de brûlures, d’incendie et d’explosion.
L’appareil est transportable mais il doit être manipulé avec précaution. Transportez l’appareil en position
horizontale. Veillez à ce que l’appareil ne soit pas exposé à des secousses ou à des vibrations. Pour plus
d’informations sur les dimensions et le poids, reportez-vous au paragraphe 12 (Caractéristiques techniques).
AVERTISSEMENT – RISQUE D’EXPLOSION
N’installez pas l’appareil dans des environnements présentant des risques d’explosion. L’appareil ne doit
pas être utilisé en présence d’une atmosphère inflammable (mélanges d’anesthésiques, oxygène, protoxyde
d’azote, etc.). Installez l’appareil dans un lieu convenablement aéré.
5.2
Raccordement du chargeur à l’alimentation secteur
1x
La Translux Wave est livrée avec un bloc d’alimentation universel séparé (6) acceptant un courant
), 50 / 60 Hz.
de 100 à 240 V (
AVERTISSEMENT
Avant de brancher le chargeur (6) sur le réseau électrique, assurez-vous que la tension et que la fréquence
du réseau électrique correspondent aux valeurs indiquées sur la plaque signalétique de l’appareil. La plaque
signalétique est apposée dans la partie inférieure du chargeur.
N’utiliser que l’adaptateur de courant électrique fourni avec l’appareil. L’usage de tout autre adaptateur
de courant électrique pourra entraîner des dégâts sur la batterie.
FR
Ne pas brancher l’adaptateur de courant électrique à la prise principale via une rallonge multiprise.
REMARQUE
- 11 Le bloc d’alimentation de la lampe Translux Wave (6) est livré avec trois adaptateurs interchangeables :
type 1
Fig. (6 a) = Europe
Fig. (6 b) = UK
type 2
Fig. (6 c) = USA / JP type 3
1 Sélectionnez l’adaptateur approprié parmi les adaptateurs disponibles : Europe – Type 1, UK – Type 2,
USA / JP – Type 3.
2 Chaque adaptateur est muni d’une fente dans laquelle vient s’insérer le loquet de retenue du bloc d’alimentation.
3 En orientant la fente en direction du bloc d’alimentation, placez l’adaptateur au-dessus du bloc d’alimentation de
façon à ce que les glissières de l’adaptateur soient alignées sur les fentes correspondantes du bloc d’alimentation.
4 Tout en exerçant une pression sur l’adaptateur et le bloc d’alimentation, faites glisser l’adaptateur dans le bloc
d’alimentation jusqu’à ce qu’un clic se fasse entendre pour indiquer que l’adaptateur est bien en place.
REMARQUE
Le fait d’appuyer sur l’adaptateur pendant l’installation garantit que toutes les glissières sont maintenues
par les dispositifs de retenue du bloc d’alimentation. Si l’adaptateur n’est pas suffisamment serré, retirez-le
et réinstallez-le.
5 Pour retirer l’adaptateur du bloc d’alimentation, appuyez sur le bouton du loquet de retenue (portant la mention
« PUSH (Pousser) ») et faites glisser l’adaptateur pour le retirer du bloc d’alimentation.
6 Conservez les adaptateurs non utilisées pour une utilisation ultérieure.
7 Branchez la fiche du cordon d’alimentation dans la prise située sous le chargeur.
AVERTISSEMENT
Vérifiez régulièrement le cordon d’alimentation, le bloc d’alimentation et l’adaptateur pour vous assurer
qu’ils sont en bon état.
En cas de dommage apparent, remplacez la pièce endommagée avant de l’utiliser.
Utilisez uniquement des pièces de rechange et des accessoires Heraeus Kulzer d’origine.
8 Branchez le bloc d’alimentation muni de son adaptateur dans la prise secteur.
9 Le témoin VERT du chargeur s’allume (icône
).
5.3
Insertion de la batterie dans la pièce à main
La Translux Wave est livrée avec une puissante batterie ion-lithium rechargeable.
La batterie est fournie séparément dans l’emballage de l’appareil et doit être insérée dans la pièce à main avant
la première mise en service.
AVERTISSEMENT
Appliquez scrupuleusement toutes les consignes de sécurité indiquées au paragraphe 3.2.3
(BATTERIE – Mesures de sécurité).
MISE EN GARDE
N’introduisez JAMAIS la pièce à main dans le chargeur tant que la batterie n’a pas été insérée dans la pièce
à main.
Insérez la batterie dans la pièce à main en procédant comme suit :
1 Retirez la batterie de son emballage.
AVERTISSEMENT
Ne court-circuitez jamais les bornes de la batterie avec des objets métalliques pour prévenir tout risque
de brûlures, d’incendie et d’explosion.
2 Utilisez un outil plat (une pièce de monnaie, par exemple) pour dévisser le capuchon
2x
de la batterie de la pièce à main dans le sens inverse des aiguilles d’une montre (Fig. 1 et 2 ).
3 Une flèche est marquée dans le logement de la batterie (Fig. 3 ).
REMARQUE
Cette flèche indique le sens dans lequel la batterie doit être introduite dans la pièce à main.
FR
- 12 -
4 Faites glisser lentement la batterie avec la flèche en direction du logement dans la pièce à main jusqu’à
la butée (Fig. 4 ).
REMARQUE
Si la batterie est insérée dans le mauvais sens (autrement dit, en sens inverse de la flèche), la pièce à
main ne fonctionne pas. L’insertion de la batterie dans le mauvais sens n’endommage pas les composants
électroniques de la pièce à main.
AVERTISSEMENT
Utilisez uniquement des batteries Heraeus Kulzer d’origine. L’utilisation de batteries d’un autre fabricant
ou de batteries non-rechargeables et/ou de batteries primaires présente un danger potentiel susceptible
d’endommager la lampe de manière irréversible.
5 Utilisez un outil plat (une pièce de monnaie, par exemple) pour visser le capuchon de la batterie de la pièce à main
dans le sens des aiguilles d’une montre.
REMARQUE
L’appareil ne fonctionne pas correctement si le capuchon de la pièce à main n’est pas complètement vissé.
5.4
Insertion de la fibre optique dans la pièce à main
2x
• Faitespivoterlégèrementleconducteurdelumière(1) et insérez-le dans la pièce à main (2)
jusqu’à son positionnement correct. La position définitive est atteinte lorsqu’un « clic » se fait
entendre.
• Montezlecônedeprotectionoculaire(3) sur l’extrémité supérieure du conducteur de lumière.
Positionnement du conducteur de lumière
• Faitespivoterleconducteurdelumièredanslapositionvouluepourlapolymérisation.
• Pourtirerpleinementpartiedel’intensitélumineusefournie,placezleconducteurdelumièreaussiprèsque
possible du composite.
Évitez tout contact direct avec le matériau composite !
MISE EN GARDE – Veillez à ce que le conducteur de lumière soit toujours propre pour obtenir une
intensité lumineuse optimale.
L’intensité lumineuse est considérablement réduite si :
– Le conducteur de lumière n’est pas en parfait état (rayé ou ébréché).
– Le conducteur de lumière n’est pas correctement introduit dans la pièce à main.
– Le conducteur de lumière présente des taches de composite.
AVERTISSEMENT
Un conducteur de lumière endommagé réduit l’intensité lumineuse et doit être immédiatement remplacé par
un conducteur neuf. Les bords tranchants peuvent entraîner des blessures graves. Utilisez uniquement des
conducteurs de lumière Heraeus Kulzer d’origine.
AVERTISSEMENT – Prévention des infections :
Pour assurer la sécurité des patients et des utilisateurs pendant le traitement, le conducteur de lumière et le
cône de protection oculaire doivent être nettoyés, désinfectés et stérilisés avant chaque traitement.
Suivez les instructions indiquées au paragraphe 8 (Nettoyage, désinfection et stérilisation), étape par étape.
5.5
Charge de la batterie
MISE EN GARDE – Batterie NEUVE : première charge
La batterie de la Translux Wave a été partiellement chargée en usine.
Elle doit par conséquent être complètement rechargée avant la première utilisation de la Translux Wave.
REMARQUE – Batterie NEUVE : première charge
Pour la première charge, cette opération demande environ 3 heures. Les batteries neuves ou stockées pendant
une longue période peuvent nécessiter une charge prolongée. La batterie atteint sa capacité optimale après
quelques cycles de charge/décharge complets.
AVERTISSEMENT – RISQUE D’EXPLOSION
Utilisez uniquement le chargeur fourni avec la Translux Wave pour charger la batterie. N’essayez jamais de
charger la batterie avec un autre type de chargeur ou une autre source d’alimentation : vous vous exposeriez
à des risques d’explosion et d’incendie.
Insérez la pièce à main avec la batterie dans le chargeur Translux Wave.
2x
Un bip confirme que les contacts sont en position de charge correcte !
REMARQUE IMPORTANTE – Touche d’alignement
La touche d’alignement (5), située dans la partie arrière inférieure du boîtier de la pièce à main, permet
l’insertion correcte de la pièce à main dans le chargeur. Lors de l’insertion de la pièce à main dans le chargeur,
la touche d’alignement doit être alignée avec la fente de guidage positionnée à l’intérieur du chargeur.
Processus de charge de la batterie.
• Letémoinvertd’étatdelabatterie,surlapièceàmain,commenceàclignoter.
• Autermedelaphasedecharge,lorsquelabatterieestcomplètementchargée,letémoind’étatvertresteallumé
en permanence.
REMARQUE IMPORTANTE – Batterie défectueuse
FR
Si pendant la phase de charge, le dispositif électronique de la pièce à main détecte un dysfonctionnement
de la batterie, il interrompt le processus de charge et le témoin d’état de la batterie clignote en JAUNE.
Dans cet état, un « bip » est émis toutes les secondes, sur une durée de 30 secondes.
- 13 Remplacez la batterie défectueuse par une neuve !
AVERTISSEMENT
Utilisez uniquement des batteries Heraeus Kulzer d’origine !
REMARQUE
Lorsque la pièce à main est placée dans le chargeur, elle n’est pas opérationnelle. La touche
« Marche / Arrêt »
est désactivée.
Il est possible de retirer la pièce à main du chargeur pendant le processus de charge ; la batterie risque
cependant de ne pas être complètement chargée, ce qui peut réduire la durée de fonctionnement.
6
Fonctionnement
AVERTISSEMENT – Vérifiez l’état de la lampe avant de démarrer le traitement.
Avant chaque traitement, vérifiez toujours que la lampe fonctionne correctement et que les accessoires
(conducteur de lumière et cône de protection oculaire) sont opérationnels. Si vous constatez une anomalie
pendant le traitement, interrompez-le immédiatement et contactez Heraeus Kulzer ou un représentant du
Service Clients local agréé (reportez-vous au paragraphe 14 relatif au Service Clients). N’utilisez pas la lampe
et ses accessoires en cas de dommage apparent. Avant chaque utilisation de la Translux Wave, assurez-vous
que l’intensité lumineuse émise est suffisante pour garantir la polymérisation. Vérifiez l’intensité lumineuse
au moyen du luxmètre intégré au chargeur (reportez-vous au paragraphe 6.2 Mesure de l’intensité lumineuse).
AVERTISSEMENT – Prévention des infections
Première utilisation
Les accessoires, le conducteur de lumière et le cône de protection oculaire sont fournis NON STÉRILES et
doivent être stérilisés avant la première utilisation.
Chaque utilisation
Après utilisation, les accessoires, le conducteur de lumière et le cône de protection oculaire doivent être
retraités avant réutilisation, conformément aux procédures décrites au paragraphe 8 (Nettoyage, désinfection
et stérilisation).
6.1
Activation et désactivation du cycle d’exposition
La Translux Wave propose deux cycles d’exposition différents :
– Exposition avec débit constant : durée de cycle de 10 secondes.
– Exposition avec débit progressif : « Démarrage progressif » (durée de cycle de 20 secondes).
Le « Démarrage progressif » permet une augmentation de l’intensité lumineuse de 50 % jusqu’à 100 % dans
un délai de 2 secondes.
• Silapièceàmainesten«Mode Veille » (tous les témoins de cycles d’exposition de la pièce à main
sont désactivés), appuyez brièvement sur la touche « Marche / Arrêt »
pour réactiver la pièce à main.
(Après redémarrage, la diode des 10 secondes s’allume par défaut).
FR
- 14 -
Polymérisation avec exposition de 10 secondes
Appuyez brièvement sur la touche « Marche / Arrêt »
. L’émission de lumière s’active.
Le témoin 10 secondes est allumé, ce qui indique que ce programme est en cours.
À la fin du cycle d’exposition, l’appareil désactive automatiquement la lumière.
Signal sonore :
Les signaux sonores suivants (bips) sont émis :
1 bip lorsqu’une pression est exercée sur la touche « Marche / Arrêt ».
1 bip à la fin du temps d’exposition.
Polymérisation en mode « Démarrage progressif » avec exposition de 20 secondes
Appuyez sur la touche « Marche / Arrêt »
et maintenez-la enfoncée pendant une seconde au moins.
L’émission de lumière s’active.
Le témoin 20 secondes est allumé, ce qui indique que ce programme est en cours.
À la fin du cycle d’exposition, l’appareil désactive automatiquement la lumière et repasse en mode 10 secondes
(témoin 10 secondes allumé).
Signal sonore :
Les signaux sonores suivants (bips) sont émis :
1 bip lorsqu’une pression est exercée sur la touche « Marche / Arrêt ».
1 bip après 1 seconde pour signal acoustique d’activation du mode « Démarrage progressif ».
1 bip après un temps d’exposition de 10 secondes.
1 bip à la fin du temps d’exposition.
REMARQUE
Vous pouvez à tout moment interrompre le cycle d’exposition, avant la fin du temps d’exposition, en appuyant
à nouveau sur la touche « Marche / Arrêt ».
Signal sonore :
Un signal sonore (bip) est émis, lorsqu’une pression est exercée sur la touche « Marche / Arrêt » pour
interrompre le cycle d’exposition.
6.2
Mesure de l’intensité lumineuse
Le chargeur de la Translux Wave est équipé d’un luxmètre intégré (8).
2x
MISE EN GARDE
Avant chaque traitement, vérifiez toujours l’intensité lumineuse au moyen du luxmètre
intégré au chargeur de la lampe Translux Wave.
• Sansexercerdepression,placezleconducteurdelumièreàplatetdirectementsurlazonedetest(8).
Activez la lampe en appuyant sur la touche « Marche / Arrêt »
(indépendamment du temps d’exposition
sélectionné).
) qui se trouve
L’intensité lumineuse mesurée est immédiatement indiquée par le témoin bicolore (symbole
dans la partie inférieure droite de la zone de test.
Témoin VERT : l’intensité lumineuse est suffisante pour le traitement.
Témoin JAUNE : l’intensité lumineuse est insuffisante et le patient ne doit pas être traité.
MISE EN GARDE
Si l’intensité lumineuse est insuffisante, veuillez effectuer les vérifications et mesures suivantes :
– Le conducteur de lumière n’a pas été inséré dans la pièce à main (reportez-vous au paragraphe 5.4
Insertion de la fibre optique dans la pièce à main).
– Vérifiez que le conducteur de lumière est exempt de contamination ou de défauts.
– Nettoyez le conducteur de lumière s’il est souillé (reportez-vous au paragraphe 8 Nettoyage,
désinfection et stérilisation) ou remplacez le conducteur de lumière endommagé.
Utilisez uniquement des conducteurs de lumière Heraeus Kulzer d’origine.
AVERTISSEMENT
Si les mesures décrites ci-dessus ne donnent lieu à aucune amélioration, n’utilisez pas la lampe pour
le traitement. Éteignez la lampe (débranchez le chargeur de l’alimentation électrique) et assurez-vous que
la réactivation non autorisée de la lampe n’est pas possible. Adressez-vous à un partenaire Heraeus Kulzer
ou à un technicien spécialisé agréé par Heraeus Kulzer (reportez-vous au paragraphe 14 relatif au
Service Clients).
6.3
Mode Veille
La pièce à main dispose d’un « Mode Veille » permettant de réduire la consommation électrique de la lampe.
En dehors du chargeur, toutes les fonctions internes de la pièce à main sont automatiquement désactivées
(« Mode Veille ») si elle n’est pas utilisée pendant 5 minutes environ.
En « Mode Veille », le LED des cycle d’exposition de la pièce à main sont éteints.
Pour mettre fin au « Mode Veille », appuyez sur la touche « Marche / Arrêt »
La pièce à main est alors prête à l’emploi.
6.4
.
Informations complémentaires sur les fonctions de la lampe
REMARQUE
Si la pièce à main est placée dans le chargeur avant la fin du cycle de polymérisation, l’émission de lumière
se désactive automatiquement.
Lorsque la pièce à main est placée dans le chargeur, elle n’est pas opérationnelle. La touche
« Marche / Arrêt »
est désactivée.
La Translux Wave est équipée de microprocesseurs qui vérifient en permanence les paramètres de charge
optimale de la batterie. Après chaque traitement, la pièce à main doit par conséquent être insérée dans le
chargeur pour son stockage, indépendamment du niveau de la batterie.
FR
7
Conditions d’alerte
7.1
Batterie défectueuse
Si la batterie est défectueuse, le témoin d’état de la batterie de la pièce à main clignote
en permanence JAUNE (Fig. a).
Un « bip » est émis toutes les secondes, sur une durée de 30 secondes.
IMPORTANT
Cette condition d’erreur n’est détectée que lorsque la pièce à main est placée
dans le chargeur.
7.2
LED défectueuse
Lorsque le microprocesseur détecte un dysfonctionnement de la LED « 10s »,
le témoin vert du mode de polymérisation en cours commence à clignoter (Fig. b).
- 15 clignotement
a
clignotement
b
7.3
Protection contre la surchauffe
En cas de plusieurs cycles de polymérisation successifs (en règle générale après 18
cycles consécutifs, de 20 secondes chacun), il se peut que le capteur de surcharge
thermique intégré s’active.
Dès que la protection contre la surchauffe s’active, un signal acoustique (3 bips) est émis à la fin du cycle d’exposition.
L’activation du mécanisme de protection contre la surchauffe interrompt temporairement l’utilisation de l’appareil
pendant quelques minutes.
Laissez la pièce à main refroidir pendant 4 à 5 minutes environ, puis démarrez l’exposition suivante en appuyant
sur la touche « Marche / Arrêt »
.
REMARQUE
La pièce à main devient opérationnelle lorsqu’elle atteint la température opérationnelle.
Pas besoin de « réinitialisation manuelle ».
7.4
Capteur de surcharge thermique INTÉGRÉ défectueux
En cas d’une élévation de température anormale du capteur de surchauffe, « 4 bips » sont émis au début d’un
cycle d’exposition.
REMARQUE
Au cas où l’anomalie du capteur de surchauffe survient pendant un cycle d’exposition, le programme permet
d’achever l’exposition. Aucun cycle d’exposition supplémentaire n’est autorisé en appuyant sur le bouton
et « 4 bips » sont émis.
« Marche / Arrêt »
Toute utilisation avec un capteur de surchauffe défectueux n’est pas possible.
7.5
Signal de batterie faible
Lorsque, après une utilisation fréquente, la charge de la batterie tombe au-dessous du niveau minimum, le microprocesseur de la Translux Wave autorise quelques cycles de polymérisation supplémentaires (indépendamment du mode)
sans recharger la batterie.
Cet état est signalé par l’émission de « 2 bips » à la fin de chaque cycle.
L’icône de la batterie clignote en vert. Rechargez la batterie !
Au bout de quelques cycles, la charge restante de la batterie n’autorise plus aucun cycle d’exposition supplémentaire.
Cet état est signalé par l’émission de « 2 bips ».
L’icône de la batterie clignote en vert. Rechargez la batterie !
8
Nettoyage, désinfection et stérilisation
DÉBRANCHER DU SECTEUR
Avant d’effectuer toute opération de nettoyage et de désinfection, débranchez le chargeur de l’alimentation
électrique !
AVERTISSEMENT
Prévention des infections
Le conducteur de lumière et le cône de protection oculaire sont fournis NON STÉRILES et doivent être nettoyés,
désinfectés et stérilisés (vapeur) avant la première utilisation et avant chaque utilisation.
Ne stérilisez pas la pièce à main ni le chargeur !
Ne stérilisez pas la batterie !
FR
- 16 8.1
Démontage
Retirez le cône de protection oculaire du conducteur de lumière.
Retirez le conducteur de lumière : faites légèrement pivoter le conducteur de lumière, puis retirez-le
de la pièce à main.
8.2
CONDUCTEUR DE LUMIÈRE – Nettoyage et désinfection
MISE EN GARDE
N’utilisez pas d’instruments tranchants ou pointus pour nettoyer le conducteur de lumière : ils risqueraient
de rayer la surface du conducteur et de réduire la transmission de la lumière.
N’utilisez pas d’agents nettoyants / désinfectants contenant des acides organiques, minéraux et oxydants,
de l’eau oxygénée, du chlorure, de l’eau iodée, du bromure et des solvants.
1) Aussitôt après utilisation, tout résidu éventuel, tel que matériau composite, doit être retiré de l’extrémité
du conducteur de lumière. Tout composite polymérisé doit être retiré à l’éthanol. Une spatule en plastique
ou une brosse en nylon souple peuvent faciliter la suppression des résidus de matériaux.
2) Désinfectez le conducteur de lumière au moyen d’un chiffon non-pelucheux, doux et propre, imprégné d’une
solution désinfectante non-abrasive, de pH doux (pH 7), conformément aux consignes du fabricant. Laissez sécher
la solution désinfectante.
8.2.1 CONDUCTEUR DE LUMIÈRE – Inspection avant la stérilisation
Avant de procéder à la stérilisation, recherchez d’éventuelles traces de détérioration,
de ternissement ou de contamination sur les surfaces du conducteur de lumière.
AVERTISSEMENT
N’utilisez jamais un conducteur de lumière endommagé. En cas de dommages apparents,
le conducteur de lumière doit être remplacé.
Si le conducteur de lumière porte toujours des traces de contamination,
répétez la procédure de nettoyage et de désinfection.
8.3
CÔNE DE PROTECTION OCULAIRE – Nettoyage et désinfection
MISE EN GARDE
N’utilisez pas d’agents nettoyants / désinfectants contenant des acides organiques, minéraux et oxydants,
de l’eau oxygénée, du chlorure, de l’eau iodée, du bromure et des solvants.
Nettoyez et désinfectez le cône de protection oculaire au moyen d’un chiffon doux imprégné d’une solution
désinfectante non-abrasive, de pH doux (pH 7), conformément aux consignes du fabricant. Laissez sécher
la solution désinfectante.
8.3.1 CÔNE DE PROTECTION OCULAIRE – Inspection avant la stérilisation
Avant de procéder à la stérilisation, recherchez d’éventuelles traces de détérioration, de ternissement des nervures
ou de contamination sur les surfaces du cône de protection oculaire.
AVERTISSEMENT
N’utilisez jamais un cône de protection oculaire endommagé. En cas de dommages apparents,
le cône de protection oculaire doit être remplacé.
Un cône de protection oculaire endommagé ne permet pas une protection suffisante contre la lumière
émise par la lampe.
Si le cône de protection oculaire porte toujours des traces de contamination,
répétez la procédure de nettoyage et de désinfection.
8.4
CONDUCTEUR DE LUMIERE et CÔNE DE PROTECTION OCULAIRE – Conditionnement avant la stérilisation
Le conducteur de lumière et le cône de protection oculaire peuvent être stérilisés au moyen d’un sachet médical
de stérilisation à la vapeur à usage unique de dimensions appropriées.
MISE EN GARDE
Le conducteur de lumière et le cône de protection oculaire doivent être emballés individuellement dans
un sachet individuel.
Lors de la stérilisation de plusieurs instruments dans un autoclave, veillez à ne pas dépasser la charge
maximale de l’autoclave.
AVERTISSEMENT
Assurez-vous que le sachet interne est suffisamment grand pour contenir chaque instrument,
sans solliciter les joints d’étanchéité ni déchirer l’emballage.
FR
- 17 -
8.4.1 CONDUCTEUR DE LUMIERE et CÔNE DE PROTECTION OCULAIRE – Stérilisation
8.4.1.1 Méthode de stérilisation
• Effectuezlastérilisationaumoyend’unautoclaveàvapeuràpré-vide.
MISE EN GARDE
Ne recourez jamais à d’autres méthodes de stérilisation, en raison de leur incompatibilité potentielle avec les
matériaux à partir desquels le conducteur de lumière est fabriqué.
N’UTILISEZ JAMAIS les méthodes de stérilisation suivantes : stérilisation à l’oxyde d’éthylène,
stérilisation à l’air chaud, autoclavage flash, stérilisation STERRAD, système STERIS ou systèmes
de stérilisation comparables.
NE RECOUREZ JAMAIS aux méthodes suivantes pour la stérilisation du conducteur de lumière et du cône
de protection oculaire : eau oxygénée, système à l’acide peracétique, stérilisation par le formaldéhyde et le
glutaraldéhyde.
8.4.1.2 Paramètres de stérilisation
• Paramètres de stérilisation minimum garantissant un niveau d’assurance de stérilité – (NAS) de 10–6.
Type de cycle
Température minimale
Pré-vide
132°C + 3°C
(270°F + 5°F)
Temps d’exposition minimum
(sachet)
4 minutes
Temps de séchage
minimum
20 minutes
MISE EN GARDE
Ne jamais dépasser 135°C (275°F).
8.5
PIÈCE À MAIN – Nettoyage et désinfection
AVERTISSEMENT
La pièce à main n’est pas protégée contre la pénétration de liquides.
Ne vaporisez pas directement de liquides sur la surface et les contacts de charge de la pièce
à main.
Les agents nettoyants et désinfectants ne doivent en aucun cas pénétrer dans la pièce à main !
N’immergez JAMAIS la pièce à main dans des liquides.
Ne nettoyez JAMAIS la pièce à main à l’eau courante.
Ne stérilisez pas la pièce à main. Risque de dommage grave, de décharge électrique et d’incendie !
2x
Nettoyez et essuyez le boîtier de la pièce à main au moyen d’un chiffon propre et doux non-pelucheux imprégné
d’un agent de désinfection de surface non-abrasif, de pH neutre (pH7), conformément aux consignes du fabricant.
Laissez sécher la solution désinfectante ou essuyez le désinfectant résiduel sur la pièce à main au moyen d’un
chiffon doux non-pelucheux.
MISE EN GARDE
N’utilisez pas de solvants tels que l’acétone, l’alcool isopropylique et l’eau oxygénée, le chlorure, l’eau iodée,
le bromure, le phénol ou autres solutions agressives pour nettoyer et désinfecter la surface en plastique de la
pièce à main.
Ces substances peuvent être nocives, et entraîner la décoloration et / ou la détérioration des matières
plastiques de la pièce à main.
N’utilisez pas de nettoyants abrasifs !
IMPORTANT : Nettoyage des contacts de charge de la pièce à main
Après le nettoyage / la désinfection du boîtier plastique de la pièce à main, nettoyez toujours les contacts
de charge positionnés dans la partie inférieure de la pièce à main. Les contacts de charge de la pièce à main
doivent toujours être exempts de souillures et de résidus de composites et de nettoyants / désinfectants.
IMPORTANT
Les contacts de charge de la pièce à main doivent être nettoyés régulièrement (au moins une fois par semaine)
et ils doivent l’être systématiquement après le nettoyage et la désinfection du boîtier de la pièce à main.
Des contacts de charge sales ou exposés à des liquides, tels que produits nettoyants ou désinfectants, peuvent
perturber la procédure de charge et empêcher le rechargement de la batterie.
Nettoyez les contacts de charge de la pièce à main au moyen d’un chiffon doux non-pelucheux imprégné d’alcool
ou d’un coton-tige.
MISE EN GARDE
N’utilisez pas d’instruments tranchants ou pointus pour nettoyer les contacts de la pièce à main : ils
risqueraient de rayer et d’endommager leur surface et de réduire la conductivité avec les contacts de charge.
Avant toute réutilisation de la pièce à main, assurez-vous que sa surface et que les contacts de charge sont
parfaitement secs. Si nécessaire, sécher les contacts en soufflant de l’air comprimé dessus.
FR
- 18 -
8.6
CHARGEUR – Nettoyage du boîtier
DÉBRANCHER DU SECTEUR
Débranchez le bloc d’alimentation du secteur et du chargeur avant toute opération de nettoyage / désinfection.
AVERTISSEMENT
Le boîtier du chargeur n’est pas protégé contre la pénétration de liquides.
Ne vaporisez pas directement de liquides sur la surface du boîtier du chargeur.
MISE EN GARDE
NE STÉRILISEZ pas le chargeur. Il ne fonctionnerait plus et pourrait provoquer de graves blessures, une
décharge électrique ou un incendie !
N’utilisez pas de solvants tels que l’acétone, l’alcool isopropylique et l’eau oxygénée, le chlorure, l’eau iodée,
le bromure, le phénol ou autres solutions agressives pour nettoyer la surface en plastique du chargeur.
Ces substances peuvent être nocives, et entraîner la décoloration et/ou la détérioration des matières plastiques
du chargeur.
N’utilisez pas de nettoyants abrasifs !
Nettoyez et essuyez le boîtier du chargeur au moyen d’un chiffon propre, doux et non-pelucheux, imprégné d’un
agent de nettoyage de surface non abrasif, de pH neutre (pH7), conformément aux consignes du fabricant.
Séchez le boîtier du chargeur au moyen d’un chiffon propre, non-abrasif.
MISE EN GARDE
Veillez à sécher le chargeur après le nettoyage. L’humidité à l’intérieur de l’appareil risquerait de provoquer
des dégâts.
IMPORTANT
À la fin de la procédure de nettoyage, assurez-vous que les contacts de charge du chargeur sont parfaitement
secs. Si nécessaire, sécher les contacts en soufflant de l’air comprimé dessus.
8.6.1
CHARGEUR – Nettoyage des contacts de charge
IMPORTANT
Après le nettoyage du boîtier plastique du chargeur, nettoyez toujours les contacts du chargeur.
Les contacts de charge du chargeur doivent toujours être exempts de souillures et de résidus de
composites et de nettoyants / désinfectants.
2x
Les contacts du chargeur doivent être nettoyés régulièrement (au moins une fois par semaine) et ils doivent
l’être systématiquement après le nettoyage du boîtier en plastique. Des contacts sales ou exposés à des
liquides, tels que produits nettoyants ou désinfectants, peuvent perturber la procédure de charge et empêcher
le rechargement de la batterie.
Nettoyez les contacts du chargeur au moyen d’un chiffon doux non-pelucheux imprégné d’alcool ou d’un coton-tige.
MISE EN GARDE
N’utilisez pas d’objets pointus ou tranchants pour nettoyer les contacts du chargeur !
Ne vaporisez pas de liquides sur les contacts et ne les plongez pas dans des liquides !
Ne pliez pas ou ne modifiez pas la forme des contacts du chargeur pendant le nettoyage.
Assurez-vous que les contacts de charge restent secs après le nettoyage et qu’ils ne sont pas en contact avec
des parties métalliques et grasses. Si nécessaire, sécher les contacts en soufflant de l’air comprimé dessus.
8.6.2 CHARGEUR – Contacts de charge remplaçables
Les contacts endommagés ou extrêmement souillés du chargeur (qui ne peuvent pas être nettoyés en appliquant les
procédures décrites dans le paragraphe qui précède) peuvent réduire la conductivité des contacts et par conséquent
empêcher la recharge de la batterie.
Dans ce cas, il est possible de remplacer les contacts endommagés du chargeur par des neufs.
Pour plus d’informations sur le remplacement des contacts du chargeur et sur la fourniture de pièces de rechange,
FR
veuillez vous adresser à votre représentant Heraeus Kulzer local.
Instructions de travail :
- 19 Outils requis : tournevis pour vis cruciformes, taille moyenne.
1. Retirez la pièce à main du support du chargeur.
2. Débranchez le chargeur de l’alimentation secteur.
3. Débranchez le câble du chargeur.
2x
4. Retournez le chargeur.
5. Retirez les 2 vis de la barrette de contacts de charge (reportez-vous au rabat arrière déplié, point 12).
6. Retirez la barrette de contacts de charge.
7. Insérez la nouvelle barrette de contacts et fixez / connectez-la en appliquant la procédure dans
l’ordre inverse.
MISE EN GARDE
Veillez à ne pas plier ou souiller la nouvelle barrette de contacts !
Veillez à ce que l’insertion et la fixation soient parfaites ! Ne serrez pas exagérément les vis !
9
Stockage
Il convient de stocker la pièce à main munie de la batterie pendant les périodes de non-utilisation prolongée. Avant ou
après une période d’inactivité prolongée, rechargez complètement la batterie ou stockez-la dans le chargeur en service.
Bien que le circuit de sécurité intégré de la batterie empêche son déchargement complet, il est fortement conseillé de
charger complètement la batterie au moins tous les 5 mois après une période d’inactivité.
10
Mise au rebut
REMARQUE – IMPORTANT
La lampe ne doit pas être jetée avec les ordures ménagères.
Pour plus d’informations sur la mise au rebut des pièces de rechange, ou de la lampe, veuillez vous adresser
directement au représentant Heraeus Kulzer de votre pays.
Débarrassez-vous des batteries et des conducteurs de lumière hors d’usage conformément aux exigences
légales de votre pays.
AVERTISSEMENT – Mise au rebut d’une batterie endommagée ou en fin de vie
Après avoir pris les mesures nécessaires pour éviter un court-circuit externe, procédez comme suit pour
la mise au rebut d’une batterie endommagée ou en fin de vie :
Après avoir isolé les bornes de la batterie avec un adhésif mettez-la au rebut conformément aux réglementations locales.
Les conditions et les précautions applicables à la mise au rebut de l’appareil sont assujetties aux dispositions légales
en vigueur pour tous les autres dispositifs électroniques devenus inutilisables.
Elimination des équipements usagés selon la WEEE (Directive Européenne) ou
la législation relative aux équipements électriques et électroniques (Loi allemande ElektroG).
11
Dépannage
AVERTISSEMENT
Si les procédures qui suivent ne permettent pas de résoudre le problème, contactez Heraeus Kulzer ou un
représentant du Service Clients local agréé : N’UTILISEZ PAS la Translux Wave et N’ESSAYEZ PAS de réparer
l’appareil car vous vous exposeriez à de graves blessures.
Si la lampe semble ne pas fonctionner correctement, relisez le présent mode d’emploi, puis reportez-vous au
tableau suivant :
PROBLÈME
Le chargeur ne s’allume pas.
Le témoin VERT
du chargeur
est éteint.
CAUSE POSSIBLE
Le bloc d’alimentation n’est pas branché
dans la prise secteur et / ou dans la prise
d’alimentation du chargeur.
Pas de tension au niveau de la prise
d’alimentation.
L’adaptateur interchangeable n’est pas
correctement inséré dans le boîtier du
bloc d’alimentation.
Le câble d’alimentation du bloc
d’alimentation est endommagé.
FR
Le bloc d’alimentation est défectueux.
- 20 -
Le chargeur est défectueux.
Les contacts du chargeur sont en courtcircuit.
Pièce à main dépourvue de batterie.
Pièce à main NON insérée dans le
chargeur.
L’émission de lumière ne démarre pas Pièce à main est en « Mode Veille ».
lorsque vous appuyez sur la touche
« Marche / Arrêt »
et aucune
information n’apparaît sur l’affichage
Batterie vide.
de la pièce à main.
La charge de la batterie n’est pas
suffisante pour activer la pièce à main.
Dysfonctionnement du système
électronique.
Batterie défectueuse.
« 2 bips » sont émis à la fin du cycle
d’exposition.
Charge de la batterie faible.
SOLUTION
Vérifiez que le bloc d’alimentation
est correctement branché dans la
prise secteur et/ou dans la prise
d’alimentation du chargeur.
Utilisez une autre prise d’alimentation.
Lisez attentivement le paragraphe 5.2
de ce mode d’emploi.
Remplacez le bloc d’alimentation par un
neuf (le bloc d’alimentation et son câble
sont indissociables).
Remplacez le bloc d’alimentation par
un neuf.
Contactez Heraeus Kulzer ou un représentant du Service Clients local agréé.
Éliminez la cause du court-circuit.
Si le court-circuit persiste, remplacez
les contacts du chargeur par des neufs.
Reportez-vous au paragraphe 8.6.2.
Insérez la batterie dans la pièce à main
(reportez-vous au paragraphe 5.3).
Appuyez sur la touche « Marche / Arrêt »
pour sortir la pièce à main du
« Mode Veille ».
Reportez-vous au paragraphe 6.3.
Placez la pièce à main dans le chargeur
et rechargez la batterie (reportez-vous
au paragraphe 5.5).
Contactez Heraeus Kulzer ou un représentant du Service Clients local agréé.
Pour vérifier si la batterie est défectueuse,
placez la pièce à main dans le chargeur.
Une « séquence de pré-vérification »
commence au cours de laquelle le microprocesseur de la Translux Wave contrôle
l’état de la batterie. Cette séquence
de pré-vérification peut durer jusqu’à
30 minutes maximum.
Si au cours de cette séquence de
vérification un « bip » est émis chaque
seconde pendant 30 secondes et que
l’icône de la batterie sur la pièce à main
clignote en JAUNE, la batterie est détectée comme étant déficiente.
Remplacez la batterie par une neuve
(reportez-vous au paragraphe 5.3).
Les « 2 bips » signalent que le niveau
de charge restante de la batterie
suffit seulement pour quelques cycles
d’exposition supplémentaires.
Placez la pièce à main dans le chargeur
et rechargez la batterie (reportez-vous
au paragraphe 5.5).
PROBLÈME
L’émission de lumière n’est pas
déclenchée après avoir appuyé
sur le bouton « Marche / Arrêt »
ou l’émission de lumière
s’interrompt pendant un cycle
d’exposition avec un bip sonore.
La diode de polymérisation « 10s » de
la pièce à main clignote en VERT.
SOLUTION
Vérifier la fonctionnalité du pack LED
à l’aide de la procédure suivante :
Insérer la pièce à main dans le chargeur
et appuyer 5 fois consécutives sur le
bouton « Marche / Arrêt » .
Retirer la pièce à main du chargeur.
La diode de polymérisation « 10s » de
la pièce à main cesse de clignoter en
VERT, la pièce à main a été réinitialisée.
Si la diode de polymérisation « 10s » de
la pièce à main réapparait en clignotant
au démarrage du cycle d’exposition
suivant et qu’aucune émission de
lumière ne se produit, le pack LED pack
clignotement
est défectueux. Dans ce cas, contacter
Heraeus Kulzer ou le SAV agréé.
Protection contre la surchauffe.
Après plusieurs cycles d’exposition
Laissez la pièce à main refroidir pendant
consécutifs, l’émission de lumière ne La pièce à main a surchauffé au cours de 4 à 5 minutes au minimum, puis démars’active pas, lorsque vous appuyez sur son utilisation et le capteur de surcharge rez l’exposition suivante en appuyant
sur la touche « Marche / Arrêt ».
thermique s’est activé.
la touche « Marche / Arrêt »
et « 3 bips » sont émis.
L’activation du mécanisme de protection Remarque : La pièce à main devient
opérationnelle lorsqu’elle atteint la
contre la surchauffe interdit tempotempérature opérationnelle. Pas besoin
rairement (pendant quelques minutes)
de « réinitialisation manuelle ».
l’utilisation de l’appareil.
Pendant un cycle d’exposition
« 3 bips » sont émis.
Dysfonctionnements pendant la
phase de charge.
Un « bip » est émis chaque seconde
pendant une période de 30 secondes
et la diode témoin de l’état de la
batterie, sur la pièce à main, clignote
en JAUNE.
clignotement
Pièce à main placée dans le
chargeur, mais la phase de charge
ne démarre pas.
Le témoin vert d’état de la batterie est
éteint sur la pièce à main.
CAUSE POSSIBLE
Le pack LED est peut-être défectueux.
Protection contre la surchauffe.
La pièce à main a surchauffé au cours de
son utilisation et le capteur de surcharge
thermique s’est activé.
L’activation du mécanisme de protection
contre la surchauffe interdit temporairement (pendant quelques minutes)
l’utilisation de l’appareil.
Pendant la phase de pré-vérification de
la batterie (état de la batterie : complètement vide, reportez-vous au paragraphe
4.2.4 et 5.5).
Le système électronique détecte un
défaut ou un dysfonctionnement de la
batterie et interrompt la procédure de
charge.
Laissez la pièce à main refroidir pendant
4 à 5 minutes au minimum, puis démarrez l’exposition suivante en appuyant
sur la touche « Marche / Arrêt ».
Erreur: interruption des contacts de
charge.
Contact inapproprié entre le chargeur et
la pièce à main.
Reportez-vous aux paragraphes 8.5 et
8.6.2.
Assurez-vous que la pièce à main a
été insérée dans le bon sens dans le
chargeur.
Touche d’alignement. Reportez-vous au
paragraphe 4.2.1, points 4 et 5.
Nettoyez les contacts de la pièce à main
et du chargeur. Reportez-vous aux
paragraphes 8.5 et 8.6.1.
Vérifiez que le conducteur de lumière
est complètement inséré dans le cône
métallique de la pièce à main.
Nettoyez la sortie du conducteur de
lumière.
Reportez-vous au paragraphe 8.2.
Les contacts du chargeur et / ou
de la pièce à main sont sales.
L’intensité lumineuse mesurée à l’aide Le conducteur de lumière n’est pas correctement inséré dans la pièce à main.
du luxmètre intégré au chargeur est
insuffisante.
Le témoin
du chargeur s’allume Sortie du conducteur de lumière contaminée par des impuretés et des résidus
en JAUNE.
de composites susceptibles d’interférer
avec la sortie de la lumière.
Conducteur de lumière endommagé ou
usagé.
Remplacez la batterie par une neuve
(reportez-vous au paragraphe 5.3).
2x
Remplacez le conducteur de lumière
par un neuf.
FR
- 21 -
12
Caractéristiques techniques
Classification conformément à la
directive 93/42/CEE :
Normes de sécurité :
Classification conformément à la
norme IEC 60601-1 :
FR
- 22 -
Chargeur :
Alimentation pour le chargeur :
Alimentation pour la pièce à main :
Pièce à main :
Source lumineuse :
Conducteur de lumière :
Cycles d’exposition configurables :
– Exposition Normale
– Exposition « Démarrage progressif »
Temps de charge d’une batterie vide :
Classe I (un)
Le produit a été testé et jugé conforme à l’IEC 60601-1
(deuxième édition) et à l’IEC 60601-1-1.
Le produit a été testé et jugé conforme à l’IEC 60601-1
(troisième édition) et à l’IEC 60601-1-2 (troisième édition – pour
la compatibilité électromagnétique – EMC).
La pièce à main est prévue pour un usage dans l’environnement
du patient alors que le chargeur et l’adaptateur de courant ne
sont pas destinés à un usage dans l’environnement du patient.
Note: L’environnement du patient est défini comme étant une
zone à 1,5 m du patient (selon l’IEC 60601-1, troisième édition
et l’EC 60601-1-1).
Classe II, Type B, Partie applicable : Conducteur de lumière avec
cône de protection.
IP 20 (chargeur).
IP 20 (Translux Wave)
Chargeur Translux Wave
Adaptateur de courant électrique (Branchement direct) fabriqué par:
Phihong Technology CO LTD – Modèle : PSACO5R-050.
Puissance d’entrée : 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Puissance de sortie : 5 V
– 1 A Max –
.
Equipement de classe II
Batterie ion-lithium rechargeable.
Fabricant : Panasonic.
Modèle : NCR-18500.
Tension nominale : 3,6 V.
Capacité nominale (Typique) : 2000 mAh
Modèle : Translux Wave.
Fonctionnement : en service intermittent: 120’’ Allumé – 40’’ Eteint –
max 2 fois de suite
LED haute luminosité.
Produit à LED de classe 2M (IEC 60825-1).
Plage de longueurs d’ondes : 440 à 480 nm.
Longueur d’onde dominante : mini. 440 nm – maxi. 465 nm
Barreau multi fibres sans plomb, 8 mm de diamètre.
Stérilisable en autoclave vapeur à pré-vide :
4 minutes (minimum) à une température minimum de 132°C + 3°C
(270°F + 5°F). 500 cycles max.
10 secondes de temps d’exposition.
Signaux sonores :
1 bip au démarrage de l’exposition.
1 bip à la fin du temps d’exposition
20 secondes de temps d’exposition. (Le « Démarrage progressif »
permet une augmentation de l’intensité lumineuse de 50 % jusqu’à
100 % dans un délai de 2 secondes.)
Signaux sonores :
1 bip au démarrage de l’exposition.
1 bip après 1 seconde pour indication de l’activation
du mode « Démarrage progressif ».
1 bip après un temps d’exposition de 10 secondes.
1 bip à la fin du temps d’exposition
3 heures environ.
Conditions environnementales de l’appareil :
Température
Humidité relative
Pression atmosphérique
Poids et dimensions :
12.1
Fonctionnement
10°C – 35°C
(50°F – 95°F)
45 % – 85 %
800 – 1060 hPa
Transport et stockage
–20°C – 40°C
(–4°F – 104°F)
45 % – 85 %
500 – 1060 hPa
Chargeur : poids de 450 g.
Dimensions : L 140 x l 58 x H 62 mm
Pièce à main : poids de 150 g (conducteur de lumière).
Dimensions : L 275 mm, Ø 24 mm max.
Compatibilité électromagnétique EN 60601-1-2
AVERTISSEMENT
L’appareil nécessite des mesures de compatibilité électromagnétique particulières, qui doivent être appliquées
et activées conformément aux indications présentes dans ce paragraphe.
Les équipements portables et de radiocommunications mobiles peuvent interférer avec le bon fonctionnement
de l’appareil.
Guide et déclaration du constructeur – Emissions électromagnétiques
La lampe Translux Wave est conçue pour être utilisée dans l’environnement électromagnétique spécifié ci-dessous.
Le client ou l’utilisateur de la Translux Wave est tenu de s’assurer qu’elle est utilisée dans un tel environnement.
Test d’émissions
Conformité
Milieu électromagnétique – remarques
Emissions HF CISPR 11
Groupe 1
La Translux Wave utilise de l’énergie RF uniquement pour son
fonctionnement interne. Ses émissions RF sont par conséquent
très faibles et non susceptibles de créer des interférences avec les
équipements électroniques à proximité.
Emissions HF CISPR 11
Classe B
La Translux Wave est utilisable dans tous les immeubles,
y compris les immeubles d’habitation et ceux qui sont directement
Emissions harmoniques
Classe A
reliés au réseau d’alimentation publique en basse tension qui
IEC 61000-3-2
alimente des immeubles à usage privé.
Émissions de variations de tension /
Conforme
papillotement selon IEC 61000-3-3
Guide et déclaration du constructeur – Immunité électromagnétique
La lampe Translux Wave est conçue pour être utilisée dans l’environnement électromagnétique spécifié ci-dessous.
Le client ou l’utilisateur de la Translux Wave est tenu de s’assurer qu’elle est utilisée dans un tel environnement.
Test d’immunité
Niveau de test selon
Niveau de conformité
Milieu électromagnétique –
IEC 60601
remarques
Décharge électro±6 kV en contact
L’appareil fonctionne
Les sols doivent être en bois,
statiques (ESD)
toujours correctement et en béton ou céramique. Si le sol est
±8 kV à l’air
IEC 61000-4-2
toute sécurité.
recouvert de matériau synthétique,
l’humidité relative doit être d’au
moins 30%.
Transitoires électriques ±2 kV pour les lignes
L’appareil fonctionne
La qualité de la tension du réseau
rapides
d’alimentation électrique
toujours correctement et en doit être égale à celle d’un environIEC 61000-4-4
toute sécurité.
nement commercial ou hospitalier
±1 kV pour les lignes
typique.
d’entrée / sortie
Ondes de choc
±1 kV en mode différentiel
L’appareil fonctionne
La qualité de la tension du réseau
IEC 61000-4-5
toujours correctement et en doit être égale à celle d’un environ±2 kV en mode commun
toute sécurité.
nement commercial ou hospitalier
typique.
Creux de tension,
< 5% UT (> 95% baisse de UT) Les irrégularités de fonctiLa qualité de la tension du réseau
pour 0,5 cycles
coupures brèves et
onnement de l’appareil sont doit être égale à celle d’un environvariations de tension
acceptables, tant que les
nement commercial ou hospitalier
40% UT (60% baisse de UT)
IEC 61000-4-11
conditions de sécurité sont typique.
pour 5 cycles
remplies, qu’aucun dysfonc70% UT (30% baisse de UT)
tionnement n’est détecté et
pour 25 cycles
que la configuration préala< 5% UT (> 95% baisse de UT) ble au test peut être rétablie
sur simple intervention de
pour 5 sec
l’utilisateur.
FR
- 23 -
Test d’immunité
Milieu électromagnétique –
remarques
Champs magnétiques
L’appareil fonctionne
Les champs magnétiques à
à la fréquence du
toujours correctement et en fréquence de réseau doivent avoir
réseau (50 / 60 Hz)
toute sécurité.
les niveaux caractéristiques de
IEC 61000-4-8
locaux typiques d’un environnement commercial ou hospitalier.
Remarque : UT est la tension d’alimentation principale avant application des niveaux de test.
FR
- 24 -
Niveau de test selon
IEC 60601
3A/m
Niveau de conformité
Guide et déclaration du constructeur – Immunité électromagnétique
La lampe Translux Wave est conçue pour être utilisée dans l’environnement électromagnétique spécifié ci-dessous.
Le client ou l’utilisateur de la Translux Wave est tenu de s’assurer qu’elle est utilisée dans un tel environnement.
Test
Niveau de
Niveau de
Environnement électromagnétique – remarques
d’immunité
test selon
conformité
IEC 60601
Haute fré3 Veff 150 kHz L’appareil
Les appareils de communication à haute fréquence portables et
quence gérée
à 80 MHz
fonctionne
mobiles ne devraient pas être utilisés près de tout ou partie du produit,
IEC 61000-4-6
toujours
y compris les câbles, excepté lorsqu’ils respectent les distances de
correctement
séparation recommandées, calculées par l’équation applicable à la
Haute fré3 V / m 80 MHz et en toute
fréquence de l’émetteur.
quence émise à 2,5 GHz
sécurité.
Distance de séparation recommandée
IEC 61000-4-3
d = 1,2 √P
d = 1,2 √P 80 MHz à 800 MHz
d = 2,3 √P 800 MHz à 2,5 GHz
où (P) est la puissance maximum nominale de sortie de l’émetteur en
Watt (W) selon le constructeur de l’émetteur et (d) est la distance de
séparation recommandée en mètres (m). L’intensité du champ de
l’émetteur à hautes fréquences installé, déterminée par une enquête
électromagnétique du lieu, doit être plus basse que le niveau
de conformité dans chaque intervalle de fréquence (b).
On peut vérifier une interférence à proximité d’appareils
repérés par le symbole suivant :
Remarques :
(1) À 80 MHz et 800 MHz, la gamme de fréquence la plus élevée s’applique.
(2) Ces spécifications peuvent ne pas s’appliquer dans toutes les situations. La propagation électromagnétique est affectée
par l’absorption et la réflexion des structures, des objets et des personnes.
a) Les forces des champs électromagnétiques des émetteurs fixes, tels que les stations d’accueil de radiotéléphones ou de
téléphones portables (cellulaires / sans fil), les radios mobiles, les radios amateurs, les émetteurs de radios AM / FM et
les émetteurs TV ne peuvent être déterminées avec exactitude par la théorie. Pour évaluer l’environnement électromagnétique dû aux émetteurs fixes, une mesure d’environnement électromagnétique doit être effectuée. Si la force mesurée
du champ dans l’environnement immédiat d’utilisation de la Translux Wave excède le niveau de conformité spécifié
ci-dessus, il est nécessaire de tester les performances de la Translux Wave pour vérifier qu’elles sont conformes aux
spécifications. Si des performances anormales sont constatées, des mesures additionnelles peuvent être nécessaires,
comme par exemple de réorienter ou déplacer la Translux Wave.
b) Dans la gamme de fréquence 150 kHz à 80 MHz, les forces des champs électromagnétiques doivent être inférieures
à 3 V / m.
Distances de séparation recommandées entre des appareils de radio ou des téléphones portables et la Translux Wave
La Translux Wave est conçue pour fonctionner dans un environnement électromagnétique où les perturbations dues à la
présence de haute fréquence ont été vérifiées. Le client ou l’opérateur de la Translux Wave peuvent contribuer à prévenir
les interférences électromagnétiques en assurant une distance minimum entre les appareils de communication mobiles
ou portatifs à haute fréquence (émetteurs) et la Translux Wave, comme recommandé ci-dessous, par rapport à la puissance
de sortie maximum des appareils de communication.
Distance de sécurité en fonction de la fréquence de l’émetteur (m)
Puissance nominale
maximum de l’émetteur (W) 150 kHz à 80 MHz d
80 MHz à 800 MHz d
800 MHz à 2,5 GHz d
= 1,2 √P
= 1,2 √P
= 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
Pour les émetteurs à puissance nominale maximum de sortie non indiquée ci-dessus, la distance de séparation recommandée (d) en mètres (m) peut être calculée en utilisant l’équation applicable à la fréquence de l’émetteur, où (P) est la
puissance maximum nominale de sortie de l’émetteur en Watt (W) selon le constructeur de l’émetteur.
Remarques :
(1) A 80 MHz et 800 MHz s’applique l’intervalle de fréquence le plus important.
(2) Ces indications pourraient ne pas être appliquées dans toutes les situations. La propagation électromagnétique est
influencée par l’absorption et par la réflexion des structures, des objets et des personnes.
12.2
Plaque signalétique du chargeur
Description des symboles de la plaque signalétique
1 Marquage CE.
2 Mise en garde, consultez les documents joints.
3 Consultez le mode d’emploi.
4 Double isolation (appareil conforme à la classe de sécurité II).
5 Mise au rebut des équipements électriques et électroniques usagés
(applicable dans la communauté européenne et autres pays européens
disposant de systèmes de collecte distincts).
6 Marquage MET.
1
2
3
4
5
FR
12.3
Numéro de série de la pièce à main
Le numéro de série de la pièce à main est gravé
dans la partie inférieure de son boîtier.
Numéro de
série gravé.
13
- 25 6
Garantie
Tout appareil Heraeus Kulzer subit avant la livraison une vérification et un contrôle final strict afin de garantir
un fonctionnement irréprochable. Heraeus Kulzer accorde une garantie de 2 (deux) ans à partir de la date d’achat pour
les défauts de matériel et de fabrication sur tous les produits achetés neufs auprès d’un revendeur ou importateur
de Heraeus. Pendant la durée de la garantie, Heraeus Kulzer s’engage à remettre en état (ou à remplacer, selon son
libre choix) gratuitement les pièces défectueuses selon lui. Un remplacement complet de produits Heraeus Kulzer
n’est pas prévu.
Dans les cas suivants, Heraeus Kulzer décline toute responsabilité pour des dommages personnels ou matériels
directs ou indirects :
• L’appareiln’apasétéutiliséselonl’utilisationprévue.
• L’appareiln’apasétéutiliséselonlesconsignesetprescriptionscontenuesdanscemanuel.
• L’installationélectriquedespiècesdanslesquellesl’appareilestutilisén’estpasconformeauxloisetrèglements
en vigueur.
• L’assemblage,l’ajoutd’accessoires,lesréglages,lesmodificationsetlesréparationsn’ontpasétéeffectuéspar
du personnel spécialisé Heraeus Kulzer.
• Lesconditionsambiantesdeconservationetdestockagenerespectentpaslesconsignesmentionnéesauparagraphe 12 (Caractéristiques techniques).
Sont également exclus de la garantie, les dommages dus au transport, à une utilisation non conforme ou une
négligence, au branchement à une tension secteur non prévue, le remplacement de lampes témoin, boutons poussoirs
ainsi que tous les accessoires. La garantie est également annulée lorsque l’appareil est transformé ou réparé par des
personnes ne faisant pas partie du service après-vente. Afin de bénéficier de la garantie, le client met l’appareil à la
disposition du revendeur ou de l’importateur Heraeus Kulzer auprès duquel il l’a acquis à ses propres frais.L’appareil
avec ses accessoires doit être correctement emballé pour l’expédition (de préférence dans son emballage d’origine).
En cas de retour de l’appareil, une fiche contenant les informations suivantes doit être jointe à l’envoi :
a) Nom, adresse, numéro de téléphone du propriétaire.
b) Nom, adresse du revendeur/importateur.
c) Copie du bon de livraison/facture au nom du propriétaire portant outre la date également la désignation
de l’appareil et le numéro de série.
d) Descriptif du dysfonctionnement.
Nous ne sommes pas responsable du transport et d’éventuels dommages dus au transport.
Dans le cas de dommages accidentels ou occasionnés par une utilisation non conforme ou après l’expiration de la
période de garantie, nous nous réservons le droit de facturer la remise en état en fonction des coûts réels de matériel
et de main-d’oeuvre.
14
Service Clients
14.1
Partenaires agréés / Interlocuteurs dans les différents pays
15
Historique du document
1x
2012-08 Version préliminaire pour les prototypes.
2013-09 Première édition.
2014-03 Corrections du paragraphe 2.1, 3.2.1, 7.2, 10, 11, 12 et 12.2.
FR
- 26 -
Sujet à modifications.
Mise à jour de l’information : 2014-03
Índice
1
1.1
1.2
1.3
Aplicación _______________________________________________________________________
General _______________________________________________________________________
Declaración de conformidad CE _____________________________________________________
Declaración del fabricante __________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Instrucciones sobre el uso seguro de la unidad __________________________________________
Explicación de los símbolos y los términos complementarios ________________________________
Daños de transporte: desembalaje e inspección _________________________________________
Obligaciones del propietario ________________________________________________________
Registro de la máquina ___________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Uso previsto _____________________________________________________________________
Descripción del dispositivo _________________________________________________________
Requisitos de seguridad ___________________________________________________________
Instrucciones generales de seguridad sobre el manejo de la unidad ___________________________
Precauciones de seguridad ________________________________________________________
BATERÍA: precauciones de seguridad _________________________________________________
BATERÍA: información _____________________________________________________________
RESPONSABILIDAD ______________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Descripción ______________________________________________________________________ 8
Contenido de la entrega ___________________________________________________________
8
Descripción de los componentes de control y manejo _____________________________________
8
Pieza de mano __________________________________________________________________
8
Clave de alineación ______________________________________________________________
8
Unidad de carga ________________________________________________________________
8
Señales acústicas de la pieza de mano ________________________________________________
9
Información LED sobre la radiación enviada ____________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Instalación y puesta en funcionamiento inicial ___________________________________________
Requisitos de seguridad durante la instalación ___________________________________________
Conexión de la unidad de carga con la toma de alimentación de la red eléctrica __________________
Inserción de la batería en la pieza de mano _____________________________________________
Inserción de la fibra óptica en la pieza de mano __________________________________________
Carga de la batería ______________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Funcionamiento ___________________________________________________________________
Activación y desactivación del ciclo de exposición ________________________________________
Medición de la intensidad luminosa __________________________________________________
Modo de espera _________________________________________________________________
Información adicional sobre el funcionamiento de la unidad _________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Estados de alarma _________________________________________________________________
Batería defectuosa _______________________________________________________________
LED defectuoso _________________________________________________________________
Protección contra sobrecalentamiento ________________________________________________
Sensor de exceso de temperatura INTEGRADO defectuoso __________________________________
Señal de batería baja _____________________________________________________________
15
15
15
15
15
16
NOTA
Utilice el icono del libro para buscar imágenes
de los capítulos o información adicional en la
portada desplegable.
HKG-Layout 99000943_01 GBA
1x /2x
Despliegue
la portada
Despliegue
la contraportada
04ES
Translux Wave EU
Dateiname: 04ES_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
ES
-1-
ES
-2-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Limpieza, desinfección y esterilización _________________________________________________
Desmontaje ____________________________________________________________________
GUÍA DE LUZ: limpieza y desinfección _________________________________________________
GUÍA DE LUZ: inspección antes de la esterilización ________________________________________
CONO PROTECTOR DE LUZ: limpieza y desinfección _______________________________________
CONO PROTECTOR DE LUZ: inspección antes de la esterilización _____________________________
GUÍA DE LUZ y CONO PROTECTOR DE LUZ: empaquetado previo a la esterilización ________________
GUÍA DE LUZ y CONO PROTECTOR DE LUZ: esterilización ___________________________________
Método de esterilización __________________________________________________________
Parámetros de esterilización ________________________________________________________
PIEZA DE MANO: limpieza y desinfección _______________________________________________
UNIDAD DE CARGA: limpieza de la cubierta _____________________________________________
UNIDAD DE CARGA: limpieza de los contactos de carga ____________________________________
UNIDAD DE CARGA: contactos de carga recambiables _____________________________________
9
Almacenamiento en estanterías _______________________________________________________ 19
10
Eliminación ______________________________________________________________________ 19
11
Solución de problemas _____________________________________________________________ 20
12
12.1
12.2
12.3
Especificaciones técnicas ___________________________________________________________
Compatibilidad electromagnética según EN 60601-1-2 ____________________________________
Etiqueta identificativa de la unidad de carga ____________________________________________
Número de serie de la pieza de mano _________________________________________________
13
Garantía ________________________________________________________________________ 25
14
14.1
Servicio _________________________________________________________________________ 26
Socios de servicio / Personas de contacto en los diferentes países _____________________________ 26
15
Historial de la documentación ________________________________________________________ 26
NOTA
Utilice el icono del libro para buscar imágenes
de los capítulos o información adicional en la
portada desplegable.
16
16
16
16
16
17
17
17
17
17
17
18
18
19
22
23
25
25
1x /2x
Despliegue
la portada
Despliegue
la contraportada
1
Aplicación
1.1
General
Translux Wave es una marca registrada de Heraeus Kulzer GmbH.
Este manual de instrucciones está destinado a:
N.° de pedido
66055012
Modelo y equipamiento
Translux Wave – Unidad de polimerizacion de LED
Edición
2014-03 / 99000943/01
1.2
Declaración de conformidad CE
Por la presente, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Alemania) manifiesta que la concepción
y construcción del aparato descrito a continuación, así como el modelo puesto a la venta, cumplen los requisitos
pertinentes de la directiva CE en cuanto a seguridad y salubridad.
Esta declaración perderá su validez en caso de efectuarse una modificación en el aparato sin nuestra conformidad.
1.3
Declaración del fabricante
Mediante el presente documento, confirmamos que la unidad Translux Wave cumple la directiva 93/42/CEE
y las normas IEC 60601-1 e IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Alemania).
2
Instrucciones sobre el uso seguro de la unidad
Lea este manual y siga las instrucciones detenidamente. Los términos ADVERTENCIA, PRECAUCIÓN y NOTA encierran
un significado especial y deben considerarse detenidamente (véase el siguiente párrafo). Guarde siempre este manual
en un lugar de fácil acceso.
2.1
Explicación de los símbolos y los términos complementarios
Símbolos
Términos complementarios
Explicación
ADVERTENCIA
Implica que podrían producirse serias lesiones e incluso la muerte si no se
siguen las advertencias.
PRECAUCIÓN
Implica que podrían producirse lesiones menores o daños al dispositivo
si no se siguen las advertencias.
NOTA
Implica advertencias que no están relacionadas con daños.
ADVERTENCIA:
ADVERTENCIA: riesgo de explosión: respete la información y las advertencias
RIESGO DE EXPLOSIÓN de los capítulos y apartados marcados con este símbolo pictórico.
DESCONECTAR DE
LA RED ELÉCTRICA
MET
WEEE / ElektroG
ADVERTENCIA: riesgo de descarga eléctrica.
Antes de llevar a cabo los procedimientos de limpieza y desinfección,
desconecte la base de carga de la fuente de alimentación eléctrica.
MET marca – UL / CSA conformidad.
Tratamiento de los equipos conforme a WEEE (Directiva Europea) o
Ley de aparatos eléctricos y electrónicos (Ley Alemana ElektroG).
Pieza aplicada:
Pieza aplicada tipo B: conforme con la norma técnica IEC 60601-1.
Doble aislamiento:
Dispositivo de clase II.
Fuente de alimentación:
Corriente alterna.
Corriente continua.
Polaridad de la clavija de la fuente de alimentación conmutada – Positivo en
el centro.
ES
-3-
Símbolos
Términos complementarios
Explicación
Usar solamente en espacios cerrados.
Dispositivo fabricado de conformidad con la directiva 93/42/CE y las normas
técnicas IEC 60601-1 e IEC 60601-1-2.
Símbolo de ADVERTENCIA, “Radiación de LED”.
Respete la información y los peligros indicados en el apartado 4.2.5.
Consulte las instrucciones de uso.
PRECAUCIÓN, consulte los documentos adjuntos.
Interruptor de funcionamiento:
“Activar / desactivar”.
Certificado de registro según el Ministerio de Sanidad de la Federación Rusa.
Protéjalo de la lluvia.
ES
Límite de temperatura de almacenamiento: de –20°C (–4°F) a 40°C (104°F).
-4-
Límite de humedad de almacenamiento: del 45 al 85% de humedad relativa.
Límite de presión atmosférica de almacenamiento: de 500 a 1060 hPa.
2.2
Daños de transporte: desembalaje e inspección
Los componentes electrónicos del aparato son sensibles a los golpes. Por este motivo, se ruega transportarlo y
colocarlo con la máxima precaución. Heraeus Kulzer ha supervisado escrupulosamente el aparato antes de su entrega.
El aparato se suministra protegido y empaquetado adecuadamente.
Compruebe una vez lo haya recibido si el aparato presenta daños ocasionados por el transporte. En caso de observar
daños, comuníquelo a la empresa de transportes en las 24 horas siguientes a la entrega, a más tardar. No instale
unidades o accesorios dañados ni trabaje con ellos bajo ninguna circunstancia.
2.3
Obligaciones del propietario
En derivación del cumplimiento de las prescripciones legales, el propietario tiene la obligación de procurar
la observación y traslado de las prescripciones legales al lugar de trabajo, p. ej., la obligación de seguir las
instrucciones, la normativa de protección en el trabajo, así como todas aquellas disposiciones y normas vigentes.
Con la ayuda del manual de instrucciones y en base a los trabajos que se van a realizar, el propietario deberá redactar
de forma comprensible en el idioma de los empleados las instrucciones para realizar los trabajos en y con el aparato.
2.4
Registro de la máquina
Se recomienda mantener un registro de la “máquina y documentar” todas las pruebas y trabajos importantes
(por ejemplo, mantenimiento o cambios) realizados en ella.
3
Uso previsto
Translux Wave es una unidad luminosa de LED de polimerización dental destinada al uso en la cavidad bucal para
la polimerización de materiales dentales fotopolimerizables, tales como materiales de relleno y adhesivos que se
activan en el intervalo de longitudes de onda comprendido entre 440 y 480 nm.
NOTA
Aunque la mayor parte de los materiales dentales fotopolimerizables se activan en este intervalo de longitudes
de onda, en caso de duda, consulte las especificaciones del fabricante o póngase en contacto con él.
ADVERTENCIA: solo para especialistas cualificados
La unidad solo la deben manejar dentistas y especialistas con la formación adecuada (véase el apartado 2.3
Obligaciones del propietario). Si la unidad se usa correctamente, no provocará efectos secundarios conocidos.
3.1
Descripción del dispositivo
La Translux Wave usa una fuente de luz que consite en un LED de diodo monocromatico muy eficiente con longidud
de onda comprendida entre 440 y 480 nm.
Toda la luz que emite Translux Wave se utiliza para activar el fotoiniciador de canforquinona. Esto genera resultados
de polimerización excelentes y reduce la emisión de calor.
Translux Wave se envía con una guía de luz giratoria 360° de 8 mm de diámetro.
Translux Wave consta de una unidad de carga y una pieza de mano, alimentada por una batería de iones de litio
recargable y extraíble.
La pieza de mano está equipada con un “Modo de espera” para minimizar el consumo energético de la unidad.
La pieza de mano pasa a “Modo de espera” si no se usa durante un período de aproximadamente 5 minutos.
Translux Wave puede funcionar con dos ciclos de exposición distintos:
• Exposición con salida constante: duración del ciclo, 10 segundos.
• Exposición con salida lentamente creciente: “Inicio suave” (duración del ciclo: 20 segundos).
El programa de “Inicio suave” implica un aumento de la intensidad luminosa de un 50% a un 100% en 2 segundos.
NOTA: respete los tiempos de exposición de los materiales especificados por el fabricante.
En el caso de aquellos materiales con tiempos de exposición específicos (por ejemplo, 30 o 40 segundos
en las resinas compuestas oscuras), repita la exposición varias veces si es necesario.
3.2
Requisitos de seguridad
La efectividad de las indicaciones de seguridad relativas a la protección de personas, el manejo del aparato y el manejo
del material depende principalmente del proceder de la persona que utiliza el aparato.
ADVERTENCIA
Antes de la puesta en marcha, se debe leer con detenimiento este manual de instrucciones, observar las
indicaciones para evitar errores y sus consecuencias, en especial las perjudiciales para la salud.
Durante la instalación y el funcionamiento del aparato hay que observar, además de las indicaciones de este
manual de instrucciones, las normativas, prescripciones y directrices nacionales vigentes.
3.2.1
Instrucciones generales de seguridad sobre el manejo de la unidad
ADVERTENCIA: USO PREVISTO
Utilice la unidad únicamente para los fines previstos (véase el apartado 3 Uso previsto). Cualquier otro uso está
totalmente contraindicado. El incumplimiento de esta norma puede provocar graves lesiones en los pacientes
o los operarios de la unidad, así como daños o defectos en esta. ¡Heraeus Kulzer no se hace responsable de los
daños emergentes derivados del incumplimiento de lo anteriormente contemplado!
ADVERTENCIA
El usuario se hace responsable de probar la unidad Translux Wave para su uso y adecuación para los fines
previstos.
No dirija nunca la luz hacia los ojos. La exposición directa o indirecta de los ojos a la luz se debe evitar siempre
usando gafas protectoras que filtren la luz azul. Durante la polimerización, coloque la punta de la guía de luz
directamente sobre el material que se debe polimerizar y evite la exposición externa de los tejidos blandos. Los
ojos, las encías, los tejidos blandos y otras partes del cuerpo no se deben exponer a la luz azul (si es necesario,
se deben cubrir con una protección). Utilice un dique de goma para proteger los tejidos blandos, es decir,
las encías, durante el tratamiento. La exposición debe limitarse a la zona de la cavidad bucal en la que se lleve
a cabo el tratamiento clínico.
ADVERTENCIA: CONTRAINDICACIONES
No utilice la unidad Translux Wave en pacientes con marcapasos u otros dispositivos electrónicos
implantables. Esto también es aplicable al operario.
Los niños, las personas con discapacidad visual o auditiva y aquellas propensas a sufrir ataques epilépticos
no deben usar la unidad ni esta se debe usar en ellos. Las personas anteriormente mencionadas pueden
no reconocer los riesgos que su uso y manejo conllevan. Debido a motivos de seguridad para el operario
y los pacientes con riesgo potencial de sufrir ataques epilépticos, se prohíbe el uso y manejo del dispositivo.
ADVERTENCIA
No está permitida la modificación de este equipo.
ES
-5-
El propietario / usuario debe garantizar lo siguiente:
– Que la unidad no se usa en pacientes con anamnesis positiva tras las pruebas con la luz (por ejemplo,
con urticaria solar o porfiria) ni en aquellos pacientes que se han sometido a tratamiento con medicación
fotosensibilizante.
– Que la unidad no se usa en pacientes que se han sometido a una intervención quirúrgica por
cataratas – que son especialmente sensibles a la luz – a menos que utilicen las medidas de protección
adecuadas, como gafas o protectores oculares que filtren la luz azul.
– Que el tratamiento con Translux Wave de aquellos pacientes cuya anamnesis incluye enfermedades
retinianas recibe la autorización de su oftalmólogo.
– Que se consulta a un médico especialista en todos los casos de riesgo potencial.
ADVERTENCIA – Temperatura de los repuestos
Max. temperatura de los repuestos (guía de luz y cono protector de la luz): 41°C (106°F).
Max. temperatura de los repuestos (cono frontal de metal) que puede entrar en contacto con el paciente:
46°C (115°F).
Heraeus Kulzer declara que si este dispositivo se utiliza en conformidad con lo contenido en las instrucciones
de este manual, no se producirá quemadura del tejido.
ADVERTENCIA: control de infecciones
La guía de luz y el cono protector de luz se deben limpiar, desinfectar y esterilizar (con vapor) antes
de cada uso. La guía de luz y el cono protector de luz se proporcionan en condición NO ESTÉRIL y se deben
esterilizar antes del primer uso. Véase el apartado 8.4.1.2 Parámetros de esterilización.
ES
-6-
3.2.2
Precauciones de seguridad
ADVERTENCIA: RIESGO DE EXPLOSIÓN
No instale el dispositivo en lugares donde exista riesgo de explosión.
El dispositivo no se debe usar en lugares con atmósfera inflamable (mezclas anestésicas, oxígeno,
óxido nitroso, etc.). Utilice el dispositivo en zonas con buena ventilación.
ADVERTENCIA
Antes de usar la unidad, compruebe el enchufe y el cable de alimentación de la red eléctrica por si estuvieran
dañados. Si lo están, no conecte la unidad a la red eléctrica.
Utilice solo accesorios o piezas de recambio originales de Heraeus Kulzer GmbH. Heraeus Kulzer proporciona
una guía de luz adecuada para su uso con la unidad Translux Wave. No se deben usar otras guías de luz.
Heraeus Kulzer GmbH no asumirá ninguna responsabilidad por los daños derivados del uso de accesorios
o piezas de recambio no originales de Heraeus Kulzer.
3.2.3 BATERÍA: precauciones de seguridad
Heraeus Kulzer GmbH no asume ninguna responsabilidad por los problemas de batería que puedan producirse como
consecuencia de no cumplir escrupulosamente las precauciones de seguridad incluidas en el siguiente apartado.
ADVERTENCIA
Un mal uso de la batería puede provocar que se caliente, se rompa o se incendie y cause lesiones graves.
Siga las normas de seguridad que se facilitan en el siguiente apartado.
¡Utilice solo baterías originales de Heraeus Kulzer!
El uso de baterías de pilas o baterías no recargables o de baterías que no sean de Heraeus Kulzer supone
un peligro potencial y puede producir daños en el dispositivo.
¡Mantenga la batería fuera del alcance de los niños!
Nunca abra, perfore ni aplaste la batería: contiene sustancias tóxicas.
Si la batería muestra signos de oxidación, emite un olor extraño o pierde líquido, extráigala inmediatamente
de la pieza de mano.
No permita que la batería entre en contacto con el agua o agua salada ni que se humedezca.
No la guarde en lugares con humedad elevada o donde pueda estar expuesta a la lluvia.
En caso de que haya fugas en la batería y que el líquido entre en contacto con los ojos, no se los frote. Lávelos
con agua abundante y busque atención médica inmediatamente. Si no se tratan, el líquido de la batería puede
provocar daños oculares.
ADVERTENCIA: RIESGO DE EXPLOSIÓN
Para cargar la batería de la pieza de mano, utilice únicamente la unidad de carga y la fuente de alimentación
de entrada de Translux Wave que se proporcionan con la unidad. No intente nunca cargar la batería de
Translux Wave con otra unidad de carga. ¡De hacerlo, puede provocar daños en la batería, así como riesgo
de explosión e incendio!
No utilice nunca la unidad de recarga de Translux Wave para cargar otros tipos de batería u otras unidades con
una batería recargable. Utilice solo baterías originales de Heraeus Kulzer.
No perfore la batería con objetos punzantes; no la golpee con un martillo u otras herramientas,
ni la pise o la someta a golpes o sacudidas fuertes.
No coloque la batería en el fuego ni le aplique calor. No cortocircuite nunca los extremos de la batería con
objetos metálicos, pues existe riesgo de quemaduras, incendio y explosión. No transporte ni almacene la
batería junto a collares, horquillas u otros objetos metálicos.
ADVERTENCIA: ¡no desmonte ni modifique la batería!
La batería lleva incorporados mecanismos de seguridad que, si se dañan, pueden provocar que se caliente,
se rompa, explote o se incendie.
ADVERTENCIA: no coloque la batería en el fuego ni cerca de él o en lugares sometidos
a altas temperaturas.
No coloque la batería en un lugar expuesto a la luz solar directa. De lo contrario, puede calentarse,
romperse o incendiarse. Si utiliza la batería de este modo, también puede ocasionar una pérdida
de rendimiento y disminuir su vida útil.
ADVERTENCIA: ¡en caso de incendio, NO ARROJE AGUA SOBRE UNA BATERÍA QUE SE ESTÁ QUEMANDO!
Se debe usar un extintor de incendios de clase C (según el reglamento europeo EN 3).
ADVERTENCIA: eliminación de baterías dañadas o agotadas.
Elimine una batería dañada o agotada después de llevar a cabo los pasos necesarios para evitar
un cortocircuito externo mediante el método siguiente:
Después de aislar los terminales de la batería con cinta aislante, elimínela según lo establecido
en la ley o de acuerdo con las estipulaciones del ayuntamiento.
3.2.4 BATERÍA: información
• Tiempodecargadeunabateríanuevaovacía:3horasaproximadamente.
NOTA: primera carga de batería NUEVA
La primera vez que se carga, tarda alrededor de 3 horas. Las baterías nuevas o aquellas que han estado
almacenadas durante mucho tiempo pueden tardar más tiempo en cargarse. La batería alcanzará su
capacidad plena tras varios ciclos de carga-descarga completos.
NOTA
Coloque la pieza de mano en la unidad de carga después de cada tratamiento o cuando no esté en uso.
• Condicionesdefuncionamiento:
Temperatura de funcionamiento: de 10°C (50°F) a 35°C (95°F).
Humedad relativa: del 45 al 85%.
Presión atmosférica: 800 hPa a 1060 hPa.
PRECAUCIÓN
Los intervalos de temperatura y humedad relativa en los que se puede cargar la temperatura están
comprendidos entre los 10°C (50°F) los 35°C (95°F) y entre el 45 y el 85 %. Si se carga la batería
a temperaturas que no estén comprendidas en este intervalo, esta puede calentarse o sufrir daños.
Si se carga la batería a temperaturas no comprendidas en este intervalo, también puede verse afectado
el rendimiento de la batería o verse reducida su vida útil.
• Condicionesdealmacenamientoytransportedelabatería:
Intervalos de temperatura y humedad relativa recomendados:
de –20°C (–4°F) a 40°C (104°F) y del 45 al 85 % de humedad relativa.
Almacene la batería cargada siempre y durante períodos no superiores a los 5 meses.
Presión atmosférica ambiental: de 500 a 1060 hPa.
NOTA
Cargue siempre la batería completamente antes de un período largo de inactividad del dispositivo
y al menos una vez cada 5 meses. En caso de un periodo extenso de inactividad sustituir la batería
de la parte de mano.
• Característicashabitualesdelavidaútildelabatería:
La batería de Translux Wave tiene una vida útil habitual de entre 300 y 400 ciclos de carga, según el uso
y las condiciones ambientales en las que se utilice.
NOTA
La batería es un producto químico que emplea reacciones químicas, por lo que el rendimiento
se deteriorará no solo con el uso, sino también con el paso del tiempo aunque no se utilice.
ES
-7-
3.2.5 RESPONSABILIDAD
Los trabajos en el equipo electrónico del aparato sólo deberán llevarse a cabo por Heraeus Kulzer, servicios técnicos
colaboradores o personal técnico instruido, y sólo bajo condiciones seguras (sin tensión).
Únicamente se utilizarán recambios y accesorios originales homologados.
El empleo de otras piezas oculta riesgos desconocidos y deberá evitarse en cualquier caso.
La capacidad de funcionamiento y seguridad del aparato sólo está garantizada cuando las comprobaciones, trabajos
de mantenimiento y reparación necesarios han sido realizados por Heraeus Kulzer, servicios técnicos colaboradores
o personal técnico instruido.
Heraeus Kulzer GmbH no se hará responsable de los posibles defectos / fallos de funcionamiento causados por
reparaciones inadecuadas que no haya realizado el servicio técnico colaborador de Heraeus Kulzer o nuestro personal
debidamente instruido, o en caso de que no se haya utilizado un repuesto o accesorio original.
4
Descripción
4.1
Contenido de la entrega
1 Unidad de carga
2 Pieza de mano
3 Guía de luz, diámetro: 8 mm
4 Cono protector de luz
5 Paquete de batería de iones de litio recargable
6 Fuente de alimentación con entrada universal (de 100 a 240 V (
de enchufe para red eléctrica internacionales:
6a: Europa,
tipo 1
6b: Reino Unido,
tipo 2
6c: EE. UU. / Japón, tipo 3
ES
-84.2
4.2.1
1x
)) y adaptadores
Descripción de los componentes de control y manejo
Pieza de mano
1 Botón de “Activar / desactivar”
2 LED de modo de polimerización (VERDE)
3 LED de estado de la batería (2 colores: VERDE / AMARILLO)
4 Contactos para la unidad de carga
5 Clave de alineación
4.2.2 Clave de alineación
La clave de alineación (5), situada en la parte inferior trasera de la cubierta de la pieza de mano,
permite insertarla correctamente en el soporte de la unidad de carga.
Al insertar la pieza de mano en la unidad de carga, la clave de alineación se debe alinear
con la ranura guía que se encuentra dentro del soporte de la unidad de carga.
¡Un pitido confirma que los contactos están en la posición de carga correcta!
4.2.3
2x
2x
Unidad de carga
1x
Componentes de la vista superior
1 Cubierta de la unidad de carga
7 Soporte de la pieza de mano con clave de alineación y contactos de la unidad de carga
recambiables
8 Sensor de intensidad luminosa
9
– LED verde
Función: indica que la unidad de carga está encendida.
10
– LED de dos colores (verde / amarillo)
Función: información sobre la intensidad luminosa.
VERDE: indica que la intensidad luminosa, que se mide con el fotómetro integrado, es adecuada para
realizar el tratamiento con eficacia.
AMARILLO: indica que la intensidad luminosa no es suficiente.
Vista inferior de la unidad de carga
11 Toma de la fuente de alimentación
12 Engaste de contacto de carga reemplazable
2x
4.2.4
Señalesacústicasdelapiezademano
Función /
condición de error
PROGRAMA DE
POLIMERIZACIÓN:
10 segundos.
PROGRAMA DE
“INICIO SUAVE”:
20 segundos.
INTERRUPCIÓN DEL
TIEMPO DE EXPOSICIÓN
SEÑAL DE BATERÍA
BAJA
El nivel de carga restante
de la batería es suficiente
para algunos ciclos de
exposición más.
AVISO CUANDO LA
BATERIA ESTÁ VACIA
No se pueden activar los
siguientes ciclos si.
SEÑAL DE BATERÍA
DEFECTUOSA
Fuente de iluminación
de LED defectuosa
ESTADO DE SOBRECALENTAMIENTO
Sensor de exceso de
temperatura INTEGRADO
defectuoso
Circuito de carga
de la pieza de mano
defectuoso
Nota: este estado se detecta únicamente cuando
la pieza de mano está
colocada en la unidad
de carga.
Funcionamiento de los botones
de la pieza de mano
• Pulseelbotónde
“ACTIVAR / DESACTIVAR”
brevemente para iniciar
la exposición.
Señalesacústicasemitidas
Indicaciones en la pieza de mano
• 1 pitido al pulsar el botón de “ACTIVAR /
DESACTIVAR”.
• 1 pitido tras el tiempo de exposición.
LED verde iluminado durante 10 segundos.
• Pulseelbotónde
• 1 pitido al pulsar el botón de “ACTIVAR /
DESACTIVAR”.
“ACTIVAR / DESACTIVAR”
durante al menos un
• 1 pitido después de 1 segundo indica
segundo para que comience la exposición.
el modo de activación “Inicio suave”.
• 1 pitido tras 10 segundos de tiempo
de exposición.
• 1 pitido tras el tiempo de exposición.
LED verde iluminado durante 20 segundos.
• Elciclodeexposiciónsepuedeinterrumpir • 1 pitido al pulsar el botón de “ACTIVAR /
DESACTIVAR”.
en cualquier momento y programa que
esté en uso pulsando el botón
de “ACTIVAR / DESACTIVAR”
.
• 2 pitidos al final del ciclo de exposición.
• Iconodelabateríaparpadeaenverde.
¡Coloque la pieza de mano en la base del
cargador para cargar!
• Hay2 pitidos sin activar el ciclo
de exposición.
• Iconodelabateríaparpadeaenverde.
¡Coloque la pieza de mano en la base del
cargador para cargar!
Solo con la pieza de mano colocada en la unidad
de carga.
• 1 pitido cada segundo durante un período
de 30 segundos.
El LED de estado de la batería se ilumina
en AMARILLO.
No se emiten señales acústicas.
El LED de ciclo de exposición verde que se está
usando parpadea.
• 3 pitidos y los mecanismos electrónicos permiten la finalización del ciclo de exposición
que está en uso.
• 4 pitidos en el inicio de un ciclo de exposición.
Dos LED verdes (10 s / 20 s) en la parte de
mano parpadeando.
ES
-9-
4.2.5
ES
- 10 -
Información LED sobre la radiación enviada
El dispositivo utiliza LED de alta luminosidad Clase 2M (IEC 60825-1).
Radiación LED.
No dirija la mirada hacia el rayo de luz ni mire hacia éste
LED RADIATION
utilizando instrumentos ópticos.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• ProductoLEDdelaclase2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Potencia máxima: < 5,00 mW.
• Longitud de onda dominante:
Mín. 440 nm – Máx. 465 nm.
ADVERTENCIA
Rayos divergentes
No mire hacia la luz LED con instrumentos ópticos como monóculos, cristales de aumento o microscopios
desde una distancia inferior a 100 mm, pues esto puede provocar lesiones oculares.
Rayos colimados
No mire hacia la luz LED con instrumentos ópticos de observación a distancia, como telescopios o anteojos,
pues esto puede provocar lesiones oculares.
En caso de que el circuito de control del LED falle, la emisión de radiación del LED no puede exceder
en condiciones normales de uso el valor del equipamiento médico.
Las etiquetas como las citadas se incluyen con el embalaje del aparato.
5
Instalación y puesta en funcionamiento inicial
Las siguientes secciones de este apartado contienen la información y las instrucciones que se deben seguir para
garantizar un funcionamiento correcto y satisfactorio del dispositivo. Antes de poner en funcionamiento la unidad
Translux Wave, siga las instrucciones en el orden descrito a continuación.
El sistema médico cumple con los estándares de seguridad solamente si se instala siguiendo las instrucciones
descritas más adelante.
El dispositivo se debe instalar en un lugar adecuado donde resulte cómodo utilizarlo. Coloque la unidad de carga en una
superficie sólida, seca, plana y horizontal.
IMPORTANTE
La parte de mano está prevista para su uso dentro del entorno del paciente mientras que la unidad de carga
y el adaptador de la Fuente de Alimentación Conmutada no están previstos para su uso dentro del entorno del
paciente.
NOTA
El entorno del paciente se define como un área de 1,5 m desde el paciente (según el IEC 60601-1 tercera
edición y el IEC 60601-1-1).
ADVERTENCIA
Inspeccione siempre la unidad y sus componentes antes de la instalación por si estuvieran dañados.
Si encuentra daños, no continúe con la instalación del dispositivo.
El operador no debe estar en contacto simultáneamente con los elementos fuera del entorno del paciente
(unidades de carga y adaptador de la fuente de alimentación conmutada) y el paciente.
No conectar otros componentes externos al sistema médico.
5.1
Requisitos de seguridad durante la instalación
ADVERTENCIA
La instalación eléctrica del local donde se instale y se utilice el dispositivo debe cumplir la legislación vigente
y las especificaciones de seguridad correspondientes a las redes de energía eléctrica.
Instale el dispositivo en un lugar donde se encuentre protegido de golpes y salpicaduras accidentales de agua
u otros líquidos. No exponga el dispositivo a la luz ultravioleta o luz solar directa.
No instale el dispositivo sobre fuentes de calor o cerca de ellas. Cuando lo instale, asegúrese de que haya suficiente ventilación alrededor del dispositivo. No instale el dispositivo cerca de líquidos inflamables o disolventes,
puesto que pueden dañar sus cubiertas de plástico.
La clavija de la Fuente de Alimentación Conmutada (Enchufable Directa), modelo PSAC05R-050, se considera el
medio de aislamiento del equipo médico de la red de suministro. Cuando la clavija está conectada, el adaptador
de la fuente de alimentación debe estar fácilmente accesible. Dejar suficiente espacio libre a su alrededor.
El equipamiento médico no se deberá colocar de manera que dificulte la operación sobre el dispositivo de
desconexión (por consiguiente la clavija de la Fuente de Alimentación Conmutada).
No cortocircuite nunca los extremos de la batería con objetos metálicos, pues puede provocar riesgo de quemaduras, incendio y explosión.
Se puede transportar el dispositivo, pero se debe manipular con cuidado. Transpórtelo en posición horizontal.
No lo exponga a sacudidas o vibraciones. Para conocer el tamaño y el peso, véase el apartado 12 Especificaciones técnicas.
ADVERTENCIA: RIESGO DE EXPLOSIÓN
No instale el dispositivo en lugares donde exista riesgo de explosión. El dispositivo no se debe usar en lugares
con una atmósfera inflamable (mezclas anestésicas, oxígeno, óxido nitroso, etc.). Instale el dispositivo en zonas
con buena ventilación.
5.2
Conexión de la unidad de carga con la toma de alimentación de la red eléctrica
1x
La unidad Translux Wave se proporciona con una unidad de entrada universal independiente (6)
) y de 50 a 60 Hz.
que admite entre 100 y 240 V (
ADVERTENCIA
Antes de conectar la unidad de carga (6) a la red eléctrica, compruebe detenidamente que la tensión
y la frecuencia de red eléctrica se corresponden con los valores indicados en la etiqueta de especificaciones
del dispositivo. Dicha etiqueta la encontrará en la parte inferior de la unidad de carga.
Usar solamente el adaptador de la fuente de alimentación conmutada que se proporciona con el dispositivo.
El uso de cualquier otro adaptador de fuente de alimentación puede provocar daños a la batería.
No conectar el adaptador de la fuente de alimentación conmutada al enchufe de la red eléctrica usando una
regleta de enchufes múltiple portátil.
ES
NOTA
La unidad de alimentación de Translux Wave (6) se proporciona con tres adaptadores intercambiables:
tipo 1
Fig. 6 a: Europa,
- 11 Fig. 6 b: Reino Unido, tipo 2
Fig. 6 c: EE. UU. / Japón, tipo 3
1 Seleccione el adaptador adecuado entre los disponibles: Europa: tipo 1, Reino Unido: tipo 2, EE. UU. / Japón: tipo 3.
2 Cada uno de los adaptadores cuenta con una ranura en la que encaja la lengüeta de retención de la unidad
de alimentación.
3 Con la ranura orientada hacia la unidad de alimentación, coloque el adaptador sobre esta de modo que las guías
de deslizamiento del adaptador estén alineadas con sus correspondientes ranuras de la unidad de alimentación.
4 Empuje el adaptador y la unidad de alimentación para deslizar el adaptador e introducirlo en la unidad
de alimentación hasta que oiga un clic y el adaptador encaje en su sitio.
NOTA
Al empujar el adaptador durante la instalación, se garantiza la sujeción de todas las guías
de deslizamiento mediante las sujeciones de la unidad de alimentación. Si el adaptador está flojo,
extráigalo y vuelva a colocarlo.
5 Para extraer el adaptador de la unidad de alimentación, presione el botón de la lengüeta de retención (marcado con
“PUSH”, “presionar” en inglés), deslice el adaptador en el sentido contrario a la unidad de alimentación y extráigalo.
6 Conserve los adaptadores que no use para una futura utilización.
7 Conecte el enchufe macho del cable de alimentación al enchufe hembra de la parte inferior de la unidad de carga.
ADVERTENCIA
Compruebe el cable de alimentación, la unidad de alimentación y el adaptador con regularidad para
asegurarse de que se encuentran en buen estado.
Si encuentra daños, no utilice las piezas dañadas hasta que se sustituyan.
Utilice solo accesorios o piezas de recambio originales de Heraeus Kulzer.
8 Enchufe la unidad de alimentación con el adaptador correspondiente en la toma de alimentación de la red eléctrica.
9 El LED VERDE de la unidad de carga se iluminará (icono
).
5.3
Inserción de la batería en la pieza de mano
Translux Wave se proporciona con una potente batería de iones de litio recargable.
La batería se facilita por separado en el paquete del dispositivo y se debe introducir en la pieza de mano antes
de ponerla en funcionamiento por primera vez.
ADVERTENCIA
Siga detenidamente todas las medidas de seguridad descritas en el apartado 3.2.3 (BATERÍA: medidas de
seguridad).
PRECAUCIÓN
No coloque NUNCA la pieza de mano en la unidad de carga si no se ha introducido la batería en ella.
Introduzca la batería en la pieza de mano en el orden que se describe a continuación:
1 Extraiga la batería del embalaje.
ADVERTENCIA
No cortocircuite nunca los terminales de la batería con objetos metálicos, pues puede provocar riesgo
de quemaduras, incendio y explosión.
2 Utilice una herramienta plana (por ejemplo, una moneda) para desatornillar en el sentido
contrario a las agujas del reloj la tapa de la batería de la pieza de mano (Fig. 1 y 2 ).
3 La cubierta de la batería está marcada con una flecha (Fig. 3 ).
NOTA
Dicha flecha indica el sentido en el que se debe introducir la batería en la pieza de mano.
ES
- 12 -
2x
4 Deslice la batería en la pieza de mano lentamente hasta que se detenga, de forma que la flecha señale
la cubierta (Fig. 4 ).
NOTA
Si la batería se introduce de forma incorrecta (es decir, en el sentido contrario al que indica la flecha),
la pieza de mano no funcionará. Si se introduce de forma incorrecta, no se producen daños en los mecanismos electrónicos de la pieza de mano.
ADVERTENCIA
Utilice solo baterías originales de Heraeus Kulzer. El uso de baterías de pilas o baterías no recargables o de
baterías de otros fabricantes supone un riesgo potencial y puede provocar daños irreversibles en la unidad.
5 Utilice una herramienta plana (por ejemplo, una moneda) para atornillar la tapa de la batería de la pieza de mano
en el sentido de agujas del reloj.
NOTA
La unidad no funcionará correctamente si no se atornilla completamente la tapa de la pieza de mano.
5.4
Inserción de la fibra óptica en la pieza de mano
2x
• Girelaguíadeluzligeramente(1) e introdúzcala en la pieza de mano (2) hasta que se alcance
la posición final. Esta se alcanza al oír un “clic”.
• Instaleelconoprotectordeluz(3) en el extremo superior de la guía de luz.
Colocación de la guía de luz
• Girelaguíadeluzhastalograrlaposiciónquedeseepararealizarlapolimerización.
• Paraaprovecharcompletamentelaintensidadluminosaproporcionada,coloquelaguíadeluztancerca
de la resina compuesta como sea posible.
¡Evite el contacto directo con el material de la resinas compuestas!
PRECAUCIÓN: mantenga siempre limpia la guía de luz para conseguir la máxima intensidad luminosa.
La intensidad luminosa se verá considerablemente reducida en los siguientes casos:
– La guía de luz no está en perfectas condiciones (está rayada o despostillada).
– La guía de luz no se ha colocado correctamente en la pieza de mano.
– La guía de luz tiene manchas de resina compuesta.
ADVERTENCIA
Una guía de luz dañada reduce la intensidad luminosa y se debe sustituir por una nueva inmediatamente.
Los bordes afilados pueden provocar lesiones graves. Utilice solo guías de luz originales de Heraeus Kulzer.
ADVERTENCIA: control de infecciones:
Para que el tratamiento sea lo más seguro posible tanto para los pacientes como para los operadores,
la guía de luz y el cono protector de luz se deben limpiar, desinfectar y esterilizar antes de cada uno de los
tratamientos. Siga paso a paso las instrucciones que se proporcionan en el apartado 8 Limpieza, desinfección
y esterilización.
5.5
Carga de la batería
PRECAUCIÓN: primera carga de batería nueva
La batería de Translux Wave se ha cargado parcialmente en la fábrica.
Por lo tanto, se debe cargar completamente antes de usar la unidad Translux Wave por primera vez.
NOTA: primera carga de batería NUEVA
La primera vez que se carga, tarda alrededor de 3 horas. Las baterías nuevas o aquellas que han estado
almacenadas durante mucho tiempo pueden tardar más tiempo en cargarse. La batería alcanzará su capacidad
plena tras varios ciclos de carga-descarga completos.
ADVERTENCIA: RIESGO DE EXPLOSIÓN
Utilice únicamente la unidad de carga que se proporciona con Translux Wave para cargar la batería.
No intente nunca cargar la batería con otra fuente de alimentación o unidad de carga de baterías,
pues existe riesgo de explosión e incendio.
Introduzca la pieza de mano con la batería en la unidad de carga de Translux Wave.
2x
¡Un pitido confirma que los contactos están en la posición de carga correcta!
NOTA IMPORTANTE: clave de alineación
La clave de alineación (5), situada en la parte inferior trasera de la cubierta de la pieza de mano, permite
introducir la pieza de mano correctamente en la unidad de carga. Al introducir la pieza de mano en la unidad
de carga, la clave de alineación se debe alinear con la ranura que se encuentra dentro de la unidad de carga.
Proceso de carga de la batería
• ElLEDverdedeestadodelabateríadelapiezademanocomienzaaparpadear.
• Cuandofinalizalafasedecarga(labateríaestácompletamentecargada),elLEDdeestadoverdeestáiluminado
de forma permanente.
NOTA IMPORTANTE: batería defectuosa
Si, durante la fase de carga, los mecanismos electrónicos de la pieza de mano detectan fallos en la batería,
se interrumpe el proceso de carga y el LED de estado de la batería parpadeará en color AMARILLO.
En este estado, se emite un “pitido” cada segundo durante un período de 30 segundos.
¡Sustituya la batería defectuosa por una nueva!
ADVERTENCIA
¡Utilice solo baterías de Heraeus Kulzer!
