advertisement
▼
Scroll to page 2
of 72
Built-In Combination Advantium®/Convection Wall Oven GEAppliances.com For a Spanish version of this manual, visit our Website at GEAppliances.com. Para consultar una version en español de este manual de instrucciones, visite nuestro sitio de internet GEAppliances.com. Printed in the United States Safety Information . . . . . . . . . . . .2 Warranty . . . . . . . . . . . . . . . . . . . . . . . .9 Assistance / Accessories . . . . 10 Owner’s Manual PT9800 - 30" Double Wall Oven CT9800 - 30" Double Wall Oven Using The Oven Oven Controls . . . . . . . . . . . . . . . . . . . . 11 Oven Settings . . . . . . . . . . . . . . . . . . . . 12 Oven Options . . . . . . . . . . . . . . . . . . . . 13 Upper Oven Speedcooking . . . . . . . . . . . . . . . . . . . . Baking, Broiling And Toasting . . . . . Warming And Proofing . . . . . . . . . . . Microwaving . . . . . . . . . . . . . . . . . . . . . Lower Oven Cooking Modes . . . . . . . . . . . . . . . . . . Sabbath Mode . . . . . . . . . . . . . . . . . . . Cooking Guide . . . . . . . . . . . . . . . . . . . Racks . . . . . . . . . . . . . . . . . . . . . . . . . . . . Aluminum Foil and Oven Liners . . . Cookware . . . . . . . . . . . . . . . . . . . . . . . . 14 18 19 20 24 25 26 27 28 28 Care and Cleaning Cleaning The Oven . . . . . . . . . . . . . . . 29 Lower Oven Racks . . . . . . . . . . . . . . . 31 Lower Oven Maintenance . . . . . . . . 32 Troubleshooting Tips . . . . . . . . 33 Write the model and serial numbers here: Model # __________________ Serial # ___________________ You can find them on a label on the side trim or on the front of the oven behind the oven door. 49-80741-2 06-15 GE SAFETY INFORMATION (Upper Oven) 2 IMPORTANT SAFETY INFORMATION. READ ALL INSTRUCTIONS BEFORE USING. PRECAUTIONS TO AVOID POSSIBLE EXPOSURE TO EXCESSIVE MICROWAVE ENERGY (a) Do Not Attempt to operate this oven with the door open since open-door operation can result in harmful exposure to microwave energy. It is important not to defeat or tamper with the safety interlocks. (b) Do Not Place any object between the oven front face and the door or allow soil or cleaner residue to accumulate on sealing surfaces. (c) Do Not Operate the oven if it is damaged. It is particularly important that the oven door close properly and that there is no damage to the: (1) door (bent), (2) hinges and latches (broken or loosened), (3) door seals and sealing surfaces. (d) The Oven Should Not be adjusted or repaired by anyone except properly qualified service personnel. To reduce the risk of burns, electric shock, fire, injury to persons or exposure to excessive microwave energy: WARNING GENERAL