NOTA
Cuando la pieza de mano se coloca en la unidad de carga, está inactiva. Se impide el funcionamiento
del botón de “Activar / desactivar”
.
La pieza de mano se puede retirar de la unidad de carga durante el proceso de carga; no obstante, es
posible que la batería no esté completamente cargada, lo que puede reducir el tiempo de funcionamiento.
6
Funcionamiento
ADVERTENCIA: compruebe el estado del dispositivo antes de iniciar el tratamiento.
Antes de comenzar un tratamiento, compruebe siempre que el dispositivo funciona correctamente y que los
accesorios (guía de luz y cono protector de luz) lo hacen con eficacia. Si observa algo durante el tratamiento,
no lo lleve a cabo y póngase en contacto con Heraeus Kulzer o con un representante local autorizado de
atención al cliente (véase el apartado 14 Mantenimiento). Si encuentra daños, no utilice el dispositivo ni los
accesorios correspondientes. Antes de cada uso de la unidad Translux Wave, compruebe que la intensidad
luminosa emitida es suficiente para garantizar la polimerización. Compruebe la intensidad luminosa mediante
el fotómetro integrado en la unidad de carga (véase el apartado 6.2 Medición de la intensidad luminosa).
ADVERTENCIA: control de infecciones
Primer uso
Los accesorios, la guía de luz y el cono protector de luz se facilitan en condición NO ESTÉRIL,
con lo que se deben esterilizar antes de utilizarlos por primera vez.
Cada uso
Una vez utilizados, los accesorios – guía de luz y cono protector de luz – se deben procesar de nuevo
antes de volver a utilizarlos, según los procedimientos descritos en el apartado 8 (Limpieza, desinfección
y esterilización).
6.1
Activación y desactivación del ciclo de exposición
Translux Wave puede funcionar con dos ciclos de exposición distintos:
– Exposición con salida constante: duración del ciclo10 segundos.
– Exposición con salida lentamente creciente: “Inicio suave” (duración del ciclo: 20 segundos).
El programa de “Inicio suave” implica un aumento de la intensidad luminosa de un 50% a un 100% en 2 segundos.
• Silapiezademanoestáen“Modo de espera” (todos los LED de ciclos de exposición de la pieza de mano están
apagados), pulse brevemente el botón de “Activar / desactivar”
para poner la pieza de mano en
funcionamiento. (Después de iniciar el LED se encenderá 10 segundos por defecto.)
ES
- 13 -
ES
- 14 -
Polimerización en 10 segundos de exposición
Pulse brevemente el botón de “Activar / desactivar”
. Se activará la emisión de luz.
El LED de 10 segundos está activado, lo que muestra que este programa se está ejecutando.
Una vez que finalice el ciclo de exposición, la unidad apagará la luz automáticamente.
Señalacústica:
Seemitenlassiguientesseñalesacústicas(pitidos):
1 pitido al pulsar el botón de “Activar / desactivar”.
1 pitido cuando termina el tiempo de exposición.
Polimerización de “Inicio suave” en 20 segundos de exposición
Mantenga pulsado el botón de “Activar / desactivar”
durante al menos un segundo.
Se activará la emisión de luz.
El LED de 20 segundos está activado, lo que muestra que este programa se está ejecutando.
Una vez que finalice el ciclo de exposición, la unidad apagará la luz automáticamente y volverá al modo
de 10 segundos (LED activado durante 10 segundos).
Señalacústica:
Seemitenlassiguientesseñalesacústicas(pitidos):
1 pitido al pulsar el botón de “Activar / desactivar”.
1 pitido después de 1 segundo indica el modo de activación “Inicio suave”.
1 pitido tras 10 segundos de tiempo de exposición.
1 pitido cuando termina el tiempo de exposición.
NOTA
El ciclo de exposición se puede interrumpir en cualquier momento antes de que finalice el tiempo
de exposición; para ello, pulse de nuevo el botón de “Activar / desactivar”.
Señalacústica:
Se emite una señal acústica (pitido) al pulsar el botón de “Activar / desactivar” para interrumpir
el ciclo de exposición.
6.2
Medición de la intensidad luminosa
La unidad de carga de Translux Wave está equipada con un fotómetro integrado para medir
2x
la intensidad luminosa (8).
PRECAUCIÓN
Antes de cada tratamiento, compruebe siempre la intensidad luminosa mediante
el fotómetro integrado en la unidad de carga de Translux Wave.
• Coloquelaguíadeluzenposiciónhorizontaldirectamenteenlazonadeprueba(8) sin ejercer presión.
Active la unidad pulsando el botón de “Activar / desactivar”
(sea cual sea el tiempo de exposición
seleccionado).
) que se encuentra en la parte inferior derecha de la zona de prueba indica
El LED de dos colores (símbolo
inmediatamente la intensidad luminosa.
LED VERDE: la intensidad luminosa es suficiente para el tratamiento.
LED AMARILLO: la intensidad luminosa no es suficiente y no se debe tratar a ningún paciente.
PRECAUCIÓN
Si la intensidad de la luz es insuficiente, por favor realice las siguientes medidas y controles:
– La guía de luz no se ha introducido en la pieza de mano (véase el apartado 5.4 Inserción de la fibra
óptica en la pieza de mano).
– Compruebe la guía de luz en busca de suciedad o defectos.
– Limpie la suciedad de la guía de luz (véase el apartado 8 Limpieza, desinfección y esterilización)
o sustituya la guía de luz dañada por una nueva.
Utilice solo guías de luz originales de Heraeus Kulzer.
ADVERTENCIA
Si las medidas anteriormente descritas no proporcionan mejora alguna, no utilice el dispositivo para ningún
tratamiento. Desconecte la unidad (desenchufe la unidad de carga de la fuente de alimentación eléctrica)
y compruebe que no es posible reactivar la unidad sin autorización. Póngase en contacto con un socio de
servicio de Heraeus Kulzer o con el personal técnico autorizado por Heraeus Kulzer (véase el apartado 14
Mantenimiento).
6.3
Modo de espera
La pieza de mano está equipada con un “Modo de espera” para minimizar el consumo energético de la unidad.
Cuando no está colocada en la unidad de carga, todas las funciones internas de la pieza de mano se desactivan
de forma automática (“Modo de espera”) si no se usa durante 5 minutos aproximadamente.
En “Modo de espera”, los LED de ciclo de exposición de la pieza de mano se apagan.
Para salir del “Modo de espera”, pulse el botón de “Activar / desactivar”
.
La pieza de mano está lista para funcionar.
6.4
Información adicional sobre el funcionamiento de la unidad
NOTA
Si la pieza de mano se coloca en la unidad de carga antes de que haya finalizado el ciclo de polimerización,
la emisión de luz se apaga automáticamente.
Cuando la pieza de mano se coloca en la unidad de carga, está inactiva. Se impide el funcionamiento del
botón de “Activar / desactivar”
.
La Translux Wave está equipada con microprocesadores que comprueban continuamente los parametros
óptimos de carga de la batería. Por lo tanto, después de cada tratamiento, la pieza de mano se debe
almacenar dentro de la unidad de carga, independientemente del nivel de la batería.
7
Estados de alarma
7.1
Batería defectuosa
En caso de que la batería esté defectuosa, el LED de estado de la batería de la pieza
de mano parpadeará AMALILLO continuamente (Fig. a).
Se emite un “pitido” cada segundo durante un período de 30 segundos.
IMPORTANTE
Esta condición de error se detecta únicamente cuando la pieza de mano está
colocada en la unidad de carga.
7.2
LED defectuoso
Cuando el microprocesador detecta una anomalía por fallo del LED, el LED “10s” de ciclo
de exposición de color verde que se está usando comienza a parpadear (Fig. b).
ES
Parpadeo
a
Parpadeo
b
7.3
Protección contra sobrecalentamiento
Si se llevan a cabo varios ciclos de polimerización seguidos (normalmente tras 18 ciclos
consecutivos, cada uno de los cuales dura 20 segundos), se puede activar el sensor de
exceso de temperatura integrado.
Una vez que se activa la protección de sobrecalentamiento, una señal acustica (3 pitidos) es emitida
al final del ciclo de exposición.
La activación de la protección contra sobrecalentamiento interrumpe temporalmente el uso de la unidad
durante varios minutos.
Permita que la pieza de mano se enfríe durante al menos 4 o 5 minutos y, a continuación,
.
comience la siguiente exposición pulsando el botón de “Activar / desactivar”
NOTA
La pieza de mano está operativa cuando alcanza la temperatura de funcionamiento.
No necesita un “reset manual”.
7.4
Sensor de exceso de temperatura INTEGRADO defectuoso
En caso de un sensor de sobrecalentamiento de temperatura defectuoso, se emiten “4 pitidos” en el inicio de un ciclo
de exposición.
NOTA
Si se produce el fallo del sensor de sobrecarga de temperatura durante un ciclo de exposición, el software
permite completar la exposición. No se permite ningún ciclo de exposición adicional presionando el botón
y se emiten “4 pitidos”.
“Activar / desactivar”
Ninguna operación adicional se previene para un defecto del sensor de sobrecalentamiento.
- 15 -
7.5
Señal de batería baja
Si después de un uso frecuente, la carga de la batería baja al nivel mínimo, el microprocesador de Translux Wave
permite varios ciclos más en cualquier modo de polimerización sin necesidad de volver a cargar la batería.
Este estado se indica al final de cada ciclo mediante “2 pitidos”.
Icono de la batería parpadea en verde. ¡Cargue la batería!
Tras varios ciclos más, la carga restante de la batería no permitirá llevar a cabo ningún ciclo de exposición más.
Este estado se indica mediante “2 pitidos”.
Icono de la batería parpadea en verde. ¡Cargue la batería!
8
ES
Limpieza, desinfección y esterilización
DESCONECTAR DE LA RED ELÉCTRICA
¡Antes de llevar a cabo los procedimientos de limpieza y desinfección, desconecte la base de carga
de la fuente de alimentación eléctrica!
ADVERTENCIA
Control de infecciones
La guía de luz y el cono protector de luz se proporcionan en condición NO ESTÉRIL y se deben limpiar,
desinfectar y esterilizar (con vapor) tanto antes de la primera utilización como antes de cada uso.
¡No esterilice la pieza de mano ni la unidad de carga!
¡No esterilice la batería!
8.1
- 16 -
Desmontaje
Extraiga el cono protector de luz de la guía de luz.
Extraiga la guía de luz: Gire ligeramente la guía de luz y sáquela de la pieza de mano.
8.2
GUÍA DE LUZ: limpieza y desinfección
PRECAUCIÓN
No utilice instrumentos punzantes o afilados para limpiar la guía de luz, puesto que pueden rayar la superficie
de la guía de luz y, por tanto, se puede ver reducida la transmisión de luz.
No emplee agentes de limpieza o desinfectantes que contengan ácidos oxidantes, minerales y orgánicos,
disolventes, bromuro, yodo cloruro y peróxido de hidrógeno.
1) Los posibles residuos, como el material de las resinas compuestas, se deben eliminar de la superficie del extremo
de la guía de luz inmediatamente después de su uso. Las resinas compuestas polimerizadas se deben eliminar con
etanol y una espátula de plástico o un cepillo de nailon suave.
2) Desinfecte la guía de luz con un paño sin pelusas limpio y suave, humedecido con una solución desinfectante suave,
con un pH suave (pH 7), según las especificaciones del fabricante. Deje que se seque la solución desinfectante.
8.2.1 GUÍA DE LUZ: inspección antes de la esterilización
Antes de continuar con el proceso de esterilización, compruebe detenidamente la guía de luz en busca de suciedad,
decoloración y superficies dañadas.
ADVERTENCIA
No utilice una guía de luz dañada. Si encuentra daños, sustitúyala por una nueva.
Si la guía de luz sigue sucia, repita el procedimiento de limpieza y desinfección.
8.3
CONO PROTECTOR DE LUZ: limpieza y desinfección
PRECAUCIÓN
No emplee agentes de limpieza o desinfectantes que contengan ácidos oxidantes, minerales y orgánicos,
disolventes, bromuro, yodo, cloruro y peróxido de hidrógeno.
Limpie y desinfecte el cono protector de luz con un paño suave humedecido con una solución desinfectante suave,
con un pH suave (pH 7), según las especificaciones del fabricante. Deje que se seque la solución desinfectante.
8.3.1 CONO PROTECTOR DE LUZ: inspección antes de la esterilización
Antes de continuar con el proceso de esterilización, compruebe detenidamente el cono protector de luz en busca
de suciedad, decoloración, vetas y superficies dañadas.
ADVERTENCIA
No utilice un cono protector de luz dañado. Si encuentra daños, sustitúyalo por uno nuevo.
Si el cono protector de luz está dañado, no puede ofrecer suficiente protección contra la luz de la unidad.
Si el cono protector de luz sigue sucio, repita el procedimiento de limpieza y desinfección.
8.4
GUÍA DE LUZ y CONO PROTECTOR DE LUZ: empaquetado previo a la esterilización
La guía de luz y el cono protector de luz se pueden esterilizar utilizando una bolsa médica de esterilización con vapor
de un solo uso y con el tamaño adecuado.
PRECAUCIÓN
La guía de luz y el cono protector de luz se deben colocar por separado en una sola bolsa.
Al esterilizar varios instrumentos en un autoclave, asegúrese de no exceder la carga máxima de este.
ADVERTENCIA
Compruebe que la bolsa interior tiene el tamaño suficiente para contener varios instrumentos sin tensar
el cierre ni romper el paquete.
8.4.1 GUÍA DE LUZ y CONO PROTECTOR DE LUZ: esterilización
8.4.1.1 Método de esterilización
ES
• Realicelaesterilizaciónmedianteunautoclaveconvaporenelqueseharealizadoelvacíopreviamente.
PRECAUCIÓN
- 17 No utilice nunca otros métodos de esterilización, puesto que existe posibilidad de incompatibilidad con los
materiales con los que se ha fabricado la guía de luz.
NO UTILICE los siguientes métodos de esterilización: Esterilización por óxido de etileno, esterilización
por aire caliente, esterilización en autoclave flash, esterilización en STERRAD, esterilización en sistemas
STERIS o similares.
NO esterilice la guía de luz y el cono protector de luz con peróxido de hidrógeno, sistemas con ácido peracético o con glutaraldehído y formaldehído.
8.4.1.2 Parámetros de esterilización
• Parámetros de esterilización mínimos que ofrecen un nivel de garantía de esterilidad (NGE) de entre 10 –6.
Tipo de ciclo
Temperatura mínima
Vacío previo
132°C + 3°C
(270°F + 5°F)
Tiempo mínimo de exposición
(bolsa)
4 minutos
Tiempo mínimo de
secado
20 minutos
PRECAUCIÓN
No exceda los 135°C (275°F).
8.5
PIEZA DE MANO: limpieza y desinfección
ADVERTENCIA
La pieza de mano no está protegida contra la penetración de líquidos.
No rocíe líquidos directamente sobre la superficie y los contactos de carga de la pieza de mano.
Los agentes de limpieza y desinfectantes no deben entrar en la pieza de mano.
NUNCA sumerja la pieza de mano en líquidos.
NUNCA limpie la pieza de mano con agua corriente.
No esterilice la pieza de mano. ¡Riesgo de daños graves, descarga eléctrica e incendio!
2x
Limpie la cubierta de la pieza de mano con un paño sin pelusas limpio y suave, humedecido con un agente
desinfectante suave para superficies con pH neutro (pH 7), según las especificaciones del fabricante.
Deje que la solución desinfectante se seque o seque los restos que queden en la cubierta de la pieza de mano
con un paño suave sin pelusas.
PRECAUCIÓN
No utilice disolventes tales como acetona, alcohol isopropílico y fenol, bromuro, yodo, cloruro, peróxido de
hidrógeno u otras soluciones agresivas para limpiar y desinfectar la superficie de plástico de la pieza de mano.
Estas sustancias pueden resultar dañinas y provocar decoloración o dañar los materiales de plástico de la pieza
de mano.
¡No utilice limpiadores abrasivos!
IMPORTANTE: limpieza de los contactos de carga de la pieza de mano
Después de llevar a cabo la desinfección o limpieza de la cubierta de plástico de la pieza de mano, limpie
siempre los contactos de carga que se encuentran en la parte inferior de esta. Los contactos de carga
de la pieza de mano deben estar siempre libres de posibles restos de limpiador o desinfectante, de resinas
compuestas o suciedad.
IMPORTANTE
Los contactos de carga de la pieza de mano se deben limpiar con regularidad (al menos una vez a la semana)
y siempre después de llevar a cabo la limpieza y desinfección de la cubierta de plástico de la pieza de mano.
Si los contactos de carga están sucios o expuestos a líquidos, como limpiadores o desinfectantes, pueden
repercutir negativamente en el proceso de carga e impedir que se cargue la batería.
Limpie los contactos de carga de la pieza de mano con un hisopo de algodón o un paño suave sin pelusas
humedecidos con alcohol.
PRECAUCIÓN
No utilice instrumentos punzantes o afilados para limpiar los contactos de la pieza de mano, puesto que
pueden rayar y dañar la superficie y, por lo tanto, empeorar la conductividad con los contactos de carga.
Antes de volver a usar la pieza de mano, compruebe que la superficie y los contactos de carga de esta están
completamente secos. Si es necesario, secar los contactos con aire seco.
ES
- 18 -
8.6
UNIDAD DE CARGA: limpieza de la cubierta
DESCONECTAR DE LA RED ELÉCTRICA
Desconecte la fuente de alimentación de entrada de la toma y la unidad de carga antes de llevar a cabo
la limpieza o desinfección.
ADVERTENCIA
La cubierta de la unidad de carga no está protegida contra la penetración de líquidos.
No rocíe líquidos directamente sobre la superficie de la cubierta de la unidad de carga.
PRECAUCIÓN
NO esterilice la unidad de carga. ¡Dejará de funcionar y puede haber riesgo de daños graves, descarga
eléctrica e incendio!
No utilice disolventes tales como acetona, alcohol isopropílico y fenol, bromuro, yodo, cloruro, peróxido
de hidrógeno u otras soluciones agresivas para limpiar la superficie de plástico de la unidad de carga.
Estas sustancias pueden resultar dañinas y provocar decoloración o dañar los materiales de plástico
de la unidad de carga.
¡No utilice limpiadores abrasivos!
Limpie la cubierta de la unidad de carga con un paño sin pelusas limpio y suave, humedecido con un agente
limpiador de superficies con pH neutro (pH 7), según las especificaciones del fabricante.
Seque la cubierta de la unidad de carga con un paño limpio y no abrasivo.
PRECAUCIÓN
Asegúrese de secar la unidad de carga después de limpiarla. La humedad en el interior de la unidad puede
provocar daños.
IMPORTANTE
Una vez que haya finalizado el procedimiento de limpieza, asegúrese de que los contactos de carga del interior
de la unidad de carga están perfectamente secos. Si es necesario, secar los contactos con aire seco.
8.6.1
UNIDAD DE CARGA: limpieza de los contactos de carga
IMPORTANTE
Después de llevar a cabo la limpieza de la cubierta de plástico del cargador, limpie siempre
los contactos de la unidad de carga. Los contactos de carga de la unidad de carga deben estar
siempre libres de posibles restos de limpiador, resinas compuestas o suciedad.
2x
Los contactos de la unidad de carga se deben limpiar con regularidad (al menos una vez a la semana) y,
en cualquier caso, siempre después de llevar a cabo la limpieza de la cubierta de plástico. Si los contactos
están sucios o expuestos a líquidos, como limpiadores o desinfectantes, pueden repercutir negativamente
en el proceso de carga e impedir que se cargue la batería.
Limpie los contactos de la unidad de carga con un hisopo de algodón o un paño suave sin pelusas
humedecidos con alcohol.
PRECAUCIÓN
¡No utilice objetos punzantes o afilados para limpiar los contactos de la unidad de carga!
¡No rocíe los contactos con líquidos ni los sumerja en ellos!
No doble ni modifique la forma de los contactos de la unidad de carga al limpiarlos.
Asegúrese de que los contactos de carga siguen estando secos después de limpiarlos y que no entran
en contacto con partes grasientas o metálicas. Si es necesario, secar los contactos con aire seco.
8.6.2 UNIDAD DE CARGA: contactos de carga recambiables
Si los contactos de la unidad de carga tienen daños o mucha suciedad (que no se puede limpiar siguiendo
los procedimientos descritos en el apartado anterior), esto puede impedir su conductividad y, por consiguiente,
la carga de la batería.
En este caso, se pueden sustituir los contactos de la unidad de carga dañados por otros nuevos.
Para obtener más información sobre la sustitución de los contactos de las unidades de carga y sobre piezas
de repuesto, póngase en contacto con una filial local de Heraeus Kulzer.
Instrucciones de trabajo:
Herramienta necesaria: destornillador para tornillos Phillips-Screw, tamaño medio.
1. Extraiga la pieza de mano de la base de carga.
2. Desconecte el cargador de la red eléctrica.
3. Desenchufe el cable de conexión del cargador.
4. Dele la vuelta al cargador.
5. Quite dos tornillos del puente de contacto de carga
(véase el punto 12 de la contraportada desplegable).
6. Saque el puente del contacto de carga.
7. Ahora introduzca el nuevo puente de contacto y fíjelo o conéctelo realizando los pasos
en sentido inverso.
PRECAUCIÓN
¡No doble ni contamine el nuevo puente de contacto!
¡Preocúpesedeinsertarloyfijarloperfectamente!¡Noaprietelostornillosenexceso!
9
ES
- 19 -
2x
Almacenamiento en estanterías
Almacenamiento de la pieza de mano con la batería durante largos períodos de inactividad. Antes o después de un largo
período de inactividad, cargue completamente la batería o guárdela dentro de la unidad de carga en funcionamiento.
Aunque el circuito de seguridad integrado de la batería impide que se descargue completamente, se recomienda encarecidamente cargarla completamente al menos una vez cada 5 meses de inactividad.
10
Eliminación
NOTA: IMPORTANTE
El dispositivo no se debe desechar junto con residuos domésticos normales.
Para desechar las piezas de repuesto, o la unidad, póngase en contacto con la filial de Heraeus Kulzer
en su país directamente.
Deseche las guías de luz y las baterías que no se puedan reparar según los requisitos legales correspondientes
de su país.
ADVERTENCIA: eliminación de batería agotada o dañada
Elimine una batería dañada o agotada después de llevar a cabo los pasos necesarios para impedir
un cortocircuito externo; para ello utilice el método siguiente:
Tras aislar los terminales de la batería con cinta elimínela según las estipulaciones del ayuntamiento.
Las condiciones y medidas de seguridad para desechar el dispositivo están sujetas a las disposiciones legales válidas,
del mismo modo que lo están otros dispositivos electrónicos que han dejado de tener utilidad.
Tratamiento de los equipos conforme a WEEE (Directiva Europea) o
Ley de aparatos eléctricos y electrónicos (Ley Alemana ElektroG).
11
Solución de problemas
ADVERTENCIA
Si el problema no se soluciona siguiendo los pasos que se indican a continuación, póngase en contacto
con Heraeus Kulzer o con un representante del servicio de atención al cliente local autorizado:
NO UTILICE la unidad Translux Wave NI INTENTE repararla, pues puede producir lesiones graves.
Si el dispositivo no funciona correctamente, lea de nuevo este manual de usuario y consulte la siguiente tabla:
PROBLEMA
La unidad de carga no se enciende.
El LED VERDE
de la unidad
de carga está apagado.
ES
- 20 -
La pieza de mano NO se ha introducido en la unidad de carga.
La emisión de luz no comienza
al pulsar el botón de
“Activar / desactivar”
y no se
muestra información en la pantalla
de la pieza de mano.
POSIBLE CAUSA
La fuente de alimentación de entrada no
está conectada a la toma de alimentación eléctrica ni a la toma de alimentación
de la unidad de carga.
SOLUCIÓN
Compruebe que la fuente de alimentación de entrada está conectada de
forma segura a la toma de alimentación
eléctrica y a la toma de alimentación
de la unidad de carga.
La toma de alimentación no conduce
Utilice una toma de alimentación
electricidad.
distinta.
El adaptador intercambiable no se ha intro- Lea detenidamente el apartado 5.2
ducido correctamente en la cubierta de la de este manual de usuario.
fuente de alimentación eléctrica de entrada.
Sustituya la fuente de alimentación
El cable de alimentación de la fuente
de alimentación eléctrica de entrada está eléctrica de entrada por una nueva.
(La fuente de alimentación eléctrica
dañado.
de entrada y el cable correspondiente
no se pueden separar).
La fuente de alimentación eléctrica
Sustituya la fuente de alimentación
de entrada está defectuosa.
eléctrica de entrada por una nueva.
La unidad de carga está defectuosa.
Póngase en contacto con Heraeus Kulzer
o con un representante del servicio
de atención al cliente local autorizado.
Los contactos de la unidad de carga
Corrija la causa del cortocircuito.
tienen un cortocircuito.
Si el cortocircuito no se soluciona,
sustituya los contactos de la unidad
de carga por unos nuevos.
Consulte el apartado 8.6.2.
Pieza de mano sin batería.
Introduzca la batería en la pieza
de mano (véase el apartado 5.3).
La pieza de mano está
Pulse el botón de “Activar / desactivar”
para que la pieza de mano salga del
en “Modo de espera”.
“Modo de espera”.
Consulte el apartado 6.3.
Batería vacía.
Coloque la pieza de mano en la unidad
No hay carga suficiente en la batería para de carga y vuelva a cargar la batería
activar la pieza de mano.
(véase el apartado 5.5).
Fallo de los mecanismos electrónicos.
Póngase en contacto con Heraeus Kulzer
o con un representante del servicio de
atención al cliente local autorizado.
Batería defectuosa.
Para comprobar si la batería está
defectuosa, coloque la pieza de mano
en la unidad de carga. El “proceso de
preconfiguración” empieza en el momento en el que el micro-procesador de
la Translux Wave comprueba el estado
de las baterías. Este paso puedo durar
hasta un máximo de 30 minutos.
Si, durante el proceso de comprobación
se emite un “pitido” cada segundo
durante 30 segundos y el símbolo de
batería en la pieza de mano parpadea
en AMARILLO, esto quiere decir que la
batería está defectuosa.
Sustituya la batería por una nueva
(véase el apartado 5.3).
PROBLEMA
Al final del ciclo de exposición, se
emiten “2 pitidos”.
SOLUCIÓN
Los “2 pitidos” indican que el nivel
de carga restante de la batería es
suficiente solo para algunos ciclos
de exposición posteriores más.
Coloque la pieza de mano en la unidad
de carga y vuelva a cargar la batería
(véase el apartado 5.5).
Verifique la funcionalidad del pack LED
La emisión de luz no empieza cuando El pack LED puede estar defectuoso.
mediante el siguiente procedimiento:
se pulsa el botón de “Activar /
Introduzca la pieza de mano en el cargadesactivar”
o durante el ciclo de
dor y presione el botón de “Activar /
exposición la luz se interrumpe con
desactivar” 5 veces consecutivas.
un. La polimerización LED “10s” en la
Retire la pieza de mano de unidad de
pieza de mano comienza a parpadear
carga. La polimerización LED “10s” en
VERDE.
la pieza de mano deja de parpadear, la
pieza de mano se ha reiniciado. Si la
polimerización LED “10s” empieza a
parpadear otra vez en la pieza de mano
de nuevo en el inicio del siguiente ciclo,
y no comienza la activación de la luz, el
Parpadeo
paquete LED está. En este caso contacte
Heraeus Kulzer o el agente autorizado de
atención al cliente.
Protección contra sobrecalentamiento. Permita que la pieza de mano se enfríe
Tras varios ciclos de exposición
consecutivos, la emisión de luz
La pieza de mano se ha sobrecalentado durante al menos 4 o 5 minutos y,
no se activa al pulsar el botón de
durante su uso y se ha activado el sensor a continuación, comience la siguiente
exposición pulsando el botón de
de exceso de temperatura.
y se
“Activar / desactivar”
“Activar / desactivar”. Nota: La pieza
emiten “3 pitidos”.
La activación de la protección contra so- de mano está operativa cuando alcanza
brecalentamiento impide temporalmente la temperatura de funcionamiento. No
(durante varios minutos) el uso
necesita un “reset manual”.
de la unidad.
Protección contra sobrecalentamiento. Permita que la pieza de mano se enfríe
A lo largo de un ciclo de exposición,
La pieza de mano se ha sobrecalentado durante al menos 4 o 5 minutos y,
se emiten “3 pitidos”.
durante su uso y se ha activado el sensor a continuación, comience la siguiente
de exceso de temperatura.
exposición pulsando el botón de
La activación de la protección contra sobre- “Activar / desactivar”.
calentamiento impide temporalmente
(durante varios minutos) el uso de la unidad.
Fallos en la fase de carga.
En la fase de precualificación de la
Sustituya la batería por una nueva
Un “pitido” se emite cada segundo
batería (estado de la batería: comple(véase el apartado 5.3).
durante el periodo de 30 segundos
tamente vacío; consulte los apartados
y el LED de estado de batería en la
4.2.4 y 5.5).
2x
pieza de mano parpadea en color
Los mecanismos electrónicos detectan
AMARILLO.
un defecto o fallo en la batería e interrumpen el proceso de carga.
Parpadeo
La pieza de mano está colocada en
la unidad de carga, pero la fase de
carga no comienza.
El verde LED de estado de la batería
en la pieza de mano está desactivado.
POSIBLE CAUSA
Carga de la batería baja.
Defecto: interrupción de los contactos
de carga.
Contacto incorrecto entre la base de
carga y la pieza de mano.
Remítase a los apartados 8.5 y 8.6.2.
Compruebe que se ha introducido la
pieza de mano en la unidad de carga en
el sentido correcto. Clave de alineación.
Remítase al apartado 4.2.1, puntos 4 y 5.
Los contactos de la pieza de mano o de Limpie los contactos de la unidad de
carga tienen suciedad.
carga y la pieza de mano.
Remítase a los apartados 8.5 y 8.6.1.
La guía de luz no se ha introducido
Compruebe que la guía de luz se ha
La intensidad luminosa medida con
introducido completamente en el cono
el fotómetro integrado en la unidad de correctamente en la pieza de mano.
de metal de la pieza de mano.
carga no es suficiente.
La salida de la guía de luz tiene suciedad Limpie la salida de la guía de luz.
El LED
de la unidad de carga
de restos de resinas compuestas o
Remítase al apartado 8.2.
se ilumina en color AMARILLO.
materiales extraños que pueden interferir
con la salida de luz.
Guía de luz dañada u obsoleta.
Sustituya la guía de luz por una nueva.
ES
- 21 -
12
Especificaciones técnicas
Clasificación de acuerdo con la
directiva 93/42/CE:
Estándares de Seguridad:
ES
- 22 -
Clase I (uno)
El producto ha sido probado y cumple con el IEC 60601-1 (segunda
edición) y con el IEC 60601-1-1.
El producto ha sido probado y cumple con el IEC 60601-1 (tercera
edición) y con el IEC 60601-1-2 (tercera edición – para compatibilidad electromagnética – EMC).
La parte de mano está prevista para su uso dentro del entorno del
paciente mientras que la unidad de carga y el adaptador de la fuente
de alimentación no están previstos para su uso dentro del entorno
del paciente.
Nota: El entorno del paciente se define como un área de 1,5 m del
paciente (según el IEC 60601-1, tercera edición y el IEC 60601-1-1).
Clasificación de acuerdo con la
Clase II, Tipo B, Parte aplicada: Guía de luz con cono de protección.
norma IEC 60601-1:
IP 20 (unidad de carga). IP 20 (Translux Wave)
Unidad de carga:
Unidad de carga de Translux Wave
Fuente de alimentación para la unidad de carga: Fuente de Alimentación Conmutada (Enchufable Directa) fabricado por:
Phihong Technology CO LTD – Modelo: PSACO5R-050.
Entrada: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Salida: 5 V
– 1 A Máx –
.
Equipo de Clase II
Fuente de alimentación para la pieza de mano: Batería de iones de litio recargable.
Fabricante: Panasonic. Modelo: NCR-18500.
Tensión nominal: 3,6 V.
Capacidad nominal (Típica): 2000 mAh
Pieza de mano:
Modelo: Translux Wave.
Operación: Servicio intermitente: 120“ ENCENDIDO – 40“ APAGADO –
máx 2 veces seguidas
Fuente de iluminación:
LED de alta luminosidad. Producto LED de la clase 2M (IEC 60825-1).
Intervalo de longitudes de onda: 440 – 480 nm.
Longitud de onda dominante: Mín. 440 nm – Máx. 465 nm
Guía de luz:
Varilla sin plomo con varios conductores, diámetro de 8 mm.
Esterilizable en autoclave en vapor al vacío:
4 minutos (mínimo) a una temperatura mínima de 132°C + 3°C
(270°F + 5°F). Máx. 500 ciclos
Ciclos de exposición configurables:
10 segundos de tiempo de exposición.
– Exposición normal
Señalesacústicas:
1 pitido cuando comienza la exposición.
1 pitido tras el tiempo de exposición
– Exposición con “Inicio suave”
20 segundos de tiempo de exposición. (El programa
de “Inicio suave” implica un aumento de la intensidad luminosa
de un 50% a un 100% en 2 segundos.)
Señalesacústicas:
1 pitido cuando comienza la exposición.
1 pitido después de 1 segundo indica el modo de activación
“Inicio suave”.
1 pitido tras 10 segundos de exposición.
1 pitido tras el tiempo de exposición
Tiempo de carga de una batería vacía:
3 horas aproximadamente
Condiciones medioambientales de la unidad:
Funcionamiento
Transporte
Temperatura
Humedad relativa
Presión atmosférica
De 10°C a 35°C
(50°F a 95°F)
45 % – 85 %
De 800 a 1060 hPa
y almacenamiento
De –20°C a 40°C
(–4°F a 104°F)
45 % – 85 %
De 500 a 1060 hPa
Unidad de carga: peso, 450 g.
Dimensiones: 140 x 58 x 62 mm (largura x anchura x altura)
Pieza de mano: peso, 150 g (incl. cono protector).
Dimensiones: 275 mm de largura, máx. 24 mm de diámetro
Peso y dimensiones:
12.1
CompatibilidadelectromagnéticasegúnEN60601-1-2
ADVERTENCIA
El aparato necesita medidas CEM especiales que deben instalarse y activarse conforme a las instrucciones
incluidas en este apartado.
Los aparatos de radiocomunicación móviles y portátiles pueden afectar al correcto funcionamiento
del dispositivo.
Guía y declaración del constructor – Emisiones electromagnéticas
La unidad Translux Wave está destinada a su uso en el entorno electromagnético que se indica a continuación.
El cliente o usuario de Translux Wave debe garantizar su utilización en dicho entorno.
Prueba de emisión
Conformidad Ambiente electromagnético – Guía
Emisiones AF CISPR 11
Grupo 1
La unidad Translux Wave utiliza energía de radiofrecuencia únicamente para su funcionamiento interno. Por lo tanto, sus emisiones
de radiofrecuencia son muy bajas y no es probable que provoquen
interferencias con los equipos electrónicos cercanos.
Emisiones AF CISPR 11
Clase B
La Translux Wave es adecuada para el uso en todos los edificios,
incluidos los edificios domésticos, y aquéllos directamente
Emisiones armónicas
Clase A
conectados a la red de alimentación pública de baja tensión que
IEC 61000-3-2
alimenta edificios para usos domésticos.
Emisiones de fluctuaciones de tensión / Conforme
flicker IEC 61000-3-3
Guía y declaración del constructor – Inmunidad electromagnética
La unidad Translux Wave está destinada a su uso en el entorno electromagnético que se indica a continuación.
El cliente o usuario de Translux Wave debe garantizar su utilización en dicho entorno.
Prueba de inmunidad Valor de prueba IEC 60601
Valor de conformidad
Ambiente electromagnético –
Guía
Descargas
±6 kV de contacto
El aparato sigue funcioLos suelos deben ser de madera,
electrostáticas (ESD)
nando de forma correcta y
hormigón o de cerámica. Si los
±8 kV en el aire
IEC 61000-4-2
segura.
suelos están cubiertos de material
sintético, la humedad relativa debe
ser de por lo menos el 30%.
Transistores, magni±2 kV para líneas de alimen- El aparato sigue funcioLa calidad de la tensión de red
tudes perturbadoras
tación de potencia
nando de forma correcta y
debe ser la de un típico ambiente
eléctricas transitorias / ±1 kV para líneas de entrada / segura.
comercial u hospitalario.
ráfagas IEC 61000-4-4 salida
Impulsos
±1 kV en tensión diferencial
El aparato sigue funcioLa calidad de la tensión de red
IEC 61000-4-5
nando de forma correcta y
debe ser la de un típico ambiente
±2 kV en tensión de modo
segura.
comercial u hospitalario.
común
Huecos de tensión,
breves interrupciones y variaciones de
tensión en las líneas de
alimentación de la red
IEC 61000-4-11
< 5% UT (> 95% hueco de UT)
por 0,5 ciclos
40% UT (60% hueco de UT)
por 5 ciclos
70% UT (30% hueco de UT)
por 25 ciclos
< 5% UT (> 95% hueco de UT)
por 5 s
Campo magnético
a la frecuencia de red
(50 / 60 Hz)
IEC 61000-4-8
3A/m
El dispositivo puede
variar respecto a los niveles
requeridos de inmunidad
durante el tiempo en que
permanezca guardado;
no se han detectado fallos
y se puede restaurar al
estado predeterminado con
la ayuda del operario.
El aparato sigue funcionando de forma correcta y
segura.
La calidad de la tensión de red
debe ser la de un típico ambiente
comercial u hospitalario.
Los campos magnéticos con frecuencia de red deben tener niveles
característicos en una localidad
típica en ambiente comercial
u hospitalario.
NOTA: UT es la tensión de red en corriente alterna antes de la aplicación del valor de prueba.
ES
- 23 -
ES
- 24 -
Guía y declaración del constructor – Inmunidad electromagnética
La unidad Translux Wave está destinada a su uso en el entorno electromagnético que se indica a continuación.
El cliente o usuario de Translux Wave debe garantizar su utilización en dicho entorno.
Prueba de
Valor de prueba Valor de
Ambiente electromagnético – Guía
inmunidad
IEC 60601
conformidad
AF conducida
3 Veff de
El aparato sigue Los aparatos de comunicación de alta frecuencia portátiles y móviles
IEC 61000-4-6 150 kHz
funcionando de no pueden usarse cerca de ninguna parte del producto, incluidos
a 80 MHz
forma correcta
los cables, excepto cuando respetan las distancias de separación
y segura.
recomendadas calculadas por la ecuación aplicable a la frecuencia
AF irradiada
3 V / m de
del transmisor.
IEC 61000-4-3 80 MHz
Distancias de separación recomendadas
a 2,5 GHz
d = 1,2 √P
d = 1,2 √P de 80 MHz a 800 MHz
d = 2,3 √P de 800 MHz a 2,5 GHz
donde (P) es la potencia máxima nominal de salida del transmisor en
Watt (W) según el constructor del transmisor y (d) es la distancia de
separación recomendada en metros (m). La intensidad del campo de
los transmisores de AF fijos, como determinado en una investigación
electromagnética del sitio a, puede ser menor del valor de
conformidad en cada uno de los intervalos de frecuencia (b).
Se pueden verificar interferencia en las proximidades
de aparatos identificados con el siguiente símbolo:
Notas:
(1) A 80 MHz y 800 MHz se aplica el intervalo de la frecuencia más alta.
(2) Estas líneas guía pueden no aplicarse en todas las situaciones. La propagación electromagnética se ve afectada por la
absorción y por la reflexión de estructuras, objetos y personas.
a) Las intensidades de campo para transmisores fijos como las estaciones de base para radioteléfonos (celulares e
inalámbricos) y radiomóviles terrestres, aparatos de radioaficionados, transmisores de radio en AM y FM y transmisores
de TV no pueden preverse teóricamente y con precisión. Para establecer un ambiente electromagnético causado
por transmisores RF fijos, se debe considerar una investigación electromagnética del sitio. Si la intensidad de campo
medida en el lugar en que se usa un Translux Wave, supera el nivel de conformidad aplicable citado, se debe poner bajo
observación el funcionamiento normal de Translux Wave. Si se notan prestaciones anormales, pueden ser necesarias
medidas adicionales como una orientación o posición diferente de Translux Wave.
b) La intensidad de campo en un intervalo de frecuencias de 150 kHz a 80 MHz dobe ser menor de 3 V / m.
Distancias de separación recomendadas entre aparatos de radiocomunicación portátiles y móviles y el Translux Wave
La Translux Wave ha sido prevista para funcionar en un ambiente electromagnético en el que las interferencias debidas a
las emisiones de alta frecuencia estén bajo control. El cliente o el operador de la Translux Wave pueden contribuir a prevenir
interferencias electromagnéticas garantizando una distancia mínima entre los aparatos de comunicación móviles y portátiles
de RF (transmisores) y el Translux Wave, como se recomienda a continuación, en lo referente a la potencia de salida máxima
de los aparatos de radio comunicación.
Distancia de protección a la frecuencia del transmisor (m)
Potencia de salida nominal
máxima del transmisor (W)
de 150 kHz a 80 MHz
de 80 MHz a 800 MHz
de 800 MHz a 2,5 GHz
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
Para los transmisores con potencia nominal máxima de salida arriba no indicada, la distancia de separación recomendada
(d) en metros (m) puede calcularse usando la ecuación aplicable a la frecuencia del transmisor, donde (P) es la potencia
máxima nominal de salida del transmisor en Watt (W) según el constructor del transmisor.
Notas:
(1) A 80 MHz e 800 MHz se aplica el intervalo de la frecuencia más alta.
(2) Estas líneas guía pueden no aplicarse en todas las situaciones. La propagación electromagnética es afectada por la
absorción y por la reflexión de estructuras, objetos y personas.
12.2
Etiqueta identificativa de la unidad de carga
Descripción de los símbolos en la etiqueta identificativa
1 Marca CE.
2 Precaución, consulte los documentos adjuntos.
3 Consulte las instrucciones de uso.
4 Doble aislamiento (el dispositivo cumple con las normativas
de seguridad de la clase II).
5 Eliminación de equipos eléctricos y electrónicos.
(Aplicable en la Comunidad Europea y en otros países
europeos con sistemas de recogida independientes).
6 Marca MET.
12.3 Númerodeseriedelapiezademano
El número de serie de la pieza de mano
está gravado en la parte inferior de la cubierta.
Número de
serie gravado.
13
1
2
3
4
5
6
Garantía
Todo aparato de Heraeus Kulzer se somete a un estricto examen y control final antes de ser entregado para garantizar
un funcionamiento perfecto. Heraeus Kulzer otorga una garantía de 2 dos años a los distribuidores o importadores
de sus productos a partir de la fecha de compra contra posibles defectos de material y de fabricación. Heraeus Kulzer
se compromete a reparar sin coste alguno las piezas que considere defectuosas dentro del período de garantía
(o sustituirlas si lo considera oportuno). No está prevista la restitución completa de los productos de Heraeus Kulzer.
HeraeusKulzernoseresponsabilizaenningúncaso,yaseadirectaoindirectamente,delosposiblesdaños
causados a personas o materiales en los siguientes casos:
• Elaparatonosehautilizadoparasufinprevisto.
• Elaparatonosehautilizadosegúnlasinstruccionesyprescripcionesdescritasenestemanual.
• Lainstalacióneléctricadeloslocalesenlosqueseutilizaráelaparatonocumplelanormativavigenteysus
prescripciones.
• Elmontaje,laampliación,losajustes,lasmodificacionesoreparacionesnohansidorealizadosporelpersonal
técnico de Heraeus Kulzer.
• Lascondicionesdelespacioparaconservaryguardarelaparatonocumplenlasdisposicionesrelacionadas
en el apartado 12 (Especificaciones técnicas).
Están excluidos de la garantía los daños causados por el transporte, por un uso indebido o por negligencia, los daños
causados por la conexión a una tensión de red diferente a la prevista, así como las luces de control, el pulsador
y todos los accesorios. La garantía se extingue si el aparato es reparado o modificado por otras personas que no sean
las del servicio posventa. Para beneficiarse de la garantía, el cliente se hará cargo de los gastos de envío del aparato
dañado al distribuidor o al importador de Heraeus Kulzer a quien compró el aparato. El aparato, incluidos los accesorios,
deberá entregarse correctamente empaquetado (si es posible, con el embalaje original).
Si se devuelve la unidad, se debe adjuntar a ella una tarjeta con la siguiente información:
a) Nombre y apellidos, dirección y número de teléfono del propietario.
b) Nombre y dirección del distribuidor / importador.
c) Fotocopia del albarán de entrega / factura del aparato, en el cual deberán constar, además de la fecha,
la denominación del aparato y el número de serie.
d) Descripción de la avería.
No hay ninguna responsabilidad por los daños de transporte y envío.
En caso de daños causados por un uso indebido o por accidentes, o que se producen una vez finalizado el período
de garantía, se facturarán los costes de la reparación, el material y la mano de obra.
ES
- 25 -
14
Servicio
14.1
Socios de servicio / Personas de contacto en los diferentes países
15
Historial de la documentación
1x
2012-08 Versión provisional para prototipos.
2013-09 Primera edición.
2014-03 Cambios en la edición del apartado 2.1, 3.2.1, 7.2, 10, 11, 12 y 12.2.
ES
- 26 -
Sujeto a modificaciones.
Revisión: 2014-03
Indice
1
1.1
1.2
1.3
Applicazione _____________________________________________________________________
In generale ____________________________________________________________________
Dichiarazione di conformità CE ______________________________________________________
Dichiarazione del produttore _________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Istruzioni per l’uso sicuro dell’unità ___________________________________________________
Spiegazione dei simboli e del testo ___________________________________________________
Danni durante il trasporto – Apertura della confezione e ispezione _____________________________
Obblighi del proprietario ___________________________________________________________
Registro dello strumento ___________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Uso previsto ______________________________________________________________________
Descrizione del dispositivo _________________________________________________________
Requisiti di sicurezza _____________________________________________________________
Istruzioni di sicurezza generali sul funzionamento dell’unità _________________________________
Avvertenze per la sicurezza ________________________________________________________
BATTERIA – Avvertenze per la sicurezza _______________________________________________
BATTERIA – Informazioni __________________________________________________________
FORNITURA ____________________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Descrizione dell’unità ______________________________________________________________ 8
Contenuti forniti _________________________________________________________________
8
Descrizione degli elementi di controllo e di funzionamento __________________________________
8
Manipolo ______________________________________________________________________
8
Chiave di allineamento ____________________________________________________________
8
Unità di carica __________________________________________________________________
8
Segnali acustici del manipolo _______________________________________________________
9
Informazioni sul LED relativamente alla radiazione emessa _________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installazione e avvio iniziale _________________________________________________________
Requisiti di sicurezza durante l’installazione ____________________________________________
Connessione dell’unità di carica alla presa di alimentazione _________________________________
Inserimento della batteria nel manipolo ________________________________________________
Inserimento della fibra ottica nel manipolo _____________________________________________
Carica della batteria ______________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Funzionamento ___________________________________________________________________
Attivazione e disattivazione del ciclo di esposizione _______________________________________
Misurazione dell’intensità luminosa __________________________________________________
Modalità riposo _________________________________________________________________
Ulteriori informazioni sul funzionamento dell’unità ________________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Condizioni di allarme _______________________________________________________________
Batteria difettosa ________________________________________________________________
LED difettoso ___________________________________________________________________
Protezione da surriscaldamento _____________________________________________________
Sensore di surriscaldamento INTEGRATO difettoso ________________________________________
Segnale di batteria bassa __________________________________________________________
15
15
15
15
15
15
NOTA
Utilizzare l‘icona del documento per trovare le immagini
dei capitoli o ulteriori informazioni sulla copertina ripiegata.
1x /2x
Aprire la
copertina
anteriore
HKG-Layout 99000943_01 GBA
Aprire la
copertina
posteriore
05IT
Translux Wave EU
Dateiname: 05IT_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
IT
-1-
IT
-2-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Pulizia, disinfezione e sterilizzazione __________________________________________________
Disassemblaggio ________________________________________________________________
GUIDA DI LUCE – Pulizia e disinfezione ________________________________________________
GUIDA DI LUCE – Ispezione prima della sterilizzazione _____________________________________
CONO PROTETTIVO – Pulizia e disinfezione _____________________________________________
CONO PROTETTIVO – Ispezione prima della sterilizzazione __________________________________
GUIDA DI LUCE e CONO PROTETTIVO – Confezione prima della sterilizzazione ____________________
GUIDA DI LUCE e CONO PROTETTIVO – Sterilizzazione _____________________________________
Metodo di sterilizzazione __________________________________________________________
Parametri di sterilizzazione _________________________________________________________
MANIPOLO – Pulizia e disinfezione ___________________________________________________
UNITÀ DI CARICA – Pulizia del corpo __________________________________________________
UNITÀ DI CARICA – Pulizia dei contatti di carica __________________________________________
UNITÀ DI CARICA – Contatti di carica sostituibili __________________________________________
9
Conservazione ____________________________________________________________________ 19
10
Smaltimento _____________________________________________________________________ 19
11
Risoluzione dei problemi ____________________________________________________________ 20
12
12.1
12.2
12.3
Specifiche tecniche ________________________________________________________________
Compatibilità elettromagnetica EN 60601-1-2 ___________________________________________
Targhetta identificativa dell’unità di carica ______________________________________________
Numero di serie del manipolo _______________________________________________________
13
Garanzia ________________________________________________________________________ 25
14
14.1
Servizio Assistenza ________________________________________________________________ 26
Partner di assistenza / Partner di assistenza nei rispettivi paesi ______________________________ 26
15
Cronologia dei documenti ___________________________________________________________ 26
NOTA
Utilizzare l‘icona del documento per trovare le immagini
dei capitoli o ulteriori informazioni sulla copertina ripiegata.
16
16
16
16
16
17
17
17
17
17
17
18
18
19
22
23
25
25
1x /2x
Aprire la
copertina
anteriore
Aprire la
copertina
posteriore
1
Applicazione
1.1
In generale
Translux Wave è un marchio registrato di Heraeus Kulzer GmbH.
Le presenti istruzioni per l’uso sono valide per:
N. Ordine
66055012
Tipo e dotazione
Translux Wave – Unità LED per la fotopolimerizzazione
Edizione
2014-03 / 99000943/01
1.2
Dichiarazione di conformità CE
Con la presente la ditta Heraeus Kulzer GmbH, Grüner Weg11, 63450 Hanau, dichiara che l’apparecchio di seguito
descritto, in base alla sua concezione ed al suo sistema di costruzione, nonché al modello da noi commercializzato,
è stato realizzato in conformità ai relativi requisiti inerenti la salute e la sicurezza definiti nella direttiva CE.
Nel caso in cui vengano apportate all’apparecchio modifiche non concordate con noi, la suddetta dichiarazione perde
la sua validità.
1.3
Dichiarazione del produttore
Con la presente si conferma che l’unità Translux Wave è conforme alla Direttiva 93/42 EC e agli standard
IEC 60601-1 e IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Germania).
2
Istruzioni per l’uso sicuro dell’unità
Leggere attentamente il presente manuale e attenersi alle sue istruzioni. Le parole ATTENZIONE, AVVERTENZA
e NOTA sono importanti e devono essere lette con attenzione (vedere il paragrafo seguente). Tenere sempre questo
manuale a portata di mano.
2.1
Spiegazione dei simboli e del testo
Simboli
Testo
Spiegazione
ATTENZIONE
Implica che potrebbe verificarsi la morte o gravi lesioni se il consiglio non
viene seguito.
AVVERTENZA
Implica che potrebbero verificarsi lesioni lievi o danni al dispositivo se il
consiglio non viene seguito.
NOTA
Implica un consiglio non è legato a danni materiali o fisici.
PERICOLO
DI ESPLOSIONE
PERICOLO di esplosione: attenersi alle informazioni e alle avvertenze
contenute nei capitoli e nelle sezioni indicati con questo simbolo.
SCOLLEGARE DALLA
RETE ELETTRICA
ATTENZIONE pericolo di scossa elettrica.
Prima di eseguire le procedure di pulizia e disinfezione scollegare la base
di carica dalla presa di alimentazione elettrica!
Marchio MET – UL / CSA conformity.
MET
WEEE / ElektroG
Smaltimento delle vecchie apparecchiature in accordo con WEEE
(Direttiva Europea) o Apparecchiature Elettriche o Elettroniche Act
(German Law ElektroG).
Classe di sicurezza:
Tipo B in conformità agli standard IEC 60601-1.
Doppio isolamento:
Dispositivo di Classe II.
Alimentazione:
Corrente alternata.
Alimentazione diretta.
Il punto di polarità dell’alimentatore tipo switiching è al centro.
IT
-3-
Simboli
Testo
Spiegazione
Utilizzare solo in ambienti chiusi.
Dispositivo prodotto in conformità alla Direttiva 93/42/EC compresi gli
standard IEC 60601-1 e IEC 60601-1-2.
Simbolo di ATTENZIONE “Radiazione LED”.
Attenersi alle informazioni e alle indicazioni di pericolo indicate nel
paragrafo 4.2.5.
Consultare le istruzioni per l’uso.
AVVERTENZA, consultare i documenti di accompagnamento.
Interruttore di accensione/spegnimento:
“Avvio / Arresto”.
Certificato di registrazione in base al Ministero della salute della
Federazione Russa.
Tenere lontano dalla pioggia.
Limite di temperatura per la conservazione: da –20°C (–4°F) a 40°C (104°F).
IT
Limite di umidità per la conservazione: umidità relativa da 45% a 85%.
-4-
Limite di pressione atmosferica per la conservazione: 500 – 1060 hPa.
2.2
Danni durante il trasporto – Apertura della confezione e ispezione
L’imballo dell’apparecchio è sensibile agli urti, in quanto contiene dispositivi / componenti elettronici. Pertanto sia
il trasporto che lo stoccaggio devono essere effettuati con particolare cautela. La merce spedita dalla ditta Heraeus
Kulzer viene controllata accuratamente prima della spedizione. L’apparecchio viene fornito imballato e protetto in modo
appropriato.
Al ricevimento della merce verificare che l’apparecchio non abbia subito danni durante il trasporto. In caso si riscontrassero danni, darne comunicazione al trasportatore entro max 24 ore dall’avvenuta consegna. In nessuna circostanza,
installare o lavorare con unità / accessori danneggiati.
2.3
Obblighi del proprietario
Oltre alle prescrizioni di legge, il proprietario ha il dovere di rispettare e di applicare sul posto di lavoro le direttive
di legge, quali ad esempio l’obbligo di addestramento del personale, la legge relativa alla tutela del lavoro nonché tutte
le ulteriori normative e prescrizioni vigenti.
Per i lavori da eseguire con e sull’apparecchio il proprietario deve predisporre, sulla scorta delle istruzioni per l’uso ed in
base alle operazioni da effettuare, apposite istruzioni scritte redatte in forma comprensibile e nella lingua dell’operatore.
2.4
Registro dello strumento
Si consiglia di tenere un “registro dello strumento” in cui documentare tutti i test e i principali interventi eseguiti sullo
strumento (ad esempio, manutenzione, modifiche).
3
Uso previsto
Translux Wave è una lampada LED per la fotopolimerizzazione di materiali fotoindurenti nella cavità orale come adesivi
e materiali di otturazione attivati nell’intervallo di lunghezza d’onda compreso tra 440 e 480 nm.
NOTA
Sebbene la maggior parte dei materiali fotoindurenti sia attivata entro questo intervallo di lunghezza d’onda,
in caso di dubbio, controllare le specifiche o rivolgersi al produttore.
ATTENZIONE - Personale qualificato.
L’unità deve essere azionata solo da personale specializzato e formato e dal dentista (vedere il paragrafo 2.3
Obblighi del proprietario). Se l’unità è usata correttamente non causerà effetti collaterali.
3.1
Descrizione del dispositivo
La Translux Wave utilizza una sorgente luminosa costituita da un efficiente diodo LED mono-cromatico con una
lunghezza d‘onda compresa tra 440 e 480 nm.
La luce emessa da Translux Wave è utilizzata per l’attivazione del fotoiniziatore a base di canforochinone. Ciò consente
di ottenere risultati di polimerizzazione straordinari con una emissione di calore inferiore.
Translux Wave è fornito con una guida di luce dotata di rotazione a 360° con un diametro di 8 mm.
Translux Wave è composto da una unità di carica e da un manipolo alimentato mediante una batteria a ioni di litio
ricaricabile rimovibile.
Il manipolo è dotato di una “Modalità riposo” che permette di ridurre il consumo di energia dell’unità.
Il manipolo passa alla “Modalità riposo” se non viene usato per un periodo di circa 5 minuti.
Translux Wave opera con due cicli di esposizione diverse:
• Esposizione con potenza costante: durata del ciclo 10 secondi.
• Esposizione con potenza ad incremento lento: “Avvio lento” (durata del ciclo 20 secondi).
L’icona “Avvio lento” indica un incremento dell’intensità luminosa da 50% a 100% in 2 secondi.
NOTA – Attenersi ai tempi di esposizione dei materiali indicati dal produttore.
Per i materiali che presentano tempi di esposizione specifici (ad esempio, 30 / 40 per compositi scuri),
occorre eseguire l’esposizione a più riprese.
3.2
Requisiti di sicurezza
Le avvertenze sulla sicurezza relative alla protezione delle persone, al contatto con l’apparecchiatura e con
il materiale da trattare sono sostanzialmente subordinate al comportamento del personale addetto all’utilizzo
dell’apparecchiatura stessa.
ATTENZIONE
Prima della messa in funzione, leggere attentamente le presenti istruzioni per l’uso ed attenersi alle
indicazioni in esse riportate, in modo da evitare errori e conseguenti danni, in particolar modo danni alla salute.
Per l’installazione e l’esercizio dell’apparecchio attenersi alle indicazioni riportate nelle presenti istruzioni per
l’uso, nonché alle leggi, prescrizioni e direttive nazionali in vigore.
3.2.1
Istruzioni di sicurezza generali sul funzionamento dell’unità
ATTENZIONE – USO PREVISTO
Usare l’unità esclusivamente per l’uso previsto (vedere il paragrafo 3 Uso previsto). Qualunque altro uso
è fortemente controindicato. La mancata osservanza di questa prescrizione può provocare lesioni gravi
ai pazienti o agli operatori dell’unità nonché danni o guasti all’unità stessa. Heraeus Kulzer non risponde
di eventuali danni causati dalla mancata osservanza della suddetta prescrizione.
ATTENZIONE
L’utente ha la responsabilità di testare il Translux Wave per verificarne l’uso e se adatto all’uso previsto.
Non indirizzare mai il raggio di luce verso gli occhi. Evitare sempre di esporre gli occhi alla luce diretta
o indiretta indossando occhiali protettivi che filtrano i raggi blu. Quando si esegue la fotopolimerizzazione,
posizionare la punta della guida di luce direttamente sul materiale che deve essere fotopolimerizzato ed evitare
esposizioni sui tessuti molli. Occhi, gengive, tessuto molle e altre parti del corpo non devono essere esposti alla
luce blu (se necessario, queste parti devono essere coperte con una protezione). Utilizzare una diga di gomma
per proteggere i tessuti molli, cioè la gengiva durante il trattamento. L’esposizione deve essere circoscritta
all’area della cavità orale nella quale si esegue il trattamento clinico.
ATTENZIONE – CONTROINDICAZIONI
Non usare Translux Wave su pazienti portatori di stimolatori cardiaci (pacemaker) o altri dispositivi elettronici
impiantabili. Questa prescrizione vale anche per l’operatore.
L’unità non deve essere usata da bambini, non vedenti o non udenti e non da / su persone prone a possibili
attacchi epilettici. Le persone sopra citate potrebbero non riconoscere i rischi legati all’uso e al funzionamento
dell’unità. Per ragioni di sicurezza è proibito l’uso e il funzionamento del dispositivo da parte di un operatore
e su pazienti con rischio potenziale di attacchi epilettici.
ATTENZIONE
Non sono consentite modifiche sull’apparecchiatura.
IT
-5-
Il proprietario / l’utente deve assicurarsi che:
– L’unità non sia usata su pazienti con anamnesi positiva alla fototerapia, ad esempio in caso di orticaria
solare e/o porfiria, e su pazienti che sono stati sottoposti a trattamento con farmaci fotosensibilizzanti.
– L’unità non sia usata su pazienti che sono stati sottoposti a interventi chirurgici per la cataratta e che sono
pertanto sensibili alla luce (a meno che non vengano usate misure di protezione adeguate, come occhiali
protettivi/lenti che filtrino la luce blu).
– I pazienti la cui anamnesi indica un’affezione della retina abbiano l’autorizzazione dell’oculista per poter
essere sottoposti al trattamento con Translux Wave.
– In tutti i casi di rischio potenziale deve essere consultato un medico specialista.
ATTENZIONE – Temperatura delle parti applicate
Max. temperature delle parti applicate (puntale e cono antiriflesso): 41°C (106°F).
Max. temperature delle parti considerate applicate (cono in metallo) nel caso vada a contatto con il paziente:
46°C (115°F).
Heraeus Kulzer dichiara che se il dispositivo viene utilizzato in conformità alle istruzioni contenute in questo
manuale, non ci saranno surriscaldamenti dei tessuti.
ATTENZIONE – Controllo delle infezioni.
La guida di luce e il cono protettivo devono essere puliti, disinfettati e sterilizzati (a vapore) prima di ogni uso.
La guida di luce e il cono protettivo sono forniti in condizione NON STERILE e devono essere sterilizzati prima
del primo utilizzo. Vedere il paragrafo 8.4.1.2 Parametri di sterilizzazione.
3.2.2
IT
-6-
Avvertenze per la sicurezza
ATTENZIONE – PERICOLO DI ESPLOSIONE
Non installare il dispositivo in locali soggetti a pericolo di esplosione. Il dispositivo non deve essere
usato in presenza di atmosfera infiammabile (miscele di anestetici, ossigeno, ossido di azoto, ecc.).
Usare il dispositivo in un’area ben ventilata.
ATTENZIONE
Prima di usare l’unità, controllare che il cavo di alimentazione e la presa non presentino eventuali danni.
Se danneggiati, non collegare l’unità all’alimentazione.
Usare esclusivamente ricambi o accessori Heraeus Kulzer GmbH. Heraeus Kulzer fornisce una guida di luce
adatta per l’uso con Translux Wave. Non devono essere usate altre guide di luce. Heraeus Kulzer GmbH non
accetta alcuna responsabilità per danni causati dall’uso di ricambi o accessori non originali Heraeus Kulzer.
3.2.3 BATTERIA – Avvertenze per la sicurezza
Heraeus Kulzer GmbH non si assume alcuna responsabilità per problemi relativi alla batteria quando non ci si attiene
scrupolosamente alle Avvertenze per la sicurezza elencate nel paragrafo seguente.
ATTENZIONE
L’uso improprio della batteria potrebbe causare calore, rottura o prendere fuoco e provocare lesioni gravi.
Attenersi scrupolosamente alla regole per la sicurezza elencate nel paragrafo seguente.
Usare esclusivamente batterie originali Heraeus Kulzer!
L’uso di batterie non originali Heraeus Kulzer o di batterie non ricaricabili e/o batterie primarie rappresenta
un rischio potenziale e può danneggiare il dispositivo.
Conservare la batteria fuori dalla portata dei bambini!
Non aprire, perforare o schiacciare la batteria in quanto contiene sostanze velenose.
Se la batteria presenta corrosione, emana un odore insolito o perde liquidi, rimuovere immediatamente
la batteria dal manipolo.
Non esporre la batteria ad acqua o acqua salata o bagnare la batteria. Non conservare la batteria in presenza
di umidità elevata o in un luogo in cui la batteria possa essere esposta alla pioggia.
Nel caso in cui la batteria perda liquidi e il liquido entri nell’occhio, non sfregare l’occhio. Lavare bene con
acqua e rivolgersi immediatamente a un medico. Se non trattato il liquido della batteria potrebbe causare
lesioni all’occhio.
ATTENZIONE – PERICOLO DI ESPLOSIONE
Per caricare la batteria del manipolo, usare esclusivamente l’unità di carica Translux Wave e il cavo di
alimentazione forniti con l’unità. Non cercare mai di caricare la batteria Translux Wave usando un’altra unità di
carica. L’uso di un’altra unità di carica potrebbe provocare danni alla batteria, rischio di esplosione e incendio!
Non usare mai l’unità di carica Translux Wave per ricaricare batterie di altro tipo o di altre unità dotate
di batteria ricaricabile. Usare esclusivamente batterie originali Heraeus Kulzer.
Non perforare la batteria con oggetti taglienti, colpire la batteria con un martello/strumento, salire sulla batteria
o sottoporre la batteria a impatti o shock forti.
Non posizionare la batteria sul fuoco o vicino a fonti di calore. Non cortocircuitare i contatti di carica della
batteria con oggetti metallici in quanto potrebbero causare ustioni, incendio ed esplosione. Non trasportare
o conservare mai la batteria con bracciali, pinze per i capelli o altri oggetti in metallo.
ATTENZIONE – Non disassemblare o modificare la batteria!
I meccanismi di sicurezza sono incorporati nella batteria che, se danneggiati, potrebbero generare calore,
rottura, esplosione o prendere fuoco.
ATTENZIONE – Non mettere la batteria sopra o nelle vicinanze di fiamme o altri luoghi
a temperatura elevata.
Non mettere la batteria sotto la luce solare diretta. In caso contrario, la batteria potrebbe generare calore,
rottura o prendere fuoco. Potrebbe inoltre causare la perdita delle prestazioni e ridurne la vita utile.
ATTENZIONE – In caso di incendio, NON GETTARE ACQUA SU UNA BATTERIA CHE BRUCIA!
Deve essere usato un estintore di classe C (in base alla regolamentazione europea EN 3).
ATTENZIONE – Smaltimento di una batteria danneggiata o esaurita.
Smaltire una batteria danneggiata o esaurita dopo aver preso le dovute precauzioni per evitare corto
circuito esterno e attenersi alla seguente procedura:
Dopo aver isolato i terminali della batteria con nastro isolante, smaltirla in base a quanto indicato dalla legge
o dalle regolamentazioni municipali.
3.2.4 BATTERIA – Informazioni
• Tempodicaricadiunabatteriavuotaonuova:circa3ore.
NOTA – Batteria NUOVA: prima carica
Per la prima carica, questo processo dura circa 3 ore. Le batterie nuove o conservate per un lungo periodo
di tempo potrebbero richiedere un tempo di carica più lungo. La batteria raggiungerà la sua capacità piena
dopo alcuni cicli di cariche/scariche complete.
NOTA
Posizionare il manipolo nell’unità di carica dopo ogni trattamento o quando non utilizzato.
• Condizionidifunzionamento:
Temperatura di funzionamento: da 10°C (50°F) fino a 35°C (95°F).
Umidità relativa: umidità relativa da 45% a 85%.
Pressione atmosferica: da 800 hPa a 1060 hPa.
AVVERTENZA
Gli intervalli di temperatura e di umidità relativa in base ai quali la batteria può essere caricata vanno da
10°C (50°F) a 35°C (95°F) e umidità relativa da 45% a 85%. Se la batteria viene caricata a temperature
che non rientrano in questo intervallo la batteria potrebbe scaldarsi o danneggiarsi. E danneggiare inoltre
le prestazioni della batteria o ridurne la vita utile.
• Condizioniditrasportoeconservazionedellabatteria:
Intervalli di temperatura e umidità relativa raccomandati:
da –20°C (–4°F) a 40°C (104°F) e umidità relativa da 45% a 85%.
Conservare la batteria sempre carica e per non più di 5 mesi.
Pressione dell’aria ambiente: da 500 hPa a 1060 hPa.
NOTA
Caricare sempre completamente la batteria prima di un periodo di inattività prolungato del dispositivo
o almeno ogni 5 mesi.
In caso di prolungato periodo di inattività rimuovere la batteria dal manipolo.
• Caratteristichetipichedellabatteria:
La batteria Translux Wave ha di solito una vita utile di 300 – 400 cicli di carica in base all’applicazione e alle
condizioni ambientali nelle quali è usata.
NOTA
La batteria è un prodotto chimico che usa una reazione chimica, quindi le prestazioni deterioreranno non
solo attraverso l’uso ma anche con il passare del tempo, anche se inutilizzata.
IT
-7-
3.2.5 FORNITURA
Eventuali interventi sull’equipaggiamento elettronico dell’apparecchio devono essere eseguiti soltanto da
Heraeus Kulzer, partner per l’assistenza Heraeus Kulzer o da personale tecnico addestrato ed in condizioni sicure
(assenza di tensione).
Devono essere utilizzati soltanto ricambi originali ed accessori omologati.
L’utilizzo di componenti di altro tipo comporta rischi non noti ed è in ogni caso da evitare.
La funzionalità e la sicurezza dell’apparecchio sono garantite soltanto se i necessari controlli, interventi di manutenzione e riparazione vengono eseguiti da Heraeus-Kulzer, partner per l’assistenza Heraeus oppure da personale tecnico
addestrato.
Heraeus Kulzer GmbH non risponde di eventuali danni riconducibili ad un difetto / un malfunzionamento
dell’apparecchio dovuti a una messa in funzione inappropriata non eseguita da punti assistenza Heraeus Kulzer oppure
da personale non da noi istruito oppure nel caso di sostituzione di componenti per i quali non sono stati impiegati pezzi
di ricambio o accessori originali.
4
Descrizione dell’unità
Contenuti forniti
1x
1 Unità di carica
2 Manipolo
3 Guida di luce, Ø = 8 mm
4 Cono protettivo
5 Confezione batteria a ioni di litio ricaricabile
6 Presa di alimentazione universale (100 V – 240 V (
)) compresi gli adattatori internazionali:
6a = Europa
tipo 1
6b = Regno Unito
tipo 2
6c = USA / Giappone tipo 3
4.2
Descrizione degli elementi di controllo e di funzionamento
2x
4.2.1 Manipolo
1 Pulsante “Avvio / Arresto”
2 LED delle modalità di fotopolimerizzazione (VERDE)
3 LED stato della batteria (2 colori: GIALLO / VERDE)
4 Contatti dell’unità di carica
5 Chiave di allineamento
4.2.2 Chiave di allineamento
2x
La chiave di allineamento (5), posizionata nella parte posteriore inferiore del corpo del manipolo,
permette l’inserimento del manipolo nel supporto dell’unità di carica.
Quando il manipolo viene inserito nell’unità di carica, la chiave di allineamento deve essere allineata
con la slot guida posizionata dell’unità di carica.
Un beep conferma che i contatti sono nella posizione di carica corretta!
4.1
IT
-8-
4.2.3
Unità di carica
1x
Elementi della parte superiore
1 Copertura dell’unità di carica
7 Supporto del manipolo con chiave di allineamento e contatti dell’unità di carica sostituibili
8 Sensore dell’intensità luminosa
9
– LED di colore VERDE
Funzione: indica che l’unità di carica è accesa.
10
– LED a due colori (VERDE / GIALLO)
Funzione: informazioni sull’intensità luminosa.
VERDE: indica che l’intensità luminosa, misurata tramite il misuratore di luminosità integrato
è adatto per il trattamento efficace.
GIALLO: indica che l’intensità luminosa non è sufficiente.
Vista dal basso dell’unità di carica
11 Presa di alimentazione
12 Inserto dei contatti di carica sostituibili
2x
4.2.4
Segnali acustici del manipolo
Funzione /
Condizione di errore
PROGRAMMA DI FOTOPOLIMERIZZAZIONE:
10 secondi.
Funzionamento dei pulsanti del manipolo
PROGRAMMA
“AVVIO LENTO”:
20 secondi.
• Premerebrevementeilpulsante
“AVVIO / ARRESTO”
per almeno un
secondo per avviare
l’esposizione.
INTERRUZIONE DEL
CICLO DI ESPOSIZIONE
• Iltempodiesposizionepuòessere
interrotto in qualsiasi momento
e indipendentemente dal programma
in uso tramite il pulsante
.
“AVVIO / ARRESTO”
SEGNALE DI BATTERIA
BASSA
Il livello di carica residuo
della batteria è sufficiente per pochi cicli di
esposizione.
SEGNALE QUANDO LA
BATTERIA È SCARICA
Non possono essere
attivati altri cicli di
esposizione.
SEGNALE DI BATTERIA
DIFETTOSA
Sorgente luminosa
LED difettosa
CONDIZIONE DI
SURRISCALDAMENTO
Sensore di surriscaldamento INTEGRATO
difettoso
Circuito di carica del
manipolo difettoso
Nota: questa condizione
di errore viene rilevata
solo con il manipolo
posizionato nell’unità di
carica.
• Premerebrevementeilpulsante
“AVVIO / ARRESTO”
per avviare
l’esposizione.
Segnali acustici emessi
Indicazioni sul manipolo
• 1 beep quando si preme il pulsante “AVVIO /
ARRESTO”.
• 1 beep al termine del tempo di esposizione.
LED verde acceso per 10 secondi.
• 1 beep quando si preme il pulsante “AVVIO /
ARRESTO”.
• 1 beep dopo 1 secondo per la segnalazione
acustica dell’ attivazione della modalità
“Avvio lento”.
• 1 beep dopo 10 secondi di tempo
di esposizione.
• 1 beep al termine del tempo di esposizione.
LED verde acceso per 20 secondi.
• 1 beep quando si preme il pulsante “AVVIO /
ARRESTO”.
• 2 beep al termine del ciclo di esposizione.
• L’iconadellabatterialampeggiainverde.
Posizionare il manipolo nella base di ricarica
per la ricarica!
• 2 beep senza attivazione del ciclo
di esposizione.
• L’iconadellabatterialampeggiainverde.
Posizionare il manipolo nella base di ricarica
per la ricarica!
Solo con il manipolo nell’unità
di carica.
• 1 beep ogni secondo per un periodo
di 30 secondi.
Il LED dello stato della batteria diventa GIALLO.
Non viene emesso alcun segnale acustico.
Il LED verde della ciclo di esposizione
lampeggia.
• 3 beep, e i dispositivi elettronici permettono
di terminare il ciclo di esposizione in uso.
• 4 beep all‘inizio di un ciclo di esposizione.
Due LED verdi (10 s / 20 s) lampeggianti sul
manipolo.
IT
-9-
4.2.5
Informazioni sul LED relativamente alla radiazione emessa
Il dispositivo utilizza LED ad alta luminosità Classe 2M (IEC 60825-1).
Radiazione LED.
Non osservare direttamente il fascio di luce né guardare
LED RADIATION
direttamente con strumenti ottici.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• ProdottoLEDdiclasse2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Max. Potenza: <5,00 mW.
• Lunghezza d’onda dominante:
min. 440 nm – max. 465 nm.
ATTENZIONE
Fasci divergenti
Non osservare la luce LED con strumenti ottici, quali monocoli, lenti di ingrandimento o microscopi da una
distanza inferiore a 100 mm, poiché ciò può provocare danni agli occhi.
Fasci collimati
Non osservare la luce LED con strumenti ottici per osservazione a distanza, quali telescopi o binocoli, poiché
ciò può provocare danni agli occhi.
In caso di guasto del circuito di comando del LED, l‘emissione di radiazione LED non può superare il valore nella
normale condizione di utilizzo delle apparecchiature mediche.
Etichette adesive come quella raffigurata sopra sono applicate sulla confezione dell‘apparecchio.
IT
- 10 -
5
Installazione e avvio iniziale
Le sezioni seguenti del presente paragrafo contengono informazioni e istruzioni alle quali attenersi per garantire
il funzionamento corretto e senza errori del dispositivo. Prima di usare il Translux Wave attenersi alle istruzioni nella
sequenza descritta di seguito.
Il dispositivo medico è in conformità con le norme di sicurezza solo se viene installato seguendo le istruzioni riportate
qui di seguito.
Il dispositivo deve essere installato in un luogo adatto e facilmente raggiungibile con la mano. Posizionare l’unità
di carica su una superficie solida, asciutta, piatta e orizzontale.
IMPORTANTE
Il manipolo è progettato per essere utilizzato all‘interno dell’area paziente, mentre il carica batterie
e l’ adattatore di alimentazione non devono essere utilizzati all‘interno dell’area paziente .
NOTA
L’area paziente è definita come un‘area di 1,5 m intorno al paziente (secondo IEC 60601-1 terza edizione
e IEC 60601-1-1).
ATTENZIONE
Prima dell’installazione ispezionare sempre l’unità e i suoi componenti per eventuali danni.
Se sono presenti danni, non procedere con l’installazione del dispositivo.
L’operatore non deve entrare simultaneamente in contatto con gli elementi al di fuori dell’area paziente
(unità di ricarica e adattatore di alimentazione) e il paziente.
Non collegare altri componenti esterni al dispositivo medico.
5.1
Requisiti di sicurezza durante l’installazione
ATTENZIONE
L’installazione elettrica del luogo in cui verrà installato e usato il dispositivo deve essere conforme alla
legislazione vigente e alle specifiche per la sicurezza rilevanti per il sistema di alimentazione.
Installare il dispositivo in un luogo in cui sarà protetto da colpi o schizzi accidentali di acqua o altri liquidi.
Non esporre il dispositivo alla luce diretta del sole, luce UV.
Non installare il dispositivo sopra o vicino a fonti di calore. Quando si esegue l’installazione, assicurarsi che
intorno al dispositivo sia presente una circolazione di aria adeguata. Non installare il dispositivo vicino a solventi
o liquidi infiammabili in quando potrebbero danneggiare la custodia in plastica del dispositivo.
La spina della alimentazione elettrica di commutazione (Direct Plug-In), modello PSAC05R-050, è considerata
il mezzo di isolamento delle attrezzature mediche dalla rete di alimentazione. Quando la spina è collegata,
l‘adattatore di alimentazione deve essere facilmente accessibile. Lasciare spazio sufficiente intorno ad essa.
L‘attrezzatura medica non deve essere posizionata in modo da rendere difficile operare sul dispositivo di
disconnessione (così sulla spina del Switching Power Supply).
Non cortocircuitare i contatti di carica della batteria con oggetti metallici in quanto potrebbero causare ustioni,
incendio ed esplosione.
Il dispositivo è trasportabile ma deve essere maneggiato con cura. Trasportare il dispositivo in una posizione
orizzontale. Non lasciare il dispositivo esposto a scossoni o vibrazioni. Per le dimensioni e il peso vedere
il paragrafo 12 (Specifiche tecniche).
ATTENZIONE – PERICOLO DI ESPLOSIONE
Non installare il dispositivo in luoghi a rischio di esplosioni. Il dispositivo non deve essere usato in presenza
di atmosfera infiammabile (miscele di anestetici, ossigeno, ossido di azoto, ecc.). Installare il dispositivo in
un’area ben ventilata.
5.2
Connessione dell’unità di carica alla presa di alimentazione
1x
Translux Wave è fornito con una presa di alimentazione universale separata (6) in grado di supportare
), 50 / 60 Hz.
da 100 a 240 V (
ATTENZIONE
Prima di collegare l’unità di carica (6) alla rete di alimentazione, controllare attentamente che la tensione
e la frequenza della rete corrisponda ai valori di potenza nominali indicati sulla targhetta del dispositivo.
La targhetta si trova nella parte inferiore dell’unità di carica.
Utilizzare solo l‘alimentatore switching che viene fornito con il dispositivo. L‘utilizzo di qualsiasi altro adattatore
di alimentazione può provocare danno della batteria.
Non collegare l‘alimentatore switching alla presa di corrente principale utilizzando una presa portatile multipla.
NOTA
L’unità di alimentazione Translux Wave (6) è fornita con tre adattatori ricaricabili:
tipo 1
Figura (6 a) = Europa
Figura (6 b) = Regno Unito
tipo 2
IT
Figura (6 c) = USA / Giappone tipo 3
1 Selezionare l’adattatore corretto tra quelli disponibili: Europa – Tipo 1, Regno Unito – Tipo 2,
- 11 USA / Giappone – Tipo 3.
2 Ciascun adattatore presenta una slot che si adatta alla linguetta di fissaggio dell’unità di alimentazione.
3 Con la slot rivolta verso l’unità di alimentazione, posizionare l’adattatore nell’unità di alimentazione in modo che
le fessure sull’adattatore siano allineate con le rispettive slot sull’unità di alimentazione.
4 Premendo sull’adattatore e sull’unità di alimentazione, far scorrere l’adattatore sull’unità di alimentazione fino
a farlo scattare in posizione e l’adattatore è bloccato in posizione.
NOTA
Premere l’adattatore durante l’installazione assicura che le fessure siano tenute in posizione dalle linguette
di fissaggio sull’unità di alimentazione. Se l’adattatore non è bloccato, rimuoverlo e installarlo nuovamente.
5 Per rimuovere l’adattatore dall’unità di alimentazione, premere il pulsante della linguetta di fissaggio (indicata dalla
parola “PUSH” – (PREMERE)), far scorrere l’adattatore fuori dall’unità di alimentazione e rimuovere l’adattatore.
6 Tenere gli adattatori non utilizzati per uso futuro.
7 Collegare la presa del cavo di alimentazione alla presa sotto l’unità di carica.
ATTENZIONE
Controllare regolarmente il cavo di alimentazione, l’unità di alimentazione e l’adattatore per assicurarsi che
siano in buone condizioni. Non usare parti danneggiate fino alla loro sostituzione. Usare esclusivamente
ricambi o accessori originali Heraeus Kulzer.
8 Collegare l’unità di alimentazione con l’adattatore nella presa di alimentazione a muro.
9 Il LED VERDE sull’unità di carica si illuminerà (icona
).
5.3
Inserimento della batteria nel manipolo
Translux Wave è fornito con una potente batteria a ioni di litio ricaricabile.
La batteria è fornita separatamente nella confezione del dispositivo e deve essere inserita nel manipolo prima
di iniziare ad usarlo.
ATTENZIONE
Attenersi scrupolosamente alle avvertenze per la sicurezza descritte nel paragrafo 3.2.3 (BATTERIA – Avvertenze
per la sicurezza).
AVVERTENZA
Non posizionare MAI il manipolo nell’unità di carica senza la batteria inserita nel manipolo.
Inserire la batteria nel manipolo nell’ordine descritto di seguito:
1 Rimuovere la batteria dalla confezione.
ATTENZIONE
Non cortocircuitare i terminali della batteria con oggetti metallici in quanto potrebbero causare ustioni,
incendio ed esplosione.
2 Con uno strumento piatto (ad esempio una moneta) svitare in senso antiorario il cappuccio
della batteria dal manipolo (Figura 1 e 2 ).
3 Una freccia è stampata sul corpo della batteria (Figura 3 ).
NOTA
La freccia indica la direzione nella quale la batteria deve essere inserita nel manipolo.
IT
- 12 -
2x
4 Far scorrere lentamente la batteria nel manipolo con la freccia rivolta verso l’alloggiamento fino a quando
si ferma (Figura 4 ).
NOTA
Se la batteria è inserita in senso contrario (cioè in direzione opposta alla freccia), il manipolo non
funzionerà. Se la batteria viene inserita in senso contrario non si causano danni ai dispositivi elettronici
del manipolo.
ATTENZIONE
Usare esclusivamente batterie originali Heraeus Kulzer. L’uso di batterie prodotte da altri o di batterie non
ricaricabili / batterie primarie rappresenta un pericolo potenziale e può causare danni irreversibili all’unità.
5 Con uno strumento piatto (ad esempio una moneta) avvitare in senso orario il cappuccio della batteria sul manipolo.
NOTA
L’unità non funzionerà correttamente se il cappuccio del manipolo non viene avvitato completamente.
5.4
Inserimento della fibra ottica nel manipolo
2x
• Ruotareleggermentelaguidadiluce(1) e inserirla nel manipolo (2) fino al raggiungimento dalla
posizione finale. La posizione finale è raggiunta quando si sente un “clic”.
• Montareilconoprotettivo(3)sull’estremitàsuperioredellaguidadiluce.
Posizionamento della guida di luce
• Ruotarelaguidadilucenellaposizionedesiderataperlafotopolimerizzazione.
• Per usare l’intensità luminosa nella sua completezza, posizionare la guida di luce il più vicino possibile al composito.
Evitare il contatto diretto con il materiale composito!
AVVERTENZA – Tenere la guida di luce sempre pulita per ottenere l’intensità luminosa completa.
L’intensità luminosa diminuisce in modo considerevole se:
– La guida di luce non è in condizioni perfette (graffiata o scheggiata).
– La guida di luce non è posizionata correttamente nel manipolo.
– La guida di luce è macchiata di composito.
ATTENZIONE
Una guida di luce danneggiata riduce l’intensità luminosa e deve essere sostituita immediatamente con
una guida nuova. I bordi taglienti possono causare lesioni gravi. Usare esclusivamente guide di luce originali
Heraeus Kulzer.
ATTENZIONE – Controllo delle infezioni:
Per rendere il trattamento il più sicuro possibile per i pazienti e per gli operatori, la guida di luce e il cono
protettivo devono essere puliti, disinfettatati e sterilizzati prima di ogni trattamento. Attenersi alle istruzioni
passo-passo elencate nel paragrafo 8 (Pulizia, disinfezione e sterilizzazione).
5.5
Carica della batteria
AVVERTENZA – Batteria NUOVA: prima carica
La batteria Translux Wave è stata caricata parzialmente in fabbrica.
La batteria deve quindi essere caricata completamente prima di usare Translux Wave per la prima volta.
NOTA – Batteria NUOVA: prima carica
Per la prima carica, questo processo dura circa 3 ore. Le batterie nuove o conservate per un lungo periodo
di tempo potrebbero richiedere un tempo di carica più lungo. La batteria raggiungerà la sua capacità piena
dopo alcuni cicli di cariche / scariche complete.
ATTENZIONE – PERICOLO DI ESPLOSIONE
Usare esclusivamente l’unità di carica, fornita con il Translux Wave, per caricare la batteria.
Non cercare mai di caricare la batteria usando un’altra unità di carica o presa di alimentazione elettrica,
per evitare rischi di esplosione e incendio.
Inserire il manipolo con la batteria nell’unità di carica Translux Wave.
2x
Un beep conferma che i contatti sono nella posizione di carica corretta!
NOTA IMPORTANTE – Chiave di allineamento
La chiave di allineamento (5), posizionata nella parte posteriore inferiore del corpo del manipolo,
permette l’inserimento del manipolo nel supporto dell’unità di carica. Quando il manipolo viene inserito
nell’unità di carica, la chiave di allineamento deve essere allineata con la slot guida posizionata all’interno
del supporto dell’unità di carica.
Procedura di carica della batteria.
• IlLEDverdedellostatodellabatteria,sulmanipolo,iniziaalampeggiare.
• Alterminedellafasedicarica,quandolabatteriaècompletamentecarica,ilLEDverdedellostatorimane
acceso fisso.
NOTA IMPORTANTE – Batteria difettosa
Se durante la fase di carica, i dispositivi elettronici del manipolo rilevano un malfunzionamento della
batteria, il processo di carica verrà interrotto e il LED dello stato della batteria lampeggerà GIALLO.
In questa condizione, viene emesso un segnale acustico (beep) ogni secondo per 30 secondi.
Sostituire la batteria difettosa con una batteria nuova!
ATTENZIONE
Usare esclusivamente batterie originali Heraeus Kulzer!
NOTA
Quando il manipolo viene posizionato sull’unità di carica, il manipolo è inattivo. Il pulsante “Avvio /
Arresto”
non funziona.
Il manipolo può essere rimosso dall’unità di carica durante la procedura di carica; la batteria, tuttavia,
potrebbe non essere completamente carica e potrebbe essere ridotta la durata operativa.
6
Funzionamento
ATTENZIONE – Controllare la condizione del dispositivo prima di iniziare il trattamento.
Prima di ogni trattamento, assicurarsi sempre che il dispositivo funzioni in modo corretto e che tutti gli
accessori (guida di luce e cono protettivo) sia efficienti. Se durante il trattamento si nota qualcosa di anomalo,
non eseguire il trattamento e rivolgersi a Heraeus Kulzer o all’agente del Servizio di assistenza locale autorizzato
(vedere paragrafo 14 Manutenzione). Non usare il dispositivo e gli accessori se appaiono danneggiati.
Prima di ogni uso del Translux Wave assicurarsi che l’intensità luminosa emessa sia sufficiente a garantire
la polimerizzazione. Controllare l’intensità luminosa usando il misuratore di luminosità integrato nell’unità
di carica (vedere il paragrafo 6.2 Misurazione dell’intensità luminosa).
ATTENZIONE – Controllo delle infezioni
Primo utilizzo
Gli accessori, la guida di luce e il cono protettivo sono forniti in condizione NON STERILE e devono essere
sterilizzati prima del primo utilizzo.
Ogni uso
Una volta usati, gli accessori, la guida di luce e il cono protettivo devono essere sottoposti alle procedure
descritte nel paragrafo 8 (Pulizia, disinfezione e sterilizzazione) prima di poterli usare nuovamente.
6.1
Attivazione e disattivazione del ciclo di esposizione
Translux Wave opera con due cicli di esposizione diverse:
– Esposizione con potenza costante: durata del ciclo 10 secondi.
– Esposizione con potenza ad incremento lento: “Avvio lento” (durata del ciclo 20 secondi).
L’icona “Avvio lento” indica un incremento dell’intensità luminosa da 50% a 100% in 2 secondi.
• Seilmanipoloèin“Modalità riposo” (tutti i LED delle cicli di esposizione sono SPENTI), premere brevemente il
pulsante “Avvio / Arresto”
per rendere operativo il manipolo.
(Dopo il riavvio, il LED della modalità “10 secondi” si accende come impostazione predefinita.)
IT
- 13 -
Fotopolimerizzazione 10 secondi
Premere brevemente il pulsante “Avvio / Arresto”
. L’emissione luminosa si accende.
Il LED della modalità da 10 secondi è acceso per indicare che il programma è in esecuzione.
Una volta completato il ciclo di esposizione, l’unità spegnerà automaticamente l’emissione luminosa.
Segnale acustico:
Vengono emessi i seguenti segnali acustici (beep):
1 beep quando si preme il pulsante “Avvio / Arresto”.
1 beep al termine del tempo di esposizione.
IT
- 14 -
Fotopolimerizzazione “Avvio lento” da 20 secondi
Tenere premuto per almeno un secondo il pulsante “Avvio / Arresto”
. L’emissione luminosa si accende.
Il LED della modalità da 20 secondi è acceso per indicare che il programma è in esecuzione.
Una volta completato il ciclo di esposizione, l’unità spegnerà automaticamente l’emissione luminosa e tornerà alla
modalità da 10 secondi (LED della modalità da 10 secondi è acceso).
Segnale acustico:
Vengono emessi i seguenti segnali acustici (beep):
1 beep quando si preme il pulsante “Avvio / Arresto”.
1 beep dopo 1 secondo per la segnalazione acustica dell’ attivazione della modalità “Avvio lento”.
1 beep dopo 10 secondi di tempo di esposizione.
1 beep al termine del tempo di esposizione.
NOTA
Il ciclo di esposizione può essere interrotto in qualsiasi momento, prima del termine del tempo di esposizione,
premendo nuovamente il pulsante “Avvio / Arresto”.
Segnale acustico:
Viene emesso un segnale acustico (beep), quando viene premuto il pulsante “Avvio / Arresto” per
interrompere il ciclo di esposizione.
6.2
Misurazione dell’intensità luminosa
L’unità di carica del Translux Wave è dotata di un misuratore di intensità luminosa integrato (8).
2x
AVVERTENZA
Prima di ogni trattamento controllare sempre l’intensità luminosa usando il misuratore
di intensità luminosa integrato nell’unità di carica del Translux Wave.
• Senzaapplicarepressione,posizionarelaguidadilucepiattaedirettamentesull’areadiverifica(8).
Attivare l’unità premendo il pulsante “Avvio / Arresto”
(indipendentemente dal tempo di esposizione selezionato).
La misurazione dell’intensità luminosa viene immediatamente indicata dal LED a due colori (simbolo
)
posizionato sulla parte inferiore destra dell’area di verifica.
LED VERDE: l’intensità luminosa è sufficiente per il trattamento.
LED GIALLO: l’intensità luminosa non è sufficiente e il paziente/i pazienti non possono essere trattati.
AVVERTENZA
Se l’intensità della luce è insufficiente, si prega di effettuare i seguenti controlli e misurazioni:
– La guida di luce non è stata inserita nel manipolo
(vedere il paragrafo 5.4 Inserimento della fibra ottica nel manipolo).
– Controllare che la guida di luce non presenti contaminazione o difetti.
– Pulire la guida di luce da ogni contaminazione (vedere il paragrafo 8 Pulizia, disinfezione e sterilizzazione)
o sostituire la guida di luce danneggiata con una guida nuova.
Usare esclusivamente guide di luce originali Heraeus Kulzer!
ATTENZIONE
Se le misurazioni descritte sopra non apportano miglioramenti, non usare il dispositivo per alcun trattamento. Spegnere l’unità (scollegare l’unità di carica dalla presa di alimentazione elettrica) e assicurarsi che
non sia possibile riattivare l’unità. Rivolgersi a un addetto alla manutenzione Heraeus Kulzer o a personale
formato tecnicamente da Heraeus Kulzer (vedere il paragrafo 14 Manutenzione).
6.3
Modalità riposo
Il manipolo è dotato di una “Modalità riposo” che permette di ridurre il consumo di energia dell’unità.
Quando il manipolo non è posizionato nell’unità di carica, tutte le funzioni interne del manipolo vengono
automaticamente spente (“Modalità riposo”) se non viene usato per un periodo di circa 5 minuti.
In “Modalità riposo” i LED delle modalità di fotopolimerizzazione sul manipolo sono spenti.
Per terminare la “Modalità riposo” premere il pulsante “Avvio / Arresto”
.
Il manipolo è pronto per essere usato.
6.4
Ulteriori informazioni sul funzionamento dell’unità
NOTA
Se il manipolo è posizionato nell’unità di carica prima del termine del ciclo di fotopolimerizzazione, l’emissione
luminosa si spegne automaticamente.
Quando il manipolo viene posizionato sull’unità di carica, il manipolo è inattivo. Il pulsante “Avvio /
Arresto”
non funziona.
La Translux Wave è dotata di microprocessori che controllano continuamente i parametri ottimali di carica della
batteria. Pertanto, dopo ogni trattamento, il manipolo dovrebbe essere inserito e tenuto nell’unità di carica
indipendentemente dal livello di carica della batteria.
7
Condizioni di allarme
7.1
Batteria difettosa
In caso di batteria difettosa, il LED dello stato della batteria sul manipolo lampeggerà
in modo continuo GIALLO (Figura a).
Viene emesso un segnale acustico (beep) ogni secondo per 30 secondi.
IMPORTANTE
Questa condizione di errore viene rilevata solo quando il manipolo viene posizionato
nell’unità di carica.
7.2
LED difettoso
Quando il microprocessore rileva una condizione di LED difettoso, il LED “10s” verde
delle modalità di fotopolimerizzazione in uso inizia a lampeggiare (Figura b).
lampeggiante
a
lampeggiante
b
7.3
Protezione da surriscaldamento
Se si eseguono cicli di fotopolimerizzazione multipli in rapida successione (di solito 18
cicli consecutivi di 20 secondi ciascuno), il sensore di surriscaldamento potrebbe attivarsi.
Una volta che si attiva la protezione anti surriscaldamento, viene emesso un segnale acustico (3 beep)
alla fine del ciclo di esposizione.
L’attivazione della protezione da surriscaldamento interrompe temporaneamente l’uso dell’unità per alcuni minuti.
Permettere al manipolo di raffreddarsi per 4 – 5 minuti, quindi avviare la successiva esposizione premendo il pulsante
“Avvio / Arresto”
.
NOTA
Il manipolo diventa operativo al raggiungimento della temperature di lavoro.
Non è necessario il „reset manuale“.
7.4
Sensore di surriscaldamento INTEGRATO difettoso
In caso di difetto del sensore di surriscaldamento temperatura, „4 beep“ vengono emessi all‘inizio del ciclo
di esposizione.
NOTA
Se la sovra temperatura con il sensore di surriscaldamento guasto si verifica durante
un ciclo di esposizione, il software consente il completando l‘esposizione.
Nessun ulteriore ciclo di esposizione è consentito premendo il tasto “Avvio / Arresto”
e “4 beep” sono emessi.
Qualsiasi ulteriore operazione con un sensore difettoso del surriscaldamento viene impedita.
IT
- 15 -
7.5
Segnale di batteria bassa
Quando dopo un uso frequente la carica della batteria scende al livello minimo, il microprocessore di Translux Wave
permette ancora alcuni cicli di esposizione, in qualsiasi modalità di fotopolimerizzazione, senza dover ricaricare
la batteria.
Questa condizione viene segnalata al termine di ogni ciclo da “2 beep”.
L’icona della batteria lampeggia in verde. Caricare la batteria!
Al termine di alcuni cicli la carica rimanente della batteria non permette ulteriori cicli di esposizione. Questa condizione
viene segnalata da “2 beep”.
L’icona della batteria lampeggia in verde. Caricare la batteria!
8
Pulizia, disinfezione e sterilizzazione
SCOLLEGARE DALLA RETE ELETTRICA
Prima di eseguire le procedure di pulizia e disinfezione scollegare la base di carica dalla presa di alimentazione
elettrica!
ATTENZIONE
Controllo delle infezioni
La guida di luce e il cono protettivo sono forniti in condizione NON STERILE e devono essere puliti,
disinfettati e sterilizzati (a vapore) prima del primo utilizzo e prima di ogni utilizzo.
Non sterilizzare il manipolo e l’unità di carica!
Non sterilizzare la batteria!
IT
8.1
- 16 -
Disassemblaggio
Rimuovere il cono protettivo dalla guida di luce.
Rimuovere la guida di luce: ruotare leggermente la guida di luce e farla fuoriuscire dal manipolo.
8.2
GUIDA DI LUCE – Pulizia e disinfezione
AVVERTENZA
Non usare strumenti affilati o appuntiti per pulire la guida di luce, poiché potrebbero graffiare la superficie della
guida di luce e ridurre la trasmissione di luce.