SAFETY INSTRUCTIONS Ŷ Read all instructions before using this appliance. When using electrical appliances, basic safety precautions should be followed, including the following: Ŷ 5HDGDQGIROORZWKHVSHFLILFSUHFDXWLRQVLQ WKH35(&$87,21672$92,'3266,%/( (;32685(72(;&(66,9(0,&52:$9( (1(5*<VHFWLRQ Ŷ %HVXUH\RXUDSSOLDQFHLVSURSHUO\LQVWDOOHG and grounded by a qualified technician in accordance with the provided installation instructions. Ŷ ,QVWDOORUORFDWHWKLVDSSOLDQFHRQO\LQ accordance with the provided installation instructions. SAVE THESE INSTRUCTIONS 49-80741-2 Ŷ 6RPHSURGXFWVVXFKDVZKROHHJJVDQGVHDOHG containers—for example, closed jars—are able to explode and should not be heated in WKLVRYHQ6XFKXVHRIWKHRYHQFRXOGUHVXOWLQ injury. Ŷ 'RQRWPRXQWWKLVDSSOLDQFHRYHUDVLQN Ŷ 7KLVRYHQLVQRWDSSURYHGRUWHVWHGIRUPDULQH use. Ŷ 7KLVRYHQLV8/OLVWHGIRUVWDQGDUGZDOO installation. Ŷ 'RQRWRSHUDWHWKLVDSSOLDQFHLILWKDVEHHQ damaged or dropped. Ŷ $VZLWKDQ\DSSOLDQFHFORVHVXSHUYLVLRQLV necessary when used by children. Ŷ 8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGXVHDV described in this manual. Ŷ 'RQRWXVHFRUURVLYHFKHPLFDOVRUYDSRUVLQWKLV appliance. Ŷ 7KLVRYHQLVVSHFLILFDOO\GHVLJQHGWRKHDWGU\RU cook food and is not intended for laboratory or industrial use. Ŷ 7KLVDSSOLDQFHPXVWRQO\EHVHUYLFHGE\ TXDOLILHGVHUYLFHSHUVRQQHO&RQWDFWQHDUHVW authorized service facility for examination, repair or adjustment. Ŷ 'RQRWFRYHURUEORFNDQ\RSHQLQJVRQWKH appliance. Ŷ 'RQRWVWRUHWKLVDSSOLDQFHRXWGRRUV'RQRW use this product near water—for example, in a wet basement, near a swimming pool, near a sink or in similar locations. Ŷ 6HHGRRUVXUIDFHFOHDQLQJLQVWUXFWLRQVLQWKH &DUHDQG&OHDQLQJRIWKH2YHQVHFWLRQRIWKLV manual. Ŷ 7RUHGXFHWKHULVNRIILUHLQWKHRYHQFDYLW\ ² 'RQRWRYHUFRRNIRRG&DUHIXOO\DWWHQG appliance when paper, plastic or other combustible materials are placed inside the oven while microwave cooking. ² 5HPRYHZLUHWZLVWWLHVDQGPHWDOKDQGOHV from paper or plastic containers before placing them in the oven. Ŷ Ŷ Ŷ Ŷ Ŷ Ŷ Ŷ Ŷ ² ' RQRWXVHWKHRYHQIRUVWRUDJHSXUSRVHV 'RQRWOHDYHSDSHUSURGXFWVFRRNLQJ utensils or food in the oven when not in use. — If materials inside the oven ignite, keep the oven door closed, turn the oven off and shut off power at the fuse or circuit breaker panel. If the door is opened, the fire may spread. ² ' RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQ succession on the same food portion. If food is undercooked after the first countdown, use &22.%<7,0(IRUDGGLWLRQDOFRRNLQJWLPH 'RQRWRSHUDWHWKHRYHQZLWKRXWWKHWXUQWDEOHLQ SODFH7KHWXUQWDEOHPXVWEHXQUHVWULFWHGVRLW can turn. 3RWHQWLDOO\KRWVXUIDFHVLQFOXGHWKHRYHQGRRU floor, walls, oven rack and turntable. 'RQ¶WGHIURVWIUR]HQEHYHUDJHVLQQDUURZ necked bottles (especially carbonated EHYHUDJHV(YHQLIWKHFRQWDLQHULVRSHQ SUHVVXUHFDQEXLOGXS7KLVFDQFDXVHWKH container to burst, possibly resulting in injury. )RRGVFRRNHGLQOLTXLGVVXFKDVSDVWDPD\WHQG to boil more rapidly than foods containing less PRLVWXUH6KRXOGWKLVRFFXUUHIHUWRWKH&DUHDQG &OHDQLQJRIWKHRYHQVHFWLRQIRULQVWUXFWLRQVRQ how to clean the inside of the oven. +RWIRRGVDQGVWHDPFDQFDXVHEXUQV%H careful when opening any containers of hot food, including popcorn bags, cooking pouches and ER[HV7RSUHYHQWSRVVLEOHLQMXU\GLUHFWVWHDP away from hands and face. 'RQRWRYHUFRRNSRWDWRHV7KH\FRXOGGHK\GUDWH and catch fire, causing damage to your oven. $YRLGKHDWLQJEDE\IRRGLQJODVVMDUVHYHQZLWK WKHOLGRII0DNHVXUHDOOLQIDQWIRRGLVWKRURXJKO\ FRRNHG6WLUIRRGWRGLVWULEXWHWKHKHDWHYHQO\ %HFDUHIXOWRSUHYHQWVFDOGLQJZKHQZDUPLQJ IRUPXOD7KHFRQWDLQHUPD\IHHOFRROHUWKDQWKH IRUPXODUHDOO\LV$OZD\VWHVWWKHIRUPXODEHIRUH feeding the baby. 'RQRWDWWHPSWWRGHHSIU\LQWKHRYHQ SAVE THESE INSTRUCTIONS 49-80741-2 SAFETY INFORMATION (Upper Oven) WARNING GENERAL SAFETY INSTRUCTIONS 3 SAFETY INFORMATION (Upper Oven) 4 IMPORTANT SAFETY INFORMATION. READ ALL INSTRUCTIONS BEFORE USING. WARNING 127,&(³3$&(0$.(56 Ŷ 0RVWSDFHPDNHUVDUHVKLHOGHGIURPLQWHUIHUHQFH from electronic products, including microwaves. +RZHYHUSDWLHQWVZLWKSDFHPDNHUVPD\ZLVKWR consult their physicians if they have concerns. WARNING ARCING $UFLQJFDQRFFXUGXULQJERWKVSHHGFRRNLQJDQGPLFURZDYHFRRNLQJ,I\RXVHHDUFLQJSUHVVWKH Clear/Off pad and correct the problem. Ŷ 0HWDOFRRNZDUHXVHGGXULQJHLWKHUVSHHGFRRNRU $UFLQJLVWKHPLFURZDYHWHUPIRUVSDUNVLQWKH microwave cooking (except for the pans provided RYHQ$UFLQJLVFDXVHGE\ with the oven). Ŷ 0HWDORUIRLOWRXFKLQJWKHVLGHRIWKHRYHQ Ŷ )RLOQRWPROGHGWRIRRGXSWXUQHGHGJHVDFWOLNH Ŷ 0HWDOVXFKDVWZLVWWLHVSRXOWU\SLQVRUJROG rimmed dishes, in the oven. antennas). Ŷ 5HF\FOHGSDSHUWRZHOVFRQWDLQLQJVPDOOPHWDO Ŷ 8VHIRLORQO\DVUHFRPPHQGHGLQWKLVPDQXDO pieces being used in the oven. WARNING FOODS Ŷ :KHQPLFURZDYLQJSODFHDOOIRRGVDQG containers on the clear glass tray. Ŷ 'RQRWSRSSRSFRUQLQ\RXURYHQXQOHVVLQD special microwave popcorn accessory or unless you use popcorn labeled for use in microwave ovens. Ŷ 'RQRWERLOHJJVLQWKLVRYHQ3UHVVXUHZLOOEXLOG up inside egg yolk and will cause it to burst, possibly resulting in injury. Ŷ 'RQRWRSHUDWHWKHRYHQZLWKRXWIRRGLQVLGH 7KLVPD\FDXVHGDPDJHWRWKHRYHQ,W increases the heat around the magnetron and can shorten the life of the oven. Ŷ )RRGVZLWKXQEURNHQRXWHU³VNLQ´VXFKDV potatoes, hot dogs, sausages, tomatoes, apples, chicken livers and other giblets, and egg yolks should be pierced to allow steam to escape during cooking. Ŷ SUPERHEATED WATER /LTXLGVVXFKDVZDWHUFRIIHHRUWHDDUHDEOHWR be overheated beyond the boiling point