Non usare agenti di pulizia / disinfettanti contenenti acidi organici, minerali o ossidanti, perossido di idrogeno,
cloruro, iodio, bromuro e solventi.
1) Subito dopo l’uso, gli eventuali residui, come materiale composito, devono essere rimossi dalla superficie esterna
della guida di luce. Eventuali residui di composito polimerizzato devono essere rimossi tramite etanolo e una spatola di plastica oppure una spazzola soffice in nylon.
2) Disinfettare la guida di luce con un panno pulito, soffice e privo di pelucchi inumidito con una soluzione disinfettante
delicata, con pH delicato (pH 7), in base alle specifiche del produttore.
Lasciare asciugare la soluzione disinfettante.
8.2.1 GUIDA DI LUCE – Ispezione prima della sterilizzazione
Prima di eseguire la procedura di sterilizzazione, verificare che la guida di luce non presenti superfici danneggiate,
scolorimento e contaminazione.
ATTENZIONE
Non usare una guida di luce danneggiata. Se appare danneggiata, sostituire la guida di luce con una
guida nuova.
Se la guida di luce è ancora contaminata, ripetere la procedura di pulizia e disinfezione.
8.3
CONO PROTETTIVO – Pulizia e disinfezione
AVVERTENZA
Non usare agenti di pulizia / disinfettanti contenenti acidi organici, minerali o ossidanti, perossido di idrogeno,
cloruro, iodio, bromuro e solventi.
Pulire e disinfettare il cono protettivo con un panno pulito e soffice inumidito con una soluzione disinfettante
delicata, con pH delicato (pH 7), in base alle specifiche del produttore.
Lasciare asciugare la soluzione disinfettante.
8.3.1 CONO PROTETTIVO – Ispezione prima della sterilizzazione
Prima di eseguire la procedura di sterilizzazione, verificare che il cono protettivo non presenti superfici danneggiate,
scolorimento e contaminazione.
ATTENZIONE
Non usare un cono protettivo danneggiato. Se appare danneggiato, sostituire il cono protettivo con
un cono nuovo.
Un cono protettivo danneggiato non è in grado di fornire protezione sufficiente contro l’emissione luminosa
dell’unità.
Se il cono protettivo è ancora contaminato, ripetere la pulizia e la disinfezione.
8.4
GUIDA DI LUCE e CONO PROTETTIVO – Confezione prima della sterilizzazione
La guida di luce e il cono protettivo possono essere sterilizzati tramite un sacchetto di sterilizzazione medica a vapore
monouso della dimensione appropriata.
AVVERTENZA
La guida di luce e il cono protettivo devono essere posizionati singolarmente in un sacchetto ciascuno.
Quando si sterilizzano strumenti multipli in un’autoclave, assicurarsi che non venga superato il carico massimo
dell’autoclave.
ATTENZIONE
Assicurarsi che il sacchetto interno sia grande a sufficienza per contenere gli strumenti singoli, senza esercitare
pressione sui sigilli o strappare la confezione.
8.4.1 GUIDA DI LUCE e CONO PROTETTIVO – Sterilizzazione
8.4.1.1 Metodo di sterilizzazione
IT
• Eseguirelasterilizzazionetramiteun’autoclaveaprevuotoevapore.
AVVERTENZA
- 17 Non usare mai un altro metodo di sterilizzazione, per evitare eventuali incompatibilità con i materiali con i quali
è costruita la guida di luce.
NON USARE i seguenti metodi di sterilizzazione: sterilizzazione con ossido di etilene, sterilizzazione ad aria
calda, autoclave con ciclo flash, sterilizzazione STERRAD, sistema STERIS o sistemi di sterilizzazione simili.
NON sterilizzare la guida di luce e il cono protettivo usando: sterilizzazione con perossido di idrogeno,
sistema con acido paracetico, formaldeide e glutaraldeide.
8.4.1.2 Parametri di sterilizzazione
• Parametri di sterilizzazione minimi che garantiscano un livello di sicurezza di sterilità (SAL) di 10 –6.
Tipo di ciclo
Temperatura minima
Prevuoto
132°C + 3°C
(270°F + 5°F)
Tempo minimo di esposizione
(sacchetto)
4 minuti
Tempo minimo di
asciugatura
20 minuti
AVVERTENZA
Non superare 135°C (275°F).
8.5
MANIPOLO – Pulizia e disinfezione
ATTENZIONE
Il manipolo non è protetto contro la penetrazione di liquidi.
Non nebulizzare liquidi direttamente sulla superficie e sui contatti di carica del manipolo.
Agenti di pulizia e disinfettanti non devono entrare nel manipolo!
NON IMMERGERE MAI il manipolo in liquidi.
NON PULIRE MAI il manipolo sotto acqua corrente.
Non sterilizzare il manipolo. Rischio di lesioni gravi, scossa elettrica e incendio!
2x
Pulire e asciugare il corpo del manipolo con un panno pulito, soffice e privo di pelucchi inumidito con una soluzione
disinfettante delicata, con pH neutro (pH7) in base alle specifiche del produttore.
Far asciugare la soluzione disinfettante o asciugare il disinfettante residuo sul corpo del manipolo con un panno
soffice e privo di pelucchi.
AVVERTENZA
Non usare solventi quali acetone, alcol isopropilico e perossido di idrogeno, cloruro, iodio, bromuro,
fenolo o altre soluzioni aggressive per pulire e disinfettare la superficie in plastica del manipolo. Queste sostanze
possono essere dannose, provocando discoloramento e/o danni ai materiali in plastica del manipolo.
Non usare detersivi abrasivi!
IMPORTANTE: pulizia dei contatti di carica del manipolo
Dopo avere pulito / disinfettato il corpo in plastica del manipolo, pulire sempre i contatti di carica posizionati
nella parte inferiore del manipolo. I contatti di carica del manipolo devono essere sempre privi di detriti,
compositi e residui di pulizia / disinfettanti.
IMPORTANTE
I contatti di carica del manipolo devono essere puliti regolarmente (almeno una volta a settimana) e sempre
dopo aver eseguito la pulizia e la disinfezione del corpo in plastica del manipolo. Contatti di carica sporchi
o contatti esposti a liquidi, come agenti di pulizia o disinfettanti, possono incidere negativamente sul processo
di carica e impedire alla batteria di essere caricata.
Pulire i contatti di carica del manipolo con un panno soffice e privo di pelucchi o un bastoncino di ovatta inumidito
di alcol.
AVVERTENZA
Non usare strumenti affilati o appuntiti per pulire i contatti del manipolo, poiché potrebbero graffiare
e danneggiare la superficie dei contatti e peggiorare la conduttività dei contatti di carica.
Prima di usare nuovamente il manipolo assicurarsi che la superficie del manipolo e dei contatti di carica siano
completamente asciutti. Se necessario, asciugare i contatti utilizzando un soffio d’aria compressa su di loro.
IT
- 18 -
8.6
UNITÀ DI CARICA – Pulizia del corpo
SCOLLEGARE DALLA RETE ELETTRICA
Prima di eseguire la pulizia / disinfezione dell’unità di carica scollegarla dalla presa di alimentazione elettrica.
ATTENZIONE
Il corpo dell’unità di carica non è protetto contro la penetrazione di liquidi.
Non nebulizzare liquidi direttamente sulla superficie e sul corpo dell’unità di carica.
AVVERTENZA
NON sterilizzare l’unità di carica. Non funzionerebbe più e potrebbe causare un rischio di lesioni gravi,
scossa elettrica e incendio!
Non usare solventi quali acetone, alcol isopropilico e perossido di idrogeno, cloruro, iodio, bromuro, fenolo
o altre soluzioni aggressive per pulire e disinfettare la superficie in plastica dell’unità di carica. Queste sostanze
possono essere dannose, provocando discoloramento e/o danni ai materiali in plastica dell’unità di carica.
Non usare detersivi abrasivi!
Pulire e strofinare il corpo dell’unità di carica con un panno pulito, soffice e privo di pelucchi inumidito
con un agente di pulizia delicato, con pH neutro (pH7), in base alle specifiche del produttore.
Asciugare il corpo dell’unità di carica con un panno pulito non abrasivo.
AVVERTENZA
Assicurarsi di asciugare l’unità di carica dopo la pulizia. L’umidità all’interno dell’unità potrebbe causare danni.
IMPORTANTE
Una volta completata la procedura di pulizia, assicurarsi che i contatti di carica all’interno dell’unità di carica
siano completamente asciutti. Se necessario, asciugare i contatti utilizzando un soffio d’aria compressa
su di loro.
8.6.1
UNITÀ DI CARICA – Pulizia dei contatti di carica
IMPORTANTE
Dopo avere pulito/disinfettato il corpo in plastica del caricatore, pulire sempre i contatti
dell’unità di carica. I contatti di carica dell’unità di carica devono essere sempre privi di detriti,
compositi e residui di pulizia / disinfettanti.
2x
I contatti di carica dell’unità di carica devono essere puliti regolarmente (almeno una volta a settimana) e,
in ogni caso, sempre dopo aver eseguito la pulizia e la disinfezione del corpo in plastica del manipolo. Contatti
sporchi o contatti esposti a liquidi, come agenti di pulizia o disinfettanti, possono incidere negativamente sul
processo di carica e impedire alla batteria di essere caricata.
Pulire i contatti di carica dell’unità di carica con un panno soffice e privo di pelucchi o un bastoncino in ovatta
inumidito di alcol.
AVVERTENZA
Non usare strumenti affilati o appuntiti per pulire i contatti dell’unità di carica!
Non nebulizzare o versare liquidi sui contatti!
Non piegare o modificare la forma dei contatti dell’unità di carica durante la pulizia.
Assicurarsi che i contatti di carica siano asciutti dopo la pulizia e che non siano in contatto con parti metalliche
o unte. Se necessario, asciugare i contatti utilizzando un soffio d’aria compressa su di loro.
8.6.2 UNITÀ DI CARICA – Contatti di carica sostituibili
Contatti dell’unità di carica danneggiati o molto sporchi (che non possono essere puliti attenendosi alle procedure
descritte in precedenza nel paragrafo) possono impedire la conduttività dei contatti e, di conseguenza, la carica della
batteria.
In questo caso è possibile sostituire i contatti danneggiati dell’unità di carica con contatti nuovi.
Per ulteriori informazioni relative alla sostituzione dei contatti dell’unità di ricarica e su come ottenere le parti
di ricambio rivolgersi alla sussidiaria locale Heraeus Kulzer.
Istruzioni:
Strumento richiesto: cacciavite per viti Phillips, di media dimensione.
1. Rimuovere il manipolo dalla base di carica.
2. Scollegare il caricatore dalla rete elettrica.
3. Scollegare il cavo di connessione dal caricatore.
2x
4. Voltare il caricatore.
5. Rimuovere le 2 viti dal ponte di contatto di carica (vedere la copertina posteriore, punto 12).
6. Estrarre il ponte dei contatti di carica.
7. Inserire il nuovo ponte dei contatti e fissare / collegare come sopra indicato ma a ritroso.
AVVERTENZA
Non piegare o contaminare il nuovo ponte dei contatti!
Prestare attenzione e inserire e fissare il ponte in modo corretto. Non esercitare un serraggio eccessivo
delle viti!
9
Conservazione
Conservazione del manipolo con la batteria per un lungo periodo di non utilizzo. Prima o dopo un lungo periodo di
inattività, caricare completamente la batteria e conservarla nell’unità di carica. Sebbene il circuito di sicurezza integrato
della batteria impedisca lo scaricamento completo, è fortemente raccomandato di caricare completamente la batteria
almeno ogni 5 mesi di inattività.
10
Smaltimento
NOTA – IMPORTANTE
Il dispositivo non deve essere smaltito nei rifiuti solidi urbani.
Per lo smaltimento delle parti di ricambio o dell’unità, rivolgersi direttamente alla sussidiaria Heraeus Kulzer
presente nel proprio paese.
Smaltire le batterie sulle quali non è possibile eseguire la manutenzione in base ai requisiti di legge del proprio
paese.
ATTENZIONE – Smaltimento di una batteria danneggiata o esaurita
Smaltire una batteria danneggiata o esaurita dopo aver preso le dovute precauzioni per evitare corto
circuito esterno e attenersi alla seguente procedura:
Dopo aver isolato i terminali della batteria con nastro isolante smaltirla in base a quanto indicato dalla legge
o dalle regolamentazioni municipali.
Le condizioni e le misure precauzionali per lo smaltimento del dispositivo sono soggette alle normative di legge vigenti
come per qualsiasi altro dispositivo elettronico non più utilizzabile.
Smaltimento delle vecchie apparecchiature in accordo con WEEE (Direttiva Europea) o
Apparecchiature Elettriche o Elettroniche Act (German Law ElektroG).
IT
- 19 -
11
Risoluzione dei problemi
ATTENZIONE
Se le fasi seguenti non risolvono il problema, rivolgersi a Heraeus Kulzer o all’agente del Servizio di assistenza
locale autorizzato: NON USARE il Translux Wave e NON CERCARE di eseguire la manutenzione sull’unità perché
potrebbe causare lesioni gravi.
Se si riscontrassero anomalie nel funzionamento del dispositivo, leggere nuovamente il presente manuale
per l’utente quindi controllare la tabella seguente:
PROBLEMA
L’unità di carica non si accende.
sull’unità di carica
Il LED VERDE
è spento.
IT
- 20 Manipolo NON inserito nell’unità
di carica.
L’emissione luminosa non si avvia
quando viene premuto il pulsante
“Avvio / Arresto”
e nessuna
informazione appare sul display del
manipolo.
Vengono emessi “2 beep” al termine
del ciclo di esposizione.
CAUSA POSSIBILE
Il cavo di alimentazione non è collegato
alla presa a muro e/o alla presa dell’unità
di carica.
La presa di alimentazione non porta
tensione.
L’adattatore intercambiabile non
è inserito correttamente nel corpo della
presa di alimentazione.
Il cavo di alimentazione della presa
di alimentazione è danneggiato.
SOLUZIONE
Assicurarsi che il cavo di alimentazione
sia collegato correttamente alla presa
a muro e alla presa dell’unità di carica.
Usare una presa di alimentazione
diversa.
Leggere attentamente il paragrafo 5.2
di questo manuale per l’utente.
Sostituire la presa di alimentazione
con una presa nuova. La presa
di alimentazione e il cavo non possono
essere separati.
La presa di alimentazione è difettosa.
Sostituire la presa di alimentazione con
una presa nuova.
L’unità di carica è difettosa.
Rivolgersi a Heraeus Kulzer o all’agente
del Servizio di assistenza locale
autorizzato.
I contatti dell’unità di carica sono in corto Eliminare la causa del corto circuito.
circuito.
Se la condizione di corto circuito
persiste, sostituire i contatti dell’unità
di carica con contatti nuovi.
Fare riferimento al paragrafo 8.6.2.
Manipolo senza batteria.
Inserire la batteria nel manipolo
(vedere il paragrafo 5.3).
Premere il pulsante “Avvio / Arresto”
Il manipolo è in “Modalità riposo”.
per togliere il manipolo dalla
“Modalità riposo”.
Fare riferimento al paragrafo 6.3.
Batteria scarica.
Mettere il manipolo nell’unità di carica
Non è disponibile carica sufficiente nella e ricaricare la batteria
(vedere il paragrafo 5.5).
batteria per accendere il manipolo.
Malfunzionamento elettronico.
Rivolgersi a Heraeus Kulzer o all’agente
del Servizio di assistenza locale
autorizzato.
Batteria difettosa.
Per verificare se la batteria è difettosa,
mettere il manipolo nell’unità di carica.
Nella Translux Wave inizia una „sequenza
prequalifica“ nella quale il microprocessore controlla lo stato della batteria.
Questa sequenza di prequalifica può
durare fino a max. 30 minuti.
Se durante questa sequenza di controllo,
viene emesso un “beep” ogni secondo
per un periodo di 30 secondi e l‘icona
batteria sul manipolo lampeggia GIALLO,
la batteria risulterà essere difettosa.
Sostituire la batteria con una batteria
nuova (vedere il paragrafo 5.3).
Carica della batteria bassa.
I “2 beep” indicano che il livello di carica rimanente della batteria è sufficiente
solo per pochi cicli di esposizione.
Mettere il manipolo nell’unità di carica
e ricaricare la batteria
(vedere il paragrafo 5.5).
PROBLEMA
L’emissione della luce non comincia
se viene premuto il pulsante “Avvio /
Arresto”
o durante un ciclo di
esposizione l’emissione della luce
è interrotta da un Bip. Il LED VERDE
del programma “10s” comincia a
lampeggiare sul manipolo.
lampeggiante
Dopo diversi cicli di esposizione
consecutivi, l’emissione luminosa non
si accende, quando viene premuto
il pulsante “Avvio / Arresto”
e vengono emessi “3 beep”.
Durante un ciclo di esposizione
vengono emessi “3 beep” al termine
del ciclo di esposizione.
CAUSA POSSIBILE
Il LED pack potrebbe essere difettoso.
SOLUZIONE
Verificare la funzionalità del “LED pack”
per mezzo della seguente procedura:
Inserire il manipolo nell’unità di carica
e premere il pulsante dello “Avvio /
Arresto” consecutivamente per 5 volte.
Rimuovere il manipolo dall’unità di
carica.
Il LED verde del programma “10s”
smette di lampeggiare quando il manipolo viene resettato.
Se il programma LED “10s” sul manipolo
lampeggia ancora impostando un nuovo
ciclo e non c’è emissione di luce, il LED
pack è difettoso.
Nel caso contattare Heraeus Kulzer o il
Deposito Dentale di riferimento.
Protezione da surriscaldamento.
Permettere al manipolo di raffreddarsi
per 4 – 5 minuti, quindi avviare la
Il manipolo si è surriscaldato durante
successiva esposizione premendo il
l’uso ed è stato attivato il sensore di
pulsante “Avvio / Arresto”.
surriscaldamento.
Nota: Il manipolo diventa operativo
L’attivazione della protezione da surriscaldamento impedisce temporaneamente al raggiungimento della temperature
di lavoro. Non è necessario il „reset
(per alcuni minuti) l’uso dell’unità.
manuale“.
Protezione da surriscaldamento.
Permettere al manipolo di raffreddarsi
per 4 – 5 minuti, quindi avviare la
Il manipolo si è surriscaldato durante
successiva esposizione premendo il
l’uso ed è stato attivato il sensore di
pulsante “Avvio / Arresto”.
surriscaldamento.
L’attivazione della protezione da surriscaldamento impedisce temporaneamente
(per alcuni minuti) l’uso dell’unità.
Malfunzionamento durante la fase
Durante la fase di prequalifica della
Sostituire la batteria con una batteria
batteria (condizione della batteria:
nuova (vedere il paragrafo 5.3).
di carica.
Un segnale „beep“ viene emesso ogni completamente scarica; fare riferimento
secondo per un periodo di 30 secondi ai paragrafi 4.2.4 e 5.5).
2x
I dispositivi elettronici rilevano uno stato
e il LED dello stato della batteria sul
difettoso o di malfunzionamento della
manipolo lampeggia GIALLO.
batteria e interrompono la procedura di
carica.
lampeggiante
Il manipolo è posizionato nell’unità
di carica ma la fase di carica non
si avvia.
Il LED verde dello stato della batteria
sul manipolo è spento.
L’intensità luminosa misurata dal
misuratore integrato nell’unità
di carica non è sufficiente.
Il LED
sull’unità di carica
è GIALLO.
Difetto: interruzione dei contatti di carica. Vedere il paragrafo 8.5 e 8.6.2.
Contatto non corretto tra l’unità di carica Controllare che il manipolo sia inserito
e il manipolo.
nell’unità di carica nella direzione
corretta.
Chiave di allineamento. Fare riferimento al paragrafo 4.2.1, punti 4 e 5.
I contatti di carica e/o del manipolo sono Pulire il manipolo e i contatti dell’unità
sporchi.
di carica. Fare riferimento ai paragrafi
8.5 e 8.6.1.
La guida di luce non è inserita correttaControllare che la guida di luce sia commente nel manipolo.
pletamente inserita nel cono di metallo
del manipolo.
L’uscita della guida di luce è contaminata Pulire l’uscita della guida di luce.
da materiali estranei o residui di
Fare riferimento al paragrafo 8.2.
compositi che possono interferire con
la luminosità emessa.
Guida di luce danneggiata o alla fine del Sostituire la guida di luce con una guida
ciclo di vita.
nuova.
IT
- 21 -
12
Specifiche tecniche
Classe I (uno)
Il prodotto è stato testato ed è risultato conforme a IEC 60601-1
(seconda edizione) e IEC 60601-1-1.
Il prodotto è stato testato ed è risultato conforme a IEC 60601-1
(terza edizione) e IEC 60601-1-2 (terza edizione – per la compatibilità
elettromagnetica – EMC).
Il manipolo è destinato all‘uso nell‘area del paziente mentre il carica
batterie e l‘adattatore di alimentazione non devono essere utilizzati
all‘interno dell‘area del paziente.
Nota: L‘area del paziente è definita come un‘area di 1,5 m intorno
al paziente (secondo IEC 60601-1, terza edizione e IEC 60601-1-1).
Classificazione in base alla Direttiva IEC 60601-1: Classe II, Tipo B, parte applicata: puntale (guida luce) con cono
di protezione.
IP 20 (unità di carica).
IP 20 (Translux Wave)
Unità di carica:
Unità di carica Translux Wave
Alimentazione per l’unità di carica:
Alimentazione elettrica di commutazione (Direct Plug-In) prodotto da:
Phihong Technology Co Ltd – Modello: PSACO5R-050.
Ingresso: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Uscita: 5 V
– 1 A max –
.
Apparecchiature di classe II
Alimentazione per il manipolo:
Batteria a ioni di litio ricaricabile.
Produttore: Panasonic. Modello: NCR-18500.
Tensione nominale: 3,6 V.
Capacità nominale (tipica): 2000 mAh
Manipolo:
Modello: Translux Wave.
Funzionamento: Servizio intermittente: 120 „ON – 40“ OFF – esecuzione, massimo 2 volte
Sorgente luminosa:
LED ad alta luminosità.
Prodotto LED di classe 2M (IEC 60825-1).
Lunghezza d’onda compreso: 440 – 480 nm.
Lunghezza d‘onda dominante: min. 440 nm – max. 465 nm
Guida di luce:
Asta multi-core senza piombo, dal diametro di 8 mm.
Sterilizzabile in autoclave a prevuoto e vapore:
4 minuti (minimo) alla temperatura minima di 132°C + 3°C
(270°F + 5°F). Massimo 500 cicli
Cicli di esposizione impostabili:
10 secondi di tempo di esposizione.
– Esposizione Normale
Segnali acustici:
1 beep all’avvio dell’esposizione.
1 beep al termine dell’esposizione
– Esposizione “Avvio lento”
20 secondi di tempo di esposizione. (L’icona “Avvio lento” indica un
incremento dell’intensità luminosa da 50% a 100% in 2 secondi.)
Segnali acustici:
1 beep all’avvio dell’esposizione.
1 beep dopo 1 secondo per l‘indicazione della modalità
di attivazione “Avvio lento”.
1 beep dopo 10 secondi di esposizione.
1 beep al termine dell’esposizione
Tempo di carica di una batteria vuota o nuova: Circa 3 ore
Condizioni ambientali dell’unità:
Funzionamento
Trasporto e
Classificazione in base alla Direttiva 93/42/EC:
Standard di sicurezza:
IT
- 22 -
Temperatura
Umidità relativa
Pressione atmosferica
Da 10°C a 35°C
(Da 50°F a 95°F)
45% – 85%
800 – 1060 hPa
conservazione
Da –20°C a 40°C
(Da –4°F a 104°F)
45% – 85%
500 – 1060 hPa
Peso e dimensioni:
12.1
Unità di carica: peso 450 g.
Dimensioni: L 140 x P 58 x A 62 mm
Manipolo: peso 150 g (compresi guida di luce).
Dimensioni: L 275 mm, max Ø 24 mm
Compatibilità elettromagnetica EN 60601-1-2
ATTENZIONE
L’apparecchio richiede speciali misure di compatibilità elettromagnetica che devono essere installate e messe
in funzione secondo le istruzioni riportate in questo paragrafo.
Gli apparecchi di radiocomunicazione portatili e mobili possono incidere sul funzionamento corretto
del dispositivo.
Guida e dichiarazione del costruttore – Emissioni elettromagnetiche
Translux Wave è previsto per l’uso nell’ambiente elettromagnetico qui di seguito indicato.
Il cliente o l’utente del Translux Wave deve assicurarsi che sia usato in tale ambiente.
Prova di emissione
Conformità
Ambiente elettromagnetico – Guida
Emissioni RF CISPR 11
Gruppo 1
Il Translux Wave usa energia RF esclusivamente per le sue
funzioni interne. Quindi le emissioni RF sono molto basse
ed è difficile che causino interferenze con le apparecchiature
elettroniche presenti nelle vicinanze.
Emissioni RF CISPR 11
Classe B
Il Translux Wave è adatto per l’uso in tutti gli edifici, compresi
gli edifici domestici, e quelli direttamente collegati alla rete di
Emissioni armoniche
Classe A
alimentazione pubblica in bassa tensione che alimenta edifici per
IEC 61000-3-2
usi domestici.
Emissioni di fluttuazioni di tensione /
Conforme
flicker IEC 61000-3-3
Guida e dichiarazione del costruttore – Immunità elettromagnetica
Translux Wave è previsto per l’uso nell’ambiente elettromagnetico qui di seguito indicato.
Il cliente o l’utente del Translux Wave deve assicurarsi che sia usato in tale ambiente.
Prova di immunità
Livello di prova IEC 60601
Livello di conformità
Ambiente elettromagnetico –
Guida
Scariche elettrostatiche ±6 kV a contatto
L’apparecchio continua a
I pavimenti devono essere in legno,
(ESD) IEC 61000-4-2
funzionare in modo regolare calcestruzzo o in ceramica.
±8 kV in aria
e sicuro.
Se i pavimenti sono ricoperti
di materiale sintetico, l’umidità
relativa dovrebbe essere almeno
del 30%.
Transitori / treni
±2 kV per linee di
L’apparecchio continua a
La qualità della tensione di rete
elettrici veloci
alimentazione di potenza
funzionare in modo regolare deve essere quella di un tipico amIEC 61000-4-4
e sicuro.
biente commerciale o ospedaliero.
±1 kV per linee di ingresso /
uscita
Impulsi
±1 kV in modo differenziale
L’apparecchio continua a
La qualità della tensione di rete
IEC 61000-4-5
funzionare in modo regolare deve essere quella di un tipico am±2 kV in modo comune
e sicuro.
biente commerciale o ospedaliero.
Buchi di tensione,
brevi interruzioni e
variazioni di tensione
sulle linee di ingresso
dell’alimentazione
IEC 61000-4-11
< 5% UT (> 95% buco di UT)
per 0,5 cicli
40% UT (60% buco di UT)
per 5 cicli
70% UT (30% buco di UT)
per 25 cicli
< 5% UT (> 95% buco di UT)
per 5 s
Durante il funzionamento
il dispositivo può variare dai
livelli di immunità richiesti a
condizione che il dispositivo
rimanga in sicurezza, non
sia stato rilevato alcun
malfunzionamento e possa
essere riportato allo stato
precedente al test con
l’intervento dell’operatore.
L’apparecchio continua a
funzionare in modo regolare
e sicuro.
Campo magnetico
3A/m
alla frequenza di rete
(50 / 60 Hz)
IEC 61000-4-8
NOTA: UT è la tensione di rete in c.a. prima dell’applicazione del livello di prova.
La qualità della tensione di rete
deve essere quella di un tipico ambiente commerciale o ospedaliero.
Il campo magnetico alla frequenza
di rete dovrebbero avere livelli
caratteristici di un tipico ambiente
commerciale o ospedaliero.
IT
- 23 -
IT
- 24 -
Guida e dichiarazione del costruttore – Immunità elettromagnetica
Translux Wave è previsto per l’uso nell’ambiente elettromagnetico qui di seguito indicato.
Il cliente o l’utente del Translux Wave deve assicurarsi che sia usato in tale ambiente.
Prova di
Livello di prova Livello di
Ambiente elettromagnetico – Guida
immunità
IEC 60601
conformità
RF condotta
3 Veff da
L’apparecchio Gli apparecchi di comunicazione a RF portatili e mobili non dovrebbero
IEC 61000-4-6 150 kHz
continua a
essere usati vicino a nessuna parte del prodotto, compresi i cavi,
a 80 MHz
funzionare in
eccetto quando rispettano le distanze di separazione raccomandate
modo regolare calcolate dall’equazione applicabile alla frequenza del trasmettitore.
RF irradiata
3 V / m da
e sicuro.
Distanze di separazione raccomandate
IEC 61000-4-3 80 MHz
d = 1,2 √P
a 2,5 GHz
d = 1,2 √P da 80 MHz a 800 MHz
d = 2,3 √P da 800 MHz a 2,5 GHz
ove (P) è la potenza massima nominale d’uscita del trasmettitore in
Watt (W) secondo il costruttore del trasmettitore e (d) è la distanza di
separazione raccomandata in metri (m). L’intensità di campo prodotta
dai trasmettitori a RF fissi, come determinato in un’indagine
elettromagnetica del sito, deve essere minore del livello
di conformità in ciascun intervallo di frequenza (b).
Si può verificare interferenza in prossimità di apparecchi
contrassegnati dal seguente simbolo:
Note:
(1) A 80 MHz e 800 MHz si applica l’intervallo della frequenza più alta.
(2) Queste linee guida potrebbero non applicarsi in tutte le situazioni. La propagazione elettromagnetica è influenzata
dall’assorbimento e dalla riflessione di strutture, oggetti e persone.
a) Le intensità di campo per trasmettitori fissi, come ad es. le stazioni di base per radiotelefoni (cellulari e cordless) e
radiomobili terrestri, apparecchi di radioamatori, trasmettitori radio in AM e FM e trasmettitori televisivi, non possono
essere previste teoreticamente e con precisione. Per stabilire un ambiente elettromagnetico causato da trasmettitori fissi,
si dovrebbe considerare un’indagine elettromagnetica del sito. Se l’intensità di campo misurata nel luogo in cui si usa
il Translux Wave, supera i livelli di conformità applicabili di cui sopra, si dovrebbe porre sotto osservazione il funzionamento normale del Translux Wave. Se si notano prestazioni anormali, possono essere necessarie misure aggiuntive come
un diverso orientamento o posizione del Translux Wave.
b) L’intensità di campo nell’intervallo di frequenze da 150 kHz a 80 MHz dovrebbe essere minore di 3 V / m.
Distanze di separazione raccomandate tra apparecchi di radiocomunicazione portatili e mobili e il Translux Wave
Il Translux Wave è previsto per funzionare in un ambiente elettromagnetico in cui sono sotto controllo i disturbi irradiati RF.
Il cliente o l’operatore del Translux Wave possono contribuire a prevenire interferenze elettromagnetiche assicurando una
distanza minima fra gli apparecchi di comunicazione mobili e portatili a RF (trasmettitori) e il Translux Wave, come sotto
raccomandato, in relazione alla potenza di uscita massima degli apparecchi di comunicazione.
Distanza di protezione alla frequenza del trasmettitore (m)
Potenza di uscita nominale
massima del trasmettitore
da 150 kHz a 80 MHz
da 80 MHz a 800 MHz
da 800 MHz a 2,5 GHz
(W)
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
Per i trasmettitori con potenza nominale massima di uscita sopra non riportata, la distanza di separazione raccomandata
(d) in metri (m) può essere calcolata usando l’equazione applicabile alla frequenza del trasmettitore, ove (P) è la potenza
massima nominale d’uscita del trasmettitore in Watt (W) secondo il costruttore del trasmettitore.
Note:
(1) A 80 MHz e 800 MHz si applica l’intervallo della frequenza più alta.
(2) Queste linee guida potrebbero non applicarsi in tutte le situazioni. La propagazione elettromagnetica è influenzata
dall’assorbimento e dalla riflessione di strutture, oggetti e persone.
12.2
Targhetta identificativa dell’unità di carica
Descrizione dei simboli sulla targhetta identificativa
1 Marchio CE.
2 Avvertenza, consultare i documenti di accompagnamento.
3 Consultare le istruzioni per l’uso.
4 Doppio isolamento (il dispositivo è conforme con la classe di sicurezza II).
5 Smaltimento della strumentazione elettrica ed elettronica
alla fine del ciclo di vita.
Applicabile nella Comunità Europea e in altri paesi Europei dotati
di raccolta dei rifiuti differenziata.
6 Marchio MET.
12.3
Numero di serie del manipolo
Il numero di serie del manipolo è inciso nella
parte inferiore del corpo del manipolo.
Numero di
serie inciso.
13
1
2
3
4
5
6
Garanzia
Ogni apparecchio della ditta Heraeus Kulzer viene sottoposto, prima della fornitura, a severi collaudi e a un controllo
finale, al fine di garantire un perfetto funzionamento del prodotto. Per quanto riguarda i difetti di materiale e di produzione, Heraeus Kulzer fornisce, per tutti i nuovi prodotti Heraeus Kulzer acquistati presso un rivenditore o importatore
Heraeus Kulzer, una garanzia di 2 (due) anni a decorrere dalla data di acquisto del prodotto. Heraeus Kulzer si impegna,
IT
durante il periodo di garanzia, a riparare (oppure, a libera scelta, a sostituire) gratuitamente i componenti del prodotto
che, a suo parere, si dimostrassero difettosi. Non è prevista la sostituzione integrale dei prodotti Heraeus Kulzer.
Heraeus Kulzer non si assume alcuna responsabilità per eventuali danni personali e/o materiali causati, in modo
- 25 diretto o indiretto, nei seguenti casi:
• l’apparecchiononèstatoimpiegatoperlafinalitàprevista;
• l’apparecchiononèstatoutilizzatosecondoleistruzionieprescrizioniriportatenelpresentemanuale;
• l’impiantoelettricodeilocaliincuivieneutilizzatol’apparecchiononèconformealleleggiinvigoreedalle
prescrizioni correlate;
• lacomposizione,glioptional,l’impostazione,lamodificaelariparazionenonsonostatieseguitidapersonale
tecnico specializzato Heraeus Kulzer;
• irapportidispazioperlaconservazioneedilmagazzinaggiodell’apparecchiononcorrispondonoalleprescrizioni
contenute nel paragrafo 12 (Specifiche tecniche).
Sono esclusi dalla garanzia danni imputabili al trasporto, danni causati da un utilizzo non conforme o da negligenza,
danni provocati dall’allacciamento ad una tensione di rete diversa da quella prevista, nonché spie di controllo, tasti
e tutti gli accessori. La garanzia decade qualora l’apparecchio venga modificato o riparato da altre persone e non
dal Servizio Assistenza Clienti. Per fruire della garanzia il Cliente deve recapitare, a proprie spese, l’apparecchio
danneggiato al rivenditore o all’ o importatore Heraeus Kulzer presso il quale l’apparecchio stesso è stato acquistato.
L’apparecchio, comprensivo di accessori, dev’essere rispedito correttamente imballato (se possibile nel suo imballo
originale).
Con le unità restituite deve essere allegata una scheda contenente le seguenti informazioni:
a) nome, indirizzo e numero di telefono del proprietario;
b) nome ed indirizzo del rivenditore/importatore;
c) fotocopia della bolla di consegna/documento d’acquisto dell’apparecchio da parte del proprietario, sul quale
risultino, oltre alla data, la descrizione dell’apparecchio ed il numero di serie;
d) descrizione del problema di funzionamento riscontrato.
Non ci si assume alcuna responsabilità per il trasporto ed eventuali danni da esso derivanti.
In caso di danni provocati da incidenti o da un utilizzo non conforme dell’apparecchio, oppure verificatisi
successivamente alla scadenza della garanzia, le riparazioni verranno fatturate in base agli effettivi costi di materiale
e manodopera.
14
Servizio Assistenza
14.1
Partner di assistenza / Partner di assistenza nei rispettivi paesi
15
Cronologia dei documenti
1x
2012-08 Versione bozza per i prototipi.
2013-09 Prima edizione.
2014-03 Aggiornamento paragrafo 2.1, 3.2.1, 7.2, 10, 11, 12 e 12.2.
IT
- 26 -
Soggetto a modifiche.
Aggiornamento al: 2014-03
Índice
1
1.1
1.2
1.3
Aplicação ________________________________________________________________________
Geral _________________________________________________________________________
Declaração de conformidade CE _____________________________________________________
Declaração do fabricante ___________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Instruções sobre como utilizar a unidade com segurança __________________________________
Explicação dos símbolos e das palavras que os acompanham ________________________________
Danos no transporte – Desembalagem e inspeção ________________________________________
Obrigações do proprietário _________________________________________________________
Diário do aparelho _______________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Finalidade de utilização _____________________________________________________________
Descrição do aparelho ____________________________________________________________
Requisitos de segurança __________________________________________________________
Instruções de segurança geral sobre o funcionamento da unidade ____________________________
Precauções de segurança __________________________________________________________
BATERIA – Precauções de segurança _________________________________________________
BATERIA – Informações ___________________________________________________________
RESPONSABILIDADE ______________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Descrição d equipamento ___________________________________________________________ 8
Conteúdo entregue ______________________________________________________________
8
Descrição do controle e elementos de operação __________________________________________
8
Aparelho ______________________________________________________________________
8
Chave de alinhamento ____________________________________________________________
8
Carregador _____________________________________________________________________
8
Sinais sonoros do aparelho _________________________________________________________
9
Informação relativa a radiação emitida por LED __________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Instalação e colocação em funcionamento ______________________________________________
Requisitos de segurança durante a instalação ___________________________________________
Conexão do carregador à tomada elétrica ______________________________________________
Colocação da bateria no aparelho ____________________________________________________
Colocação do guia luminoso no aparelho _______________________________________________
Carregamento da bateria __________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Operação ________________________________________________________________________
Ativação e desativação do ciclo de exposição ___________________________________________
Medição da intensidade luminosa ____________________________________________________
Modo de pausa _________________________________________________________________
Informações adicionais sobre as operações do aparelho ____________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Condições de alarme _______________________________________________________________
Bateria com defeito ______________________________________________________________
LED com defeito ________________________________________________________________
Proteção contra superaquecimento ___________________________________________________
Sensor interno de sobrecarga de temperatura com defeito _________________________________
Sinal de bateria fraca _____________________________________________________________
15
15
15
15
15
16
OBSERVAÇÃO
Use o ícone do livro para encontrar as imagens
do capítulo ou mais informações na capa desdobrável.
1x /2x
Desdobre
a capa frontal
HKG-Layout 99000943_01 GBA
Desdobre
a capa traseira
06PT
Translux Wave EU
Dateiname: 06PT_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
PT
-1-
PT
-2-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Limpeza, desinfecção e esterilização __________________________________________________
Desmontagem __________________________________________________________________
GUIA LUMINOSO – Limpeza e desinfecção _____________________________________________
GUIA LUMINOSO – Inspeção antes da esterilização _______________________________________
CONE DE LUZ PROTETOR – Limpeza e desinfecção _______________________________________
CONE DE LUZ PROTETOR – Inspeção antes da esterilização _________________________________
GUIA LUMINOSO e CONE DE LUZ PROTETOR – Embalagem antes da esterilização _________________
GUIA LUMINOSO e CONE DE LUZ PROTETOR – Esterilização _________________________________
Método de esterilização ___________________________________________________________
Parâmetros de esterilização ________________________________________________________
APARELHO – Limpeza e desinfecção __________________________________________________
CARREGADOR – Limpeza da embalagem ______________________________________________
CARREGADOR – Limpeza dos contatos ________________________________________________
CARREGADOR – Contatos substituíveis ________________________________________________
9
Armazenamento por longo tempo ______________________________________________________ 19
10
Descarte ________________________________________________________________________ 19
11
Solução de problemas ______________________________________________________________ 20
12
12.1
12.2
12.3
Especificações técnicas ____________________________________________________________
Compatibilidade eletromagnética EN 60601-1-2 _________________________________________
Placa de identificação do carregador __________________________________________________
Número de série do aparelho _______________________________________________________
13
Garantia ________________________________________________________________________ 25
14
14.1
Assistência Técnica _______________________________________________________________ 26
Concessionários de serviços / contatos internacionais _____________________________________ 26
15
Histórico do documento _____________________________________________________________ 26
OBSERVAÇÃO
Use o ícone do livro para encontrar as imagens
do capítulo ou mais informações na capa desdobrável.
16
16
16
16
16
17
17
17
17
17
17
18
18
19
22
23
25
25
1x /2x
Desdobre
a capa frontal
Desdobre
a capa traseira
1
Aplicação
1.1
Geral
Translux Wave é uma marca registrada da Heraeus Kulzer GmbH.
Este manual de instruções é válido para:
Código
66055012
Tipo e equipamento
Translux Wave – LED Unidade Fotopolimerizadora
Versão
2014-03 / 99000943/01
1.2
Declaração de conformidade CE
Pela presente, nós, a Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, declaramos que, devido à sua concepção,
estrutura e versão introduzida no mercado, o aparelho designado a seguir corresponde aos requisitos de segurança
e saúde da Diretriz CE.
Esta declaração torna-se inválida em caso de modificações do aparelho, sem prévia autorização.
1.3
Declaração do fabricante
Confirmamos que a unidade Translux Wave cumpre com a diretiva 93/42 EC e as normas IEC 60601-1
e IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Alemanha).
2
Instruções sobre como utilizar a unidade com segurança
Leia este manual e siga atentamente as instruções. As palavras ADVERTÊNCIA, CUIDADO e OBSERVAÇÃO têm
significados especiais e devem ser analisadas cuidadosamente (consulte o item a seguir). Mantenha este manual
sempre em um local de fácil alcance.
2.1
Explicação dos símbolos e das palavras que os acompanham
Símbolos
Palavras que os
acompanham
Explicação
ADVERTÊNCIA
Implica que morte ou sérios danos podem ocorrer caso os cuidados não
sejam seguidos.
CUIDADO
Implica que lesões mínimas ou danos no equipamento caso os cuidados não
sejam seguidos.
OBSERVAÇÃO
Implica o aviso não estar relacionado a danos.
ADVERTÊNCIA
DE EXPLOSÃO
ADVERTÊNCIA de explosão – observe as informações e advertências
dos capítulos e das seções marcadas com esses símbolos pictóricos.
DESLIGAR DA
REDE ELÉTRICA
ADVERTÊNCIA de choque elétrico.
Antes de efetuar os procedimentos de limpeza e desinfecção,
desligue o carregador da fonte de energia elétrica!
Marca MET – conformidade UL / CSA.
MET
WEEE / ElektroG
Descarte de equipamentos antigos de acordo com as diretrizes européias
WEEE ou equipamentos elétricos e eletrônicos (Lei alemã ElektroG).
Parte aplicada:
Parte aplicada tipo B em conformidade com as normas técnicas
IEC 60601-1.
Isolamento duplo:
Equipamento de classe II.
Fonte de alimentação:
Corrente alternada.
Corrente contínua.
Mudando a polaridade do plugue da fonte de energia – Centro positivo.
PT
-3-
Símbolos
Palavras que os
acompanham
Explicação
Utilizar somente em espaços fechados.
Dispositivo fabricado em conformidade com a diretiva 93/42/EC, incluindo
as normas técnicas IEC 60601-1 e IEC 60601-1-2.
Símbolo de ADVERTÊNCIA “radiação LED”.
Observe as informações e os perigos no item 4.2.5.
Consulte as instruções de uso.
CUIDADO, consulte os documentos que acompanham o aparelho.
Interruptor de funcionamento:
“Iniciar / Parar”.
Certificado de registro de acordo com o Ministério da Saúde da Federação
Russa.
Mantenha longe da chuva.
Limite de temperatura para armazenamento (–20°C (–4°F) a 40°C (104°F)).
Limite de umidade para armazenamento (45% – 85% U.R).
PT
Limite de pressão atmosférica para armazenamento
(500 – 1060 hPa).
-4-
2.2
Danos no transporte – Desembalagem e inspeção
O aparelho é sensível a choques mecânicos, devido aos componentes eletrônicos. Por isso, deve haver um cuidado
especial relativamente ao transporte e armazenagem. Os produtos fornecidos pela Heraeus Kulzer são minuciosamente
checados antes do seu envio. O aparelho é fornecido devidamente protegido e embalado.
Após recebimento verifique o aparelho quanto a danos de transporte. Em caso de danos, comunique-os à empresa
transportadora, o mais tardar 24 horas após o recebimento. Não instale ou opere o aparelho em nenhuma circunstância
com uma unidade e/ou acessórios danificados.
2.3
Obrigações do proprietário
É obrigação do proprietário se submeter às disposições legais, além de assegurar a observância e realização dos
regulamentos legais no local de trabalho, ex.: treinamento de pessoal, segurança do trabalho bem como todos
os demais regulamentos, disposições e leis em vigor.
Relativo aos trabalhos com o aparelho, o proprietário deve elaborar instruções compreensíveis, baseadas no manual
de instruções e nos trabalhos a executar, de forma clara e objetiva a todos operadores.
2.4
Diário do aparelho
Recomendamos que você mantenha um “diário do aparelho” e documente todos os testes e trabalhos importantes
(por exemplo, manutenção, modificações) nele.
3
Finalidade de utilização
O Translux Wave é um fotopolimerizador LED destinado ao uso na cavidade oral para a polimerização de materiais
odontológicos como materiais restauradores e adesivos, que são ativados em um intervalo de comprimento de onda
de 440 – 480 nm.
OBSERVAÇÃO
Embora a maioria dos materiais odontológicos de fotopolimerização sejam ativados dentro desse intervalo
de comprimento de onda, em caso de dúvidas, verifique as especificações do fabricante ou entre em contato
com o fabricante.
ADVERTÊNCIA – Pessoal especializado e qualificado.
O aparelho só pode ser operado por pessoal especializado devidamente qualificado e pelo dentista (consulte
o item 2.3 – Obrigações do proprietário). Se o aparelho for usado corretamente, não causará nenhum efeito
colateral conhecido.
3.1
Descrição do aparelho
O Translux Wave utiliza uma fonte de luz constituída por um díodo de LED, mono-cromático, muito eficiente,
com comprimento de onda compreendido entre 440 e 480 nm.
Toda a luz irradiada pelo Translux Wave é usada para ativar o fotoiniciador de canforoquinona. Isso produz resultados
de polimerização excelentes, com uma emissão de calor menor.
O Translux Wave é fornecido com um guia luminoso rotativo de 360° com 8 mm de diâmetro.
O Translux Wave é composto por um carregador e um aparelho, alimentado por uma bateria de íons de lítio removível
e recarregável.
O aparelho dispõe de um “Modo de pausa” para minimizar o consumo de energia da unidade.
O aparelho entrará em “Modo de pausa” se não for usado por um período de cerca de 5 minutos.
O Translux Wave pode operar com dois ciclos de exposição diferentes:
• Exposição com potência constante: ciclo de duração de 10 segundos.
• Exposição com aumento gradual na potência: “Soft-Start” (ciclo de duração de 20 segundos).
O “Soft-Start” significa um aumento na intensidade da luz de 50% a 100% em 2 segundos.
OBSERVAÇÃO – Respeite os tempos especificados pelo fabricante para a exposição dos materiais.
Para materiais com tempos de exposição específicos (por exemplo, 30 / 40 segundos para compósitos
escuros), repita a exposição várias vezes, se necessário.
3.2
Requisitos de segurança
A eficácia das instruções de segurança relacionada à proteção pessoal, ao manuseio do aparelho e manuseio
de materiais depende principalmente do comportamento das pessoas que trabalham com este aparelho.
ADVERTÊNCIA
Previamente à utilização, ler cuidadosamente este manual de instruções e observar as instruções para evitar
erros e conseqüentes danos, especialmente danos à saúde.
Relativamente à instalação e operação do aparelho devem ser observadas, além das instruções contidas neste
manual, as respectivas leis, disposições legais e normas nacionais em vigor.
3.2.1
Instruções de segurança geral sobre o funcionamento da unidade
ADVERTÊNCIA – FINALIDADE DE UTILIZAÇÃO
Utilize o aparelho apenas para a finalidade a que se destina (consulte o item 3 – Finalidade de utilização).
Nenhum outro uso é indicado. A não observância destas regras pode resultar em lesões graves aos pacientes
ou operadores da unidade, bem como falhas ou danos à unidade. A Heraeus Kulzer não se responsabiliza por
danos causados pelo não cumprimento da disposição acima!
ADVERTÊNCIA
O usuário é responsável por testar o Translux Wave para seu uso e sua adequação aos fins pretendidos.
Nunca aponte a luz em direção aos olhos! A exposição direta ou indireta da luz nos olhos deve ser evitada
sempre pelo uso de óculos de proteção que filtrem a luz azul. Durante a polimerização, posicione a ponta
do guia luminoso diretamente sobre o material que precisa ser polimerizado e evite a exposição externa aos
tecidos moles. Olhos, gengivas, tecidos moles e outras partes do corpo não devem ser expostos à luz azul
(se necessário, essas partes devem ser protegidas). Use uma proteção dental para proteger os tecidos moles,
ou seja, a gengiva, durante o tratamento. A exposição deve ser restrita à área da cavidade oral em que
o tratamento clínico é executado.
ADVERTÊNCIA – CONTRAINDICAÇÕES
Não use o Translux Wave em pacientes com marcapasso ou outros dispositivos eletrônicos implantáveis.
Isso também se aplica ao operador.
O aparelho não deve ser usado por crianças, cegos ou surdos e também não por / em pessoas propensas
a crises epilépticas. Essas pessoas podem não reconhecer os riscos de uso e operação. Por conta de razões de
segurança para o operador e os pacientes com risco potencial de convulsões epiléticas, é proibida a utilização
e a operação do aparelho.
ADVERTÊNCIA
Não é permitifo nenhuma modificação deste equipamento.
PT
-5-
O proprietário / usuário deve garantir que:
– O aparelho não seja usado em pacientes com anamnese positiva após o teste de luz, por exemplo,
com urticária solar e/ou porfiria, bem como em pacientes que foram tratados com medicação fotossensibilizantes.
– O aparelho não seja usado em pacientes que fizeram cirurgia de catarata e que sejam particularmente
sensíveis à luz, a menos que usem medidas de proteção adequadas, como o uso de óculos / protetores
oculares que filtrem a luz azul.
– Pacientes cuja anamnese inclua doenças da retina devem receber autorização do seu oftalmologista para
o tratamento com o Translux Wave.
– Um médico especialista seja consultado em todos os casos de risco potencial.
ADVERTÊNCIA – Temperatura das peças
Temperatura máximadas partes (guia de luz e cone protetor de luz): 41°C (106°F).
Temperatura máxima da parte considerada peça de aplicação (cone metálico frontal) que pode entrar em
contato com o paciente: 46°C (115°F).
Heraeus Kulzer declara que se o aparelho for usado em conformidade com as instruções de uso contidas neste
manual, não haverá aquecimento dos tecidos.
ADVERTÊNCIA – Controle de infecções.
O guia luminoso e o cone de luz protetor devem ser limpos, desinfetados e esterilizados (com vapor) antes
de cada utilização. O guia luminoso e o cone de luz protetor são entregues SEM ESTERILIZAÇÃO e devem
ser esterilizados antes de serem utilizados pela primeira vez. Consulte o item 8.4.1.2 – Parâmetros de
esterilização.
3.2.2
PT
-6-
Precauções de segurança
ADVERTÊNCIA – RISCO DE EXPLOSÃO
Não instale o aparelho onde houver risco de explosões.
O aparelho não deve ser usado em atmosferas inflamáveis (misturas de anestesia, oxigênio, óxido nitroso, etc).
Use o dispositivo em uma área bem ventilada.
ADVERTÊNCIA
Antes de utilizar o aparelho, verifique se há danos no cabo de alimentação e no plugue. Se eles estiverem
danificados, não ligue o aparelho à rede elétrica.
Use somente peças ou acessórios originais de reposição da Heraeus Kulzer GmbH. A Heraeus Kulzer fornece
um guia luminoso adequado para uso com o Translux Wave. Nenhum outro guia luminoso deve ser usado.
A Heraeus Kulzer GmbH não aceitará qualquer responsabilidade por danos resultantes da utilização de peças
ou acessórios que não forem os originais da Heraeus Kulzer.
3.2.3 BATERIA – Precauções de segurança
A Heraeus Kulzer GmbH não assumirá nenhuma responsabilidade por problemas na bateria que ocorram quando
as precauções de segurança indicadas no item abaixo não forem seguidas cuidadosamente.
ADVERTÊNCIA
O mau uso da bateria pode causar aquecimento, ruptura ou ignição da bateria e causar lesões graves.
Não deixe de seguir as regras de segurança do item abaixo.
Use somente baterias originais da Heraeus Kulzer!
O uso de baterias que não são da Heraeus Kulzer ou de baterias não recarregáveis e/ou primárias é um perigo
potencial e pode danificar o aparelho.
Mantenha a bateria fora do alcance de crianças!
Nunca abra, perfure ou esmague a bateria – ela contém substâncias venenosas.
Se a bateria apresentar corrosão, emitir um cheiro incomum ou perder líquido, retire-a do aparelho imediatamente.
Não exponha a bateria à água ou permita que a bateria fique molhada. Não armazene a bateria em locais com
umidade alta ou que possam expor a bateria à chuva.
No caso de a bateria vazar e o fluido entrar em um olho, não o esfregue. Enxágue-o bem com água e procure
assistência médica imediatamente. Se for deixado sem tratamento, o líquido da bateria pode causar danos aos
olhos.
ADVERTÊNCIA – RISCO DE EXPLOSÃO
Para carregar a bateria do aparelho, use apenas a fonte de alimentação e o carregador do Translux Wave
fornecidos com o aparelho. Nunca tente carregar a bateria do Translux Wave usando outro carregador.
O uso de qualquer outro carregador pode resultar em danos à bateria, risco de explosão e incêndio!
Nunca use o carregador do Translux Wave para carregar outros tipos de bateria ou outros aparelhos!
Use somente baterias originais da Heraeus Kulzer.
Não perfure a bateria com objetos afiados, bata na bateria com um martelo / ferramentas, pise na bateria nem
a submeta a fortes impactos ou choques.
Não coloque a bateria no fogo ou aplique calor a ela. Nunca provoque um curto-circuito nos terminais
da bateria com objetos metálicos, por causa do risco de queimaduras, incêndio e explosão.
Nunca transporte ou armazene a bateria juntamente com colares, grampos ou outros objetos de metal.
ADVERTÊNCIA – Não desmonte nem modifique a bateria!
Se os mecanismos de segurança incorporados na bateria forem danificados, podem fazer a bateria gerar calor,
se romper, explodir ou pegar fogo.
ADVERTÊNCIA – Não coloque a bateria no fogo ou perto dele ou em outros locais de alta temperatura.
Não coloque a bateria diretamente na luz do sol. Isso pode causar aquecimento, ruptura ou ignição da bateria.
Usar a bateria dessa maneira também pode causar perda de desempenho e redução na expectativa da vida útil.
ADVERTÊNCIA – Em caso de incêndio, NÃO JOGUE ÁGUA SOBRE A BATERIA!
Deve ser usado um extintor de incêndio classe C (de acordo com o Regulamento Europeu EN 3).
ADVERTÊNCIA – Descarte de baterias vazias ou danificadas.
Descarte uma bateria vazia ou danificada conforme o método a seguir, depois de tomar as medidas
necessárias para evitar curto-circuito externo:
Depois de ter isolado os terminais da bateria com fita isolante, faça o descarte nos termos da lei ou de acordo
com as orientações da prefeitura.
3.2.4 BATERIA – Informações
• Tempodecarregamentodeumabateriavaziaounova:cercade3horas.
OBSERVAÇÃO – bateria NOVA: primeira carga
Para a primeira carga, este processo demora cerca de 3 horas. O carregamento de baterias novas ou
baterias armazenadas por um longo tempo pode levar mais tempo. A bateria atingirá sua capacidade total
após alguns ciclos completos de carga / descarga.
OBSERVAÇÃO
Coloque o aparelho no carregador após cada tratamento ou quando não estiver em uso.
• Condiçãodeoperação:
Temperatura de funcionamento: 10°C (50°F) a 35°C (95°F).
Umidade relativa: 45% a 85% U.R.
Pressão atmosférica: 800 hPa a 1060 hPa.
CUIDADO
Os intervalos de temperatura e umidade relativa do ar sobre os quais a bateria pode ser carregada são
de 10°C (50°F) a 35°C (95°F) e 45% a 85% U.R. Carregar a bateria em temperaturas fora desse intervalo
pode causar aquecimento ou danificá-la. Carregar a bateria fora desse intervalo de temperatura também
pode prejudicar o desempenho ou reduzir a expectativa de vida dela.
• Condiçõesdetransporteearmazenamentodabateria:
Intervalos recomendados de temperatura e umidade relativa:
–20°C (–4°F) a 40°C (104°F) e 45% a 85% U.R.
Guarde sempre a bateria carregada, mas não por mais de 5 meses.
Pressão do ar ambiente: 500 hPa a 1060 hPa.
OBSERVAÇÃO
Sempre carregue a bateria antes de um longo período de inatividade do aparelho e pelo menos uma vez
a cada 5 meses. Em caso de longos períodos de inatividade substituir a bateria da peça de mão.
• Característicastípicasdavidaútildabateria:
A bateria do Translux Wave tem uma expectativa de vida útil típica de 300 a 400 ciclos de carga, dependendo
da aplicação e das condições ambientais em que o aparelho é usado.
OBSERVAÇÃO
A bateria é um produto químico que utiliza uma reação química; portanto, o desempenho vai se deteriorar
não só pelo uso, mas também com o passar do tempo, mesmo que ela não seja utilizada.
PT
-7-
3.2.5 RESPONSABILIDADE
Trabalhos na parte elétrica do aparelho devem ser executados exclusivamente pela Heraeus Kulzer ou assistência
técnica / profissional especializado indicado pela Heraeus Kulzer sempre numa situação segura (isento de tensão).
Utilizar somente peças e acessórios originais e autorizados.
Evitar outro tipo de peças uma vez que essa utilização acarreta riscos desconhecidos.
O funcionamento e segurança do aparelho são assegurados apenas se as inspeções necessárias, manutenção
e reparos forem executados pela Heraeus Kulzer ou assistência técnica / profissional especializado indicado pela
Heraeus Kulzer.
A Heraeus Kulzer não se responsabilizará por defeitos / falhas provocados pelo reparo ou manutenção não realizados
pela Heraeus Kulzer ou assistência técnica / profissional especializado indicado pela Heraeus Kulzer de acordo
com as condições acima informadas e caso não sejam utilizadas peças de reposição / acessórios originais.
PT
4
Descrição d equipamento
4.1
Conteúdoentregue
1 Carregador
2 Aparelho
3 Guia luminoso, Ø = 8 mm
4 Cone de luz protetor
5 Bateria de íons de lítio recarregável
6 Fonte de alimentação de entrada universal (100 V – 240 V (
para rede elétrica internacional:
6a = Europa
tipo 1
6b = Reino Unido tipo 2
6c = EUA / Japão tipo 3
4.2
4.2.1
-8-
1x
)), incluindo adaptadores
Descrição do controle e elementos de operação
Aparelho
1 Botão “Iniciar / Parar”
2 LEDs de modos de polimerização (VERDE)
3 LED de status da bateria (2 cores: VERDE / AMARELO)
4 Contatos do carregador
5 Chave de alinhamento
4.2.2 Chave de alinhamento
A chave de alinhamento (5), localizada na parte de trás inferior baixo do aparelho,
permite a inserção correta do aparelho no suporte do carregador.
Ao inserir o aparelho no carregador, a chave de alinhamento deve ser alinhada com a ranhura-guia
posicionada dentro do suporte do carregador.
Um bipe confirma que os contatos estão na posição correta para o carregamento!
4.2.3
Carregador
Visão superior dos elementos
1 Tampa do carregador
7 Suporte do aparelho com chave de alinhamento e contatos substituíveis do carregador
8 Sensor de intensidade de luz
9
– LED de cor VERDE
Função: Ele indica que o carregador está ligado.
10
– LED de 2 cores (VERDE / AMARELO)
Função: Informações sobre a intensidade da luz.
VERDE: Indica que a intensidade da luz, medida com o medidor de luz embutido,
é adequada para um tratamento eficaz.
AMARELO: Indica que a intensidade da luz é insuficiente.
Visão inferior carregador
11 Entrada de alimentação
12 Entrada dos contatos substituíveis
2x
2x
1x
2x
4.2.4
Sinais sonoros do aparelho
Condição de erro /
função
PROGRAMA DE
POLIMERIZAÇÃO:
10 segundos.
Operação do botão do aparelho
PROGRAMA
“Soft-Start”:
20 segundos.
• Aperteobotão“INICIAR / PARAR”
por pelo menos um segundo
para começar a exposição.
• Aperteobotão“INICIAR / PARAR”
brevemente para começar
a exposição.
INTERRUPÇÃO DO CICLO • Ociclodeexposiçãopodeserinterrompido a qualquer momento e em qualquer
DE EXPOSIÇÃO
programa, bastando apertar o botão
.
“INICIAR / PARAR”
SINAL DE BATERIA
FRACA
O nível de carga
residual da bateria é
suficiente para alguns
ciclos de exposição.
SINAL BATERIA VAZIA
Ciclo de exposição a
seguir pode não ser
ativado.
SINAL DE BATERIA
COM DEFEITO
Fonte de luz LED
com defeito
CONDIÇÃO DE
SUPERAQUECIMENTO
Sensor interno de
sobrecarga de temperatura com defeito
Circuito do aparelho
com defeito
Observação: Esta
condição é detectada
apenas com o aparelho
no carregador.
Sinais sonoros emitidos
Indicações do aparelho
• 1 bipe ao pressionar o botão “INICIAR /
PARAR”.
• 1 bipe no fim da exposição.
O LED de 10 segundos fica verde.
• 1 bipe ao pressionar o botão “INICIAR /
PARAR”.
• 1 bipe depois de 1 segundo indica ativação
do modo “Soft-Start”.
• 1 bipe após 10 segundos de tempo
de exposição.
• 1 bipe no fim da exposição.
O LED de 20 segundos fica verde.
• 1 bipe ao pressionar o botão “INICIAR /
PARAR”.
• 2 bipes no fim do ciclo de exposição.
• Oíconedabateriapiscaráverde.
Coloque peça da mão na base carregadora
para carregamento!
• 2 bipes sem ativação do ciclo de exposição.
• Oíconedabateriapiscaráverde.
Coloque peça da mão na base carregadora
para carregamento!
Somente com o aparelho colocado no carregador.
• 1 bipe a cada segundo por um período
de 30 segundos.
O LED de status da bateria fica AMARELO.
Nenhum sinal sonoro emitido.
O LED de ciclo de exposição em uso pisca.
• 3 bipes, e a parte eletrônica permite a conclusão do ciclo de exposição em uso.
• 4 bipes no início do ciclo de exposição.
Dois LEDs verdes (10 s / 20 s) na peça de mão
piscando.
PT
-9-
4.2.5
Informação relativa a radiação emitida por LED
O aparelho utiliza LEDs com alta luminância da classe 2M (IEC 60825-1).
Radiação do LED.
Não olhar para o raio de luz nem diretamente com
LED RADIATION
instrumentos ópticos.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• ProdutodeLEDdaclasse2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Máx. energia: < 5.00 mW.
• Comprimento de onda dominante:
Mín. 440 nm – Max. 465 nm.
ADVERTÊNCIA
Raios divergentes
Não olhar com instrumentos ópticos como monóculo, lentes de aumento ou microscópios de uma distância
de menos de 100 mm para a luz do LED, porque isso pode causar lesões aos olhos.
Raios colimados
Não olhar com instrumentos de observação à distância como telescópios ou binóculos para a luz do LED,
porque isso pode causar lesões aos olhos.
No caso de falha do circuito de controle do LED, a emissão de radiação do LED não pode exceder o valor
na condição de uso normal do equipamento.
Rótulos como representado acima encontram-se na embalagem do aparelho.
5
PT
- 10 -
Instalação e colocação em funcionamento
As seções a seguir contêm as informações e instruções que devem ser seguidas para assegurar a operação
bem-sucedida e sem falhas do aparelho. Antes de operar o Translux Wave, siga as instruções na sequência descrita
abaixo.
Este equipamento está em conformidade com as normas de segurança apenas se for instalado de acordo com
as instruções descritas a seguir.
O aparelho deve ser instalado em um local adequado e que facilite a sua utilização. Coloque o carregador
em uma superfície sólida, seca, plana e horizontal.
IMPORTANTE
A peça de mão é destinado para uso no ambiente do paciente, enquanto que o carregador e o cabo de energia
não devem ser utilizados desta forma.
OBSERVAÇÃO
O ambiente do paciente é definido como a área compreendida a 1,5 m ao redor dele (como no IEC 60601-1
terceira edição e IEC 60601-1-1).
ADVERTÊNCIA
Sempre verifique se há algum dano no aparelho ou em seus componentes antes da instalação.
Se houver algum dano, não prossiga com a instalação do aparelho.
O operador não deve entrar simultaneamente em contato com os elementos fora do ambiente do paciente
(unidades do carregador e cabo de energia) e o paciente.
Não conecte outros componentes externos ao equipamento.
5.1
Requisitos de segurança durante a instalação
ADVERTÊNCIA
A instalação elétrica do local em que o aparelho será instalado e usado deve respeitar a legislação em vigor
e as especificações de segurança relevantes para sistemas elétricos.
Instale o aparelho em um lugar em que ele fique protegido contra batidas e respingos acidentais de água
ou outros líquidos. Não exponha diretamente o aparelho à luz solar ou ultravioleta.
Não instale o aparelho em cima ou perto de fontes de calor. Ao instalar, verifique se há ar suficiente circulando
ao redor do aparelho. Não instale o aparelho perto de solventes ou líquidos inflamáveis, pois eles podem
danificar a embalagem plástica dele.
O plugue do cabo de energia (Direct Plug-In), modelo PSAC05R-050, é considerada um meio de isolamento
do equipamento da rede elétrica. Quando o plugue estiver conectado, o dispositivo de acionamento de energia
deve ser facilmente acessível. Deixe espaço livre suficiente em torno dele. O aparelho não deve ser posicionado
de forma a desconectá-lo (no plugue do dispositivo de acionamento de energia – Switching Power Supply).
Nunca provoque um curto-circuito nos terminais da bateria com objetos metálicos, por causa do risco de
queimaduras, incêndio e explosão.
O aparelho pode ser transportado, mas deve ser manuseado com cuidado. Transporte o aparelho na posição
horizontal. Não deixe que o aparelho seja exposto a agitações ou vibrações. Para informações sobre tamanho
e peso, consulte o item 12 (Especificações técnicas).
ADVERTÊNCIA – RISCO DE EXPLOSÃO
Não instale o aparelho onde haja risco de explosões. O aparelho não deve ser usado em uma atmosfera inflamável (misturas de anestesia, oxigênio, óxido nitroso, etc). Instale o dispositivo em uma área bem ventilada.
5.2
Conexão do carregador à tomada elétrica
1x
O Translux Wave é fornecido com uma unidade de entrada universal separada (6) que aceita
), 50 / 60 Hz.
100 a 240 V (
ADVERTÊNCIA
Antes de conectar o carregador (6) à rede elétrica, verifique se a tensão e a frequência da rede elétrica
correspondem aos valores indicados na placa de identificação do aparelho. A placa de identificação localiza-se
na parte inferior do carregador.
Use somente o cabo de energia fornecido com o aparelho. O uso de qualquer outro adaptador pode resultar em
dano da bateria.
Não ligue o cabo a uma tomada de rede usando um adaptador múltiplo de energia.
OBSERVAÇÃO
A fonte de alimentação do Translux Wave (6) vem com três adaptadores intercambiáveis:
tipo 1
Fig. (6 a) = Europa
Fig. (6 b) = Reino Unido tipo 2
Fig. (6 c) = EUA / Japão tipo 3
1 Selecione o adaptador correto entre os disponíveis: Europa – Tipo 1, Reino Unido – Tipo 2, EUA / Japão – Tipo 3.
PT
2 Cada adaptador tem uma abertura para o encaixe da trava de retenção na fonte de alimentação.
3 Com a abertura virada para a fonte de alimentação, encaixe o adaptador na fonte de alimentação de forma que
as travas do adaptador fiquem alinhadas a suas respectivas aberturas na fonte de alimentação.
- 11 4 Pressionando as duas peças, introduza o adaptador na fonte de alimentação até ouvir um clique e o adaptador
ficar firme no lugar.
OBSERVAÇÃO
Pressionar o adaptador durante a colocação garante que as travas fiquem presas pelos retentores na fonte
de alimentação. Se o adaptador ficar solto, remova-o e reinstale-o.
5 Para remover o adaptador da fonte de alimentação, pressione o botão de trava retentor (marcado com a palavra
“PUSH”), deslize o adaptador da fonte de alimentação e remova-o.
6 Guarde os adaptadores não utilizados para uso futuro.
7 Conecte o plugue do cabo de alimentação na entrada da parte inferior do carregador.
ADVERTÊNCIA
Verifique regularmente o cabo de alimentação, a fonte de alimentação e o adaptador, para garantir
que eles estejam em boas condições.
Se houver algum dano, não use a peça danificada até que ela seja substituída.
Use somente peças ou acessórios originais de reposição da Heraeus Kulzer.
8 Conecte a fonte de alimentação com o adaptador na tomada.
9 O LED VERDE do carregador se acende (ícone
).
5.3
Colocação da bateria no aparelho
O Translux Wave vem com uma potente bateria de íons de lítio recarregável.
A bateria é fornecida separadamente dentro da embalagem do aparelho e deve ser inserida nele antes
da operação inicial.
ADVERTÊNCIA
Siga atentamente as precauções de segurança descritas no item 3.2.3 (BATERIA – Precauções de segurança).
CUIDADO
NUNCA coloque o aparelho no carregador sem a bateria.
Insira a bateria no aparelho na sequência descrita abaixo:
1 Retire a bateria da embalagem.
ADVERTÊNCIA
Nunca provoque um curto-circuito nos terminais da bateria com objetos metálicos,
por causa do risco de queimaduras, incêndio e explosão.
2 Use algo plano (uma moeda, por exemplo) para desparafusar, no sentido anti-horário,
a tampa da bateria do aparelho (Fig. 1 e 2 ).
3 Há uma seta marcada na embalagem da bateria (Fig. 3 ).
OBSERVAÇÃO
Esta seta indica a orientação na qual a bateria deve ser inserida no aparelho.
2x
4 Deslize lentamente a bateria no aparelho, com a seta virada para ele, até que ela pare (Fig. 4 ).
OBSERVAÇÃO
Se a bateria for inserida de forma errada (ou seja, na direção oposta da seta), o aparelho não funcionará.
No caso de a bateria ser inserida da forma errada, nenhum dano será causado à parte eletrônica do
aparelho.
ADVERTÊNCIA
Use somente baterias originais da Heraeus Kulzer. O uso de baterias de outro fabricante ou de baterias
não recarregáveis / primárias é um risco potencial e pode provocar danos irreversíveis ao aparelho.
5 Use algo plano (uma moeda, por exemplo) para parafusar, no sentido horário, a tampa da bateria do aparelho.
OBSERVAÇÃO
O aparelho não funcionará corretamente se a tampa não estiver completamente parafusada.
PT
- 12 -
5.4
Colocação do guia luminoso no aparelho
2x
• Gireoguialuminosoumpouco(1) e insira-o no aparelho (2) até que ele atinja a posição final.
A posição final é atingida quando você ouve um barulho de “clique”.
• Monteoconedeluzprotetor(3) na extremidade superior do guia luminoso.
Posicionamento do guia luminoso
• Gireoguialuminosoatéaposiçãodesejadaparaapolimerização.
• Para fazer pleno uso da intensidade luminosa fornecida, coloque o guia luminoso o mais perto possível do compósito.
Evite o contato direto com o material do compósito!
CUIDADO – Mantenha o guia luminoso limpo em todos os momentos para obter a intensidade
total da luz.
A intensidade da luz é reduzida consideravelmente se:
– O guia luminoso não está em perfeitas condições (riscado ou lascado).
– O guia luminoso não está corretamente colocado no aparelho.
– O guia luminoso tem manchas de compósito.
ADVERTÊNCIA
Um guia luminoso danificado reduz a intensidade da luz e deve ser substituído por um novo imediatamente.
Bordas afiadas podem causar ferimentos graves. Use somente guias luminosos originais da Heraeus Kulzer.
ADVERTÊNCIA – Controle de infecções:
Para tornar o tratamento o mais seguro possível para os pacientes e operadores, o guia luminoso e o cone
de luz protetor devem ser limpos, desinfetados e esterilizados antes de cada tratamento. Siga passo a passo
as instruções indicadas no item 8 – Limpeza, desinfecção e esterilização.
5.5
Carregamento da bateria
CUIDADO – Bateria NOVA: primeira carga
A bateria do Translux Wave vem parcialmente carregada de fábrica.
Portanto, a bateria deve ser totalmente carregada antes do primeiro uso do Translux Wave.
OBSERVAÇÃO – Bateria NOVA: primeira carga
Para a primeira carga, este processo demora cerca de 3 horas. O carregamento de baterias novas ou baterias
armazenadas por um longo período pode levar mais tempo. A bateria atingirá sua capacidade total após alguns
ciclos completos de carga / descarga.
ADVERTÊNCIA – RISCO DE EXPLOSÃO
Use somente o carregador fornecido com o Translux Wave para carregar a bateria.
Nunca tente carregar a bateria usando outro carregador ou fonte de energia, por causa
do risco de explosão e incêndio.
Insira o aparelho com a bateria no carregador do Translux Wave.
2x
Um bipe confirma que os contatos estão na posição correta para o carregamento!
OBSERVAÇÃO IMPORTANTE – Chave de alinhamento
A chave de alinhamento (5), localizada na parte de trás inferior baixo do aparelho,
permite a inserção correta do aparelho no suporte do carregador. Ao inserir o aparelho no carregador,
a chave de alinhamento deve ser alinhada com a ranhura posicionada dentro do carregador.
Processo de carregamento da bateria.
• OLEDverdedestatusdabateriacomeçaapiscarnoaparelho.
• Quandoafasedecarregamentoestiverconcluídaeabateriaestivertotalmentecarregada,oLEDverdedestatus
estará iluminado de forma constante.
OBSERVAÇÃO IMPORTANTE – Bateria com defeito
Se o aparelho detectar algum defeito na bateria durante a fase de carregamento, ele interromperá
o processo de recarga, e o LED de status da bateria piscará em AMARELO.
Nesta condição, um sinal de “bipe” é emitido a cada segundo por um período de 30 segundos.
Substitua a bateria com defeito por uma nova!
ADVERTÊNCIA
Use somente baterias da Heraeus Kulzer!
OBSERVAÇÃO
Quando o aparelho estiver no carregador, seu funcionamento será interrompido. O botão “Iniciar /
Parar”
não funciona.
O aparelho pode ser removido do carregador durante o carregamento; no entanto,
a bateria pode não estar totalmente carregada e isso pode reduzir a duração do funcionamento.
6
Operação
ADVERTÊNCIA – Verifique o estado do aparelho antes de iniciar o tratamento.
Antes de cada tratamento, sempre verifique se o aparelho e os acessórios (guia luminoso e cone
de luz protetor) funcionam corretamente. Se algo for observado durante o tratamento, interrompa-o e entre
em contato com a Heraeus Kulzer ou um agente autorizado local de atendimento ao cliente (consulte
o item 14 – Assistência Técnica). Se houver algum dano, não use o aparelho e seus acessórios.
Antes de usar o Translux Wave, sempre verifique se a intensidade da luz emitida é suficiente para garantir
a polimerização. Verifique a intensidade da luz usando o medidor de luz integrado ao carregador (consulte
o item 6.2 – Medição da intensidade da luz).
ADVERTÊNCIA – Controle de infecções
Primeira utilização
Os acessórios, o guia luminoso e o cone de luz protetor são entregues SEM ESTERILIZAÇÃO e devem
ser esterilizados antes de serem utilizados pela primeira vez.
A cada utilização
Depois de utilizados, os acessórios, o guia luminoso e o cone de luz protetor devem ser reprocessados
antes de serem reutilizados, de acordo com os procedimentos descritos no item 8 (Limpeza, desinfecção
e esterilização).
6.1
Ativação e desativação do ciclo de exposição
O Translux Wave pode operar com dois ciclos de exposição diferentes:
– Exposição com potência constante: ciclo de duração de 10 segundos.
– Exposição com aumento gradual na potência: “Soft-Start” (ciclo de duração de 20 segundos).
O “Soft-Start” significa um aumento na intensidade da luz de 50% a 100% em 2 segundos.
• Seoaparelhoestiverem“Modo de pausa” todos os LEDs de ciclo de duração no aparelho estão desligados),
pressione brevemente o botão “Iniciar / Parar”
para colocar o aparelho em funcionamento.
(Após o reinício, o LED acenderá 10 segundo por padrão).
PT
- 13 -
Polimerização de 10 segundos de exposição
Pressione brevemente o botão “Iniciar / Parar”
. A emissão de luz será ativada.
O LED de 10 segundos mostra que este programa está sendo executado.
Depois que o ciclo de duração for concluído, o aparelho desligará a luz automaticamente.
Sinal sonoro:
Os sinais sonoros (bipes) a seguir são emitidos:
1 bipe ao pressionar o botão “Iniciar / Parar”.
1 bipe no fim da exposição.
PT
- 14 -
Polimerização “Soft-Start” de 20 segundos de exposição
Pressione e mantenha pressionado por pelo menos um segundo o botão “Iniciar / Parar”
. A emissão de luz
será ativada.
O LED de 20 segundos mostra que este programa está sendo executado.
Depois que o ciclo de duração for concluído, o aparelho desligará a luz automaticamente e a unidade retornará
ao modo de 10 segundos (LED de 10 segundos aceso).
Sinal sonoro:
Os sinais sonoros (bipes) a seguir são emitidos:
1 bipe ao pressionar o botão “Iniciar / Parar”.
1 bipe depois de 1 segundo indica ativação do modo “Soft-Start”.
1 bipe após 10 segundos de tempo de exposição.
1 bipe no fim da exposição.
OBSERVAÇÃO
O ciclo de exposição pode ser interrompido a qualquer momento, antes que o tempo de exposição seja
concluído, bastando pressionar novamente o botão “Iniciar / Parar”.
Sinal sonoro:
Um sinal sonoro (bipe) é emitido quando o botão “Iniciar / Parar” é pressionado para interromper
o ciclo de exposição.
6.2
Medição da intensidade luminosa
O carregador do Translux Wave está equipado com um medidor de intensidade de luz integrado (8).
2x
CUIDADO
Antes de cada tratamento, sempre verifique a intensidade da luz usando o medidor integrado
no carregador do Translux Wave.
• Semaplicarpressão,coloqueoguialuminosonahorizontaldiretamentesobreaáreadeteste(8).
Ative o aparelho apertando o botão “Iniciar / Parar”
(independentemente do tempo de exposição selecionado).
A medição da intensidade da luz é imediatamente indicada pelo LED de 2 cores (símbolo
) localizado no canto
inferior direito da área de teste.
LED VERDE: A intensidade da luz é suficiente para o tratamento.
LED AMARELO: A intensidade da luz é insuficiente e o aparelho não deve ser utilizado no momento.
CUIDADO
Caso a intensidade de luz seja insuficiente, por favor realizar os seguintes controles e medidas:
– O guia luminoso não foi inserido no aparelho (consulte o item 5.4 – Colocação do guia luminoso
no aparelho).
– Verifique se o guia luminoso está contaminado ou com defeito.
– Elimine todos os traços de contaminação do guia luminoso (consulte o item 8 – Limpeza, desinfecção
e esterilização) ou substitua o guia luminoso danificado por um novo.
Use somente guias luminosos originais da Heraeus Kulzer.
ADVERTÊNCIA
Se as medidas descritas acima não resolverem o problema, não use o aparelho para nenhum tratamento.
Desligue o aparelho (desconecte o carregador da fonte de energia elétrica) e garanta que não seja possível
ligá-lo novamente por acidente. Entre em contato com uma assistência técnica da Heraeus Kulzer ou com
um técnico qualificado autorizado da Heraeus Kulzer (consulte o item 14 – Assistência Técnica).
6.3
Modo de pausa
O aparelho dispõe de um “Modo de pausa” para minimizar o consumo de energia da unidade.
Quando o aparelho não estiver no carregador, todas as suas funções internas serão automaticamente desligadas
(“Modo de pausa”) se ele não for usado por aproximadamente 5 minutos.
No “Modo de pausa”, os LEDs de ciclo de duração no aparelho são desligados.
Para sair do “Modo de pausa”, aperte o botão “Iniciar / Parar”
.
O aparelho está pronto para operação.
OBSERVAÇÃO
Com o “Modo de pausa” concluído, o aparelho e o visor retornam à última configuração utilizada.
6.4
Informações adicionais sobre as operações do aparelho
OBSERVAÇÃO
Se o aparelho for colocado no carregador antes que o ciclo de polimerização seja finalizado, a emissão
de luz será desligada automaticamente.
Quando o aparelho estiver no carregador, seu funcionamento será interrompido. O botão “Iniciar /
Parar”
não funciona.
O Translux Wave é equipado com microprocessadores que continuamente verificam os parâmetros
otimizados de carregamento da bateria. Portanto, depois de cada tratamento, o aparelho deve ser
armazenado no carregador, independentemente do nível da bateria.
7
Condições de alarme
7.1
Bateria com defeito
No caso de uma bateria com defeito, o LED de status da bateria no aparelho piscará
continuamente AMARELO (Fig. a).
Um som de “bipe” é emitido a cada segundo por um período de 30 segundos.
IMPORTANTE
Esta condição de erro é detectada apenas quando o aparelho está colocado no
carregador.
7.2
LED com defeito
Quando um defeito no LED é detectado pelo microprocessador, o LED “10s” verde de modo
de polimerização que está em uso começa a piscar (Fig. b).
piscando
PT
a
- 15 -
piscando
b
7.3
Proteção contra superaquecimento
Se acontecerem vários ciclos de polimerização em sequência (normalmente após 18 ciclos
consecutivos, cada um com duração de 20 segundos), o sensor interno de sobrecarga de temperatura
pode ser ativado.
Uma vez ativada a proteção de superaquecimento, um sinal acústico (3 bipes) é emitido no final do ciclo de exposição.
A ativação da proteção contra superaquecimento interrompe temporariamente o uso do aparelho por alguns minutos.
Deixe o aparelho esfriar por pelo menos 4 – 5 minutos e depois inicie a próxima exposição,
apertando o botão “Iniciar / Parar”
.
OBSERVAÇÃO
A peça de mão torna-se capacitada a funcionar, ao atingir a temperatura operacional.
Nenhum „reset manual“ é necessário.
7.4
Sensor interno de sobrecarga de temperatura com defeito
No caso de defeito do sensor de temperatura, “4 bipes” são emitidos no início de um ciclo de exposição.
OBSERVAÇÃO
Se ocorrer a falha do Sensor de Temperatura durante um ciclo de exposição,
o software permite que se complete a exposição. No entanto, não será permitido
e “4 bipes” são emitidos.
um novo ciclo de exposição, apertando o botão “Iniciar / Parar”
Qualquer outra operação com defeito no sensor de temperatura de superaquecimento é impedida.
7.5
Sinal de bateria fraca
Quando, depois do uso frequente, a carga da bateria cair para o nível mínimo, o microprocessador do Translux Wave
permite outros poucos ciclos em ciclos de exposição sem necessidade de recarga da bateria.
Esta condição é sinalizada no final de cada ciclo por “2 bipes”.
O ícone da bateria piscará verde. Carregue a bateria!
No fim de alguns ciclos, a carga restante da bateria não permite mais nenhum ciclo de exposição. Esta condição é
sinalizada por “2 bipes”.
O ícone da bateria piscará verde. Carregue a bateria!
8
Limpeza, desinfecção e esterilização
DESLIGAR DA REDE ELÉTRICA
Antes de efetuar os procedimentos de limpeza e desinfecção, desligue o carregador da fonte
de energia elétrica!
ADVERTÊNCIA
Controle de infecções
O guia luminoso e o cone de luz protetor são entregues SEM ESTERILIZAÇÃO e devem ser limpos, desinfetados
e esterilizados (com vapor) antes de serem utilizados pela primeira vez e antes de cada utilização.
Não esterilize o aparelho e o carregador!
Não esterilize a bateria!
8.1
PT
- 16 -
Desmontagem
Retire o cone de luz protetor do guia luminoso.
Remova o guia luminoso: gire um pouco o guia luminoso e o retire do aparelho.
8.2
GUIA LUMINOSO – Limpeza e desinfecção
CUIDADO
Não use instrumentos afiados ou pontiagudos para limpar o guia luminoso, pois eles podem riscar a sua
superfície e, assim, diminuir a transmissão de luz.
Não utilize produtos de limpeza / desinfetantes que contenham ácidos orgânicos, minerais e oxidantes,
peróxido de hidrogênio, cloreto, iodo, brometo e solventes.
1) Imediatamente após o uso, todos os resíduos, como material de compósito, devem ser removidos da superfície
do guia luminoso. Todos os compósitos polimerizados devem ser removidos com o uso de etanol e uma espátula
de plástico ou escova de náilon macia.
2) Desinfete o guia luminoso com um pano limpo e macio sem fiapos, umedecido com uma solução desinfetante
suave com pH neutro (pH 7), de acordo com as especificações do fabricante. Deixe a solução desinfetante secar.
8.2.1 GUIA LUMINOSO – Inspeção antes da esterilização
Antes de prosseguir com o processo de esterilização, verifique cuidadosamente se há superfícies danificadas,
descoloração e contaminação no guia luminoso.
ADVERTÊNCIA
Não use um guia luminoso danificado. Se houver algum dano, substitua o guia luminoso por um novo.
Se o guia luminoso ainda estiver contaminado, repita o procedimento de limpeza e desinfecção.
8.3
CONE DE LUZ PROTETOR – Limpeza e desinfecção
CUIDADO
Não utilize produtos de limpeza / desinfetantes que contenham ácidos orgânicos, minerais e oxidantes,
peróxido de hidrogênio, cloreto, iodo, brometo e solventes.
Limpe e desinfete o cone protetor de luz com um pano macio umedecido com uma solução desinfetante suave
com pH neutro (pH 7), de acordo com as especificações do fabricante. Deixe a solução desinfetante secar.
8.3.1 CONE DE LUZ PROTETOR – Inspeção antes da esterilização
Antes de prosseguir com o processo de esterilização, verifique cuidadosamente se há superfícies danificadas,
descoloração de veias e contaminação no cone de luz protetor.
ADVERTÊNCIA
Não use um cone de luz protetor danificado. Se houver algum dano, substitua o cone de luz protetor
por um novo.
Um cone de luz protetor danificado não consegue oferecer proteção suficiente contra a luz do aparelho.
Se o cone de luz protetor ainda estiver contaminado, repita o procedimento de limpeza e desinfecção.
8.4
GUIA LUMINOSO e CONE DE LUZ PROTETOR – Embalagem antes da esterilização
O guia luminoso e o cone protetor de luz podem ser esterilizados com uma embalagem de esterilização a vapor
descartável de tamanho adequado.
CUIDADO
O guia luminoso e o cone protetor de luz devem ser embalados individualmente em uma única embalagem.
Durante a esterilização de vários instrumentos em um autoclave, não ultrapasse a carga máxima.
ADVERTÊNCIA
Verifique se a embalagem interna é grande o suficiente para acomodar os instrumentos individuais,
sem apertar as vedações ou rasgar a embalagem.
8.4.1 GUIA LUMINOSO e CONE DE LUZ PROTETOR – Esterilização
8.4.1.1 Método de esterilização
• Realizeaesterilizaçãocomautoclaveavapordepré-vácuo.
CUIDADO
Nunca use nenhum outro método de esterilização, por causa da possível incompatibilidade com os materiais
do guia luminoso.
NÃO USE os seguintes métodos de esterilização: Esterilização por óxido de etileno, esterilização por ar quente,
autoclavagem de tipo flash, esterilização STERRAD, sistema STERIS ou sistemas de esterilização similares.
NÃO esterilize o guia luminoso e o cone de luz protetor usando: peróxido de hidrogênio, esterilização por
glutaraldeído, formaldeído e sistema de ácido peracético.
8.4.1.2 Parâmetros de esterilização
• Parâmetros de esterilização mínimos que fornecem um nível de garantia de esterilidade (SAL) de 10 –6.
Tipo de ciclo
Temperatura mínima
Pré-vácuo
132°C + 3°C
(270°F + 5°F)
Tempo mínimo de exposição
(embalagem)
4 minutos
Tempo mínimo
de secagem
20 minutos
CUIDADO
Não ultrapasse 135°C (275°F).
8.5
APARELHO – Limpeza e desinfecção
ADVERTÊNCIA
O aparelho não está protegido contra a penetração de líquidos.
Não derrame líquidos diretamente na superfície e nos contatos do aparelho.
Os produtos de limpeza e desinfetantes não devem entrar no aparelho!
NUNCA mergulhe o aparelho em líquidos.
NUNCA limpe o aparelho com água corrente.
Não esterilize o aparelho. Risco de danos graves, choque elétrico e fogo!
2x
PT
- 17 -
Limpe e seque a embalagem do aparelho com um pano limpo e macio sem fiapos, umedecido com uma solução
desinfetante suave com pH neutro (pH7), de acordo com as especificações do fabricante.
Deixe a solução desinfetante secar sozinha ou seque o desinfetante remanescente na embalagem do aparelho
com um pano limpo e macio sem fiapos.
CUIDADO
Não use solventes como acetona, álcool isopropílico e peróxido de hidrogênio, cloreto, iodo, brometo, fenol ou
outras soluções agressivas para limpar e desinfetar a superfície plástica do aparelho. Essas substâncias podem
ser prejudiciais e causar descoloração e/ou danos nos materiais plásticos do aparelho.
Não use limpadores abrasivos!
IMPORTANTE: limpeza dos contatos do aparelho
Após a limpeza / desinfecção da embalagem plástica, sempre limpe os contatos que estão posicionados
na parte inferior do aparelho. Os contatos do aparelho devem estar sempre sem resíduos de produtos
de limpeza / desinfetantes, compósitos e sujeira.
IMPORTANTE
Os contatos do aparelho devem ser limpos regularmente (pelo menos uma vez por semana) e sempre após
a limpeza e desinfecção da embalagem plástica. Contatos sujos ou expostos a líquidos, como de limpeza
ou desinfetantes, podem afetar o processo de carregamento e impedir que a bateria seja carregada.
Limpe os contatos do aparelho com um pano limpo e macio sem fiapos ou um cotonete de algodão umedecido
com álcool.
CUIDADO
Não use instrumentos afiados ou pontiagudos para limpar os contatos, pois eles podem riscar e danificar a sua
superfície e, assim, reduzir a condutividade.
Antes de voltar a utilizar o aparelho, verifique se a superfície e os contatos estão totalmente secos.
Se necessário, secar os contactos com jato de ar sobre os mesmos.
PT
- 18 -
8.6
CARREGADOR – Limpeza da embalagem
DESLIGAR DA REDE ELÉTRICA
Desconecte a fonte de alimentação da tomada elétrica e do carregador antes da limpeza / desinfecção.
ADVERTÊNCIA
A embalagem do carregador não está protegida contra a penetração de líquidos.
Não derrame líquidos diretamente na embalagem do carregador.
CUIDADO
NÃO esterilize o carregador. Ele não funcionará mais e poderá causar danos graves, choque elétrico e fogo!
Não use solventes como acetona, álcool isopropílico e peróxido de hidrogênio, cloreto, iodo, brometo, fenol
ou outras soluções agressivas para limpar a superfície plástica do carregador. Essas substâncias podem ser
prejudiciais e causar descoloração e/ou danos aos materiais plásticos do carregador.
Não use limpadores abrasivos!
Limpe e seque a embalagem do carregador com um pano limpo e macio sem fiapos, umedecido com um produto
de limpeza suave para superfícies com pH neutro (pH 7), de acordo com as especificações do fabricante.
Seque a embalagem do carregador com um pano limpo e macio.
CUIDADO
Seque o carregador sempre após a limpeza. A umidade dentro do aparelho pode causar danos.
IMPORTANTE
Após a conclusão do procedimento de limpeza, verifique se os contatos no interior do carregador estão
totalmente secos. Se necessário, secar os contactos com jato de ar sobre os mesmos.
8.6.1
CARREGADOR – Limpeza dos contatos
2x
IMPORTANTE
Após a limpeza da embalagem plástica do carregador, sempre limpe seus contatos. Os contatos
do carregador devem estar sempre sem resíduos de produtos de limpeza, compósitos e sujeira.
Os contatos do carregador devem ser limpos regularmente (pelo menos uma vez por semana) e sempre após
a limpeza da embalagem plástica. Contatos sujos ou expostos a líquidos, como de limpeza ou desinfetantes,
podem afetar o processo de carregamento e impedir que a bateria seja carregada.
Limpe os contatos do carregador com um pano limpo e macio sem fiapos ou um cotonete de algodão umedecido
com álcool.
CUIDADO
Não use objetos pontiagudos ou afiados para limpar os contatos do carregador!
Não coloque molhe os contatos!
Não dobre ou modifique a forma dos contatos do carregador durante a limpeza.
Seque os contatos após a limpeza e não encoste peças metálicas e gordurosas neles.
Se necessário, secar os contactos com jato de ar sobre os mesmos.
8.6.2 CARREGADOR – Contatos substituíveis
Contatos do carregador danificados ou muito sujos (que não podem ser limpos com os procedimentos descritos
no item acima) podem impedir a condutividade e, consequentemente, o carregamento da bateria.
Nesse caso, é possível substituir os contatos danificados por novos.
Para obter informações adicionais sobre a substituição de contatos do carregador e o fornecimento de peças
de reposição, entre em contato com a subsidiária local da Heraeus Kulzer.
Instruções de trabalho:
Ferramenta necessária: chave de fenda phillips de tamanho médio.
1. Retire o aparelho da base do carregador.
2. Desligue o carregador da tomada.
3. Retire o fio do carregador.
4. Coloque o carregador de cabeça para baixo.
5. Retire os 2 parafusos da ponte de contatos (veja a capa desdobrável traseira, item 12)
6. Puxe a ponte de contatos.
7. Insira a nova ponte de contatos e repita a operação de forma inversa para a montagem.
CUIDADO
Não dobre ou contamine a nova ponte de contatos!
Tenha cuidado ao fixar e inserir a ponte! Não aperte demais os parafusos!
2x
PT
- 19 -
9
Armazenamento por longo tempo
Armazenamento do aparelho com a bateria durante longos períodos de não utilização. Antes ou depois de um período
de longa inatividade, carregue totalmente a bateria ou armazene-a no carregador em funcionamento. Embora o circuito
de segurança interno da bateria evite a descarga completa, recomenda-se carregar totalmente a bateria pelo menos
uma vez a cada 5 meses de inatividade.
10
Descarte
OBSERVAÇÃO – IMPORTANTE
O aparelho não deve ser descartado no lixo doméstico normal.
Para descartar peças de reposição ou o aparelho, entre em contato com a subsidiária da Heraeus Kulzer
diretamente no seu país.
Descarte guias luminosos e baterias inutilizáveis de acordo com as exigências legais de seu país.
ADVERTÊNCIA – Descarte de baterias vazias ou danificadas
Descarte uma bateria vazia ou danificada conforme o método a seguir, depois de tomar as medidas
necessárias para evitar curto-circuito externo:
Depois de ter isolado os terminais da bateria com fita isolante, faça o descarte de acordo com as orientações
da prefeitura.
As condições e medidas de precaução para o descarte do aparelho estão sujeitas às disposições legais válidas
semelhantes a qualquer outro aparelho eletrônico que ficou inutilizável.
Descarte de equipamentos antigos de acordo com as diretrizes européias WEEE ou
equipamentos elétricos e eletrônicos (Lei alemã ElektroG).
11
Solução de problemas
ADVERTÊNCIA
Se os passos abaixo não resolverem o problema, entre em contato com a Heraeus Kulzer ou um agente
autorizado local de atendimento ao cliente: NÃO USE o Translux Wave e NÃO TENTE consertar o aparelho,
pois isso pode causar ferimentos graves.
Se o aparelho não estiver funcionando corretamente, leia de novo este manual do usuário e depois verifique
a tabela a seguir:
PROBLEMA
CAUSA POSSÍVEL
O carregador não liga.
A fonte de alimentação não está ligada
do carregador está à tomada elétrica e/ou à entrada do
O LED VERDE
carregador.
desligado.
Tomada elétrica sem tensão.
O adaptador intercambiável não está
colocado corretamente na entrada da
fonte de alimentação.
O cabo da fonte de alimentação está
danificado.
PT
- 20 -
SOLUÇÃO
Verifique se a fonte de alimentação está
firmemente conectada à tomada elétrica
e à entrada do carregador.
Use uma tomada diferente.
Leia atentamente o item 5.2 deste
manual.
Substitua a fonte de alimentação por
uma nova (a fonte de alimentação e seu
cabo não podem ser separados).
A fonte de alimentação está com defeito. Substitua a fonte de alimentação por
uma nova.
O carregador está com defeito.
Entre em contato com a Heraeus Kulzer
ou um agente autorizado local de
atendimento ao cliente.
Os contatos do carregador estão em
Elimine a causa do curto-circuito.
curto.
Se a condição de curto-circuito persistir,
substitua os contatos por novos.
Consulte o item 8.6.2.
Aparelho NÃO inserido no carregador. Aparelho sem bateria.
Insira a bateria no aparelho
(consulte o item 5.3).
A emissão de luz não funciona quando
Aperte o botão “Iniciar / Parar” para
Aparelho em “Modo de pausa”.
o botão “Iniciar / Parar”
é
tirar o aparelho do “Modo de pausa”.
pressionado e nenhuma informação
Consulte o item 6.3.
aparece no visor do aparelho.
Bateria descarregada.
Coloque o aparelho no carregador
e recarregue a bateria
Não há carga suficiente na bateria para
(consulte o item 5.5).
ligar o aparelho.
Defeito na parte eletrônica.