without DSSHDULQJWREHERLOLQJ9LVLEOHEXEEOLQJRU boiling when the container is removed from the PLFURZDYHRYHQLVQRWDOZD\VSUHVHQW7+,6 &28/'5(68/7,19(5<+27/,48,'6 68''(1/<%2,/,1*29(5:+(17+( &217$,1(5,6',6785%('25$63221 2527+(587(16,/,6,16(57(',1727+( /,48,' 7RUHGXFHWKHULVNRILQMXU\WRSHUVRQV ² ' RQRWRYHUKHDWWKHOLTXLG ² 6 WLUWKHOLTXLGERWKEHIRUHDQGKDOIZD\ through heating it. ² ' RQRWXVHVWUDLJKWVLGHGFRQWDLQHUVZLWK narrow necks. ² $ IWHUKHDWLQJDOORZWKHFRQWDLQHUWRVWDQGLQ the microwave oven for a short time before removing the container. ² 8 VHH[WUHPHFDUHZKHQLQVHUWLQJDVSRRQRU other utensil into the container. SAVE THESE INSTRUCTIONS 49-80741-2 Oven-safe cookware for Speedcooking, Baking, Broiling, Warming, Proofing & Toasting Ŷ The oven and door will get very hot when speedcooking, baking, broiling, warming, proofing or toasting. Ŷ Cookware will become hot.2YHQPLWWVZLOOEH needed to handle the cookware. Ŷ 'RQRWXVHFRYHULQJVFRQWDLQHUVRUFRRNLQJ roasting bags made of foil, plastic, wax or paper when speedcooking. Ŷ 'RQRWFRYHUWKHWXUQWDEOHZLUHRYHQUDFNWUD\V RUDQ\SDUWRIWKHRYHQZLWKPHWDOIRLO7KLVZLOO cause arcing in the oven. Ŷ 8VHWKHQRQVWLFNPHWDOWUD\LQWKHVDPHZD\\RX would use a shallow baking pan or baking tray. Ŷ 8VHWKHDOXPLQXPEDNLQJVKHHWRQWKHZLUH oven rack, and place them on the non-stick metal tray when baking on two levels, broiling or toasting foods. The turntable must always be in place when using the oven. Ŷ 3ODFHIRRGGLUHFWO\RQWKHWUD\VZKHQFRRNLQJ unless prompted by the oven to do otherwise. Ŷ $Q\RYHQVDIHGLVKFDQEHXVHGLQ\RXU RYHQ5HFLSHVLQWKH$GYDQWLXP&RRNERRN were tested in Pyrex® glass cookware and &RUQLQJZDUH®FHUDPLFFDVVHUROHV&RRNWLPHV and results may vary when using other types of oven-safe dishes. Place them directly on the trays. Ŷ 'RQRWXVHWKHRYHQWRGU\QHZVSDSHUV Ŷ 8VHRIWKHFOHDUJODVVWUD\ZKHQEDNLQJ broiling, warming, proofing or toasting will result in inferior cooking performance. Put food directly on the non-stick metal tray to bake on one level or to speedcook. Put food directly on the aluminum baking sheet on the wire oven rack, and place them on the non-stick metal tray, when baking on two levels, broiling or toasting foods. SAVE THESE INSTRUCTIONS 49-80741-2 SAFETY INFORMATION (Upper Oven) WARNING 5 SAFETY INFORMATION (Upper Oven) IMPORTANT SAFETY INFORMATION. READ ALL INSTRUCTIONS BEFORE USING. WARNING 0,&52:$9(6$)(&22.:$5( 0DNHVXUHWRXVHVXLWDEOHFRRNZDUHGXULQJPLFURZDYHFRRNLQJ0RVWJODVVFDVVHUROHVFRRNLQJGLVKHV measuring cups, custard cups, pottery or china dinnerware which does not have metallic trim or glaze with DPHWDOOLFVKHHQFDQEHXVHG6RPHFRRNZDUHLVODEHOHG³VXLWDEOHIRUPLFURZDYLQJ´ Ŷ 3DSHUWRZHOVZD[HGSDSHUDQGSODVWLFZUDS Ŷ 3ODFHIRRGRUPLFURZDYDEOHFRQWDLQHUGLUHFWO\ can be used to cover dishes in order to retain on the clear glass tray to cook your food. PRLVWXUHDQGSUHYHQWVSDWWHULQJ%HVXUHWRYHQW Ŷ 8VHRIWKHQRQVWLFNPHWDOWUD\GXULQJ plastic wrap so steam can escape. microwave cooking will result in inferior cooking Ŷ 1RWDOOSODVWLFZUDSLVVXLWDEOHIRUXVHLQ performance. PLFURZDYHRYHQV&KHFNWKHSDFNDJHIRU Ŷ ,I\RXDUHQRWVXUHLIDGLVKLVPLFURZDYH proper use. safe, use this test: Place in the oven both the Ŷ ³%RLODEOH´FRRNLQJSRXFKHVDQGWLJKWO\FORVHG dish you are testing plastic bags should be slit, pierced or vented and a glass measuring as directed by package. If they are not, plastic cup filled with 1 cup of could burst during or immediately after cooking, water—set the measuring SRVVLEO\UHVXOWLQJLQLQMXU\$OVRSODVWLFVWRUDJH cup either in or next containers should be at least partially uncovered WRWKHGLVK0LFURZDYH How to test for a microwave-safe dish. EHFDXVHWKH\IRUPDWLJKWVHDO:KHQFRRNLQJ 30-45 seconds at high. If with containers tightly covered with plastic wrap, the dish heats, it should remove covering carefully and direct steam not be used for microwaving. away from hands and face. If the dish remains cool and only the water in Ŷ Plastic cookware—Plastic cookware designed for the cup heats, then the dish is microwave-safe. microwave cooking is very useful, but should be Ŷ &RRNZDUHPD\EHFRPHKRWEHFDXVHRIKHDW XVHGFDUHIXOO\(YHQPLFURZDYHVDIHSODVWLFPD\ WUDQVIHUUHGIURPWKHKHDWHGIRRG2YHQPLWWV not be as tolerant of overcooking conditions as may be needed to handle the cookware. are glass or ceramic materials and may soften or Ŷ 'RQRWXVHUHF\FOHGSDSHUSURGXFWV5HF\FOHG char if subjected to short periods of overcooking. paper towels, napkins and waxed paper can In longer exposures to overcooking, the food and contain metal flecks which may cause arcing or cookware could ignite. ignite. Paper products containing nylon or nylon Follow these guidelines: filaments should be avoided, as they may also ignite. 8VHPLFURZDYHVDIHSODVWLFVRQO\DQGXVH them in strict compliance with the cookware Ŷ 8VHIRLORQO\DVGLUHFWHGLQWKLVPDQXDO:KHQ PDQXIDFWXUHU¶VUHFRPPHQGDWLRQV XVLQJIRLOLQWKHRYHQNHHSWKHIRLODWOHDVW´ away from the sides of the oven. 'RQRWPLFURZDYHHPSW\FRQWDLQHUV Ŷ 'RQRWXVHWKHRYHQWRGU\QHZVSDSHUV 'RQRWSHUPLWFKLOGUHQWRXVHSODVWLFFRRNZDUH without complete supervision. Ŷ ,I\RXXVHDPHDWWKHUPRPHWHUZKLOHFRRNLQJ make sure it is safe for use in microwave ovens. Ŷ 6RPHIRDPWUD\VOLNHWKRVHWKDWPHDWLV packaged on) have a thin strip of metal HPEHGGHGLQWKHERWWRP:KHQPLFURZDYHG the metal can burn the floor of the oven or ignite a paper towel. The turntable must always be in place when using the oven. 6 The clear glass tray should always be in place when microwaving. SAVE THESE INSTRUCTIONS 49-80741-2 5HDGDOOVDIHW\LQVWUXFWLRQVEHIRUHXVLQJWKHSURGXFW)DLOXUHWRIROORZWKHVHLQVWUXFWLRQVPD\UHVXOWLQILUH electrical shock, serious injury or death. STATE OF CALIFORNIA PROPOSITION 65 WARNING 7KH&DOLIRUQLD6DIH'ULQNLQJ:DWHUDQG7R[LF(QIRUFHPHQW$FWUHTXLUHVWKH*RYHUQRURI&DOLIRUQLDWR publish a list of substances known to the state to cause cancer, birth defects or other reproductive harm, and requires businesses to warn customers of potential exposure to such substances. WARNING 7KLVSURGXFWFRQWDLQVRQHRUPRUHFKHPLFDONQRZQWRWKH6WDWHRI&DOLIRUQLDWR cause cancer, birth defects or other reproductive harm. 6HOIFOHDQRYHQVFDQFDXVHORZOHYHOH[SRVXUHWRVRPHRIWKHVHVXEVWDQFHVLQFOXGLQJFDUERQPRQR[LGH GXULQJWKHFOHDQLQJF\FOH([SRVXUHFDQEHPLQLPL]HGE\YHQWLQJZLWKDQRSHQZLQGRZRUXVLQJD ventilation fan or hood. WARNING GENERAL SAFETY INSTRUCTIONS Ŷ 'RQRWWRXFKWKHKHDWLQJHOHPHQWVRUWKHLQWHULRU Ŷ8VHWKLVDSSOLDQFHRQO\IRULWVLQWHQGHGSXUSRVH VXUIDFHRIWKHRYHQ7KHVHVXUIDFHVPD\EHKRW DVGHVFULEHGLQWKLV2ZQHU¶V0DQXDO enough to burn even though they are dark in Ŷ%HVXUH\RXUDSSOLDQFHLVSURSHUO\LQVWDOOHGDQG FRORU'XULQJDQGDIWHUXVHGRQRWWRXFKRUOHW grounded by a qualified installer in accordance clothing or other flammable materials contact any with the provided installation instructions. interior area of the oven; allow sufficient time for Ŷ'RQRWDWWHPSWWRUHSDLURUUHSODFHDQ\SDUWRI FRROLQJILUVW2WKHUVXUIDFHVRIWKHDSSOLDQFHPD\ your oven unless it is specifically recommended become hot enough to cause burns. Potentially LQWKLVPDQXDO$OORWKHUVHUYLFLQJVKRXOGEH hot surfaces include the oven vent opening, transferred to a qualified technician. surfaces near the opening and crevices around Ŷ%HIRUHSHUIRUPLQJDQ\VHUYLFHGLVFRQQHFWWKH the oven door. power supply at the household distribution panel Ŷ 'RQRWKHDWXQRSHQHGIRRGFRQWDLQHUV3UHVVXUH by removing the fuse or switching off the circuit could build up and the container could burst, breaker. causing an injury. Ŷ'RQRWOHDYHFKLOGUHQDORQH²FKLOGUHQVKRXOGQRW Ŷ 'RQRWXVHDQ\W\SHRIIRLORUOLQHUWRFRYHUWKH be left alone or unattended in an area where an oven bottom or anywhere in the oven, except as DSSOLDQFHLVLQXVH7KH\VKRXOGQHYHUEHDOORZHG GHVFULEHGLQWKLVPDQXDO2YHQOLQHUVFDQWUDS to climb, sit or stand on any part of the appliance. heat or melt, resulting in damage to the product and risk of shock, smoke or fire. Ŷ : 'RQRWVWRUHLWHPVRI interest to children in cabinets above an oven Ŷ $YRLGVFUDWFKLQJRULPSDFWLQJJODVVGRRUVRU - children climbing on the oven to reach items FRQWUROSDQHOV'RLQJVRPD\OHDGWRJODVV could be seriously injured. EUHDNDJH'RQRWFRRNRQRULQDSURGXFWZLWK EURNHQJODVV6KRFNILUHRUFXWVPD\RFFXU Ŷ8VHRQO\GU\SRWKROGHUV²PRLVWRUGDPSSRW holders