Entre em contato com a Heraeus Kulzer
ou um agente autorizado local de
atendimento ao cliente.
Bateria com defeito.
Para verificar se a bateria está com defeito, coloque o aparelho no carregador.
A “sequencia de pré-qualificação”
começa com a verificação do status
da bateria pelo micro-processador
do Translux Wave. Esta sequencia de
pré-qualificação pode durar até no max.
30 minutos.
Se, durante esta sequencia de verificação, um “sinal sonoro” for emitido
a cada segundo por um período de
30 segundos e o ícone da bateria na
peça de mão estiver piscando em
amarelo, a bateria é considerada /
detectada com defeito.
Substitua a bateria por uma nova
(Consulte o item 5.3).
Os “2 bipes” sinalizam que o nível de
“2 bipes” são emitidos no fim do ciclo Carga de bateria baixa.
de exposição.
carga residual da bateria é adequado
apenas para alguns ciclos de exposição
adicionais.
Coloque o aparelho no carregador
e recarregue a bateria
(consulte o item 5.5).
PROBLEMA
A emissão de luz não inicia quando
estiver
o botão “Iniciar / Parar”
pressionado ou durante um ciclo de
exposição, quando a emissão de luz
for interrompida com o som de um
bip. A luz LED “10s“ da peça de mão
começa a picar VERDE.
CAUSA POSSÍVEL
O conjunto de LEDs pode estar com
defeito.
piscando
Após vários ciclos de exposição consecutivos, a emissão de luz não liga
quando o botão “Iniciar / Parar”
é pressionado, e “3 bipes” são
emitidos.
Proteção contra superaquecimento.
O aparelho ficou superaquecido no
decorrer do uso e ativou o sensor de
sobrecarga de temperatura.
A ativação da proteção contra superaquecimento impede temporariamente
(por alguns minutos) o uso do aparelho.
Proteção contra superaquecimento.
O aparelho ficou superaquecido no
decorrer do uso e ativou o sensor de
sobrecarga de temperatura.
A ativação da proteção contra superaquecimento impede temporariamente
(por alguns minutos) o uso do aparelho.
Problemas durante o carregamento. Durante a fase de pré-qualificação
da bateria (condição da bateria:
Um sinal de „bipe“ é emitido a cada
segundo por um período de 30 segun- completamente vazia, consulte
os itens 4.2.4 e 5.5).
dos e o LED de status da bateria,
na peça de mão, pisca AMARELO.
A parte eletrônica detecta um status
de defeito da bateria e interrompe
o carregamento.
Durante um ciclo de exposição,
“3 bipes” são emitidos.
piscando
Aparelho colocado no carregador,
mas o carregamento não é iniciado.
O LED de status da bateria no
aparelho está desligado.
A intensidade da luz medida com
o medidor integrado no carregador
é insuficiente.
O LED
AMARELO.
no carregador está
Defeito: interrupção dos contatos de
carregamento.
Falha no contato entre o carregador
e o aparelho.
SOLUÇÃO
Verifique a funcionalidade do LED por
meio do seguinte procedimento:
Insira peça de mão no carregador e
pressione o botão “Iniciar / Parar”
consecutivamente por 5 vezes.
Retire a peça de mão do carregador.
A luz LED “10s“ da peça de mão
começa a picar VERDE, a peça de mão
foi reiniciada.
A luz LED “10s“ na peça de mão
fica novamente piscante no início do
próximo ciclo de exposição e não há
nenhuma emissão de luz, o conjunto de
LED está com defeito.
Neste caso, entre em contato com Heraeus Kulzer ou agente autorizado local de
Atendimento ao Cliente.
Deixe o aparelho esfriar por pelo
menos 4 – 5 minutos e depois inicie
a próxima exposição, apertando o botão
“Iniciar / Parar”.
Nota: A peça de mão torna-se capacitada a funcionar, ao atingir a temperatura
operacional. Nenhum „reset manual“ é
necessário.
Deixe o aparelho esfriar por pelo
menos 4 – 5 minutos e depois inicie
a próxima exposição, apertando o botão
“Iniciar / Parar”.
PT
- 21 -
Substitua a bateria por uma nova
(consulte o item 5.3).
2x
Consulte os itens 8.5 e 8.6.2.
Verifique se o aparelho foi inserido no
carregador com a orientação correta.
Chave de alinhamento.
Consulte o item 4.2.1, pontos 4 e 5.
Os contatos do aparelho e/ou carregador Limpe os contatos do aparelho e do carestão sujos.
regador. Consulte os itens 8.5 e 8.6.1.
O guia luminoso não está corretamente
Verifique se o guia luminoso está comcolocado no aparelho.
pletamente colocado no cone de metal
do aparelho.
Saída do guia luminoso contaminada por Limpe a saída do guia luminoso.
materiais estranhos ou resíduos de compó- Consulte o item 8.2.
sitos que podem interferir na saída de luz.
Guia luminoso com defeito ou desgaste. Substitua o guia luminoso por um novo.
12
PT
- 22 -
Especificações técnicas
Classificação de acordo com a diretiva 93/42/EC: Classe I (um)
Normas de segurança:
O produto foi testado e está em conformidade com a norma
IEC 60601-1 (segunda edição) e com IEC 60601-1-1.
O produto foi testado e está em conformidade com a norma
IEC 60601-1 (terceira edição) e IEC 60601-1-2
(terceira edição – para compatibilidade eletromagnética – EMC).
A peça de mão é para uso em paciente enquanto que a unidade
de carga e o adaptador de alimentação não devem ser utilizados
no ambiente do paciente.
Observação: O ambiente do paciente é compreendido pela
área de 1,5 m ao redor dele (de acordo com IEC 60601-1,
terceira edição e IEC 60601-1-1).
Classificação de acordo com a IEC 60601-1:
Classe II, Tipo B, Parte Aplicada: guia de luz com cone de proteção.
IP 20 (Carregador).
IP 20 (Translux Wave)
Carregador:
Carregador do Translux Wave
Alimentação para o carregador:
Cabo de energia (Direct Plug-In) fabricados por:
Phihong Technology CO LTD – Modelo: PSACO5R-050.
Entrada: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Saída: 5 V
– 1 A Max –
.
O equipamento de classe II
Alimentação para o aparelho:
Bateria de íons de lítio recarregável.
Fabricante: Panasonic. Modelo: NCR-18500.
Tensão nominal: 3,6 V.
A capacidade nominal (Típico): 2000 mAh
Aparelho:
Modelo: Translux Wave.
Operação: Serviço intermitente: 120 s ON – 40 s OFF –
max 2 vezes seguidas
Fonte de luz:
LED de alta luminosidade.
Produto de LED da classe 2M (IEC 60825-1).
Intervalo de comprimento de onda: 440 – 480 nm.
Comprimento de onda dominante: Mín. 440 nm – Max. 465 nm
Guia luminoso:
Haste de múltiplos núcleos sem chumbo, 8 mm de diâmetro.
Esterilizável em autoclave a vapor de pré-vácuo:
4 minutos (no mínimo) a temperatura mínima de 132°C + 3°C
(270°F + 5°F). Máx. 500 ciclos
Ciclos de exposição configuráveis:
10 segundos de tempo de exposição.
– Exposição Normal
Sinais sonoros:
1 bipe no início da exposição.
1 bipe no fim da exposição
– Exposição modo “Soft-Start”
20 segundos de tempo de exposição. (O “Soft-Start” significa um
aumento na intensidade da luz de 50% a 100% em 2 segundos.)
Sinais sonoros:
1 bipe no início da exposição.
1 bipe depois de 1 segundo para a indicação de ativação
do modo „Soft-Start“.
1 bipe após 10 segundos de exposição.
1 bipe no fim da exposição
Tempo de carregamento de uma bateria vazia: Cerca de 3 horas
Condições ambientais do aparelho:
Operação
Transporte
Temperatura
Umidade relativa
Pressão atmosférica
10°C – 35°C
(50°F – 95°F)
45% – 85%
800 – 1060 hPa
e armazenamento
–20°C – 40°C
(–4°F – 104°F)
45% – 85%
500 – 1060 hPa
Carregador: peso de 450 g.
Dimensões: C 140 x L 58 x A 62 mm
Aparelho: peso de 150 g (incluindo guia luminoso).
Dimensões: C 275 mm, máx. Ø 24 mm
Peso e dimensões:
12.1
Compatibilidade eletromagnética EN 60601-1-2
ADVERTÊNCIA
O aparelho exige medidas especiais CEM que devem ser instaladas e ativadas de acordo com as instruções
descritas nesta seção.
Equipamentos de comunicação de rádio móveis e portáteis podem afetar o funcionamento correto do aparelho.
Instruções e declaração do fabricante – emissões eletromagnética
O Translux Wave destina-se à utilização no ambiente eletromagnético especificado abaixo.
O cliente ou o usuário do Translux Wave deve utilizá-lo apenas nesse ambiente.
Verificação de emissões
ConformiMeio eletromagnético – instruções
dade
Emissões de RF CISPR 11
Grupo 1
O Translux Wave usa energia de radiofrequência apenas para o
funcionamento interno. Portanto, as emissões de RF são muito
baixas e não devem causar qualquer interferência em equipamentos eletrônicos nas proximidades.
Emissões de RF CISPR 11
Classe B
O Translux Wave é adequado para ser utilizado em todos os
edifícios, inclusive, em residenciais e edifícios ligados diretamente
Emissões harmônicas IEC 61000-3-2
Classe A
à rede pública de distribuição em baixa tensão, que abastece
Emissões de flutuação de tensão /
Conforme
edifícios de uso particular.
Flicker IEC 61000-3-3
Instruções e declaração do fabricante – imunidade eletromagnética
O Translux Wave destina-se à utilização no ambiente eletromagnético especificado abaixo.
O cliente ou o usuário do Translux Wave deve utilizá-lo apenas nesse ambiente.
Verificação
Valor de ensaio IEC 60601
Valor de conformidade
Meio eletromagnético –
de imunidade
instruções
Descargas
±6 kV contato
O dispositivo continua
Os pavimentos devem ser de
eletrostáticas (ESD)
a funcionar corretamente
madeira, betão ou cerâmica. Se os
±8 kV ar
IEC 61000-4-2
e com segurança.
pavimentos forem recobertos com
material sintético, a umidade relativa
deverá ser, no mínimo, de 30%.
Perturbações elétricas, ±2 kV para linhas de potência O dispositivo continua
A qualidade da tensão de rede deverá
rápidas, transientes /
ser igual à existente tipicamente
±1 kV para linhas de entrada / a funcionar corretamente
Bursts de acordo com
e com segurança.
numa zona comercial ou hospitalar.
saída
IEC 61000-4-4
A qualidade da tensão de rede deverá
Impulsos
±1 kV tensão diferencial
O dispositivo continua
ser igual à existente tipicamente
IEC 61000-4-5
a funcionar corretamente
±2 kV tensão de modo
numa zona comercial ou hospitalar.
e com segurança.
comum
Intermitências de
< 5% UT (> 95% de queda UT) O aparelho pode mostrar
A qualidade da tensão de rede
tensão, breves interdurante 0,5 ciclos
efeitos irregulares durante
deverá ser igual à existente
rupções e variações da 40% UT (60% de queda UT)
a operação, desde que seja tipicamente numa zona comercial
tensão nas linhas de
operado de forma segura,
ou hospitalar.
durante 5 ciclos
alimentação elétrica
sem surgimento de nenhum
70% UT (30% de queda UT)
IEC 61000-4-11
defeito e contanto que o
durante 25 ciclos
utilizador possa colocá-lo
< 5% UT (> 95% de queda UT) de volta ao estado de
funcionamento anterior.
em 5 seg.
Campo magnético
de frequência de rede
(50 / 60 Hz)
IEC 61000-4-8
3A/m
O dispositivo continua
a funcionar corretamente
e com segurança.
NOTA: UT é a tensão da rede alternada antes da utilização do valor de ensaio.
Os campos magnéticos de frequência de rede devem apresentar
os níveis característicos de um
espaço típico numa zona comercial
ou hospitalar.
PT
- 23 -
PT
- 24 -
Instruções e declaração do fabricante – imunidade eletromagnética
O Translux Wave destina-se à utilização no ambiente eletromagnético especificado abaixo.
O cliente ou o usuário do Translux Wave deve utilizá-lo apenas nesse ambiente.
Verificação de Valor de
Valor de
Meio eletromagnético – instruções
imunidade
ensaio
conformidade
IEC 60601
Alta frequência 3 Veff de
O dispositivo
Os telefones celulares de alta frequêncianão devem ser utilizados nas
conduzida
150 kHz até
continua a
proximidades do produto ou de uma parte deste, incluindo os cabos,
IEC 61000-4-6 80 MHz
funcionar
exceto se forem respeitadas as distâncias de separação recomendacorretamente
das, que são calculadas através da equação que pode ser utilizada
Alta frequência 3 V / m de
e com segupara a frequência do emissor.
irradiada
80 MHz até
rança.
Distâncias de separação recomendadas
IEC 61000-4-3 2,5 GHz
d = 1,2 √P
d = 1,2 √P de 80 MHz até 800 MHz
d = 2,3 √P de 800 MHz até 2,5 GHz
onde (P) é a máxima potência nominal de saída do emissor em Watt
(W) de acordo com o fabricante do emissor e (d) a distância de
separação recomendada em metros (m). A intensidade de campo dos
emissores de alta frequência fixos, tal como determinada numa
verificação eletromagnética do local, deve ser inferior ao valor
de conformidade em cada intervalo de frequência (b).
Podem surgir interferências nas proximidades de
equipamentos identificados através do seguinte símbolo:
Nota:
(1) A 80 MHz e 800 MHz é válida a gama de frequências mais elevada.
(2) É possível que estas diretivas não possam ser aplicadas em todos os casos. A difusão de grandezas eletromagnéticas
é influenciada pela absorção e reflexão de estruturas, objetos e pessoas.
a) A intensidade de campo de emissores estacionários, como, p.ex., estações base de radiotelefones e radio-comunicadores móveis, estações de rádio amador, emissoras de rádio em AM e FM e de televisão, na teoria, não podem ser
predefinidos com precisão. Para averiguar o meio eletromagnético com respeito aos emissores estacionários, deverá
fazer-se um estudo do local. Se a intensidade de campo, medida no local em que o produto é utilizado, exceder os
valores de conformidade acima, deverá observar-se o produto para comprovar o funcionamento segundo a finalidade a
que se destina. Se forem observadas características de desempenho fora do comum, poderão ser necessárias medidas
adicionais, como, p.ex., um ajuste modificado ou um outro local de permanência do produto.
b) Sobre a gama de frequências de 150 kHz até 80 MHz, a intensidade de campo deverá ser inferior a 3 V / m.
Distâncias de separação recomendadas entre rádio-comunicadores portáteis e telefones celulares e o Translux Wave
O funcionamento do Translux Wave está previsto para um meio eletromagnético, em que as interferências emitidas
por alta frequência estão sob controle. O cliente ou o utilizador do Translux Wave pode prevenir interferências
eletromagnéticas, mantendo uma distância mínima entre os rádio-comunicadores e telemóveis por radiofrequência portátil
(emissor) e o Translux Wave, de acordo com as recomendações indicadas em baixo relativas à máxima potência de saída
dos aparelhos de comunicação.
Distância de proteção em função da frequência de emissão (m)
Máxima potência de saída
nominal do emissor (W)
de 150 kHz até 80 MHz
de 80 MHz até 800 MHz
de 800 MHz até 2,5 GHz
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
Para os emissores cuja máxima potência de saída nominal não se encontra indicada em cima, a distância recomendada (d)
em metros (m) pode ser calculada com base na equação a aplicar à frequência do emissor, onde (P) é a máxima potência de
saída nominal do emissor em Watt (W) segundo o fabricante do emissor.
Nota:
(1) Para 80 MHz e 800 MHz é aplicado o máximo intervalo de frequência.
(2) É possível que estas diretivas não tenham de ser aplicadas em todas as situações. A difusão eletromagnética é influenciada pela absorção e a reflexão de estruturas, de objectos e de pessoas.
12.2
Placa de identificação do carregador
Descrição dos símbolos na placa de identificação
1 Marca CE.
2 Cuidado, consulte os documentos que acompanham o aparelho.
3 Consulte as instruções de uso.
4 Isolamento duplo (o aparelho está em conformidade
com a classe de segurança II).
5 Descarte de equipamentos elétricos e eletrônicos antigos.
(Aplicável na Comunidade Europeia e em outros países
europeus com sistemas de coleta seletiva.)
6 Marca MET.
12.3 Númerodesériedoaparelho
O número de série do aparelho está gravado
na parte inferior da embalagem.
Número de
série gravado.
13
1
2
3
4
5
6
Garantia
Para garantir o perfeito funcionamento, cada aparelho Heraeus Kulzer é sujeito a uma inspeção e controle final rígido
antes da entrega. A Heraeus Kulzer dá uma garantia de 2 (dois) anos a partir da data de aquisição, para todos os produtos Heraeus Kulzer adquiridos em estado novo num revendedor ou importador Heraeus Kulzer, que abrange defeitos
do material e de produção. Durante o prazo de garantia, a Heraeus Kulzer obriga-se a reparar (ou, ao seu critério,
a substituir) gratuitamente, os componentes dos produtos considerados defeituosos. A substituição total de produtos
Heraeus Kulzer não está prevista.
A Heraeus Kulzer não se responsabiliza, de forma alguma, pelos eventuais danos pessoais ou materiais diretos
ou indiretos nos seguintes casos:
PT
• Oaparelhonãofoiutilizadodeacordocomafinalidadedeutilizaçãoprevista.
• Oaparelhonãofoiutilizadodeacordocomasinstruçõeseregulamentosconstantesdopresentemanual.
- 25 • Ainstalaçãoelétricanolocaldeoperaçãodoaparelhonãocorrespondeàlegislaçãoemvigoreaosrespectivos
regulamentos.
• Amontagem,adaptação,regulagem,modificaçãooureparonãoforamefetuadosporpessoalespecializado
e indicado pela Heraeus Kulzer.
• Ascondiçõesambientaisdolocalusadoparaarmazenagemdoaparelhonãocorrespondemaosregulamentos
constantes no item 12 (Especificações técnicas).
Danos de transporte, danos provocados pelo uso indevido ou por negligência, danos provocados pela ligação em
tensão de rede não prevista, bem como danos em lâmpadas de controle, botões e em todos os acessórios estão
excluídos da garantia. A garantia caducará se o aparelho for modificado ou reparado por outras pessoas que não
a assistência técnica autorizada e indicada pela Heraeus Kulzer. Para reclamar os direitos de garantia, o cliente deverá
entregar o equipamento danificado aos cuidados do revendedor ou importador da Heraeus Kulzer, onde adquiriu
o aparelho. O aparelho deve ser enviado empacotado adequadamente, incluindo todos os acessórios (se possível,
na embalagem original).
Uma ficha deve ser colocada com o aparelho em caso de devolução, contendo as seguintes informações:
a) Nome, endereço e número para contato do proprietário.
b) Nome e endereço do revendedor / importador.
c) Fotocópia da nota de entrega ou comprovante de compra do aparelho pelo proprietário, devendo constar,
além da data, a descrição do aparelho e o número de série.
d) Descrição da falha de operação.
A garantia não cobre transporte e eventuais danos de transporte.
Em caso de danos provocados por acidentes ou uso indevido, ou que ocorram após findo o prazo de garantia,
os serviços de reparo serão orçados de acordo com os custos do material e da mão-de-obra.
14
Assistência Técnica
14.1
Concessionários de serviços / contatos internacionais
15
Histórico do documento
1x
2012-08 Versão preliminar para protótipos.
2013-09 Primeira edição.
2014-03 Mudanças editoriais o item 2.1, 3.2.1, 7.2, 10, 11, 12 e 12.2.
PT
- 26 -
Sujeito a modificações.
Última revisão: 2014-03
Inhoud
1
1.1
1.2
1.3
Toepassing ______________________________________________________________________
Algemeen _____________________________________________________________________
EG-conformiteitsverklaring _________________________________________________________
Verklaring van de fabrikant __________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Instructies voor veilig gebruik van het apparaat __________________________________________
Verklaring van symbolen en bijbehorende tekst __________________________________________
Transportschade – Uitpakken en inspecteren ____________________________________________
Plichten van de eigenaar ___________________________________________________________
Logboek ______________________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Beoogd gebruik ___________________________________________________________________
Beschrijving van het apparaat ______________________________________________________
Veiligheidsvereisten ______________________________________________________________
Algemene instructies voor veilig gebruik van het apparaat __________________________________
Veiligheidsvoorschriften ___________________________________________________________
ACCU – Veiligheidsvoorschriften _____________________________________________________
ACCU – Informatie _______________________________________________________________
AANSPRAKELIJKHEID _____________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Beschrijving van het apparaat ________________________________________________________ 8
Inhoud van de verpakking _________________________________________________________
8
Beschrijving van de controle- en bedieningselementen ____________________________________
8
Handstuk _____________________________________________________________________
8
Uitlijnpunt _____________________________________________________________________
8
Oplader _______________________________________________________________________
8
Geluidssignalen van het handstuk ____________________________________________________
9
Led-informatie over uitgezonden straling ______________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installatie en eerste gebruik _________________________________________________________
Veiligheidseisen tijdens installatie ____________________________________________________
Aansluiting van de oplader op het stopcontact ___________________________________________
De accu in het handstuk plaatsen ____________________________________________________
De lichtgeleider in het handstuk schuiven ______________________________________________
Accu opladen ___________________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Bediening _______________________________________________________________________
De belichtingscyclus activeren en deactiveren ___________________________________________
De lichtintensiteit meten __________________________________________________________
Slaapmodus ___________________________________________________________________
Aanvullende informatie over de bediening van het apparaat _________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Waarschuwingsfuncties ____________________________________________________________
Defecte accu ___________________________________________________________________
Defecte LED ____________________________________________________________________
Bescherming tegen oververhitting ___________________________________________________
INGEBOUWDE temperatuursensor defect _______________________________________________
Signaal accu bijna leeg ___________________________________________________________
15
15
15
15
15
16
OPMERKING
De afbeelding van een boek verwijst naar de
afbeeldingen in het hoofdstuk en aanvullende
informatie die u op de uitgevouwen omslag vindt.
HKG-Layout 99000943_01 GBA
1x /2x
Vouw
vooromslag uit
Vouw
achteromslag uit
07NL
Translux Wave EU
Dateiname: 01DE_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
NL
-1-
NL
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Reiniging, desinfectie en sterilisatie ___________________________________________________
Demontage ____________________________________________________________________
LICHTGELEIDER – Reiniging en desinfectie _____________________________________________
LICHTGELEIDER – Inspectie vóór de sterilisatie __________________________________________
BESCHERMKAPJE – Reiniging en desinfectie ____________________________________________
BESCHERMKAPJE – Inspectie vóór sterilisatie ___________________________________________
LICHTGELEIDER en BESCHERMKAPJE – Verpakking vóór de sterilisatie _________________________
LICHTGELEIDER en BESCHERMKAPJE – Sterilisatie _______________________________________
Sterilisatiemethode ______________________________________________________________
Sterilisatieparameters ____________________________________________________________
HANDSTUK – Reiniging en desinfectie ________________________________________________
OPLADER – Reiniging van behuizing __________________________________________________
OPLADER – Reiniging van contactpunten ______________________________________________
OPLADER – Verwisselbare contactpunten ______________________________________________
16
16
16
16
16
17
17
17
17
17
17
18
18
19
9
Opslag __________________________________________________________________________ 19
10
Afvalverwerking __________________________________________________________________ 19
11
Problemen oplossen _______________________________________________________________ 20
12
12.1
12.2
12.3
Technische specificaties ___________________________________________________________
Elektromagnetische compatibiliteit EN 60601-1-2 ________________________________________
Identificatieplaatje van de oplader ___________________________________________________
Serienummer van handstuk ________________________________________________________
13
Garantie ________________________________________________________________________ 25
14
14.1
Service __________________________________________________________________________ 26
Servicepartner / contactpersoon in de regio _____________________________________________ 26
15
Documentenhistorie ________________________________________________________________ 26
22
23
25
25
-2-
OPMERKING
De afbeelding van een boek verwijst naar de
afbeeldingen in het hoofdstuk en aanvullende
informatie die u op de uitgevouwen omslag vindt.
1x /2x
Vouw
vooromslag uit
Vouw
achteromslag uit
1
Toepassing
1.1
Algemeen
Translux Wave is een geregistreerd handelsmerk van Heraeus Kulzer GmbH.
Deze gebruiksaanwijzing geldt voor:
Bestel-nr.
66055012
Type en uitrusting
Translux Wave – LED-Polymerisatielamp
Uitgave
2014-03 / 99000943/01
1.2
EG-conformiteitsverklaring
Hiermee verklaren wij, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, dat het hierna beschreven apparaat
qua concept en constructie alsook de door ons op de markt gebrachte uitvoering aan de betreffende fundamentele
veiligheids- en gezondheidsbepalingen van de EG-richtlijn voldoet.
Bij een niet met ons overeengekomen wijziging van het apparaat verliest deze verklaring haar geldigheid.
1.3
Verklaring van de fabrikant
Hierbij verklaren wij, dat het apparaat Translux Wave voldoet aan richtlijn 93/42 EG en de normen IEC 60601-1
en IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Duitsland).
2
Instructies voor veilig gebruik van het apparaat
Lees deze handleiding goed door en volg de instructies zorgvuldig op. De woorden WAARSCHUWING, VOORZICHTIG
en OPMERKING verwijzen naar belangrijke informatie die u aandachtig dient te lezen (zie de volgende paragraaf).
Zorg ervoor dat u deze handleiding altijd binnen handbereik heeft.
2.1
Verklaring van symbolen en bijbehorende tekst
Symbolen
Bijbehorende tekst
Verklaring
WAARSCHUWING
Impliceert dat niet opvolgen van het advies de dood of ernstig letsel tot
gevolg kan hebben.
VOORZICHTIG
Impliceert dat niet opvolgen van het advies licht letsel of beschading aan het
apparaat tot gevolg kan hebben.
OPMERKING
Impliceert dat het advies niet aan schade gerelateerd is.
WAARSCHUWING
EXPLOSIEGEVAAR
WAARSCHUWING explosiegevaar – volg de informatie en waarschuwingen
in de hoofdstukken en secties die zijn gemarkeerd met dit symbool.
STEKKER UIT
STOPCONTACT
WAARSCHUWING voor elektrische schok.
Haal de stekker van de oplader uit het stopcontact voordat
u de reinigings- en desinfectieprocedures uitvoert!
MET-markering – UL / CSA conformiteit.
MET
WEEE / ElektroG
Afvoeren van oude apparaten conform de WEEE (Europese Richtlijn) of
Elektrische en Elektronische Apparatuur Wet (Duitse ElektroG-wet).
Patiëntdeel:
Type B-patiëntdeel – conform de technische norm IEC 60601-1.
Dubbele isolatie:
Klasse II-apparaat.
Voeding:
Wisselstroom.
Gelijkstroom.
Polariteit oplaadstation – centrum positief.
Gebruik alleen binnenshuis.
NL
-3-
Symbolen
Bijbehorende tekst
Verklaring
Apparaat vervaardigd conform richtlijn 93/42/EG inclusief technische normen
IEC 60601-1 en IEC 60601-1-2.
WAARSCHUWING “LED-straling”.
Volg de informatie en wees alert op de gevaren die worden genoemd in
paragraaf 4.2.5.
Raadpleeg gebruiksinstructies.
VOORZICHTIG, raadpleeg bijbehorende documenten.
Bedieningsknop:
“Start / Stop”.
Registratiecertificaat conform de vereisten van het Ministerie van Gezondheid
van de Russische Federatie.
Stel het apparaat niet bloot aan regen.
Temperatuurbereik bij opslag (–20°C (–4°F) tot 40°C (104°F)).
Vochtigheidsbereik bij opslag (45% – 85% relatieve vochtigheid).
Bereik atmosferische druk bij opslag (500 – 1060 hPa).
NL
-4-
2.2
Transportschade – Uitpakken en inspecteren
Het apparaat is gevoelig voor stoten, omdat het elektronische onderdelen bevat. Daarom moet zowel bij het transport
als bij de opslag uitermate voorzichtig te werk worden gegaan. De door Heraeus Kulzer verzonden goederen worden
voor het verzenden zorgvuldig gecontroleerd. Het apparaat wordt goed beschermd en verpakt geleverd.
Controleer na ontvangst van de levering het apparaat op transportschade. Indien schade wordt vastgesteld moet dit
uiterlijk 24 uur na de uitlevering aan de transportonderneming worden gemeld. U dient onder geen beding beschadigde
apparatuur en / of toebehoren te installeren of te gebruiken.
2.3
Plichten van de eigenaar
Naast het volgen van de wettelijke voorschriften is de eigenaar eveneens verplicht zorg te dragen voor het naleven
en toepassen van de wettelijk geldende bepalingen voor de werkplek zoals bijv. de opleidingsplicht, de wettelijke
maatregelen ter bescherming van de werknemer en alle overige geldende voorschriften en wetten.
Voor de werkzaamheden aan en met het apparaat moeten aan de hand van de gebruiksaanwijzing en gebaseerd
op de uit te voeren werkzaamheden door de eigenaar schriftelijke instructies in een duidelijke vorm worden opgesteld
en moeten deze aan de gebruikers in hun eigen taal worden bekend gemaakt.
2.4
Logboek
We raden u aan een “apparaatlogboek” bij te houden, waarin u alle tests en belangrijke werkzaamheden noteert
(zoals onderhoud en wijzigingen).
3
Beoogd gebruik
De Translux Wave is een tandheelkundige LED-uithardingslamp die bedoeld is voor gebruik in de mondholte voor
de polymerisatie van lichtuithardende tandheelkundige materialen zoals adhesieven en vulmaterialen die worden
geactiveerd op een golflengte van 440 – 480 nm.
OPMERKING
De meeste lichtuithardende tandheelkundige materialen worden binnen dit golflengtebereik geactiveerd.
Controleer echter in geval van twijfel de specificaties van de fabrikant of neem contact op met de fabrikant.
WAARSCHUWING – Gekwalificeerde specialisten.
Het apparaat mag alleen worden gebruikt door speciaal hiervoor opgeleid personeel en de tandarts
(zie paragraaf 2.3, Plichten van de eigenaar). Als het apparaat op de juiste manier wordt gebruikt,
zijn er geen bijwerkingen bekend.
3.1
Beschrijving van het apparaat
Als lichtbron gebruikt de Translux Wave gebruikt een zeer efficiënte eenkleuren-LED met een golflengte tussen
de 440 en 480 nm.
Al het licht dat wordt uitgestraald door de Translux Wave, wordt gebruikt om de kamferchinon fotoinitiator te activeren.
Dit levert uitstekende polymerisatieresultaten op met een lagere warmte-emissie.
De Translux Wave wordt geleverd met een 360° draaiende lichtgeleider met een diameter van 8 mm.
De Translux Wave bestaat uit een oplader en een handstuk, dat wordt gevoed door een verwisselbare en oplaadbare
lithium-ion-accu.
Het handstuk beschikt over een “Slaapmodus” om het energieverbruik van het apparaat te minimaliseren.
De “Slaapmodus” wordt geactiveerd als het handstuk gedurende een periode van ongeveer 5 minuten
niet is gebruikt.
De Translux Wave heeft twee belichtingscycli:
• Belichting met constante intensiteit: cyclus van 10 seconden.
• Belichting met een langzaam toenemende intensiteit: “Soft-Start” (cyclus van 20 seconden).
Bij “Soft-Start” neemt de lichtintensiteit binnen 2 seconden toe van 50% tot 100%.
OPMERKING – Houd u aan de door de fabrikant van de materialen opgegeven belichtingstijd.
Herhaal de belichting zo nodig enkele malen voor materialen met een specifieke belichtingstijd
(bijvoorbeeld 30 / 40 seconden voor donkere composieten).
3.2
Veiligheidsvereisten
De effectiviteit van de veiligheidsinstructies met betrekking tot de persoonlijke veiligheid, de omgang met het
apparaat en de omgang met het te bewerken product zijn in wezen afhankelijk van de wijze waarop personen met
dit apparaat werken.
WAARSCHUWING
Voor de ingebruikneming de gebruiksaanwijzing zorgvuldig lezen en de informatie in acht nemen om fouten
en hieruit volgende schade, in het bijzonder schade aan de gezondheid, te vermijden.
Voor installatie en gebruik van het apparaat moeten, naast de informatie in deze gebruiksaanwijzing,
de geldende nationale wetten, voorschriften en richtlijnen in acht genomen worden.
NL
3.2.1
-5-
Algemene instructies voor veilig gebruik van het apparaat
WAARSCHUWING – BEOOGD GEBRUIK
Gebruik het apparaat alleen voor het beoogde doel (zie paragraaf 3, Beoogd gebruik). Elk ander gebruik wordt
sterk gecontraindiceerd. Niet naleven van dit voorschrift kan resulteren in ernstig letsel bij de patiënt of de
gebruiker van het apparaat en in schade of storingen van het apparaat. Heraeus Kulzer is niet aansprakelijk
voor gevolgschade als gevolg van het niet in acht nemen van de hierboven genoemde voorwaarde!
WAARSCHUWING
De gebruiker is verantwoordelijk voor het testen van de Translux 2Wave voor het gebruik en geschiktheid voor
de beoogde doeleinden.
Richt het licht nooit op de ogen. Voorkom te allen tijde dat de ogen direct of indirect worden blootgesteld aan
het licht door het dragen van een veiligheidsbril die blauw licht uitfiltert. Plaats bij het uitharden de punt van
de lichtgeleider altijd recht boven het materiaal dat moet worden uitgehard en vermijd onnodige belichting
van weke delen. Stel ogen, tandvlees, weke delen en andere lichaamsdelen niet bloot aan het blauwe licht.
Bedek deze delen zo nodig met beschermend materiaal. Gebruik cofferdam om tijdens de behandeling de weke
delen, bijv. de gingiva, te beschermen. Beperk de belichting tot het gebied in de mondholte waar de klinische
behandeling wordt uitgevoerd.
WAARSCHUWING – CONTRA-INDICATIES
Gebruik de Translux Wave niet bij patiënten met een pacemaker of een ander geïmplanteerd elektronisch
apparaat. Dit geldt ook voor de gebruiker.
Het apparaat mag niet worden gebruikt door kinderen, blinden of doven en ook niet door of bij personen die
gevoelig zijn voor mogelijke epileptische aanvallen. De hierboven genoemde personen herkennen de risico’s
van het gebruik en de bediening mogelijk niet. Om veiligheidsredenen zijn het gebruik en de bediening van
het apparaat verboden voor gebruikers en patiënten die het risico lopen een epileptische aanval te krijgen.
WAARSCHUWING
Het is niet toegestaan enige wijzigingen/modificaties aan het apparaat aan te brengen.
De eigenaar / gebruiker moet ervoor zorgen dat:
– het apparaat niet wordt gebruikt bij patiënten met een positieve anamnese na lichttests, bijvoorbeeld
voor urticaria solaris en/of porfyrie, en ook niet bij patiënten die zijn behandeld met fotosensibiliserende
medicijnen;
– het apparaat niet wordt gebruikt bij patiënten die zijn geopereerd aan staar (zij zijn bijzonder gevoelig
voor licht), tenzij ze passende beschermingsmaatregelingen nemen, zoals het dragen van oogbescherming
of een veiligheidsbril die blauw licht uitfiltert;
– patiënten met een anamnese van netvliesafwijkingen toestemming hebben van hun oogarts voor
de behandeling met de Translux Wave;
– In alle potentiële risicogevallen dient een specialist te worden geraadpleegd.
WAARSCHUWING – Temperatuur van de toegepaste onderdelen
Max. temperatuur van toegepaste onderdelen (lichtgeleider en beschermkapje): 41°C (106°F).
Max. temperatuur van het deel,beschouwd als toegepast onderdeel (metalen conus voor) omdat het in contact
kan komen met de patiënt: 46°C (115°F).
Heraeus Kulzer verklaart dat, als het apparaat conform de instructies in deze gebruiksaanwijzing wordt gebruikt,
er geen oververhitting van weefsel zal plaatsvinden.
WAARSCHUWING – Infectiepreventie
De lichtgeleider en het beschermkapje moeten vóór elk gebruik worden gereinigd, gedesinfecteerd
en gesteriliseerd (stoom). Bij levering zijn de lichtgeleider en het beschermkapje NIET STERIEL. Ze moeten vóór
het eerste gebruik worden gesteriliseerd. Zie paragraaf 8.4.1.2, Sterilisatieparameters.
3.2.2
NL
-6-
Veiligheidsvoorschriften
WAARSCHUWING – EXPLOSIEGEVAAR
Installeer het apparaat niet in een ruimte waar sprake is van explosiegevaar.
Het apparaat mag niet worden gebruikt in een ruimte met brandbare gassen (anesthesiegassen, zuurstof,
lachgas, enzovoort). Gebruik het apparaat in een goed geventileerde ruimte.
WAARSCHUWING
Controleer vóór gebruik van het apparaat het netsnoer en de stekker op schade. Sluit het apparaat niet aan op
het netstroom als deze beschadigd zijn.
Gebruik alleen originele onderdelen en toebehoren van Heraeus Kulzer GmbH. Heraeus Kulzer levert een lichtgeleider die geschikt is voor gebruik in combinatie met de Translux Wave. Gebruik geen andere lichtgeleiders.
Heraeus Kulzer GmbH aanvaardt geen enkele aansprakelijkheid voor schade die het gevolg is van gebruik van
niet-originele onderdelen of toebehoren van Heraeus Kulzer.
3.2.3 ACCU – Veiligheidsvoorschriften
Heraeus Kulzer GmbH aanvaardt geen aansprakelijkheid voor accuproblemen die zich voordoen als de hierna
genoemde veiligheidsvoorschriften niet zorgvuldig zijn opgevolgd.
WAARSCHUWING
Onjuist gebruik van de accu kan ertoe leiden dat de accu heet wordt, barst of in brand vliegt en ernstig letsel
veroorzaakt. Zorg ervoor dat u de volgende veiligheidsvoorschriften opvolgt.
Gebruik alleen originele Heraeus Kulzer-accu’s!
Het gebruik van accu’s die niet afkomstig zijn van Heraeus Kulzer of het gebruik van niet-oplaadbare accu’s
en / of primaire accu’s vormt een potentieel gevaar en kan leiden tot beschadiging van het apparaat.
Houd accu’s buiten het bereik van kinderen!
Open, doorboor of plet accu’s nooit, met het oog op de giftige stoffen die erin zitten.
Verwijder een accu direct uit het handstuk als de accu roestplekken vertoont, een ongewone geur
verspreidt of vloeistof verliest.
Stel de accu niet bloot aan (zout) water en zorg ervoor dat de accu niet nat wordt. Bewaar de accu niet op
plaatsen met een hoge luchtvochtigheid of waar deze kan worden blootgesteld aan regen.
Wrijf niet in uw ogen als de accu lekt en de vloeistof in uw ogen komt. Spoel uw ogen goed met water
en ga direct naar een arts. Zonder behandeling kan het oog beschadigd raken door de accuvloeistof.
WAARSCHUWING – EXPLOSIEGEVAAR
Laad het handstuk alleen op met de bij het apparaat geleverde Translux Wave-oplader en adapter. Probeer nooit
de Translux Wave-accu op te laden met behulp van een andere oplader. Het gebruik van een andere oplader
kan leiden tot schade aan de accu, explosiegevaar en brand!
Gebruik de Translux Wave-oplader nooit om andere soorten accu’s of andere apparaten met een oplaadbare
accu op te laden! Gebruik alleen originele Heraeus Kulzer-accu’s.
Zorg ervoor dat u de accu niet doorboort met een scherp voorwerp, erop slaat met een hamer of ander
gereedschap, erop stapt of de accu op een andere manier blootstelt aan hevige botsingen of schokken.
Plaats de accu niet in het vuur en verwarm de accu niet. Veroorzaak geen kortsluiting tussen de contactpunten
van de accu, bijvoorbeeld met een metalen voorwerp. Dit kan leiden tot brandwonden, brand of een explosie.
Zorg ervoor dat u de accu nooit vervoert of bewaart samen met kettingen, haarspelden of andere metalen
voorwerpen.
WAARSCHUWING – Haal de accu niet uit elkaar en voer geen aanpassingen uit!
De accu bevat veiligheidsmechanismen die bij beschadiging ervoor kunnen zorgen dat de accu heet wordt,
barst, explodeert of in brand vliegt.
WAARSCHUWING – Plaats de accu niet op of in de buurt van vuur of op andere locaties met een hoge
temperatuur
Stel de accu niet bloot aan direct zonlicht. Als u dat wel doet, kan de accu heet worden, barsten of in brand
vliegen. Als u de accu op deze manier gebruikt, kan dit ook leiden tot prestatieverlies en een kortere levensduur
van de accu.
WAARSCHUWING – GOOI NOOIT WATER OP EEN BRANDENDE ACCU!
Gebruik een Klasse C-brandblusser (conform de Europese verordening EN 3).
WAARSCHUWING – Afvoeren van beschadigde of oude accu’s
Gooi een beschadigde of oude accu pas weg als u de volgende voorzorgsmaatregelen hebt genomen
om externe kortsluiting te voorkomen:
Isoleer de contactpunten van de accu met isolatietape en lever de accu in als klein chemisch afval.
3.2.4 ACCU – Informatie
• Oplaadtijdvoorlegeofnieuweaccu:ongeveer3uur.
OPMERKING – NIEUWE accu: eerste keer opladen
Als u de accu voor het eerst oplaadt, duurt dit ongeveer 3 uur. De oplaadtijd van nieuwe accu’s of accu’s
die lange tijd niet zijn gebruikt, kan langer zijn. De accu beschikt over de volledige capaciteit als deze een
aantal malen volledig is opgeladen / ontladen.
OPMERKING
Plaats het handstuk na elke behandeling en als u het handstuk niet gebruikt, in de oplader.
• Bedrijfscondities:
Bedrijfstemperatuur: 10°C (50°F) tot 35°C (95°F).
Relatieve luchtvochtigheid: 45% tot 85%.
Luchtdruk: 800 hPa tot 1060 hPa.
VOORZICHTIG
Het temperatuur- en relatieve-vochtigheidsbereik waarbinnen de accu kan worden opgeladen is 10°C (50°F)
tot 35°C (95°F) en 45% tot 85%. Als u de accu oplaadt bij een hogere of lagere temperatuur, kan de accu
heet worden of beschadigd raken. Het opladen bij een hogere of lagere temperatuur kan ook nadelig zijn
voor de prestaties van de accu en de levensduur verminderen.
• Transport-enopslagconditiesvooraccu’s:
Aanbevolen bereik voor temperatuur en relatieve luchtvochtigheid:
–20°C (–4°F) tot 40°C (104°F) en 45% tot 85%.
Bewaar de accu altijd opgeladen en niet langer dan 5 maanden.
Omgevingsluchtdruk: 500 hPa tot 1060 hPa.
OPMERKING
Laad de accu altijd volledig op als u het apparaat gedurende langere tijd niet gebruikt. Laad de accu tenminste elke 5 maanden op. Vervang, in geval van een langere inactieve periode, de accu uit het handstuk.
• Standaardlevensduurvandeaccu:
De Translux Wave-accu heeft een standaardlevensduur van 300 – 400 oplaadcycli afhankelijk van het gebruik
en de omgevingscondities.
OPMERKING
De accu is een chemisch product dat gebruik maakt van een chemische reactie. De prestaties nemen dus
niet alleen door het gebruik af, maar ook door het verstrijken van de tijd zelfs als u de accu niet gebruikt.
NL
-7-
3.2.5 AANSPRAKELIJKHEID
Werkzaamheden aan de elektronische uitrusting van het apparaat mogen alleen door Heraeus Kulzer, Heraeus Kulzerservicepartners of geschoold vakpersoneel worden uitgevoerd en in een veilige (spanningsloze) toestand.
Er mogen enkel goedgekeurde originele reserveonderdelen en accessoires gebruikt worden.
Het gebruik van andere onderdelen zorgt voor onbekende risico’s en moet in elk geval achterwege gelaten worden.
De goede werking en veiligheid van het apparaat is enkel gegarandeerd als de nodige controles, onderhouds- en
reparatiewerkzaamheden door Heraeus Kulzer, Heraeus Kulzer-servicepartners of door geschoold vakpersoneel
wordt uitgevoerd.
In geval van eventuele defecten of storingen aan het apparaat door ondeskundige reparaties die niet door Heraeus
Kulzer-servicepartners of door ons opgeleid personeel uitgevoerd werden of als bij het vervangen van onderdelen
geen originele reserveonderdelen of accessoires gebruikt zijn is, is Heraeus Kulzer GmbH niet aansprakelijk.
4
Beschrijving van het apparaat
4.1
Inhoud van de verpakking
1 Oplader
2 Handstuk
3 Lichtgeleider, Ø = 8 mm
4 Beschermkapje
5 Oplaadbare lithium-ion-accu
6 Universele adapter (100 V – 240 V (
6a = Europa
type 1
6b = UK
type 2
6c = VS / Japan type 3
4.2
4.2.1
NL
-8-
1x
)) inclusief adapterstekkers:
Beschrijving van de controle- en bedieningselementen
Handstuk
1 “Start / stop”-knop
2 LED´s voor de uithardingsmodi (GROEN)
3 Accustatus-LED (twee kleuren: GROEN / GEEL)
4 Contactpunten voor de oplader
5 Uitlijnpunt
4.2.2 Uitlijnpunt
Het uitlijnpunt (5), op de achter onderkant van de behuizing van het handstuk, zorgt voor juiste
plaatsing van het handstuk in de oplader.
Als u het handstuk in de oplader plaatst, moet het uitlijnpunt worden uitgelijnd met de gleuf aan
de binnenkant van de houder op de oplader.
Als u een piep hoort, bevinden de contactpunten zich in de juiste oplaadpositie!
4.2.3
2x
2x
Oplader
1x
Bovenaanzicht
1 Oplader
7 Houder voor handstuk met uitlijnpunt en verwisselbare contactpunten
8 Lichtintensiteitssensor
9
– GROENE LED
Functie: Geeft aan dat de oplader is ingeschakeld.
10
– Tweekleuren-LED (GROEN / GEEL)
Functie: Informatie over de lichtintensiteit.
GROEN: Geeft aan dat de lichtintensiteit, gemeten met de ingebouwde lichtmeter, geschikt is voor een
effectieve behandeling.
GEEL: Geeft aan dat de lichtintensiteit onvoldoende is.
Onderaanzicht Oplader
11 Aansluiting adapter
12 Verwisselbare contactpunten
2x
4.2.4
Geluidssignalen van het handstuk
Functie / Fout
POLYMERISATIEPROGRAMMA:
10 seconden.
“SOFT-START”PROGRAMMA:
20 seconden.
ONDERBREKING VAN DE
BELICHTINGSCYCLUS
Knop op handstuk
Geluidssignaal
Aanduidingen op de handstuk
• Drukkortopde“START / STOP”-knop
• 1 piep wanneer u op de “START / STOP”knop drukt.
om de belichting te starten.
• 1 piep na afloop van de belichtingstijd.
De groene 10-sec. LED licht op.
• Drukkortopde“START / STOP”-knop
• 1 piep wanneer u op de “START / STOP”knop drukt.
en houdt deze minstens één seconde
• 1 piep na 1 seconde als teken dat
ingedrukt om de belichting te starten.
“Soft-Start”-modus is geactiveerd.
• 1 piep na een belichtingstijd
van 10 seconden.
• 1 piep na afloop van de belichtingstijd.
De groene 20-sec. LED licht op.
• 1 piep wanneer als u op de “START / STOP”• Ukuntdebelichtingscyclusop
elk gewenst moment en tijdens elk
knop drukt.
programma onderbreken door op de
te drukken.
“START / STOP”-knop
SIGNAAL ACCU BIJNA
LEEG
De accu is nog voldoende
opgeladen voor enkele
belichtingscycli.
• 2 piepjes na afloop van de belichtingscyclus.
• Hetaccusymboolknippertgroen.
Plaats het handstuk in de oplader om
op te laden!
SIGNAAL BIJ LEGE ACCU
Er kan geen nieuwe
belichtingscyclus gestart
worden.
• 2 piepjes zonder dat de belichtingscyclus
geactiveerd wordt.
• Hetaccusymboolknippertgroen.
Plaats het handstuk in de oplader om
op te laden!
Alleen als het handstuk in de
oplader is geplaatst.
• Gedurende30secondenelkeseconde1 piep.
De accustatus-LED licht GEEL op.
Geen geluidssignaal.
De groene LED van de gekozen belichtingscyclus knippert.
• 3 piepjes en de gekozen belichtingscyclus
wordt automatisch beëindigd.
• 4 piepjes bij het begin van een belichtingscyclus.
SIGNAAL DEFECTE ACCU
LED-lichtbron defect
OVERVERHITTING
INGEBOUWDE
temperatuursensor
defect
Oplaadcircuit van het
handstuk defect
Opmerking: Deze fout
wordt alleen gedetecteerd als het handstuk in
de oplader is geplaatst.
Op het handstuk knipperen 2 groene LEDlampjes (10 s / 20 s).
NL
-9-
4.2.5
Led-informatie over uitgezonden straling
Het apparaat maakt gebruik van led’s met hoge lichtsterkte, klasse 2M (IEC 60825-1).
Led -straling.
Niet in de lichtstraal kijken of direct met optische
LED RADIATION
instrumenten bekijken.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• Led-productklasse2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Max. output: < 5.00 mW.
• Dominante golflengte: min. 440 nm – max. 465 nm.
WAARSCHUWING
Divergente stralen
Kijk niet in het led-licht met optische instrumenten, zoals monocles, vergrootglazen of microscopen van
afstanden kleiner dan 100 mm. Het kan oogletsel veroorzaken.
Gecollimeerde stralen
Kijk niet in het led-licht met optische instrumenten die ontwikkeld zijn voor veraf, zoals telescopen
of verrekijkers. Het kan oogletsel veroorzaken.
In het geval het LED controle circuit kapot gaat, kan de LED-straling emissie niet hoger zijn dan de waarde
tijdens normaal gebruik van de medische apparatuur.
Stickers zoals hierboven weergegeven, bevinden zich op de verpakking van het apparaat.
5
NL
- 10 -
Installatie en eerste gebruik
De volgende secties van deze paragraaf bevatten informatie en instructies die u moet volgen voor een succesvolle
en foutloze werking van het apparaat. Volg de instructies in onderstaande volgorde voordat u de Translux Wave gebruikt.
Het medische systeem is alleen in overeenstemming met de veiligheidsnormen als het is geïnstalleerd volgens onderstaande instructies.
Installeer het apparaat op een geschikte plaats die handig is in het gebruik. Plaats de oplader op een stevig, droog,
vlak en horizontaal oppervlak.
BELANGRIJK
Het handstuk is bedoeld voor gebuik in de omgeving van de patiënt terwijl de oplader en de adapter niet
bedoeld zijn voor gebruik in de omgeving van de patiënt.
OPMERKING
De omgeving van de patiënt is gedefinieerd als een gebied van 1,5 meter rondom de patënt IEC 60601-1 derde
editie en IEC 60601-1-1).
WAARSCHUWING
Inspecteer het apparaat en de onderdelen altijd op beschadigingen voordat u het installeert.
Ga in geval van beschadigingen niet verder met de installatie van het apparaat.
De gebruiker mag niet tegelijkertijd in contact komen met de onderdelen buiten de omgeving van de patiënt
(oplader en adapter) en de patiënt zelf.
5.1
Veiligheidseisen tijdens installatie
WAARSCHUWING
Het elektriciteitssysteem van het gebouw waarin het apparaat wordt geïnstalleerd en gebruikt, moet voldoen
aan alle bestaande wetgeving en veiligheidsspecificaties die gelden voor elektriciteitssystemen.
Installeer het apparaat op een plaats waar niemand er tegenaan loopt of stoot en waar het beschermd is tegen
onvoorzien gespat met water of andere vloeistoffen. Stel het apparaat niet bloot aan direct zonlicht / UV-licht.
Installeer het apparaat niet op of in de buurt van een warmtebron. Zorg voor voldoende luchtcirculatie rondom
het apparaat. Installeer het apparaat niet in de buurt van oplosmiddelen of brandbare vloeistoffen, aangezien
deze de kunststofbehuizing van het apparaat kunnen beschadigen.
De plug van de oplader (directe plug-in), model PSAC05R-050, wordt gebruikt voor isolatie van het medische
apparaat ten opzichte van de netspanning. Als de plug is aangesloten, moet de adapter gemakkelijk toegankelijk zijn. Zorg voor voldoende ruimte rondom. De medische apparatuur mag niet dusdanig worden geplaatst dat
het moeilijk is deze uit te schakelen (de stekker uit het stopcontact).
Veroorzaak nooit met een metalen voorwerp kortsluiting tussen de contactpunten van de accu.
Dit kan leiden tot brandwonden, brand of een explosie.
U kunt het apparaat vervoeren, maar het moet met zorg worden behandeld. Vervoer het apparaat in horizontale
positie. Stel het apparaat niet bloot aan schud- of trilbewegingen. Zie paragraaf 12, Technische specificaties,
voor afmetingen en gewicht.
WAARSCHUWING – EXPLOSIEGEVAAR
Installeer het apparaat niet in een ruimte waar sprake is van explosiegevaar. Gebruik het apparaat niet in
een ruimte met brandbare gassen (anesthesiegassen, zuurstof, lachgas, enzovoort). Installeer het apparaat
in een goed geventileerde ruimte.
5.2
Aansluiting van de oplader op het stopcontact
1x
De Translux Wave wordt geleverd met een aparte universele adapter (6) voor
), 50 / 60 Hz.
100 tot 240 V (
WAARSCHUWING
Controleer voordat u de adapter (6) aansluit op het stopcontact, zorgvuldig of het voltage en de frequentie van
het elektriciteitsnet overeenkomen met de waarden op het identificatieplaatje van het apparaat. U vindt het
identificatieplaatje aan de onderzijde van de oplader.
Gebruik alleen de meegeleverde adapter. Gebruik van een andere adapter kan de accu beschadigen.
Gebruik voor het aansluiten van de adapter geen stekkerdoos.
OPMERKING
De adapter van de Translux Wave (6) wordt geleverd met drie verwisselbare stekkers:
type 1
Afb. (6 a) = Europa
Afb. (6 b) = UK
type 2
Afb. (6 c) = VS / Japan type 3
1 Selecteer uit de beschikbare stekkers de juiste: Europa – type 1, Verenigd Koninkrijk – type 2, VS / Japan – type 3.
2 Elke stekker heeft een gleuf waarin de borgpal van de adapter past.
3 Plaats de stekker met de gleuf richting de adapter op de adapter, zodat de geleiders op de stekker uitgelijnd zijn
met de bijbehorende gleuven op de adapter.
4 Druk op de adapterstekker en de adapter en schuif de adapter deze in de adapter totdat u een klik hoort
en de adapterstekker vast zit.
OPMERKING
Door tijdens de installatie op de stekker te drukken zorgt u ervoor dat alle geleiders in de bijbehorende
gleuven op de adapter zitten. Verwijder de stekker en installeer hem opnieuw als deze los lijkt te zitten.
5 Verwijder de stekker uit de adapter door op de borgpalknop (gemarkeerd met het woord “PUSH” te drukken,
de stekker uit de adapter te schuiven en deze te verwijderen.
6 Bewaar de overige stekkers voor toekomstig gebruik.
7 Steek de plug van het netsnoer in de aansluiting aan de onderkant van de oplader.
WAARSCHUWING
Controleer het netsnoer, de adapter en de stekker regelmatig om er zeker van te zijn dat ze in goede
conditie zijn.
Gebruik beschadigde onderdelen niet, maar vervang ze.
Gebruik alleen originele onderdelen en toebehoren van Heraeus Kulzer.
8 Sluit de adapter met de stekker aan op het stopcontact.
9 De GROENE LED op de oplader licht op (symbool
).
5.3
De accu in het handstuk plaatsen
De Translux Wave wordt geleverd met een krachtige oplaadbare lithium-ion-accu.
De accu wordt apart verpakt geleverd in de doos van het apparaat. Plaats de accu in het handstuk voordat
u het apparaat voor de eerste keer gebruikt.
WAARSCHUWING
Volg alle veiligheidsvoorschriften zoals beschreven in paragraaf 3.2.3, ACCU – Veiligheidsvoorschriften, nauwkeurig op.
VOORZICHTIG
Plaats het handstuk NOOIT in de oplader als de accu zich niet in het handstuk bevindt.
NL
- 11 -
Plaats de accu als volgt in het handstuk:
1 Haal de accu uit de verpakking.
WAARSCHUWING
Veroorzaak nooit kortsluiting tussen de contactpunten van de accu, bijvoorbeeld met een
metalen voorwerp. Dit kan leiden tot brandwonden, brand of een explosie.
2 Schroef met een plat voorwerp (bijvoorbeeld een munt) de achterkant van het handstuk
linksom los (afb. 1 en 2 ).
3 Op de accuhuls ziet u een pijl (afb. 3 ).
OPMERKING
Deze pijl geeft de richting aan waarin u de accu in het handstuk moet plaatsen.
2x
4 Schuif de accu met de pijl gericht naar de behuizing langzaam helemaal in het handstuk (afb. 4 ).
OPMERKING
Als u de accu verkeerd in het handstuk plaatst (in de tegenovergestelde richting van de pijl), werkt het
handstuk niet. De elektronica van het handstuk kan in dat geval echter niet beschadigd raken.
WAARSCHUWING
Gebruik alleen originele Heraeus Kulzer-accu’s. Het gebruik van accu’s van andere fabrikanten of van nietoplaadbare accu’s en / of primaire accu’s vormt een potentieel gevaar en kan het apparaat onherstelbaar
beschadigen.
5 Schroef met een plat voorwerp (bijvoorbeeld een munt) de achterkant van het handstuk rechtsom weer vast.
OPMERKING
Het apparaat werkt niet naar behoren als de achterkant niet helemaal is vastgeschroefd op het handstuk.
NL
- 12 -
5.4
De lichtgeleider in het handstuk schuiven
2x
• Draaidelichtgeleideriets(1) en schuif deze zo ver mogelijk in het handstuk (2) totdat
u een “klik” hoort.
• Plaatshetbeschermkapje(3) op het uiteinde van de lichtgeleider.
De lichtgeleider positioneren
• Draaidelichtgeleiderindegewenstepositievoorpolymerisatie.
• Plaatsdelichtgeleiderzodichtmogelijkbijhetuittehardenmateriaalomoptimaalteprofiterenvandegeleverde
lichtintensiteit.
Vermijd direct contact met de composiet!
VOORZICHTIG – Zorg ervoor dat de lichtgeleider altijd schoon is. Alleen dan beschikt u over
de volledige lichtintensiteit.
In de volgende omstandigheden is de lichtintensiteit aanzienlijk minder:
– De lichtgeleider is niet in perfecte conditie (krassen of ontbrekende schilfertjes).
– De lichtgeleider is niet goed in het handstuk geplaatst.
– Er zitten composietvlekken op de lichtgeleider.
WAARSCHUWING
Een beschadigde lichtgeleider vermindert de lichtintensiteit en moet direct door een nieuwe worden vervangen.
Scherpe randen kunnen ernstig letsel veroorzaken. Gebruik alleen originele Heraeus Kulzer-lichtgeleiders.
WAARSCHUWING – Infectiepreventie:
Om de behandeling zo veilig mogelijk te maken voor patiënten en gebruikers moet u de lichtgeleider
en het beschermkapje vóór elke behandeling reinigen, desinfecteren en steriliseren.
Volg de instructies in paragraaf 8, Reiniging, desinfectie en sterilisatie, nauwkeurig op.
5.5
Accu opladen
VOORZICHTIG – NIEUWE accu: eerste keer opladen
De Translux Wave-accu is in de fabriek gedeeltelijk opgeladen.
Daarom moet u de accu volledig opladen voordat u de Translux Wave voor het eerst gebruikt.
OPMERKING – NIEUWE accu: eerste keer opladen
Als u de accu voor het eerst oplaadt, duurt dit ongeveer 3 uur. De oplaadtijd van nieuwe accu’s of accu’s die
lange tijd niet zijn gebruikt, kan langer zijn. De accu beschikt over de volledige capaciteit als deze een aantal
malen volledig is opgeladen / ontladen.
WAARSCHUWING – EXPLOSIEGEVAAR
Laad de accu alleen op met de bij de Translux Wave geleverde oplader. Probeer nooit de accu op te laden met
behulp van een andere oplader of voedingsbron, vanwege explosie- en brandgevaar.
Plaats het handstuk met de accu in de Translux Wave-oplader.
2x
Als u een piep hoort, bevinden de contactpunten zich in de juiste oplaadpositie!
BELANGRIJKE OPMERKING – Uitlijnpunt
Het uitlijnpunt (5), op de achter onderkant van het handstuk, zorgt voor de juiste plaatsing
van het handstuk in de oplader. Als u het handstuk in de oplader plaatst, moet het uitlijnpunt
worden uitgelijnd met de gleuf aan de binnenkant van de oplader.
Accuoplaadproces.
• Deaccustatus-LEDophethandstukbegintgroenteknipperen.
• Alshetopladenisvoltooidendeaccuvolledigisopgeladen,brandtdeaccustatus-LEDcontinu(groen).
BELANGRIJKE OPMERKING – Defecte accu
Als er tijdens het opladen een storing in de accu wordt gedetecteerd, wordt het opladen onderbroken
en begint de accustatus-LED GEEL te knipperen.
Als dit het geval is, hoort u gedurende 30 seconden elke seconde een “piep”.
Vervang de defecte accu door een nieuwe!
WAARSCHUWING
Gebruik alleen Heraeus Kulzer-accu’s!
OPMERKING
Als het handstuk zich in de oplader bevindt, zijn alle functies uitgeschakeld. De “Start /
stop”-knop
werkt niet.
U kunt het handstuk tijdens het opladen verwijderen uit de oplader. De accu is dan mogelijk niet
helemaal opgeladen en dit kan de werkingstijd verkorten.
6
Bediening
NL
WAARSCHUWING – Controleer de conditie van het apparaat voordat u de behandeling start.
Controleer altijd vóór elke behandeling of het apparaat en de toebehoren (lichtgeleider en beschermkapje)
- 13 goed werken. Als u tijdens de behandeling iets opmerkt, staakt u de behandeling en neemt u contact op met
Heraeus Kulzer of een plaatselijke erkende servicepartner (zie paragraaf 14, Service). Gebruik het apparaat
en de toebehoren niet als u beschadigingen constateert. Controleer vóór elk gebruik van de Translux Wave
of de lichtintensiteit voldoende is voor polymerisatie. Controleer de lichtintensiteit met behulp van de lichtmeter
in de oplader. Zie paragraaf 6.2, De lichtintensiteit meten.
WAARSCHUWING – Infectiepreventie
Bij eerste gebruik
Bij levering zijn de toebehoren (lichtgeleider en beschermkapje) NIET STERIEL. U moet ze vóór het eerste
gebruik steriliseren.
Bij elk gebruik
Vóór elk volgend gebruik moet u de toebehoren (lichtgeleider en beschermkapje) opnieuw behandelen.
Volg hiervoor de procedures in paragraaf 8 (Reiniging, desinfectie en sterilisatie).
6.1
De belichtingscyclus activeren en deactiveren
De Translux Wave heeft twee belichtingscycli:
– Belichting met constante intensiteit: cyclus van 10 seconden.
– Belichting met een langzaam toenemende intensiteit: “Soft-Start” (cyclus van 20 seconden).
Bij “Soft-Start” neemt de lichtintensiteit binnen 2 seconden toe van 50% tot 100%.
• Alsde“Slaapmodus” van het handstuk is geactiveerd (alle LED´s van de belichtingscycli op het handstuk zijn UIT),
drukt u kort op de “Start / stop”-knop
om het handstuk weer in te schakelen.
(Bij het eerstvolgende gebruik, licht standaard de 10-seconden LED op.)
Belichting voor polymerisatie van 10 seconden
Druk kort op de “Start / stop”-knop
. De lichtemissie wordt ingeschakeld.
De 10-sec. LED licht op om aan te geven dat dit programma actief is.
Als de belichtingscyclus is voltooid, wordt de lamp automatisch uitgeschakeld.
Geluidssignaal:
U hoort de volgende geluidssignalen:
1 piep wanneer u op de “Start / stop”-knop drukt.
1 piep aan het eind van de belichtingstijd.
Belichting voor Soft-Start-polymerisatie van 20 seconden
Druk op de “Start / stop”-knop
en houdt deze minimaal één seconde ingedrukt. De lichtemissie wordt
ingeschakeld.
De 20-sec. LED licht op om aan te geven dat dit programma actief is.
Als de belichtingscyclus is voltooid, wordt de lamp automatisch uitgeschakeld en keert het apparaat terug naar
de 10-secondenmodus (de 10-sec. LED gaat aan).
Geluidssignaal:
U hoort de volgende geluidssignalen:
1 piep wanneer u op de “Start / stop”-knop drukt.
1 piep na 1 seconde als teken dat “Soft-Start”-modus is geactiveerd.
1 piep na een belichtingstijd van 10 seconden.
1 piep aan het eind van de belichtingstijd.
OPMERKING
U kunt de belichtingscyclus op elk gewenst moment onderbreken door nogmaals op de “Start / stop”-knop
te drukken.
Geluidssignaal:
U hoort een “piep” als u op de “Start / stop”-knop drukt om de belichtingscyclus te onderbreken.
NL
- 14 -
6.2
De lichtintensiteit meten
De oplader van de Translux Wave is uitgerust met een geïntegreerde lichtintensiteitsmeter (8).
2x
VOORZICHTIG
Controleer vóór elke behandeling de lichtintensiteit met behulp van de lichtintensiteitsmeter in de Translux Wave-oplader.
• Legdelichtgeleiderzonderdrukuitteoefenen,platendirectophettestvlak(8).
Activeer het apparaat door op de “Start / stop”-knop
te drukken (ongeacht de geselecteerde belichtingstijd).
Het resultaat van de meting wordt direct aangegeven door de tweekleuren-LED (symbool
) rechts onder
het testvlak.
GROENE LED: De lichtintensiteit is voldoende voor de behandeling.
GELE LED: De lichtintensiteit is onvoldoende en patiënten mogen niet worden behandeld.
VOORZICHTIG
Als de lichtintensiteit onvoldoende is, voer dan aub de volgende controles en maatregelen uit:
– Controleer of de lichtgeleider in het handstuk is geplaatst (zie paragraaf 5.4, De lichtgeleider in het
handstuk plaatsen).
– Controleer de lichtgeleider op vuil of defecten.
– Reinig de lichtgeleider (zie paragraaf 8, Reiniging, desinfectie en sterilisatie) of vervang de beschadigde
lichtgeleider door een nieuwe.
Gebruik alleen originele Heraeus Kulzer-lichtgeleiders!
WAARSCHUWING
Gebruik het apparaat niet voor behandelingen als bovenstaande maatregelen niet leiden tot verbetering.
Schakel het apparaat uit (haal de stekker van de oplader uit het stopcontact) en zorg ervoor dat het
apparaat niet door onbevoegden kan worden gereactiveerd. Neem contact op met uw lokale Heraeus Kulzer
vestiging, een servicepartner van Heraeus Kulzer of technisch, door Heraeus Kulzer goedgekeurd personeel
(zie paragraaf 14, Service).
6.3
Slaapmodus
Het handstuk beschikt over een “Slaapmodus” om het energieverbruik van het apparaat te minimaliseren.
Als het handstuk niet in de oplader staat, worden alle interne functies automatisch uitgeschakeld (“Slaapmodus”)
als u het gedurende ongeveer 5 minuten niet gebruikt.
In de “Slaapmodus” zijn alle LED´s van de belichtingscycli uit.
Als u de “Slaapstand” wilt beëindigen, drukt u op de “Start / stop”-knop
Het handstuk is klaar voor gebruik.
.
6.4
Aanvullende informatie over de bediening van het apparaat
OPMERKING
Als u het handstuk in de oplader plaatst voordat de belichtingscyclus is voltooid, wordt de lichtemissie
automatisch beëindigd.
Als het handstuk zich in de oplader bevindt, zijn alle functies uitgeschakeld. De “Start / stop”-knop
werkt niet.
De Translux Wave is uitgerust met een microprocessor die voortdurend de optimale oplaadparameters
van de accu controleert. Plaats daarom na elke behandeling het handstuk terug in de oplader, ongeacht
de resterende acculading.
7
Waarschuwingsfuncties
7.1
Defecte accu
Bij een defecte accu knippert de accustatus-LED op het handstuk continu GEEL (afb. a).
U hoort gedurende 30 seconden elke seconde een “piep”.
BELANGRIJK
Deze fout wordt alleen gedetecteerd als het handstuk zich in de oplader bevindt.
knipperend
7.2
Defecte LED
Als er een storing wordt gedetecteerd in een LED, begint de groene LED “10s” van
de geselecteerde belichtingscyclus te knipperen (afb. b).
knipperend
a
b
7.3
Bescherming tegen oververhitting
Als er snel na elkaar meerdere belichtingscycli worden uitgevoerd (normaal na 18 opeenvolgende cycli van elk 20 seconden), kan de ingebouwde temperatuursensor worden geactiveerd.
Zodra de oververhittingsbescherming wordt geactiveerd, hoort u aan het einde van de belichtingscyclus
een geluidssignaal (3 maal).
Als de oververhittingsbescherming is geactiveerd, kunt u het apparaat enkele minuten niet gebruiken.
Laat het handstuk minimaal 4 – 5 minuten afkoelen en druk dan op de “Start / stop”-knop
om de volgende
belichting te starten.
OPMERKING
Het handstuk kan weer worden gebruikt als het de operationele temperatuur heeft bereikt – er is geen “reset”
nodig.
7.4
INGEBOUWDE temperatuursensor defect
Als de temperatuursensor tegen oververhitting defect is, zijn era an het begin van een belichtingscyclus “4 piepjes”
hoorbaar.
OPMERKING
Als de temperatuursensor stuk gaat tijdens een belichtingscyclus, zorgt de software dat de belichtingscyclus
afgemaakt kan worden. Het is niet mogelijk een volgende belichtingscyclus te starten door op de “Start /
Stop”-knop
te drukken en er zijn “4 piepjes” hoorbaar.
De lamp kan niet gebruikt worden als de oververhittingsbescherming defect is.
NL
- 15 -
7.5
Signaal accu bijna leeg
Als de acculading na veelvuldig gebruik tot het minimumniveau is gedaald, kunt u in elke uithardingsmodus
de Translux Wave nog een aantal belichtingscycli gebruiken zonder dat u de accu hoeft op te laden.
Deze status wordt na afloop van elke cyclus aangegeven door “2 piepjes”.
Het accusymbool knippert groen. Laad de accu op!
Na enkele cycli is de resterende acculading onvoldoende voor nog meer belichtingscycli. Deze status wordt aangegeven
door “2 piepjes”.
Het accusymbool knippert groen. Laad de accu op!
8
Reiniging, desinfectie en sterilisatie
STEKKER UIT STOPCONTACT
Haal de stekker van de oplader uit het stopcontact voordat u de reinigings- en desinfectieprocedures uitvoert!
WAARSCHUWING
Infectiepreventie
De lichtgeleider en het beschermkapje zijn bij levering NIET STERIEL en moeten vóór het eerste gebruik en
vervolgens vóór elk volgend gebruik worden gereinigd, gedesinfecteerd en gesteriliseerd (stoom).
Steriliseer het handstuk en de oplader niet!
Steriliseer de accu niet!
8.1
Demontage
Verwijder het beschermkapje van de lichtgeleider.
Verwijder de lichtgeleider. Draai de lichtgeleider iets en trek deze uit het handstuk.
8.2
NL
- 16 -
LICHTGELEIDER – Reiniging en desinfectie
VOORZICHTIG
Reinig de lichtgeleider niet met een scherp of puntig voorwerp. Dit kan leiden tot krassen op het oppervlak van
de lichtgeleider, waardoor de lichttransmissie afneemt.
Gebruik geen reinigings-/ desinfectiemiddelen die organische, minerale of oxiderende zuren, waterstofperoxide,
chloor, jodium, bromide of oplosmiddel bevatten.
1) Verwijder direct na gebruik alle eventuele resten, zoals composiet, van het uiteinde van de lichtgeleider.
Verwijder gepolymeriseerd composiet met ethanol; gebruik van een kunststof spatel of zachte nylon borstel
hierbij kan handig zijn.
2) Desinfecteer de lichtgeleider met een schone, zachte, stofvrije doek die vochtig is gemaakt met een milde
desinfecterende oplossing met een milde pH (pH 7), in overeenstemming met de specificaties van de fabrikant.
Laat de desinfecterende oplossing opdrogen.
8.2.1 LICHTGELEIDER – Inspectie vóór de sterilisatie
Controleer de lichtgeleider nauwkeurig op beschadigde oppervlakken, verkleuringen en verontreinigingen voordat
u het sterilisatieproces start.
WAARSCHUWING
Gebruik nooit een beschadigde lichtgeleider. Vervang de lichtgeleider door een nieuwe als u beschadigingen
constateert.
Herhaal de reinigings- en desinfectieprocedure als de lichtgeleider nog steeds verontreinigd is.
8.3
BESCHERMKAPJE – Reiniging en desinfectie
VOORZICHTIG
Gebruik geen reinigings-/ desinfectiemiddelen die organische, minerale of oxiderende zuren, waterstofperoxide,
chloor, jodium, bromide of oplosmiddel bevatten.
Reinig en desinfecteer het beschermkapje met een zachte doek die nat is gemaakt met een milde desinfecterende
oplossing met een milde pH (pH 7), in overeenstemming met de specificaties van de fabrikant.
Laat de desinfecterende oplossing opdrogen.
8.3.1 BESCHERMKAPJE – Inspectie vóór sterilisatie
Controleer het beschermkapje nauwkeurig op beschadigde oppervlakken, nerfverkleuringen en verontreinigingen
voordat u het sterilisatieproces start.
WAARSCHUWING
Gebruik nooit een beschadigd beschermkapje. Vervang het beschermkapje door een nieuwe als
u beschadigingen constateert.
Een beschadigd beschermkapje biedt onvoldoende bescherming tegen het licht van het apparaat.
Herhaal de reinigings- en desinfectieprocedures als het beschermkapje nog steeds verontreinigd is.
8.4
LICHTGELEIDER en BESCHERMKAPJE – Verpakking vóór de sterilisatie
U kunt de lichtgeleider en het beschermkapje steriliseren in een wegwerpsterilisatiezakje van het juiste formaat.
VOORZICHTIG
Verpak de lichtgeleider en het beschermkapje ieder afzonderlijk in een zakje.
Zorg ervoor dat u de maximale belasting van de autoclaaf niet overschrijdt als u meerdere instrumenten
in één autoclaaf steriliseert.
WAARSCHUWING
Zorg ervoor dat het binnenste zakje groot genoeg is voor de afzonderlijke instrumenten,
zodat er geen druk op de afsluiting staat en de verpakking niet kan scheuren.
8.4.1 LICHTGELEIDER en BESCHERMKAPJE – Sterilisatie
8.4.1.1 Sterilisatiemethode
• Voerdesterilisatieuitineenstoomautoclaafmetpre-vacuümprogramma.
VOORZICHTIG
Gebruik geen andere sterilisatiemethoden. Deze zijn mogelijk ongeschikt voor het materiaal waarvan
de lichtgeleider is gemaakt.
Gebruik de volgende sterilisatiemethoden NIET: sterilisatie door middel van ethyleenoxide,
hete lucht sterilisatie, een flashautoclaaf, STERRAD, STERIS-systeem of vergelijkbare sterilisatiesystemen.
Steriliseer de lichtgeleider en het beschermkapje NIET met behulp van: waterstofperoxide, een systeem
met perazijnzuur, formaldehyde of glutaraldehyde.
8.4.1.2 Sterilisatieparameters
• Minimale sterilisatieparameters die zorgen voor een Sterility Assurance Level (SAL, sterilisatiegarantieniveau)
van 10 –6.
Cyclustype
Pre-vacuüm
Minimumtemperatuur
132°C + 3°C
(270°F + 5°F)
Minimale blootstellingstijd (zak)
4 minuten
Minimale droogtijd
20 minuten
VOORZICHTIG
Overschrijd de 135°C (275°F) niet.
8.5
HANDSTUK – Reiniging en desinfectie
2x
WAARSCHUWING
Het handstuk is niet waterdicht.
Spuit geen vloeistof rechtstreeks op het oppervlak en de contactpunten van het handstuk.
Zorg ervoor dat er geen reinigings- of ontsmettingsmiddelen in het handstuk kunnen komen!
Dompel het handstuk NOOIT onder in vloeistof.
Reinig het handstuk NOOIT onder stromend water.
Steriliseer het handstuk niet. Als u dat wel doet, kan dit resulteren in ernstige schade, elektrische schokken
en brand!
NL
- 17 -
Reinig en veeg de behuizing van het handstuk af met een droge, zachte, stofvrije doek die is bevochtigd met een
mild oppervlak-desinfectiemiddel met een neutrale pH-waarde (pH7), in overeenstemming met de specificaties van
de fabrikant.
Laat het desinfectiemiddel drogen of wrijf het resterende desinfectiemiddel van het handstuk met een zachte,
stofvrije doek.
VOORZICHTIG
Gebruik geen oplosmiddelen als aceton, isopropylalcohol en waterstofperoxide, chloor, jodium, bromide, fenol
of andere agressieve oplossingen om het kunststofoppervlak van het handstuk te reinigen en desinfecteren.
Deze stoffen kunnen schadelijk zijn; veroorzaken verkleuring en / of beschadigen de kunststof van het handstuk.
Gebruik geen schuurmiddel!
BELANGRIJK: Reiniging van de contactpunten van het handstuk
Reinig altijd de contactpunten aan de onderzijde nadat u de kunststofbehuizing van het handstuk hebt
gereinigd en gedesinfecteerd. De contactpunten van het handstuk moeten altijd vrij zijn van vuil, composiet
en restanten reinigings-/ desinfectiemiddel.
BELANGRIJK
Reinig de contactpunten van het handstuk regelmatig (minstens eenmaal per week) en altijd nadat u de
kunststofbehuizing van het handstuk heeft gereinigd en gedesinfecteerd. Als de contactpunten vuil zijn of zijn
blootgesteld aan vloeistoffen zoals reinigings- of desinfectiemiddelen, is het mogelijk dat de accu minder goed
of helemaal niet wordt opgeladen.
Reinig de contactpunten van het handstuk met een zachte, stofvrije doek of wattenstaaf die met alcohol
is bevochtigd.
VOORZICHTIG
Reinig de contactpunten van het handstuk niet met een scherp of puntig voorwerp. Hiermee zou het oppervlak
beschadigd of bekrast kunnen raken, waardoor de geleiding van de contactpunten afneemt.
Zorg ervoor dat het oppervlak en de contactpunten van het handstuk volledig droog zijn voordat u het handstuk
weer gaat gebruiken. Indien nodig, de contactpunten met de luchtspuit drogen.
NL
- 18 -
8.6
OPLADER – Reiniging van behuizing
STEKKER UIT STOPCONTACT
Ontkoppel de adapter van het stopcontact en van de oplader voordat u deze gaat reinigen / desinfecteren.
WAARSCHUWING
De behuizing van de oplader is niet waterdicht.
Spuit geen vloeistoffen rechtstreeks op het oppervlak van de oplader.
VOORZICHTIG
Steriliseer de oplader NIET. Als u dat wel doet, werkt de oplader niet meer en kan er sprake zijn van ernstige
schade, elektrische schokken of brand!
Gebruik geen oplosmiddelen als aceton, isopropylalcohol en waterstofperoxide, chloor, jodium, bromide, fenol
of andere agressieve oplossingen om het kunststofoppervlak van de oplader te reinigen. Deze stoffen kunnen
schadelijk zijn; veroorzaken verkleuring en / of beschadigen de kunststof van de oplader.
Gebruik geen schuurmiddel!
Reinig en veeg de behuizing van de oplader af met een droge, zachte, stofvrije doek die is bevochtigd met een
mild oppervlak-reinigingsmiddel met een neutrale pH-waarde (pH7), in overeenstemming met de specificaties
van de fabrikant.
Droog de behuizing van de oplader met een schone, niet-schurende doek.
VOORZICHTIG
Zorg ervoor dat u de oplader na het reinigen droogt. Vocht in het apparaat kan schade veroorzaken.
BELANGRIJK
Controleer na afloop van de reinigingsprocedure of de contactpunten in de oplader volledig droog zijn.
Indien nodig, de contactpunten met de luchtspuit drogen.
8.6.1
OPLADER – Reiniging van contactpunten
BELANGRIJK
Reinig altijd de contactpunten als u de kunststof behuizing van de oplader hebt schoongemaakt.
De contactpunten van de oplader moeten altijd vrij zijn van vuil, composiet en restanten
reinigings-/ desinfectiemiddel.
2x
Reinig de contactpunten van de oplader regelmatig (minstens eenmaal per week) en altijd nadat u de
kunststofbehuizing heeft gereinigd. Als de contactpunten vuil zijn of zijn blootgesteld aan vloeistoffen zoals
reinigings- of desinfectiemiddelen, is het mogelijk dat de accu minder goed of helemaal niet wordt opgeladen.
Reinig de contactpunten van de oplader met een zachte, stofvrije doek of wattenstaaf die met alcohol is bevochtigd.
VOORZICHTIG
Reinig de contactpunten van de oplader niet met een puntig of scherp voorwerp!
Spuit geen vloeistof op de contactpunten!
Let op dat u tijdens het reinigen de contactpunten van de oplader niet buigt of de vorm ervan wijzigt.
Zorg ervoor dat de contactpunten droog blijven na de reiniging en dat ze niet in contact komen met metalen
of vettige onderdelen. Indien nodig, de contactpunten met de luchtspuit drogen.
8.6.2 OPLADER – Verwisselbare contactpunten
Beschadigde of zeer vuile contactpunten van de oplader (die u niet schoon krijgt met de procedures in de vorige paragraaf) kunnen ervoor zorgen dat de contactpunten niet meer geleiden en de accu dus niet kan worden opgeladen.
In dat geval kunt u de beschadigde contactpunten van de oplader vervangen door nieuwe.
Neem contact op met uw plaatselijke Heraeus Kulzer-vertegenwoordiger voor aanvullende informatie over de vervanging van de contactpunten van de oplader en levering van onderdelen.
Instructies:
Benodigd gereedschap: kruiskopschroevendraaier (middelgroot).
1. Verwijder het handstuk uit de oplader.
2. Haal de stekker van de oplader uit het stopcontact.
3. Haal de plug van het netsnoer uit de oplader.
2x
4. Draai de oplader om.
5. Verwijder de 2 schroeven van het deel met de contactpunten (zie uitgevouwen achterblad, punt 12).
6. Trek het deel eruit.
7. Plaats het nieuwe deel met contactpunten in de oplader en voer bovenstaande stappen
in omgekeerde volgorde uit om alles weer vast te zetten en aan te sluiten.
VOORZICHTIG
Buig of verontreinig het nieuwe deel niet!
Zorg ervoor dat u het zeer nauwkeurig en goed plaatst en vastzet. Draai de schroeven niet te vast!
9
Opslag
Opslag van het handstuk met de accu erin als deze langere tijd niet gebruikt wordt. Laad de accu vóór of na een lange
periode van inactiviteit volledig op of bewaar het handstuk in de werkende oplader. Hoewel het ingebouwde veiligheidscircuit voorkomt dat de accu volledig wordt ontladen, raden we u sterk aan de accu tenminste elke 5 maanden volledig
op te laden als u het apparaat niet gebruikt.
10
Afvalverwerking
OPMERKING – BELANGRIJK
Gooi het apparaat niet bij het gewone huisvuil.
Neem rechtstreeks contact op met de Heraeus Kulzer-vertegenwoordiger in uw land voor inzameling
van het apparaat of van onderdelen ervan.
Lever accu’s en lichtgeleiders in als klein chemisch afval.
WAARSCHUWING – Afvoeren van beschadigde of oude accu’s
Gooi een beschadigde of oude accu pas weg als u de volgende voorzorgsmaatregelen hebt genomen
om externe kortsluiting te voorkomen:
Isoleer de contactpunten van de accu met isolatietape en lever de accu in als klein chemisch afval.
Op de condities en voorzorgsmaatregelen die gelden voor het weggooien van het apparaat zijn de geldende juridische
bepalingen van kracht vergelijkbaar met die voor andere onbruikbare elektronische apparatuur.
Afvoeren van oude apparaten conform de WEEE (Europese Richtlijn) of
Elektrische en Elektronische Apparatuur Wet (Duitse ElektroG-wet).
NL
- 19 -
11
Problemen oplossen
WAARSCHUWING
Als u het probleem niet kunt verhelpen aan de hand van de volgende stappen, neemt u contact op met
Heraeus Kulzer of een plaatselijke erkende servicepartner: GEBRUIK de Translux Wave NIET en PROBEER NIET
onderhoud te plegen aan het apparaat aangezien dit kan leiden tot ernstig letsel.
Lees deze gebruikershandleiding opnieuw als het apparaat niet goed lijkt te werken en bekijk daarna de informatie
in de volgende tabel:
PROBLEEM
De oplader wordt niet ingeschakeld.
De GROENE LED
op de oplader
is uit.
MOGELIJKE OORZAAK
De adapter is niet aangesloten op een
stopcontact en / of op de
voedingsaansluiting op de oplader.
Er staat geen stroom op het stopcontact.
De verwisselbare stekker is niet goed
in de adapter geplaatst.
Het netsnoer van de adapter is beschadigd.
De adapter is defect.
De oplader is defect.
Er is kortsluiting opgetreden tussen
de contactpunten.
NL
Handstuk NIET in de oplader
geplaatst.
De lichtemissie start niet als
u op de “Start / stop”-knop
drukt en er verschijnt geen informatie
op de display van het handstuk.
- 20 -
Er zit geen accu in het handstuk.
Het handstuk staat in de “Slaapmodus”.
De accu is leeg.
Er is onvoldoende lading in de accu om
het handstuk in te schakelen.
Er is een storing in de elektronica.
De accu is defect.
U hoort “2 piepjes” na afloop van de
belichtingscyclus.
De accu is bijna leeg.
OPLOSSING
Zorg ervoor dat de adapter goed is
aangesloten op een stopcontact en op
de voedingsaansluiting op de oplader.
Gebruik een ander stopcontact.
Lees paragraaf 5.2 van deze
gebruikershandleiding goed door.
Vervang de adapter door een nieuwe.
(Het netsnoer zit vast aan de adapter en
kan niet worden losgekoppeld.)
Vervang de adapter door een nieuwe.
Neem contact op met Heraeus Kulzer of
een plaatselijke erkende servicepartner.
Haal de oorzaak van de kortsluiting weg.
Vervang de contactpunten door nieuwe
als de kortsluiting aanhoudt.
Zie paragraaf 8.6.2.
Plaats de accu in het handstuk
(zie paragraaf 5.3).
Druk op de “Start / stop”-knop om
de “Slaapmodus” van het handstuk
te beëindigen. Zie paragraaf 6.3.
Plaats het handstuk in de oplader en
laad de accu op (zie paragraaf 5.5).
Neem contact op met Heraeus Kulzer of
een plaatselijke erkende servicepartner.
Plaats het handstuk in de oplader
om te verifiëren of de accu defect is.
Een “prekwalificatie check” begint
waarin de Translux Wave micro-processor de status van de accu controleert.
Deze controle kan tot max. 30 minuten
duren. Als tijdens deze controle, gedurende 30 seconden iedere seconde een
“pieptoon” klinkt en het accupictogram
op het handstuk GEEL knippert, is
vastgesteld dat de accu defect is.
Vervang de accu door een nieuwe
(zie paragraaf 5.3).
De “2 piepjes” geven aan dat de resterende acculading voldoende is voor nog
slechts enkele belichtingscycli.
Plaats het handstuk in de oplader en
laad de accu op (zie paragraaf 5.5).
PROBLEEM
MOGELIJKE OORZAAK
De LED is mogelijk defect.
De lichtemissie start niet als de
is ingedrukt
“Start / stop”-knop
of als tijdens een belichtingscyclus de
lichtemissie is onderbroken met een
piep. De LED “10s” op het handstuk
begint GROEN te knipperen.
knipperend
De oververhittingsbescherming
is geactiveerd.
Het handstuk is tijdens het gebruik oververhit geraakt en de temperatuursensor
is geactiveerd.
Als de oververhittingsbescherming is
geactiveerd, kunt u het apparaat enkele
minuten niet gebruiken.
Tijdens een belichtingscyclus hoort u De oververhittingsbescherming
“3 piepjes”.
is geactiveerd.
Het handstuk is tijdens het gebruik oververhit geraakt en de temperatuursensor
is geactiveerd.
Als de oververhittingsbescherming is
geactiveerd, kunt u het apparaat enkele
minuten niet gebruiken.
Storingen tijdens het opladen.
Tijdens de prekwalificatiefase van de
Gedurende 30 seconden hoort u elke accu (accu volledig leeg, zie paragraaf
seconde een geluidssignaal en op het 4.2.4 en 5.5).
handstuk knippert de accustatus-LED Er is een storing of defect in de accu en
GEEL.
het oplaadproces wordt onderbroken.
Na een aantal opeenvolgende
belichtingscycli wordt de lichtemissie
niet ingeschakeld als u op de
drukt.
“Start / stop”-knop
U hoort “3 piepjes”.
knipperend
Handstuk is geplaatst in de oplader, Fout: Laadcontact onderbroken.
maar het opladen wordt niet gestart. De oplader en het handstuk maken
onvoldoende contact.
De groen accustatus-LED op het
handstuk is uit.
De contactpunten van de oplader en / of
het handstuk zijn vuil.
De lichtintensiteit die is gemeten met De lichtgeleider is niet goed
de meter in de oplader is onvoldoende. in het handstuk geplaatst.
De LED
GEEL op.
op de oplader licht
De output van de lichtgeleider
is verminderd door vervuiling met
vreemd materiaal of composietresten.
De lichtgeleider is beschadigd
of versleten.
OPLOSSING
Controleer de LED functionaliteit door
de volgende procedure:
Zet het handstuk in de oplader en druk
de “Start / stop”-knop achtereenvolgend 5x in.
Neem het handstuk uit de oplader.
De LED “10s” op het handstuk stopt
met GROEN knipperen, het handstuk is
gereset.
Als de LED “10s” op het handstuk
opnieuw begint te knipperen bij het begin van een volgende belichtingscyclus
is de LED defect.
Neem in dit geval contact op met
Heraeus Kulzer of uw lokale distributeur.
Laat het handstuk minimaal 4 – 5 minuten afkoelen en druk dan op de
“Start / stop”-knop om de volgende
belichting te starten.
Opmerking: Het handstuk kan weer
worden gebruikt als het de operationele
temperatuur heeft bereikt – er is geen
“reset” nodig.
Laat het handstuk minimaal 4 – 5 minuten afkoelen en druk dan op de
“Start / stop”-knop om de volgende
belichting te starten.
NL
Vervang de accu door een nieuwe
(zie paragraaf 5.3).
2x
Zie paragraaf 8.5 en 8.6.2.
Controleer of het handstuk in de juiste
richting in de oplader is geplaatst.
Uitlijnsymbool.
Zie paragraaf 4.2.1, punt 4 en 5.
Reinig de contactpunten van het
handstuk en de oplader.
Zie paragraaf 8.5 en 8.6.1.
Controleer of de lichtgeleider helemaal
in het metalen uiteinde van het handstuk is gestoken.
Reinig de lichtgeleider.
Zie paragraaf 8.2.
Vervang de lichtgeleider door een
nieuwe.
- 21 -
12
Technische specificaties
Classificatie conform richtlijn 93/42/EG:
Veiligheidsnormen:
Classificatie conform IEC 60601-1:
Oplader:
Voeding voor oplader:
Voeding voor handstuk:
NL
- 22 -
Handstuk:
Lichtbron:
Lichtgeleider:
Instelbare belichtingscycli:
– Normale belichting
– “Soft-Start”-belichting
Oplaadtijd van lege accu:
Omgevingsvereisten van apparaat:
Klasse I (één)
Het product is getest en in overeenstemming bevonden met
IEC 60601-1 (tweede editie) en met IEC 60601-1-1.
Het product is getest en in overeenstemming bevonden met
IEC 60601-1 (derde editie) en met IEC 60601-1-2
(derde editie – voor elektromagnetische compatibiliteit– EMC).
Het handstuk is bedoeld voor gebuik in de omgeving van de patiënt
terwijl het oplaadstation en de stroomstekker niet bedoeld zijn voor
gebruik in de omgeving van de patiënt.
Opmerking: De omgeving van de patiënt is gedefinieerd als een
gebied van 1,5 meter rondom de patënt IEC 60601-1 derde editie en
IEC 60601-1-1).
Klasse II, Type B,
Meegeleverd onderdeel: Lichtgeleider met beschermkapje.
IP 20 (oplader).
IP 20 (Translux Wave)
Translux Wave-oplader
Oplaadstation (directe plug-in) geproduceerd door:
Phihong Technology CO LTD – Model: PSACO5R-050.
Input: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Output: 5 V
– 1 A Max –
.
Klasse II apparatuur
Oplaadbare lithium-ion-accu.
Producent: Panasonic. Model: NCR-18500.
Nominale spanning: 3,6 V.
Nominale capaciteit (typisch): 2000 mAh
Model: Translux Wave.
Gebruik: intermitterend gebruik: 120“ AAN – 40“ UIT – max 2 cycli
LED met hoge lichtsterkte.
Led-product klasse 2M (IEC 60825-1).
Golflengtebereik: 440 – 480 nm.
Dominante golflengte: min. 440 nm – max. 465 nm
Loodvrije multi-corestaaf, 8 mm diameter.
Te steriliseren in stoomautoclaaf met pre-vacuümprogramma:
4 minuten (minimaal) bij minimale temperatuur van 132°C + 3°C
(270°F + 5°F). Max. 500 cycli
10 seconden belichtingstijd.
Geluidssignalen:
1 piep bij de start van de belichting.
1 piep na afloop van de belichting
20 seconden belichtingstijd. (Bij “Soft-Start” neemt de lichtintensiteit binnen 2 seconden toe van 50% tot 100%.)
Geluidssignalen:
1 piep bij de start van de belichting.
1 piep na 1 seconde als teken dat “Soft-Start”-modus
is geactiveerd.
1 piep na 10 seconden belichting.
1 piep na afloop van de belichting
Ongeveer 3 uur
In gebruik
Temperatuur
Relatieve luchtvochtigheid
Atmosferische druk
10°C – 35°C
(50°F – 95°F)
45% – 85%
800 – 1060 hPa
Transport
en opslag
–20°C – 40°C
(–4°F – 104°F)
45% – 85%
500 – 1060 hPa
Oplader: gewicht 450 g.
Afmetingen: L 140 x B 58 x H 62 mm
Handstuk: gewicht 150 g (incl. lichtgeleider).
Afmetingen: L 275 mm, max. Ø 24 mm
Gewicht en afmetingen:
12.1
Elektromagnetische compatibiliteit EN 60601-1-2
WAARSCHUWING
Voor het apparaat zijn speciale EMC-maatregelen nodig, die volgens de instructies in deze paragraaf moeten
worden geïnstalleerd en geactiveerd.
Draagbare en mobiele radiocommunicatie-apparatuur kan van invloed zijn op de juiste werking
van het apparaat.
Instructie en verklaring van de fabrikant – elektromagnetische emissie
De Translux Wave is bedoeld voor gebruik in de hierna vermelde elektromagnetische omgeving. De klant of gebruiker
van de Translux Wave dient ervoor te zorgen dat het apparaat in een dergelijke omgeving wordt gebruikt.
Emissiecontrole
Conformiteit Elektromagnetische omgeving – handleiding
HF emissies CISPR 11
Groep 1
De Translux Wave gebruikt alleen RF-energie voor interne
functies. Daarom zijn de RF-emissies van het apparaat
erg laag en is interferentie met elektronische apparatuur
in de buurt niet waarschijnlijk.
HF emissies CISPR 11
Klasse B
De Translux Wave is voor het gebruik in alle gebouwen
geschikt inclusief woningen en gebouwen die direct met
Limietwaarden voor de emissie van harmonische Klasse A
het openbare stroomnet met laagspanning verbonstromen IEC 61000-3-2
den zijn, dat gebouwen voor privégebruik van stroom
Limietwaarden voor spanningsschommelingen
Conform
voorziet.
en flikkering IEC 61000-3-3
Instructie en verklaring van de fabrikant – elektromagnetische immuniteit
De Translux Wave is bedoeld voor gebruik in de hierna vermelde elektromagnetische omgeving. De klant of gebruiker
van de Translux Wave dient ervoor te zorgen dat het apparaat in een dergelijke omgeving wordt gebruikt.
Immuniteitstest
Controlestand IEC 60601
Conformiteitstoestand Elektromagnetische omgeving –
handleiding
Elektrostatische
±6 kV bij contact
Het apparaat blijft
De vloeren moeten uit hout, beton
ontlading (ESD)
normaal en veilig
of keramiek bestaan. Zijn de vloeren
±8 kV in de lucht
IEC 61000-4-2
functioneren.
met synthetisch materiaal bedekt,
dan moet de relatieve vochtigheid
minstens 30% bedragen.
Snelle elektrische
±2 kV voor voedingsleidingen
Het apparaat blijft
De kwaliteit van de netspanning
moet dezelfde zijn als in een typische
transiënten en lawines ±1 kV voor ingangs-/ uitgangsnormaal en veilig
IEC 61000-4-4
lijnen
functioneren.
zakelijke of ziekenhuisomgeving.
Stootspanningen
±1 kV differential
Het apparaat blijft
De kwaliteit van de netspanning
moet dezelfde zijn als in een typische
IEC 61000-4-5
normaal en veilig
±2 kV common mode
zakelijke of ziekenhuisomgeving.
functioneren.