on hot surfaces may result in burns from Ŷ &RRNPHDWDQGSRXOWU\WKRURXJKO\²PHDWWR VWHDP'RQRWOHWSRWKROGHUVWRXFKKRWKHDWLQJ DWOHDVWDQLQWHUQDOWHPSHUDWXUHRI)DQG HOHPHQWV'RQRWXVHDWRZHORURWKHUEXON\FORWK poultry to at least an internal temperature of in place of pot holders. )&RRNLQJWRWKHVHWHPSHUDWXUHVXVXDOO\ protects against foodborne illness. Ŷ 1 HYHUXVH\RXUDSSOLDQFHIRUZDUPLQJRUKHDWLQJ the room. SAFETY INFORMATION (Lower Oven) WARNING CAUTION SAVE THESE INSTRUCTIONS 49-80741-2 7 SAFETY INFORMATION (Lower Oven) IMPORTANT SAFETY INFORMATION. READ ALL INSTRUCTIONS BEFORE USING. WARNING .((3)/$00$%/(0$7(5,$/6$:$<)5207+(29(1 Failure to do so may result in fire or personal injury. Ŷ ' RQRWVWRUHRUXVHIODPPDEOHPDWHULDOVLQRUQHDU an oven, including paper, plastic, pot holders, linens, wall coverings, curtains, drapes and gasoline or other flammable vapors and liquids. Ŷ 1 HYHUZHDUORRVHILWWLQJRUKDQJLQJJDUPHQWVZKLOH XVLQJWKHDSSOLDQFH7KHVHJDUPHQWVPD\LJQLWHLI they contact hot surfaces, causing severe burns. Ŷ 'RQRWOHWFRRNLQJJUHDVHRURWKHUIODPPDEOH PDWHULDOVDFFXPXODWHLQRUQHDUWKHRYHQ*UHDVH in the oven or near the oven may ignite. WARNING ,17+((9(172)$),5(7$.(7+()2//2:,1* STEPS TO PREVENT INJURY AND FIRE SPREADING Ŷ 'RQRWXVHZDWHURQJUHDVHILUHV1HYHUSLFNXS a flaming pan. Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJEDNLQJ smother the fire by closing the oven door and turning the oven off or by using a multi-purpose dry chemical or foam-type fire extinguisher. Ŷ ,IWKHUHLVDILUHLQWKHRYHQGXULQJVHOIFOHDQWXUQ the oven off and wait for the fire to go out. 'R not force the door open. Introduction of fresh air at self-clean temperatures may lead to a burst RIIODPHIURPWKHRYHQ)DLOXUHWRIROORZWKLV instruction may result in severe burns. WARNING OVEN SAFETY INSTRUCTIONS Ŷ 6WDQGDZD\IURPWKHRYHQZKHQRSHQLQJWKH RYHQGRRU+RWDLURUVWHDPZKLFKHVFDSHVFDQ FDXVHEXUQVWRKDQGVIDFHDQGRUH\HV Ŷ .HHSWKHRYHQYHQWXQREVWUXFWHG Ŷ .HHSWKHRYHQIUHHIURPJUHDVHEXLOGXS*UHDVH in the oven may ignite. Ŷ Place oven racks in desired location while oven is cool. If rack must be moved while oven is hot, do not let pot holder contact hot heating element in oven. Ŷ :KHQXVLQJFRRNLQJRUURDVWLQJEDJVLQWKH RYHQIROORZWKHPDQXIDFWXUHU¶VGLUHFWLRQV Ŷ 3XOOLQJRXWWKHVWDQGDUGUDFNVWRWKHLUVWRSORFNV or the extension rack to its fully open position is a convenience in lifting heavy foods. It is also a precaution against burns from touching hot surfaces of the door or oven walls. Ŷ 'RQRWOHDYHLWHPVVXFKDVSDSHUFRRNLQJ utensils or food in the oven when not in use. Items stored in an oven can ignite. Ŷ 1HYHUSODFHFRRNLQJXWHQVLOVSL]]DRUEDNLQJ stones, or any type of foil or liner on the oven IORRU7KHVHLWHPVFDQWUDSKHDWRUPHOWUHVXOWLQJ in