Spanningsgaten,
< 5% UT (> 95% spanningsval UT) Het apparaat mag tijdens De kwaliteit van de netspanning
moet dezelfde zijn als in een typische
het gebruik onregelkorte spanningsonder- voor 0,5 cycli
zakelijke of ziekenhuisomgeving.
matigheden vertonen,
brekingen en
40% UT (60% spanningsval UT)
zolang het veilig werkt,
veranderingen aan de voor 5 cycli
er geen storingen ontingangslijnen van
70% UT (30% spanningsval UT)
staan en de gebruiker
de stroomvoorziening
voor 25 cycli
het apparaat kan resetIEC 61000-4-11
< 5% UT (> 95% spanningsval UT) ten naar de bedrijfsconditie van vóór de test.
in 5 sec
Magneetveld bij netfrequentie (50 / 60 Hz)
IEC 61000-4-8
3A/m
Het apparaat blijft
normaal en veilig
functioneren.
De netfrequentiemagneetvelden
zouden de karakteristieke niveaus
van een typische ruimte in een
zakelijke of ziekenhuisomgeving
moeten vertonen.
OPMERKING: UT is de netspanning in wisselstroom voor de toepassing van de controlestand.
NL
- 23 -
NL
- 24 -
Handleiding en verklaring van de fabrikant – elektromagnetische immuniteit
De Translux Wave is bedoeld voor gebruik in de hierna vermelde elektromagnetische omgeving. De klant of gebruiker
van de Translux Wave dient ervoor te zorgen dat het apparaat in een dergelijke omgeving wordt gebruikt.
ImmuniteitsControlestand Conformiteits- Elektromagnetische omgeving – handleiding
controle
IEC 60601
toestand
Geleide
3 Veff van
Het apparaat
De draagbare mobiele telefoons met radiofrequentie mogen niet in de
radiofrequentie 150 kHz tot
blijft normaal
buurt van het product of van een deel ervan inclusief kabels gebruikt
IEC 61000-4-6 80 MHz
en veilig
worden, tenzij de aanbevolen scheidingsafstanden in acht genomen
functioneren.
worden, die met de vergelijking berekend worden die voor de frequenUitgestraalde
3 V / m van
tie van de zender toepasbaar is.
radiofrequentie 80 MHz tot
Aanbevolen scheidingsafstand
IEC 61000-4-3 2,5 GHz
d = 1,2 √P
d = 1,2 √P van 80 MHz tot 800 MHz
d = 2,3 √P van 800 MHz tot 2,5 GHz
waarbij (P) het maximale nominale uitgangsvermogen van de zender in
watt (W) volgens fabrikant van de zender en (d) de aanbevolen
scheidingsafstand in meter (m) is. De veldsterkte van de vaste
radiofrequentiezenders, zoals ze in een elektromagnetisch onderzoek
van de plaats bepaald wordt, moet kleiner zijn dan de
conformiteitstoestand in elk frequentie-interval (b).
Interferenties kunnen in de buurt van toestellen optreden
die met het volgende symbool aangeduid zijn:
Opmerkingen:
(1) Bij 80 MHz en 800 MHz geldt het hogere frequentiebereik.
(2) Deze richtlijnen zijn misschien niet in alle gevallen toepasbaar. Eektromagnetische voortplanting wordt door absorptie
en reflectie van de gebouwen, voorwerpen en mensen beïnvloed.
a) De veldsterkte van stationaire zenders, zoals basisstations van radiotelefoons en walkietalkies, radioamateurstations,
AM- en FM-radio- en televisiezenders kan theoretisch niet precies vooraf bepaald worden. Om de elektromagnetische
omgeving m.b.t. de stationaire zenders te bepalen, moet een studie van de standplaats in overweging genomen worden.
Als de gemeten veldsterkte aan de standplaats, waarop het product gebruikt wordt, de hierboven genoemde conformiteitstoestanden overschrijdt, dan moet het product gecontroleerd worden om de reglementaire werking aan te tonen.
Als ongewone waarden vastgesteld worden, kunnen bijkomende maatregelen vereist zijn, zoals bijv. een veranderde
afstemming of een andere standplaats van het product.
b) In het frequentiebereik van 150 kHz tot 80 MHz moet de veldsterkte geringer zijn dan 3 V / m.
Aanbevolen scheidingsafstanden tussen draagbarezendontvangers en mobiele telefoons en de Translux Wave
De Translux Wave is bestemd voor het gebruik in een elektromagnetische omgeving waarin door radiofrequentie uitgestraalde storingen onder controle staan. De klant of de bediener van de Translux Wave kan elektromagnetische interferenties
voorkomen door een minimumafstand tussen de draagbare radiofrequentiezendontvangers en mobiele telefoons (zenders)
en de Translux Wave volgens de onderaan vermelde aanbevelingen naargelang het maximale uitgangsvermogen van de
zendontvangers in acht te nemen.
Veiligheidsafstand afhankelijk van de zendfrequentie (m)
Maximaal nominaal
uitgangsvermogen van de
van 150 kHz tot 80 MHz
van 80 MHz tot 800 MHz
van 800 MHz tot 2,5 GHz
zender (W)
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
Voor de zenders met een hierboven niet vermeld maximaal nominaal uitgangsvermogen kan de aanbevolen afstand (d) in
meter (m) aan de hand van de op de frequentie van de zender toe te passen vergelijking berekend worden, waarbij (P) het
maximale nominale uitgangsvermogen van de zender in watt (W) volgens de fabrikant van de zender is.
Opmerkingen:
(1) Bij 80 MHz en 800 MHz wordt het hoogste frequentie-interval toegepast.
(2) Het is mogelijk dat deze richtlijnen niet in alle situaties toegepast moeten worden. De elektromagnetische uitbreiding
wordt door de absorptie en de reflectie van structuren, voorwerpen en personen beïnvloed.
12.2
Identificatieplaatje van de oplader
Beschrijving van de symbolen op het identificatieplaatje
1 CE-markering.
2 Voorzichtig, raadpleeg bijbehorende documenten.
3 Raadpleeg gebruiksinstructies.
4 Dubbele isolatie (apparaat voldoet aan veiligheidsklasse II).
5 Afvalverwerking elektrische en elektronische apparatuur.
(Van toepassing in de Europese Gemeenschap en andere Europese
landen met afzonderlijke inzamelingssystemen.)
6 MET-markering.
12.3
Serienummer van handstuk
Het serienummer van het handstuk is gegraveerd aan de onderkant van de behuizing.
Gegraveerd
serienummer.
13
1
2
3
4
5
6
Garantie
Ieder Heraeus Kulzer-apparaat wordt voor uitlevering aan strenge tests en een strenge eindcontrole onderworpen,
om optimaal bedrijf van het apparaat te waarborgen. Heraeus Kulzer verleent op alle bij een Heraeus Kulzer-wederverkoper of -importeur nieuw gekochte Heraeus Kulzer-producten een garantie van 2 (twee) jaar vanaf de aankoopdatum
op materiaal- en productiefouten. Heraeus Kulzer verplicht zich, tijdens de garantieperiode de zijns inziens defecte
onderdelen van de producten kosteloos te repareren (of indien zo beslist te vervangen). Het geheel vervangen van
Heraeus Kulzer-producten is niet de bedoeling.
Heraeus Kulzer is in geen geval aansprakelijk voor directe of indirecte persoonlijke of materiële schade in de
volgende gevallen:
• Hetapparaatisnietconformdebedoelinggebruikt.
• Hetapparaatisnietconformdeindezegebruiksaanwijzingbeschreveninstructiesenvoorschriftengebruikt.
• Deelektrischeinstallatieinderuimten,waarinhetapparaatisgebruikt,voldoetnietaandegeldendewettelijke
en overig geldende voorschriften.
• Samenstelling,toevoegingen,instellingen,veranderingenofreparatieswerdennietdoorHeraeusKulzervakpersoneel uitgevoerd.
• Deomgevingsomstandighedenvoorhetbewarenenopslaanvanhetapparaatvoldoennietaandevoorschriften
zoals genoemd in de paragraaf 12 (Technische specificaties).
Uitgesloten van de garantie zijn transportschade, schade veroorzaakt door ondeskundig gebruik of nalatigheid, schade
die ontstaat door aansluiting van een andere dan de gespecificeerde netspanning en de controlelampen, de knop en
alle toebehoren. De garantie vervalt, wanneer het apparaat door andere personen dan de servicedienst wordt gewijzigd
of gerepareerd. Voor het aanspraak maken op de garantie stuurt de klant op eigen kosten het beschadigde apparaat
op aan de wederverkoper of de Heraeus Kulzer-importeur, waarbij het apparaat is gekocht. Het apparaat inclusief de
accessoires moet goed verpakt worden verzonden (zo mogelijk in de originele verpakking).
Bij retourzending van het apparaat dient de volgende informatie te zijn bijgevoegd:
a) Naam, adres en telefoonnummer van de eigenaar.
b) Naam en adres van de wederverkoper / importeur.
c) Fotokopie van de pakbon / koopovereenkomst van het apparaat waarop de datum, de identificatie van het
apparaat en het serienummer zijn aangegeven.
d) Beschrijving van de bedrijfsstoring.
Er bestaat geen aansprakelijkheid voor het transport en eventuele transportschade.
In geval van schade die is veroorzaakt door een ongeval of ondeskundig gebruik of schade die optreedt na afloop van
de garantieperiode, worden de reparaties in rekening gebracht.
NL
- 25 -
14
Service
14.1
Servicepartner / contactpersoon in de regio
15
Documentenhistorie
1x
2012-08 Conceptversie voor prototypes.
2013-09 Eerste editie.
2014-03 Wijzigingen in paragraaf 2.1, 3.2.1, 7.2, 10, 11, 12 en 12.2.
NL
- 26 -
De informatie in dit document kan gewijzigd worden.
Status: 2014-03
Innehållsförteckning
1
1.1
1.2
1.3
Användning ______________________________________________________________________
Allmänt _______________________________________________________________________
EG-konformitetsförklaring _________________________________________________________
Tillverkarens deklaration ___________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Instruktioner om säker användning av enheten __________________________________________
Förklaring av symboler och associerade ord ____________________________________________
Transportskada – uppackning och inspektion ___________________________________________
Ägarens ansvar _________________________________________________________________
Maskinjournal __________________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Avsedd användning ________________________________________________________________
Beskrivning av enheten ___________________________________________________________
Säkerhetskrav __________________________________________________________________
Allmänna säkerhetsinstruktioner för användning av enheten _________________________________
Säkerhetsåtgärder _______________________________________________________________
BATTERI – Säkerhetsåtgärder _______________________________________________________
BATTERI – information ____________________________________________________________
ANSVAR _______________________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Beskrivning av enheten _____________________________________________________________ 8
Innehåll vid leverans _____________________________________________________________
8
Beskrivning av reglage och användningselement _________________________________________
8
Handenhet ____________________________________________________________________
8
Inriktningsknapp ________________________________________________________________
8
Laddningsenhet _________________________________________________________________
8
Handenhetens ljudsignaler _________________________________________________________
9
Information om utsänd strålning från lysdioder __________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installation och driftstart ___________________________________________________________
Säkerhetskrav under installationen __________________________________________________
Anslutning av laddningsenheten till huvudströmsuttaget ___________________________________
Placering av batteriet i handenheten __________________________________________________
Placering av fiberoptiken i handenheten _______________________________________________
Batteriladdning _________________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Användning ______________________________________________________________________
Aktivera och inaktivera exponeringscykeln _____________________________________________
Mätning av ljusintensiteten _________________________________________________________
Viloläge _______________________________________________________________________
Ytterligare information om användning av enheten ________________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Larmtillstånd _____________________________________________________________________
Fel på batteriet _________________________________________________________________
Felaktig LED ___________________________________________________________________
Överhettningsskydd ______________________________________________________________
Den INBYGGDA temperaturöverbelastningssensorn defekt __________________________________
Signal för låg batteriladdning _______________________________________________________
15
15
15
15
15
16
OBS!
Använd bokikonen för att visa kapitlets bilder eller
ytterligare information på det utvikbara omslaget.
1x /2x
Vik ut det
främre omslaget
HKG-Layout 99000943_01 GBA
Vik ut det
bakre omslaget
08SE
Translux Wave EU
Dateiname: 08SE_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
SE
-1-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Rengöring, desinfektion och sterilisering _______________________________________________
Montera isär ___________________________________________________________________
LJUSLEDARE – Rengöring och desinfektion _____________________________________________
LJUSLEDARE – Inspektion före sterilisering _____________________________________________
LJUSSKYDDSKON – Rengöring och desinfektion _________________________________________
LJUSSKYDDSKON – Inspektion före sterilisering _________________________________________
LJUSLEDARE och LJUSSKYDDSKON – Paketering före steriliseringen __________________________
LJUSLEDARE och LJUSSKYDDSKON – Sterilisering _______________________________________
Steriliseringsmetod ______________________________________________________________
Steriliseringsparametrar ___________________________________________________________
HANDENHET – Rengöring och desinfektion _____________________________________________
LADDNINGSENHET – rengöra höljet __________________________________________________
LADDNINGSENHET – Rengöring av laddningskontakterna __________________________________
LADDNINGSENHET – utbytbara laddningskontakter _______________________________________
16
16
16
16
16
17
17
17
17
17
17
18
18
19
9
Förvaring ________________________________________________________________________ 19
10
Kassering _______________________________________________________________________ 19
11
Felsökning _______________________________________________________________________ 20
12
12.1
12.2
12.3
Tekniska specifikationer ____________________________________________________________
Elektromagnetisk kompatibilitet EN 60601-1-2 __________________________________________
Laddningsenhetens identifieringsplatta ________________________________________________
Handenhetens serienummer ________________________________________________________
13
Garanti __________________________________________________________________________ 25
14
14.1
Service __________________________________________________________________________ 26
Servicepartner / kontaktpersoner i landet ______________________________________________ 26
15
Dokumentversion __________________________________________________________________ 26
22
23
25
25
SE
-2-
OBS!
Använd bokikonen för att visa kapitlets bilder eller
ytterligare information på det utvikbara omslaget.
1x /2x
Vik ut det
främre omslaget
Vik ut det
bakre omslaget
1
Användning
1.1
Allmänt
Translux Wave är ett registrerat varumärke som tillhör Heraeus Kulzer GmbH.
Denna bruksanvisning gäller för:
Artikelnr.
66055012
Typ och utförande
Translux Wave – LED ljushärdningsenhet
Utgåva
2014-03 / 99000943/01
1.2
EG-konformitetsförklaring
Härmed förklarar vi, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, att följande apparat uppfyller EU:s riktlinjer
för säkerhet och hälsa vad gäller konstruktion och leveransutförande.
Om apparaten ändras utan vårt godkännande, eller om den ändras på ett icke godkänt sätt,
upphör konformitetsförklaringen att gälla.
1.3
Tillverkarens deklaration
Vi bekräftar härmed att enheten Translux Wave uppfyller direktivet 93/42 EG och normerna IEC 60601-1
och IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Tyskland).
2
Instruktioner om säker användning av enheten
Var god läs denna manual och följ instruktionerna noggrant. Orden VARNING, FÖRSIKTIGT! och OBS! har speciella
betydelser och text under dessa rubriker måste granskas noggrant (se följande stycke). Förvara alltid denna manual
lättåtkomligt.
2.1
Förklaring av symboler och associerade ord
Symboler
Associerade ord
Förklaring
VARNING
Dödsfall eller allvarliga skador kan intäffa om inte anvisningarna följs.
FÖRSIKTIGT!
Mindre skador eller skador på enheten kan kan uppkomma om inte
anvisningarna följs.
OBS!
Anvisningar för hur apparaten används på bästa sätt för att minimera skada.
SE
VARNING FÖR
EXPLOSION
VARNING för explosion – iaktta information och varningar i kapitel och avsnitt
märkta med dessa bildsymboler.
-3-
KOPPLA BORT FRÅN
HUVUDSTRÖMMEN
VARNING för elektrisk stöt.
Koppla bort laddningsenheten från eluttaget innan du utför rengöringsoch desinficeringsprocedurer!
MET-märkning – UL / CSA överensstämmelse.
MET
WEEE / ElektroG
Kassering av gammal utrustning enligt WEEE (EU-direktiv) eller
Elektrisk och elektroniska utrustningslagen (tyska lagen ElektroG).
Tillämpningsdel:
Typ B, tillämpningsdel som uppfyller de tekniska normerna IEC 60601-1.
Dubbel isolering:
Klass II-enhet.
Strömtillförsel:
Växelström.
Likström.
Adapterns polaritet – centrum positiv (plus).
Endast för användning i slutna utrymmen.
Symboler
Associerade ord
Förklaring
Enheten har tillverkats enligt direktivet 93/42/EG inklusive de tekniska
normerna IEC 60601-1 och IEC 60601-1-2.
VARNING-symbolen ”LED-strålning”.
Iaktta informationen och varningarna i avsnitt 4.2.5.
Se bruksanvisningen.
FÖRSIKTIGT! Se medföljande dokumentation.
Strömbrytare:
”Start / stopp”.
Registreringsbevis enligt hälsoministeriet i Ryssland.
Håll produkten borta från regn.
Temperaturbegränsning vid förvaring (–20°C (–4°F) till 40°C (104°F)).
Fuktighetsbegränsning vid förvaring (45 – 85 % RH).
Begränsning för atmosfärtrycket vid förvaring (500 – 1060 hPa).
SE
-4-
2.2
Transportskada – uppackning och inspektion
Apparaten är känslig för stötar, eftersom den innehåller elektriska komponenter. Iaktta försiktighet vid såväl transport
som förvaring. Varorna kontrolleras noggrant innan de skickas från Heraeus Kulzer. Vid leverans är apparaten väl
skyddad och förpackad.
Kontrollera omedelbart vid mottagandet att apparaten inte har skadats under transporten. Skador ska meddelas
transportföretaget inom högst 24 timmar efter mottagandet. Installera inte och arbeta under inga omständigheter med
en skadad enhet och / eller skadade tillbehör.
2.3
Ägarens ansvar
Ägaren ansvarar för att föreskrifterna följs, att de personer som ska använda apparaten utbildas i dess handhavande
samt att arbetsplatsen uppfyller gällande krav på säkerhet och miljö.
För arbeten på och med apparaten ska innehavaren utarbeta skriftliga anvisningar mot bakgrund av bruksanvisningen
och det arbete som ska utföras. Dessa anvisningar bör finnas tillgängliga i förståelig form och på de anställdas språk.
2.4
Maskinjournal
Vi rekommenderar att du för en ”maskinjournal” och dokumenterar alla tester och större arbeten (t.ex. service,
förändringar) i den.
3
Avsedd användning
Translux Wave är en dental LED-härdningsenhet som är avsedd för användning i munhålan för polymerisering
av ljushärdande tandmaterial, t.ex. adhesiva material och fyllnadsmaterial som aktiveras inom våglängdsintervallet
440 – 480 nm.
OBS!
Trots att de flesta ljushärdande tandmaterial aktiveras inom detta våglängdsintervall bör du vid osäkerhet
kontrollera tillverkarens specifikationer eller kontakta tillverkaren.
VARNING – Kvalificerade specialister.
Enheten får endast handhas av korrekt utbildad specialistpersonal och tandläkare (se stycke 2.3 Ägarens
ansvar). Om enheten används korrekt kommer den inte att ge upphov till några kända biverkningar.
3.1
Beskrivning av enheten
Translux Wave använder en ljuskälla som består av en mycket effektiv mono-kromatisk ljusdiod med en våglängd
mellan 440 och 480 nm.
Allt ljus som avges av Translux Wave används för att aktivera fotoinitieraren kamferkinon. Detta ger utmärkta
polymeriseringsresultat med låg värmeavgivning.
Translux Wave levereras med en 360° roterande ljusledare med 8 mm diameter.
Translux Wave består av en laddningsenhet och en handenhet som drivs av ett avtagbart uppladdningsbart
litiumjonbatteri.
Handenheten är utrustad med ett ”Viloläge” för att minimera enhetens energiförbrukning.
Handenheten växlar till ”Viloläget” om den inte används under ungefär 5 minuter.
Translux Wave fungerar med två olika exponeringscykler:
• Exponering med konstant effekt: cykeln varar 10 sekunder.
• Exponering med långsamt ökande effekt: ”Mjukstart” (cykeln varar 20 sekunder).
”Mjukstart” betyder att ljusintensiteten ökar från 50 % till 100 % inom 2 sekunder.
OBS! – Följ de exponeringstider för materialen som angetts av tillverkaren.
För material med specifika exponeringstider (t.ex. 30 / 40 sekunder för mörka kompositmaterial) upprepas
exponeringen flera gånger vid behov.
3.2
Säkerhetskrav
De personer som brukar eller hanterar apparaten måste läsa igenom säkerhetsanvisningarna, så att apparaten och
bearbetningsmaterialet används och hanteras på ett säkert sätt.
VARNING
Förhindra skador, särskilt personskador, genom att noggrant läsa igenom bruksanvisningen och de tekniska
uppgifterna innan apparaten tas i bruk.
Utöver informationen i bruksanvisningen ska nationella och lokala föreskrifter och regler följas vid uppställning
och användning.
3.2.1
Allmänna säkerhetsinstruktioner för användning av enheten
VARNING – AVSEDD ANVÄNDNING
Använd endast enheten för avsett ändamål (se avsnitt 3 Avsedd användning). All annan användning är kontraindicerad. Om denna bestämmelse inte efterlevs kan det resultera i allvarlig skada för patienter eller enhetens
handhavare samt ge skada eller fel på enheten. Heraeus Kulzer ansvarar inte för följdskador som uppstår
på grund av att tidigare nämnda villkor inte efterlevs!
VARNING
Användaren ansvarar för testning av Translux Wave vad gäller dess användning och lämplighet för avsett
ändamål.
Rikta aldrig ljuspunkten mot ögonen! Direkt eller indirekt exponering av ljuset i ögonen måste alltid förhindras
genom användning av skyddsglasögon som filtrerar bort blått ljus. Vid härdning ska ljusledarens spets placeras
direkt över materialet som ska härdas och exponering av den omgivande mjukvävnaden ska undvikas.
Ögon, gom, mjukvävnad och andra kroppsdelar får inte exponeras för det blå ljuset (dessa delar måste vid
behov täckas över). Använd en kofferdamm för att skydda mjukvävnaden, t.ex. gingiva, under behandlingen.
Exponeringen måste begränsas till det område i munhålan där den kliniska behandlingen utförs.
VARNING – KONTRAINDIKATIONER
Använd inte Translux Wave på patienter med pacemaker eller andra implanterade elektroniska enheter.
Detta gäller även handhavaren.
Enheten får inte användas av barn, blinda eller döva och inte heller av/på personer som kan få epileptiska
anfall. Ovan nämnda personer kanske inte känner till riskerna med användning och handhavande.
Av säkerhetsskäl är användning och handhavande av enheten förbjudet för personer med potentiell risk
för epileptiska anfall.
VARNING
Ingen modifiering av denna utrustning är tillåten.
Ägaren / användaren måste säkerställa att:
– Enheten inte används på patienter med positiv anamnes efter ljustestning, t.ex. på urticaria solaris
och / eller porfyri samt på patienter som har behandlats med fotosensibiliserande läkemedel.
SE
-5-
–
Enheten inte används på patienter som har genomgått operation av gråstarr. Dessa patienter är extra
känsliga mot ljus, om de inte använder lämplig skyddsutrustning, t.ex. ögonskydd / glasögon som filtrerar
bort blått ljus.
– För patienter vars anamnes innehåller retinasjukdomar måste behandlingen med Translux Wave
godkännas av ögonläkaren.
– En specialläkare konsulteras i alla potentiella riskfall.
VARNING – Hög temperatur på specifika delar
Max. temperaturen för de applicerade delarna (ljusledaren och skyddande ljuskägla): 41°C (106°F).
Max. temperaturen hos en behandlad del utav dom applicerade (främre metall kon) som kan komma i kontakt
med patienten: 46°C (115°F).
Heraeus Kulzer förklarar att om enheten används i enlighet med instruktionerna i denna manual, kommer ingen
uppvärmning av vävnad uppstå.
VARNING – infektionskontroll
Ljusledaren och ljusskyddskonen måste rengöras, desinficeras och steriliseras (ånga) före varje användning.
Ljusledaren och ljusskyddskonen levereras OSTERILA och måste steriliseras innan de används för första
gången. Se avsnitt 8.4.1.2 Steriliseringsparametrar.
3.2.2
SE
-6-
Säkerhetsåtgärder
VARNING – RISK FÖR EXPLOSION
Installera inte enheten där det finns risk för explosion.
Enheten får inte användas i lättantändliga miljöer (i närheten av anestesiblandningar, syrgas, kväveoxidul etc.)
Använd enheten i ett väl ventilerat område.
VARNING
Innan du använder enheten måste du kontrollera huvudströmskabeln och -kontakten. Om de är skadade ska
de inte anslutas till huvudströmmen.
Använd endast originaldelar eller tillbehör från Heraeus Kulzer GmbH. Heraeus Kulzer tillhandahåller en ljusledare som är lämplig för användning med Translux Wave. Andra ljusledare får inte användas. Heraeus Kulzer
GmbH påtar sig inte något ansvar för skador som uppstår genom användning av andra reservdelar och tillbehör
än originaldelar från Heraeus Kulzer.
3.2.3 BATTERI – Säkerhetsåtgärder
Heraeus Kulzer GmbH påtar sig inte något ansvar för batteriproblem som inträffar när de säkerhetsåtgärder som finns
i listan i avsnittet nedan inte åtföljs noggrant.
VARNING
Felanvändning av batteriet kan leda till att batteriet överhettas, brister eller antänds och ger upphov till allvarlig
skada. Säkerställ att du följer säkerhetsreglerna i listan i stycket nedan.
Använd endast originalbatterier från Heraeus Kulzer!
Användning av batterier som inte kommer från Heraeus Kulzer eller ej uppladdningsbara batterier och / eller
primära batterier utgör en potentiell fara och kan skada enheten.
Förvara batteriet utom räckhåll för barn!
Öppna, punktera eller krossa aldrig batteriet – det innehåller giftiga substanser.
Om batteriet visar korrosion, avger en ovanlig lukt eller läcker vätska, avlägsna batteriet från handenheten
omedelbart.
Utsätt inte batteriet för vatten eller saltvatten. Låt inte heller batteriet bli vått. Förvara inte batteriet i hög
luftfuktighet eller på en plats där det kan utsättas för regn.
Gnugga inte ögonen i den händelse batteriet skulle läcka och vätskan tränger in i ögonen. Skölj noga med
vatten och uppsök omedelbart sjukvården. Utan behandling kan batterivätska skada ögat.
VARNING – RISK FÖR EXPLOSION
Använd endast Translux Wave laddningsenhet och den strömtillförselenhet som medföljer enheten för att ladda
handenhetens batteri. Försök aldrig ladda Translux Wave-batteriet genom att använda någon annan laddningsenhet. Användning av någon annan laddningsenhet kan leda till skada på batteriet, risk för explosion och brand!
Använd aldrig Translux Wave laddningsenhet för att ladda andra typer av batterier eller andra enheter med
ett uppladdningsbart batteri! Använd endast originalbatterier från Heraeus Kulzer.
Utsätt inte batteriet för åverkan genom att sticka det med vassa föremål, slå på det med hammare / verktyg,
trampa på det eller på något annat sätt utsätta det för kraftiga slag eller stötar.
Placera inte batteriet i öppen eld eller stark hetta. Kortslut aldrig batteriets element med något metallföremål
på grund av risken för brännskador, brand eller explosion. Bär eller förvara aldrig batteriet tillsammans med
halskedjor, hårnålar eller andra metallföremål.
VARNING – Montera aldrig isär eller modifiera batteriet!
Säkerhetsmekanismer är inbyggda i batteriet vilka vid skada kan leda till att batteriet genererar värme,
spricker, exploderar eller antänds.
VARNING – Placera inte batteriet på eller nära öppen eld eller på platser med hög temperatur
Placera inte batteriet i direkt solsken. Om så sker kan det leda till att batteriet genererar värme, spricker eller
antänds. Om batteriet används på detta sätt kan det även leda till funktionsfel och förkortad livslängd.
VARNING – Vid brand, HÄLL INTE VATTEN PÅ ETT BRINNANDE BATTERI!
En brandsläckare av klass C (enligt Europeiska normen EN 3) måste användas.
VARNING – Kassering av skadade eller förbrukade batterier
Kassera skadade eller förbrukade batterier efter att ha vidtagit nödvändiga åtgärder för att förhindra
extern kortslutning på följande sätt:
Kassera enligt lag eller enligt gällande lokala bestämmelser efter att ha isolerat batteripolerna på batterierna
med isoleringstejp.
3.2.4 BATTERI – information
• Laddningstidförtomtellernyttbatteri:ca3timmar.
ANMÄRKNING – NYTT batteri: första laddningen
Första gången batteriet laddas kan processen ta cirka 3 timmar. Nya batterier eller batterier som
förvarats under en lång tid kan ta längre tid att ladda. Batteriet når sin fulla kapacitet efter några laddning /
urladddning-cykler.
OBS!
Placera handenheten i laddningsenheten efter varje behandling eller när den inte används.
• Driftsvillkor:
Driftstemperatur: 10°C (50°F) upp till 35°C (95°F).
Relativ luftfuktighet: 45% till 85% RH.
Lufttryck: 800 hPa to 1060 hPa.
FÖRSIKTIGT!
Intervallen för temperatur och relativ luftfuktighet inom vilka batteriet kan laddas är 10°C (50°F) till
35°C (95°F) och 45% till 85% RH. Laddning av batteriet vid temperaturer utanför detta intervall
kan leda till att batteriet blir överhettat eller skadat. Laddning av batteriet vid temperaturer utanför
detta intervall kan också försämra batteriets prestanda eller minska batteriets livslängd.
• Villkorförtransportochförvaringavbatteriet:
Rekommenderade intervall för temperatur och relativ luftfuktighet:
–20°C (–4°F) till 40°C (104°F) och 45% till 85% RH.
Förvara alltid batteriet laddat och inte under längre tid än 5 månader.
Omgivningens lufttryck: 500 hPa till 1060 hPa.
OBS!
Ladda alltid batteriet helt före en längre tids användningsuppehåll för enheten och minst var 5:e månad.
Om apparaten inte används under en längre tid, avlägsna då batteriet från handstycket.
• Normallivslängdförbatteriet:
Translux Wave-batteriet har en normal livslängd på 300 – 400 laddningscykler beroende på användningsoch omgivningsvillkor.
OBS!
Batteriet är en kemisk produkt som använder kemisk reaktion så prestanda försämras inte bara genom
användning utan även med tiden även om det inte används.
SE
-7-
3.2.5 ANSVAR
Endast personal från Heraeus Kulzer, Heraeus Kulzers servicepartner eller utbildad fackpersonal får utföra arbeten
på elektriska delar, och då endast när dessa inte är anslutna till en strömkälla.
Endast godkända originaldelar och tillbehör får användas.
Om andra delar används uppstår oförutsägbara risker.
Apparatens funktion och säkerhet kan endast garanteras om apparaten kontrolleras, underhålls och repareras
av Heraeus Kulzer, Heraeus Kulzers servicepartner eller utbildad fackpersonal.
Heraeus Kulzer GmbH ansvarar inte för eventuella skador som uppstår på grund av en defekt / felfunktion hos apparaten till följd av oriktiga reparationer, som inte utförts av Heraeus Kulzer-servicepartner eller av oss utbildad personal,
eller i fall där inte originalreservdelar / originaltillbehör använts vid utbyte av delar.
4
Beskrivning av enheten
4.1
Innehåll vid leverans
1 Laddningsenhet
2 Handenhet
3 Ljusledare, Ø = 8 mm
4 Ljusskyddskon
5 Uppladdningsbart litiumjonbatteripack
6 Universalströmtillförselenhet (100 V – 240 V (
6a = Europa
typ 1
6b = Storbritannien typ 2
6c = USA / Japan typ 3
4.2
4.2.1
SE
-8-
1x
)) inklusive internationella stickkontakter:
Beskrivning av reglage och användningselement
Handenhet
1 ”Start / stopp”-knapp
2 Lysdioder för härdningslägen (GRÖNT)
3 Lysdiod för batteristatus (2 färger: GRÖN / GUL)
4 Laddningsenhetens kontakter
5 Inriktningsknapp
4.2.2 Inriktningsknapp
Inriktningsknappen (5) som är placerad på baksidan nedre delen av handenhetens hölje underlättar
placeringen av handenheten i laddningsenhetens hållare.
När handenheten placeras i laddningsenheten måste inriktningsknappen riktas in mot styrspåret
i insidan av laddningsenhetens hållare.
En ljudsignal bekräftar att kontakterna är i rätt laddningsposition!
4.2.3
2x
2x
Laddningsenhet
1x
Komponenter, sett ovanifrån
1 Laddningsenhetens hölje
7 Handenhetshållare med inriktningsskåra och kontakter för utbytbar laddningsenhet
8 Ljusintensitetssensor
9
– GRÖN LED
Funktion: Den anger att laddningsenheten är påslagen.
10
– 2-färgad LED (GRÖN / GUL)
Funktion: Ljusintensitetsinformation.
GRÖN: Anger att ljusintensiteten, mätt med den inbyggda ljusmätaren är lämplig för effektiv behandling.
GUL: Anger att ljusintensiteten är otillräcklig.
Laddningsenhet sett underifrån
11 Strömtillförseluttag
12 Insats för utbytbar laddningskontakt
2x
4.2.4
Handenhetens ljudsignaler
Funktion / feltillstånd
Användning av knapp på handenheten
POLYMERISERINGSPROGRAM:
10 sekunder.
• Tryckpåknappen”START / STOPP”
kortvarigt för att starta exponeringen.
”MJUKSTART”
PROGRAM:
20 sekunder.
AVBROTT I EXPONERINGSCYKELN
SIGNAL FÖR LÅG
BATTERILADDNING
Batteriets kvarvarande
laddningsnivå är tillräcklig för ytterligare några
exponeringscykler.
LJUDSIGNAL VID TOMT
BATTERI
Följande exponeringscykler kan inte aktiveras.
SIGNAL FÖR
DEFEKT BATTERI
LED-ljuskällan
är defekt
ÖVERHETTNINGSTILLSTÅND
INBYGGD temperaturöverlastningssensor
defekt
Laddningskretsen
på handenheten defekt
OBS! Detta tillstånd
detekteras endast när
handenheten är placerad
i laddningsenheten.
• Tryckpåknappen”START / STOPP”
i minst en sekund för att starta
exponeringen.
• Exponeringscykelnkanavbrytasnär
som helst och programmet som används
stoppas genom att knappen
trycks in.
”START / STOPP”
Akustisk /-a signal /-er som avges
Indikationer på handenheten
• 1 ljudsignal när knappen ”START / STOPP”
trycks in.
• 1 ljudsignal i slutet av exponeringstiden.
Den gröna 10-sekunderslysdioden tänds.
• 1 ljudsignal när knappen ”START / STOPP”
trycks in.
• 1 ljudsignal efter 1 sekund indikerar att
”Mjukstart” läget är aktiverat.
• 1 ljudsignal efter 10 sekunders exponeringstid.
• 1 ljudsignal i slutet av exponeringstiden.
Den gröna 20-sekunderslysdioden tänds.
• 1 ljudsignal när knappen ”START / STOPP”
trycks in.
• 2 ljudsignaler i slutet av exponeringscykeln.
• Ikonenförbatteriblinkargrönt.
Placera handstycket i laddningsenheten för
laddining!
• 2 ljudsignaler utan ljusaktivering.
• Ikonenförbatteriblinkargrönt.
Placera handstycket i laddningsenheten för
laddining!
Endast när handenheten är placerad i laddningsenheten.
• 1 ljudsignal hörs varje sekund under
30 sekunder.
Lysdioden för batteristatus lyser GUL.
Ingen akustisk signal avges.
Den gröna lysdioden för använt exponeringscykeln blinkar.
• 3 ljudsignaler och elektroniken tillåter att
exponeringscykeln som används kan avslutas.
• 4 ljudsignaler hörs vid start av exponering.
Två gröna LED´s (10 s / 20 s) blinker på
handstycket.
SE
-9-
4.2.5
Information om utsänd strålning från lysdioder
Utrustningen innehåller lysdioder med hög ljusstyrka i klass 2M (IEC 60825-1).
Lysdiodsstrålning.
Titta inte in i ljusstrålen eller rikta optiska instrument
LED RADIATION
direkt mot den.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• Lysdiodsproduktklass2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Max effect: < 5.00 mW.
• Dominerande våglängd: Min. 440 nm – Max. 465 nm.
VARNING
Divergent strålning
Titta inte på lysdiodsljuset genom optiska instrument som luppar, förstoringsglas eller mikroskop en på ett
avstånd mindre än 100 mm eftersom detta kan skada ögonen.
Kollimerad strålning
Titta inte in i lysdiodsljuset genom förstoringshjälpmedel som teleskop, kikare e.d. eftersom detta kan skada
ögonen.
Om en defect i LED enheten uppstår kommer värdet av LED strålningsemissionen inte överskridas I förhållande
till den normal användningen av den medicinska produkten.
Etiketter med varningarna ovan sitter på enhetens förpackning.
5
SE
- 10 -
Installation och driftstart
Följande delar av detta avsnitt innehåller information och instruktioner som måste följas för att säkerställa framgångsrik
och felfri användning av enheten. Följ instruktionerna i sekvensen som beskrivs nedan innan Translux Wave används.
Den medicinska produkten uppfyller säkerhetsstandarden endast om den installerats enligt de anvisningar som
beskrivs nedan.
Enheten måste installeras på en lämplig plats som är praktisk för dess användning. Placera laddningsenheten
på en fast, torr, plan och vågrät yta.
VIKTIGT
Handstycket är ämnat för patientbehandling enligt föreskrivna anvisningar. Laddningsstationen och eladaptern
är ej, enligt anvisningar, ämnade för patientbehandling.
OBS!
Patientområdet är definierat till ett område på 1,5 m från patienten. (enligt IEC 60601-1 tredje utgåvan
och IEC 60601-1-1).
VARNING
Inspektera alltid enheten och dess komponenter före installationen.
Om skada upptäcks, fortsätt inte med installationen av enheten.
Operatören får ej vara I kontak med andra delar (laddningsstation, eladapter)) utanför patientområdet samtidigt
med patientbehandling.
Anslut aldrig externa komponenter till den medicinska apparaten.
5.1
Säkerhetskrav under installationen
VARNING
Den elektriska installationen på plats där enheten ska installeras och användas måste uppfylla gällande
lagstiftning och de säkerhetsspecifikationer som gäller för elsystem.
Installera enheten på en plats där den kan skyddas från slag och från oavsiktligt stänk av vatten och andra
vätskor. Utsätt inte enheten för direkt solljus, UV-strålning.
Installera inte enheten ovanpå eller nära värmekällor. Kontrollera vid installationen att det finns tillräckligt
med luft som cirkulerar runt enheten. Installera inte enheten nära lösningsmedel eller lättantändliga vätskor
eftersom detta kan skada plasthöljet på enheten.
Kontakten på eladaptern (direct anslutning) modell PSAC05R-050 säkrar isolering av apparaten i förbindelse
med nätspänning. När kontakten är ansluten skall strömbrytaren lätt kunna nås. Lämna tillräckligt med
fri yta runt apparaten. Den medicinska produkten skall placeras så att det lätt går att bryta strömtillförseln
(gäller även kontakten till eladaptern).
Kortslut aldrig batteriets slutelement med något metallföremål eftersom detta kan leda till risk för brännskador,
brand eller explosion.
Enheten kan transporteras men den måste hanteras varsamt. Transportera enheten i vågrätt läge. Låt inte
enheten utsättas för skakningar eller vibrationer. För storlekar och vikt, se avsnitt 12 (Tekniska specifikationer).
VARNING – RISK FÖR EXPLOSION
Installera inte enheten där det finns explosionsrisk. Enheten får inte användas i en lättantändlig miljö
(anestesiblandningar, syrgas, kväveoxidul, etc.). Installera enheten i ett väl ventilerat område.
5.2
Anslutning av laddningsenheten till huvudströmsuttaget
1x
Translux Wave levereras med en separat universalingångsenhet (6) som tar
), 50 / 60 Hz.
100 till 240 V (
VARNING
Kontrollera innan du ansluter laddningsenheten (6) till huvudströmmen att spänning och
nätfrekvens för huvudströmmen motsvarar de värden som anges på enhetens märkplåt.
Märkplåten är placerad på undersidan av laddningsenheten.
Använd endast den eladapter som levereras tillsammans med apparaten. Användning av annan eladapter kan
skada apparatens batteri.
Koppla inte eladaptern till ett externt grenuttag.
OBS!
Translux Wave strömtillförselenhet (6) levereras med tre utbytbara adaptrar:
typ 1
Fig. (6 a) = Europa
Fig. (6 b) = Storbritannien typ 2
Fig. (6 c) = US / JP
typ 3
1 Välj rätt adapter av de som är tillgängliga: Europa – typ 1, Storbritannien – typ 2, USA / Japan – typ 3.
2 Varje adapter har en skåra där spärrhaken på strömtillförselenheten passar in.
3 Placera adaptern med skåran riktad mot strömtillförselenheten på strömtillförselenheten så att styrklackarna
på adaptern riktas in mot motsvarande skåror på strömtillförselenheten.
4 Tryck ned adaptern och strömtillförselenheten och skjut in adaptern i strömtillförselenheten tills det klickar och
adaptern låses på plats.
OBS!
Tryck ned adaptern under installationen för att säkerställa att alla styrklackar hålls kvar av hållhakarna
på strömtillförselenheten. Avlägsna adaptern och installera om den om den känns lös.
5 Avlägsna adaptern från strömtillförselenheten genom att trycka på spärrhakens knapp (märkt med ordet ”PUSH”
(Tryck)) och skjut bort adaptern från strömtillförselenheten. Avlägsna adaptern.
6 Spara oanvända adaptrar för framtida användning.
7 Anslut kontakten till elkabeln till uttaget på undersidan av laddningsenheten.
VARNING
Kontrollera elkabeln, strömtillförselenheten och adaptern regelbundet för att kontrollera att de är i gott skick.
Om någon skada upptäcks ska den skadade delen inte användas utan bytas ut.
Använd endast originaldelar och tillbehör från Heraeus Kulzer.
8 Anslut strömtillförselenheten med dess adapter till huvudströmsuttaget.
9 Den GRÖNA lysdioden på laddningsenheten tänds (ikonen
).
5.3
Placering av batteriet i handenheten
Translux Wave levereras med ett kraftfullt uppladdningsbart litiumjonbatteri.
Batteriet levereras separat i enhetens förpackning och måste placeras i handenheten före första användningstillfället.
VARNING
Följ noga säkerhetsföreskrifterna som beskrivs i avsnittet 3.2.3 (BATTERI – säkerhetsåtgärder).
FÖRSIKTIGT!
Ställ ALDRIG handenheten i laddningsenheten utan att batteriet placerats i handenheten.
SE
- 11 -
För in batteriet i handenheten i den ordning som beskrivs nedan:
1 Avlägsna batteriet från dess förpackning.
VARNING
Kortslut aldrig batteriets terminaler med något metallföremål eftersom detta kan leda till risk för
brännskador, brand eller explosion.
2 Använd ett platt verktyg (t.ex. ett mynt) för att skruva av batteriskyddet moturs från
handenheten (Fig. 1 och 2 ).
3 Batterihöljet är märkt med en pil (Fig. 3 ).
OBS!
Denna pil anger den riktning i vilken batteriet måste skjutas in i handenheten.
2x
4 Skjut sakta in batteriet i handenheten med pilen riktad mot höljet tills det tar stopp (Fig. 4 ).
OBS!
Om batteriet skjuts in på fel sätt (dvs. i motsatt riktning mot pilen) fungerar inte handenheten.
Om batteriet förs in på fel sätt blir handenhetens elektronik skadad.
VARNING
Använd endast originalbatterier från Heraeus Kulzer. Användning av batterier från andra tillverkare eller
ej uppladdningsbara batterier / primära batterier utgör en potentiell risk och kan leda till skada på enheten
som inte kan lagas.
5 Använd ett platt verktyg (t.ex. ett mynt) för att skruva fast batteriskyddet medurs på handenheten.
OBS!
Enheten fungerar inte korrekt om skyddet på handenheten inte skruvas fast helt.
SE
- 12 -
5.4
Placering av fiberoptiken i handenheten
2x
• Vridljusledarennågot(1) och placera den i handenheten (2) till dess slutgiltiga plats.
Den slutgiltiga platsen har uppnåtts när du hör ett ”klick”.
• Monteraljusskyddskonen(3) i den övre änden av ljusledaren.
Positionera ljusledaren
• Vridljusledarentillönskadplatsförpolymerisering.
• Förattutnyttjaljusintensitetensåmycketsommöjligtskaljusledarenplacerassånärakompositmaterialet
som möjligt.
Undvik direkt kontakt med kompositmaterialet!
FÖRSIKTIGT! – Håll alltid ljusledaren ren för att få full ljusintensitet.
Ljusintensiteten minskas avsevärt om:
– ljusledaren inte är i perfekt skick (repor eller hack),
– ljusledaren inte är korrekt placerad i handenheten,
– ljusledaren har kompositfläckar.
VARNING
En skadad ljusledare reducerar ljusintensiteten och måste bytas ut mot en ny omedelbart.
Skarpa kanter kan leda till allvarlig skada. Använd endast originalljusledare från Heraeus Kulzer.
VARNING – infektionskontroll:
För att göra behandlingen så säker som möjligt för patienterna och handhavarna måste ljusledaren och ljusskyddskonen rengöras, desinficeras och steriliseras före varje behandling. Följ instruktionerna i listan i avsnitt 8
(Rengöring, desinficering och sterilisering) steg för steg.
5.5
Batteriladdning
FÖRSIKTIGT – NYTT batteri: första laddningen
Translux Wave-batteriet är delvis uppladdat från fabriken.
Därför måste batteriet laddas upp helt före användning av Translux Wave för första gången.
ANMÄRKNING – NYTT batteri: första laddningen
Första gången batteriet laddas kan processen ta cirka 3 timmar. Nya batterier eller batterier som förvarats
under en lång tid kan ta längre tid att ladda. Batteriet når sin fulla kapacitet efter några laddning / urladddningcykler.
VARNING – RISK FÖR EXPLOSION
Använd endast laddningsenheten som medföljer Translux Wave för att ladda batteriet. Försök aldrig att ladda
batteriet med någon annan batteriladdningsenhet eller kraftkälla på grund av risken för explosion och brand.
Placera handenheten med batteriet i Translux Wave-laddningsenheten.
2x
En ljudsignal bekräftar att kontakterna är i rätt laddningsposition!
VIKTIGT ANMÄRKNING – Inriktningsknapp
Inriktningsknappen (5) som är placerad på baksidan nedre delen av handenhetens hölje underlättar placeringen
av handenheten i laddningsenhetens hållare. När handenheten placeras i laddningsenheten måste inriktningsknappen riktas in mot styrspåret på insidan av laddningsenhetens hållare.
Batteriladdningsprocess.
• Dengrönalysdiodenförbatteristatuspåhandenhetenbörjarblinka.
• Närladdningsfasenärklarochbatterietärfulladdattändsdengrönalysdiodenpermanent.
VIKTIG ANMÄRKNING – defekt batteri
Om handenhetens elektronik under laddningsfasen upptäcker ett fel på batteriet avbryts laddningsprocessen och statuslampan för batteriet blinkar med GUL färg.
I detta läge hörs en ”ljudsignal” varje sekund under 30 sekunder.
Byt ut det defekta batteriet mot ett nytt!
VARNING
Använd endast batterier från Heraeus Kulzer!
OBS!
När handenheten placeras i laddningsenheten är dess funktion inaktiv. ”Start / stopp”-knappen
inte användas.
Handenheten kan tas bort från laddningsenheten under laddningsprocessen,
men batteriet laddas eventuellt inte fullständigt och användningstiden kan bli kortare.
6
kan
Användning
VARNING – Kontrollera enhetens funktion innan behandlingen startas.
Före varje behandling måste du alltid kontrollera att enheten fungerar korrekt och att tillbehören (ljusledaren
SE
och ljusskyddskonen) fungerar. Om något observeras under behandlingen, utför inte behandlingen utan
kontakta Heraeus Kulzer eller en lokal auktoriserad kundservicerepresentant (se avsnitt 14 Service).
Använd inte enheten eller tillbehören om skada upptäckts. Kontrollera före varje användning av Translux Wave - 13 att den avgivna ljusintensiteten är tillräcklig för att garantera polymerisering. Kontrollera ljusintensiteten genom
att använda ljusmätaren i laddningsenheten (se avsnitt 6.2 Mätning av ljusintensiteten).
VARNING – infektionskontroll
Första användning
Tillbehören, ljusledaren och ljusskyddskon levereras OSTERILA och måste steriliseras före första
användningstillfället.
Varje användning
När de använts måste tillbehören, ljusledaren och ljusskyddskon rengöras före återanvändning enligt
procedurerna som beskrivs i avsnitt 8 (Rengöring, desinficering och sterilisering).
6.1
Aktivera och inaktivera exponeringscykeln
Translux Wave fungerar med två olika exponeringscykler:
– Exponering med konstant effekt: cykeln varar 10 sekunder.
– Exponering med långsamt ökande effekt: ”Mjukstart” (cykeln varar 20 sekunder).
”Mjukstart” betyder att ljusintensiteten ökar från 50 % till 100 % inom 2 sekunder.
• Omhandenhetenäri”Viloläge” (alla exponeringscykler lysdioder på handenheten är släckta) trycker du kortvarigt
på ”Start / stopp”-knappen
för att få handenheten att lämna viloläget.
(Som standard efter återstart lyser indikatorlampan i 10 sekunder.)
Exponering med 10 sekunders polymerisering.
Tryck kortvarigt på knappen ”Start / stopp”
. Ljusavgivningen startar.
10-sekunderslysdioden är tänd och visar att detta program körs.
När exponeringscykeln är klar stänger enheten automatiskt av ljuset.
Akustisk signal:
Följande akustiska ljudsignaler avges:
1 ljudsignal när knappen ”Start / stopp” trycks in.
1 ljudsignal i slutet av exponeringstiden.
Exponering med 20 sekunders ”Mjukstart”-polymerisering.
Tryck ned och håll ”Start / stopp”-knappen
intryckt i minst en sekund. Ljusavgivningen startar.
20-sekunderslysdioden är tänd och visar att detta program körs.
När exponeringscykeln är klar stänger enheten automatiskt av ljuset och enheten återgår till
10-sekundersläget (10-sekunderslysdioden tänd).
Akustisk signal:
Följande akustiska ljudsignaler avges:
1 ljudsignal när knappen ”Start / stopp” trycks in.
1 ljudsignal efter 1 sekund indikerar att ”Mjukstart” läget är aktiverat.
1 ljudsignal efter 10 sekunders exponeringstid.
1 ljudsignal i slutet av exponeringstiden.
OBS!
Exponeringscykeln kan avbrytas när som helst innan exponeringstiden är över genom
att knappen ”Start / stopp” trycks in igen.
Akustisk signal:
En akustisk ”ljudsignal” avges när knappen ”Start / stopp” trycks in för att avbryta exponeringscykeln.
SE
- 14 -
6.2
Mätning av ljusintensiteten
Laddningsenheten till Translux Wave är utrustad med en integrerad ljusintensitetsmätare (8).
2x
FÖRSIKTIGT!
Kontrollera alltid före varje behandling ljusintensiteten genom att använda den inbyggda
intensitetsmätaren i Translux Wave laddningsenhet.
• Utanattanvändatryckplacerarduljusledarenplantochdirektpåtestområdet(8).
Aktivera enheten genom att trycka på knappen ”Start / stopp”
(vilkendera exponeringstid som valts).
Ljusintensitetsmätningen anges omedelbart med den 2-färgade lysdioden (Symbolen
) som är placerad
nederst till höger i testområdet.
GRÖN lysdiod: Ljusintensiteten är tillräcklig för behandlingen.
GUL lysdiod: Ljusintensiteten är otillräcklig och patienten /-erna får inte behandlas.
FÖRSIKTIGT!
Om ljusintensiteten är otillräcklig, vänligen utför följande kontroller och åtgärder:
– Ljusledaren har inte placerats i handenheten (se avsnitt 5.4 Föra in fiberoptiken i handenheten).
– Kontrollera om ljusledaren har kontaminerats eller är felaktig.
– Rengör ljusledaren om den är kontaminerad (se avsnitt 8 Rengöring, desinficering och sterilisering)
eller byt ut den skadade ljusledaren mot en ny.
Använd endast originalljusledare från Heraeus Kulzer!
VARNING
Om åtgärderna som beskrivs ovan inte resulterar i någon förbättring ska enheten inte användas för någon
behandling. Stäng av enheten (koppla bort laddningsenheten från strömförsörjningen) och kontrollera
att oavsiktlig återaktivering av enheten inte är möjlig. Kontakta en serviceparter för Heraeus Kulzer eller
tekniskt utbildad personal som är auktoriserad av Heraeus Kulzer (se avsnitt 14 Service).
6.3
Viloläge
Handenheten är utrustad med ett ”Viloläge” för att minimera enhetens energiförbrukning.
När handenheten inte är placerad i laddningsenheten stängs alla interna funktioner av automatiskt
(”Viloläge”) om den inte används under cirka 5 minuter.
I ”Viloläge” är lysdioderna för exponeringscykeln släckta.
Avsluta ”Viloläge” genom att trycka på knappen ”Start / stopp”
.
Handenheten är redo för användning.
OBS!
När ”Viloläge” avslutas återgår handenheten till den senaste inställningen som använts.
6.4
Ytterligare information om användning av enheten
OBS!
Om handenheten placeras i laddningsenheten innan exponeringscykeln avslutats stängs ljusavgivningen
automatiskt av.
kan
När handenheten placeras i laddningsenheten är dess funktion inaktiv. ”Start / stopp”-knappen
inte användas.
Translux Wave har micro-processorer som kontinuerligt kontrollerar batteriets kapacitet. Efter varje behandling
ska handenheten därför placeras i laddningsenheten för förvaring oavsett batterinivå.
7
Larmtillstånd
7.1
Fel på batteriet
Om det är fel på batteriet blinkar statuslysdioden för batteriet kontinuerligt GUL (Fig. a).
En ”ljudsignal” hörs varje sekund under 30 sekunder.
VIKTIGT
Detta feltillstånd visas endast när handenheten är placerad i laddningsenheten.
blinkar
7.2
Felaktig LED
När ett tillstånd med felaktig LED detekteras av mikroprocessorn blinkar den gröna
lysdioden ”10s” för det exponeringscykeln som används (Fig. b).
blinkar
a
b
7.3
Överhettningsskydd
Om flera härdningscykler i snabb följd inträffar (normalt efter 18 cykler i följd,
var och en på 20 sekunder) kan den inbyggda temperatursensorn för överbelastning aktiveras.
När överhettningsskyddet aktiveras avges ”3 ljudsignaler” i slutet av exponeringscykeln.
Aktiveringen av överhettningsskyddet stoppar användning av enheten temporärt under några minuter.
Låt handenheten kylas ner i minst 4 – 5 minuter och starta därefter nästa exponering genom att trycka
på knappen ”Start / stopp”
.
OBS!
Handstycket blir operativt när handstycket når drifttemperatur. ”Reset” är inte nödvändigt.
7.4
Den INBYGGDA temperaturöverbelastningssensorn defekt
”4 ljudsignaler” hörs om överhettningscensorn är defect I samband med exponering.
OBS!
Om det under exponering uppstår ett fel på överhettningssensorn avslutas
processen automatiskt. Ny exponering går ej att starta via ”Start / stopp” knappen
och ”4 ljudsignaler” hörs.
Det är inte möjligt att använda härdljuslampan om den är överhettad.
SE
- 15 -
7.5
Signal för låg batteriladdning
När batteriets laddning minskar till lägsta nivån genom användning av enheten kan mikroprocessorn i Translux Wave
genomföra några cykler till i valfritt exponeringscykler utan att batteriet behöver laddas.
Detta tillstånd signaleras i slutet av varje cykel med ”2 ljudsignaler”.
Ikonen för batteri blinkar grönt. Ladda batteriet!
Efter ett par cykler till räcker inte den kvarvarande batteriladdningen till ytterligare en exponeringscykel. Detta tillstånd
signaleras med ”2 ljudsignaler”.
Ikonen för batteri blinkar grönt. Ladda batteriet!
8
Rengöring, desinfektion och sterilisering
KOPPLA BORT FRÅN HUVUDSTRÖMMEN
Koppla bort laddningsenheten från eluttaget innan du utför rengörings- och desinficeringsprocedurer!
VARNING
Infektionskontroll
Ljusledaren och ljusskyddskonen levereras OSTERILA och måste rengöras, desinficeras och steriliseras (ånga)
innan de används för första gången samt före varje användning.
Sterilisera inte handenheten och laddningsenheten!
Sterilisera inte batteriet!
8.1
Montera isär
Avlägsna ljusskyddskonen från ljusledaren.
Avlägsna ljusledaren: Rotera ljusledaren något och dra ut den ur handenheten.
8.2
SE
- 16 -
LJUSLEDARE – Rengöring och desinfektion
FÖRSIKTIGT!
Använd inte vassa eller spetsiga instrument för att rengöra ljusledaren eftersom dessa kan repa ytan
på ljusledaren och därmed minska ljusavgivningen.
Använd inte rengörings-/ desinficeringsmedel som innehåller organiska, mineralhaltiga eller oxiderande syror,
väteperoxid, klorid, jod, bromid eller lösningsmedel.
1) Omedelbart efter användning måste alla eventuella rester, t.ex. kompositmaterial, avlägsnas från ytan på ljusledaren. All polymeriserad komposit ska avlägsnas med hjälp av etanol och en plastspatel eller en mjuk nylonborste.
2) Desinficera ljusledaren med en ren, mjuk luddfri duk som fuktats med ett milt desinficeringsmedel,
med ett milt pH (pH 7), enligt tillverkarens specifikationer. Låt desinficeringsmedlet torka.
8.2.1 LJUSLEDARE – Inspektion före sterilisering
Innan du fortsätter med steriliseringsprocessen, kontrollera noggrant om ljusledarens ytor är skadade,
missfärgade eller kontaminerade.
VARNING
Använd inte en skadad ljusledare. Om skada upptäcks, byt ut ljusledaren mot en ny.
Om ljusledaren fortfarande är kontaminerad, upprepa rengörings- och desinficeringsproceduren.
8.3
LJUSSKYDDSKON – Rengöring och desinfektion
FÖRSIKTIGT!
Använd inte rengörings-/ desinficeringsmedel som innehåller organiska, mineralhaltiga eller oxiderande syror,
väteperoxid, klorid, jod, bromid eller lösningsmedel.
Rengör och desinficera ljusskyddskonen med en ren, mjuk duk som fuktats med ett milt desinficeringsmedel,
med ett milt pH (pH 7), enligt tillverkarens specifikationer. Låt desinficeringsmedlet torka.
8.3.1 LJUSSKYDDSKON – Inspektion före sterilisering
Innan du fortsätter med steriliseringsprocessen, kontrollera noggrant om ljusskyddskonens ytor är skadade,
missfärgade eller kontaminerade.
VARNING
Använd inte en skadad ljusskyddskon. Om skada upptäcks, byt ut ljusskyddskonen mot en ny.
En skadad ljusskyddskon kan inte ge tillräckligt skydd för enhetens ljus.
Om ljusskyddskonen fortfarande är kontaminerad, upprepa rengörings- och desinficeringsproceduren.
8.4
LJUSLEDARE och LJUSSKYDDSKON – Paketering före steriliseringen
Ljusledaren och ljusskyddskonen kan steriliseras genom användning av en medicinsk ångsteriliseringspåse
för engångsbruk i lämplig storlek.
FÖRSIKTIGT!
Ljusledaren och ljusskyddskonen måste förpackas individuellt i var sin påse.
Kontrollera vid sterilisering av flera instrument i en autoklav att autoklavens maxbelastning inte överskrids.
VARNING
Kontrollera att innerpåsen är tillräckligt stor för att rymma instrumenten utan att belasta förseglingarna
eller göra hål på förpackningen.
8.4.1 LJUSLEDARE och LJUSSKYDDSKON – Sterilisering
8.4.1.1 Steriliseringsmetod
• Utförsteriliseringenmedhjälpavångautoklavmedförvakuum.
FÖRSIKTIGT!
Använd aldrig någon annan steriliseringsmetod på grund av potentiell inkompatibilitet med de material
ljusledaren är tillverkad av.
ANVÄND INTE följande steriliseringsmetoder: Etylenoxidsterilisering, varmluftssterilisering, flashautoklavering,
STERRAD-sterilisering, STERIS-system eller liknande steriliseringssystem.
Sterilisera INTE ljusledaren och ljusskyddskonen med användning av: Sterilisering med väteperoxid,
perättiksyra, formaldehyd eller glutaraldehyd.
SE
8.4.1.2 Steriliseringsparametrar
• Lägsta steriliseringsparametrar som ger en sterilitetssäkerhetsnivå (SAL) på 10 –6.
Cykeltyp
Förvakuum
Minsta temperatur
132°C + 3°C
(270°F + 5°F)
Minsta exponeringstid (påse)
4 minuter
- 17 -
Minsta torktid
20 minuter
FÖRSIKTIGT!
Överskrid inte 135°C (275°F).
8.5
HANDENHET – Rengöring och desinfektion
VARNING
Handenheten är inte skyddad mot vätskeintrång.
Spreja inte vätska direkt på ytan och laddningskontakterna på handenheten.
Rengörings- och desinficeringsmedel får inte tränga in i handenheten!
Sänk ALDRIG ned handenheten i vätska.
Rengör ALDRIG handenheten under rinnande vatten.
Sterilisera inte handenheten. Risk för allvarlig skada, elektrisk stöt och brand!
2x
Rengör och torka av handenhetens hölje med en ren, mjuk, luddfri duk som fuktats med ett milt ytdesinficeringsmedel med neutralt pH (pH 7), enligt tillverkarens specifikationer.
Låt desinficeringsmedlet torka eller torka av resterna av desinficeringsmedlet på handenhetens hölje med
en mjuk dammfri duk.
FÖRSIKTIGT!
Använd inte lösningsmedel som t.ex. aceton, isopropylalkohol, väteperoxid, klorid, jod, bromid, fenol eller
andra aggressiva lösningar för att rengöra och desinficera plastytan på handenheten. Dessa substanser kan
vara skadliga, leda till missfärgning och / eller skada på plastmaterialen i handenheten.
Använd inte rengöringsmedel med slipmedel!
VIKTIGT: Rengöring av laddningskontakterna på handenheten
Rengör alltid laddningskontakterna på handenheten efter att rengöring / desinficering av handenhetens hölje
har genomförts. Dessa sitter i den nedersta delen av handenheten. Laddningskontakterna på handenheten
måste alltid vara fria från eventuell smuts, komposit och rengörings-/ desinficeringsmedelsrester.
VIKTIGT
Handenhetens laddningskontakter måste rengöras regelbundet (minst en gång i veckan) och alltid efter att
rengöring och desinficering av handenhetens plasthölje. Smutsiga laddningskontakter eller kontakter som
utsatts för vätskor, t.ex. rengörings- eller desinficeringsmedel, kan påverka laddningsprocessen negativt och
förhindra att batteriet laddas.
Rengör laddningskontakterna i handenheten med mjuk luddfri duk eller bomullstopp som fuktats med alkohol.
FÖRSIKTIGT!
Använd inte vassa eller spetsiga instrument för att rengöra handenhetens kontakter eftersom dessa kan repa
och skada ytan och därmed försämra laddningskontakternas ledande förmåga.
Kontrollera innan handenheten återanvänds att handenhetens yta och laddningskontakterna är helt torra.
Om nödvändigt blästra handstyckets knappar med luft.
8.6
SE
- 18 -
LADDNINGSENHET – rengöra höljet
KOPPLA BORT FRÅN HUVUDSTRÖMMEN
Koppla bort strömförsörjningen från eluttaget och laddningsenheten före rengöring / desinficering.
VARNING
Laddningsenhetens hölje är inte skyddat mot vätskeintrång.
Spreja inte vätska direkt på laddningsenhetens yta.
FÖRSIKTIGT!
Sterilisera INTE laddningsenheten! Den kommer inte längre att fungera och kan ge upphov till risk för allvarlig
skada, elektrisk stöt och brand.
Använd inte lösningsmedel som t.ex. aceton, isopropylalkohol, väteperoxid, klorid, jod, bromid, fenol eller
andra aggressiva lösningar för att rengöra plastytan på laddningsenheten. Dessa substanser kan vara skadliga,
leda till missfärgning och / eller skada på plastmaterialen i laddningsenheten.
Använd inte rengöringsmedel med slipmedel!
Rengör och torka av laddningsenheten med en ren, mjuk luddfri duk som fuktats med ett milt ytrengöringsmedel,
med ett neutralt pH (pH 7), enligt tillverkarens specifikationer.
Torka laddningsenhetens hölje med en ren duk utan slipande verkan.
FÖRSIKTIGT!
Kontrollera att laddningsenheten är torr efter rengöringen. Fukt på insidan av enheten kan leda till skada.
VIKTIGT
När rengöringsproceduren är klar kontrollera att laddningskontakterna i laddningsenheten är helt torra.
Om nödvändigt blästra handstyckets knappar med luft.
8.6.1
LADDNINGSENHET – Rengöring av laddningskontakterna
2x
VIKTIGT
Rengör alltid laddningsenhetens kontakter efter rengöring av laddarens plasthölje.
Laddningskontakterna på laddningsenheten måste alltid vara fria från eventuell smuts,
komposit och rengöringsmedelsrester.
Laddningsenhetens kontakter måste rengöras regelbundet (minst en gång i veckan) och alltid efter rengöring
och desinficering av handenhetens plasthölje. Smutsiga kontakter eller kontakter som utsatts för vätskor,
t.ex. rengörings- eller desinficeringsmedel, kan påverka laddningsprocessen negativt och förhindra att batteriet
laddas.
Rengör kontakterna i laddningsenheten med mjuk luddfri duk eller bomullstopp som fuktats med alkohol.
FÖRSIKTIGT!
Använd inte spetsiga eller vassa föremål för att rengöra laddningsenhetens kontakter!
Spreja inte eller spola kontakterna med vätska!
Böj inte eller modifiera formen på laddningsenhetens kontakter under rengöring.
Kontrollera att laddningskontakterna förblir torra efter rengöring och inte får kontakt med metalliska eller oljiga
delar. Om nödvändigt blästra handstyckets knappar med luft.
8.6.2 LADDNINGSENHET – utbytbara laddningskontakter
Skadade eller mycket smutsiga kontakter på laddningsenheten (som inte kan rengöras genom att procedurerna ovan
följs) kan hindra ledningsförmågan och därmed batteriladdningen.
I så fall går det att byta ut de skadade kontakterna på laddningsenheten mot nya.
Kontakta din lokala representant för Heraeus Kulzer för ytterligare information om byte av laddningsenhetens
kontakter och om reservdelar.
Arbetsinstruktioner:
Obligatoriskt verktyg: skruvmejsel för krysskruvar, mellanstorlek.
1. Ta ur handenheten ur laddningsenheten.
2. Koppla bort laddaren från huvudströmmen.
3. Koppla bort sladden från laddaren.
2x
4. Vänd laddaren upp och ner.
5. Skruva ur 2 skruvar från laddarens kontaktbrygga (se det bakre utvikbara omslaget, punkt 12).
6. Dra ut laddarens kontaktbrygga.
7. För in den nya kontaktbryggan och fäst / anslut i omvänd ordning.
FÖRSIKTIGT!
Böj inte och kontaminera inte den nya kontaktbryggan!
Var noga med perfekt montering och fixering! Skruva inte åt skruvarna för hårt!
9
Förvaring
Förvaring av handenheten med batteri under längre perioder utan användning. Ladda batteriet helt eller förvara
det i driftsladdningsenheten före eller efter en längre tid med inaktivitet. Trots att den inbyggda säkerhetskretsen
till batteriet förhindrar fullständig urladdning rekommenderar vi laddning av batteriet helt minst var 5:e månad efter
inaktivitet.
10
Kassering
OBS! – VIKTIGT
Enheten får inte kasseras som vanligt hushållsavfall.
Kontakta Heraeus Kulzer-återförsäljaren direkt i ditt land för kassering av reservdelar eller hela enheten.
Kassera uttjänta batterier och ljusledare enligt gällande lagkrav i ditt land.
VARNING – kassering av skadade eller uttjänta batterier
Kassera skadade eller förbrukade batterier efter att ha vidtagit nödvändiga åtgärder för att förhindra
extern kortslutning på följande sätt:
Kassera enligt lag eller enligt gällande lokala bestämmelser efter att ha isolerat batteripolerna på batterierna
med isoleringstejp.
Villkor och försiktighetsåtgärder för kassering av enheten lyder under giltig lagstiftning liksom för andra elektroniska
enheter som är uttjänta.
Kassering av gammal utrustning enligt WEEE (EU-direktiv) eller
Elektrisk och elektroniska utrustningslagen (tyska lagen ElektroG).
SE
- 19 -
11
Felsökning
VARNING
Om stegen nedan inte löser problemet, kontakta Heraeus Kulzer eller en lokal auktoriserad
kundservicerepresentant:
ANVÄND INTE Translux Wave och FÖRSÖK INTE utföra service på enheten eftersom det kan leda till allvarlig
skada.
Om enheten inte verkar fungera korrekt, läs denna användarmanual igen och kontrollera därefter i följande tabell:
PROBLEM
Laddningsenheten startar inte.
Den gröna lysdioden
på
laddningsenheten är släckt.
Handenheten är INTE placerad
i laddningsenheten.
Ljusavgivningen startar inte när
”Start / stopp”-knappen
trycks
in och ingen information visas på
handenhetens display.
SE
- 20 -
”2 ljudsignaler” avges i slutet av
exponeringscykeln.
MÖJLIG ORSAK
Strömförsörjningen är inte ansluten till ett
eluttag och / eller till laddningsenhetens
strömförsörjningsuttag.
ÅTGÄRD
Kontrollera att strömförsörjningen är
säkert ansluten till ett eluttag och till
laddningsenhetens strömförsörjningsuttag.
Eluttaget har ingen spänning.
Använd ett annat eluttag.
Den utbytbara adaptern är inte korrekt
Läs stycke 5.2 noggrant i denna använplacerad i höljet med elingången.
darmanual.
Elsladden till ingången för strömtillförseln Byt ut strömtillförselenheten mot en ny.
är skadad.
(Strömtillförselenheten och dess sladd
får inte skiljas åt från varandra.)
Strömtillförselenheten är defekt.
Byt ut strömtillförselenheten mot en ny!
Laddningsenheten är defekt.
Kontakta Heraeus Kulzer eller en lokal
auktoriserad kundservicerepresentant.
Laddningsenhetens kontakter har
Eliminera orsaken till kortslutning.
kortslutits.
Om tillståndet med kortslutning kvarstår,
byt ut laddningsenhetens kontakter.
Se stycke 8.6.2.
Handenhet utan batteri.
Placera batteriet i handenheten
(se avsnitt 5.3).
Tryck på knappen ”Start / stopp” för att
Handenheten är i ”Viloläge”.
avsluta ”Viloläget” för handenheten.
Se stycke 6.3.
Tomt batteri.
Placera handenheten i laddningsenheten
och ladda om batteriet (se stycke 5.5).
Det finns inte tillräckligt med laddning
i batteriet för att starta handenheten.
Elektroniken fungerar inte.
Kontakta Heraeus Kulzer eller en lokal
auktoriserad kundservicerepresentant.
Defekt batteri.
Kontrollera om batteriet är defekt genom
att placera handenheten i laddningsenheten.
En ”förberedande sekvens” startas
och Translux Wave micro-processor
kontrollerar batteriets status.
Detta pågår i max 30 minuter.
Om det under denna sekvens hörs
en ”ljudsignal” varje sekund under
30 sekunder och batteriets ikon på
handstycket blinkar GULT indikerar
detta att batteriet är defekt.
Byt ut batteriet mot ett nytt
(se avsnitt 5.3).
Låg batteriladdning.
”2 ljudsignaler” anger att batteriets
kvarvarande laddningsnivå endast
är tillräcklig för några efterföljande
exponeringscykler.
Placera handenheten i laddningsenheten
och ladda om batteriet (se stycke 5.5).
PROBLEM
Lampan startar inte när
”Start / stopp”-knappen
hålls
intryckt eller om exponeringscykelns
ljus blivit avbrutet och ett ”pip” hörs.
Härdnings LED „10s“ på handstycket
börjar blinka GRÖNT.
MÖJLIG ORSAK
LED enheten kan vara defekt.
blinkar
Efter flera exponeringscykler i följd
startar inte ljusavgivningen när
trycks
knappen ”Start / stopp”
in och ”3 ljudsignaler” avges.
Under en exponeringscykel avges
”3 ljudsignaler”.
Driftsfel under laddningsfasen.
En akustisk ”signal hörs” varje
sekund i 30 sekunder och LED
indikatorlampan på handstycket
blinkar GULT.
Överhettningsskydd.
Handenheten har blivit överhettad under
användning och temperaturöverbelastningssensorn har aktiverats.
Aktiveringen av överhettningsskyddet
förhindrar temporärt (i fem minuter)
användning av enheten under några
minuter.
Överhettningsskydd.
Handenheten har blivit överhettad under
användning och temperaturöverbelastningssensorn har aktiverats.
Aktiveringen av överhettningsskyddet
förhindrar temporärt (i fem minuter)
användning av enheten under några
minuter.
Under batteriets kontrollfas (batteritillstånd: helt tomt, se stycke 4.2.4 och 5.5).
Elektroniken upptäcker ett defekt batteri
eller ett driftsfel för batteriet och avbryter
laddningsprocessen.
blinkar
Handenheten är placerad i laddFel: Ingen kontakt till laddaren.
ningsenheten men laddningsfasen
Felaktig kontakt mellan laddningsbasen
startar inte.
och handenheten.
Lysdioden för batteristatus på handenheten släcks.
ÅTGÄRD
Kontrollera LED enhetens funktion
med hjälp av följande åtgärder:
Placera handstycket i laddaren och
tryck på ”Start / stopp”-knappen
5 gånger i snabb följd.
Tag bort handstycket ur laddaren.
Om härdnings LED „10s“ på handstycket slutar blinka GRÖNT, har
handstycket återställts.
Om härdnings LED „10s“ på handstycket blinkar igen vid start av nästa
exponeringscykeln och inget ljus startar
är LED lampan defekt.
Kontakta då Heraeus Kulzer eller en
lokal auktoriserad återförsäljare.
Låt handenheten kylas ner i minst
4 – 5 minuter och starta därefter nästa
exponering genom att trycka på
knappen ”Start / stopp”.
OBS! Handstycket blir operativt när
handstycket når drifttemperatur.
”Reset” är inte nödvändigt.
Låt handenheten kylas ner i minst
4 – 5 minuter och starta därefter nästa
exponering genom att trycka på
knappen ”Start / stopp”.
Byt ut batteriet mot ett nytt
(se avsnitt 5.3).
2x
Se stycke 8.5 och 8.6.2.
Kontrollera om handenheten har placerats i rätt riktning i laddningsenheten.
Inriktningsknapp.
Se stycke 4.2.1, punkt 4 och 5.
Laddningsenhetens och / eller handenRengör kontakterna på handenheten
hetens kontakter är smutsiga.
och laddningsenheten.
Se stycke 8.5 och 8.6.1.
Ljusledaren är inte korrekt placerad
Kontrollera ljusledaren så att den
Ljusintensiteten som mätts med
är korrekt placerad i metallkonen
mätaren som är integrerad i laddning- i handenheten.
på handenheten.
senheten är otillräcklig.
Rengör ljusledaren.
Lysdioden
på laddningsenheten Ljusledaren är kontaminerad av
främmande partiklar eller kompositrester Se avsnitt 8.2.
lyser GUL.
som kan störa ljuseffekten.
Ljusledaren skadad eller utsliten.
Byt ut ljusledaren mot en ny.
SE
- 21 -
12
Tekniska specifikationer
Klassificering enligt Direktiv 93/42/EG:
Säkerhetsstandarder:
Klassificering enligt IEC 60601-1:
Laddningsenhet:
Strömtillförsel till laddningsenheten:
Strömtillförsel till handenheten:
Handenhet:
SE
Ljuskälla:
- 22 Ljusledare:
Inställbara exponeringscykler:
– Normal exponering
– ”Mjukstart”-exponering
Laddningstid för tomt batteri:
Klass I (ett)
Produkten är tesad och uppfyller IEC 60601-1
(andra utgåvan) och IEC 60601-1-1.
Produkten är tested och uppfyller IEC 60601-1 (tredje utgåvan ) och
IEC 60601-1-2 (tredje utgåvan – elektromagnetisk kompatibilitet –
EMC).
Handstycket är ämnat för patientbehandling inom patientomgivningen. Laddningsstationen och eladaptern är ej ämnade för användning inom patientomgivningen enligt föreskrivna anvisningar.
OBS! Patientomgivningen är definierad till ett område 1,5 m
från patienten. patient (enligt IEC 60601-1, tredje utgåvan och
IEC 60601-1-1).
Klass II, Typ B, Tillbehör: Ljusledarstav med koniskt ljusskydd.
IP 20 (Laddningsenhet).
IP 20 (Translux Wave)
Translux Wave laddningsenhet
Eladapter (Direct Plug-In) tillverkad av:
Phihong Technology CO LTD – Modell: PSACO5R-050.
Inspänning: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Utspänning: 5 V
– 1 A Max –
.
Klass II utrustning
Uppladdningsbart litiumjonbatteri.
Tillverkare: Panasonic.
Modell: NCR-18500.
Nominell spänning: 3,6 V.
Nominell kapacitet (Typvärde): 2000 mAh
Modell: Translux Wave.
Användning: Intermittent service: 120“ ON – 40“ OFF –
max 2 exponerings-cykler
LED med hög luminositet.
Lysdiodsprodukt klass 2M (IEC 60825-1).
Våglängdsintervallet: 440 – 480 nm.
Dominerande våglängd: Min. 440 nm – Max. 465 nm
Blyfri ljusledarstav, 8 mm i diameter.
Steriliserbar i ångautoklav med förvakuum:
4 minuter (minst) vid en minsta temperatur på 132°C + 3°C
(270°F + 5°F). Max. 500 cykler
10 sekunders exponeringstid.
Akustiska signaler:
1 ljudsignal vid exponeringens start.
1 ljudsignal i slutet av exponeringen
20 sekunders exponeringstid. (”Mjukstart” betyder att ljusintensiteten ökar från 50 % till 100 % inom 2 sekunder.)
Akustiska signaler:
1 ljudsignal vid exponeringens start.
1 ljudsignal efter 1 sekund indikerar att ”Mjukstart” läget
är aktiverat.
1 ljudsignal efter 10 sekunders exponering.
1 ljudsignal i slutet av exponeringen
ca 3 timmar
Miljövillkor för enheten:
Användning
Temperatur
Relativ luftfuktighet
Lufttryck
Vikt och dimensioner:
12.1
10°C – 35°C
(50°F – 95°F)
45 % – 85 %
800 – 1060 hPa
Transport
och förvaring
–20°C – 40°C
(–4°F – 104°F)
45 % – 85 %
500 – 1060 hPa
Laddningsenhet: vikt 450 g.
Mått: L 140 x W 58 x H 62 mm
Handenhet: vikt 150 g (inkl. ljusledare).
Mått: L 275 mm, max. Ø 24 mm
Elektromagnetisk kompatibilitet EN 60601-1-2
VARNING
Enheten kräver särskilda EMV-åtgärder som måste installeras och aktiveras enligt anvisningarna i detta avsnitt.
Portabel och mobil radiokommunikationsutrustning kan påverka korrekt funktion för enheten.
Anvisning och förklaring från tillverkaren – elektromagnetisk emission
Translux Wave är avsedd för användning i den elektromagnetiska miljö som anges nedan.
Kunden eller användaren av Translux Wave ska säkerställa att den används i en sådan miljö.
Strålningskontroll
Konformitet Elektromagnetisk omgivning – anvisning
RF-nivåer CISPR 11
Grupp 1
Translux Wave använder radiofrekvent energi för den interna
funktionen. Därför är dess RF-avgivning mycket låg och leder inte
sannolikt till några störningar för elektronisk utrustning i närheten.
RF-nivåer CISPR 11
Klasse B
Translux Wave är lämplig för användning i alla byggnader, även
bostäder och byggnader som är anslutna till nätspänning för
Harmonisk utsändning IEC 61000-3-2 Klasse A
privatbruk.
Spänningsfluktuationer / flimmer
Konform
IEC 61000-3-3
Anvisning och förklaring från tillverkaren – elektromagnetisk immunitet
Translux Wave är avsedd för användning i den elektromagnetiska miljö som anges nedan.
Kunden eller användaren av Translux Wave ska säkerställa att den används i en sådan miljö.
Immunitetskontroll
Kontrollstatus
Konformitetsstatus
Elektromagnetisk omgivning –
IEC 60601
anvisning
Elektrostatiska
±6 kV vid kontakt
Enheten fungerar
Golven måste vara gjorda av trä,
urladdningar (ESD)
fortfarande korrekt och
betong eller keramik. Om golven är
±8 kV i luften
IEC 61000-4-2
säkert.
lagda med syntetiskt material så bör
den relativa fuktigheten ligga på 30%.
Snabba, transienta
±2 kV för effektförsörjningsEnheten fungerar
Kvaliteten hos nätspänningen måselektriska störningsledningar
fortfarande korrekt och
te vara samma som den i en typisk
storlekar / skurar enligt ±1 kV för inmatnings-/
säkert.
butiks- eller sjukhusomgivning.
IEC 61000-4-4
utmatningsledningar
Impulser
±1 kV differentialspänning
Enheten fungerar
Kvaliteten hos nätspänningen måsIEC 61000-4-5
fortfarande korrekt och
te vara samma som den i en typisk
±2 kV CM-spänning
säkert.
kontors- eller sjukhusmiljö.
Spänningshål, korta
spänningsavbrott
och -förändringar på
inmatnings-ledningarna
för strömförsörjningen
IEC 61000-4-11
< 5% UT (> 95% Inbrott UT)
för 0,5 cykler
40% UT (60% Inbrott UT)
för 5 cykler
70% UT (30% Inbrott UT)
för 25 cykler
< 5% UT (> 95% Inbrott UT)
i 5 sek.
3A/m
Enheten kan avvika från de Kvaliteten hos nätspänningen måsobligatoriska immunitetste vara samma som den i en typisk
nivåerna en tid så länge som kontors- eller sjukhusmiljö.
enheten används i en säker
miljö. Inga driftsstörningar
har detekterats och denna
funktion kan återställas
till status före testning av
användaren.
Magnetfält vid nätEnheten fungerar
frekvens (50 / 60 Hz)
fortfarande korrekt och
IEC 61000-4-8
säkert.
ANMÄRKNING: UT är nätspänningen i växelström före kontrollstatus.
Nätfrekvens-magnetfälten bör ha
de karaktäristiska nivåerna för
butiks- eller sjukhusomgivningar.
SE
- 23 -
Anvisning och förklaring från tillverkaren – elektromagnetisk immunitet
Translux Wave är avsedd för användning i den elektromagnetiska miljö som anges nedan.
Kunden eller användaren av Translux Wave ska säkerställa att den används i en sådan miljö.
ImmunitetsKontrollstatus Konformitets- Elektromagnetisk omgivning – anvisning
kontroll
IEC 60601
status
Ledd
3 Veff från
Enheten funge- Radiofrekvensmobiltelefoner får inte användas i närheten av produkten
radiofrekvens
150 kHz till
rar fortfarande eller en del av den, inklusive kabeln, såvida inte de rekommenderade
IEC 61000-4-6 80 MHz
korrekt och
avstånden hålls, där sändarens frekvens kommer till sin rätt.
säkert.
Rekommenderade avstånd
Utsänd
3 V / m från
d = 1,2 √P
radiofrekvens
80 MHz till
d = 1,2 √P från 80 MHz till 800 MHz
IEC 61000-4-3 2,5 GHz
d = 2,3 √P från 800 MHz till 2,5 GHz
där (P) är det maximala utgångsvärdet från sändaren i watt (W) enligt
tillverkaren av sändaren och (d) är det rekommenderade avståndet i
meter (m). Fältstyrkan hos den fasta radiofrekvenssändaren, så som
den fastställs vid en elektromagnetisk undersökning på plats, måste
vara lägre än konformitetsvärdet i varje frekvensintervall (b).
Interferenser kan dyka upp i närheten av apparater som är
märkta med följande symbol:
Anmärkningar:
(1) Vid 80 MHz och 800 MHz gäller det högre frekvensområdet.
(2) Dessa riktlinjer är kanske inte alltid användbara. Den elektromagnetiska utbredningen påverkas av absorption och
reflexion i byggnader, föremål och människor.
a) Fältstyrkan hos stationära sändare, t.ex. basstationer hos telefoner och mobila enheter, amatörradiostationer, AM-, FM-radiooch TV-sändare, kan teoretiskt inte bestämmas precist. För att överföra den elektromagnetiska omgivningen gentemot
den stationära sändaren, bör en studie av platsen genomföras. Om den uppmätta fältstyrkan överskrider ovan angivna
värden på den plats där produkten används, bör produkten övervakas så att den uppvisar rätt funktion. Om ovanliga
egenskaper uppträder kan andra åtgärder behövas, t.ex. en ändrad riktning eller en annan plats för produkten.
b) Över frekvensområdet från 150 kHz till 80 MHz ska fältstyrkan vara lägre än 3 V/m.
SE
- 24 -
Rekommenderat avstånd mellan mobila radioenheter och mobiltelefoner och Translux Wave
Translux Wave ska användas i en elektromagnetisk omgivning där störningar från radiofrekvent strålning är under kontroll.
Kunden eller användaren av Translux Wave kan framkalla elektromagnetiska interferenser genom ett minsta avstånd
mellan de bärbara radiofrekvensenheterna och mobiltelefoner (sändare) och Translux Wave enligt rekommendationerna
nedan allt efter kommunikationsutrustningens maximala uteffekt.
Skyddsavståndet är beroende av sändfrekvensen (m)
Maximal uteffekt hos
sändaren (W)
från 150 kHz till 80 MHz
från 80 MHz till 800 MHz
från 800 MHz till 2,5 GHz
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
För sändare med en maximal utgångseffekt som inte angivits ovan kan det rekommenderade avståndet (d) i meter (m)
beräknas efter sändarens frekvens, där (P) är den maximala utgångseffekten hos sändaren i watt (W) enligt tillverkaren
av sändaren.
Anmärkningar:
(1) Vid 80 MHz och 800 MHz används det högsta frekvensintervallet.
(2) Det är möjligt att dessa riktlinjer inte kan användas i alla situationer. Den elektromagnetiska utbredningen påverkas
av absorption och reflexion hos strukturer, föremål och personer.
12.2
Laddningsenhetens identifieringsplatta
Beskrivning av symbolerna på identifieringsplattan
1 CE-märkning.
2 Försiktigt! Se medföljande dokumentation.
3 Se bruksanvisningen.
4 Dubbel isolering (enheten uppfyller säkerhetsklass II).
5 Kassering av gammal elektronisk utrustning och elektronisk utrustning.
(Tillämplig inom EU och andra europeiska länder med
separata uppsamlingssystem.)
6 MET-märkning.
12.3
Handenhetens serienummer
Handenhetens serienummer är ingraverat
på nederdelen av höljet.
Ingraverat
serienummer.
13
1
2
3
4
5
6
Garanti
Alla apparater från Heraeus Kulzer har före leveransen genomgått noggranna kontroller för att säkerställa deras
funktion. Heraeus Kulzer ger en garanti på 2 (två) år från inköpsdatum för material- och tillverkningsfel. Garantin gäller
nya produkter som köpts från en Heraeus Kulzer-återförsäljare eller importör. Heraeus Kulzer åtar sig under garantitiden
att utan kostnad reparera eller vid behov byta ut skadade komponenter. Observera att Heraeus Kulzer-produkter inte
kan bytas ut i sin helhet.
Heraeus Kulzer tar inget som helst ansvar för direkta eller indirekta person- eller materialskador i följande fall:
• Apparatenharinteanväntsidetavseddasyftet.
• Apparatenharinteanväntsenligtanvisningarnaochföreskrifternaidenhärbruksanvisningen.
• Elnätetidetutrymmedärapparatenanvändsharinteinstalleratsenligtgällandereglerochförordningar.
• Montering,tillsatser,inställningar,ändringarochserviceharinteutförtsellertillhandahållitsavfackpersonalfrån
Heraeus-Kulzer.
• Omgivningsmiljönförförvaringochlagringmotsvararintedensombeskrivsiavsnitt12(Tekniskaspecifikationer).
Garantin omfattar inte transportskador, skador som uppstått till följd av underlåtenhet, felaktig användning eller skador
på kontrollampor, knappar och tillbehör till följd av att strömkällan är defekt. Garantin förfaller om apparaten ändras av,
eller lämnas till service hos, andra personer än kundtjänstpersonal. För att garantin ska kunna åberopas, ska kunden
lämna in eller skicka den skadade apparaten till återförsäljaren eller en Heraeus Kulzer-importör. Kunden står själv
för eventuella transport- och fraktkostnader. Apparaten och eventuella tillbehör ska förpackas väl, helst i originalförpackningen.
Ett kort som innehåller följande information måste medfölja enheten vid retur av enheten:
a) Ägarens namn, adress och telefonnummer.
b) Namn och adress för återförsäljare / importör.
c) En fotokopia av ägarens fraktsedel / inköpsbevis, där apparatens serienummer samt inköpsplats och datum
tydligt syns.
d) Beskrivning av felet.
Vi tar inget ansvar för transport eller eventuella skador som uppstår under denna.
För skador som orsakats genom olyckshändelser eller felaktig användning, eller som uppstått efter garantitiden,
beräknas kostnaderna utifrån gällande arbets- och materialkostnader.
SE
- 25 -
14
Service
14.1
Servicepartner / kontaktpersoner i landet
15
Dokumentversion
1x
2012-08 Utkastversion för prototyper.
2013-09 Första utgåvan.
2014-03 Redaktionella ändringar i avsnitt 2.1, 3.2.1, 7,2, 10, 11, 12 och 12.2.
SE
- 26 -
Kan komma att ändras.
Version: 2014-03
Indholdsfortegnelse
1
1.1
1.2
1.3
Anvendelse ______________________________________________________________________
Generelt ______________________________________________________________________
EF-overensstemmelseserklæring ____________________________________________________
Producentens erklæring ____________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Anvisninger i sikker brug af enheden __________________________________________________
Forklaring på symboler og tilhørende ord ______________________________________________
Transportbeskadigelse – Udpakning og inspektion ________________________________________
Ejers forpligtigelser ______________________________________________________________
Maskinjournal __________________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Tilsigtet anvendelse ________________________________________________________________
Beskrivelse af udstyret ____________________________________________________________
Sikkerhedskrav _________________________________________________________________
Generelle sikkerhedsanvisninger til betjening af udstyret ___________________________________
Sikkerhedsforanstaltninger _________________________________________________________
BATTERI – Sikkerhedsforanstaltninger _________________________________________________
BATTERI – Oplysninger ____________________________________________________________
ERSTATNINGSANSVAR ____________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Beskrivelse ______________________________________________________________________ 8
Indhold ved levering ______________________________________________________________
8
Beskrivelse af kontrol- og betjeningspaneler ____________________________________________
8
Håndstykke ____________________________________________________________________
8
Justeringskile __________________________________________________________________
8
Opladeren _____________________________________________________________________
8
Akustiske signaler for håndstykke ____________________________________________________
9
LED – Information vedr. udsendt stråling _______________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installation og første ibrugtagning ____________________________________________________
Sikkerhedskrav under installationen __________________________________________________
Tilslutning af opladeren til netstrømforsyningen __________________________________________
Indsættelse af batteriet i håndstykket _________________________________________________
Montering af fiberoptik i håndstykket _________________________________________________
Opladning af batteri ______________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Drift ____________________________________________________________________________
Aktivering og deaktivering af eksponeringscyklussen ______________________________________
Måling af lysintensiteten ___________________________________________________________
Dvaletilstand ___________________________________________________________________
Yderligere oplysninger om enhedens funktioner __________________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Alarmtilstande ____________________________________________________________________
Fejlbehæftet batteri ______________________________________________________________
Fejlbehæftet lysdiode _____________________________________________________________
Beskyttelse mod overophedning _____________________________________________________
Den INDBYGGEDE sensor for temperaturoverophedning er defekt _____________________________
Signal for lavt batteri _____________________________________________________________
15
15
15
15
15
16
BEMÆRK
Brug bogikonet til at finde kapitelbilleder eller
yderligere oplysninger på udfoldningssiden.
1x /2x
Fold
forside ud
HKG-Layout 99000943_01 GBA
Fold
bagside ud
09DK
Translux Wave EU
Dateiname: 09DK_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
DK
-1-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Rengøring, desinfektion og sterilisering ________________________________________________
Afmontering ___________________________________________________________________
LYSLEDER – Rengøring og desinfektion ________________________________________________
LYSLEDER – Eftersyn før steriliseringen ________________________________________________
BESKYTTENDE KEGLE TIL LYSET – Rengøring og desinfektion _______________________________
BESKYTTENDE KEGLE TIL LYSET – Eftersyn før steriliseringen _______________________________
LYSLEDER og BESKYTTENDE KEGLE TIL LYSET – emballering før sterilisering ____________________
LYSLEDER og BESKYTTENDE KEGLE TIL LYSET – Sterilisering ________________________________
Steriliseringsmetode _____________________________________________________________
Steriliseringsparametre ___________________________________________________________
HÅNDSTYKKE – Rengøring og desinfektion _____________________________________________
OPLADERENHED – Rengøring af kabinet _______________________________________________
OPLADEREN – Rengøring af opladerens kontakter ________________________________________
OPLADEREN – Udskiftelige kontakter i opladeren _________________________________________
16
16
16
16
16
17
17
17
17
17
17
18
18
19
9
Opbevaring på lager ________________________________________________________________ 19
10
Bortskaffelse _____________________________________________________________________ 19
11
Fejlfinding _______________________________________________________________________ 20
12
12.1
12.2
12.3
Tekniske specifikationer ____________________________________________________________
Elektromagnetisk kompatibilitet EN 60601-1-2 __________________________________________
Opladerens identifikationsplade _____________________________________________________
Serienummer for håndstykke _______________________________________________________
13
Garanti __________________________________________________________________________ 25
14
14.1
Service __________________________________________________________________________ 26
Servicepartner / kontaktperson i landene _______________________________________________ 26
15
Dokumenthistorie __________________________________________________________________ 26
22
23
25
25
DK
-2-
BEMÆRK
Brug bogikonet til at finde kapitelbilleder eller
yderligere oplysninger på udfoldningssiden.
1x /2x
Fold
forside ud
Fold
bagside ud
1
Anvendelse
1.1
Generelt
Translux Wave er et registreret varemærke tilhørende Heraeus Kulzer GmbH.
Denne brugsanvisning gælder for:
Bestillingsnr.
66055012
Type og udstyr
Translux Wave – LED lyspolymeriseringslampe
Udgave
2014-03 / 99000943/01
1.2
EF-overensstemmelseserklæring
Hermed erklærer vi, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, at det nedenfor nævnte apparat er i overensstemmelse med EF-direktivets væsentligste sikkerheds- og sundhedskrav med hensyn til konstruktion og udformning
samt den markedsførte model.
Hvis der foretages ændringer på apparatet, som ikke er afstemt med os, mister denne erklæring sin gyldighed.
1.3
Producentens erklæring
Vi bekræfter hermed, at enheden Translux Wave overholder EU-direktiv 93/42/EF og standarderne IEC 60601-1
og IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Tyskland).
2
Anvisninger i sikker brug af enheden
Læs og følg denne håndbogs anvisninger omhyggeligt. Ordene ADVARSEL, FORSIGTIG og BEMÆRK har særlige betydninger og skal læses omhyggeligt (se det følgende punkt). Sørg altid for at have denne håndbog inden for rækkevidde.
2.1
Forklaring på symboler og tilhørende ord
Symboler
Tilhørende ord
Forklaring
ADVARSEL
Betyder at død eller alvorlige skader kan forekomme,
hvis anvisningerne ikke følges.
FORSIGTIG
Betyder at mindre skader eller ødelæggelse af apparatet kan forekomme,
hvis anvisningerne ikke følges.
BEMÆRK
Betyder at anvisningen ikke drejer sig om sundhedsrisici.
EKSPLOSIONSADVARSEL
ADVARSEL om eksplosion – overhold oplysningerne og advarslerne
i de kapitler og afsnit, hvor der er angivelser af dette billedsymbol.
KOBL FRA NETSTRØMFORSYNINGEN
ADVARSEL om elektrisk stød.
Før der udføres rengørings- eller desinfektionsprocedurer,
skal opladerbasisenheden kobles fra den elektriske strømkilde!
MET mærket – UL / CSA overensstemmelse.
MET
WEEE / ElektroG
Bortskaffelse af gammelt udstyr jvf. WEEE (EU-direktiv) eller
Elektrisk og elektronisk udstyrsbekendtgørelse (tysk bekendtgørelse ElektroG).
Anvendt del:
Type B anvendt del – i henhold til de tekniske standarder IEC 60601-1.
Dobbeltisolering:
Klasse II-udstyr.
Strømforsyning:
Vekselstrøm.
Jævnstrøm.
Adapterens polaritet = centrum positive (plus).
Må kun anvendes I lukkede områder.
DK
-3-
Symboler
Tilhørende ord
Forklaring
Udstyr der er fremstillet i henhold til EU-direktiv 93/42/EF, inklusive
de tekniske standarder IEC 60601-1 og IEC 60601-1-2.
ADVARSEL-symbol for ”LED-stråling”.
Overhold de generelle oplysninger og fareoplysningerne i punkt 4.2.5.
Se brugsvejledningen.
FORSIGTIG, se de tilhørende dokumenter.
Driftskontakten:
”Start / stop”.
Registreringscertifikat fra den russiske føderations sundhedsministerium.
Må ikke udsættes for regn.
Opbevaringstemperaturgrænse (–20°C (–4°F) til 40°C (104°F)).
Luftfugtighedsgrænse ved opbevaring (45 % – 85 % rel. luftfugtighed).
Grænse for atmosfærisk tryk ved opbevaring (500 – 1060 hPa).
DK
-4-
2.2
Transportbeskadigelse – Udpakning og inspektion
Apparatet er følsomt over for stød, da det indeholder elektroniske komponenter. Derfor skal der udvises særlig
omhu under transporten og også ved lagring. Den af Heraeus Kulzer afsendte vare er blevet kontrolleret grundigt før
forsendelsen. Apparatet er korrekt beskyttet og emballeret.
Kontroller apparatet for transportskader efter modtagelse af leveringen. Ved konstatering af skader skal det meddeles
til transportfirmaet senest 24 timer efter udleveringen. En beskadiget enhed og/eller beskadiget tilbehør må under
ingen omstændigheder installeres eller tages i drift.
2.3
Ejers forpligtigelser
Ejeren er udover overholdelsen af gældende retsforskrifter forpligtet til at sørge for, at lovbestemmelser overholdes
og realiseres på arbejdspladsen, f.eks. instruktionspligten, loven om arbejdsbeskyttelse såvel som alle andre gældende
forskrifter og love.
Til brug i forbindelse med anvendelsen af apparatet, skal “delete” ejeren udarbejde skriftlige anvisninger på baggrund
af brugsanvisningen og det arbejde, der skal udføres. Anvisningerne skal noteres tydeligt og præsenteres forståligt for
de ansatte.
2.4
Maskinjournal
Vi anbefaler, at du fører en ”maskinjournal” og dokumenterer alle test og større arbejder
(f.eks. service eller ændringer) i den.
3
Tilsigtet anvendelse
Translux Wave er en dental LED-enhed til lyshærdning og er beregnet til brug i mundhulen til polymerisering
af lyshærdende dentale materialer, som f.eks. adhæsiver og fyldningsmaterialer, der aktiveres i bølgelængdeområdet
440 – 480 nm.
BEMÆRK
Selvom de fleste lyshærdende dentale materialer aktiveres inden for dette bølgelængdeområde, skal du ved
tvivl kontrollere producentens specifikationer eller kontakte producenten.
ADVARSEL – Uddannede specialister.
Enheden må kun betjenes af uddannede medarbejdere og tandlægen (se punkt 2.3 Ejers forpligtigelser).
Hvis enheden bruges korrekt, vil den ikke forårsage nogen kendte bivirkninger.
3.1
Beskrivelse af udstyret
Translux Wave anvender en lyskilde bestående af en meget effektiv mono-kromatisk lysdiode med en bølgelængde i
området 440 – 480 nm.
Den samlede mængde lys, der afgives fra Translux Wave, bruges til at aktivere den kamferkinon-baserede fotoinitiator.
Dette giver fremragende polymeriseringsresultater med lav varmeafgivelse.
Translux Wave leveres med en lysleder, der kan roteres 360° grader og er 8 mm i diameter.
Translux Wave består af en oplader og et håndstykke, der får strøm fra et udskifteligt genopladeligt lithium-ion-batteri.
Håndstykket er udstyret med en ”Dvaletilstand” for at minimere enhedens energiforbrug.
Håndstykket skifter til ”Dvaletilstand”, hvis den ikke bruges i 5 minutter.
Translux Wave kan betjenes via to forskellige eksponeringscyklusser:
• Eksponering med konstant output: cyklusvarighed på 10 sekunder.
• Eksponering med langsomt stigende output: ”Soft-start” (cyklusvarighed 20 sekunder).
”Soft-start” betyder en stigning i lysintensiteten fra 50 % og op til 100 % inden for 2 sekunder.
BEMÆRK – Overhold de materialeeksponeringstider, der er angivet af producenten.
For materialer med specifikke eksponeringstider (f.eks. 30 / 40 sekunder for mørkt kompositmateriale)
gentages eksponeringen om nødvendigt flere gange.
3.2
Sikkerhedskrav
Sikkerhedshenvisningernes effektivitet med hensyn til beskyttelse af personer, omgangen med apparatet og omgangen
med bearbejdningsmaterialet afhænger først og fremmest af, hvordan de personer, der betjener apparatet, forholder sig.
ADVARSEL
Læs denne brugsanvisning grundigt igennem, før apparatet tages i brug, og overhold angivelserne for
at forebygge fejl og de deraf resulterende skader, specielt sundhedsskader.
I forbindelse med opstilling og drift af apparatet skal de til enhver tid gældende nationale love, forskrifter
og retningslinjer overholdes udover angivelserne i denne brugsanvisning.
3.2.1
Generelle sikkerhedsanvisninger til betjening af udstyret
ADVARSEL – TILSIGTET ANVENDELSE
Enheden må kun bruges til det tilsigtede formål (se punkt 3 Tilsigtet anvendelse). Alle andre anvendelser
er stærkt kontraindicerede. Enhver manglende overholdelse af denne bestemmelse kan resultere i alvorlig
personskade på patienterne eller operatørerne af enheden samt beskadigelse af eller fejltilstande på enheden.
Heraeus Kulzer er ikke ansvarlig for følgeskader, der skyldes manglende overholdelse af ovennævnte
bestemmelse!
ADVARSEL
Brugeren er ansvarlig for test af Translux Wave mht. dens anvendelse og egnethed til de tilsigtede formål.
Ret aldrig lyset mod øjnene! Direkte eller indirekte lyseksponering ind i øjnene skal altid undgås, ved at bruge
beskyttelsesbriller, der filtrerer det blå lys. Ved hærdning skal spidsen af lyslederen placeres direkte over det
materiale, der skal hærdes, og eksponering af det bløde væv skal undgås. Øjne, tandkød, blødt væv og andre
kropsdele må ikke belyses (disse dele skal om nødvendigt dækkes med beskyttende materiale). Brug kofferdam til at beskytte blødt væv, dvs. tandkødet, under behandlingen. Eksponeringen skal begrænses til den del
af mundhulen, hvor den kliniske behandling skal udføres.
ADVARSEL – KONTRAINDIKATIONER
Brug ikke Translux Wave på patienter, der bruger pacemaker eller andet implanterbart elektronisk udstyr.
Dette gælder også for operatøren.
Enheden må ikke bruges af børn, blinde eller døve og heller ikke af/på personer, der kan være tilbøjelige til at
få epileptiske anfald. De ovenfor nævnte personer vil muligvis ikke opdage risiciene ved brugen og betjeningen.
Af sikkerhedsmæssige årsager for operatøren og de patienter, der har en potentiel risiko for at få epileptiske
anfald, er brugen og betjeningen af udstyret forbudt.
ADVARSEL
Apparatet må ikke modificeres eller ændres.
DK
-5-
Ejeren / brugeren skal sørge for, at:
– Enheden ikke bruges på patienter med en positiv anamnese efter lystest, f.eks. med nældefeber fremkaldt
af sollys og/eller porfyri samt på patienter, der er blevet behandlet med fotosensitiserende medicin.
– Enheden ikke bruges på patienter, der er opereret for katarakt i øjnene, der er særligt lysfølsomme,
medmindre disse bruger passende beskyttelsesudstyr, som f.eks. øjenbeskyttelse / briller, der filtrerer det
blå lys.
– Patienter med anamnese, der inkluderer nethindesygdomme, skal godkendes af deres øjenlæge til behandling med Translux Wave.
– En speciallæge skal konsulteres ved alle potentielle risikotilfælde.
ADVARSEL – Temperaturforøgelse på specifikke dele
Max. temperaturen på de applicerede dele (lyslederen og den beskyttende lyskegle): 41°C (106°F).
Max. temperaturen på en behandlet del foruden de applicerede (forreste metaldel) som kan komme i kontakt
med patienten: 46°C (115°F).
Heraeus Kulzer garanterer at hvis enheden anvendes i overensstemmelse med instruktionerne angivet i denne
manual, vil utilsigtet opvarmning af blødtvæv ikke forekomme.
ADVARSEL – Infektionskontrol.
Lyslederen og den beskyttende kegle til lyset skal rengøres, desinficeres og steriliseres (damp) før hver brug.
Lyslederen og den beskyttende kegle til lyset leveres som IKKE-STERILE og skal steriliseres, før de bruges
første gang. Se punkt 8.4.1.2 Steriliseringsparametre.
3.2.2
DK
-6-
Sikkerhedsforanstaltninger
ADVARSEL – EKSPLOSIONSRISIKO
Installer ikke udstyret, hvor der er eksplosionsrisiko.
Udstyret må ikke bruges i et miljø med antændelige stoffer (anæstesiblandinger, ilt, lattergas osv.).
Brug udstyret i et godt udluftet område.
ADVARSEL
Kontrollér, at netledningsstrømkablet og -stikket ikke er beskadiget, før enheden anvendes.
Hvis de er beskadiget, må du ikke slutte enheden til netstrømforsyningen.
Brug kun originale reservedele eller originalt tilbehør fra Heraeus Kulzer GmbH. Heraeus Kulzer leverer en
lysleder, der passer til brug med Translux Wave. Der må ikke bruges andre lysledere. Heraeus Kulzer GmbH
påtager sig ikke noget ansvar for skader, der skyldes brugen af uoriginale reservedele eller tilbehør, der ikke
er fra Heraeus Kulzer.
3.2.3 BATTERI – Sikkerhedsforanstaltninger
Heraeus Kulzer GmbH påtager sig ikke noget ansvar for batteriproblemer, der skyldes, at de sikkerhedsforanstaltninger,
som er angivet i nedenstående punkt, ikke overholdes nøje.
ADVARSEL
Forkert brug af batteriet kan resultere i, at batteriet bliver varmt, går i stykker eller antændes, og forårsage
alvorlig personskade. Sørg for at følge de sikkerhedsregler, der er angivet i nedenstående punkt.
Brug kun originale batterier fra Heraeus Kulzer!
Brugen af andre batterier end Heraeus Kulzer-batterier eller ikke-genopladelige batterier og/eller primære
batterier udgør en potentiel fare og kan beskadige udstyret.
Opbevar batteriet utilgængeligt for børn!
Batteriet må aldrig åbnes, gennemhulles eller mases – Det kan indeholde giftige stoffer.
Hvis batteriet viser tegn på tæring, afgiver en usædvanlig lugt eller lækker væske, skal batteriet straks fjernes
fra håndstykket.
Udsæt ikke batteriet for vand eller saltvand, og lad ikke batteriet blive vådt. Opbevar ikke batteriet ved høj
luftfugtighed eller på et sted, hvor det kan blive udsat for regn.
I tilfælde af, at batteriet lækker væske, og du får væsken i øjet, må du ikke gnide øjet. Skyl grundigt med vand,
og søg straks læge. Hvis det ikke behandles, kan batterivæsken forårsage skade på øjet.
ADVARSEL – EKSPLOSIONSRISIKO
Brug kun den Translux Wave-opladerenhed og -strømforsyning, der følger med enheden, til at oplade håndstykkets batteri. Forsøg aldrig at oplade Translux Wave-batteriet ved hjælp af en anden opladerenhed.
Brugen af enhver anden opladerenhed kan resultere i beskadigelse af batteriet, eksplosionsrisiko
og brand!
Brug aldrig Translux Wave-opladerenheden til at oplade andre typer batterier eller andre enheder med
et genopladeligt batteri! Brug kun originale batterier fra Heraeus Kulzer.
Bor ikke hul i batteriet med en skarp genstand, slå ikke på batteriet med en hammer / værktøj, træd ikke
på batteriet, og udsæt det ikke på anden måde for hårde slag eller stød.
Placer ikke batteriet i ild, og varm ikke batteriet op. Kortslut aldrig batteriets endeelementer med metalgenstande, da dette kan resultere i risikoen for forbrændinger, brand og eksplosion. Bær eller opbevar aldrig
batteriet sammen med halskæder, hårnåle eller andre metalgenstande.
ADVARSEL – Batteriet må ikke skilles ad eller ændres!
Batteriet indeholder sikkerhedsmekanismer, der gør, at det kan generere varme, gå i stykker, eksplodere eller
antændes, hvis det beskadiges.
ADVARSEL – Placer ikke batteriet på eller nær ild, eller andre steder med høje temperaturer.
Placer ikke batteriet i direkte solskin. Hvis dette sker, kan batteriet bliver varmt, går i stykker eller antændes.
Hvis batteriet bruges på denne måde, kan det også resultere i tab af ydeevne og kortere levetid.
ADVARSEL – I tilfælde af brand, MÅ DER IKKE KOMMES VAND PÅ ET BRÆNDENDE BATTERI!
Der skal bruges en klasse C-brandslukker (i henhold til europæisk forordning EN 3).
ADVARSEL – Bortskaffelse af beskadiget eller udtjent batteri.
Bortskaf et beskadiget eller udtjent batteri, efter at have taget de nødvendige trin til at forhindre
en ekstern kortslutning, på følgende måde:
Efter at have isoleret batteriets poler med isolerede tape skal det bortskaffes i henhold til lovgivningen
og i overensstemmelse med de lokale regler.
3.2.4 BATTERI – Oplysninger
• Opladningstidforettomtellernytbatteri:ca.3timer.
BEMÆRK – NYT batteri: første opladning
Første opladning tager ca. 3 timer. Det kan tage længere tid at oplade nye batterier eller batterier, der har
været opbevaret længe. Batteriet når sin fulde kapacitet efter nogle få fulde opladning / afladningsforløb.
BEMÆRK
Placer håndstykket i opladeren efter hver behandling, eller når den ikke bruges.
• Driftsforhold:
Driftstemperatur: 10°C (50°F) til to 35°C (95°F).
Relativ luftfugtighed: 45 % til 85 % rel. luftfugtighed.
Atmosfærisk tryk: 800 hPa – 1060 hPa.
FORSIGTIG
De temperatur- og relative luftfugtighedsområder, som batteriet kan oplades i, er 10°C (50°F) til
35°C (95°F) og 45 % til 85 % rel. luftfugtighed. Hvis batteriet oplades uden for disse temperaturområder,
kan det resultere i, at batteriet bliver varmt eller beskadiges. Hvis batteriet oplades uden for disse temperaturområder, kan det også gå ud over batteriets ydeevne eller reducere batteriets forventede levetid.
• Transport-ogopbevaringsforholdforbatteri:
Anbefalede temperatur- og relative luftfugtighedsområder:
–20°C (–4°F) til 40°C (104°F) og 45 % til 85 % rel. luftfugtighed.
Opbevar altid batteriet i opladet tilstand og ikke længere end i 5 måneder.
Omgivende lufttryk: 500 hPa til 1060 hPa.
BEMÆRK
Oplad altid batteriet helt før en længere periode med inaktivitet for enheden og mindst én gang hver
5. måned. Fjern batteriet fra håndstykket, hvis apparatet ikke er I brug gennem længere periode.
• Typiskelevetidsegenskaberforbatteriet:
Translux Wave-batteriet har en typisk forventet levetid på 300 – 400 opladningscyklusser afhængigt
af anvendelsen og de omgivende forhold, som det bliver brugt under.
BEMÆRK
Batteriet er et kemisk produkt, der anvender en kemisk reaktion, så ydeevnen vil falde,
ikke bare efterhånden som det bruges, men også efterhånden som tiden går, selv hvis det ikke bruges.
DK
-7-
3.2.5 ERSTATNINGSANSVAR
Arbejder på apparatets elektroniske udstyr må kun udføres af Heraeus Kulzer, Heraeus Kulzer-servicepartnere eller
uddannet fagpersonale og kun i sikker (spændingsfri) tilstand.
Der må kun anvendes godkendte originale reserve- og tilbehørsdele.
Anvendelsen af andre dele indebærer ukendte risici og skal under alle omstændigheder undgås.
Apparatets funktionsevne og sikkerhed kan kun garanteres, hvis de nødvendige kontroller, vedligeholdelses- og
reparationsarbejder af Heraeus Kulzer, Heraeus Kulzer-servicepartnere eller uddannet fagpersonale.
Heraeus Kulzer GmbH hæfter ikke for skader, som skyldes en defekt på apparatet eller en fejlfunktion heraf som følge
af ukorrekte reparationer, der ikke er blevet udført af Heraeus Kulzer-servicepartnere eller personale uddannet af os,
eller hvor uoriginale reserve-/ tilbehørsdele er anvendt ved udskiftning af disse.
4
Beskrivelse
Indhold ved levering
1x
1 Oplader
2 Håndatykke
3 Lysleder, Ø = 8 mm
4 Beskyttende kegle til lyset
5 Pakke med genopladeligt lithium-ion-batteri
6 Universal strømforsyning (100 V – 240 V (
)), inklusive internationale stikadapterer til strømstik:
6a = Europa type 1
6b = Storbritannien type 2
6c = USA / Japan
type 3
4.2
Beskrivelse af kontrol- og betjeningspaneler
2x
4.2.1 Håndstykke
1 Knappen ”Start / stop”
2 Lysdioder for hærdning (GRØN)
3 Lysdiode for batteristatus (tofarvet: GRØN / GUL)
4 Kontakter til opladeren
5 Justeringskile
4.2.2 Justeringskile
2x
Justeringskilen (5), der findes på den bageste nederste del af håndstykkets kabinet,
gør, at håndstykket kan indsættes korrekt i holderen til opladeren.
Ved indsættelse af håndstykket i opladeren skal justeringskilen være justeret med det styrehul,
der findes i holderen til opladeren.
Et bip bekræfter, at kontakterne er i den korrekte opladningsposition!
4.1
DK
-8-
4.2.3
Opladeren
1x
Elementerne set ovenfra
1 Kabinet til opladeren
7 Holder til håndstykke med justeringskile og udskiftelige kontakter til opladeren
8 Sensor for lysintensitet
9
– GRØN lysdiode
Funktion: Den angiver, at opladeren er tændt.
10
– 2-farvet lysdiode (GRØN / GUL)
Funktion: Oplysninger om lysintensitet.
GRØN: Angiver, at lysintensiteten, der måles med den indbyggede lysmåler, er egent til effektiv behandling.
GUL: Angiver, at der ikke er tilstrækkelig lysintensitet.
Opladeren set nedenfra
11 Strømforsyningsstik
12 Udskiftelige kontakter til opladerenhed
2x
4.2.4
Akustiske signaler for håndstykke
Funktion / fejltilstand
Knapfunktion på håndstykket
POLYMERISERINGSPROGRAM:
10 sekunder.
• Trykpåknappen”START / STOP”
for at starte eksponeringen
kortvarigt.
”SOFT-START”PROGRAM:
20 sekunder.
• Trykpåknappen”START / STOP”
i mindst ét sekund for at starte
eksponeringen.
AFBRYDELSE AF
EKSPONERINGSCYKLUSSEN
• Eksponeringscyklussenkanafbrydesfor
enhver(t) anvendt tid og program ved at
.
trykke på knappen ”START / STOP”
SIGNAL FOR LAVT
BATTERI
Det resterende strømniveau på batteriet er nok
til nogle få eksponeringscyklusser.
SIGNAL NÅR BATTERI
ER OPBRUGT
Følgende cyklusser kan
ikke aktiveres.
SIGNAL FOR DEFEKT
BATTERI
Defekt LED-lyskilde
OVEROPHEDNINGSTILSTAND
Den INDBYGGEDE
sensor for temperaturoverophedning er defekt
Håndstykkets opladerkredsløb er defekt
Bemærk: Denne tilstand
detekteres kun, når
håndstykket er placeret
i opladeren.
Akustiske signal(er), der afgives.
Indikationer på håndstykket
• 1 bip ved tryk på knappen ”START / STOP”.
• 1 bip ved afslutningen af eksponeringstiden.
Den grønne lysdiode for eksponering
i 10 sekunder lyser.
• 1 bip ved tryk på knappen ”START / STOP”.
• Akustisksignalindikerer”Soft-start”aktivering ved ”1 bip” i èt sekund.
• 1 bip efter 10 sekunders eksponeringstid.
• 1 bip ved afslutningen af eksponeringstiden.
Den grønne lysdiode for eksponering
i 20 sekunder lyser.
• 1 bip ved tryk på knappen ”START / STOP”.
• 2 bip ved afslutningen af eksponeringscyklussen.
• Batteri-ikonetlysergrønt.
Placèr håndstykket i opladeren for opladning!
• 2 bip uden aktivering en eksponeringscyklussen.
• Batteri-ikonetlysergrønt.
Placèr håndstykket i opladeren for opladning!
Kun med håndstykket placeret i opladeren.
• 1 bip for hvert sekund i 30 sekunder.
Lysdioden for batteristatus lyser GULT.
Der afgives ikke noget akustisk signal.
Den grønne lysdiode, i forbindelse med den
anvendte eksponeringscyklussen, blinker.
• 3 bip, og den anvendte eksponeringscyklus
kan afsluttes.
• 4 bip ved begyndelsen af en eksponeringscyklussen.
To grønne LED`s (10 s / 20 s) blinker på
håndstykket.
DK
-9-
4.2.5
LED – Information vedr. udsendt stråling
Apparatet anvender LED med høj lysstyrke af klasse 2M (IEC 60825-1).
LED-stråling.
Se ikke direkte ind i lysstrålen eller ved hjælp af optiske
LED RADIATION
instrumenter.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• LED-produktafklassen2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Max. Power: < 5.00 mW.
• Dominerende bølgelængde:
Min. 440 nm – Max. 465 nm.
ADVARSEL
Divergente stråler
Se ikke ind i LED-lyset gennem optiske instrumenter, som f.eks. monokler, forstørrelsesglas eller mikroskoper
fra en afstand på mindre end 100 mm, da dette kan ødelægge øjnene.
Kollimerede stråler
Se ikke ind i LED-lyset med optiske instrumenter til betragtning af fjerne objekter, som f.eks. teleskoper eller
kikkerter, da dette kan ødelægge øjnene.
Hvis en defekt af LED -styreenheden forekommer, vil værdien af LED-strålingsemissionen ikke overskrides,
I forhold til den normale anvendelse af det medicinske produkt.
Den herover viste mærkat sidder på apparatets emballage.
5
DK
- 10 -
Installation og første ibrugtagning
Følgende afsnit under dette punkt indeholder oplysninger og anvisninger, der skal følges for at sikre en problem- og
fejlfri drift af udstyret. Før Translux Wave betjenes skal de anvisninger, der er beskrevet nedenfor, følges i den angivne
rækkefølge.
Det medicinske produkt opfylder kun sikkerhedsstandarderne, hvis det installeres efter de foreskrevne anvisninger
herunder.
Udstyret skal installeres på et passende sted, der passer til dets anvendelse. Placer opladeren på en solid, tør,
flad og vandret overflade.
VIGTIGT
Håndstykket er beregnet til anvendelse, efter de foreskrevne anvisninger, I forbindelse med patientbehandlinger. Derimod er ladestation og ledninger ikke beregnet til anvendelse, efter de foreskrevne anvisninger,
i forbindelse med patientbehandlinger.
BEMÆRK
Patientomgivelser er defineret ud fra et område på 1,5 m fra patienten (se IEC 60601-1, 3. udgave
og IEC 60601-1-1).
ADVARSEL
Undersøg altid enheden og dens komponenter for skader før installationen.
Hvis der er en skade, må du ikke fortsætte med installationen af udstyret.
Operatøren må ikke være I kontakt med genstande (ladestation og ledninger) uden for patientomgivelserne
samtidigt med patientbehandlingen.
Tilslut aldrig eksterne komponenter til det medicinske apparat.
5.1
Sikkerhedskrav under installationen
ADVARSEL
Den elektriske installation på den lokation, hvor udstyret installeres og bruges, skal overholde
den eksisterende lovgivning og de sikkerhedsspecifikationer, der er gældende for strømsystemer.
Installér udstyret på et sted, hvor det er beskyttet mod slag og utilsigtede vandstænk eller stænk fra andre
væsker. Udsæt ikke udstyret for direkte sollys og UV-lys.
Installer ikke udstyret oven på eller tæt på varmekilder. Sørg under installationen for, at der er tilstrækkeligt
med luftcirkulation omkring udstyret. Installer ikke udstyret tæt på opløsningsmidler eller brændbare væsker,
da disse kan beskadige udstyrets plastikkabinet.
Stikket på ledningen (direkte tilslutning), model PSAC05R-050, sikrer isolering af apparatet i forbindelse
med netspænding. Når stikket er tilsluttet skal ledningen kunne nås. Apparatet skal have luft omkring sig.
Det medicinske produkt skal placeres således, at der ikke er vanskeligheder forbundet med at afbryde
strømmen (stik tilsluttet stikkontakt).
Kortslut aldrig batteriets endeelementer med metalgenstande, da dette kan resultere i risikoen for
forbrændinger, brand og eksplosion.
Udstyret kan transporteres, men skal håndteres forsigtigt. Transportér udstyret i vandret position.
Udsæt ikke udstyret for rystelser eller vibrationer. Se punkt 12 for oplysninger om størrelser og vægt
(tekniske specifikationer).
ADVARSEL – EKSPLOSIONSRISIKO
Installer ikke udstyret, hvor der er eksplosionsrisiko. Udstyret må ikke bruges i et miljø med antændelige
stoffer (anæstesiblandinger, ilt, lattergas osv.). Installer udstyret i et godt udluftet område.
5.2
Tilslutning af opladeren til netstrømforsyningen
1x
Translux Wave leveres med en separat universal strømforsyning (6), der kan tilsluttes 100 til
), 50 / 60 Hz.
240 V (
ADVARSEL
Før opladeren (6) sluttes til netstrømforsyningen, skal det kontrolleres omhyggeligt, om spændingen
og frekvensen for netstrømforsyningen svarer til de værdier, der er angivet på udstyrets mærkeplade.
Mærkepladen sidder i bunden af opladeren.
BEMÆRK
Translux Wave-strømforsyningsenheden (6) leveres med tre udskiftelige adapterer:
type 1
Fig. (6 a) = Europa
Fig. (6 b) = Storbritannien type 2
Fig. (6 c) = USA / Japan type 3
1 Vælg den korrekte adapter blandt de tilgængelige: Europa – Type 1, Storbritannien – Type 2, USA / Japan – Type 3.
2 Hver adapter indeholder et hul, som låsemekanismen på strømforsyningsenheden passer ind i.
3 Vend hullet mod strømforsyningsenheden, og placer adapteren på strømforsyningsenheden, så guiderne
på adapteren er justeret til de respektive huller på strømforsyningsenheden.
4 Tryk ned på adapteren og strømforsyningsenheden, skub adapteren ind i strømforsyningsenheden, til der lyder
et klik, hvorefter adapteren er låst fast.
BEMÆRK
Hvis der trykkes ned på adapteren under installationen, sikres det, at alle guiderne holdes fast af holderne
på strømforsyningsenheden. Hvis adapteren føles løs, skal den fjernes og geninstalleres.
5 For at fjerne adapteren fra strømforsyningsenheden skal du trykke ned på knappen til låsemekanismen
(markeret med ordet ”PUSH” (TRYK)) og skubbe adapteren væk fra strømforsyningsenheden og fjerne adapteren.
6 Behold ubrugte adaptere til fremtidig brug.
7 Sæt stikket på strømledningen i kontakten på undersiden af opladeren.
ADVARSEL
Kontrollér strømkablet og adapteren regelmæssigt for at sikre dig, at de er i god stand.
Hvis der er en skade, må den beskadigede del ikke bruges, før den er udskiftet.
Brug kun originale reservedele og originalt tilbehør fra Heraeus Kulzer.
8 Sæt strømforsyningsenheden og den tilhørende adapter i netstrømforsyningen.
9 Den GRØNNE lysdiode på opladeren lyser (ikonet
).
5.3
Indsættelse af batteriet i håndstykket
Translux Wave leveres med et kraftfuldt genopladeligt lithium-ion-batteri.
Batteriet leveres separat i emballagen med udstyret og skal indsættes i håndstykket før ibrugtagningen.
ADVARSEL
Følg alle sikkerhedsforanstaltninger nøje som beskrevet i punkt 3.2.3 (BATTERI – Sikkerhedsforanstaltninger).
FORSIGTIG
Sæt ALDRIG håndstykket i opladeren, uden at batteriet er indsat i håndstykket.
DK
- 11 -
Indsæt batteriet i håndstykket i den rækkefølge, der er beskrevet nedenfor:
1 Fjern batteriet fra dens emballage.
ADVARSEL
Kortslut aldrig batteriets poler med metalgenstande, da dette kan resultere i risikoen for forbrændinger,
brand og eksplosion.
2 Brug et fladt stykke værktøj (f.eks. en mønt) til at skrue batterilåget af håndstykket
mod uret (Fig. 1 og 2 ).
3 Batterihylsteret er markeret med en pil (Fig. 3 ).
BEMÆRK
Denne pil angiver den retning, som batteriet skal indsættes i håndstykket.
2x
4 Skub langsomt batteriet ind i håndstykket med pilen pegende mod kabinettet, indtil det stopper (Fig. 4 ).
BEMÆRK
Hvis batteriet indsættes i den forkerte retning (dvs. i den modsatte retning af pilen), fungerer håndstykket
ikke. Hvis batteriet indsættes i den forkerte retning, vil der ikke ske nogen skade på håndstykkets elektroniske elementer.
ADVARSEL
Brug kun originale batterier fra Heraeus Kulzer. Brugen af andre batterier fra andre producenter eller
ikke-genopladelige batterier / primære batterier udgør en potentiel fare og kan forårsage uoprettelig skade
på udstyret.
5 Brug et fladt stykke værktøj (f.eks. en mønt) til at skrue batterilåget på håndstykket.
BEMÆRK
Enheden vil ikke fungere korrekt, hvis låget på håndstykket ikke skures helt på.
DK
- 12 -
5.4
Montering af fiberoptik i håndstykket
2x
• Roterlyslederenlet(1),ogindsætdenihåndstykket(2), indtil den endelig placering er nået.
Den endelige placering er nået, når du hører et ”klik”.
• Montérdenbeskyttendekegletillyset(3) i den øverste ende af lyslederen.
Placering af lyslederen
• Roterlyslederentildenønskedeplaceringforpolymeriseringen.
• Foratfådetfuldeudbytteafdenafgivnelysintensitetskallyslederenplaceressåtætsommuligt
på kompositmaterialet.
Undgå direkte kontakt med kompositmaterialet!
FORSIGTIG – Hold altid lyslederen ren for at opnå fuld lysintensitet.
Lysintensiteten reduceres betragteligt, hvis:
– Lyslederen ikke er i perfekt stand (ridset eller flækket).
– Lyslederen ikke er korrekt placeret i håndstykket.
– Lyslederen har pletter fra kompositmaterialet.
ADVARSEL
En beskadiget lysleder reducerer lysintensiteten og skal straks udskiftes med en ny.
Skarpe kanter kan forårsage alvorlig personskade. Brug kun originale lysledere fra Heraeus Kulzer.
ADVARSEL – Infektions kontrol:
For at gøre behandlingen så sikker som muligt for patienter og operatører skal lyslederen og den beskyttende
kegle til lyset rengøres, desinficeres og steriliseres før hver behandling. Følg de anvisninger, der er angivet
i punkt 8 (Rengøring, desinfektion og sterilisering), trin for trin.
5.5
Opladning af batteri
FORSIGTIGT – NYT batteri: første opladning
Translux Wave-batteriet er delvist opladet fra fabrikken.
Batteriet skal derfor oplades helt, før Translux Wave tages i brug for første gang.
BEMÆRK – NYT batteri: første opladning
Første opladning tager ca. 3 timer. Det kan tage længere tid at oplade nye batterier eller batterier, der har
været opbevaret længe. Batteriet når sin fulde kapacitet efter nogle få fulde opladning / afladningsforløb.
ADVARSEL – EKSPLOSIONSRISIKO
Brug kun den opladerenhed, der blev leveret med Translux Wave, til at oplade batteriet.
Forsøg aldrig at oplade batteriet ved hjælp af en anden batteriopladerenhed eller strømkilde pga.
risikoen for eksplosion eller brand.
Indsæt håndstykket med batteriet i Translux Wave-opladeren.
2x
Et bip bekræfter, at kontakterne er i den korrekte opladningsposition!
VIGTIG BEMÆRKNING – Justeringskile
Justeringskilen (5), der findes på den bageste nederste del af håndstykkets hylster, gør,
at håndstykket kan indsættes korrekt i opladeren. Ved indsættelse af håndstykket i opladeren
skal justeringskilen være justeret med det hul, der findes i opladeren.
Opladning af batteriet.
• Dengrønnelysdiodeforbatteristatuspåhåndstykketbegynderatblinke.
• Nåropladningsfasenerafsluttet,erbatterietfuldtopladet,ogdengrønnestatuslysdiodelyserkonstant.
VIGTIG BEMÆRKNING – Defekt batteri
Hvis håndstykkets elektronik under opladningsfasen viser en batterifejlfunktion, afbrydes opladningsprocessen, og lysdioden med batteristatus blinker GULT.
I denne tilstand afgives et ”bip”-signal hvert sekund i en periode på 30 sekunder.
Udskift det defekte batteri med et nyt!
ADVARSEL
Brug kun batterier fra Heraeus Kulzer!
BEMÆRK
Når håndstykket er placeret i opladeren, deaktiveres dens funktioner. Betjeningen via knappen „Start /
stop”
blokeres.
Håndstykket kan fjernes fra opladeren under opladningsprocessen.
Batteriet er dog muligvis ikke fuldt opladet, hvilket kan forkorte funktionsvarigheden.
6
Drift
ADVARSEL – Kontrollér udstyrets tilstand, før behandlingen startes.
Kontrollér altid før hver behandling, at udstyret fungerer korrekt, og at tilbehøret (lysleder og den beskyttende
kegle til lyset) er effektivt. Hvis der opdages noget under behandlingen, skal du stoppe behandlingen og
DK
kontakte Heraeus Kulzer eller en lokal autoriseret kundeservicemedarbejder (se punkt 14 Service).
Hvis der er en skade, må udstyret og dets tilbehør ikke anvendes. Før hver anvendelse af Translux Wave
skal det kontrolleres, at den afgivne lysintensitet er tilstrækkelig til at garantere polymeriseringen. Kontrollér
- 13 lysintensiteten ved hjælp af den lysmåler, der er integreret i opladeren (se punkt 6.2 Måling af lysintensiteten).
ADVARSEL – Infektionskontrol
Første anvendelse
Tilbehøret, lyslederen og den beskyttende kegle til lyset leveres som IKKE-STERILE og skal steriliseres,
før de bruges første gang.
Hver anvendelse
Når tilbehøret, lyslederen og den beskyttende kegle til lyset er brugt, skal de genbehandles før, de bruges igen,
i overensstemmelse med de procedure, der er beskrevet i punkt 8 (Rengøring, desinfektion og sterilisering).
6.1
Aktivering og deaktivering af eksponeringscyklussen
Translux Wave kan betjenes via to forskellige eksponeringscyklusser:
– Eksponering med konstant output: cyklusvarighed på 10 sekunder.
– Eksponering med langsomt stigende output: ”Soft-start” (cyklusvarighed 20 sekunder).
”Soft-start” betyder en stigning i lysintensiteten fra 50 % og op til 100 % inden for 2 sekunder.
• Hvishåndstykketeri„Dvaletilstand“ (alle lysdioder for eksponeringscyklussen på håndstykket er slukkede), skal
der trykkes kortvarigt på knappen „Start / stop“
for at håndstykket igen kan betjenes.
(Efter genstart lyser 10-sek. LED standardmæssigt.)
Eksponering for 10 sekunders polymerisering
Tryk kortvarigt på knappen ”Start / stop”
. Lyset tændes.
Lysdioden for 10 sekunder lyser og viser dermed, at dette program kører.
Når eksponeringscyklussen er færdig, slukker enheden automatisk for lyset.
Akustisk signal:
Følgende akustiske signaler (bip) afgives:
1 bip ved tryk på knappen ”Start / stop”.
1 bip ved afslutningen af eksponeringstiden.
Eksponering for 20 sekunders ”Soft-start”-polymerisering
Tryk og hold knappen ”Start / stop”
nede i mindst ét sekund. Lyset tændes.
Lysdioden for 20 sekunder lyser og viser dermed, at dette program kører.
Når eksponeringscyklussen er færdig, slukker enheden automatisk for lyset, og enheden vender tilbage
til tilstanden med 10 sekunder (lysdioden for 10 sekunder lyser).
Akustisk signal:
Følgende akustiske signaler (bip) afgives:
1 bip ved tryk på knappen ”Start / stop”.
Akustisk signal indikerer ”Soft-start”-aktivering ved ”1 bip” i èt sekund.
1 bip efter 10 sekunders eksponeringstid.
1 bip ved afslutningen af eksponeringstiden.
BEMÆRK
Eksponeringscyklussen kan til hver en tid afbrydes, før eksponeringen er slut,
ved igen at trykke på knappen ”Start / stop”.
Akustisk signal:
Der afgives et akustisk signal (bip), når der trykkes på knappen ”Start / stop” for at afbryde
eksponeringscyklussen.
DK
- 14 -
6.2
Måling af lysintensiteten
Opladeren til Translux Wave er udstyret med en integreret lysintensitetsmåler (8).
2x
FORSIGTIG
Kontrollér altid lysintensiteten ved hjælp af den lysintensitetsmåler, der er integreret
i Translux Wave-opladeren, før hver behandling.
• Placerlyslederenfladtogdirektepåtestområdetudenatpressepåden(8).
Aktivér enheden ved at trykke på knappen ”Start / stop”
(uanset hvilken eksponeringstid, der er valgt).
Målingen af lysintensiteten angives straks af den tofarvede lysdiode (symbol
), der findes nederst til højre
i testområdet.
GRØN LYSDIODE: Lysintensiteten er tilstrækkelig til behandlingen.
GUL LYSDIODE: Lysintensiteten er utilstrækkelig, og patienten eller patienterne må ikke behandles.
FORSIGTIG
Hvis lysintensiteten er utilstrækkelig, udfør venligst følgende kontrol og måling:
– Lyslederen er ikke indsat i håndstykket (se punkt 5.4 Indsættelse af fiberoptik i håndstykket).
– Kontrollér lyslederen for kontaminering eller defekter.
– Rengør lyslederen, hvis den er kontamineret (se punkt 8 Rengøring, desinfektion og sterilisering),
eller udskift den beskadigede lysleder med en ny.
Brug kun originale lysledere fra Heraeus Kulzer!
ADVARSEL
Hvis de ovenfor beskrevne foranstaltninger ikke giver forbedringer, må enheden ikke bruges til behandling.
Sluk for enheden (tag opladeren ud af den elektriske strømkilde), og sørg for, at uautoriseret genaktivering
af enheden ikke er mulig. Kontakt en Heraeus Kulzer-servicepartner eller teknisk uddannede medarbejdere,
der er autoriserede af Heraeus Kulzer (se punkt 14 Service).
6.3
Dvaletilstand
Håndstykket er udstyret med en ”Dvaletilstand” for at minimere enhedens energiforbrug.
Uden for opladeren slukkes alle håndstykkets interne funktioner automatisk (”Dvaletilstand”). Dette indtræder hvis
enheden ikke anvendes i ca. 5 min.
I ”Dvaletilstand” er lysdioderne for eksponeringscyklusser slukket på håndstykket.
For at afslutte ”Dvaletilstand” skal der trykkes på knappen ”Start / stop”
Håndstykket er klar til brug.
.
6.4
Yderligere oplysninger om enhedens funktioner
BEMÆRK
Hvis håndstykket placeres i opladeren, før eksponeringscyklusser er afsluttet, slukkes der automatisk for lyset.
Når håndstykket er placeret i opladeren, deaktiveres dens funktioner. Betjeningen via knappen ”Start /
Stop”
blokeres.
Translux Wave lysapparatet er udstyret med mikroprocessorer, som kontinuerligt vurderer batteriets tilstand.
Efter hver behandling skal håndstykket derfor sættes i opladeren til opbevaring uanset batteriniveauet.
7
Alarmtilstande
7.1
Fejlbehæftet batteri
Hvis batteriet er defekt, blinker lysdioden for batteristatus på håndstykket
kontinuerligt GUL (Fig. a).
En ”bip”-lyd afgives hvert sekund i en periode på 30 sekunder.
VIGTIGT
Denne fejltilstand detekteres kun, når håndstykket er placeret i opladeren.
blinker
7.2
Fejlbehæftet lysdiode
Når en funktionsfejl i en lysdiode vises via mikroprocessoren, begynder den grønne
lysdiode ”10s” for den anvendte hærdningstilstand at blinke (Fig. b).
blinker
a
b
7.3
Beskyttelse mod overophedning
Hvis der forekommer flere hærdningscyklusser i hurtig rækkefølge (normalt efter
18 fortløbende cyklusser på hver 20 sekunder), kan den indbyggede temperatursensor
for overophedning blive aktiveret.
Beskyttelse mod overophedning indikeres akustisk ved ”3 bip” i slutningen af en lysaktivering.
Aktiveringen af beskyttelsen mod overophedning stopper midlertidigt for brugen af enheden i nogle få minutter.
Lad håndstykket køle ned i mindst 4 – 5 minutter, og start derefter den næste eksponering
ved at trykke på knappen ”Start / stop”
.
BEMÆRK
Håndstykket er klar til brug når driftstemperaturen nås. ”Reset” er IKKE nødvendigt.
7.4
Den INDBYGGEDE sensor for temperaturoverophedning er defekt
”4 bip” lyder, hvis der forekommer defekt af overophedningssensoren, i forbindelse med en polymeriseringscyklus.
BEMÆRK
Hvis der under polymerisering, forekommer en defekt af overophedningssensoren,
vil apparatets software afslutte processen. Der kan ikke foretages yderligere eksponeringscyklussen
og ”4 bip” lyder.
via ”START / STOP”-knappen
Det er ikke muligt at anvende apparatet hvis det er overophedet.
DK
- 15 -
7.5
Signal for lavt batteri
Når batteriniveauet falder til laveste niveau, giver Translux Wave-mikroprocessoren mulighed for nogle få ekstra
eksponeringscyklusser uden genopladning af batteriet.
Dette forhold signaleres ved afslutningen af hver cyklus med ”2 bip”.
Batteri-ikonet lyser grønt. Oplad batteriet!
Ved afslutningen af nogle få cyklusser tillader det resterende batteriniveau ikke yderligere eksponeringscyklusser.
Dette forhold signaleres ved ”2 bip”.
Batteri-ikonet lyser grønt. Oplad batteriet!
8
Rengøring, desinfektion og sterilisering
KOBL NETSTRØMFORSYNINGEN FRA
Før der udføres rengørings- eller desinfektionsprocedurer, skal opladerbasisenheden kobles fra den elektriske
strømkilde!
ADVARSEL
Infektionskontrol
Lyslederen og den beskyttende kegle til lyset leveres som IKKE-STERILE og skal rengøres,
desinficeres og steriliseres (damp), før de bruges første gang samt før hver brug.
Steriliser ikke håndstykket og opladeren!
Steriliser ikke batteriet!
8.1
Afmontering
Fjern den beskyttende kegle til lyset fra lyslederen.
Fjern lyslederen: Roter lyslederen let, og træk den ud af håndstykket.
8.2
DK
- 16 -
LYSLEDER – Rengøring og desinfektion
FORSIGTIG
Brug ikke skarpe eller spidse instrumenter til at rengøre lyslederen, da de kan ridse overfladen på lyslederen
og derved reducere lystransmissionen.
Brug ikke rengørings-/ desinfektionsmidler, der indeholder organisk, mineralsk og oxiderende syre,
hydrogenperoxid, klorid, jod, bromid og opløsningsmidler.
1) Straks efter brug skal eventuelle rester, som f.eks. kompositmateriale, fjernes fra endefladen på lyslederen.
Eventuelt polymeriseret kompositmateriale skal fjernes ved hjælp af ethanol, og en plastikspatel eller en blød
nylonbørste kan være en hjælp til at fjerne rester.
2) Desinficer lyslederen med en ren, blød og fnugfri klud, der er fugtet med en mild desinfektionsopløsning med lav
pH-værdi (pH 7), i henhold til producentens specifikationer. Lad desinfektionsopløsningen tørre.
8.2.1 LYSLEDER – Eftersyn før steriliseringen
Før der fortsættes med steriliseringsprocessen, skal lyslederen kontrolleres omhyggeligt for beskadigede overflader,
misfarvning og kontaminering.
ADVARSEL
Brug ikke en beskadiget lysleder. Hvis der er en skade, skal lyslederen udskiftes med en ny.
Hvis lyslederen stadig er kontamineret, skal rengørings- og desinfektionsproceduren gentages.
8.3
BESKYTTENDE KEGLE TIL LYSET – Rengøring og desinfektion
FORSIGTIG
Brug ikke rengørings-/ desinfektionsmidler, der indeholder organisk, mineralsk og oxiderende syre,
hydrogenperoxid, klorid, jod, bromid og opløsningsmidler.
Rengør og desinficer den beskyttende kegle til lyset med en blød klud, der er vædet med en mild desinfektionsopløsning med lav pH-værdi (pH 7), i henhold til producentens specifikationer. Lad desinfektionsopløsningen tørre.
8.3.1 BESKYTTENDE KEGLE TIL LYSET – Eftersyn før steriliseringen
Før steriliseringsprocessen fortsættes, skal den beskyttende kegle til lyset kontrolleres omhyggeligt for beskadigede
overflader, misfarvning og kontaminering.
ADVARSEL
Brug ikke en beskadiget beskyttende kegle til lyset. Hvis der er en skade, skal den beskyttende kegle til lyset
udskiftes med en ny.
En beskadiget beskyttende kegle til lyset giver ikke beskyttelse nok fra lysenheden.
Hvis den beskyttende kegle til lyset stadig er kontamineret, skal rengøringen og desinfektionen gentages.
8.4
LYSLEDER og BESKYTTENDE KEGLE TIL LYSET – emballering før sterilisering
Lyslederen og den beskyttende kegle til lyset kan steriliseres ved hjælp af en engangspose i passende størrelse
til medicinsk dampsterilisering.
FORSIGTIG
Lyslederen og den beskyttende kegle til lyset skal pakkes enkeltvist i en enkelt pose.
Ved sterilisering af flere instrumenter i én autoklavering, må autoklaveringens maksimalbelastning
ikke overskrides.
ADVARSEL
Sørg for, at den indvendige pose er stor nok til at indeholde de enkelte instrumenter uden at belaste
forseglingerne eller rive emballagen i stykker.
8.4.1 LYSLEDER og BESKYTTENDE KEGLE TIL LYSET – Sterilisering
8.4.1.1 Steriliseringsmetode
• Udførsteriliseringenvedhjælpafdampautoklaveringmedforvakuum.
FORSIGTIG
Brug aldrig andre steriliseringsmetoder på grund af risikoen for inkompatibilitet med de materialerne,
som lyslederen er lavet af.
BRUG IKKE følgende steriliseringsmetoder: Ethylenoxidsterilisering, varmluftsterilisering,
flash-autoklavering, STERRAD-sterilisering, STERIS-systemet eller tilsvarende steriliseringssystemer.
Lyslederen og den beskyttende kegle til lyset MÅ IKKE steriliseres ved hjælp af: Hydrogenperoxid,
pereddikesyre-system, formaldehyd- og glutaraldehydsterilisering.
8.4.1.2 Steriliseringsparametre
• Minimumsparametre for sterilisering, der giver et 10 –6-niveau for sterilitetssikkerhed – (SAL).
Cyklustype
Forvakuum
Minimumstemperatur
132°C + 3°C
(270°F + 5°F)
Minimumseksponeringstid (pose)
4 minutter
DK
- 17 -
Minimumstørretid
20 minutter
FORSIGTIG
Må ikke overstige 135°C (275°F).
8.5
HÅNDSTYKKE – Rengøring og desinfektion
ADVARSEL
Håndstykket er ikke beskyttet mod indtrængning af væske.
Sprøjt ikke væske direkte på overfladen og kontakterne til opladeren på håndstykket.
Rengørings- og desinfektionsmidler må ikke komme ind i håndstykket!
Sænk ALDRIG håndstykket ned i væske.
Rengør ALDRIG håndstykket under rindende vand.
Steriliser ikke håndstykket. Risiko for alvorlig skade, elektrisk stød og brand!
2x
Rengør og tør håndstykkets kabinet med en ren, blød og fnugfri klud, der er fugtet med et mildt desinfektionsmiddel
til overflader og har en neutral pH-værdi (pH7) i henhold til producentens specifikationer.
Lad desinfektionsopløsningen tørre, eller tør det resterende desinfektionsmiddel på håndstykkets kabinet af med
en blød, fnugfri klud.
FORSIGTIG
Brug ikke opløsningsmidler, som f.eks. acetone, isopropylalkohol og hydrogenperoxid, klorid, jod, bromid,
fenol eller andre aggressive opløsninger til at rengøre og desinficere plastikoverfladen på håndstykket.
Disse stoffer kan være farlige og medføre misfarvning og/eller skade på plastikmaterialerne i håndstykket.
Brug ikke slibende rengøringsmidler!
VIGTIGT: Rengøring af kontakterne til opladeren på håndstykket
Efter at have udført rengøringen / desinfektionen af håndstykkets plastikkabinet skal kontakterne til opladeren,
som er placeret i den nederste del af håndstykket, altid rengøres. Kontakterne til opladeren skal altid være fri
for eventuel snavs, kompositmateriale og rester af rengørings-/ desinfektionsmiddel.
VIGTIGT
Håndstykkets kontakter til opladeren skal rengøres regelmæssigt (mindst én gang om ugen) og altid efter,
at håndstykkets plastikkabinet er rengjort og desinficeret. Snavsede kontakter til opladeren eller kontakter,
der udsættes for væske, som f.eks. rengørings- eller desinfektionsmidler, kan påvirke opladningsprocessen
negativt og forhindre batteriet i at blive opladet.
Rengør kontakterne til opladeren i håndstykket med en blød, fnugfri klud eller vatpind, der er fugtet med alkohol.
FORSIGTIG
Brug ikke skarpe eller spidse instrumenter til at rengøre håndstykkets kontakter, da de kan ridse og beskadige
deres overflade og derved forringe ledningsevnen i kontakterne til opladeren.
Før håndstykket tages i brug igen, skal det kontrolleres, at håndstykkets overflade og kontakterne til opladeren
er helt tørre. Om nødvendigt lufttørres knapperne med luft fra multifunktionssprøjten.
8.6
DK
- 18 -
OPLADERENHED – Rengøring af kabinet
KOBL FRA NETSTRØMFORSYNINGEN
Kobl strømforsyningen fra stikkontakten og opladeren før rengøring / desinfektion.
ADVARSEL
Opladerens kabinet er ikke beskyttet mod indtrængning af væske.
Sprøjt ikke væske direkte på overfladen af opladerens kabinet.
FORSIGTIG
STERILISER IKKE opladeren. Den vil ikke længere fungere, og det kan medføre en risiko for alvorlig skade,
elektrisk stød og brand!
Brug ikke opløsningsmidler, som f.eks. acetone, isopropylalkohol og hydrogenperoxid, klorid, jod, bromid,
fenol eller andre aggressive opløsninger til at rengøre og desinficere plastikoverfladen på opladeren.
Disse stoffer kan være farlige og medføre misfarvning og/eller skade på plastikmaterialerne i opladeren.
Brug ikke slibende rengøringsmidler!
Rengør og tør opladeren med en ren, blød og fnugfri klud, der er fugtet med et mildt rengøringsmiddel til overflader
med en neutral pH-værdi (pH7) i henhold til producentens specifikationer.
Tør opladerens kabinet med en ren, ikke-slibende klud.
FORSIGTIG
Sørg for at tørre opladeren efter rengøring. Fugt inden i enheden kan medføre skade.
VIGTIGT
Ved afslutning af rengøringsproceduren skal du sørge for, at kontakterne i opladeren er helt tørre.
Om nødvendigt lufttørres knapperne med luft fra multifunktionssprøjten.
8.6.1
OPLADEREN – Rengøring af opladerens kontakter
2x
VIGTIGT
Når rengøringen af opladerens plastikkabinet er udført, skal opladerens kontakter altid rengøres.
Opladerens kontakter skal altid være fri for eventuel snavs, kompositmateriale og rester af
rengøringsmidler.
Opladerens kontakter skal rengøres regelmæssigt (mindst én gang om ugen) og under alle omstændigheder
altid efter, at opladerens plastikkabinet er rengjort. Snavsede kontakter eller kontakter, der udsættes for væske,
som f.eks. rengørings- eller desinfektionsmidler, kan påvirke opladningsprocessen negativt og forhindre
batteriet i at blive opladet.
Rengør kontakterne til opladeren i håndstykket med en blød, fnugfri klud eller vatpind, der er fugtet med alkohol.
FORSIGTIG
Brug ikke spidse eller skarpe genstande til at rengøre opladerens kontakter!
Sprøjt eller hæld ikke væske på kontakterne!
Undgå at bøje eller ændre formen på opladerens kontakter under rengøring.
Sørg for, at opladerens kontakter forbliver tørre efter rengøring og ikke kommer i kontakt med metalliske
og fedtede dele. Om nødvendigt lufttørres knapperne med luft fra multifunktionssprøjten.
8.6.2 OPLADEREN – Udskiftelige kontakter i opladeren
Beskadigede eller meget snavsede kontakter i opladeren (som ikke kan rengøres ved at følge de procedurer,
der er beskrevet i afsnittet ovenfor) kan forhindre kontakternes ledningsevne og opladningen af batteriet.
I dette tilfælde kan de beskadigede kontakter i opladeren udskiftes med nye.
Få yderligere oplysninger om udskiftning af opladerens kontakter og levering af reservedele ved at kontakte det lokale
Heraeus Kulzer-datterselskab.
Arbejdsinstruktioner:
Nødvendigt værktøj: skruetrækker til Phillips-skruer, mellemstørrelse.
1. Tag håndstykket ud af opladerbasisenheden.
2. Kobl opladeren fra netstrømsforsyningen.
3. Tag tilslutningskablet ud af opladeren.
2x
4. Vend bunden i vejret på opladeren.
5. Fjern 2 skruer fra opladerens kontaktbro (se udfoldningsbagsiden, punkt 12).
6. Træk opladerens kontaktbro ud.
7. Indsæt en ny kontaktbro, og fastgør / tilslut i omvendt rækkefølge.
FORSIGTIG
Den nye kontaktbro må ikke bøjes eller kontamineres!
Sørg for korrekt isættelse og fastgørelse! Skruerne må ikke strammes for hårdt!
9
Opbevaring på lager
Opbevaring af håndstykket med batteri i længere perioder uden brug. Før eller efter en lang periode med inaktivitet
skal batteriet oplades helt eller opbevares i opladeren. Selvom det indbyggede sikkerhedskredsløb i batteriet forhindrer
fuld afladning, anbefales det kraftigt at oplade batteriet helt mindst én gang hver 5. måned efter inaktivitet.
10
Bortskaffelse
BEMÆRK – VIGTIGT
Enheden må ikke bortskaffes sammen med almindeligt husholdningsaffald.
Kontakt det lokale Heraeus Kulzer-datterselskab for oplysninger om bortskaffelse af reservedele.
Bortskaf ubrugelige batterier og lysledere i henhold til de tilsvarende lokale lovkrav.
ADVARSEL – Bortskaffelse af beskadiget eller udtjent batteri
Bortskaf et beskadiget eller udtjent batteri efter at have udført de nødvendige trin til at forhindre
en ekstern kortslutning på følgende måde:
Efter at have isoleret batteriets poler med tape skal det bortskaffes i henhold til de lokale regler.
Betingelserne og sikkerhedsforanstaltningerne for bortskaffelse af enheden er underlagt de gældende lovbestemmelser
for lignende elektroniske enheder, som ikke længere er brugbare.
Bortskaffelse af gammelt udstyr jvf. WEEE (EU-direktiv) eller
Elektrisk og elektronisk udstyrsbekendtgørelse (tysk bekendtgørelse ElektroG).
DK
- 19 -
11
Fejlfinding
ADVARSEL
Hvis de nedenstående trin ikke løser problemet, skal du kontakte Heraeus Kulzer eller en lokal autoriseret
kundeservicemedarbejder: BRUG IKKE Translux Wave, og FORSØG IKKE at foretage service på enheden,
da det kan medføre alvorlig personskade.
Læs denne brugervejledning igen, hvis enheden ikke ser ud til at fungere korrekt, og se derefter følgende tabel:
PROBLEM
Opladeren tænder ikke.
Den GRØNNE LYSDIODE
opladeren er slukket.
på
MULIG ÅRSAG
Strømforsyningen er ikke tilsluttet
stikkontakten og/eller til opladerens
strømstik.
Der er ikke strøm i stikkontakten.
Den udskiftelige adapter er ikke sat korrekt i strømforsyningsenhedens kabinet.
Strømkablet til strømforsyningen er
beskadiget.
Strømforsyningen er defekt.
Opladeren er defekt.
Opladerens kontakter er kortsluttet.
Håndstykket er IKKE indsat
i opladeren.
Lysafgivelsen starter ikke,
når der trykkes på knappen
”Start / stop”
, og der vises
ingen oplysninger på håndstykkets
panel.
Håndstykke uden batteri.
Håndstykket er i ”Dvaletilstand”.
Tomt batteri.
Der er ikke nok strøm på batteriet til at
aktivere håndstykket.
Elektronisk fejlfunktion.
Defekt batteri.
DK
- 20 -
Der afgives ”2 bip” ved afslutningen
af eksponeringscyklussen.
Lav batteristrøm.
AFHJÆLPNING
Kontrollér, at strømforsyningen er sikkert
tilsluttet stikkontakten og til opladerens
strømstik.
Brug en anden stikkontakt.
Læs punkt 5.2 i denne brugervejledning
omhyggeligt.
Udskift strømforsyningen med en ny.
(Strømforsyningen og dens kabel kan
ikke adskilles).
Udskift strømforsyningen med en ny.
Kontakt Heraeus Kulzer eller en lokal
autoriseret kundeservicemedarbejder.
Fjern årsagen til kortslutningen.
Hvis dette ikke afhjælper kortslutningen,
skal kontakterne i opladeren udskiftes
med nye. Se punkt 8.6.2.
Indsæt batteriet i håndstykket
(se punkt 5.3).
Tryk på knappen ”Start / stop” for at
aktivere håndstykket fra ”Dvaletilstand”.
Se punkt 6.3.
Sæt håndstykket i opladeren,
og genoplad batteriet (se punkt 5.5).
Kontakt Heraeus Kulzer eller en lokal
autoriseret kundeservicemedarbejder.
Sæt håndstykket i opladeren for at
kontrollere, om batteriet er defekt.
En ”forberedende sekvens” startes og
Translux Wave mikroprocessor kontrollerer batteriets status. Dette varer i max.
30 minutter.
Hvis der under denne sekvens høres et
”akustisk signal” hvert sekund, i løbet
af de 30 sek., og at der desuden ses
et gult blinkende lys i batteri-ikonet på
håndstykket, er batteriet defekt.
Udskift batteriet med et nyt
(se punkt 5.3).
De ”2 bip” signalerer, at det resterende strømniveau på batteriet kun er
tilstrækkeligt til nogle få efterfølgende
eksponeringscyklusser.
Sæt håndstykket i opladeren,
og genoplad batteriet (se punkt 5.5).
PROBLEM
Lampen starter ikke når ”Start /
stop”-knappen
holdes inde
eller hvis exponeringscyklus afbrydes
og et ”pip” høres. LED ”10s” blinker
grøn på håndstykket.
blinker
Efter flere fortløbende eksponeringscyklusser, tænder lyset ikke,
når der trykkes på knappen
, og der afgives
”Start / stop”
”3 bip”.
Under en eksponeringscyklus afgives
der ”3 bip”.
Fejlfunktioner under opladningsfasen.
Et akustisk ”signal” lyder for hvert
sekund i 30 sekunder og LED statusknappen på håndstykket blinker GUL.
MULIG ÅRSAG
LED enheden kan være defekt.
AFHJÆLPNING
Kontroller LED enhedens funktion ved
hjælp af følgende måling:
Placer håndstykket i laderen og tryk på
”Start / stop”-knappen 5 gange hurtigt
efter hinanden.
Fjern håndstykket fra laderen.
LED “10s” stopper at blinke grøn hvis
håndstykket nulstilles.
Hvis LED „10s“ igen blinker ved starten
af den næste eksponering og lyspolymeriseringen ikke påbegynder er LED
defekt.
Kontakt da Heraeus Kulzer eller en lokal
autoriseret forhandler.
Beskyttelse mod overophedning.
Lad håndstykket køle ned i mindst
Håndstykket er blevet overophedet under 4 – 5 minutter, og start derefter den
brugen, og sensoren for temperaturover- næste eksponering ved at trykke på
knappen ”Start / stop”.
ophedning er blevet aktiveret.
Bemærk: Håndstykket er klar til brug
Aktiveringen af beskyttelsen mod overnår driftstemperaturen nås. ”Reset” er
ophedning forhindrer midlertidigt
(i nogle få minutter) brugen af enheden. IKKE nødvendigt.
Beskyttelse mod overophedning.
Lad håndstykket køle ned i mindst
Håndstykket er blevet overophedet under 4 – 5 minutter, og start derefter den
brugen, og sensoren for temperaturover- næste eksponering ved at trykke på
knappen ”Start / stop”.
ophedning er blevet aktiveret.
Aktiveringen af beskyttelsen mod overophedning forhindrer midlertidigt
(i nogle få minutter) brugen af enheden.
Under batteriets prækvalifikationsfase
Udskift batteriet med et nyt
(batteritilstand: helt tomt, se punkt 4.2.4 (se punkt 5.3).
og 5.5).
Elektronikken detekterer en defekt status
2x
eller fejlfunktionsstatus for batteriet og
afbryder opladningsprocessen.
DK
blinker
Håndstykket er placeret i opladeren,
men opladningsfasen starter ikke.
De grøn lysdioden for batteristatus på
håndstykket er slukket.
Fejl: Manglende kontakt til oplader.
Ulovlig kontakt mellem opladerbasisenheden og håndstykket.
Opladers og/eller håndstykkets
kontakter er snavsede.
Den lysintensitet, der er målet med
den måler, som er integreret i opladeren, er utilstrækkelig.
Lysdioden
GUL.
på opladeren lyser
Lyslederen ikke er korrekt indsat
i håndstykket.
Lyslederens udgang er kontamineret
med fremmedmateriale eller rester fra
kompositmateriale, der kan påvirke den
afgivne lysmængde.
Lyslederen er beskadiget eller for
gammel.
Se punkt 8.5 og 8.6.2.
Kontrollér, om håndstykket er sat
i opladeren i den korrekte retning.
Justeringskile.
Se punkt 4.2.1, underpunkt 4 og 5.
Rengør håndstykkets og opladerens
kontakter.
Se punkt 8.5 og 8.6.1.
Kontrollér, at lyslederen er sat helt ind
i metalkeglen på håndstykket.
Rengør lyslederens udgang.
Se punkt 8.2.
Udskift lyslederen med en ny.
- 21 -
12
DK
- 22 -
Tekniske specifikationer
Klassificering i henhold til EU-direktiv 93/42/EF: Klasse I (ét)
Sikkerhedsstandarder:
Produktet er testet I overensstemmelse med IEC 60601-1
(2. udgave) og IEC 60601-1-1.
Produktet er testet i overensstemmelse med IEC 60601-1
(3. udgave) og IEC 60601-1-2 (3. udgave omhandlende elektromagnetisk beskaffenhed – EMV).
Håndstykket er beregnet til anvendelse, efter de foreskrevne anvisninger, i forbindelse med patientbehandlinger. Derimod er ladestation og ledninger ikke beregnet til anvendelse, efter de foreskrevne
anvisninger, i forbindelse med patientbehandlinger.
Bemærk: Patientomgivelser er defineret ud fra et område på 1,5 m
fra patienten (se IEC 60601-1, 3. udgave og IEC 60601-1-1).
Klassificering i henhold til IEC 60601-1:
Klasse II, Type B, Tilbehør: Lyslederstav med beskyttelses-anordning.
IP 20 (opladerenhed).
IP 20 (Translux Wave)
Opladeren:
Translux Wave-opladeren
Strømforsyning til opladeren:
Stik til direkte tilslutning, fremstillet af:
Phihong Technology CO LTD – Model: PSACO5R-050.
Input: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Output: 5 V
– 1 A Max –
.
Klasse II apparat
Strømforsyning til håndstykke:
Genopladeligt lithium-ion-batteri.
Producent: Panasonic. Model: NCR-18500.
Nominel spænding: 3,6 V.
Nominel kapacitet (typisk): 2000 mAh
Håndstykke:
Model: Translux Wave.
Anvendelse: 120 s “ON” – 40 s “OFF” – Max. 2 eksponeringscyklusser
Lyskilde:
Lysdiode med høj luminositet.
LED-produkt af klassen 2M (IEC 60825-1).
Bølgelængdeområdet: 440 – 480 nm.
Dominerende bølgelængde: Min. 440 nm – Max. 465 nm
Lysleder:
Blyfri flerkernet stang, 8 mm i diameter.
Steriliserbar ved dampautoklavering med forvakuum:
4 minutter (minimum) ved en minimumstemperatur på 132°C + 3°C
(270°F + 5°F). Maks. 500 cyklusser
Indstillelige eksponeringscyklusser:
10 sekunders eksponeringstid.
– Normal eksponering
Akustiske signaler:
1 bip ved starten af eksponeringen.
1 bip ved afslutningen af eksponeringen
– ”Soft-start”-eksponering
20 sekunders eksponeringstid. (”Soft-start” betyder en stigning
i lysintensiteten fra 50 % og op til 100 % inden for 2 sekunder.)
Akustiske signaler:
1 bip ved starten af eksponeringen.
Akustisk signal indikerer ”Soft-start”-aktivering ved ”1 bip”
i èt sekund.
1 bip efter 10 sekunders eksponering.
1 bip ved afslutningen af eksponeringen
Opladningstid for et tomt batteri:
Ca. 3 timer
Omgivende forhold for enheden:
Drift
Transport
Temperatur
Relativ luftfugtighed
Atmosfærisk tryk
10°C – 35°C
(50°F – 95°F)
45 % – 85 %
800 – 1060 hPa
og opbevaring
–20°C – 40°C
(–4°F – 104°F)
45 % – 85 %
500 – 1060 hPa
Opladeren: vægt 450 g.
Dimensioner: L 140 x B 58 x H 62 mm
Håndstykke: vægt 150 g (inkl. lysleder).
Dimensioner: L 275 mm, maks. Ø 24 mm
Vægt og dimensioner:
12.1
Elektromagnetisk kompatibilitet EN 60601-1-2
ADVARSEL
Apparatet bruger specielle EMC-tiltag, der skal være installeret og aktiveret som beskrevet i anvisningerne
i dette afsnit.
Bærbare og mobile radiokommunikationsanordninger kan påvirke den korrekte funktion af udstyret.
Producentvejledning og -erklæring – elektromagnetiske emissioner
Translux Wave er beregnet til brug i de elektromagnetiske omgivelser, der er angivet nedenfor.
Kunden og bruger af Translux Wave skal sørger for, at den bruges i sådanne omgivelser.
Emissionskontrol
Konformitet Elektromagnetisk miljø – vejledning
HF-emission CISPR 11
Gruppe 1
Translux Wave bruger kun RF-energi til dens interne funktion.
Dens RF-emissioner er derfor meget lave og vil sandsynligvis ikke
forårsage interferens for elektronisk udstyr i nærheden.
HF-emission CISPR 11
Klasse B
Translux Wave er beregnet til brug i alle bygninger, herunder også
boliger og bygninger, der er forbundet direkte med det offentlige
Harmoniske emissioner
Klasse A
private lavspændingsnet.
IEC 61000-3-2
Spændingssvingnings-emissioner /
flicker IEC 61000-3-3
Konform
Producentvejledning og -erklæring – elektromagnetisk immunitet
Translux Wave er beregnet til brug i de elektromagnetiske omgivelser, der er angivet nedenfor.
Kunden og bruger af Translux Wave skal sørger for, at den bruges i sådanne omgivelser.
Immunitetskontrol
Testværdi IEC 60601
Konformitetsværdi
Elektromagnetisk miljø –
vejledning
Elektrostatiske
±6 kV ved kontakt
Apparatet fungerer fortsat
Gulvene skal bestå af træ, beton
udladninger (ESD)
korrekt og sikkert.
eller keramik. Hvis gulvene er
±8 kV i luften
IEC 61000-4-2
belagt med syntetisk materiale,
skal den relative fugtighed udgøre
mindst 30%.
Hurtige, transiente
±2 kV for ydelsestilførsler
Apparatet fungerer fortsat
Kvaliteten af netspændingen skal
elektriske forstyrrelser / ±1 kV for indgangs-/
korrekt og sikkert.
være den samme som i et typisk
bursts iht.
kontor- eller sygehusmiljø.
udgangslinjer
IEC 61000-4-4
Impulser
±1 kV differentialspænding
Apparatet fungerer fortsat
Kvaliteten af netspændingen skal
IEC 61000-4-5
korrekt og sikkert.
være den samme som i et typisk
±2 kV common modekontor- eller sygehusmiljø.
spænding
Spændingshuller, korte
spændingsafbrydelser
og -udsving på
strømforsyningens
indgangslinje
IEC 61000-4-11
Magnetfelt med netfrekvens (50 / 60 Hz)
IEC 61000-4-8
< 5% UT (> 95% indbrud UT)
for 0,5 cyklusser
40% UT (60% indbrud UT)
for 5 cyklusser
70% UT (30% indbrud UT)
for 25 cyklusser
< 5% UT (> 95% indbrud UT)
på 5 sek.
3A/m
Udstyret kan variere fra de
Kvaliteten af netspændingen skal
påkrævede imunitetsniveau- være den samme som i et typisk
er et stykke tid, så længe
kontor- eller sygehusmiljø.
udstyret fungerer sikkert,
der ikke detekteres nogen
fejlfunktioner, og udstyret
kan gendannes til statussen
for før testen med hjælp fra
operatøren.
Apparatet fungerer fortsat
korrekt og sikkert.
BEMÆRKNING: UT er netspændingen i vekselstrøm før brug af testværdien.
Netfrekvens-magnetfelterne skal
have de karakteristiske niveauer
for et typisk sted i et kontor- eller
sygehusmiljø.
DK
- 23 -
Producentvejledning og -erklæring – elektromagnetisk immunitet
Translux Wave er beregnet til brug i de elektromagnetiske omgivelser, der er angivet nedenfor.
Kunden og bruger af Translux Wave skal sørger for, at den bruges i sådanne omgivelser.
ImmunitetsTestværdi
Konformitets- Elektromagnetisk miljø – vejledning
kontrol
IEC 60601
værdi
Ledsaget
3 Veff fra
Apparatet
De transportable højfrekvens-mobiltelefoner må ikke bruges i
højfrekvens
150 kHz til
fungerer fortsat nærheden af produktet eller en del deraf, inklusive kablet, medmindre
IEC 61000-4-6 80 MHz
korrekt og
de anbefalede beskyttelsesafstande, der kan udregnes ved hjælp af
sikkert.
ligningen for senderens frekvens, overholdes.
Strålet
3 V / m fra
Anbefalede beskyttelsesafstande
højfrekvens
80 MHz til
d = 1,2 √P
IEC 61000-4-3 2,5 GHz
d = 1,2 √P fra 80 MHz til 800 MHz
d = 2,3 √P fra 800 MHz til 2,5 GHz
hvor (P) er den maksimale nominelle udgangsydelse for senderen i
watt (W) i henhold til producenten af senderen og (d) den anbefalede
beskyttelsesafstand i meter (m). Feltstyrken for den faste højfrekvenssender, som bestemt i en elektromagnetisk undersøgelse
af stedet, skal være lavere end konformitetsværdien i hvert
frekvensinterval (b). Der kan forekomme interferenser
i nærheden af apparater, der er mærket med følgende symbol:
Bemærkninger:
(1) Bed 80 MHz og 800 MHz gælder det højere frekvensområde.
(2) Disse retningslinjer kan muligvis ikke anvendes i alle situationer. Udbredelsen af elektromagnetiske størrelser påvirkes
af absorption og refleksion af bygninger, genstande og mennesker.
a) Feltstyrkerne for de stationære sendere som f.eks. basisstationer fra radiotelefoner og mobile fastlandsradiosendere,
amatørradiosendere, AM- og FM-radio- og tv-sendere kan teoretisk set ikke forudbestemmes med sikkerhed. For at
finde de elektromagnetiske miljøer for de stationære sendere skal der foretages en undersøgelse af stedet. Hvis de målte
feltstyrker på det sted, hvor produktet anvendes, overskrider det overensstemmelsesniveau, der er angivet ovenfor, skal
produktet undersøges med henblik på at påvise den bestemmelsesmæssige funktion. Hvis der registreres usædvanlige
ydelseskendetegn, kan det være nødvendigt at træffe andre foranstaltninger som f.eks. en ændret udligning eller en
anden placering af produktet.
b) I frekvensområdet fra 150 kHz til 80 MHz bør feltstyrken være lavere end 3 V / m.
DK
- 24 -
Anbefalede beskyttelsesafstande mellem bærbart radioudstyr og mobiltelefoner og Translux Wave
Translux Wave skal bruges i et elektromagnetisk miljø, hvor forstyrrelser fra højfrekvensstråling er under kontrol. Kunden
eller brugeren af Translux Wave kan forebygge elektromagnetisk interferens ved at overholde en mindsteafstand mellem
bærbare radiofrekvenssendere og -mobiltelefoner (sendere) og Translux Wave i henhold til de anbefalinger, der er angivet
nedenfor. Disse afhænger af den maksimale udgangsydelse for kommunikationsudstyret.
Maksimal nominel udgangs- Beskyttelsesafstand afhængig af senderfrekvensen (m)
ydelse for senderen (W)
fra 150 kHz til 80 MHz
fra 80 MHz til 800 MHz
fra 800 MHz til 2,5 GHz
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
For sendere, hvis maksimale nominelle udgangsydelse ikke er angivet ovenfor, kan den anbefalede afstand (d) beregnes
i meter (m) på baggrund af ligningen for senderens frekvens, hvor (P) er den maksimale nominelle udgangsydelse for
senderen i watt (W) i henhold til producenten af senderen.
Bemærkninger:
(1) Ved 80 MHz og 800 MHz anvendes det højeste frekvensinterval.
(2) Det er muligt, at disse retningslinjer ikke kan anvendes i alle situationer. Den elektromagnetiske udbredelse påvirkes
af absorption og refleksion fra strukturer, genstande og personer.
12.2
Opladerens identifikationsplade
Beskrivelse af symbolerne på identifikationspladen
1 CE-mærket.
2 Forsigtig, se de tilhørende dokumenter.
3 Se brugsvejledningen.
4 Dobbeltisolering (udstyret lever op til sikkerhedsklasse II).
5 Bortskaffelse af elektrisk og elektronisk udstyr.
(Gældende i EF-landene og andre europæiske lande
med et separate indsamlingssystemer).
6 MET-mærket.
12.3
Serienummer for håndstykke
Håndstykkets serienummer er indgraveret
i bunden af kabinettet.
Indgraveret
serienummer.
13
1
2
3
4
5
6
Garanti
Hvert enkelt Heraeus Kulzer-apparat gennemgår en streng afprøvning og slutkontrol inden levering for at sikre en
fejlfri drift af apparatet. Heraeus Kulzer yder 2 (to) års garanti fra købstidspunktet for materiale- og produktionsfejl
på nye Heraeus Kulzer-produkter, der er købt hos en Heraeus Kulzer-videreforhandler eller -importør. Heraeus Kulzer
er i garantiperioden forpligtet til at reparere (eller efter frit valg udskifte) de dele af produktet gratis, som vurderes
at være defekte. En totaludskiftning af Heraeus Kulzer-produkter er ikke påtænkt.
Heraeus Kulzer hæfter under ingen omstændigheder for eventuelle direkte eller indirekte person- og
materielskader i følgende tilfælde:
• Apparatetblevikkebrugttildettiltænkteanvendelsesformål.
• Apparatetblevikkebrugtihenholdtildeanvisningerogforskrifter,somerbeskrevetidennemanual.
• El-installationerneiderum,hvorapparatetanvendes,erikkeioverensstemmelsemedgældendelovgivning
og de heraf resulterende forskrifter.
• Sammensætning,udvidelser,indstillinger,ændringerellerreparationerblevikkeudførtafHeraeusKulzerfagpersonale.
• Omgivelsesbetingelserneforopbevaringoglagringafapparateterikkeioverensstemmelsemedforskrifterne
anført i afsnit 12 (Tekniske specifikationer).
Garantien omfatter ikke transportskader, skader som følge af ukorrekt brug eller skødesløshed, skader som følge
af tilslutning til forkert netspænding samt kontrollamper, knapper og alt tilbehør. Garantien bortfalder, hvis apparatet
ændres eller repareres af andre personer end kundeservicen. For at gøre garantikravet gældende indleverer kunden
apparatet til den videreforhandler eller Heraeus Kulzer-importør, hvor apparatet blev købt, og for dennes regning.
Apparatet inklusive tilbehørsdelene skal være godt emballeret (om muligt i original emballage).
Der skal være vedhæftet et kort, som indeholder følgende oplysninger, med enheden, hvis enheden returneres:
a) Ejerens navn, adresse og telefonnummer.
b) Videreforhandlerens / importørens navn og adresse.
c) Kopi af ejerens følgeseddel / købskvittering på apparatet, som udover dato angiver apparatets betegnelse
og serienummer.
d) Beskrivelse af driftsfejlen.
Der hæftes ikke for transporten og eventuelle transportskader.
Skader, der opstår som følge af uheld eller ukorrekt brug eller indtræffer efter garantiens udløb, repareres til de reelle
materiale- og arbejdsomkostninger.
DK
- 25 -
14
Service
14.1
Servicepartner / kontaktperson i landene
15
Dokumenthistorie
1x
2012-08 Udkastsversion for prototyper.
2013-09 Første udgave.
2014-03 Redaktionelle ændringer i punkt 2.1, 3.2.1, 7.2, 10, 11, 12 og 12.2.
DK
- 26 -
Kan ændres.
Ajourført: 2014-03
Innholdsfortegnelse
1
1.1
1.2
1.3
Anvendelse ______________________________________________________________________
Generelt ______________________________________________________________________
EF-samsvarserklæring ____________________________________________________________
Produsenterklæring _______________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Instruksjoner for sikker bruk av enheten _______________________________________________
Forklaring på symboler og ledsagende ord _____________________________________________
Transportskade – utpakking og kontroll ________________________________________________
Eierens ansvar __________________________________________________________________
Maskinjournal __________________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Tiltenkt bruk _____________________________________________________________________
Beskrivelse av enheten ___________________________________________________________
Sikkerhetskrav __________________________________________________________________
Generelle sikkerhetsinstruksjoner ved betjening av enheten _________________________________
Sikkerhetsforanstaltninger _________________________________________________________
BATTERI – Sikkerhetsforanstaltninger _________________________________________________
BATTERI – Informasjon ____________________________________________________________
ANSVAR ______________________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Beskrivelse av enheten _____________________________________________________________ 8
Innholdet i leveringen _____________________________________________________________
8
Beskrivelse av kontroll- og betjeningselementene ________________________________________
8
Håndstykke ____________________________________________________________________
8
Justeringsnøkkel ________________________________________________________________
8
Ladeenhet _____________________________________________________________________
8
Akustiske signaler fra håndstykket ___________________________________________________
9
LED informasjon angående utsendt stråling _____________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Installasjon og første idriftssetting ____________________________________________________
Sikkerhetskrav under installasjon ____________________________________________________
Koble ladeenheten til et strømuttak __________________________________________________
Sette batteriet inn i håndstykket _____________________________________________________
Sette fiberoptikken inn i håndstykket _________________________________________________
Lade batteriet __________________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Drift ____________________________________________________________________________
Aktivere og deaktivere eksponeringssyklusen ___________________________________________
Måle lysstyrken _________________________________________________________________
Hvilemodus ____________________________________________________________________
Tilleggsinformasjon om hvordan enheten fungerer ________________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Alarmtilstander ___________________________________________________________________
Defekt batteri __________________________________________________________________
Defekt LED-lys _________________________________________________________________
Overopphetingsvern ______________________________________________________________
INNEBYGD sensor for temperaturoverbelastning defekt ____________________________________
Signal om lavt batteri _____________________________________________________________
15
15
15
15
15
16
MERK
Bruk bok-ikonet til å finne kapittelbildene eller
mer informasjon på det utbrettbare omslaget.
1x /2x
Brett ut
forsiden
HKG-Layout 99000943_01 GBA
Brett ut
baksiden
10NO
Translux Wave EU
Dateiname: 10NO_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
NO
-1-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Rengjøring, desinfisering og sterilisering _______________________________________________
Demontering ___________________________________________________________________
LYSLEDER – Rengjøring og desinfisering _______________________________________________
LYSLEDER – Kontroll før sterilisering __________________________________________________
BESKYTTENDE LYSKJEGLE – Rengjøring og desinfisering ___________________________________
BESKYTTENDE LYSKJEGLE – Kontroll før sterilisering ______________________________________
LYSLEDER og BESKYTTENDE LYSKJEGLE – Emballering før sterilisering ________________________
LYSLEDER og BESKYTTENDE LYSKJEGLE – Sterilisering ____________________________________
Steriliseringsmetode _____________________________________________________________
Steriliseringsparametere ___________________________________________________________
HÅNDSTYKKE – Rengjøring og desinfisering ____________________________________________
LADEENHET – Rengjøre hus ________________________________________________________
LADEENHET – Rengjøre ladekontakter _________________________________________________
LADEENHET – Utskiftbare ladekontakter _______________________________________________
16
16
16
16
16
17
17
17
17
17
17
18
18
19
9
Oppbevaring ______________________________________________________________________ 19
10
Avhending _______________________________________________________________________ 19
11
Feilsøking _______________________________________________________________________ 20
12
12.1
12.2
12.3
Tekniske spesifikasjoner ___________________________________________________________
Elektromagnetisk kompatibilitet EN 60601-1-2 __________________________________________
Ladeenhetens identifikasjonsplate ___________________________________________________
Håndstykkets serienummer ________________________________________________________
13
Garanti _________________________________________________________________________ 25
14
14.1
Service __________________________________________________________________________ 26
Servicepartnere / samtalepartnere i de forskjellige land ____________________________________ 26
15
Dokumentasjonshistorikk ___________________________________________________________ 26
22
23
25
25
NO
-2-
MERK
Bruk bok-ikonet til å finne kapittelbildene eller
mer informasjon på det utbrettbare omslaget.
1x /2x
Brett ut
forsiden
Brett ut
baksiden
1
Anvendelse
1.1
Generelt
Translux Wave er et registrert varemerke for Heraeus Kulzer GmbH.
Denne bruksanvisningen gjelder for:
Bestillingsnr.
66055012
Type og utstyr
Translux Wave – LED lysherdings enhet
Modell
2014-03 / 99000943/01
1.2
EF-samsvarserklæring
Hermed erklærer vi, Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, at apparatet som beskrives nedenfor
på grunn av sin utforming og konstruksjon, oppfyller aktuelle gjeldende sikkerhets- og helsekrav i henhold til
EF-direktivene.
Denne erklæringen blir ugyldig hvis apparatet modifiseres eller endres uten vår tillatelse.
1.3
Produsenterklæring
Vi bekrefter herved at enheten Translux Wave er i overensstemmelse med direktiv 93/42/EF og standardene
IEC 60601-1 og IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Tyskland).
2
Instruksjoner for sikker bruk av enheten
Les denne bruksanvisningen, og følg instruksjonene nøye. Ordene ADVARSEL, FORSIKTIG og MERK har bestemte
betydninger og må gjennomgås nøye (se følgende avsnitt). Ha alltid denne bruksanvisningen for hånden.
2.1
Forklaring på symboler og ledsagende ord
Symboler
Ledsagende ord
Forklaring
ADVARSEL
For å unngå alvorlig personskade skal bruksanvisningen følges nøye.
FORSIKTIG
Det same gjelder for å unngå skade på apparatet.
MERK
Ta hensyn til retningslinjene I denne bruksanvisningen så unngås skader.
ADVARSEL OM
EKSPLOSJON
ADVARSEL om eksplosjon – vær oppmerksom på informasjon og advarsler
i kapitler og avsnitt merket med dette bildesymbolet.
KOBLE FRA
STRØMUTTAKET
ADVARSEL om elektrisk støt.
Før rengjørings- og desinfiseringsprosedyrene utføres, må ladebasen kobles
fra strømkilden!
MET merket – UL / CSA overensstemmelse.
MET
WEEE / ElektroG
Deponering av gammelt utstyr i henhold til WEEE (EU-direktiv) eller
Elektrisk og elektronisk utstyr Act (tysk lov ElektroG).
Anvendt del:
Anvendt del av type B – i samsvar med den tekniske standarden
IEC 60601-1.
Dobbel isolasjon:
Klasse II-enhet.
Strømforsyning:
Vekselstrøm.
Likestrøm.
Strømadapter - senter – Positiv.
Brukes kun I lukkede områder.
NO
-3-
Symboler
Ledsagende ord
Forklaring
Enhet produsert i samsvar med 93/42/EF-direktivet samt de tekniske
standardene IEC 60601-1 og IEC 60601-1-2.
ADVARSEL om «LED-stråling».
Vær oppmerksom på informasjonen og farene beskrevet i avsnitt 4.2.5.
Se bruksanvisninger.
FORSIKTIG, sjekk medfølgende dokumenter.
Betjeningsbryter:
«Start / stopp».
Registreringsbevis i henhold til helsedepartementet i Den russiske føderasjon.
Må ikke utsettes for regn.
Grenser for oppbevaringstemperatur (–20°C (–4°F) opptil 40°C (104°F)).
Grenser for luftfuktighet ved oppbevaring (45 – 85 % RH).
Grenser for lufttrykk ved oppbevaring (500 – 1060 hPa).
2.2
Transportskade – utpakking og kontroll
Apparatet er ømfintlig for støt, fordi det inneholder elektroniske moduler. Det må derfor utvises stor forsiktighet ved
transport og lagring. Apparatet ble kontrollert nøye hos Heraeus Kulzer før det ble sendt ut. Apparatet leveres med
forskriftsmessig sikring og emballasje.
Kontroller apparatet for transportskader når leveransen er mottatt. Hvis det oppdages skader, må disse meldes fraktselskapet innen 24 timer etter utlevering. En skadet enhet og / eller skadet ekstrautstyr må under ingen omstendigheter
installeres eller brukes.
NO
-4-
2.3
Eierens ansvar
I tillegg til å overholde gjeldende lover og forskrifter, plikter eieren å sørge for at lover og forskrifter på arbeidsplassen
overholdes og iverksettes, f.eks. opplæringsplikt, arbeidsmiljøloven, samt alle andre gjeldende lover og forskrifter.
For arbeid på og med apparatet, må eieren, på grunnlag av bruksanvisningen og arbeidene som skal utføres, sørge for
å utforme skriftlige, lett forståelige instrukser i det språket alle de ansatte snakker og gjøre disse tilgjengelige.
2.4
Maskinjournal
Vi anbefaler at du fører en «maskinjournal» hvor alle tester og større arbeider (f.eks. vedlikehold, endringer)
dokumenteres.
3
Tiltenkt bruk
Translux Wave er en lysherdingsenhet med LED som skal brukes i munnhulen til polymerisering av lysherdende
tannmaterialer som adhesjonsmidler og fyllmaterialer som aktiveres i et bølgelengdeområde på 440 – 480 nm.
MERK
Selv om de fleste lysherdende tannmaterialer aktiveres innenfor dette bølgelengdeområdet,
må spesifikasjonene kontrolleres eller produsenten kontaktes.
ADVARSEL – Kvalifiserte spesialister.
Enheten må bare betjenes av personell med tilstrekkelig opplæring og av tannlegen (se avsnitt 2.3 Eierens
ansvar). Hvis enheten brukes på riktig måte, forårsaker den ingen kjente bivirkninger.
3.1
Beskrivelse av enheten
Translux Wave benytter en lyskilde som består av en meget effektiv mono-kromatisk lysdiode med en bølgelengde
på mellom 440 og 480 nm.
Alt lyset som stråler fra Translux Wave, brukes til å aktivere kamferkinon-fotoinitiatoren. Dette gir utmerkede polymiseringsresultater med lav varmeavgivelse.
Translux Wave leveres med en lysleder som roterer 360 grader og har en diameter på 8 mm.
Translux Wave består av en ladeenhet og et håndstykke, som drives av et uttakbart, oppladbart litiumionbatteri.
Håndstykket er utstyrt med «Hvilemodus» for å minimere enhetens energiforbruk.
Håndstykket går inn i «hvilemodus» hvis det ikke brukes i en periode på ca. 5 minutter.
Translux Wave har to forskjellige eksponeringssykluser:
• Eksponering med konstant effekt: syklusvarighet 10 sekunder.
• Eksponering med langsomt økende effekt: «Myk start» (syklusvarighet 20 sekunder).
«Myk start» betyr at lysstyrken økes fra 50 % opp til 100 % innen 2 sekunder.
MERK – Overhold eksponeringstiden som produsenten har oppgitt for materialene.
For materialer med spesifikke eksponeringstider (f.eks. 30 / 40 sekunder for mørke kompositter) gjentas
eksponeringen flere ganger om nødvendig.
3.2
Sikkerhetskrav
Hvor effektive sikkerhetsmerknadene er med hensyn til personsikkerhet, bruk av apparatet og håndtering av materialer,
er i alt vesentlig avhengig av hvordan personer som arbeider med dette apparatet opptrer.
ADVARSEL
Les denne bruksanvisningen nøye før apparatet tas i bruk og følg anvisningene for å unngå feil og skader,
spesielt helseskader, som skyldes feilaktig bruk.
I tillegg til anvisningene i denne bruksanvisningen må alle aktuelle gjeldende nasjonale lover,
regler og retningslinjer for oppsetting og bruk av apparatet overholdes.
3.2.1
Generelle sikkerhetsinstruksjoner ved betjening av enheten
ADVARSEL – TILTENKT BRUK
Enheten må bare brukes til det formålet den er tiltenkt (se avsnitt 3 Tiltenkt bruk). All annen bruk frarådes
på det sterkeste. Manglende overholdelse av denne bestemmelsen kan påføre pasienter eller operatører
av enheten alvorlig skade samt føre til skade på eller feil i enheten. Heraeus Kulzer er ikke ansvarlig for
følgeskader som skyldes manglende overholdelse av ovennevnte bestemmelse!
ADVARSEL
Brukeren er ansvarlig for å teste Translux Wave med hensyn til bruk og egnethet for tiltenkte formål.
Lyset må aldri rettes mot øynene! Direkte eller indirekte eksponering av lys i øynene må alltid avverges ved
bruk av vernebriller som filtrerer ut blått lys. Under herding må lyslederspissen plasseres rett over materialet
som skal herdes, og eksponering på mykt vev må unngås. Øyne, gummer, mykt vev og andre kroppsdeler må
ikke eksponeres for det blå lyset (om nødvendig må disse delene dekkes til). Bruk en kofferdam til å beskytte
det myke vevet, dvs. tannkjøttet, under behandling. Eksponering må begrenses til området i munnhulen der
den kliniske behandlingen utføres.
ADVARSEL – KONTRAINDIKASJONER
Ikke bruk Translux Wave på pasienter med pacemaker eller andre elektroniske implantater. Dette gjelder også
operatøren.
Enheten må ikke brukes av barn, blinde eller døve og heller ikke av/på personer som har lett for å få epileptiske
anfall. Det er ikke sikkert at de ovennevnte personene er oppmerksom på farene ved bruk og betjening av
enheten. Av hensyn til sikkerheten for operatører og pasienter med potensiell risiko for epileptiske anfall er det
forbudt for disse å bruke og betjene enheten.
ADVARSEL
Det er ikke tillatt å modifisere apparatet.
NO
-5-
Eieren / brukeren må påse følgende:
– Enheten ikke brukes på pasienter med en positiv anamnese etter lystesting, for eksempel med solutløst
elveblest og / eller porfyri, eller på pasienter som har vært behandlet med legemidler mot lysoverfølsomhet.
– Enheten må ikke brukes på pasienter som er operert for grå stær, som er særlig følsomme for lys, med
mindre de benytter seg av egnede vernetiltak, for eksempel bruk av vernebriller som filtrerer ut blått lys.
– Når det gjelder pasienter med en anamnese som omfatter sykdommer på netthinnen, må behandlingen
med Translux Wave godkjennes av øyenlegen.
– En spesialistlege må konsulteres i alle tilfeller hvor det foreligger en potensiell risiko.
VARNING – Høy Temperatur på anvendte deler
Temperaturen for de anvendte deler (lightguide og beskyttende lys kjegle): 41°C (106°F).
Max. Temperatur av partiet betraktet som anvendt del (metall fremre kon) som kan komme i berøring med
pasienten: 46°C (115°F).
Heraeus Kulzer erklærer at hvis enheten brukes i samsvar med instruksjonene i denne håndboken, vil ingen
oppvarming av vev oppstå.
ADVARSEL – Infeksjonskontroll
Lyslederen og den beskyttende lyskjeglen må rengjøres, desinfiseres og steriliseres (damp) før hver bruk.
Lyslederen og den beskyttende lyskjeglen leveres i IKKE-STERIL tilstand og må steriliseres før første gangs
bruk. Se avsnitt 8.4.1.2 Steriliseringsparametere.
3.2.2
NO
-6-
Sikkerhetsforanstaltninger
ADVARSEL – EKSPLOSJONSFARE
Ikke installer enheten på steder med eksplosjonsfare.
Enheten må ikke brukes på steder med en eksplosiv atmosfære (anestetiske blandinger, oksygen,
dinitrogenoksid osv.). Bruk enheten i et område som er godt ventilert.
ADVARSEL
Før enheten tas i bruk, må strømkabelen og støpselet kontrolleres for skade. Hvis de er skadet,
må ikke enheten kobles til strømuttaket.
Bruk bare originale reservedeler og originalt ekstrautstyr fra Heraeus Kulzer GmbH. Heraeus Kulzer leverer en
lysleder som er egnet for bruk med Translux Wave. Andre lysledere må ikke brukes. Heraeus Kulzer GmbH
påtar seg ikke noe ansvar for skade som skyldes bruk av reservedeler eller ekstrautstyr som ikke er originale
Heraeus Kulzer-produkter.
3.2.3 BATTERI – Sikkerhetsforanstaltninger
Heraeus Kulzer GmbH påtar seg ikke noe ansvar for batteriproblemer som oppstår når sikkerhetsforanstaltningene
oppført i avsnittet nedenfor ikke følges nøye.
ADVARSEL
Feil bruk av batteriet kan føre til at det blir varmt, sprekker eller antenner og forårsake alvorlig skade.
Følg sikkerhetsreglene oppført i avsnittet nedenfor.
Bruk bare originale Heraeus Kulzer-batterier!
Bruk av batterier som ikke leveres av Heraeus Kulzer, ikke-oppladbare batterier og / eller primærbatterier utgjør
en potensiell fare og kan skade enheten.
Batteriet må oppbevares utenfor barns rekkevidde!
Batteriet må aldri åpnes, punkteres eller knuses, da det inneholder giftige stoffer.
Hvis batteriet viser tegn til korrosjon, avgir en uvanlig lukt eller lekker væsker, må det fjernes fra håndstykket
umiddelbart.
Batteriet må ikke eksponeres for vann eller saltvann eller bli vått. Batteriet må ikke oppbevares i høy fuktighet
eller på et sted der det kan bli utsatt for regn.
Hvis batteriet lekker og noen får væske i øynene, må vedkommende ikke gni seg i øynene. Skyll godt med
vann, og oppsøk lege umiddelbart. Hvis øyet ikke behandles, kan væsken fra batteriet påføre øyet skade.
ADVARSEL – EKSPLOSJONSFARE
Bruk bare Translux Wave-ladeenheten og strømforsyningsutstyret som kommer med enheten, til å lade
batteriet for håndstykket. Prøv aldri å lade Translux Wave-batteriet ved å bruke en annen ladeenhet.
Bruk av alle andre ladeenheter kan påføre batteriet skade eller medføre eksplosjons- eller brannfare!
Bruk aldri Translux Wave-ladeenheten til å lade andre batterityper eller andre enheter med et oppladbart
batteri! Bruk bare originale batterier fra Heraeus Kulzer.
Batteriet må ikke gjennombores med skarpe gjenstander, slås med en hammer eller annet verktøy,
trøs på eller på annen måte utsettes for kraftige slag eller støt.
Batteriet må ikke settes fyr på eller varmes opp. Batteripolene må aldri kortsluttes med metallgjenstander,
da det kan medføre fare for brannskader, brann og eksplosjon. Batteriet må aldri bæres eller oppbevares
sammen med smykker, hårnåler eller andre metallgjenstander.
ADVARSEL – Batteriet må aldri demonteres eller endres!
Sikkerhetsmekanismer i batteriet kan få batteriet til å generere varme, sprekke, eksplodere eller antenne hvis
batteriet skades.
ADVARSEL – Ikke plasser batteriet på eller i nærheten av ild eller andre steder med høy temperatur.
Ikke utsett batteriet for direkte sollys. Dette kan få batteriet til å generere varme, sprekke eller antenne.
Bruk av batteriet på denne måten kan også føre til tap av ytelse og kortere forventet levetid.
ADVARSEL – IKKE HELL VANN OVER ET BRENNENDE BATTERI i tilfelle brann!
Et brannslukkingsapparat i klasse C (i henhold til den europeiske standarden EN 3) må brukes.
ADVARSEL – Avhending av skadet eller tomt batteri.
Et skadet eller tomt batteri avhendes etter at følgende nødvendige tiltak for å hindre ekstern kortslutting
er utført:
Etter at batteripolene er dekket med isolasjonstape avhendes batteriet i henhold til gjeldende lovgivning eller
lokale forskrifter.
3.2.4 BATTERI – Informasjon
• Tidendettaråladeettomtellernyttbatteri:ca.3timer.
MERK – NYTT batteri: første lading
Første lading tar omtrent 3 timer. Det kan ta lengre tid å lade nye batterier eller batterier som har vært
oppbevart lenge. Batteriet når full kapasitet etter et par fullstendige lade-/utladingssykluser.
MERK
Plasser håndstykket i ladeenheten etter hver behandling, eller når det ikke er i bruk.
• Driftstilstand:
Driftstemperatur: 10°C (50°F) opptil 35°C (95°F).
Relativ fuktighet: 45 – 85 % RH.
Atmosfærisk trykk: 800 hPa til 1060 hPa.
FORSIKTIG
Temperaturområdet og området for relativ fuktighet der batteriet kan lades, er 10°C (50°F) til 35°C (95°F)
og 45 – 85 % RH. Hvis batteriet lades ved temperaturer utenfor dette området, kan det bli varmt eller
skadet. Å lade batteriet utenfor dette temperaturområdet kan også skade batteriets ytelse eller redusere
batteriets forventede levetid.
• Batteritransportogoppbevaringsforhold:
Anbefalte temperaturområder og områder for relativ fuktighet:
–20°C (–4°F) til 40°C (104°F) og 45 – 85 % RH.
Batteriet må alltid oppbevares ladet og ikke lenger enn 5 måneder.
Omgivelseslufttrykk: 500 – 1060 hPa.
MERK
Batteriet må alltid fullades før enheten skal være inaktiv i en lengre periode, og minst hver 5 måneder.
Ved lengre inactive perioder skal batteriet fjernes fra håndheten.
• Normalelevetidsegenskaperforbatteriet:
Translux Wave-batteriet har en normal forventet levetid på 300 – 400 ladesykluser avhengig av bruk
og miljøforholdene der batteriet brukes.
MERK
Batteriet er et kjemisk produkt som benytter en kjemisk reaksjon, så ytelsen forringes ikke bare gjennom
bruk, men også etter hvert som tiden går, selv om det ikke brukes.
NO
-7-
3.2.5 ANSVAR
Arbeid på det elektroniske utstyret på apparatet skal kun utføres av Heraeus Kulzer, Heraeus Kulzer-servicepartnere
eller opplært fagpersonell, og apparatet må være i sikker (spenningsfri) tilstand når arbeidet utføres.
Det er ikke tillatt å bruke annet enn godkjente originalreservedeler og originaltilbehør.
Bruk av andre deler innebærer et ukjent risiko og er ikke tillatt.
Apparatets funksjonsdyktighet og sikkerhet kan kun garanteres når alle nødvendige kontroller, og alt vedlikeholds- og
reparasjonsarbeid utføres av Heraeus Kulzer, Heraeus Kulzer-servicepartnere eller av fagpersonell som er opplært
til dette.
Heraeus Kulzer GmbH er ikke ansvarlig for en eventuell defekt / funksjonsfeil på apparatet som skyldes ufagmessige
reparasjoner som ikke er utført av en Heraeus Kulzer-servicepartner eller av personell som er opplært av oss, eller
skader som skyldes at det ikke brukes originalreservedeler / tilbehørsdeler ved utskifting av deler.
4
Beskrivelse av enheten
4.1
Innholdet i leveringen
1 Ladeenhet
2 Håndstykke
3 Lysleder, Ø = 8 mm
4 Beskyttende lyskjegle
5 Pakke med oppladbare litiumionbatterier
6 Universell strømforsyningsenhet (100 – 240 V (
6a = Europa
type 1
6b = Storbritannia type 2
6c = USA / JAPAN type 3
4.2
4.2.1
NO
-8-
1x
)), inkludert internasjonale støpseladaptere:
Beskrivelse av kontroll- og betjeningselementene
Håndstykke
1 «Start / stopp»-knapp
2 LED-lys for herdemoduser (GRØNT)
3 LED-lys for batteristatus (tofarget: GRØNT / GULT)
4 Ladeenhetskontakter
5 Justeringsnøkkel
4.2.2 Justeringsnøkkel
Justeringsnøkkelen (5), som er plassert på baksiden undersiden av håndstykkehuset,
gjør det mulig å plassere håndstykket på riktig måte i holderen for ladeenheten.
Når håndstykket settes inn i ladeenheten, må justeringsnøkkelen være på linje med styresporet
som er plassert på innsiden av holderen for ladeenheten.
Et pip bekrefter at kontaktene er i riktig ladeposisjon!
4.2.3
2x
2x
Ladeenhet
1x
Elementer sett ovenfra
1 Deksel for ladeenhet
7 Holder for håndstykket med justeringsnøkkel og utskiftbare ladeenhetskontakter
8 Lysstyrkesensor
9
– GRØNT LED-lys
Funksjon: Lyset indikerer at ladeenheten er på.
10
– Tofarget LED-lys (GRØNT / GULT)
Funksjon: Informasjon om lysstyrken.
GRØNT: Indikerer at lysstyrken, som måles med den innebygde lysmåleren, egner seg til effektiv
behandling.
GULT: Indikerer at lysstyrken er utilstrekkelig.
Elementene sett nedenfra
11 Strømforsyningsplugg
12 Utskiftbart innlegg for ladekontakter
2x
4.2.4
Akustiske signaler fra håndstykket
Funksjon / feiltilstand
POLYMERISERINGSPROGRAM:
10 sekunder.
«MYK START»PROGRAM:
20 sekunder.
AVBRUDD I EKSPONERINGSSYKLUS
SIGNAL OM LAVT
BATTERI
Det gjenstående batterinivået er nok til et par
eksponeringssykluser.
LYDSIGNAL VED TOMT
BATTERI
Følgende eksponeringssyklusen kan ikke
aktiveres.
SIGNAL OM DEFEKT
BATTERI
Defekt LED-lyskilde
OVEROPPHETING
INNEBYGD sensor for
temperaturoverbelastning defekt
Håndstykkets ladeenhet
defekt
Merk: Denne tilstanden
oppdages bare når
håndstykket er plassert i
ladeenheten.
Betjening av knapper på håndstykket
Akustiske signaler
Indikasjoner på håndstykket
• Trykkrasktpå«START / STOPP»• Ett pip når «START / STOPP»-knappen
trykkes ned.
for å starte eksponeringen.
knappen
• Ett pip på slutten av eksponeringstiden.
Det grønne LED-lyset for 10-sekundersprogrammet lyser.
• Ett pip når «START / STOPP»-knappen
• Trykkrasktpå«START / STOPP»trykkes ned.
i minst ett sekund for å
knappen
• Ett pip etter 1 sekund indikerer
starte eksponeringen.
at «Myk start» er aktivert.
• Ett pip etter 10 sekunder med
eksponeringstid.
• Ett pip på slutten av eksponeringstiden.
Det grønne LED-lyset for 20-sekundersprogrammet lyser.
• Ett pip når «START / STOPP»-knappen
• Eksponeringssyklusenkanavbrytesnår
som helst og uavhengig av hvilket program
trykkes ned.
som er i bruk, ved at «START /
STOPP»-knappen
trykkes ned.
• To pip på slutten av eksponeringssyklysen.
• Ikonetforbatterietlysergrønt.
Plasser håndstykket i ladeenheten for lading!
• To pip uten aktivering av eksponeringssyklusen.
• Ikonetforbatterietlysergrønt.
Plasser håndstykket i ladeenheten for lading!
Bare når håndstykket er plassert
i ladeenheten.
• Ett pip hvert sekund i en periode
på 30 sekunder.
LED-lyset for batteristatus lyser GULT.
Ingen akustiske signaler avgis.
Det grønne LED-lyset for eksponeringssyklusen
som brukes, blinker.
• Tre pip avgis før elektronikken avslutter
eksponeringssyklusen som brukes.
• Fire pip I starten av eksponeringssyklusen.
To grønne LED lys (10 sek / 20 sek) blinker på
håndenheten.
NO
-9-
4.2.5
LED-informasjon angående utsendt stråling
Apparatet bruker LED med høy lysstyrke i klasse 2M (IEC 60825-1).
LED-stråling.
Se hverken i lysstrålen eller se på det direkte med
LED RADIATION
optiske instrumenter.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• LED-produktiklasse2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Max styrke: < 5,00 mW.
• Dominerende bølgelengde:
Min. 440 nm – Max. 465 nm.
ADVARSEL
Divergente stråler
Se ikke med optiske instrumenter som monokler, forstørrelsesglass eller mikroskoper med en avstand
på mindre enn 100 mm i LED-lyset, da dette kan skade øynene.
Kollimerte stråler
Se ikke med optiske instrumenter for jernobservasjon som teleskoper eller kikkerter i LED-lyset, da dette kan
skade øynene.
Om det skulle oppstå en feil på LED-styreenheten vil verdien av LED-stråling ikke overskrides, verdien ved
normale forhold for det medisinske apparatet.
Klistremerker som vist ovenfor befinner seg på apparatets emballasje.
5
NO
- 10 -
Installasjon og første idriftssetting
Følgende deler i dette avsnittet inneholder informasjon og instruksjoner som må følges for å sikre vellykket og feilfri
drift av enheten. Før Translux Wave tas i bruk, må instruksjonene utføres i rekkefølgen som beskrives nedenfor.
Standard for sikkerhet på apparatet garanteres kun om installasjon utføres I samsvar med instruksene beskrevet
nedenfor.
Enheten må installeres på et sted som er praktisk med tanke på bruk. Plasser ladeenheten på en solid, tørr,
flat og vannrett overflate.
VIKTIG
Håndenheten er beregnet til bruk etter foreskrevne instrukser I forbindelse med pasientbehandling. Derimot er
lader og strømadapter ikke beregnet til bruk ved pasientbehandling.
MERK
Pasientens nærhet definers som et område på 1,5 m fra pasienten
(som beskrevet I IEC 60601-1 3 utg. og IEC 60601-1-1).
ADVARSEL
Kontroller alltid enheten og enhetens komponenter for skade før installasjon.
Enheten må ikke installeres når det er tegn til skade.
Operatøren må ikke være I kontakt med lader og / eller strømadapter samtidig med kontakt med pasienten.
Eksterne komponenter skal ikke kobles til det medisinske apparatet.
5.1
Sikkerhetskrav under installasjon
ADVARSEL
Den elektriske installasjonen i lokalene der enheten skal installeres og brukes, må være i samsvar med
gjeldende lovgivning og sikkerhetsspesifikasjonene som gjelder elektriske systemer.
Installer enheten på et sted hvor den er beskyttet fra støt og fra utilsiktet sprut av vann eller andre væsker.
Enheten må ikke eksponeres for direkte sollys, UV-lys.
Enheten må ikke installeres oppå eller i nærheten av varmekilder. Påse at det er tilstrekkelig luftsirkulering
rundt enheten ved installasjon. Enheten må ikke installeres i nærheten av løsemidler eller brennbare væsker,
da de kan skade enhetens plasthus.
Kontakten på strømadapteren, modell PSACO5R-050 sikrer isolering av apparatet fra nettspenning.
Når kontakten er plugget I strømnettet, må adapteren være let tilgjengelig. Apparatet skal stå fritt, med luft
rundt. Det medisinske apparatet skal stå slik at det ikke er vanskelig å avbryte strømtilførselen.
Batteripolene må aldri kortsluttes med metallgjenstander, da det kan medføre fare for brannskader,
brann og eksplosjon.
Enheten kan transporteres, men må håndteres varsomt. Transporter enheten i vannrett posisjon. Enheten må
ikke eksponeres for rysting eller vibrasjoner. For størrelser og vekt se kapittel 12 (Tekniske spesifikasjoner).
ADVARSEL – EKSPLOSJONSFARE
Enheten må ikke installeres på steder med eksplosjonsfare. Enheten må ikke brukes på steder med en
eksplosiv atmosfære (anestetiske blandinger, oksygen, dinitrogenoksid osv.) Installer enheten i et område
som er godt ventilert.
5.2
Koble ladeenheten til et strømuttak
1x
Translux Wave kommer med en egen universell strømforsyningsenhet (6) som godtar
), 50 / 60 Hz.
100 – 240 V (
ADVARSEL
Kontroller at spenningen og frekvensen i strømnettet tilsvarer verdiene oppgitt på enhetens
merkeplate før ladeenheten (6) tilkobles. Merkeplaten er festet på undersiden av ladeenheten.
Bruk kun den ledningen some r levert med apparatet. Benyttes en annen ledning kan apparatets batteri skades.
Benytt aldri skjøteledning med flere uttak.
MERK
Strømforsyningsenheten (6) for Translux Wave er utstyrt med tre utskiftbare adaptere:
type 1
Fig. (6 a) = Europa
Fig. (6 b) = Storbritannia type 2
Fig. (6 c) = USA / JP
type 3
1 Velg riktig adapter: Europa – type 1, Storbritannia – type 2, USA /JAPAN – type 3.
2 Hver adapter har et spor som passer til festelåsen på strømforsyningsenheten.
3 Rett sporet mot og plasser adapteren på strømforsyningsenheten, slik at skinnene på adapteren er på linje
de tilsvarende sporene på strømforsyningsenheten.
4 Press ned adapteren og strømforsyningsenheten, og skyv adapteren inn i strømforsyningsenheten til et klikk høres
og adapteren låses på plass.
MERK
Når adapteren presses ned, festes alle skinnene i festelåsene på strømforsyningsenheten. Hvis adapteren
føles løs, tas den ut og installeres på nytt.
5 Ta adapteren ut av strømforsyningsenheten ved å trykke på festelåsknappen (merket med ordet «PUSH» [SKYV],
skyve adapteren bort fra strømforsyningsenheten og fjerne den.
6 Ta vare på ubrukte adaptere for fremtidig bruk.
NO
7 Koble støpselet på strømledningen inn i kontakten på undersiden av ladeenheten.
ADVARSEL
- 11 Kontroller strømkabelen, strømforsyningsenheten og adapteren jevnlig for å påse at de er i god stand.
Ved tegn til skade må ikke den skadede delen brukes før den er skiftet ut.
Bruk bare originale reservedeler og originalt ekstrautstyr fra Heraeus Kulzer.
8 Koble strømforsyningsenheten og adapteren til strømuttaket.
9 Det GRØNNE LED-lyset på ladeenheten lyser (ikonet
).
5.3
Sette batteriet inn i håndstykket
Translux Wave kommer med et kraftig oppladbart litiumionbatteri.
Batteriet kommer separat i pakken med enheten og må settes inn i håndstykket før enheten tas i bruk første gang.
ADVARSEL
Følg alle sikkerhetsforanstaltninger beskrevet i avsnitt 3.2.3 (BATTERI – Sikkerhetsforanstaltninger) nøye.
FORSIKTIG
Håndstykket må ALDRI plasseres i ladeenheten uten at batteriet er satt inn i håndstykket.
Sett batteriet inn i håndstykket i rekkefølgen beskrevet nedenfor:
1 Ta batteriet ut av emballasjen.
ADVARSEL
Batteripolene må aldri kortsluttes med en metallgjenstand, da det kan medføre fare for brannskader,
brann og eksplosjon.
2 Bruk et flatt verktøy (for eksempel en mynt) til å skru av batterihetten på håndstykket mot klokken
(fig. 1 og 2 ).
3 Batterihetten er merket med en pil (fig. 3 ).
MERK
Denne pilen indikerer i hvilken retning batteriet må settes inn i håndstykket.
4 Skyv batteriet langsomt med pilen som er rettet mot huset, inn i håndstykket til den stopper (fig. 4 ).
MERK
Hvis batteriet settes inn på feil måte (dvs. i motsatt retning av pilen), vil ikke håndstykket fungere.
Elektronikken i håndstykket blir ikke skadet hvis batteriet settes inn på feil måte.
ADVARSEL
Bruk bare originale Heraeus Kulzer-batterier. Bruk av batterier som leveres av andre produsenter,
ikke-oppladbare batterier og / eller primærbatterier utgjør en potensiell fare og kan påføre enheten ikkereversibel skade.
5 Bruk et flatt verktøy (for eksempel en mynt) til å skru batterihetten på håndstykket med klokken.
MERK
Enheten vil ikke fungere skikkelig hvis hetten på håndstykket ikke er skrudd helt fast.
NO
- 12 -
5.4
Sette fiberoptikken inn i håndstykket
• Roterlyslederennoe(1), og sett den inn i håndstykket (2) til endelig posisjon nås.
Når den endelige posisjonen nås, høres et «klikk».
• Monterdenbeskyttendelyskjeglen(3) på den øverste enden av lyslederen.
Plassere lyslederen
• Roterlysledereniønsketposisjonforpolymeriseringen.
• Foråutnyttelysstyrkenfulltutplassereslyslederensånærkomposittensommulig.
Unngå direkte kontakt med komposittmaterialet!
FORSIKTIG – Lyslederen må til enhver tid holdes ren for å oppnå full lysstyrke.
Lysstyrken reduseres betydelig hvis:
– lyslederen ikke er i perfekt stand (riper eller hakk).
– lyslederen ikke er plassert riktig i håndstykket.
– lyslederen er tilsmusset av kompositter.
ADVARSEL
En skadet lysleder reduserer lysstyrken og må umiddelbart skiftes ut med en ny.
Skarpe kanter kan forårsake alvorlig skade. Bruk bare originale Heraeus Kulzer-lysledere.
2x
ADVARSEL – Infeksjonskontroll:
For å gjøre behandlingen så sikker som mulig for pasienter og operatører må lyslederen og den beskyttende
lyskjeglen rengjøres, desinfiseres og steriliseres før hver behandling. Følg instruksjonene i kapittel 8
(Rengjøring, desinfisering og sterilisering) trinn for trinn.
5.5
Lade batteriet
FORSIKTIG – NYTT batteri: første lading
Translux Wave-batteriet er delvis ladet på fabrikken.
Derfor må batteriet fullades før Translux Wave brukes første gang.
MERK – NYTT batteri: første lading
Første lading tar omtrent 3 timer. Det kan ta lengre tid å lade nye batterier eller batterier som har vært
oppbevart lenge. Batteriet når full kapasitet etter et par fullstendige lade-/ utladingssykluser.
ADVARSEL – EKSPLOSJONSFARE
Bruk bare ladeenheten som kommer med Translux Wave, til å lade batteriet. Prøv aldri å lade batteriet
med en annen ladeenhet eller strømkilde, da det kan medføre fare for eksplosjon og brann.
2x
Sett håndstykket med batteriet inn i Translux Wave-ladeenheten.
2x
Et pip bekrefter at kontaktene er i riktig ladeposisjon!
VIKTIG MERKNAD – Justeringsnøkkel
Justeringsnøkkelen (5), som er plassert på baksiden undersiden av håndstykkehuset,
gjør det mulig å plassere håndstykket riktig i ladeenheten. Når håndstykket settes inn i ladeenheten,
må justeringsnøkkelen være på linje med sporet som er plassert på innsiden av ladeenheten.
Ladeprosessen for batteriet.
• DetgrønneLED-lysetforbatteristatuspåhåndstykketbegynneråblinke.
• Nårladefasenerfullførtogbatterieterfulladet,lyserdetgrønneLED-lysetforbatteristatuspermanent.
VIKTIG MERKNAD – Defekt batteri
Hvis elektronikken i håndstykket oppdager en batteridefekt under ladefasen, avbrytes ladingen
og LED-lyset for batteristatus blinker GULT.
I denne modusen avgis et «pipesignal» hvert sekund i en periode på 30 sekunder.
Skift ut det defekte batteriet med et nytt batteri!
ADVARSEL
Bruk bare Heraeus Kulzer-batterier!
MERK
Når håndstykket er plassert i ladeenheten, er funksjonene deaktivert. Det er ikke mulig å betjene
«Start / stopp»-knappen
.
Håndstykket kan fjernes fra ladeenheten mens ladingen pågår, men batteriet er kanskje ikke fulladet
og driftstiden kan bli forkortet.
6
Drift
ADVARSEL – Kontroller tilstanden til enheten før behandlingsstart.
Kontroller alltid at enheten er i god driftstilstand og at ekstrautstyret (lysleder og beskyttende lyskjegle) virker
som det skal, før hver behandling. Hvis noe uvanlig viser seg under behandlingen, må behandlingen ikke gjennomføres. Kontakt Heraeus Kulzer eller en autorisert lokal kundeservicerepresentant (se avsnitt 14 Service).
Enheten og ekstrautstyret må ikke brukes ved tegn til skade. Kontroller at den avgitte lysstyrken er tilstrekkelig
til å sikre polymeriseringen, før hver bruk av Translux Wave. Kontroller lysstyrken ved å bruke lysmåleren som
er innebygd i ladeenheten (se avsnitt 6.2 Måle lysstyrken).
ADVARSEL – Infeksjonskontroll
Første gangs bruk
NO
Ekstrautstyret, lyslederen og den beskyttende lyskjeglen leveres i IKKE-STERIL tilstand og må steriliseres
før første gangs bruk.
Bruk hver gang
- 13 Nå ekstraustyret, lyslederen og den beskyttende lyskjeglen er brukt, må de behandles i henhold til prosedyrene
beskrevet i kapittel 8 (Rengjøring, desinfisering og sterilisering) før de brukes på nytt.
6.1
Aktivere og deaktivere eksponeringssyklusen
Translux Wave har to forskjellige eksponeringssykluser:
– Eksponering med konstant effekt: syklusvarighet 10 sekunder.
– Eksponering med langsomt økende effekt: «Myk start» (syklusvarighet 20 sekunder).
«Myk start» betyr at lysstyrken økes fra 50 % opp til 100 % innen 2 sekunder.
• Hvishåndstykketeri«Hvilemodus»(alleLED-lyseneforeksponeringssykluserpåhåndstykketerAV),
trykkes «Start / stopp»-knappen
raskt ned for å aktivere håndstykket.
(Etter omstart lyser indikatorlampen i 10 sekunder som standar.)
Eksponering med 10 sekunders polymerisering
Trykk raskt på «Start / stopp»-knappen
. Lysstrålingen slås på.
LED-lyset for 10-sekundersprogrammet lyser og indikerer at dette programmet kjører.
Når eksponeringssyklusen er fullført, slås lyset i enheten automatisk av.
Akustisk signal:
Følgende akustiske signaler (pip) avgis:
Ett pip når «Start / stopp»-knappen trykkes ned.
Ett pip på slutten av eksponeringstiden.
Eksponering med 20 sekunders «Myk start»-polymerisering
Trykk og hold nede «Start / stopp»-knappen
i minst ett sekund. Lysstrålingen slås på.
LED-lyset for 20-sekundersprogrammet lyser og indikerer at dette programmet kjører.
Når eksponeringssyklusen er fullført, slås lyset i enheten automatisk av, og enheten går tilbake til 10-sekundersmodusen (LED-lyset for 10-sekundersprogrammet lyser).
Akustisk signal:
Følgende akustiske signaler (pip) avgis:
Ett pip når «Start / stopp»-knappen trykkes ned.
Ett pip etter 1 sekund indikerer at «Myk start» er aktivert.
Ett pip etter 10 sekunder med eksponeringstid.
Ett pip på slutten av eksponeringstiden.
MERK
Eksponeringssyklusen kan avbrytes når som helst før eksponeringstiden er over,
ved at «Start / stopp»-knappen trykkes ned på nytt.
Akustisk signal:
Et akustisk signal (pip) avgis når «Start / stopp»-knappen trykkes ned for å avbryte eksponeringssyklusen.
NO
- 14 -
6.2
Måle lysstyrken
Ladeenheten til Translux Wave er utstyrt med en innebygd lysmåler (8).
2x
FORSIKTIG
Før hver behandling må lysstyrken alltid kontrolleres ved hjelp av lysmåleren som
er innebygd i Translux Wave-ladeenheten.
• Utenbrukavtrykkplassereslyslederenflattogdirektepåtestområdet(8).
Aktiver enheten ved å trykke på «Start / stopp»-knappen
(uansett hvilken eksponeringstid som er valgt).
Lysstyrkemålingen indikeres umiddelbart av det tofargede LED-lyset (symbolet
) nederst til høyre
i testområdet.
GRØNT LED-lys: Lysstyrken er tilstrekkelig for behandlingen.
GULT LED-lys: Lysstyrken er utilstrekkelig, og pasienten(e) må ikke behandles.
FORSIKTIG
Hvis lysstyrken er utilstrekkelig, vennligst utføres følgende kontroller og målinger:
– Kontroller om lyslederen er satt inn i håndstykket (se avsnitt 5.4 Sette fiberoptikken inn i håndstykket).
– Kontroller lyslederen for kontaminasjon og defekter.
– Rengjør lyslederen for kontaminasjon (se kapittel 8 Rengjøring, desinfisering og sterilisering),
eller skift ut den skadde lyslederen med en ny.
Bruk bare originale Heraeus Kulzer-lysledere!
ADVARSEL
Hvis målingene beskrevet over ikke resulterer i forbedringer, må enheten ikke brukes til behandling.
Slå av enheten (koble ladeenheten fra strømkilden), og påse at uautorisert reaktivering av enheten ikke er
mulig. Kontakt en av Heraeus Kulzers servicepartnere eller teknisk kompetent personell som er autorisert
av Heraeus Kulzer (se kapittel 14 Service).
6.3
Hvilemodus
Håndstykket er utstyrt med «Hvilemodus» for å minimere enhetens energiforbruk.
Når håndstykket ikke er plassert i ladeenheten, slås alle de interne funksjonene automatisk
av («Hvilemodus») hvis det ikke brukes i ca. 5 minutter.
I «Hvilemodus» er LED-lysene for eksponeringssyklusen på håndstykket slått av.
Avslutt «Hvilemodus» ved å trykke på «Start / stopp»-knappen
Håndstykket er klart til bruk.
.
6.4
Tilleggsinformasjon om hvordan enheten fungerer
MERK
Hvis håndstykket plasseres i ladeenheten før herdesyklusen er avsluttet, slås lysstrålingen automatisk av.
Når håndstykket er plassert i ladeenheten, er funksjonene deaktivert. Det er ikke mulig å betjene
«Start / stopp»-knappen
.
Translux Wave har mikro-prosessorer som kontinuerlig kontrollerer batteriets kapasitet. Etter hver behandling
skal håndstykket derfor settes inn i ladeenheten for oppbevaring uavhengig av batterinivået.
7
Alarmtilstander
7.1
Defekt batteri
Hvis batteriet er defekt, blinker LED-lyset for batteristatus på håndstykket kontinuerlig
GUL (Fig. a).
En «pipelyd» avgis hvert sekund i en periode på 30 sekunder.
VIKTIG
Denne feilen oppdages bare når håndstykket er plassert i ladeenheten.
blinker
7.2
Defekt LED-lys
Når mikroprosessoren oppdager en defekt i LED-lyset, begynner det grønne LED-lyset «10s»
for herdemodusen som brukes, å blinke (Fig. b).
blinker
a
b
7.3
Overopphetingsvern
Hvis det forekommer flere herdesykluser i rask rekkefølge (vanligvis etter 18 påfølgende
sykluser, som hver varer 20 sekunder), kan det hende den innebygde sensoren for
temperaturoverbelastning aktiveres.
Når beskyttelse mot overoppheting aktiveres høres «tre pip» ved slutten av eksponeringssyklusen.
Aktiveringen av overopphetingsvernet stanser bruken av enheten i et par minutter.
La håndstykket kjøle seg ned i minst 4 – 5 minutter, og start deretter neste eksponering
ved å trykke på «Start / stopp»-knappen
.
MERK
Håndstykket er automatisk klar til å brukes etter avkjøling. Manuell «Reset» er ikke nødvendig.
7.4
INNEBYGD sensor for temperaturoverbelastning defekt
Ved feil på sensoren for overopphetning høres «4 pip» ved oppstart av eksponering.
MERK
Om det under en eksponering skulle oppstå en feil på sensoren for overopphetning, vil apparatets
programvare tillate at påbegynt eksponeringssyklus fullføres. En ny eksponering vil så ikke
og det vil
være mulig. Det vil ikke være mulig å starte en ny eksponering med «Start / stopp» knappen
høres «4 pip».
Enhver ytterlig bruk av herdelampen under overoppheting blir forhindret.
NO
- 15 -
7.5
Signal om lavt batteri
Når batterinivået faller til minimumsnivå etter hyppig bruk, tillater Translux Wave-mikroprosessoren
et par sykluser til i et hvilket som helst eksponeringssyklusen, uten at batteriet lades på nytt.
Denne tilstanden signaliseres ved slutten av hver syklus med «to pipelyder».
Ikonet for batteriet lyser grønt. Lad batteriet!
Etter et par sykluser tillater ikke det gjenstående batterinivået flere eksponeringssykluser.
Denne tilstanden signaliseres med «to pipelyder».
Ikonet for batteriet lyser grønt. Lad batteriet!
8
Rengjøring, desinfisering og sterilisering
KOBLE FRA STRØMUTTAKET
Før rengjørings- og desinfiseringsprosedyrene utføres, må ladebasen kobles fra strømkilden!
ADVARSEL
Infeksjonskontroll
Lyslederen og den beskyttende lyskjeglen leveres i IKKE-STERIL tilstand og må rengjøres,
desinfiseres og steriliseres (damp) før de brukes første gang samt før hver bruk.
Håndstykket og ladeenheten må ikke steriliseres!
Batteriet må ikke steriliseres!
8.1
Demontering
Fjern den beskyttende lyskjeglen fra lyslederen.
Fjern lyslederen: Roter lyslederen litt, og dra den ut av håndstykket.
8.2
NO
- 16 -
LYSLEDER – Rengjøring og desinfisering
FORSIKTIG
Ikke bruk skarpe eller spisse instrumenter til å rengjøre lyslederen, da disse kan ripe opp lyslederens overflate
og dermed redusere lystransmisjonen.
Ikke bruk rengjørings-/ desinfiseringsmidler som inneholder organiske syrer, mineralsyrer, oksiderende syrer,
hydrogenperoksid, klorid, jod, bromid eller løsemidler.
1) Rett etter bruk må eventuelle rester, som komposittmateriale, fjernes fra overflaten på enden av lyslederen.
Alle polymeriserte kompositter bør fjernes ved bruk av etanol og en plastspatel eller en myk nylonbørste.
2) Desinfiser lyslederen med en ren, myk og lofri klut fuktet med en mild desinfiserende løsning med en mild pH-verdi
(pH 7), i henhold til produsentens spesifikasjoner. La den desinfiserende løsningen tørke.
8.2.1 LYSLEDER – Kontroll før sterilisering
Før steriliseringsprosessen igangsettes må lyslederen kontrolleres nøye for skadde overflater,
misfarging og kontaminasjon.
ADVARSEL
Ikke bruk en skadet lysleder. Ved tegn til skade skiftes lyslederen ut med en ny.
Hvis lyslederen fortsatt er kontaminert, gjentas rengjørings- og desinfiseringsprosedyren.
8.3
BESKYTTENDE LYSKJEGLE – Rengjøring og desinfisering
FORSIKTIG
Ikke bruk rengjørings-/ desinfiseringsmidler som inneholder organiske syrer, mineralsyrer, oksiderende syrer,
hydrogenperoksid, klorid, jod, bromid eller løsemidler.
Rengjør og desinfiser den beskyttende lyskjeglen med en myk klut fuktet med en mild desinfiseringsløsning med
en mild pH-verdi (pH 7), i henhold til produsentens spesifikasjoner. La den desinfiserende løsningen tørke.
8.3.1 BESKYTTENDE LYSKJEGLE – Kontroll før sterilisering
Før steriliseringsprosessen igangsettes, må den beskyttende lyskjeglen kontrolleres nøye for skadde overflater,
misfarging og kontaminasjon.
ADVARSEL
Ikke bruk en beskyttende lyskjegle som er skadet. Ved tegn til skade skiftes den beskyttende lyskjeglen
ut med en ny.
En beskyttende lyskjegle som er skadet, kan ikke gi tilstrekkelig beskyttelse mot lyset fra enheten.
Hvis den beskyttende lyskjeglen fortsatt er kontaminert, gjentas rengjøringen og desinfiseringen.
8.4
LYSLEDER og BESKYTTENDE LYSKJEGLE – Emballering før sterilisering
Lyslederen og den beskyttende lyskjeglen kan steriliseres ved å bruke en medisinsk engangspose til dampsterilisering
i riktig størrelse.
FORSIKTIG
Lyslederen og den beskyttende lyskjeglen må pakkes enkeltvis i atskilte poser.
Ved sterilisering av flere instrumenter i én autoklav må autoklavens maksimumsbelastning ikke overskrides.
ADVARSEL
Påse at innerposen er stor nok til å romme de enkelte instrumentene, uten at forseglingene belastes eller
emballasjen rives.
8.4.1 LYSLEDER og BESKYTTENDE LYSKJEGLE – Sterilisering
8.4.1.1 Steriliseringsmetode
• Utførsteriliseringenvedhjelpavendampautoklavmedforvakuum.
FORSIKTIG
Bruk aldri andre steriliseringsmetoder, da de kan være uforenlige med materialene som lyslederen er laget av.
IKKE BRUK følgende steriliseringsmetoder: etylenoksidsterilisering, varmluftsterilisering, hurtigautoklavering,
STERRAD-sterilisering, STERIS-system eller tilsvarende steriliseringssystemer.
IKKE steriliser lyslederen og den beskyttende lyskjeglen ved å bruke: sterilisering med hydrogenperoksid,
pereddiksyresystem, formaldehyd eller glutaraldehyd.
8.4.1.2 Steriliseringsparametere
• Minimum steriliseringsparametere som gir et garantert steriliseringsnivå (SAL) på 10 –6.
Syklustype
Forvakuum
Minimumstemperatur
132°C + 3°C
(270°F + 5°F)
Minimum eksponeringstid (pose)
4 minutter
Minimum tørketid
20 minutter
NO
FORSIKTIG
Ikke overskrid 135°C (275°F).
8.5
HÅNDSTYKKE – Rengjøring og desinfisering
ADVARSEL
Håndstykket er ikke beskyttet mot inntrenging av væske.
Ikke spray væske direkte på håndstykkets overflate og ladekontakter.
Rengjørings- og desinfiseringsmidler må ikke trenge inn i håndstykket!
Håndstykket må ALDRI senkes ned i væske.
Håndstykket må ALDRI rengjøres under rennende vann.
Håndstykket må ikke steriliseres. Fare for alvorlig skade, elektrisk støt og brann!
- 17 -
2x
Rengjør og tørk håndstykkehuset med en ren, myk og lofri klut fuktet med et mildt desinfiseringsmiddel for
overflater med en nøytral pH-verdi (pH 7), i henhold til produsentens spesifikasjoner.
La desinfiseringsløsningen tørke, eller tørk restene etter desinfiseringsløsningen på håndstykkehuset med en myk
og lofri klut.
FORSIKTIG
Ikke bruk løsemidler som aceton, isopropylalkohol, hydrogenperoksid, klorid, jod, bromid, fenol eller andre
sterke løsninger for å rengjøre og desinfisere håndstykkets plastoverflate. Disse stoffene kan være skadelige,
forårsake misfarging og / eller skade plastmaterialene.
Ikke bruk slipende rengjøringsmidler!
VIKTIG: Rengjøre ladekontaktene på håndstykket
Når rengjøringen / desinfiseringen av håndstykkets plasthus er fullført, må ladekontaktene som er plassert
på undersiden av håndstykket, alltid rengjøres. Ladekontaktene på håndstykket må alltid være fri for smuss-,
kompositt- og rengjørings-/ desinfiseringsmiddelrester.
VIKTIG
Ladekontaktene på håndstykket må rengjøres jevnlig (minst én gang i uken) og alltid etter at håndstykkets
plasthus er rengjort og desinfisert. Tilsmussede ladekontakter eller kontakter eksponert for væske, som
rengjøringsmidler eller desinfiseringsmidler, kan påvirke ladeprosessen negativt og hindre at batteriet lades.
Rengjør ladekontaktene på håndstykket med en lofri klut eller bomullspinne fuktet med alkohol.
FORSIKTIG
Ikke bruk skarpe eller spisse instrumenter til å rengjøre kontaktene på håndstykket, da de kan ripe opp
og skade overflaten og dermed forringe ladekontaktenes ledeevne.
Før håndstykket brukes på nytt, må håndstykkets overflate og ladekontakter være helt tørre.
Om nødvendig, kan kontakten tørkes ved å blåse luft på dem med komprimert luft.
8.6
NO
- 18 -
LADEENHET – Rengjøre hus
KOBLE FRA STRØMUTTAKET
Koble strømforsyningsenheten fra strømuttaket og ladeenheten før rengjøring / desinfisering.
ADVARSEL
Ladeenhetshuset er ikke beskyttet mot inntrenging av væske.
Ikke spray væske direkte på overflaten til ladeenhetshuset.
FORSIKTIG
Ladeenheten må IKKE steriliseres. Det vil føre til at den ikke lenger fungerer og kan utgjøre en fare for
alvorlig skade, elektrisk støt og brann!
Ikke bruk løsemidler som aceton, isopropylalkohol, hydrogenperoksid, klorid, jod, bromid, fenol eller andre
sterke løsninger for å rengjøre plastoverflaten på ladeenheten. Disse stoffene kan være skadelige og forårsake
misfarging og / eller skade på plastmaterialene.
Ikke bruk slipende rengjøringsmidler!
Rengjør og tørk ladeenheten med en ren, myk og lofri klut fuktet med et mildt rengjøringsmiddel for overflater med
en nøytral pH-verdi (pH 7), i henhold til produsentens spesifikasjoner.
Tørk ladeenhetshuset med en ren, ikke-slipende klut.
FORSIKTIG
Sørg for å tørke ladeenheten etter rengjøring. Fukt inne i enheten kan forårsake skade.
VIKTIG
Påse at ladekontaktene inne i ladeenheten er helt tørre ved fullføring av rengjøringsprosedyren.
Om nødvendig, kan kontakten tørkes ved å blåse luft på dem med komprimert luft.
8.6.1
LADEENHET – Rengjøre ladekontakter
2x
VIKTIG
Når rengjøringen / desinfiseringen av ladeenhetens plasthus er fullført, må kontaktene
på ladeenheten alltid rengjøres. Ladekontaktene på ladeenheten må alltid være fri for smuss-,
kompositt- og rengjørings-/desinfiseringsmiddelrester.
Kontaktene på ladeenheten må rengjøres jevnlig (minst én gang i uken) og alltid etter at håndstykkets plasthus
er rengjort/desinfisert. Tilsmussede kontakter eller kontakter eksponert for væske, som rengjøringsmidler eller
desinfiseringsmidler, kan påvirke ladeprosessen negativt og hindre at batteriet lades.
Rengjør kontaktene på ladeenheten med en myk og lofri klut eller bomullspinne fuktet med alkohol.
FORSIKTIG
Ikke bruk spisse eller skarpe gjenstander til å rengjøre kontaktene på ladeenheten!
Ikke spray eller dynk kontaktene med væske!
Ikke bøy eller endre formen på kontaktene på ladeenheten under rengjøring.
Påse at ladekontaktene er tørre etter rengjøring og ikke er i kontakt med metalliske eller fettede deler.
Om nødvendig, kan kontakten tørkes ved å blåse luft på dem med komprimert luft.
8.6.2 LADEENHET – Utskiftbare ladekontakter
Skadde eller svært tilsmussede ladeenhetskontakter (som ikke kan rengjøres ved å følge prosedyrene beskrevet
i avsnittet over) kan forhindre kontaktenes ledeevne og følgelig ladingen av batteriet.
I dette tilfellet er det mulig å skifte ut de skadde kontaktene på ladeenheten med nye.
Hvis du vil ha mer informasjon om utskifting av kontakter på ladeenhet og levering av reservedeler,
kan du kontakte din lokale Heraeus Kulzer-avdeling.
Arbeidsinstruksjoner:
Nødvendig verktøy: skrutrekker til Phillips-skruer, medium størrelse.
1. Ta håndstykket ut av ladebasen.
2. Koble laderen fra strømuttaket.
3. Koble ledningen fra laderen.
4. Snu laderen opp-ned.
5. Fjern to skruer fra ladekontaktbroen (se den utbrettbare baksiden, punkt 12).
6. Dra ut ladekontaktbroen.
7. Sett inn ny bro, og fest / koble til i omvendt rekkefølge.
FORSIKTIG
Ikke bøy eller kontaminer den nye kontaktbroen!
Påse at broen settes inn og festes på en skikkelig måte! Ikke stram skruene for hardt!
9
2x
Oppbevaring
Oppbevaring av håndstykket med batteri i lengre perioder der det ikke er i bruk: Før eller etter en lang periode
med inaktivitet må batteriet fullades eller oppbevares i den virksomme ladeenheten. Selv om batteriets innebygde
sikkerhetskrets forhindrer at batteriet tømmes helt, er det sterkt tilrådelig å fullade batteriet minst én gang hver
5 måneder etter inaktivitet.
10
Avhending
MERK – VIKTIG
Enheten må ikke kastes sammen med vanlig husholdningsavfall.
Når det gjelder avhending av enheten eller reservedeler, kontaktes den lokale eller nasjonale Heraeus Kulzeravdelingen.
Ubrukelige batterier og lysledere avhendes i henhold til gjeldende nasjonale bestemmelser.
ADVARSEL – Avhending av skadde eller tomme batterier
Et skadet eller tomt batteri avhendes etter at de nødvendige tiltakene for å hindre ekstern kortslutning
er utført:
Etter at batteripolene er dekket til med tape avhendes batteriet i henhold til lokale forskrifter.
Vilkårene og sikkerhetstiltakene for avhending av enheten er underlagt gyldige lovbestemmelser i likhet med
alle andre elektroniske enheter som ikke kan brukes lenger.
Deponering av gammelt utstyr i henhold til WEEE (EU-direktiv) eller
Elektrisk og elektronisk utstyr Act (tysk lov ElektroG).
NO
- 19 -
11
Feilsøking
ADVARSEL
Hvis trinnene nedenfor ikke løser problemet, kontaktes Heraeus Kulzer eller en autorisert lokal kundeservicerepresentant: IKKE BRUK Translux Wave og IKKE PRØV å utføre service på enheten, da det kan forårsake
alvorlig skade.
Hvis enheten ikke ser ut til å fungere skikkelig, leser du denne bruksanvisningen på nytt og kontrollerer deretter
følgende tabell:
PROBLEM
Ladeenheten slås ikke på.
på ladeDet GRØNNE LED-lyset
enheten er av.
MULIG ÅRSAK
Strømforsyningsenheten er ikke koblet
til strømuttaket og / eller til kontakten
på ladeenheten.
Det overføres ingen spenning fra
strømuttaket.
Den utskiftbare adapteren er ikke satt
ordentlig inn i strømforsyningsenheten.
Strømkabelen for strømforsyningsenheten er skadet.
Strømforsyningsenheten er defekt.
Ladeenheten er defekt.
Kontaktene på ladeenheten har
kortsluttet.
Håndstykke IKKE satt inn
i ladeenheten.
Lysstrålingen starter ikke når
«Start / stopp»-knappen
trykkes ned, og ingen informasjon
vises på displayet på håndstykket.
Håndstykke uten batteri.
Håndstykke i «Hvilemodus».
Tomt batteri.
Batterinivået er ikke høyt nok til at
håndstykket kan slås på.
Elektronikkfeil.
Defekt batteri.
NO
- 20 -
«To pipelyder» avgis på slutten av
eksponeringssyklusen.
Lavt batterinivå.
LØSNING
Kontroller at strømforsyningsenheten er
godt festet til strømuttaket og kontakten
på ladeenheten.
Bruk et annet strømuttak.
Les avsnitt 5.2 i denne brukeranvisningen nøye.
Skift ut strømforsyningsenheten med
en ny. (Strømforsyningsenheten og
tilhørende kabel kan ikke skilles fra
hverandre.)
Skift ut strømforsyningsenheten med
en ny.
Kontakt Heraeus Kulzer eller en autorisert lokal kundeservicerepresentant.
Eliminer årsaken til kortslutningen.
Hvis kortslutningen vedvarer, skiftes
kontaktene på ladeenheten ut med nye.
Se avsnitt 8.6.2.
Sett batteriet inn i håndstykket
(se avsnitt 5.3).
Trykk ned «Start / stopp»-knappen for
å få håndstykket ut av «Hvilemodus».
Se avsnitt 6.3.
Plasser håndstykket i ladeenheten,
og lad batteriet på nytt (se avsnitt 5.5).
Kontakt Heraeus Kulzer eller en autorisert lokal kundeservicerepresentant.
Kontroller om batteriet er defekt ved
å plassere håndstykket i ladeenheten.
En «Pre-kvalifiseringssekvens» starter,
hvorav Translux Wave mikro-prosessor
kontrollerer batteriets status.
Denne sekvensen kan vare i maksimalt
30 minutter.
Hvis det i løpet av denne sekvensen
høres et «pip»-signal hvert sekund i
30 sekunder, samtidig som batteriets
ikon på håndstykket blinker GULT, er det
en indikasjon på at batteriet er defekt.
Skift ut batteriet med et nytt
(se avsnitt 5.3).
De «to pipelydene» signaliserer at det
resterende batterinivået bare rekker til
et par påfølgende eksponeringssykluser.
Plasser håndstykket i ladeenheten,
og lad batteriet på nytt (se avsnitt 5.5).
PROBLEM
Lampen starter ikke når «Start /
stopp»-knappen
trykkes inn
eller om eksponeringssyklus lys blir
avbrutt med en pipelyd. Herding
LED «10s» på håndstykket begynner
å blinke GRØNT.
MULIG ÅRSAK
LED enheten kan være defect.
blinker
Overopphetingsvern.
Håndstykket er blitt overopphetet under
bruk, og sensoren for temperaturoverbelastning er aktivert.
Aktiveringen av overopphetingsvernet
hindrer bruk av enheten midlertidig
(i et par minutter).
«Tre pipelyder» avgis under en ekspo- Overopphetingsvern.
neringssyklus.
Håndstykket er blitt overopphetet under
bruk, og sensoren for temperaturoverbelastning er aktivert.
Aktiveringen av overopphetingsvernet
hindrer bruk av enheten midlertidig
(i et par minutter).
Feil i ladefasen.
Under batteriets prekvalifiseringsfase
(batteritilstand: helt tomt, se avsnitt 4.2.4
Et «pipelyd» høres hvert sekund i en
periode på 30 sekunder og batteriets og 5.5).
indikatorlampe på håndstykket lyser
Elektronikken oppdager en defekt eller
GULT.
funksjonsfeil i batteriet og avbryter
ladeprosessen.
Etter flere eksponeringssykluser etter
hverandre slås ikke lysstrålingen
på når «Start / stopp»-knappen
trykkes ned, og «tre pipelyder»
avgis.
blinker
Håndstykket er plassert i ladeenheten, men ladingen starter ikke.
Den grønt LED-lyset for batteristatus
på håndstykket er av.
LØSNING
Kontroller LED enhetens funksjonalitet
ved hjelp av følgende prosedyre:
Sett håndstykket i laderen og trykk
på «Start / stopp»-fem ganger i rask
rekkefølge.
Fjern håndstykket fra laderen.
Om Herdings LED «10s» på håndstykket
slutter å blinke GRØNT, har håndstykket
blitt tilbakestilt.
Hvis herdings LED «10s» på håndstykket blinker igjen ved start av neste
eksponering syklus og ingen lys
utslipp starter, er LED-lampen defekt.
I dette tilfellet kan du kontakte
Heraeus Kulzer eller en lokal autoriserte
kundeservice agent.
La håndstykket kjøle seg ned i minst
4 – 5 minutter, og start deretter neste
eksponering ved å trykke på «Start /
stopp»-knappen.
Merk: Håndstykket er automatisk klar
til å brukes etter avkjøling. Manuell
«Reset» er ikke nødvendig.
La håndstykket kjøle seg ned i minst
4 – 5 minutter, og start deretter neste
eksponering ved å trykke på «Start /
Stopp»-knappen.
Skift ut batteriet med et nytt
(se avsnitt 5.3).
2x
NO
Feil: Ingen kontakt med laderen.
Feil kontakt mellom ladebasen og
håndstykket.
Kontaktene på ladeenheten og / eller
håndstykket er tilsmusset.
Lysstyrken som måles med lysmåleren Lyslederen er ikke satt ordentlig inn
innebygd i ladeenheten, er ikke
i håndstykket.
tilstrekkelig.
Lyslederen er kontaminert av fremmed
materiale eller komposittrester som kan
LED-lyset
på ladeenheten
forstyrre lyseffekten.
er GULT.
Lyslederen er skadet eller gammel.
Se avsnitt 8.5 og 8.6.2.
Kontroller om håndstykket er satt inn
i riktig retning i ladeenheten.
Justeringsnøkkel.
Se avsnitt 4.2.1, punkt 4 og 5.
Rengjør kontaktene på håndstykket og
ladeenheten. Se avsnitt 8.5 og 8.6.1.
Kontroller om lyslederen er satt helt inn
i metallkjeglen på håndstykket.
Rengjør lyslederen. Se avsnitt 8.2.
Skift ut lyslederen med en ny.
- 21 -
12
Tekniske spesifikasjoner
Klassifisering i henhold til direktiv 93/42/EF:
Sikkerhetsstandarder:
Klassifisering i henhold til IEC 60601-1:
Ladeenhet:
Strømforsyning for ladeenheten:
Strømforsyning for håndstykket:
Håndstykke:
Lyskilde:
Lysleder:
NO
Eksponeringssykluser som kan angis:
– «Normal» eksponering
- 22 – «Myk start»-eksponering
Ladetid for tomt batteri:
Miljøbetingelser for enheten:
Klasse I (én)
Produktet er testet I overensstemmelse med IEC 60601-1
(2. utg.) og IEC 60601-1-1.
Produktet er testet I overensstemmelse med IEC 60601-1
(3. utg.) og IEC 60601-1-2 (3. utg. som omhandler elektromagnetisk
kompabilitet – EMC).
Håndenheten er beregnet til bruk, etter de foreskrevne anvisninger,
I forbindelse med pasientbehandlinger.
Merk: Pasientomgivelser er definert til et område på 1,5 m fra
pasienten (se IEC 60601-1, 3. utg. og IEC 60601-1-1).
Klasse II, Type B, Tilbehør: Lyslederstav med beskyttelses-anordning.
IP 20 (ladeenhet).
IP 20 (Translux Wave)
Translux Wave-ladeenhet
Strømadapter fremstilt av:
Phihong Technology CO LTD – Modell: PSACO5R-050.
Input: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Output: 5 V
– 1 A Max –
.
Klasse II Apparat
Oppladbart litiumionbatteri.
Produsent: Panasonic. Modell: NCR-18500.
Nominell spenning: 3,6 V.
Nominell kapasitet (Typisk): 2000 mAh
Modell: Translux Wave.
Drift: Andvendelse: 120“ ON – 40“ OFF – Max 2 ganger eksponering
LED med høy lysstyrke.
LED-produkt i klasse 2M (IEC 60825-1).
Bølgelengdeområde: 440 – 480 nm.
Dominerende bølgelengde: Min. 440 nm – Max. 465 nm
Blyfri multikjernestav, 8 mm diameter.
Steriliserbar i dampautoklav med forvakuum:
4 minutter (minimum) ved minimumstemperatur på 132°C + 3°C
(270°F + 5°F). Maks. 500 sykluser
10 sekunders eksponeringstid.
Akustiske signaler:
Ett pip på begynnelsen av eksponeringen.
Ett pip på slutten av eksponeringen
20 sekunders eksponeringstid. («Myk start» betyr at lysstyrken økes
fra 50 % opp til 100 % innen 2 sekunder.)
Akustiske signaler:
Ett pip på begynnelsen av eksponeringen.
Ett pip etter 1 sekund indikerer at «Myk start» er aktivert.
Ett pip etter 10 sekunder med eksponering.
Ett pip på slutten av eksponeringen
ca. 3 timer
Drift
Temperatur
Relativ fuktighet
Lufttrykk
10°C – 35°C
(50°F – 95°F)
45 % – 85 %
800 – 1060 hPa
Transport
og oppbevaring
–20°C – 40°C
(–4°F – 104°F)
45 % – 85 %
500 – 1060 hPa
Ladeenhet: vekt 450 g.
Dimensjoner: 140 (L) x 58 (B) x 62 (H) mm
Håndstykke: vekt 150 g (inkl. lysleder).
Dimensjoner: 275 mm (L), maks. Ø 24 mm
Vekt og dimensjoner:
12.1
Elektromagnetisk kompatibilitet EN 60601-1-2
ADVARSEL
Apparatet trenger spesielle EMC-tiltak som må være installert og aktivert iht. henvisninger i dette avsnittet.
Bærbare og mobile radiokommunikasjonsapparater kan påvirke enhetens funksjonsevne.
Veiledning og erklæring fra produsenten – elektromagnetisk emisjon
Translux Wave er ment å brukes i det elektromagnetiske miljøet angitt nedenfor.
Kunden eller brukeren av Translux Wave bør påse at den brukes i et slikt miljø.
Utslippskontroll
Samsvar
Elektromagnetiske omgivelser – veiledning
HF-utslipp CISPR 11
Gruppe 1
Translux Wave bruker bare RF-energi til enhetens interne funksjoner. Dermed er RF-strålingen svært lav og vil lite trolig forstyrre
elektronisk utstyr i nærheten.
HF Emissionen CISPR 11
Klasse B
Translux Wave er egnet for bruk i alle bygninger inkludert bolighus
og bygninger som er direkte forbundet med det offentlige strømHarmoniserte utslipp
Klasse A
nettet med lavspenning, som forsyner bygninger for privat bruk.
IEC 61000-3-2
Spenningsvariasjons utslipp / flimmer I overensIEC 61000-3-3
stemmelse
Veiledning og erklæring fra produsenten – elektromagnetisk immunitet
Translux Wave er ment å brukes i det elektromagnetiske miljøet angitt nedenfor.
Kunden eller brukeren av Translux Wave bør påse at den brukes i et slikt miljø.
Immunitetskontroll
Testverdi IEC 60601
Samsvarsverdi
Elektromagnetiske omgivelser –
veiledning
Gulvene må bestå av tre, betong
eller keramikk. Hvis gulvene er
belagt med syntetisk materiale,
skal den relative fuktigheten være
minst 30%.
Kvaliteten på nettspenningen må
være den samme som i typiske forretnings- eller sykehusomgivelser.
Elektrostatisk utladning ±6 kV ved kontakt
(ESD) IEC 61000-4-2
±8 kV i luften
Apparatet virker fortsatt
forskriftsmessig og sikkert.
Raske, transiente
forstyrrelsesende
størrelser / bursts iht.
IEC 61000-4-4
±2 kV for strømtilførselsledninger
±1 kV for inngangs-/ utgangsledninger
±1 kV differansespenning
±2 kV fellsmodusspenning
Apparatet virker fortsatt
forskriftsmessig og sikkert.
Apparatet virker fortsatt
forskriftsmessig og sikkert.
Kvaliteten på nettspenningen må
være den samme som i typiske forretnings- eller sykehusomgivelser.
< 5% UT (> 95% fall UT)
for 0,5 sykluser
40% UT (60% fall UT)
for 5 sykluser
70% UT (30% fall UT)
for 25 sykluser
< 5% UT (> 95% fall UT)
innen 5 sek
3A/m
Enheten kan uregelmessig
effekt under drift så lenge
den fungerer på en sikker
måte, ingen feil oppstår, og
brukeren kan tilbakestille
den til driftstilstanden før
testen.
Kvaliteten på nettspenningen må
være den samme som i typiske forretnings- eller sykehusomgivelser.
Apparatet virker fortsatt
forskriftsmessig og sikkert.
Nettfrekvens-magnetfeltene må
ha det karakteristiske nivået til et
typisk lokale i forretnings- eller
sykehusomgivelser.
Impulser
IEC 61000-4-5
Spenningslommer,
korte spenningsavbrudd og – endringer
på strømforsyningsledningene
IEC 61000-4-11
Magnetfelt ved nettfrekvens (50 / 60 Hz)
IEC 61000-4-8
MERKNAD: UT er nettspenningen i vekselstrøm før bruk av testverdien.
NO
- 23 -
Veiledning og erklæring fra produsenten – elektromagnetisk immunitet
Translux Wave er ment å brukes i det elektromagnetiske miljøet angitt nedenfor.
Kunden eller brukeren av Translux Wave bør påse at den brukes i et slikt miljø.
ImmunitetsTestverdi
Samsvarsverdi Elektromagnetiske omgivelser – veiledning
kontroll
IEC 60601
Ledet høy3 Veff fra
Apparatet
De bærbare høyfrekvens-mobiltelefonene må ikke brukes i nærheten
frekvens
150 kHz til
virker fortsatt
av produktet eller i nærheten av produktets deler inkludert ledningene
IEC 61000-4-6 80 MHz
forskriftsmes- hvis ikke de anbefalte separasjonsdistansene som beregnes med
sig og sikkert. ligningen som er anvendbar for frekvensen til senderen, overholdes.
Strålt høy3 V / m fra
Anbefalte separasjonsdistanser
frekvens
80 MHz til
d = 1,2 √P
IEC 61000-4-3 2,5 GHz
d = 1,2 √P fra 80 MHz til 800 MHz
d = 2,3 √P fra 800 MHz til 2,5 GHz
der (P) er den maksimale utgangskapasiteten til senderen i watt (W)
i henhold til senderprodusenten og (d) er den anbefalte separasjonsdistansen i meter (m). Feltstyrken til den fastmonterte høyfrekvenssenderen, slik den bestemmes i en elektromagnetisk undersøkelse
av stedet til, må være lavere enn samsvarstilstanden i hvert
frekvensintervall (b). Interferens kan oppstå i nærheten av
utstyr som er merket med følgende symbol:
Merknader:
(1) Høyere frekvensområde gjelder ved 80 MHz og 800 MHz.
(2) Det er mulig at disse retningslinjene ikke gjelder i alle situasjoner. Elektromagnetisk forplantning påvirkes av absorpsjon
og refleksjon fra strukturer, gjenstander og mennesker.
a) Disse retningslinjene er ikke nødvendigvis anvendbare i alle tilfeller. Spredningen av elektromagnetiske størrelser
påvirkes av bygningers, gjenstanders og mennesker absorpsjon og refleksjon. Feltstyrken til stasjonære sendere som
f.eks. basestasjoner for radiotelefoner og mobile radioer, amatørradiostasjoner, AM- og FM- radio- og fjernsynsstasjoner kan ikke forhåndsbestemmes nøyaktig teoretisk. For å fastslå de elektromagnetiske omgivelsene med hensyn til
de stasjonære senderne bør en studie av lokaliseringen overveies. Hvis den målte feltstyrken overskrider ovennevnte
samsvarsverdier på stedet der produktet brukes, skal produktet overvåkes for å dokumentere forskriftsmessig funksjon.
Hvis det konstateres uvanlige egenskaper, kan det være nødvendig å iverksette tiltak som f.eks. å justere plasseringen
av eller plassere produktet et annet sted.
b) I frekvensområdet fra 150 kHz til 80 MHz bør feltstyrken være under 3 V / m.
NO
- 24 -
Anbefalte distanser mellom bærbart radioutstyr og mobiltelefoner og Translux Wave
Translux Wave er konstruert for å brukes i elektromagnetiske omgivelser der forstyrrelser i form av høyfrekvent stråling,
holdes under kontroll. Kunden eller brukeren av Translux Wave kan forebygge elektromagnetisk interferens ved å overholde
en minsteavstand mellom det bærebare radiofrekvens-radioutstyret og mobiltelefonene (sender) og Translux Wave
i henhold til anbefalingene som er oppført under i samsvar med kommunikasjonsapparatenes maksimale utgangseffekt.
Senderens maksimale nomi- Sikkerhetsavstand avhengig av sendefrekvens (m)
nelle utgangseffekt (W)
fra 150 kHz til 80 MHz
fra 80 MHz til 800 MHz
fra 800 MHz til 2,5 GHz
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
For sendere med annen nominell utgangseffekt enn de som er oppført over kan den anbefalte distansen (d) i meter (m)
beregnes med ligningen som skal brukes for senderens frekvens, der (P) er senderens maksimale nominelle utgangseffekt
i watt (W) i henhold til produsenten av senderen.
Merknader:
(1) Det høyeste frekvensintervallet brukes ved 80 MHz og 800 MHz.
(2) Det er mulig at disse retningslinjene ikke skal anvendes i alle situasjoner. Den elektromagnetiske spredningen påvirkes
av absorpsjon og refleksjon av strukturer, gjenstander og personer.
12.2
Ladeenhetens identifikasjonsplate
Beskrivelse av symbolene på identifikasjonsplaten
1 CE-merke.
2 Forsiktig, sjekk medfølgende dokumenter.
3 Se bruksanvisninger.
4 Dobbel isolasjon (enhet i samsvar med sikkerhetsklasse II).
5 Avhending av gammelt elektrisk og elektronisk utstyr.
(Gjelder i Den europeiske union og i andre europeiske land
med egne innsamlingssystemer.)
6 MET-merke.
12.3
Håndstykkets serienummer
Håndstykkets serienummer er gravert inn
i bunnen på huset.
Inngravert
serienummer.
13
1
2
3
4
5
6
Garanti
Hvert Heraeus Kulzer-apparat gjennomgår en streng test og sluttkontroll før det sendes ut. Dette for å sikre feilfri drift.
Heraeus Kulzer gir 2 (to) års garanti fra kjøpsdato for material- og produksjonsfeil på alle Heraeus Kulzer-produkter
som er kjøpt nye hos en Heraeus Kulzer-forhandler eller -importør. I garantitiden forplikter Heraeus Kulzer seg til
å reparere, etter egen vurdering, mangelfulle deler av produktet kostnadsfritt (eller kan fritt velge å bytte disse ut).
Det er ikke meningen at hele Heraeus Kulzer-produktet byttes ut.
I følgende tilfeller er Heraeus Kulzer ikke under noen omstendigheter verken direkte eller indirekte ansvarlig
for person- og / eller materialskader:
• Apparatetbleikkebrukttildetsomerdefinertsombruksformål.
• Apparatetbleikkebruktisamsvarmedanvisningeneogforskrifteneidennehåndboken.
• Elektroinstallasjoneneirommenederapparatetbrukesstemmerikkeoverensmedgjeldendeloverogaktuelle
forskrifter.
• Sammensetning,tilføyelser,innstillinger,endringerellerreparasjonerbleikkeutførtavfagpersonellfra
Heraeus Kulzer.
• Omgivelsesbetingelseneforoppbevaringoglagringstemmerikkeoverensmedforskrifteneunderkapittel12
(Tekniske spesifikasjoner).
Garantien omfatter heller ikke transportskader, skader som skyldes ufagmessig bruk eller uaktsomhet, skader som
skyldes tilkobling til feil nettspenning, samt kontrollindikatorer, taster og alt tilbehør. Garantien bortfaller hvis apparatet
endres eller repareres av andre enn vår kundeservice. Når garantikravet gjøres gjeldende, må kunden for egen regning
sende det skadede apparatet til forhandleren eller Heraeus Kulzer-importøren der apparatet ble kjøpt. Apparatet,
inkludert tilbehør må sendes i egnet emballasje (helst i originalemballasjen).
Et kort med følgende informasjon må legges ved enheten hvis den returneres:
a) Eierens navn, adresse og telefonnummer.
b) Forhandlerens / importørens navn og adresse.
c) Kopi av eierens følgeseddel / kjøpskvittering for apparatet der dato, apparatbetegnelse og serienummer er angitt.
d) Beskrivelse av driftsfeil.
Heraeus Kulzer er ikke ansvarlig for transport eller eventuelle transportskader.
Ved skader som skyldes ulykker eller ufagmessig bruk eller som har opptrådt etter at garantitiden har utløpt,
beregnes reparasjonskostnadene etter effektivt material- og arbeidstidforbruk.
NO
- 25 -
14
Service
14.1
Servicepartnere / samtalepartnere i de forskjellige land
15
Dokumentasjonshistorikk
1x
2012-08 Utkastversjon for prototyper.
2013-09 Første utgave.
2014-03 Redaksjonelle endringer kapittel 2.1, 3.2.1, 7.2, 10, 11, 12 og 12.2.
NO
- 26 -
Gjenstand for endringer.
Redaksjonen avsluttet: 2014-03
Sisällysluettelo
1
1.1
1.2
1.3
Käyttö ___________________________________________________________________________
Yleistä ________________________________________________________________________
EY-vaatimustenmukaisuusvahvistus __________________________________________________
Valmistajan vakuutus ______________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Laitteen turvallista käyttöä koskevat ohjeet _____________________________________________
Symbolien ja niihin liittyvien sanojen selitys _____________________________________________
Kuljetusvaurio – pakkauksen purkaminen ja tarkistus _____________________________________
Omistajan velvollisuudet ___________________________________________________________
Laitepäiväkirja __________________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Käyttötarkoitus ___________________________________________________________________
Laitteen kuvaus _________________________________________________________________
Turvallisuusvaatimukset ___________________________________________________________
Laitteen käyttöä koskevat yleiset turvallisuusohjeet _______________________________________
Turvallisuusvarotoimet ____________________________________________________________
AKKU – turvallisuusvarotoimet ______________________________________________________
AKKU – tietoja __________________________________________________________________
VASTUUVELVOLLISUUS ____________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Laitteen kuvaus ___________________________________________________________________ 8
Toimituksen sisältö ______________________________________________________________
8
Säätö- ja käyttöelementtien kuvaus __________________________________________________
8
Käsikappale ___________________________________________________________________
8
Kohdistusmerkki ________________________________________________________________
8
Latauslaite _____________________________________________________________________
8
Äänimerkit käsikappale ____________________________________________________________
9
Tietoa LED-valon lähettämästä säteilystä ______________________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Asennus ja käyttöönotto ____________________________________________________________
Turvallisuusvaatimukset asennuksen aikana ____________________________________________
Latauslaitteen yhdistäminen verkkovirtapistorasiaan ______________________________________
Akun asentaminen käsikappaleeseen _________________________________________________
Kuituoptiikan asentaminen käsikappaleeseen ___________________________________________
Akun lataaminen ________________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Käyttö __________________________________________________________________________
Valotussyklin aktivointi ja inaktivointi _________________________________________________
Valotehon mittaaminen ____________________________________________________________
Lepotilaan _____________________________________________________________________
Lisätietoja laitteen toiminnoista ______________________________________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Hälytysolosuhteet _________________________________________________________________
Viallinen akku __________________________________________________________________
Viallinen LED-valo _______________________________________________________________
Ylikuumenemissuojaus ___________________________________________________________
Viallinen SISÄÄNRAKENNETTU lämpötilan ylikuormitusanturi ________________________________
Akku vähissä -merkkiääni _________________________________________________________
15
15
15
15
15
16
HUOMIO
Kirja-kuvakkeen avulla löydät lukuun liittyvät kuvat
tai lisätietoja avattavasta kannesta.
1x /2x
Avaa
etukansi
HKG-Layout 99000943_01 GBA
Avaa
takakansi
11FI
Translux Wave EU
Dateiname: 11FI_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
FI
-1-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Puhdistus, desinfiointi ja sterilointi ____________________________________________________
Purkaminen ____________________________________________________________________
VALONJOHDIN – puhdistus ja desinfiointi ______________________________________________
VALONJOHDIN – Tarkistus ennen sterilointia ____________________________________________
SUOJAKARTIO – Puhdistus ja desinfiointi ______________________________________________
SUOJAKARTIO – Tarkistus ennen sterilointia ____________________________________________
VALONJOHDIN ja SUOJAKARTIO – Pakkaaminen ennen sterilointia ____________________________
VALONJOHDIN ja SUOJAKARTIO – sterilointi ____________________________________________
Sterilointi menetelmä _____________________________________________________________
Sterilointi parametrit ______________________________________________________________
KÄSIKAPPALE – Puhdistus ja desinfiointi _______________________________________________
LATAUSLAITE – Kotelon puhdistaminen ________________________________________________
LATAUSLAITE– Latauskontaktien puhdistus _____________________________________________
LATAUSLAITE – Vaihdettavat latauskontaktit ____________________________________________
16
16
16
16
16
17
17
17
17
17
17
18
18
19
9
Käyttöaika _______________________________________________________________________ 19
10
Hävittäminen _____________________________________________________________________ 19
11
Vianmääritys _____________________________________________________________________ 20
12
12.1
12.2
12.3
Tekniset tiedot ___________________________________________________________________
Sähkömagneettinen yhteensopivuus EN 60601-1-2 _______________________________________
Latauslaitteen tunnistuslevy ________________________________________________________
Käsikappaleen sarjanumero ________________________________________________________
13
Takuu __________________________________________________________________________ 25
14
14.1
Huolto __________________________________________________________________________ 26
Huollon yhteystiedot / yhteystiedot maissa _____________________________________________ 26
15
Asiakirjahistoria __________________________________________________________________ 26
22
23
25
25
FI
-2-
HUOMIO
Kirja-kuvakkeen avulla löydät lukuun liittyvät kuvat
tai lisätietoja avattavasta kannesta.
1x /2x
Avaa
etukansi
Avaa
takakansi
1
Käyttö
1.1
Yleistä
Translux Wave on Heraeus Kulzer GmbH:n rekisteröity tavaramerkki.
Tämä käyttöohje on voimassa seuraavasti:
Tilausnumero
66055012
Malli ja varusteet
Translux Wave – LED valokovettajalaite
Painos
2014-03 / 99000943/01
1.2
EY-vaatimustenmukaisuusvahvistus
Täten Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, ilmoittaa, että seuraavassa kuvattu laite vastaa
suunnittelultaan ja rakenteeltaan sekä meiltä toimitetussa muodossaan voimassa olevia EY-direktiivien turvallisuus- ja
terveysmääräyksiä.
Jos laitetta on muutettu tavalla, josta ei ole sovittu kanssamme, tämä vahvistus ei enää ole voimassa.
1.3
Valmistajan vakuutus
Vakuutamme täten, että laite Translux Wave on direktiivin 93/42 EC ja standardien IEC 60601-1 ja
IEC 60601-1-2 mukainen.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Saksa).
2
Laitteen turvallista käyttöä koskevat ohjeet
Lue tämä ohjekirja ja noudata sen ohjeita tarkoin. Sanoilla VAKAVA VAROITUS, VAROITUS ja HUOMIO on erityiset
merkitykset ja niihin pitää tutustua huolella (ks. seuraava kappale). Pidä tämä ohjekirja aina helposti saatavilla.
2.1
Symbolien ja niihin liittyvien sanojen selitys
Symbolit
Liittyvät sanat
Selitys
VAKAVA VAROITUS
Vakavan vammam tai kuoleman mahdollisuus jos ohjeita ei noudateta.
VAROITUS
Pienempiä vaurioita tai laite voi vahingoittua jos ohjeita ei noudateta.
HUOMIO
Ohjeet kuinka laitetta käytetään parhaalla mahdollisella tavalla jotta
minimoidaan vahingot.
Räjähdyksen VAARA – katso lukujen ja osioiden tällä kuvasymboleilla
varustetut tiedot ja varoitukset.
RÄJÄHDYSVAARA
KYTKE IRTI
SÄHKÖVERKOSTA
Sähköiskun VAARA.
Ennen puhdistusta ja desinfiointia kytke latausalusta irti sähkövirtalähteestä!
MET
MET-merkintä – UL / CSA noudattaminen.
WEEE / ElektroG
Vanhojen laitteiden hävittäminen WEEE (European Directive) tai
sähkö-ja elektroniikkalaitteiden laki (German Law ElektroG).
Sovellettu osa:
Tyypin B sovellettu osa – teknisen standardin IEC 60601-1 mukaisesti.
Kaksinkertainen eristys:
Luokan II laite.
Virransyöttö:
vaihtovirta.
Tasavirta.
Sovittimen polariteetti – keskus positiivinen (plussa).
Käytä vain suljetuissa tiloissa.
FI
-3-
Symbolit
Liittyvät sanat
Selitys
Laite on valmistettu direktiivin 93/42/EEC mukaisesti, mukaan lukien
tekniset standardit IEC 60601-1 ja IEC 60601-1-2.
VAKAVA VAROITUS -symboli ”LED-säteily”.
Lue tiedot ja vaarat kappaleessa 4.2.5.
Katso käyttöohjeita.
VAROITUS, katso asiakirjoja.
Käyttökytkin:
”Käynnistä / Pysäytä”.
Rekisteröintitodistus Venäjän tasavallan terveysministeriön mukaisesti.
Pidettävä pois sateesta.
Säilytyslämpötilan rajoitus (–20°C (–4°F) – 40°C (104°F)).
Säilytyskosteuden rajoitus (45 – 85 % suhteellinen kosteus).
Säilytysilmanpaineen rajoitus (500 – 1060 hPa).
2.2
Kuljetusvaurio – pakkauksen purkaminen ja tarkistus
Laite ei kestä iskuja, koska se sisältää elektronisia komponentteja. Tästä syystä kuljetuksessa ja varastoinnissa
tulee noudattaa erityistä varovaisuutta. Heraeus Kulzerin toimittama tavara on tarkastettu ennen lähetystä huolellisesti.
Laite on suojattu asianmukaisesti ja toimitettu pakkauksessa.
Tarkasta toimituksen saatuasi, ettei laite ole vaurioitunut kuljetuksen aikana. Jos löydät vaurioita, ilmoita niistä
viimeistään 24 tunnin kuluttua toimituksen saapumisesta kuljetusyritykselle. Älä missään olosuhteissa asenna
vaurioitunutta laitetta ja/tai lisävarusteita tai käytä niitä.
FI
-4-
2.3
Omistajan velvollisuudet
Omistajalla on lakimääräysten noudattamisen lisäksi velvollisuus huolehtia työpaikkaa koskevien työsuojelulain
määräysten, esimerkkinä työhönperehdyttämisvelvollisuus, sekä kaikkien muiden voimassa olevien määräysten
ja lakien noudattamisesta ja täytäntöönpanosta.
Omistajan tulee huolehtia siitä, että kirjalliset, ymmärrettävässä muodossa olevat ja käyttöohjeen mukaiset ohjeet
laitteen lähellä ja sen kanssa suoritettavia töitä varten ovat käytettävissä; nämä ohjeet on saatettava työntekijöiden
tietoon heidän omalla äidinkielellään.
2.4
Laitepäiväkirja
Suosittelemme, että pidät ”laitepäiväkirjaa” ja dokumentoit siihen kaikki testaukset ja suuremmat työt
(esim. huolto, muutokset).
3
Käyttötarkoitus
Translux Wave on hammaslääketieteellinen LED-valokovetuslaite, joka on tarkoitettu käytettäväksi suuontelossa
440 – 480 nm:n aallonpituusalueella kovettuvien valokovetteisten dentaalimateriaalien, kuten sidosaineiden
ja täytemateriaalien, polymerisoinnissa.
HUOMIO
Vaikka useimmat valokovetteiset dentaalimateriaalit aktivoituvat tällä aallonpituusalueella, ollessasi epävarma
tarkista valmistajan ohjeista tai ota yhteyttä valmistajaan.
VAKAVA VAROITUS – Pätevät asiantuntijat.
Laitetta saa käyttää vain asianmukaisesti koulutettu henkilökunta ja hammaslääkäri (ks. kappale 2.3 Omistajan
velvollisuudet). Jos laitetta käytetään oikein, se ei aiheuta mitään tunnettuja haittavaikutuksia.
3.1
Laitteen kuvaus
Translux Wave käyttää erittäin tehokkaasta LED-diodista koostuvaa valonlähdettä, jonka aallonpituus
on välillä 440 – 480 nm.
Koko Translux Wave säteilemä valo käytetään aktivoimaan kamfrokinoni-fotoinitiaattori. Tämä tuottaa erinomaisia
polymerisaatiotuloksia kanssa pienemmällä lämpösäteilyä.
Translux Wave toimitetaan 8 mm halkaisijaltaan olevan 360° kääntyvän valonjohtimen kanssa.
Translux Wave koostuu latauslaitteesta ja käsikappaleesta, johon virta saadaan irrotettavasta, uudelleen ladattavasta
litiumioniakusta.
Käsikappaleessa on ”Lepotilaan” laitteen energiankulutuksen minimoimiseksi.
Käsikappale siirtyy ”Lepotilaan”, jos se on käyttämättä noin 5 minuuttia.
Translux Wave voidaan käyttää kahdessa kanssa eri valotussykliä:
• Valotus tasaisella teholla: syklin kesto 10 sekuntia.
• Valotus hitaasti kasvavalla teholla: ”Pehmeä käynnistys” (syklin kesto 20 sekuntia).
”Pehmeä käynnistys” tarkoittaa valotehon kasvua 50 %:sta 100 %:iin 2 sekunnin kuluessa.
HUOMIO – Tarkista valmistajan ilmoittamat materiaalien kovetusajat.
Materiaaleille, joilla on tietyt valotusajat (esim. 30 / 40 sekuntia tummille yhdistelmämuoveille), toista valotus
useita kertoja tarvittaessa.
3.2
Turvallisuusvaatimukset
Se miten tehokkaasti turvallisuushuomaukset suojaavat henkilöstöä, auttavat laitteen käsittelyssä tai työstettävän
materiaalin käsittelyssä, riippuu oleellisesti tällä laitteella työskentelevien henkilöiden käyttäytymisestä.
VAKAVA VAROITUS
Tämä käyttöohje tulee lukea huolellisesti ennen laitteen käyttöönottoa ja ohjeita tulee myös noudattaa virheiden
ja niistä aiheutuvien vahinkojen välttämiseksi, etenkin terveydellisten haittojen ehkäisemiseksi.
Laitteen käyttöönottoa ja käyttöä koskevat tämän käyttöohjeen tietojen lisäksi kulloinkin kansalliset lait,
määräykset ja direktiivit.
3.2.1
Laitteen käyttöä koskevat yleiset turvallisuusohjeet
VAKAVA VAROITUS – KÄYTTÖTARKOITUS
Käytä laitetta vain sen käyttötarkoitukseen (ks. kappale 3 Käyttötarkoitus). Kaikki muu käyttö on vahvasti
vasta-aiheista. Tämän määräyksen noudattamatta jättäminen voi johtaa potilaan tai käyttäjän vakavaan
vammaan sekä laitteen vaurioon tai häiriöön. Heraeus Kulzer ei ota vastuuta vaurioista, jotka johtuvat edellä
mainittujen järjestelyjen huomiotta jättämisestä!
VAKAVA VAROITUS
Käyttäjän vastuulla on testata Translux Wave käyttöä varten ja sen soveltuvuus suunniteltuun käyttöön.
Älä koskaan suuntaa valoa silmiin päin! Suora tai epäsuora valon kohdistuminen silmiin tulee aina estää
käyttämällä suojalaseja, jotka suodattavat pois sinisen valon. Aseta kovettamisen aikana valonjohtimen
kärki suoraan kovetettavan materiaalin päälle ja vältä pehmytkudosten valottamista. Silmiä, ikeniä, pehmytkudoksia ja muita kehon osia ei saa altistaa siniselle valolle (tarvittaessa nämä osat pitää peittää suojaimella).
Käytä kofferdamia perhmytkudosten, ts. ikenien, suojaamiseen hoidon aikana. Valotus on rajoitettava sille
suuontelon alueelle, jolla kliininen hoito tapahtuu.
VAKAVA VAROITUS – VASTA-AIHEET
Älä käytä Translux Wave a potilailla, joilla on tahdistin tai muita implantoituja elektronisia laitteita.
Tämä koskee myös käyttäjää.
Laitetta eivät saa käyttää lapset, sokeat tai kuurot eivätkä henkilöt, jotka ovat alttiita saamaan epileptisiä
kohtauksia. Laitetta ei myöskään saa käyttää potilaille, joilla on taipumusta epileptisiin kohtauksiin.
Edellä mainitut henkilöt eivät ehkä tunnista käyttöön liittyviä riskejä. Laitteen käyttö on turvallisuussyistä
kielletty käyttäjiltä ja potilailta, joilla on epileptisten kohtausten riski.
VAKAVA VAROITUS
Tämän laitteen muutokset ei sallittua.
FI
-5-
Omistajan / käyttäjän on varmistettava, että:
– laitetta ei käytetä potilailla, joilla positiivinen anamneesi valotestauksen jälkeen, esimerkiksi urticaria
solaris ja / tai porfyria, tai potilailla, joita on hoidettu valoherkkyyttä lisäävillä lääkkeillä.
– laitetta ei käytetä potilailla, joille on tehty kaihileikkaus tai jotka ovat erityisen herkkiä valolle, elleivät he
käytä sopivaa suojausta, kuten silmäsuojaimia tai suojalaseja, jotka suodattavat pois sinisen valon.
– potilailla, joilla on anamneesissa verkkokalvon sairauksia, saa käyttää Translux Wave vain heidän
silmälääkärinsä hyväksynnän mukaan.
– kaikissa riskitapauksissa on konsultoitava erikoislääkäriä.
VAKAVA VAROITUS – Lämpötila eri osille
Max.lämpötila käsiteltäville osille (valonjohdin ja suojakartio): 41°C (106°F).
Max. lämpötila käsiteltäville osille (etummainen metallikartio) silloin kun se on kontaktissa potilaaseen:
46°C (115°F).
Heraeus Kulzer painottaa että jos laitteen käytössä on noudatettu tämän manuaalin ohjeita ei kudoksen
kuumenemista esiinny.
VAKAVA VAROITUS – Infektionhallinta.
Valonjohdin ja suojakartio on puhdistettava, desinfioitava ja steriloitava (höyry) ennen jokaista käyttöä.
Valonjohdin ja suojakartio toimitetaan EPÄSTERIILEINÄ, ja ne tulee steriloida ennen ensimmäistä käyttökertaa.
Ks. kappale 8.4.1.2 Sterilointiparametrit.
3.2.2
FI
-6-
Turvallisuusvarotoimet
VAKAVA VAROITUS – RÄJÄHDYSVAARA
Älä asenna laitetta paikkaan, jossa on räjähdysten vaara.
Laitetta ei saa käyttää paikassa, jossa on läsnä syttyviä aineita (anestesiaseoksia, happea, ilokaasua jne.).
Käytä laitetta hyvin ilmastoidussa tilassa.
VAKAVA VAROITUS
Ennen käyttöä tarkista verkkovirtajohto ja pistoke vaurioiden varalta. Jos niissä on vaurioita, älä kytke niitä
sähköverkkoon.
Käytä vain alkuperäisiä Heraeus Kulzer GmbH:n varaosia ja lisävarusteita. Heraeus Kulzer toimittaa
Translux Wave -laitteeseen sopivia valonjohtimia. Muita valonjohtimia ei saa käyttää. Heraeus Kulzer GmbH
ei vastaa vahingosta, joka johtuu muun kuin alkuperäisen Heraeus Kulzerin varaosan tai lisävarusteen käytöstä.
3.2.3 AKKU – turvallisuusvarotoimet
Heraeus Kulzer GmbH ei vastaa akkuongelmista, joita ilmenee, kun alla olevassa kappaleessa lueteltuja
turvallisuusvarotoimia ei noudateta.
VAKAVA VAROITUS
Akun väärinkäyttö saattaa aiheuttaa akun kuumenemisen, repeämisen tai syttymisen ja vakavan vamman.
Alla olevassa kappaleessa lueteltuja turvallisuussääntöjä on noudatettava.
Käytä vain alkuperäisiä Heraeus Kulzerin akkuja!
Muiden kuin Heraeus Kulzerin akkujen tai ei-ladattavien paristojen ja / tai primaariakkujen käyttö
on potentiaalinen vaara ja voi vahingoittaa laitetta.
Pidä akku poissa lasten ulottuvilta!
Älä koskaan avaa, puhkaise tai murskaa akkua – se sisältää myrkyllisiä aineita.
Jos akussa ilmenee korroosiota, säteilyä tai epätavallista hajua taikka nesteiden vuotamista, poista akku
käsikappaleesta välittömästi.
Älä altista akkua vedelle tai suolavedelle äläkä anna sen kastua. Älä säilytä akkua kosteassa tai paikassa,
jossa se voisi altistua sateelle.
Jos akku vuotaa ja nestettä pääsee jonkun silmiin, silmiä ei saa hangata. Silmät on huuhdottava hyvin vedellä
ja hakeuduttava lääkärin hoitoon välittömästi. Ilman hoitoa akkuneste voi aiheuttaa silmävaurion.
VAKAVA VAROITUS – RÄJÄHDYSVAARA
Käytä käsikappaleen akun lataamiseen vain Translux Wave -latauslaitetta ja tehonsyöttöä, jotka tulevat
laitteen mukana. Älä koskaan yritä ladata Translux Wave -akkua millään muulla latauslaitteella.
Muun latauslaitteen käyttö voi aiheuttaa akun vaurioitumisen sekä räjähdys- ja tulipalovaaran!
Älä koskaan käytä Translux Wave -latauslaitetta muuntyyppisten akkujen tai muiden uudelleenladattavan akun
sisältävien laitteiden lataamiseen. Käytä vain alkuperäisiä Heraeus Kulzerin akkuja.
Älä lävistä akkua terävillä esineillä, iske sitä vasaralla / työkaluilla, astu sen päälle tai muuten kohdista siihen
voimakkaita vaikutuksia tai iskuja.
Älä aseta akkua tuleen tai kohdista siihen lämpöä. Älä koskaan aiheuta oikosulkua akun elementteihin
metalliesineillä palovammojen, tulipalo- ja räjähdysvaaran takia. Älä koskaan kanna akkua yhdessä
kaulakorujen, hiuspinnien tai muiden metalliesineiden kanssa.
VAKAVA VAROITUS – Älä pura tai muuntele akkua!
Akussa on sisällä turvamekanismeja, jotka saattavat vaurioituessaan aiheuttaa akun kuumenemisen,
repeytymisen tai syttymisen.
VAKAVA VAROITUS – Älä aseta akkua tulen lähelle tai muihin kuumiin paikkoihin.
Älä aseta akkua suoraan auringonvaloon. Se voisi aiheuttaa akun kuumenemisen, repeytymisen tai syttymisen.
Tällainen akun käyttö voisi aiheuttaa myös toiminahäiriön ja käyttöiän lyhenemisen.
VAKAVA VAROITUS – Tulipalon sattuessa ÄLÄ HEITÄ VETTÄ PALAVAN AKUN PÄÄLLE!
Luokan C palonsammutinta (EU-määräyksen EN 3 mukaan) tulee käyttää.
VAKAVA VAROITUS – Vaurioituneen tai loppuun kuluneen akun hävittäminen.
Tehtyäsi tarvittavat vaiheet ulkoisen oikosulun estämiseksi hävitä vaurioitunut tai loppuun kulunut akku
seuraavalla menetelmällä:
Eristettyäsi akun liitäntänavat eristysteipillä hävitä se lain tai paikallisten ohjeiden mukaisesti.
3.2.4 AKKU – tietoja
• Tyhjäntaiuudenakunlatausaika:noin3tuntia.
HUOMIO – UUSI akku: ensimmäinen lataus
Ensimmäisessä latauksessa tämä prosessi kestää noin 3 tuntia. Uusien akkujen tai pitkään varastossa
olleiden akkujen lataaminen saattaa kestää pidempään. Akku saavuttaa täyden kapasiteettinsa muutaman
täyden lataus / purku-syklin jälkeen.
HUOMIO
Aseta käsikappale latauslaitteeseen jokaisen hoidon jälkeen tai kun sitä ei käytetä.
• Käyttöolosuhteet:
Käyttölämpötila: 10°C (50°F) – 35°C (95°F).
Suhteellinen kosteus: 45 – 85 % RH.
Ilmanpaine: 800hPa – 1060 hPa.
VAROITUS
Lämpötila-alueet ja suhteellisen kosteuden alueet, joilla akku voidaan ladata, ovat 10°C (50°F) – 35°C (95°F)
ja 45 – 85 % RH. Akun lataaminen tämän alueen ulkopuolella saattaa aiheuttaa akun kuumenemisen tai
vaurioitumisen. Akun lataaminen tämän lämpötila-alueen ulkopuolella saattaa myös haitata akun toimintaa
tai lyhentää akun odotettua käyttöikää.
• Akunkuljetus-jasäilytysolosuhteet:
Suositellut lämpötilan ja suhteellisen kosteuden alueet:
–20°C (–4°F) – 40°C (104°F) ja 45 – 85 % RH.
Säilytä akkua aina ladattuna, äläkä säilytä sitä varastossa pidempään kuin 5 kuukautta.
Ympäristön ilmanpaine: 500 – 1060 hPa.
HUOMIO
Lataa akku aina ennen kuin laite on pitkään käyttämättä ja vähintään joka 5 kuukautta.
Jos laite on pitkään käyttämättä, vaihda akku käsikappaleessa.
• Akuntyypillinenelinaikaominaisto:
Translux Wave -akun tyypillinen käyttöikäodotus on 300 – 400 lataussykliä sen mukaan, millaisissa käyttö- ja
ympäristöolosuhteissa sitä käytetään.
HUOMIO
Akku on kemiallinen tuote, joka käyttää hyväkseen kemiallista reaktiota, joten sen toimintaa heikentää
paitsi käyttö, myös käyttämättä olo ajan mittaan.
FI
-7-
3.2.5 VASTUUVELVOLLISUUS
Laitteen sähkövarusteita koskevia töitä saa tehdä ainoastaan Heraeus Kulzer, Heraeus Kulzerin huoltoalan
yhteistyökumppani tai koulutettu ammattihenkilökunta ja ainoastaan varmassa (jänniteettömässä) tilassa.
Vain hyväksyttyjä alkuperäisosia ja -tarvikkeita saa käyttää.
Muiden osien käyttäminen luo uusia riskejä ja on joka tapauksessa syytä jättää tekemättä.
Laitteen toimintakelpoisuus ja varmuus on taattu vain kun tarvittavat tarkastukset, huolto- ja käyttöönottotyöt tekee
Heraeus Kulzer, Heraeus Kulzer-huoltoalan yhteistyökumppani tai koulutettu ammattihenkilökunta.
Heraeus Kulzer GmbH ei vastaa asiattomasta korjauksesta aiheutuneesta viasta tai virhetoiminnosta, jos töitä ei ole
suorittanut Heraeus Kulzer -huoltoalan yhteistyökumppani tai koulutettu henkilökunta tai jos osia vaihdettaessa
ei ole käytetty alkuperäisvara- tai lisäosia.
4
Laitteen kuvaus
4.1
Toimituksen sisältö
1 Latauslaite
2 Käsikappale
3 Valonjohdin, Ø = 8 mm
4 Suojakartio
5 Uudelleenladattava litiumioniakkupakkaus
6 Yleiskäyttöinen virtalähde (100 V – 240 V (
6a = Eurooppa tyyppi 1
6b = U.K.
tyyppi 2
6c = US / JP tyyppi 3
4.2
4.2.1
FI
-8-
1x
)) ja kansainväliset verkkovirtapistokkeen sovittimet:
Säätö- ja käyttöelementtien kuvaus
Käsikappale
1 ”Käynnistä / Pysäytä”-painike
2 Kovetustilojen LEDit (VIHREÄ)
3 Akun tilan LED (2-värinen: VIHREÄ / KELTAINEN)
4 Latauslaitteen kontaktit
5 Kohdistusmerkki
4.2.2 Kohdistusmerkki
Kohdistusmerkki (5), joka sijaistee käsikappaleen kotelon taka pohjaosassa, mahdollistaa
käsikappaleen asettamisen oikeaan asentoon latauslaitteen pidikkeeseen.
Asetettaessa käsikappaletta latauslaitteeseen kohdistusmerkki tulee kohdistaa latauslaitteen
pidikkeen sisässä olevaan ohjausrakoon.
Piippaus vahvistaa, että kontaktit ovat oikeassa latausasennossa!
4.2.3
2x
2x
Latauslaite
1x
Yläreunan näyttöelementit
1 Latauslaitteen kotelo
7 Käsikappaleen pidike, jossa kohdistusmerkki ja vaihdettevat latauslaitteen kontaktit
8 Valotehon anturi
9
– VIHREÄ LED-merkkivalo
Toiminto: Se ilmoittaa, että latauslaitteessa on virta.
10
– 2-värinen LED-merkkivalo (VIHREÄ / KELTAINEN)
Toiminto: Valotehon tiedot.
VIHREÄ: Ilmoittaa, että valoteho, mitattuna sisäänrakennetulla valomittarilla, on sopiva tehokkaaseen
hoitoon.
KELTAINEN: Ilmoittaa, että valoteho on riittämätön.
Näkymä alhaalta latauslaitteen
11 Virtajohdon liitin
12 Vaihdettava latauskontaktin insertti
2x
4.2.4
Äänimerkit käsikappale
Toiminto / virhetila
Käsikappaleen painikkeen käyttö
POLYMEROINTIOHJELMA:
10 sekuntia.
• Paina”KÄYNNISTÄ / PYSÄYTÄ”lyhyesti aloittaaksesi
painiketta
valotuksen.
”PEHMEÄ KÄYNNISTYS”- • Paina”KÄYNNISTÄ / PYSÄYTÄ”OHJELMA:
vähintään sekunnin ajan
painiketta
20 sekuntia.
valotuksen käynnistämiseksi.
VALOTUSSYKLIN
KESKEYTTÄMINEN
• Valotussyklivoidaankeskeyttäämilloin
tahansa ja käytössä oleva ohjelma
painamalla ”KÄYNNISTÄ / PYSÄYTÄ”.
painiketta
Äänimerkki /-merkit kuuluu /kuuluvat
Merkkivalot käsikappaleen
• 1 piippaus painettaessa ”KÄYNNISTÄ /
PYSÄYTÄ”-painiketta.
• 1 piippaus valotusajan päättyessä.
Vihreä LED palaa 10 sekuntia.
• 1 piippaus painettaessa ”KÄYNNISTÄ /
PYSÄYTÄ”-painiketta.
• 1 piippaus 1 sekunnin kuluttua
”Pehmeä käynnistys”- ohjelman aktivointi.
• 1 piippaus 10 sekunnin valotuksen jälkeen.
• 1 piippaus valotusajan päättyessä.
Vihreä LED palaa 20 sekuntia.
• 1 piippaus painettaessa ”KÄYNNISTÄ /
PYSÄYTÄ“-painiketta.
AKKU VÄHISSÄÄÄNIMERKKI
Jäljellä oleva akun
lataus riittää muutamaan
valotussykliin.
• 2 piippausta valotussyklin päättyessä.
• Akkumerkkivilkkuuvihreää.
Aseta käsikappale latauslaitteeseen lataukseen!
AKKU VÄHISSÄ ÄÄNIMERKKI
Seuraavia syklejä ei voi
aktivoida.
• 2 piippausta ilman valoaktivointia.
• Akkumerkkivilkkuuvihreää.
Aseta käsikappale latauslaitteeseen lataukseen!
Vain kun käsikappale on latauslaitteessa.
• 1 piippaus sekunnin välein 30 sekunnin ajan.
Akun tila LED palaa ”KELTAISENA”.
Äänimerkkiä ei kuulu.
Käytössä olevan valotussyklin vihreä LED
vilkkuu.
• 3 piippausta. Elektroniikka sallii käytössä
olevan valotussyklin päättymisen.
• 4 piippausta valotuksen alussa.
AKKUVIAN
ÄÄNIMERKKI
LED-valonlähteen vika
YLIKUUMENEMISTILA
SISÄÄNRAKENNETUN
lämpötilan ylikuormitusanturin vika
Käsikappaleen
latauspiirin vika
Huomio: Tämä tila
havaitaan vain silloin,
kun käsikappale
on latauslaitteessa.
Kaksi vihreää LED valoa (10s / 20s) vilkkuu
käsikappaleessa.
FI
-9-
4.2.5
Tietoa LED-valon lähettämästä säteilystä
Laite säteilee voimakasta luokan 2M (IEC 60825-1) LED-valoa.
LED-valon aiheuttama säteily.
Älä katso suoraan valoa kohti paljain silmin tai optisella
LED RADIATION
instrumentilla.
DO NOT STARE INTO THE BEAM OR VIEW DIRECTLY
WITH OPTICAL INSTRUMENTS
• LEDtuoteluokka2M.
CLASS 2M LED PRODUCT
IEC 60825-1:1993 + A1:1997 + A2:2001
• IEC60825-1:1993+A1:1997+A2:2001.
MAX POWER < 5,00 mW
Dominant wavelenght Min. 440nm – Max. 465nm
• Suurin teho: < 5,00 mW.
• Hallitseva aallonpituus: Min. 440 nm – Max 465 nm.
VAKAVA VAROITUS
Hajasäteily
Älä katso optisilla instrumenteilla kuten monokkelilla, suurennuslasilla tai mikroskoopilla lähietäisyydeltä
(alle 100 mm) LED-valoon – tämä voi vahingoittaa silmiä.
Kollimoitu valo
Älä katso LED-valoon kaukoputkella tai teleskoopilla – tämä voi vahingoittaa silmiä.
Jos vika ilmenee laitteen LED yksikössä, LED säteilypäästö ei saa ylittää normaalissa käytössä plevan
lääketieteellisen laitteen arvoa.
Yllä mainitut huomiotarrat on kiinnitetty pakkauksen kylkeen.
5
FI
- 10 -
Asennus ja käyttöönotto
Tämän kappaleen seuraavat osiot sisältävät tiedot ja ohjeet, joita tulee noudattaa laitteen sujuvan ja virheettömän
käytön varmistamiseksi. Toimi seuraavien ohjeiden mukaan ennen Translux Wave käyttöä.
Lääketieteellinen laite täyttää turvallisuuden tason vain jos se on asennettu alla olevien ohjeiden mukaan.
Laite tulee asentaa paikkaan, josta sitä on kätevä käyttää. Aseta latauslaite tukevalle, kuivalle, tasaiselle vaakapinnalle.
TÄRKEÄÄ
Käsikappale on tarkoitettu potilaiden hoitoon näiden turvaohjeiden mukaan. Latausasema ja sähköadapteri
eivät ole tarkoitettu potilaiden hoitoon.
HUOMIO
Potilasalue määritellään alueeksi 1,5 m potilaasta ( IEC 60601-1 kolmas painos ja IEC 60601-1-1).
VAKAVA VAROITUS
Tarkista laite vaurioiden varalta aina ennen asennusta.
Jos huomaat vaurioita, älä asenna laitetta.
Käyttäjä ei saa olla kosketuksessa muiden osien kanssa (latausasema, sähköadapteri) potilasalueen
ulkopuolella potilashoidon aikana.
Älä koskaan liitä ulkoisia komponentteja lääketietelliseen laitteeseen.
5.1
Turvallisuusvaatimukset asennuksen aikana
VAKAVA VAROITUS
Sähköasennuksen tiloissa, joihin laite asennetaan ja jossa sitä käytetään, tulee olla olemassa olevan
lainsäädännön ja sähköjärjestelmiä koskevien turvallisuusmääräysten mukainen.
Asenna laite paikkaan, jossa se on suojassa iskuilta sekä veden ja muiden nesteiden roiskeilta.
Älä altista laitetta suoralle auringonvalolle, UV-valolle.
Älä asenna laitetta lämmönlähteen päälle tai lähelle. Varmista asennuksen aikana, että ilma kiertää riittävästi
laitteen lähellä. Älä asenna laitetta lähelle liuottimia tai syttyviä nesteitä, sillä ne voivat vahingoittaa laitteen
muovikuoria.
Virtalähteen liitin ( suora yhteys) malli PSACO5R-050 takaa laitteen eristyksen kytkettynä verkkovirtaan.
Kun virta on kytketty, virta-adapteri on helposti oltava saatavilla. Jätä riittävästi vapaata tilaa laitteen ympärille.
Laite on sijoitettava siten että virta on helppo katkaista ( koskee myös virtalähteen pistoketta).
Älä koskaan aiheuta oikosulkua akun pääte-elementteihin millään metalliesineellä, sillä se voi aiheittaa
palovammojen, tulipalon ja räjähdyksen vaaran.
Laitetta voidaan siirtää, mutta sitä pitää käsitellä varovasti. Siirrä laite aina vaaka-asennossa.
Älä anna laitteen altistua tärähdyksille tai tärinälle. Mitat ja paino on annettu kappalessa 12 (Tekniset tiedot).
VAKAVA VAROITUS – RÄJÄHDYSVAARA
Älä asenna laitetta paikkaan, jossa on räjähdysvaara. Laitetta ei saa käyttää syttyvien aineiden
(anaestesiaseokset, happi, ilokaasu jne.) läheisyydessä. Asenna laite hyvin ilmastoituun tilaan.
5.2
Latauslaitteen yhdistäminen verkkovirtapistorasiaan
1x
Translux Wave toimitetaan erillisen yleissyöttöyksikon kanssa (6), jonka vaatimukset
), 50 / 60 Hz.
ovat 100 – 240 V (
VAKAVA VAROITUS
Ennen latauslaitteen (6) yhdistämistä sähköverkkoon tarkista huolellisesti, että sähköverkon jännite ja taajuus
vastaavat laitteen arvokilvessä annettuja arvoja. Arvokilpi on kiinnitetty latauslaitteen pohjaan.
Käytä ainoastaan virtalähdetta joka toimitetaan laitteen mukana. Toisen virtalähteen käyttäminen voi
vahingoittaa laitteen akkua.
Älä kytke verkkolaitetta ulkoiseen ylijännitesuojaan.
HUOMIO
Translux Wave tehonsyöttöyksikkö (6) toimitetaan kolmen vaihdettavan adapterin kanssa:
tyyppi 1
Kuva (6 a) = Eurooppa
Kuva (6 b) = U.K.
tyyppi 2
Kuva (6 c) = USA / Japani tyyppi 3
1 Valitse oikea adapteri saatavana olevista: Eurooppa – Tyyppi 1, U.K. – Tyyppi 2, USA / Japani – Tyyppi 3.
2 Kussakin adapterissa on lovi, johon tehonsyöttöyksikön lukitussalpa sopii.
3 Lovi suunnattuna tehonsyöttöyksikköön päin aseta adapteri tehonsyöttöyksiköön niin, että adapterin kannattimet
ovat niitä vastaavien aukkojen kohdalla.
4 Painaen adapteria ja tehonsyöttöyksikköa alaspäin työnnä adapteria tehonsyöttöyksikköön, kunnes kuulet
naksahduksen ja adapteri lukittuu paikalleen.
HUOMIO
Adapterin painaminen asennuksen aikana varmistaa sen, että kaikki kannattimet pysyvät
tehonsyöttöyksikön pitimissä. Jos adapteri tuntuu löysältä, irrota se ja asenna se uudelleen.
5 Adapteri poistetaan tehonsyöttöyksiköstä painamalla salvan pidikepainiketta (merkitty sanalla ”PUSH” (TYÖNNÄ)),
liu‘uttamalla adapteri pois tehonsyöttöyksiköstä ja poistamalla se.
6 Säilytä käyttämättömät adapterit tulevaa käyttöä varten.
7 Liitä virtajohdon pistoke latauslaitteen pohjassa olevaan pistukkaan.
VAKAVA VAROITUS
Tarkista virtajohto, tehonsyöttöyksikkö ja adapteri säännöllisesti varmistaaksesi,
että ne ovat hyvässä kunnossa.
Jos huomaat vaurioita, älä käytä vioittunutta osaa ennen kuin se on vaihdettu.
Käytä vain alkuperäisiä Heraeus Kulzerin varaosia ja lisävarusteita.
8 Kytke tehonsyöttöyksikkö adaptereineen verkkopistorasiaan.
9 Latauslaitteen VIHREÄ LED-merkkivalo syttyy (kuvake
).
5.3
Akun asentaminen käsikappaleeseen
Translux Wave toimitetaan tehokkaan uudelleenladattavan litiumioniakun kanssa.
Akku toimitetaan erilleen pakattuna laitepakkauksessa, ja se tulee asentaa käsikappaleseen ennen ensimmäistä
käyttökertaa.
VAKAVA VAROITUS
Noudata tarkoin kaikkia kappaleessa 3.2.3 (AKKU – Turvallisuusvarotoimet) kuvattuja turvallisuusvarotoimia.
VAROITUS
ÄLÄ KOSKAAN aseta käsikappaletta latauslaitteeseen ilman että akku on asennettu käsikappaleeseen.
FI
- 11 -
Asenna akku käsikappaleeseen seuraavien ohjeiden mukaan:
1 Poista akku pakkauksesta.
VAKAVA VAROITUS
Älä koskaan aiheuta oikosulkua akun liitäntänapoihin millään metalliesineellä,
sillä se voi aiheuttaa palovamman, tulipalon tai räjähdyksen vaaran.
2 Ruuvaa auki litteällä työkalulla (esimerkiksi kolikolla) vastapäivään käsikappaleen
akkukansi (Kuvat 1 ja 2 ).
3 Akun koteloon on merkitty nuoli (Kuva 3 ).
HUOMIO
Tämä nuoli osoittaa akun asennussuunnan käsikappaleeseen.
2x
4 Liu‘uta akkua käsikappaleeseen hitaasti nuoli suunnattuna koteloon, kunnes se pysähtyy (Kuva 4 ).
HUOMIO
Jos akku on asetettu väärin (ts. ei nuolen suunnassa), käsikappale ei toimi. Jos akku on asennettu väärin,
käsikappaleen elektroniikkaan ei tule vaurioita.
VAKAVA VAROITUS
Käytä vain alkuperäisiä Heraeus Kulzerin akkuja. Muiden valmistajien akkujen ja ei-uudelleenladattavien
akkujen / primääriakkujen käyttö on potentiaalinen riski ja voi aiheuttaa laitteelle palautumattoman vaurion.
5 Ruuvaa litteällä työkalulla (esimerkiksi kolikolla) vastapäivään käsikappaleen akkukansi auki.
HUOMIO
Laite ei toimi kunnolla, jos käsikappaleen akkukansi ei ole ruuvattu täysin kiinni.
FI
- 12 -
5.4
Kuituoptiikan asentaminen käsikappaleeseen
2x
• Kierrävalonjohdintahieman(1) ja työnnä sitä käsikappaleeseen (2), kunnes se menee
pohjaan asti. Se on pohjassa, kun kuulet ”naksahduksen”.
• Asennasuojakartio(3) valonjohtimen yläreunaan.
Valonjohtimen asettaminen
• Kierrävalonjohdinhaluttuunasentoonpolymerisointiavarten.
• Saadaksesitäydenhyödynvalotehostaasetavalonjohdinmahdollisimmanlähelleyhdistelmämuovia.
Vältä koskettamasta yhdistelmämuovimateriaalia!
VAROITUS – Pidä valonjohdin aina puhtaana täyden valotehon ylläpitämiseksi.
Valoteho on huomattavasti alentunut, jos:
– valonjohdin ei ole täydellisessä kunnossa (naarmuuntunut tai lohkeillut).
– valonjohdin ei ole kunnolla kiinni käsikappaleessa.
– valonjohtimessa on yhdistelmämuovitahroja.
VAKAVA VAROITUS
Vioittunut valonjohdin alentaa valotehoa ja pitää vaihtaa uuteen välittömästi.
Terävät reunat saattavat aiheuttaa vakavan vamman. Käytä vain alkuperäisiä Heraeus Kulzerin valonjohtimia.
VAKAVA VAROITUS – Infektionhallinta:
Jotta hoito olisi mahdollisimman turvallista potilaille ja käyttäjille, valonjohdin ja suojakartio tulee puhdistaa,
desinfioida ja steriloida ennen jokaista hoitoa. Noudata kappaleen 8 (Puhdistus, desinfiointi ja sterilointi) ohjeita
vaihe vaiheelta.
5.5
Akun lataaminen
VAROITUS – UUSI akku: ensimmäinen lataus
Translux Wave -akku on osittain ladattu tehtaassa.
Siksi akku pitää ladata täydellisesti ennen Translux Wave ensimmäistä käyttökertaa.
HUOMIO – UUSI akku: ensimmäinen lataus
Ensimmäisessä latauksessa tämä prosessi kestää noin 3 tuntia. Uusien tai pitkään varastossa olleiden akkujen
lataaminen voi kestää pidempään. Akku saavuttaa täyden kapasiteettinsa muutaman täyden lataus / purkusyklin jälkeen.
VAKAVA VAROITUS – RÄJÄHDYSVAARA
Käytä akun lataamiseen vain vain Translux Wave mukana toimitettua latauslaitetta. Räjähdys- ja
tulipalovaaran takia älä koskaan yritä ladata akkua käyttäen muuta akkulaturia tai virtalähdettä.
Aseta käsikappale akkuineen Translux Wave -latauslaitteeseen.
2x
Piippaus vahvistaa, että kontaktit ovat oikeassa latausasennossa!
TÄRKEÄ HUOMIO – kohdistusmerkki
Kohdistusmerkki (5), joka sijaitsee käsikappaleen taka pohjaosassa, mahdollistaa käsikappaleen
oikean asettamisen latauslaitteeseen. Asetettaessa käsikappaletta latauslaitteeseen kohdistusmerkki
tulee kohdistaa latauslaitteen sisällä sijaitsevaan loveen.
Akun latausprosessi.
• VihreäakuntilanLEDkäsikappaleessaalkaavilkkua.
• Kunlatausvaiheonpäättynytjaakkutäysinlatautunut,vihreäakuntilanLEDpalaajatkuvasti.
TÄRKEÄ HUOMIO – Viallinen akku
Siinä tapauksessa, että käsikappaleen elektroniikka havaitsee akkuvian latausvaiheessa, latausprosessi
keskeytyy ja akun tilan LED alkaa vilkkua KELTAISENA.
Tässä tilassa ”laite piippaa” sekunnin välein 30 sekunnin ajan.
Vaihda viallinen akku uuteen!
VAKAVA VAROITUS
Käytä vain Heraeus Kulzerin akkuja!
HUOMIO
Kun käsikappale on latauslaitteessa, sen toiminta on inaktiivinen. ”Käynnistä / Pysäytä”-painikkeen
toiminta on estetty.
Käsikappale voidaan poistaa latauslaitteesta latausprosessin aikana, mutta akku ei lataudu täyteen,
mikä saattaa lyhentää käyttöaikaa.
6
Käyttö
VAROITUS – Tarkista laitteen kunto ennen hoidon aloitusta.
Varmista ennen jokaista hoitoa, että laite on asianmukaisessa toimintakunnossa ja että lisävarusteet
(valonjohdin ja suojakartio) ovat teholliset. Jos hoidon aikana huomataan jotain, älä jatka hoitoa vaan ota
yhteyttä Heraeus Kulzeriin tai paikalliseen asiakaspalveluun (ks. kappale 14 Huolto). Älä käytä laitetta ja sen
lisävarusteita, jos huomaat niissä vaurioita. Varmista ennen Translux Wave jokaista käyttökertaa, että säteilevä
valoteho on riittävä takaamaan polymerisoinnin. Tarkista valoteho käyttäen latauslaitteeseen integroitua
valomittaria (ks. kappale 6.2 Valotehon mittaaminen).
VAKAVA VAROITUS – Infektionhallinta
Ensimmäinen käyttökerta
Lisävarusteet, valonjohdin ja suojakartio toimitetaan EPÄSTERIILEINÄ ja pitää steriloida ennen ensimmäistä
käyttökertaa.
Jokainen käyttökerta
Käytön jälkeen lisävarusteet, valonjohdin ja suojakartio tulee käsitellä ennen seuraavaa käyttökertaa
kappaleessa 8 (Puhdistus, desinfiointi ja sterilointi) kuvattujen toimien mukaisesti.
6.1
Valotussyklin aktivointi ja inaktivointi
Translux Wave voidaan käyttää kahdessa kanssa eri valotussykliä:
– Valotus tasaisella teholla: syklin kesto 10 sekuntia.
– Valotus hitaasti kasvavalla teholla: ”Pehmeä käynnistys” (syklin kesto 20 sekuntia).
”Pehmeä käynnistys” tarkoittaa valotehon kasvua 50 %:sta 100 %:iin 2 sekunnin kuluessa.
• Joskäsikappaleon”Lepotilaan”(kaikkikovetustilojenLEDitvalotussyklinovatSAMMUKSISSA),painalyhyesti
”Käynnistä / Pysäytä”-painiketta
saadaksesi käsikappaleen toimimaan.
(Uudelleenkäynnistyksen jälkeen 10 sekunnin LED valo syttyy.)
FI
- 13 -
Valotus 10 sekunnin polymerisointi
Paina lyhyesti ”Käynnistä / Pysäytä”-painiketta
. Valosäteily kytkeytyy päälle.
10 sekunnin LED palaa ilmoittaen, että tämä ohjelma on käynnissä.
Kun valotussyklin on päättynyt, laite kytkee valon pois päältä automaattisesti.
Äänimerkki:
Seuraavat äänimerkit (piippaus) kuuluvat:
1 piippaus painettaessa ”Käynnistä / Pysäytä”-painiketta.
1 piippaus valotusajan päättyessä.
Valotus 20 sekunnin ”Pehmeä käynnistys”- polymerisointi
Paina ja pidä alhaalla vähintään sekunnin ajan ”Käynnistä / Pysäytä”-painiketta
. Valosäteily kytkeytyy päälle.
20 sekunnin LED palaa ilmoittaen, että tämä ohjelma on käynnissä.
Kun valotussyklin on päättynyt, laite sammuttaa valon ja palautuu 10 sekunnin tilaan (10 sekunnin LED palaa)
automaattisesti.
Äänimerkki:
Seuraavat äänimerkit (piippaus) kuuluvat:
1 piippaus painettaessa ”Käynnistä / Pysäytä”-painiketta.
1 piippaus 1 sekunnin kuluttua ”Pehmeä käynnistys”- ohjelman aktivointi.
1 piippaus 10 sekunnin valotuksen jälkeen.
1 piippaus valotusajan päättyessä.
HUOMIO
Valotussykli voidaan keskeyttää milloin tahansa ennen valotusajan päättymistä painamalla
uudelleen ”Käynnistä / Pysäytä”-painiketta.
Äänimerkki:
Äänimerkki (piippaus) kuuluu, kun ”Käynnistä / Pysäytä”-painiketta painetaan valotussyklin keskeyttämiseksi.
FI
- 14 -
6.2
Valotehon mittaaminen
Translux Wave -latauslaite on varustettu integroidulla valotehon mittarilla (8).
2x
VAROITUS
Tarkista valoteho ennen jokaista hoitoa käyttäen Translux Wave -latauslaitteeseen
integroitua valotehon mittaria.
• Asetavalonjohdinpainettakäyttämättätasaisestijasuoraantestausalueelle(8).
Aktivoi laite painamalla ”Käynnistä / Pysäytä”-painiketta
(mikä tahansa valotusaika valittuna).
Valotehon mittauksesta ilmoittaa heti 2-värinen LED-valo (Symboli
) testausalueen oikeassa alakulmassa.
VIHREÄ LED-VALO: Valoteho on riittävä hoitoon.
KELTAINEN LED-VALO: Valoteho on riittämätön eikä potilasta/potilaita saa hoitaa.
VAROITUS
Jos valoteho ei ole riittävä, ole hyvä ja suorita seuraavat tarkastukset ja toimenpiteet:
– Valonjohdinta ei ole asennettu käsikappaleeseen (ks. kappale 5.4 Kuituoptiikan asentaminen
käsikappaleeseen).
– Tarkista, onko valonjohtimessa likaa tai vaurioita.
– Puhdista valonjohdin liasta (ks. kappale 8 Puhdistus, desinfiointi ja sterilointi) tai vaihda vioittunut
valonjohdin uuteen.
Käytä vain alkuperäisiä Heraeus Kulzerin valonjohtimia!
VAKAVA VAROITUS
Jos edellä kuvatut toimet eivät paranna valotehoa, älä käytä laitetta hoidossa. Kytke laite pois päältä
(kytke latauslaite irti sähköverkosta) ja varmista, että laitteen luvaton uudelleenaktivointi ei ole mahdollista.
Ota yhteyttä Heraeus Kulzerin huoltokumppaniin tai Heraeus Kulzerin valtuuttamaan, koulutettuun
henkilökuntaan (ks. kappale 14 Huolto).
6.3
Lepotilaan
Käsikappaleessa on ”Lepotilaan” laitteen energiankulutuksen minimoimiseksi.
Latauslaitteen ulkopuolella kaikki käsikappaleen sisäiset toiminnot kytkeytyvät automaattisesti pois päältä
(”Lepotilaan”), jos se on käyttämättä 5 minuuttia.
”Lepotilaan” käsikappaleen valotussyklin LED-valot ovat sammuksissa.
Voit poistua ”Lepotilaan” painamalla ”Käynnistä / Pysäytä”-painiketta
Käsikappale on käyttövalmis.
.
6.4
Lisätietoja laitteen toiminnoista
HUOMIO
Jos käsikappale asetetaan latauslaitteeseen ennen kovetussyklin päättymistä, valosäteily kytkeytyy
automaattisesti pois päältä.
Kun käsikappale on latauslaitteessa, sen toiminta on inaktiivinen. ”Käynnistä / Pysäytä”-painikkeen
toiminta on estetty.
Translux Wave on varustettu mikroprosessoreilla, jotka tarkistavat jatkuvasti akun latausparametreja
ja ylläpitävät optimaallisia arvoja. Jokaisen hoidon jälkeen käsikappale tulisi siksi asettaa latauslaitteeseen
säilytykseen lataukseen katsomatta.
7
Hälytysolosuhteet
7.1
Viallinen akku
Akkuvian sattuessa akun tilan LED käsikappaleessa alkaa vilkkua KELTAINEN (Kuva a).
”Laite piippaa” sekunnin välein 30 sekunnin ajan.
TÄRKEÄÄ
Tämä vikatila havaitaan vain silloin, kun käsikappale on latauslaitteessa.
vilkkuu
7.2
Viallinen LED-valo
Kun mikroprosessori havaitsee LED-tilan vian, vihreä kovetustilan LED ”10s”,
joka on käytössä, alkaa vilkkua (Kuva b).
vilkkuu
a
b
7.3
Ylikuumenemissuojaus
Jos useita kovetussyklejä seuraa nopeasti peräjälkeen (normaalisti 18 peräkkäisen syklin
jälkeen, kukin kestää 20 sekuntia), sisäänrakennettu ylikuormituksen lämpötila-anturi
saattaa aktivoitua.
Kun ylikuumenemissuojaus aktivoituu, äänisignaali (”3 piippausta”) kuuluu.
Ylikuumenemissuojauksen aktivoituminen pysäyttää laitteen käytön muutamaksi minuutiksi.
Anna käsikappaleen jäähtyä vähintään 4 – 5 minuutin ajan ja aloita sitten seuraava valotus
painamalla ”Käynnistä / Pysäytä”-painiketta
.
HUOMIO
Käsikappale aloittaa toimintansa saavutettuaan käyttölämpötilan – no ”reset” on tarpeen.
7.4
Viallinen SISÄÄNRAKENNETTU lämpötilan ylikuormitusanturi
Jos lämpötilan ylikuormitusanturi on viallinen kuuluu ”4 piippausta” valotuksen alussa.
HUOMIO
Jos valotuksen aikana tapahtuu virhe ylikuumenemisanturissa prosessi päättyy automaattisesti.
Uusi valotus ei käynnisty ”Käynnistä / Pysäytä”-painikkeesta
ja kuuluu ”4 piippausta”.
Valokovettajalamppua ei ole mahdollista käyttää jos se on ylikuumentunut.
FI
- 15 -
7.5
Akku vähissä -merkkiääni
Kun akun lataus putoaa alle minimitason taajan käytön jälkeen, Translux Wave-mikroprosessori sallii vielä muutaman
valotussyklin kaikissa kovetustiloissa ilman akun uudelleen lataamista.
Tästä tilasta ilmoittavat kunkin syklin päättyessä ”2 piippausta”.
Akkumerkki vilkkuu vihreää. Lataa akku!
Muutaman syklin jälkeen jäljellä oleva akun lataus ei salli enää yhtään valotussykliä. Tästä tilasta ilmoittavat
”2 piippausta”.
Akkumerkki vilkkuu vihreää. Lataa akku!
8
Puhdistus, desinfiointi ja sterilointi
KYTKE IRTI SÄHKÖVERKOSTA
Ennen puhdistusta ja desinfiointia kytke latausalusta irti sähköverkosta!
VAKAVA VAROITUS
Infektionhallinta
Valonjohdin ja suojakartio toimitetaan EPÄSTERIILEINÄ, ja ne pitää puhdistaa, desinfioida ja steriloida (höyry)
ennen ensimmäistä käyttökertaa ja jokaista käyttöä.
Älä steriloi käsikappaletta ja latauslaitetta!
Älä steriloi akkua!
8.1
Purkaminen
Irrota suojakartio valonjohtimesta.
Irrota valonjohdin: kierrä valonjohdinta hieman ja vedä se pois käsikappaleesta.
8.2
VALONJOHDIN – puhdistus ja desinfiointi
VAROITUS
Älä käytä teräviä tai suippoja instrumentteja valonohjaimen puhdistukseen, sillä ne voivat naarmuttaa
valonjohtimen pintaa ja siten vähentää valosäteilyä.
Älä käytä puhdistus-/ desinfiointiaineita, jotka sisältävät orgaanisia, epäorgaanisia tai hapettavia happoja,
vetyperoksidia, kloridia, jodia, bromidia tai liuottimia.
1) Mahdolliset jäämät, kuten yhdistelmämuovimateriaali, tulee poistaa valonjohtimen päästä heti käytön jälkeen.
Mahdollinen kovettunut yhdistelmämuovi tulee poista käyttäen etanolia, ja muovispaattelista tai nailonharjasta voi
olla apua materiaalijäämien poistamisessa.
2) Desinfioi valonjohdon puhtaalla, nukkaamattomalla liinalla, joka on kostutettu miedolla desinfiointiliuoksella jonka
pH on alhainen (pH 7), valmistajan ohjeiden mukaisesti. Anna desinfiointiliuoksen kuivua.
FI
- 16 -
8.2.1 VALONJOHDIN – Tarkistus ennen sterilointia
Ennen sterilointiprosessiin siirtymistä tarkista huolellisesti, onko valonjohtimessa vaurioituneita pintoja,
värjäytymiä tai likaa.
VAKAVA VAROITUS
Älä käytä vaurioitunutta valonjohdinta. Jos huomaat vaurion, vaihda valonjohdin uuteen.
Jos valonjohtimessa on edelleen likaa, toista puhdistus- ja desinfiointoimet.
8.3
SUOJAKARTIO – Puhdistus ja desinfiointi
VAROITUS
Älä käytä puhdistus-/ desinfiointiaineita, jotka sisältävät orgaanisia, epäorgaanisia tai hapettavia happoja,
vetyperoksidia, kloridia, jodia, bromidia tai liuottimia.
Desinfioi suojakartio puhtaalla, nukkaamattomalla liinalla, joka on kostutettu miedolla desinfiointiliuoksella jonka pH
on alhainen (pH 7),valmistajan ohjeiden mukaisesti. Anna desinfiointiliuoksen kuivua.
8.3.1 SUOJAKARTIO – Tarkistus ennen sterilointia
Ennen sterilointiprosessiin siirtymistä tarkista huolellisesti, onko onko suojakartiossa vaurioituneita pintoja,
värjäytymiä tai likaa.
VAKAVA VAROITUS
Älä käytä vaurioitunutta suojakartiota. Jos huomaat vaurion, vaihda suojakartio uuteen.
Vaurioitunut suojakartio ei suojaa riittävästi laitteen valolta.
Jos suojakartiossa on edelleen likaa, toista puhdistus ja desinfiointi.
8.4
VALONJOHDIN ja SUOJAKARTIO – Pakkaaminen ennen sterilointia
Valonjohdin ja suojakartio voidaan steriloida sopivan kokoisessa lääketieteellisessä höyrysterilointipussissa.
VAROITUS
Valonjohdin ja suojakartio on pakattava yksittäin erillisiin pusseihin.
Kun yhdessä autoklaavissa steriloidaan useita instrumentteja, varmista, ettei autoklaavin maksimikuormitusta
ylitetä.
VAKAVA VAROITUS
Varmista, että sisäpussi on tarpeeksi iso, niin että siihen mahtuu yksi instrumentti rasittamatta saumoja
tai repimättä pakkausta.
8.4.1 VALONJOHDIN ja SUOJAKARTIO – sterilointi
8.4.1.1 Sterilointi menetelmä
• Suoritasterilointiesivakuumi-höyryautoklavoimalla.
VAROITUS
Älä koskaan käytä muita sterilointimenetelmiä, koska ne eivät ehkä sovi valonjohtimen valmistusmateriaaleille.
ÄLÄ KÄYTÄ seuraavia sterilointimenetelmiä: etyleenioksidisterilointi, kuumailmasterilointi, flash-autoklavointi,
STERRAD-sterilointi, STERIS-järjestelmä tai vastaavat sterilointijärjestelmät.
ÄLÄ sterilioi valonjohdinta tai suojakartiota seuraavilla menetelmillä: vetyperoksidi, peretikkahappojärjestelmä, formaldehydi- ja glutaraldehydisterilointi.
8.4.1.2 Sterilointi parametrit
• Minimisterilointiparametrit, jotka tuottavat 10 –6 steriloinnin luotettavuusrajan (SAL).
Syklin tyyppi
Esivakuumi
Minimilämpötila
132°C + 3°C
(270°F + 5°F)
Minimivalotusaika (pussi)
4 minuuttia
Minimikuivausaika
20 minuuttia
VAROITUS
Älä ylitä 135°C (275°F).
8.5
KÄSIKAPPALE – Puhdistus ja desinfiointi
VAKAVA VAROITUS
Käsikappaletta ei ole suojattu nesteiden sisäänpääsyltä.
Älä suihkuta nesteitä suoraan käsikappaleen pinnalle tai latauskontakteihin.
Puhdistus- ja desinfiointiaineita ei saa päästää käsikappaleen sisään!
ÄLÄ KOSKAAN upota käsikappaletta nesteisiin.
ÄLÄ KOSKAAN puhdista käsikappaletta juoksevan veden alla.
Älä steriloi käsikappaletta. Vaurion, sähköiskun ja tulipalon vaara!
FI
2x
- 17 -
Puhdista ja pyyhi käsikappaleen kotelo puhtaalla, pehmeällä, nukkaamattomalla liinalla, joka on kostutettu miedolla
desinfiointiaineella jonka pH on neutraali (pH 7), valmistajan ohjeiden mukaan.
Anna desinfiointiliuoksen kuivua tai kuivaa liika aine käsikappaleen kotelosta pehmeällä, nukkaamattomalla liinalla.
VAROITUS
Älä käytä käsikappaleen muovipinnan puhdistukseen ja desinfiointiin sellaisia liuottimia kuin asetoni,
isopropyylialkoholi ja vetyperoksidi, kloridi, jodi, bromidi, fenoli tai muut voimakkaat liuokset.
Nämä aineet voivat olla haitallisia ja aiheuttaa värjääntymistä ja/tai vaurioita käsikappaleen muovipinnalle.
Alä käytä hankaavia puhdistusaineita!
TÄRKEÄÄ: Käsikappaleen latauskontaktien puhdistus
Kun olet puhdistanut ja desinfioinut käsikappaleen muovikotelon, puhdista aina käsikappaleen pohjaosassa
olevat latauskontaktit. Käsikappaleen latauskontakti on aina pidettävä puhtaana liasta, yhdistelmämuovista
ja puhdistus-/ desinfiointiaineen jäämistä.
TÄRKEÄÄ
Käsikappaleen latauskontaktit tulee puhdistaa säännöllisin väliajoin (vähintään kerran viikossa) ja aina
käsikappaleen muovikotelon puhdistuksen ja desinfioinnin yhteydessä. Latauskontakteissa oleva lika
tai niiden altistuminen nesteille, kuten puhdistus- tai desinfiointiaineille, voi häiritä latausprosessia ja estää
akun latautumisen.
Puhdista käsikappaleen latauskontaktit alkoholiin kastetulla pehmeällä, nukkaamattomalla liinalla tai vanulapulla.
VAROITUS
Älä käytä teräviä tai suippoja instrumentteja käsikappaleen kontaktien puhdistukseen,
sillä ne voivat naarmuttaa ja vaurioittaa niiden pintaa ja siten heikentää latauskontaktien johtavuutta.
Ennen kuin käytät käsikappaletta uudelleen, varmista että käsikappaleen pinta ja latauskontaktit ovat täysin
kuivat. Jos tarpeellista, kuivaa kontaktit puhaltamalla paineilmalla.
8.6
FI
- 18 -
LATAUSLAITE – Kotelon puhdistaminen
KYTKE IRTI SÄHKÖVERKOSTA
Kytke tehonsyöttöyksikkö irti verkkopistorasiasta ja latauslaitteesta ennen puhdistusta / desinfiointia.
VAKAVA VAROITUS
Latauslaitteen koteloa ei ole suojattu nesteiden sisäänpääsyltä.
Älä suihkuta nesteitä suoraan latauslaitteen kotelon pinnalle.
VAROITUS
ÄLÄ steriloi latauslaitetta. Se ei enää toimi ja saattaa aiheuttaa vakavan vamman, sähköiskun ja tulipalon
vaaran!
Älä käytä latauslaitteen muovipinnan puhdistukseen ja desinfiointiin sellaisia liuottimia kuin asetoni,
isopropyylialkoholi vetyperoksidi, kloridi, jodi, bromidi, fenoli tai muut voimakkaat liuokset.
Nämä aineet voivat olla haitallisia ja aiheuttaa värjääntymistä ja/tai vaurioita käsikappaleen muovipinnalle.
Nämä aineet voivat olla haitallisia ja aiheuttaa värjääntymistä ja/tai vaurioita latauslaitteen muovipinnalle.
Älä käytä hankaavia puhdistusaineita!
Puhdista ja pyyhi latauslaitteen kotelo puhtaalla, pehmeällä, nukkaamattomalla liinalla, joka on kostutettu miedolla
puhdistusaineella jonka pH on neutraali (pH7) valmistajan ohjeiden mukaisesti.
Kuivaa latauslaitteen koteli puhtaalla, hankaamattomalla liinalla.
VAROITUS
Kuivaa latauslaite puhdistuksen jälkeen. Laitteen sisällä oleva kosteus voisi aiheuttaa vaurioita.
TÄRKEÄÄ
Tehtyäsi puhdistustoimet varmista, että latauslaitteen sisällä olevat latauskontaktit ovat täysin kuivat.
Jos tarpeellista, kuivaa kontaktit puhaltamalla paineilmalla.
8.6.1
LATAUSLAITE– Latauskontaktien puhdistus
2x
TÄRKEÄÄ
Kun olet puhdistanut latauslaitteen muovikotelon, puhdista aina latauskontaktit. Latauslaitteen
latauskontaktit tulee aina pitää puhtaana liasta, yhdistelmämuovista ja puhdistusainejäämistä.
Latauslaitteen kontaktit tulee puhdistaa säännöllisin väliajoin (vähintään kerran viikossa) ja aina muovikotelon
puhdistuksen yhteydessä. Latauskontakteissa oleva lika tai niiden altistuminen nesteille, kuten puhdistus- tai
desinfiointiaineille, voi häiritä latausprosessia ja estää akun latautumisen.
Puhdista käsikappaleen latauskontaktit alkoholiin kastetulla pehmeällä, nukkaamattomalla liinalla tai vanulapulla.
VAROITUS
Älä käytä teräviä tai suippoja esineitä latauslaitteen kontaktien puhdistukseen!
Älä suihkuta tai kastele kontakteja nesteillä!
Älä taivuta latauslaitteen kontakteja tai muuta niiden muotoa puhdistuksen aikana.
Varmista, että latauslaitteen kontaktit jäävät kuiviksi puhdistuksen jälkeen eivätkä ole kosketuksessa
metallisten tai rasvaisten osien kanssa. Jos tarpeellista, kuivaa kontaktit puhaltamalla paineilmalla.
8.6.2 LATAUSLAITE – Vaihdettavat latauskontaktit
Latauslaitteen kontaktien vauriot tai runsas lika (jota ei voida puhdistaa edellisessä kappaleessa kuvatuilla toimilla)
voivat estää kontaktien johtavuutta ja siten akun latautumisen.
Tässä tapauksessa vaurioituneet latauslaitteen kontaktit voidaan vaihtaa uusiin.
Lisätietoja lataislaitteen kontaktien vaihtamisesta ja varaosien toimituksesta saat paikalliselta Heraeus Kulzerin
edustajalta.
Työskentelyohjeet:
Tarvittava työkalu: Phillips-Screws-ruuvimeisseli, keskikoko.
1. Poista käsikappale latausalustasta.
2. Kytke laturi irti verkosta.
3. Irrota liitäntäjohto laturista.
4. Käännä laturi ylösalaisin.
5. Irrota 2 ruuvia latauskontaktin sillasta (ks. avattava takakansi, kohta 12).
6. Vedä latauskontaktisilta ulos.
7. Laita uusi kontaktisilta sisään ja kiinnitä / yhdistä päinvastaiseen suuntaan.
VAROITUS
Älä taivuta tai kontaminoi uutta kontaktisiltaa!
Tee sisäänlaitto ja kiinnittäminen huolellisesti! Älä kiristä ruuveja liian tiukkaan!
9
2x
Käyttöaika
Käsikappaleen säilytys pidemmän käyttämättäolojakson aikana. Ennen pitkää käyttämättäolojaksoa tai sen jälkeen
lataa akku täyteen tai säilytä sitä toimivassa latauslaitteessa. Vaikka sisäänrakennettu akun turvapiiri estääkin
täydellisen tyhjentymisen, on erittäin suositeltavaa ladata akku viimeistään kerran 5 kuukautta jälkeen.
10
Hävittäminen
HUOMIO – TÄRKEÄÄ
Laitetta ei saa hävittää normaalina kotitalousjätteenä.
Varaosien tai laitteen hävittämisestä saat tietoja Heraeus Kulzerin jälleenmyyjältä suoraan maassasi.
Hävitä huoltokelvottomat akut ja valonjohtimet maasi vastaavien lakisääteisten vaatimusten mukaisesti.
VAKAVA VAROITUS – Vaurioituneen tai loppun käytetyn akun hävittäminen
Hävitä vaurioitunut tai loppuun käytetty akku tehtyäsi tarvittavat toimet oikosulun välttämiseksi
seuraavalla menetelmällä:
Eristettyäsi akun teipillä hävitä laite paikallisten ohjeiden mukaisesti.
Laitteen hävittämisen olosuhteita ja varotoimia koskevat samat voimassa olevat lain määräykset kuin mitä tahansa
muuta elektronista laitetta, joka on tullut käyttökelvottomaksi.
Vanhojen laitteiden hävittäminen WEEE (European Directive) tai
sähkö-ja elektroniikkalaitteiden laki (German Law ElektroG).
FI
- 19 -
11
Vianmääritys
VAKAVA VAROITUS
Jos seuraavat vaiheet eivät ratkaise ongelmaa, ota yhteyttä Heraeus Kulzerin tai paikallisen valtuutetun
asiakaspalvelun edustajaan: ÄLÄ KÄYTÄ Translux Wave ÄLÄKÄ YRITÄ huoltaa laitetta, sillä seurauksena
voi olla vakava vamma.
Jos laite ei näytä toimivan oikein, lue tämä käyttöopas uudelleen ja käy läpi seuraava taulukko:
ONGELMA
Latauslaite ei käynnisty.
VIHREÄ LED-VALO
latauslaitteessa on sammunut.
Käsikappale eI asetettuna
latauslaitteeseen.
Valosäteily ei käynnisty, kun
”Käynnistä / Pysäytä”-painiketta
painetaan eikä käsikappaleen
näytössä näy tietoja.
FI
- 20 -
”2 piippausta” kuuluu valotussyklin
päättyessä.
MAHDOLLINEN SYY
Tehonsyöttöyksikköä ei ole liitetty
sähköverkkopistorasiaan ja / tai
latauslaitteen virtapistukkaan.
Virtapistorasiassa ei ole jännitettä.
Vaihdettava adapteri ei ole asetetty oikein
tehonsyöttöyksikön koteloon.
Tehonsyöttöyksikön virtajohto on
vaurioitunut.
KORJAUSEHDOTUS
Varmista, että tehonsyöttöyksikkö on
tiukasti liitetty sähköverkkopistorasiaan
ja latauslaitteen virtapistukkaan.
Käytä toista pistorasiaa.
Lue tämän oppaan kappale 5.2
huolellisesti.
Vaihda tehonsyöttöyksikkö uuteen.
(Tehonsyöttöyksikköä ja sen johtoa
ei voida erottaa toisistaan.)
Tehonsyöttöyksikkö on viallinen.
Vaihda tehonsyöttöyksikkö uuteen.
Latauslaite on viallinen.
Ota yhteyttä Heraeus Kulzeriin tai
paikallisen valtuutetun asiakaspalvelun
edustajaan.
Latauslaitteen kontaktit ovat oikosulussa. Poista oikosulun syy.
Jos oikosulkutila jatkuu, vaihda
latauslaitteen kontaktit uusiin.
Katso kappaletta 8.6.2.
Käsikappale ilman akkua.
Aseta akku käsikappaleeseen
(ks. Kappale 5.3).
Paina ”Käynnistä / Pysäytä”-painiketta
Käsikappale on „Lepotilaan“.
saadaksesi käsikappaleen pois
”Lepotilaan”. Katso kappale 6.3.
Tyhjä akku.
Aseta käsikappale latauslaitteeseen ja
Akussa ei ole riittävästi latausta käsikap- lataa akku uudelleen (ks. kappale 5.5).
paleen käynnistämiseen.
Elektroniikan toimintahäiriö.
Ota yhteyttä Heraeus Kulzeriin tai
paikallisen valtuutetun asiakaspalvelun
edustajaan.
Viallinen akku.
Tarkistaaksesi, onko akku viallinen,
aseta käsikappale latauslaitteeseen.
”Alustava sekvenssi” käynnistyy
ja Translux Wave mikro-prosessori
tarkistaa akun tilan. Tämä kestää max
30 minuuttia.
Jos tämän vaiheen aikana kuuluu
”piippaus”-signaali joka sekuntti
30 sekunnin ajan ja akku ikoni käsikappaleessa vilkkuu KELTAISTA,
osoittaa se että akku on viallinen.
Vaihda akku uuteen (ks. kappale 5.3).
Vähäinen akun lataus.
”2 piippausta” ilmoittavat, että akun jäljellä oleva lataus riittää vain muutamaan
seuraavaan valotussykliin.
Aseta käsikappale latauslaitteeseen ja
lataa akku uudelleen (ks. kappale 5.5).
ONGELMA
MAHDOLLINEN SYY
Lamppu ei käynnisty kun ”Käynnistä / LED laite voi olla viallinen.
Pysäytä”-painiketta
painetaan
tai kun valotus keskeytyy ja kuuluu
”beep” äänimerkki. Kovetus LED ”10s”
käsikappaleessa alkaa vilkkua
VIHREÄÄ.
vilkkuu
Usean peräkkäisen valotussyklin
jälkeen valosäteily ei käynnisty, kun
”Käynnistä / Pysäytä”-painiketta
painetaan, ja ”3 piippausta”
kuuluu.
Valotussyklin aikana kuuluu
”3 piippausta”.
Toimintahäiriöt latauksen aikana.
”Piippaus kuuluu” sekunnin välein
30 sekunnin ajan ja akun tilan LED
merkkivalo, käsikappaleessa, vilkkuu
KELTAISTA.
Ylikuumenemissuojaus.
Käsikappale on ylikuumentunut käytön
aikana, ja lämpötilan ylikuormitusanturi
on aktivoitunut.
Ylikuumenemissuojaus estää
tilapäisesti (muutaman minuutin ajan)
laitteen käytön.
Ylikuumenemissuojaus.
Käsikappale on ylikuumentunut käytön
aikana, ja lämpötilan ylikuormitusanturi
on aktivoitunut.
Ylikuumenemissuojaus estää
tilapäisesti (muutaman minuutin ajan)
laitteen käytön.
Akun esikvalifikaatiovaiheen aikana
(akun tila: täysin tyhjä, ks. kappaleet
4.2.4 ja 5.5).
Elektroniikka havaitsee akun
vika- tai toimintahäiriötilan ja keskeyttää
latausprosessin.
vilkkuu
Käsikappale on asetettu latausVika: ei kontaktia latauslaitteeseen.
laitteeseen, mutta latausvaihe ei
Huono kontakti latausalustan ja käsikapkäynnisty.
paleen välillä.
Vihreä akun tilan LED käsikappaleessa
on sammuksissa.
Latauslaitteeseen integroidulla mittarilla mitattu valoteho on riittämätön.
LED-valo
latauslaitteessa palaa
KELTAISENA.
Lataus- ja / tai käsikappalekontaktit ovat
likaiset.
Valonjohdinta ei ole asetettu oikein
käsikappaleeseen.
Valonjohtimen ulostulo on likaantunut
vieraasta materiaalistä tai yhdistelmämuovista, mikä voi häiritä valon
ulostuloa.
Valonjohdin on vaurioitunut tai kulunut.
KORJAUSEHDOTUS
Varmista LED laitteen toimivuus
seuraavan menettelyn avulla:
Aseta käsikappale latausyksikköön ja
paina ”Käynnistä / Pysäytä”-painiketta 5 kertaa peräkkäin.
Poista käsikappale latausyksiköstä.
Kovetus LED ”10s” käsikappaleessa
lopettaa vilkkumasta vihreää on käsikappale nollattu.
Jos kovetus LED ”10s” käsikappaleessa
vilkkuu taas seuraavaa valokovetusta
aloittaessa ja valokovetus ei käynnisty
on LED lamppu viallinen. Tässä tapauksessa ota yhteyttä Heraeus Kulzeriin.
Anna käsikappaleen jäähtyä vähintään
4 – 5 minuutin ajan ja käynnistä
sitten seuraava valotus painamalla
”Käynnistä / Pysäytä”-painiketta.
Huomio: Käsikappale aloittaa toimintansa saavutettuaan käyttölämpötilan
– no ”reset” on tarpeen.
Anna käsikappaleen jäähtyä vähintään
4 – 5 minuutin ajan ja käynnistä
sitten seuraava valotus painamalla
”Käynnistä / Pysäytä”-painiketta.
Vaihda akku uuteen (ks. kappale 5.3).
2x
Katso kappaleet 8.5 ja 8.6.2.
Tarkista, onko käsikappale asetetty
latauslaitteeseen oikeassa suunnassa.
Kohdistusmerkki. Katso kappale 4.2.1,
kohdat 4 ja 5.
Puhdista käsikappaleen ja latauslaitteen
kontaktit. Katso kappaleet 8.5 ja 8.6.1.
Tarkista, että valonjohdin on täysin työnnettynä käsikappaleen metallikartioon.
Puhdista valonjohtimen ulostulo.
Katso kappaletta 8.2.
Vaihda valonjohdin uuteen.
FI
- 21 -
12
Tekniset tiedot
Luokitus direktiivin 93/42/EEC mukaan:
Safety Standards:
Luokitus IEC 60601-1 mukaan:
Latauslaite:
Tehonsyöttö latauslaitteelle:
Tehonsyöttö käsikappaleelle:
Käsikappale:
Valonlähde:
Valonjohdin:
Valittavat valotussykliä:
– Normaali valotus
FI
- 22 -
– ”Pehmeä käynnistys” -valotus
Tyhjän akun latausaika:
Laitteen ympäristöolosuhteet:
Luokka I (yksi)
Tuote on testattu ja täyttää vaatimukset IEC 60601-1
(second edition) ja IEC 60601-1-1.
Tuote on testattu ja täyttää vaatimukset IEC 60601-1 (third edition)
ja IEC 60601-1-2 ( third edition – for electromagnetic compatibility –
EMC).
Käsikappale on tarkoitettu potilaan hoitoon potilasalueella.
Latausasemaa ja sähköadapteria ei ole tarkoitettu käytettäväksi
potilashoidossa ohjeiden mukaisesti.
Huomio: Potilaan ympäröivä alue on määritelty 1,5 m potilaasta
(IEC 60601-1, third edition and IEC 60601-1-1).
Luokka II, Tyyppi B, Varaosat: Valonjohdin ja kooninen valosuoja.
IP 20 (latauslaite).
IP 20 (Translux Wave)
Translux Wave Latauslaite
Sähköadapteri (Direct Plug-in) valmistaa:
Phihong Technology CO LTD – Malli: PSACO5R-050.
Input: 100 – 240 V
– 300 mA – 50 / 60 Hz –.
Output: 5 V
– 1 A Max –
.
II luokan laite
Uudelleenladattava litiumioniakku.
Valmistaja: Panasonic. Malli: NCR-18500.
Nimellisjännite: 3,6 V.
Nimellisteho (tyypillinen): 2000 mAh
Malli: Translux Wave.
Toiminta: Intermittent service: 120“ ON – 40“ OFF – max 2 sykliä
Erittäin valotehoinen LED.
LED tuoteluokka 2M (IEC 60825-1).
Aallonpituusalueella: 440 – 480 nm.
Hallitseva aallonpituus: Min. 440 nm – Max 465 nm
Lyijytön moniydinsauva, läpimitta 8 mm.
Steriloitavissa esivakuumi-höyryautoklaavissa:
4 minuuttia (minimi) minimilämpötilassa 132°C + 3°C (270°F + 5°F).
Enint. 500 sykliä
10 sekunnin valotusaika.
Äänimerkit:
1 piippaus valotuksen alkaessa.
1 piippaus valotuksen päättyessä
20 sekuntia valotusaikaa. (”Pehmeä käynnistys” tarkoittaa valotehon
kasvua 50 %:sta 100 %:iin 2 sekunnin kuluessa.)
Äänimerkit:
1 piippaus valotuksen alkaessa.
1 piippaus 1 sekunnin jälkeen ”Pehmeä käynnistys” tlan aktivointi.
1 piippaus 10 sekunnin valotuksen jälkeen.
1 piippaus valotuksen päättyessä
Noin 3 tuntia
Lämpötila
Suhteellinen kosteus
Ilmanpaine
Paino ja mitat:
Käyttö
10°C – 35°C
(50°F – 95°F)
45 % – 85 %
800 – 1060 hPa
Latauslaite: paino 450 g.
MItat: P 140 x L 58 x K 62 mm
Käsikappale: paino 150 g (sis. valonjohtimen).
Mitat: P 275 mm, maks. Ø 24 mm
Kuljetus ja säilytys
–20°C – 40°C
(–4°F – 104°F)
45 % – 85 %
500 – 1060 hPa
12.1
Sähkömagneettinen yhteensopivuus EN 60601-1-2
VAKAVA VAROITUS
Laitteeseen on tehtävä erityistoimenpiteitä sähkömagneettisen yhteensopivuuden varmistamiseksi.
Asennus ja aktivointi täytyy tehdä oheisten ohjeiden mukaan.
Siirrettävät ja kannettavat radioviestintälaitteet saattavat vaikuttaa laitteen oikeaan toimintaan.
Johdanto ja valmistajan selvitys – sähkömagneettinen säteily
Translux Wave on tarkoitettu käytettäväksi alla kuvatunlaisessa sähkömagneettisessa ympäristössä.
Asiakkaan tai Translux Wave käyttäjän tulee varmistaa, että sitä käytetään sellaisessa ympäristössä.
Säteilytarkastus
YhdenmuSähkömagneettinen ympäristö – Johdanto
kaisuus
HF-säteily CISPR 11
Ryhmä 1
Translux Wave useskäyttää radiotaajuusenergiaa sisäisiin
toimintoihinsa. Siksi sen radiotaajuuspäästöt ovat hyvin
pienet eivätkä todennäköisesti aiheuta häiriötä lähellä olevissa
elektronisissa laitteissa.
HF-säteily CISPR 11
Luokka B
Translux Wave sopii käytettäväksi kaikissa rakennuksissa,
mukaanlukien suoraan yleiseen pienjännitesähköverkkoon
Harmoniset säteilyt
Luokka A
liitetyt asuinrakennukset ja tämänkaltaiset rakennukset,
IEC 61000-3-2
sekä yksityiskäytössä oleviin rakennuksiin hankittavaksi.
Jännitteenvaihtelu-säteily / välkyntä
YhdenmuIEC 61000-3-3
kainen
Johdanto ja valmistajan selvitys – sähkömagneettinen häiriösieto
Translux Wave on tarkoitettu käytettäväksi alla kuvatunlaisessa sähkömagneettisessa ympäristössä.
Asiakkaan tai Translux Wave käyttäjän tulee varmistaa, että sitä käytetään sellaisessa ympäristössä.
Häiriösiedon tarkastus Tarkastusarvo IEC 60601
Yhdenmukaisuusarvo
Sähkömagneettinen ympäristö –
Johdanto
Sähköstaattiset
±6 kV kosketuksessa
Laite toimii asianmukaisesti Lattioiden täytyy olla puuta, betonia
purkaukset (ESD)
ja luotettavasti.
tai keramiikkaa. Jos lattia on pääl±8 kV ilmassa
IEC 61000-4-2
lystetty synteettisellä materiaalilla,
suhteellisen kosteuden pitää olla
vähintään 30 %.
Nopeat, transienttiset
±2 kV tehonsyöttöjohdoille
Laite toimii asianmukaisesti Verkkojännitteen laadun pitää olla
sähköiset
ja luotettavasti.
tyypillisessä liike- tai sairaalaym±1 kV tulo-/ lähtölinjoille
häiriösuureet / purstit
päristössä käytettävää verkkoIEC 61000-4-4 mukaan
jännitettä koskevien vaatimusten
mukainen.
Impulssi
±1 kV erotusjännite
Laite toimii asianmukaisesti Verkkojännitteen laadun pitää olla
IEC 61000-4-5
ja luotettavasti.
tyypillisessä liike- tai sairaalaym±2 kV tasajännite
päristössä käytettävää verkkojännitettä koskevien vaatimusten
mukainen.
Laite voi vaihdella vaadituis- Verkkojännitteen laadun pitää olla
Sähkönsyötön tulo< 5 % UT
(> 95 %:n pudotus UT)
ta häiriönsietotasoista kes- tyypillisessä liike- tai sairaalaymjohdon jännitevuodot,
0,5 sykleille
ton puolesta niin kauan kuin päristössä käytettävää verkkolyhyet jännitteiden
laite pysyy turvallisena, siinä jännitettä koskevien vaatimusten
katkeamiset
40 % UT
ei ole havaittu toimintahäiri- mukainen..
ja muuttumiset
(60 %:n pudotus UT)
öitä ja se voidaan palauttaa
IEC 61000-4-11
5 sykleille
testiä edeltävään tilaan
70 % UT
käyttäjän interventiolla.
(30 %:n pudotus UT)
25 sykleille
< 5 % UT
(> 95 %:n pudotus UT)
5 sekunnissa
Verkkotaajuuden
3A/m
Laite toimii asianmukaisesti Verkkotaajuuden magneettikenttien
magneettikenttä
ja luotettavasti.
pitää olla liike- ja sairaalaympäri(50 / 60 Hz)
stöille ominaisella tasolla.
IEC 61000-4-8
HUOMAUTUS: UT on vaihtovirran verkkojännite ennen tarkastusarvon käyttöä.
FI
- 23 -
Johdanto ja valmistajan selvitys – sähkömagneettinen häiriösieto
Translux Wave on tarkoitettu käytettäväksi alla kuvatunlaisessa sähkömagneettisessa ympäristössä.
Asiakkaan tai Translux Wave käyttäjän tulee varmistaa, että sitä käytetään sellaisessa ympäristössä.
Häiriösietoisuus Tarkastusarvo
Yhdenmukaisu- Sähkömagneettinen ympäristö – Johdanto
tarkastus
IEC 60601
usarvo
Johtunut
3 Veff taajuLaite toimii
Kannettavia korkeataajuusmatkapuhelimia ei saa käyttää
korkeataajuinen udesta 150 kHz
asianmukaisesti tuotteen tai osan läheisyydessä siitä, mukaanluettuna kaapeli.
IEC 61000-4-6
80 MHz saakka
ja luotettavasti.
Ellei näin tehdä, on noudatettava suositeltuja etäisyyksiä,
jotka lasketaan kaavalla, jotka ovat käyttökelpoisia lähettimen
Säteily
3 V / m taajutaajuudelle.
korkeataajuinen udesta 80 MHz
Suositellut etäisyydet
IEC 61000-4-3
2,5 GHz saakka
d = 1,2 √P
d = 1,2 √P taajuudesta 80 MHz – 800 MHz saakka
d = 2,3 √P taajuudesta 800 MHz – 2,5 GHz saakka
(P) on lähettimen valmistajan ilmoittama lähettimen suurin
nimellislähtöteho watteina (W) ja (d) on suositeltu etäisyys
metreinä (m). Liikkumattoman korkeataajuuslähettimen
kentänvoimakkuus, kuinka se paikan sähkömagneettisessa
tutkimuksessa toistaiseksi määritetään, täytyy olla
pienempi kuin yhdenmukaisuusarvo jokaisessa
taajuusvälissä (b). Laitteen läheisyydessä voi esiintyä
häiriöitä, joka esitetään seuraavalla merkillä:
Huomautukset:
(1) Taajuudella 80 MHz ja 800 MHz pätee korkeampi taajuusalue.
(2) Näitä suuntaviivoja ei voi välttämättä käyttää kaikissa tapauksissa. Sähkömagneettisen säteilyn leviämiseen vaikuttaa
rakenteiden, esineiden ja henkilöiden aiheuttama absorbtio ja heijastuminen.
a) Paikallaan pysyvän lähettimen kentänvoimakkuutta, kuten matkapuhelimen tukiasemat tai kannettavat maaradioasemat, radioamatööriasemat, AM- ja FM-radio- ja televisiolähetykset, ei voi teoreettisesti ennakolta tarkkaan määrätä.
Selvittääksesi sähkömagneettisen ympäristön paikallaan olevaan lähettimeen nähden on paikasta suoritettava tutkimus.
Kun mitattu kentänvoimakkuus käytettävässä sijaintipaikassa ylittää ylläolevan yhdenmukaisuusarvon, tuotetta tulee
tarkkailla määräystenmukaisen toiminnan todistamiseksi. Kun havaitaan epätavallisia tehotunnuksia, lisätoimenpide voi
olla tarpeen, esim. suuntauksen muuttaminen tai tuotteen paikan vaihtaminen.
b) Taajuusalueella 150 kHz – 80 MHz kentänvoimakkuuden tulee olla pienempi kuin 3 V / m.
FI
- 24 -
Suositellut etäisyydet kannettavien radiolaitteiden ja matkapuhelinten sekä Translux Wave:n välillä
Translux Wave on tarkoitettu käytettäväksi sähkömagneettisessa ympäristössä, jossa korkeataajuisen säteilyn aiheuttamat
häiriöt ovat hallinnassa. Ostaja tai Translux Wave:n käyttäjä voi välttää sähkömagneettisia häiriöitä pitämällä vähimmäisetäisyyden kannettavien radiotaajuuslaitteiden ja matkapuhelinten (lähetin) välillä ja noudattaa Translux Wave:lle alla ilmoitettuja
suosituksia kulloistenkin radiolaitteiden maksimaalisen lähtötehon mukaan.
Lähettimen enimmäislähtöteh Suojaetäisyys riippuu lähetystaajuudesta (m)
o (W)
150 kHz – 80 MHz
80 MHz – 800 MHz
800 MHz – 2,5 GHz
d = 1,2 √P
d = 1,2 √P
d = 2,3 √P
0,01
0,12
0,12
0,23
0,1
0,38
0,38
0,73
1
1,2
1,2
2,3
10
3,8
3,8
7,3
100
12
12
23
Lähettimelle, jolle yllä mainittua maksimaalista nimellislähtötehoa ei ole mainittu, suositeltu etäisyys (d) voidaan laskea
metreinä (m) lähettimen taajuudelle käytettävällä kaavalla, jolloin (P) on lähettimen valmistajan ilmoittama lähettimen suurin
nimellislähtöteho watteina (W).
Huomautukset:
(1) 80 MHz:n ja 800 MHz:n kohdalla käytetään korkeimpia taajuusvälejä.
(2) On mahdollista, että näitä ohjeita ei ole käytettävä kaikissa tilanteissa. Sähkömagneettinen leviäminen vaikuttaa
esineisiin ja ihmisiin heijastumalla ja imeytymällä rakenteisiin.
12.2
Latauslaitteen tunnistuslevy
Tunnistuslevyn symbolien kuvaus
1 CE-merkintä.
2 Varoitus, katso mukana tulevia asiakirjoja.
3 Katso käyttöohjeita.
4 Kaksinkertainen eristys (laite on turvallisuusluokan II mukainen).
5 Vanhan sähköisen ja elektroninen laitteen hävittäminen.
(Sovelletaan EU:ssa ja muissa Euroopan maissa erillisillä
keräysjärjestelmillä.)
6 MET-merkintä.
12.3
Käsikappaleen sarjanumero
Käsikappaleen sarjanumero on kaiverrettu
sen kotelon pohjaan.
Kaiverrettu
sarjanumero.
13
1
2
3
4
5
6
Takuu
Jokainen Heraeus Kulzer-laite joutuu ennen toimitusta ankaran testauksen ja lopputarkastuksen kohteeksi, jotta
pystytään takaamaan laitteen moitteeton toiminta. Heraeus Kulzer antaa kaikille Heraeus Kulzer-jälleenmyyjältä
tai -maahantuojalta uutena ostetuille Heraeus Kulzer-tuotteille 2 (kahden) vuoden takuun ostopäivämäärästä materiaalija valmistusvirheiden varalta. Heraeus Kulzer on sitoutunut korjaamaan takuuaikana mielestään vialliset tuotteen
osat ilmaiseksi (tai vapaavalintaisesti korvaamaan uudella). Heraeus Kulzer-tuotteiden kokonaiskorvausta ei ole.
Heraeus Kulzer ei vastaa missään tapauksessa suorista tai epäsuorista henkilö- ja esinevaurioista seuraavissa
tapauksissa:
• Laitettaeiolekäytettysilletarkoitettuunkäyttötarkoitukseen.
• Laitettaeiolekäytettytässäohjekirjassakuvattujenohjeidenjamääräystenmukaisesti.
• Sähköasennukset tiloissa, joissa laitetta käytetään, eivät vastaa voimassaolevia lakeja ja niihin kuuluvia määräyksiä.
• Kokoamista,lisäyksiä,säätöjä,muutoksiataikorjauksiaeioletehnytHeraeusKulzer-ammattihenkilökunta.
• Laitteensäilytystäjavarastointiakoskevattilavaatimukseteivätvastaakappalessa12(Teknisettiedot)annettuja
ohjeita.
Takuun piiriin eivät kuulu kuljetusvauriot, asiattomata käytöstä tai huolimattomuudesta johtuvat vauriot, muuhun
kuin laitteelle tarkoitettuun verkkovirtaan kytkemisestä aiheutuneet vauriot sekä merkkivalot, näppäimet ja muut
lisävarusteet. Takuu raukeaa, jos laitetta on muuttanut tai korjannut joku muu kuin asiakaspalvelun henkilöt.
Takuuvaatimusta varten on asiakkaan toimitettava omalla kustannuksellaan vaurioitunut laite jälleenmyyjälle tai
Heraeus Kulzer-maahantuojalle, jolta on laitteen ostanut. Laite ja lisäosat on lähetettävä hyvin pakattuina (mielellään
alkuperäisessä pakkauksessa).
FI
Seuraavat tiedot sisältävä kortti on liitettävä laitteen mukaan, jos se palautetaan:
a) Omistajan nimi, osoite ja puhelinnumero.
- 25 b) Jälleenmyyjän/maahantuojan nimi ja osoite.
c) Kopio laitteen omistajan kuormakirjeestä / ostokuitista, jossa näkyy päiväyksen lisäksi laitten kuvaus
ja sarjanumero.
d) Toimintähäiriön kuvaus.
Kuljetuksesta ja kuljetusvaurioista ei vastata.
Jos vauriot ovat aiheutuneet onnettomuudessa tai epäasiallisen käytön vuoksi tai takuuajan päättymisen jälkeen,
veloitetaan korjauksesta materiaali- ja työkustannusten mukaisesti.
14
Huolto
14.1
Huollon yhteystiedot / yhteystiedot maissa
15
Asiakirjahistoria
1x
2012-08 Luonnosversio prototyypeille.
2013-09 Ensimmäinen laitos.
2014-03 Muutokset kappaleessa 2.1, 3.2.1, 7.2, 10, 11, 12 ja 12.2.
FI
- 26 -
Muutosten kohteena.
Painos: 2014-03
Πίνακας περιεχομένων
1
1.1
1.2
1.3
Εφαρμογή _______________________________________________________________________
Γενικά ________________________________________________________________________
Δήλωση πιστότητας ΕΚ ____________________________________________________________
Δήλωση του κατασκευαστή __________________________________________________________
3
3
3
3
2
2.1
2.2
2.3
2.4
Οδηγίες σχετικά με την ασφαλή χρήση της μονάδας _______________________________________
Ερμηνεία των συμβόλων και των συνοδευτικών όρων _______________________________________
Ζημιά κατά τη μεταφορά – Άνοιγμα συσκευασίας και επιθεώρηση _____________________________
Υποχρεώσεις ιδιοκτήτη ____________________________________________________________
Ημερολόγιο μηχανήματος __________________________________________________________
3
3
4
4
4
3
3.1
3.2
3.2.1
3.2.2
3.2.3
3.2.4
3.2.5
Προβλεπόμενη χρήση ______________________________________________________________
Περιγραφή της συσκευής __________________________________________________________
Απαιτήσεις ασφαλείας ____________________________________________________________
Γενικές οδηγίες ασφαλείας για τη λειτουργία της μονάδας ___________________________________
Προφυλάξεις ασφαλείας ___________________________________________________________
ΜΠΑΤΑΡΙΑ – Προφυλάξεις ασφαλείας __________________________________________________
ΜΠΑΤΑΡΙΑ – Πληροφορίες _________________________________________________________
ΕΥΘΥΝΗ _______________________________________________________________________
4
5
5
5
6
6
7
8
4
4.1
4.2
4.2.1
4.2.2
4.2.3
4.2.4
4.2.5
Περιγραφή συσκευής ______________________________________________________________ 8
Περιεχόμενα συσκευασίας __________________________________________________________
8
Περιγραφή των στοιχείων χειρισμού και λειτουργίας ________________________________________
8
Μονάδα χειρός __________________________________________________________________
8
Οδηγός ευθυγράμμισης ____________________________________________________________
8
Μονάδα φόρτισης ________________________________________________________________
8
Ηχητικά σήματα μονάδας χειρός ______________________________________________________
9
Πληροφορία εκπεμπόμενης ακτινοβολίας λυχνιών LED _____________________________________ 10
5
5.1
5.2
5.3
5.4
5.5
Εγκατάσταση και αρχική λειτουργία ___________________________________________________
Απαιτήσεις ασφαλείας κατά την εγκατάσταση ____________________________________________
Σύνδεση της βάσης φόρτισης στην πρίζα _______________________________________________
Τοποθέτηση της μπαταρίας στη μονάδα χειρός ___________________________________________
Τοποθέτηση της φωτοθυρίδας στη μονάδα χειρός _________________________________________
Φόρτιση μπαταρίας ______________________________________________________________
10
10
11
11
12
12
6
6.1
6.2
6.3
6.4
Λειτουργία _______________________________________________________________________
Ενεργοποίηση και απενεργοποίηση του κύκλου έκθεσης ____________________________________
Μέτρηση της έντασης του φωτός _____________________________________________________
Λειτουργία αναμονής ______________________________________________________________
Πρόσθετες πληροφορίες σχετικά με τις λειτουργίες της συσκευής _____________________________
13
13
14
15
15
7
7.1
7.2
7.3
7.4
7.5
Καταστάσεις συναγερμού ___________________________________________________________
Βλάβη μπαταρίας ________________________________________________________________
Βλάβη LED _____________________________________________________________________
Προστασία από υπερθέρμανση ______________________________________________________
Βλάβη ΕΝΣΩΜΑΤΩΜΕΝΟΥ αισθητήρα υπερθέρμανσης ______________________________________
Ένδειξη χαμηλής μπαταρίας ________________________________________________________
15
15
15
15
15
16
ΣΗΜΕΙΩΣΗ
Χρησιμοποιήστε το εικονίδιο του βιβλίου για να βρείτε
τις εικόνες του κεφαλαίου ή περαιτέρω πληροφορίες στο
πτυσσόμενο κάλυμμα.
HKG-Layout 99000943_01 GBA
1x /2x
Ανοίξτε το εμπρός
πτυσσόμενο
κάλυμμα
Ανοίξτε το πίσω
πτυσσόμενο
κάλυμμα
12GR
Translux Wave EU
Dateiname: 12GR_99000943_01_W11180_GBA TL Wave EU_V01_X3
SAP-Nr:
99000943
Projektmanager:
Michael Helken
EURO / Pantone
C
M
Y
K
Version
01
HK-Toolbox-Nr:
W11180
Format:
297 x 210 mm
Falzmaß:
148 x 210 mm
HKG-Version:
V01, 0.AK
Datum
05.03.2014
HKG Freigabe am
Sonderfarben
Druckverfahren: Digitaldruck
varnish DieCut var.Data
GR
-1-
8
8.1
8.2
8.2.1
8.3
8.3.1
8.4
8.4.1
8.4.1.1
8.4.1.2
8.5
8.6
8.6.1
8.6.2
Καθαρισμός, απολύμανση και αποστείρωση _____________________________________________
Αποσυναρμολόγηση ______________________________________________________________
ΦΩΤΟΘΥΡΙΔΑ – Καθαρισμός και απολύμανση ____________________________________________
ΦΩΤΟΘΥΡΙΔΑ – Επιθεώρηση πριν από την αποστείρωση ____________________________________
ΠΡΟΣΤΑΤΕΥΤΙΚΟΣ ΚΩΝΟΣ – Καθαρισμός και απολύμανση ___________________________________
ΠΡΟΣΤΑΤΕΥΤΙΚΟΣ ΚΩΝΟΣ – Επιθεώρηση πριν από την αποστείρωση ___________________________
ΦΩΤΟΘΥΡΙΔΑ και ΠΡΟΣΤΑΤΕΥΤΙΚΟΣ ΚΩΝΟΣ – Συσκευασία πριν από την αποστείρωση _______________
ΦΩΤΟΘΥΡΙΔΑ και ΠΡΟΣΤΑΤΕΥΤΙΚΟΣ ΚΩΝΟΣ – Αποστείρωση __________________________________
Μέθοδος αποστείρωσης ___________________________________________________________
Παράμετροι αποστείρωσης _________________________________________________________
ΜΟΝΑΔΑ ΧΕΙΡΟΣ – Καθαρισμός και απολύμανση _________________________________________
ΒΑΣΗ ΦΟΡΤΙΣΗΣ – Καθαρισμός περιβλήματος ___________________________________________
ΒΑΣΗ ΦΟΡΤΙΣΗΣ – Καθαρισμός επαφών φόρτισης ________________________________________
ΒΑΣΗ ΦΟΡΤΙΣΗΣ – Αντικαθιστώμενες επαφές φόρτισης _____________________________________
16
16
16
16
16
17
17
17
17
17
17
18
18
19
9
Αποθήκευση ______________________________________________________________________ 19
10
Απόρριψη _______________________________________________________________________ 19
11
Αντιμετώπιση προβλημάτων _________________________________________________________ 20
12
12.1
12.2
12.3
Τεχνικές προδιαγραφές ____________________________________________________________
Ηλεκτρομαγνητική συμβατότητα EN 60601-1-2 __________________________________________
Πινακίδα αναγνώρισης της βάσης φόρτισης ______________________________________________
Σειριακός αριθμός μονάδας χειρός ____________________________________________________
13
Εγγύηση _________________________________________________________________________ 25
14
14.1
Σέρβις __________________________________________________________________________ 26
Συνεργάτες σέρβις / Αρμόδια πρόσωπα σε διάφορες χώρες __________________________________ 26
15
Ιστορικό εγγράφων ________________________________________________________________ 26
22
23
25
25
GR
-2-
ΣΗΜΕΙΩΣΗ
Χρησιμοποιήστε το εικονίδιο του βιβλίου για να βρείτε
τις εικόνες του κεφαλαίου ή περαιτέρω πληροφορίες στο
πτυσσόμενο κάλυμμα.
1x /2x
Ανοίξτε το εμπρός
πτυσσόμενο
κάλυμμα
Ανοίξτε το πίσω
πτυσσόμενο
κάλυμμα
1
Εφαρμογή
1.1
Γενικά
Η επωνυμία Translux Wave είναι σήμα κατατεθέν της Heraeus Kulzer GmbH.
Αυτές οι Οδηγίες Λειτουργίας ισχύουν για:
Αριθ. παραγγελίας Τύπος και εξοπλισμός
66055012
Translux Wave – Συσκευή φωτοπολυμερισμού LED
Έκδοση
2014-03 / 99000943/01
1.2
Δήλωση πιστότητας ΕΚ
Με την παρούσα δηλώνουμε, η φίρμα Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau, ότι η κάτωθι ονομαζόμενη
συσκευή βάσει του σχεδιασμού και του τύπου κατασκευής της καθώς και της έκδοσης που διαθέσαμε στην κυκλοφορία
ανταποκρίνεται στις σχετικές απαιτήσεις ασφαλείας και υγείας των οδηγιών της ΕΚ.
Σε περίπτωση μιας αλλαγής της συσκευής, χωρίς προσυνεννόηση μαζί μας, αυτή η δήλωση καθίσταται άκυρη.
1.3
Δήλωση του κατασκευαστή
Βεβαιώνουμε ότι η μονάδα Translux Wave συμμορφώνεται με την οδηγία 93/42 ΕΚ και τα πρότυπα IEC 60601-1
και IEC 60601-1-2.
Hanau, 2014-03 – Heraeus Kulzer GmbH, Grüner Weg 11, 63450 Hanau (Γερμανία).
2
Οδηγίες σχετικά με την ασφαλή χρήση της μονάδας
Παρακαλούμε διαβάστε αυτό το εγχειρίδιο και ακολουθήστε τις οδηγίες που περιέχονται σε αυτό προσεκτικά.
Οι όροι ΠΡΟΕΙΔΟΠΟΙΗΣΗ, ΠΡΟΣΟΧΗ και ΣΗΜΕΙΩΣΗ έχουν ιδιαίτερη σημασία και θα πρέπει να εξεταστούν προσεκτικά
(ανατρέξτε στην επόμενη παράγραφο). Διατηρείτε πάντα αυτό το εγχειρίδιο σε σημείο με εύκολη πρόσβαση.
2.1
Ερμηνεία των συμβόλων και των συνοδευτικών όρων
Σύμβολα
Συνοδευτικοί όροι
Ερμηνεία
ΠΡΟΕΙΔΟΠΟΙΗΣΗ
Συνεπάγεται ότι θάνατος ή σοβαρός τραυματισμός μπορεί να προκληθεί,
αν δεν ακολουθήσετε τις οδηγίες
ΠΡΟΣΟΧΗ
Συνεπάγεται ότι ελαφρύς τραυματισμός ή βλάβη στη συσκευή μπορεί
να προκληθεί, αν δεν ακολουθήσετε τις οδηγίες
ΣΗΜΕΙΩΣΗ
Συνεπάγεται οδηγία που δεν σχετίζεται με βλάβη/ζημιά.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ
ΕΚΡΗΞΗΣ
ΠΡΟΕΙΔΟΠΟΙΗΣΗ έκρηξης – διαβάστε με προσοχή τις πληροφορίες και τις
προειδοποιήσεις στα κεφάλαια και τις ενότητες που επισημαίνονται με αυτό
το σύμβολο.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ ηλεκτροπληξίας.
Προτού εκτελέσετε τις διαδικασίες καθαρισμού και απολύμανσης,
αποσυνδέστε τη βάση φόρτισης από την παροχή ηλεκτρικού ρεύματος!
Σήμανση ΜΕΤ – Συμμόρφωση με UL / CSA.
ΑΠΟΣΥΝΔΕΣΤΕ
ΑΠΟ ΤΗΝ ΠΡΙΖΑ
MET
WEEE / ElektroG
Απόρριψη παλιάς συσκευής, σύμφωνα με το πρότυπο WEEE
(Ευρωπαϊκή Οδηγία) ή την Οδηγία για Ηλεκτρικό και Ηλεκτρονικό Εξοπλισμό
(Γερμανικός Νόμος ElektroG).
Εφαρμοζόμενο τμήμα:
Εφαρμοζόμενο τμήμα τύπου B σύμφωνα με τα τεχνικά πρότυπα IEC 60601-1.
Διπλή μόνωση:
Συσκευή κατηγορίας II.
Τροφοδοσία:
Εναλλασσόμενο ρεύμα.
Συνεχές ρεύμα.
Ανοίγοντας την πολικότητα παροχής ρεύματος – Θετική.
GR
-3-
Σύμβολα
Συνοδευτικοί όροι
Ερμηνεία
Χρησιμοποιήστε μόνο σε κλειστό χώρο.
Η κατασκευή της συσκευής συμμορφώνεται με την οδηγία 93/42/ΕΚ,
καθώς και με τα τεχνικά πρότυπα IEC 60601-1 και IEC 60601-1-2.
Σύμβολο ΠΡΟΕΙΔΟΠΟΙΗΣΗΣ για „ακτινοβολία LED“.
Διαβάστε προσεκτικά τις πληροφορίες και τους κινδύνους που περιγράφονται
στην παράγραφο 4.2.5.
Συμβουλευτείτε τις οδηγίες χρήσης.
ΠΡΟΣΟΧΗ, συμβουλευτείτε τα συνοδευτικά έγγραφα.
Διακόπτης λειτουργίας:
„Έναρξη / Τερματισμός“.
Πιστοποιητικό καταχώρησης σύμφωνα με το υπουργείο υγείας της Ρωσικής
Ομοσπονδίας.
Να φυλάσσεται μακριά από τη βροχή.
Όρια θερμοκρασίας αποθήκευσης (–20°C (–4°F) έως 40°C (104°F)).
Όρια υγρασίας αποθήκευσης (45% – 85% RH).
Όρια ατμοσφαιρικής πίεσης αποθήκευσης (500 – 1060 hPa).
GR
-4-
2.2
Ζημιά κατά τη μεταφορά – Άνοιγμα συσκευασίας και επιθεώρηση
Η συσκευή είναι ευαίσθητη στα κτυπήματα, επειδή περιλαμβάνει ηλεκτρονικά εξαρτήματα. Γι’αυτό τόσο κατά τη μεταφορά
όσο και στην αποθήκευση απαιτείται ιδιαίτερη προσοχή. Το προϊόν που στέλνεται από τη φίρμα Heraeus Kulzer, έχει ελεγχθεί
επακριβώς πριν την αποστολή. Η συσκευή παραδίδεται προστατευμένη και συσκευασμένη σύμφωνα με τους κανονισμούς.
Ελέγξτε παρακαλώ μετά την παραλαβή τη συσκευή για τυχόν ζημιές μεταφοράς. Σε περίπτωση διαπίστωσης ζημιών
δηλώστε τες το αργότερο 24 ώρες μετά την παράδοση στην επιχείρηση μεταφοράς. Δεν πρέπει σε καμία περίπτωση
να εγκαταστήσετε ή να λειτουργήσετε μια μονάδα ή εξαρτήματα που έχουν υποστεί ζημιά.
2.3
Υποχρεώσεις ιδιοκτήτη
Ο ιδιοκτήτης πέρα από την τήρηση των νομικών διατάξεων έχει την υποχρέωση να φροντίζει για την τήρηση και την
εφαρμογή των νομικών οδηγιών στη θέση εργασίας, π.χ. την υποχρέωση ενημέρωσης, το νόμο περί προστασίας της
εργασίας καθώς και όλους τους περαιτέρω ισχύοντες κανονισμούς και νόμους.
Για τις εργασίες στη συσκευή και με τη συσκευή πρέπει να συντάσσονται από τον ιδιοκτήτη με τη βοήθεια των οδηγιών
λειτουργίας και με βάση τις προς εκτέλεση εργασίες γραπτές υποδείξεις και να κοινοποιούνται σε απλή κατανοητή μορφή
και στη γλώσσα όλων των εργαζομένων.
2.4
Ημερολόγιο μηχανήματος
Συνιστούμε την τήρηση „ημερολογίου μηχανήματος“ για την καταγραφή όλων των δοκιμών και σοβαρών εργασιών
σε αυτό (π.χ. συντήρηση, αλλαγές).
3
Προβλεπόμενη χρήση
Το Translux Wave είναι μια συσκευή πολυμερισμού οδοντιατρικών υλικών φωτισμού LED για χρήση στη στοματική
κοιλότητα, για τον φωτοπολυμερισμό οδοντιατρικών υλικών, όπως υλικών συγκόλλησης ή εμφράξεων, τα οποία
ενεργοποιούνται σε εύρος μηκών κύματος 440 – 480 nm.
ΣΗΜΕΙΩΣΗ
Παρότι τα περισσότερα φωτοπολυμεριζόμενα οδοντιατρικά υλικά ενεργοποιούνται εντός αυτού του εύρους
μηκών κύματος, σε περίπτωση αμφιβολίας, ελέγξτε τις προδιαγραφές του κατασκευαστή ή επικοινωνήστε με τον
κατασκευαστή.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – Εξειδικευμένο προσωπικό.
Η συσκευή θα πρέπει να χρησιμοποιείται από κατάλληλα εκπαιδευμένο προσωπικό και από τον οδοντίατρο
(ανατρέξτε στην παράγραφο 2.3 Υποχρεώσεις ιδιοκτήτη). Εφόσον η συσκευή χρησιμοποιείται σωστά δεν προκαλεί
καμία γνωστή παρενέργεια.
3.1
Περιγραφή της συσκευής
Το Translux Wave χρησιμοποιεί ως πηγή φωτός μια πολύ αποτελεσματική μονο-χρωματική δίοδο LED, με μήκος κύματος
που κυμαίνεται από 440 – 480 nm.
Το συνολικό φως που εκπέμπεται από το Translux Wave χρησιμοποιείται για να ενεργοποιήσει τον φωτοεκκινητή
καμφορκινόνης. Αυτή η διαδικασία παράγει εξαιρετικά αποτελέσματα φωτοπολυμερισμού με χαμηλότερες εκπομπές
θερμότητας.
Το Translux Wave συνοδεύεται από φωτοθυρίδα που μπορεί να περιστραφεί κατά 360° με διάμετρο 8 mm.
Το Translux Wave αποτελείται από μια βάση φόρτισης και μια μονάδα χειρός, η οποία τροφοδοτείται από αφαιρούμενη
επαναφορτιζόμενη μπαταρία ιόντων λιθίου.
Η μονάδα χειρός είναι εξοπλισμένη με „Λειτουργία αναμονής“, η οποία ελαχιστοποιεί την κατανάλωση ενέργειας της
συσκευής.
Η μονάδα χειρός μεταβαίνει στη „Λειτουργία αναμονής“ όταν δεν χρησιμοποιείται για χρονικό διάστημα 5 λεπτών.
Το Translux Wave μπορεί να λειτουργήσει με δύο διαφορετικές κύκλους έκθεσης:
• Έκθεση με σταθερή ένταση: διάρκεια κύκλου 10 δευτερολέπτων.
• Έκθεση με σταδιακά αυξανόμενη ένταση: „Σταδιακή εκκίνηση“ (διάρκεια κύκλου 20 δευτερολέπτων).
Η „Σταδιακή εκκίνηση“ σημαίνει την αύξηση της έντασης του φωτός από 50% έως 100% μέσα σε 2 δευτερόλεπτα.
ΣΗΜΕΙΩΣΗ – Διαβάστε προσεκτικά τους χρόνους έκθεσης των υλικών που καθορίζονται από τον
κατασκευαστή.
Για υλικά με συγκεκριμένους χρόνους έκθεσης (π.χ. 30 / 40 δευτερόλεπτα για ρητίνες σκούρας απόχρωσης)
επαναλάβετε την έκθεση αρκετές φορές αν χρειάζεται.
3.2
Απαιτήσεις ασφαλείας
Η αποτελεσματικότητα των υποδείξεων ασφαλείας ως προς την προστασία των ατόμων, την εργασία με τη συσκευή
και την εργασία με το επεξεργαζόμενο υλικό εξαρτάται σε σημαντικό βαθμό από τη συμπεριφορά των ατόμων που
ασχολούνται σ’αυτήν τη συσκευή.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ
Πριν τη θέση σε λειτουργία διαβάστε προσεκτικά αυτές τις οδηγίες λειτουργίας και τηρείτε τις οδηγίες,
για να αποφύγετε τα σφάλματα και τις επακόλουθες ζημιές, ιδιαίτερα τις βλάβες στην υγεία.
Για την τοποθέτηση και τη λειτουργία της συσκευής πρέπει να προσέξετε, εκτός από τις υποδείξεις σ’αυτές
τις οδηγίες λειτουργίας, τους εθνικούς νόμους, τους κανονισμούς και τις κατευθυντήριες γραμμές που ισχύουν
κάθε φορά.
3.2.1
Γενικές οδηγίες ασφαλείας για τη λειτουργία της μονάδας
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – ΠΡΟΒΛΕΠΟΜΕΝΗ ΧΡΗΣΗ
Χρησιμοποιήστε τη συσκευή μόνο για τον προβλεπόμενο σκοπό χρήσης (ανατρέξτε στην παράγραφο 3
Προβλεπόμενη χρήση). Οποιαδήποτε άλλη χρήση αντενδείκνυται έντονα. Οποιαδήποτε μη συμμόρφωση
με αυτήν την οδηγία μπορεί να προκαλέσει σοβαρό τραυματισμό των ασθενών ή των χειριστών της συσκευής
καθώς και ζημιά ή δυσλειτουργία της μονάδας. Η Heraeus Kulzer δεν φέρει καμία ευθύνη για επακόλουθες
ζημιές λόγω της μη τήρησης της παραπάνω πρόβλεψης!
ΠΡΟΕΙΔΟΠΟΙΗΣΗ
Ο χρήστης είναι υπεύθυνος για τον έλεγχο του Translux Wave ως προς τη χρήση και την καταλληλότητά
του για τους προβλεπόμενους σκοπούς.
Μην κατευθύνετε ποτέ το φως προς τα μάτια! Η άμεση ή έμμεση έκθεση των ματιών στο φως πρέπει να
αποφεύγεται πάντοτε με χρήση προστατευτικών γυαλιών που φιλτράρουν το κυανό φως. Κατά τον πολυμερισμό,
τοποθετήστε το άκρο του οδηγού φωτός απευθείας επάνω στο υλικό που πρέπει να πολυμεριστεί και αποφύγετε
την έκθεση σε μαλακούς ιστούς. Τα μάτια, τα ούλα, ο μαλακός ιστός και άλλα μέρη του σώματος δεν πρέπει
να εκτίθενται στο κυανό φως (αν χρειάζεται, αυτά τα μέρη θα πρέπει να καλύπτονται με προστατευτικό
εξοπλισμό). Χρησιμοποιήστε ελαστικό απομονωτήρα για την προστασία των μαλακών ιστών, όπως των ούλων,
κατά τη θεραπεία. Η έκθεση πρέπει να περιορίζεται στην περιοχή της στοματικής κοιλότητας στην οποία
πραγματοποιείται η κλινική θεραπεία.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – ΑΝΤΕΝΔΕΙΞΕΙΣ
Μην χρησιμοποιείτε το Translux Wave σε ασθενείς με βηματοδότη ή άλλες εμφυτεύσιμες ηλεκτρονικές συσκευές.
Το ίδιο ισχύει και για τον χειριστή.
Η συσκευή δεν πρέπει να χρησιμοποιείται από παιδιά, από άτομα με προβλήματα όρασης ή ακοής και επίσης
από άτομα επιρρεπή σε πιθανές επιληπτικές κρίσεις. Τα παραπάνω άτομα ενδέχεται να μην αντιληφθούν τους
κινδύνους από τη χρήση και τη λειτουργία της συσκευής. Για λόγους ασφαλείας, στην περίπτωση χειριστή
ή ασθενών με πιθανό κίνδυνο επιληπτικών κρίσεων η χρήση και η λειτουργία της συσκευής απαγορεύεται.
GR
-5-
ΠΡΟΕΙΔΟΠΟΙΗΣΗ
Δεν επιτρέπεται καμία τροποποίηση αυτής της συσκευής.
Ο κάτοχος / χρήστης πρέπει να διασφαλίσει τα εξής:
– Η συσκευή δεν χρησιμοποιείται σε ασθενείς με ιστορικό φωτοευαισθησίας, για παράδειγμα,
σε ασθενείς με ηλιακή κνίδωση ή πορφυρία, καθώς και σε ασθενείς που έχουν υποβληθεί σε θεραπεία
με φωτοευαισθητοποιά φάρμακα.
– Η συσκευή δεν χρησιμοποιείται σε ασθενείς που έχουν υποβληθεί σε επέμβαση καταρράκτη, οι οποίοι έχουν
ιδιαίτερη ευαισθησία στο φως, παρά μόνον εάν λαμβάνονται κατάλληλα προστατευτικά μέτρα, όπως η χρήση
προστατευτικών / γυαλιών που φιλτράρουν το κυανό φως.
– Οι ασθενείς των οποίων το ιστορικό περιλαμβάνει παθήσεις του αμφιβληστροειδούς πρέπει να λαμβάνουν
άδεια από τον οφθαλμίατρό τους προτού υποβληθούν σε θεραπεία με το Translux Wave.
– Πρέπει να ζητείται ιατρική βοήθεια από εξειδικευμένο ιατρό σχετικά με όλα τα πιθανά ενδεχόμενα κινδύνων.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – Θερμοκρασία των εξαρτημάτων
Μέγιστη θερμοκρασία των εξαρτημάτων (φωτοθυρίδα και προστατευτικός κώνος): 41°C (106°F).
Μέγιστη θερμοκρασία των μερών που θεωρούνται εξαρτήματα (ο μεταλλικός πρόσθιος κώνος), καθώς είναι
πιθανόν να έρθουν σε επαφή με τον ασθενή: 46°C (115°F).
Η Heraeus Kulzer δηλώνει ότι αν η συσκευή χρησιμοποιείται σύμφωνα με τις οδηγίες που περιλαμβάνονται σε
αυτό το εγχειρίδιο, δεν θα συμβεί θέρμανση των ιστών.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – Έλεγχος μολύνσεων.
Η φωτοθυρίδα και ο προστατευτικός κώνος πρέπει να καθαρίζονται, να απολυμαίνονται και να αποστειρώνονται
(με ατμό) πριν από κάθε χρήση. Η φωτοθυρίδα και ο προστατευτικός κώνος παραδίδονται ΜΗ ΑΠΟΣΤΕΙΡΩΜΕΝΑ
και πρέπει να αποστειρωθούν πριν από την πρώτη χρήση. Ανατρέξτε στην παράγραφο 8.4.1.2 Παράμετροι
αποστείρωσης.
3.2.2
GR
-6-
Προφυλάξεις ασφαλείας
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – ΚΙΝΔΥΝΟΣ ΕΚΡΗΞΗΣ
Μην εγκαθιστάτε τη συσκευή σε σημεία όπου υπάρχει κίνδυνος εκρήξεων.
Η συσκευή δεν πρέπει να χρησιμοποιείται σε σημεία με εύφλεκτη ατμόσφαιρα (αναισθητικά παρασκευάσματα,
οξυγόνο, υποξείδιο του αζώτου κλπ.). Χρησιμοποιήστε τη συσκευή σε καλά αεριζόμενο χώρο.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ
Πριν από τη χρήση της συσκευής, ελέγξτε το καλώδιο τροφοδοσίας και την πρίζα για τυχόν φθορές.
Αν παρουσιάζουν φθορές, μην συνδέετε τη μονάδα στην πρίζα.
Χρησιμοποιείτε μόνο αυθεντικά ανταλλακτικά ή αξεσουάρ από την Heraeus Kulzer GmbH. Η Heraeus Kulzer
παρέχει φωτοθυρίδα κατάλληλη για χρήση με το Translux Wave. Δεν πρέπει να χρησιμοποιηθούν άλλες
φωτοθυρίδες. Η Heraeus Kulzer GmbH δεν θα δεχθεί καμία ευθύνη για ζημιές που οφείλονται στη χρήση μη
αυθεντικών ανταλλακτικών ή αξεσουάρ της Heraeus Kulzer.
3.2.3 ΜΠΑΤΑΡΙΑ – Προφυλάξεις ασφαλείας
Η Heraeus Kulzer GmbH δεν φέρει καμία ευθύνη για προβλήματα της μπαταρίας που παρουσιάζονται όταν οι προφυλάξεις
ασφαλείας που αναφέρονται στην ακόλουθη παράγραφο δεν τηρούνται προσεκτικά.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ
Η κακή χρήση της μπαταρίας μπορεί να προκαλέσει θέρμανση, διάρρηξη ή ανάφλεξη της μπαταρίας και σοβαρό
τραυματισμό. Βεβαιωθείτε ότι ακλουθείτε τους κανόνες ασφαλείας που αναφέρονται στην ακόλουθη παράγραφο.
Χρησιμοποιείτε μόνο αυθεντικές μπαταρίες Heraeus Kulzer!
Η χρήση άλλων μπαταριών εκτός των μπαταριών της Heraeus Kulzer ή μη επαναφορτιζόμενων / απλών
μπαταριών ενέχει κινδύνους και μπορεί να προκαλέσει ζημιά στη συσκευή.
Φυλάξτε την μπαταρία μακριά από τα παιδιά!
Ποτέ μην ανοίγετε, τρυπάτε ή σπάτε την μπαταρία – περιέχει δηλητηριώδεις ουσίες.
Αν η μπαταρία εμφανίζει σημάδια οξείδωσης, αναδύει ασυνήθιστη οσμή ή παρουσιάζει διαρροή υγρών, αφαιρέστε
την από τη μονάδα χειρός αμέσως.
Μην εκθέτετε την μπαταρία σε νερό ή αλμυρό νερό και μην την αφήνετε να βραχεί. Μην αποθηκεύσετε την
μπαταρία σε χώρο με υψηλή υγρασία ή σε σημείο όπου μπορεί να εκτίθεται στη βροχή.
Σε περίπτωση διαρροής υγρών από την μπαταρία και επαφής των υγρών με τα μάτια, μην τρίβετε τα μάτια.
Ξεπλύνετε καλά και αναζητήστε αμέσως ιατρική βοήθεια. Αν δεν ληφθεί ιατρική βοήθεια, τα υγρά της μπαταρίας
μπορεί να βλάψουν τα μάτια.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – ΚΙΝΔΥΝΟΣ ΕΚΡΗΞΗΣ
Χρησιμοποιείτε μόνο τη μονάδα φόρτισης και το τροφοδοτικό του Translux Wave, τα οποία παρέχονται με τη
συσκευή, για τη φόρτιση της μπαταρίας της μονάδας χειρός. Μην επιχειρείτε ποτέ να φορτίσετε την μπαταρία του
Translux Wave χρησιμοποιώντας άλλη μονάδα φόρτισης. Η χρήση οποιασδήποτε άλλης μονάδας φόρτισης μπορεί
να προκαλέσει ζημιά στην μπαταρία, κίνδυνο έκρηξης και πυρκαγιά!
Μην χρησιμοποιείτε ποτέ τη μονάδα φόρτισης του Translux Wave για να φορτίσετε άλλους τύπους μπαταριών
ή άλλες μονάδες με επαναφορτιζόμενη μπαταρία! Χρησιμοποιείτε μόνο αυθεντικές μπαταρίες της Heraeus Kulzer.
Μην τρυπάτε την μπαταρία με αιχμηρά αντικείμενα, μην τη χτυπάτε με σφυρί ή εργαλεία, μην την πατάτε και μην
την υποβάλλετε με άλλο τρόπο σε ισχυρές κρούσεις ή δονήσεις.
Μην πετάτε την μπαταρία στη φωτιά και μην τη ζεσταίνετε. Μην βραχυκυκλώνετε ποτέ τους πόλους της
μπαταρίας με μεταλλικά αντικείμενα, διότι υπάρχει κίνδυνος εγκαυμάτων, πυρκαγιάς και έκρηξης.
Μην μεταφέρετε ή αποθηκεύετε ποτέ την μπαταρία μαζί με κολιέ, καρφίτσες ή άλλα μεταλλικά αντικείμενα.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – Μην αποσυναρμολογείτε ή τροποποιείτε την μπαταρία!
Η μπαταρία περιλαμβάνει μηχανισμούς ασφαλείας, οι οποίοι, αν καταστραφούν, μπορεί να προκαλέσουν
θέρμανση, διάρρηξη ή ανάφλεξη της μπαταρίας .
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – Μην τοποθετείτε την μπαταρία κοντά σε φωτιά ή σε άλλα σημεία με υψηλή
θερμοκρασία.
Μην τοποθετείτε την μπαταρία σε σημείο με απευθείας έκθεση στον ήλιο. Κάτι τέτοιο ενδέχεται να προκαλέσει
θέρμανση, διάρρηξη ή ανάφλεξη της μπαταρίας. Η χρήση της μπαταρίας με τέτοιο τρόπο ενδέχεται επίσης
να προκαλέσει περιορισμό της απόδοσης και μικρότερο προσδόκιμο χρόνο ζωής της μπαταρίας.
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – Σε περίπτωση πυρκαγιάς, ΜΗΝ ΠΕΤΑΤΕ ΝΕΡΟ ΣΤΗ ΦΛΕΓΟΜΕΝΗ ΜΠΑΤΑΡΙΑ!
Θα πρέπει να χρησιμοποιηθεί πυροσβεστήρας κατηγορίας C (σύμφωνα με τον Ευρωπαϊκό κανονισμό EN 3).
ΠΡΟΕΙΔΟΠΟΙΗΣΗ – Απόρριψη κατεστραμμένης ή εξαντλημένης μπαταρίας.
Απορρίψτε μια κατεστραμμένη ή εξαντλημένη μπαταρία αφού λάβετε τα απαραίτητα μέτρα για την
αποφυγή εξωτερικού βραχυκυκλώματος σύμφωνα με τα ακόλουθα:
Αφού μονώσετε τους πόλους της μπαταρίας με μονωτική ταινία, απορρίψτε τη σύμφωνα με τη νομοθεσία ή τους
τοπικούς κανονισμούς.
3.2.4 ΜΠΑΤΑΡΙΑ – Πληροφορίες
• Χρόνοςφόρτισηςμιαςκενήςήνέαςμπαταρίας:περίπου3ώρες.
ΣΗΜΕΙΩΣΗ – ΝΕΑ μπαταρία: πρώτη φόρτιση
Κατά την πρώτη φόρτιση, αυτή η διαδικασία θα διαρκέσει περίπου 3 ώρες. Η φόρτιση νέων μπαταριών
ή μπαταριών που έχουν αποθηκευτεί για μεγάλο χρονικό διάστημα, μπορεί να απαιτήσει περισσότερο χρόνο.
Η μπαταρία θα φτάσει σε πλήρη απόδοση μετά από λίγους κύκλους φόρτισης / αποφόρτισης.
ΣΗΜΕΙΩΣΗ
Τοποθετείτε τη μονάδα χειρός στη βάση φόρτισης μετά από κάθε χρήση ή όταν δεν χρησιμοποιείται.
• Συνθήκεςλειτουργίας:
Θερμοκρασία λειτουργίας: 10°C (50°F) έως 35°C (95°F).
Σχετική υγρασία: 45% έως 85% RH.
Ατμοσφαιρική πίεση: 800 hPa έως 1060 hPa.
ΠΡΟΣΟΧΗ
Το εύρος θερμοκρασίας και σχετικής υγρασίας στο οποίο μπορεί να φορτιστεί η μπαταρία είναι 10°C (50°F)
έως 35°C (95°F) και 45% έως 85% RH. Η φόρτιση της μπαταρίας σε θερμοκρασίες εκτός αυτού του εύρους
μπορεί να προκαλέσει θέρμανση ή ζημιά της μπαταρίας. Η φόρτιση της μπαταρίας σε θερμοκρασίες εκτός
αυτού του εύρους μπορεί επίσης να επηρεάσει την απόδοση της μπαταρίας ή να μειώσει τον προσδόκιμο
χρόνο ζωής της μπαταρίας.
• Συνθήκεςμεταφοράςκαιαποθήκευσηςτηςμπαταρίας:
Συνιστώμενο εύρος θερμοκρασίας και σχετικής υγρασίας:
–20°C (–4°F) έως 40°C (104°F) και 45% έως 85% RH.
Αποθηκεύετε πάντοτε φορτισμένη την μπαταρία και όχι για διάστημα μεγαλύτερο των 5 μηνών.