damage to the product and risk of shock, smoke or fire. WARNING SELF-CLEANING OVEN SAFETY INSTRUCTIONS 7KHVHOIFOHDQLQJIHDWXUHRSHUDWHVWKHRYHQDWWHPSHUDWXUHVKLJKHQRXJKWREXUQDZD\IRRGVRLOVLQWKH RYHQ)ROORZWKHVHLQVWUXFWLRQVIRUVDIHRSHUDWLRQ amount of grease may ignite, leading to smoke Ŷ ' RQRWWRXFKRYHQVXUIDFHVGXULQJVHOIFOHDQ damage to your home. RSHUDWLRQ.HHSFKLOGUHQDZD\IURPWKHRYHQ GXULQJVHOIFOHDQLQJ)DLOXUHWRIROORZWKHVH Ŷ ,IWKHVHOIFOHDQLQJPRGHPDOIXQFWLRQVWXUQWKH instructions may cause burns. RYHQRIIDQGGLVFRQQHFWWKHSRZHUVXSSO\+DYH it serviced by a qualified technician. Ŷ % HIRUHVHOIFOHDQLQJWKHRYHQUHPRYHVKLQ\ silver colored oven racks (on some models), the Ŷ 'RQRWFOHDQWKHGRRUJDVNHW7KHGRRUJDVNHWLV probe, any aluminum foil, and any broiler pan, HVVHQWLDOIRUDJRRGVHDO&DUHVKRXOGEHWDNHQ JULGDQGRWKHUFRRNZDUH2QO\SRUFHODLQFRDWHG not to rub, damage or move the gasket. oven racks may be left in the oven. Ŷ ' RQRWXVHRYHQFOHDQHUV1RFRPPHUFLDORYHQ Ŷ % HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSH cleaner or oven liner protective coating of any kind JUHDVHDQGIRRGVRLOVIURPWKHRYHQ([FHVVLYH should be used in or around any part of the oven. 8 SAVE THESE INSTRUCTIONS 49-80741-2 Register Your Appliance: 5HJLVWHU\RXUQHZDSSOLDQFHRQOLQHDW\RXUFRQYHQLHQFH ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWUHJLVWHU 7LPHO\SURGXFWUHJLVWUDWLRQZLOODOORZIRUHQKDQFHGFRPPXQLFDWLRQDQGSURPSWVHUYLFHXQGHUWKHWHUPVRI\RXUZDUUDQW\ VKRXOGWKHQHHGDULVH<RXPD\DOVRPDLOLQWKHSUHSULQWHGUHJLVWUDWLRQFDUGLQFOXGHGLQWKHSDFNLQJPDWHULDO WARRANTY Thank You! ... for your purchase of a GE Brand appliance. GE Electric Range Warranty GEAppliances.com $OOZDUUDQW\VHUYLFHLVSURYLGHGE\RXU)DFWRU\6HUYLFH&HQWHUVRUDQDXWKRUL]HG&XVWRPHU&DUH® technician. 7RVFKHGXOHVHUYLFHRQOLQHYLVLWXVDWZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWRUFDOO*(&$5(6 (800.432.2737). Please have serial number and model number available when calling for service. 6HUYLFLQJ\RXUDSSOLDQFHPD\UHTXLUHWKHXVHRIWKHRQERDUGGDWDSRUWIRUGLDJQRVWLFV7KLVJLYHVD*(IDFWRU\ VHUYLFHWHFKQLFLDQWKHDELOLW\WRTXLFNO\GLDJQRVHDQ\LVVXHVZLWK\RXUDSSOLDQFHDQGKHOSV*(LPSURYHLWVSURGXFWV E\SURYLGLQJ*(ZLWKLQIRUPDWLRQRQ\RXUDSSOLDQFH,I\RXGRQRWZDQW\RXUDSSOLDQFHGDWDWREHVHQWWR*(SOHDVH DGYLVH\RXUWHFKQLFLDQQRWWRVXEPLWWKHGDWDWR*(DWWKHWLPHRIVHUYLFH )RUWKHSHULRGRIRQH\HDUIURPWKHGDWHRIWKHRULJLQDOSXUFKDVH*(ZLOOSURYLGHDQ\SDUWRIWKHUDQJHZKLFKIDLOVGXH WRDGHIHFWLQPDWHULDOVRUZRUNPDQVKLS'XULQJWKLVOLPLWHGRQH\HDUZDUUDQW\*(ZLOODOVRSURYLGHIUHHRIFKDUJHDOO labor and in-home service to replace the defective part. What GE will not cover: Ŷ 'DPDJHWRWKHSURGXFWFDXVHGE\DFFLGHQWILUH IORRGVRUDFWVRI*RG Ŷ Incidental or consequential damage caused by possible defects with this appliance. Ŷ 'DPDJHFDXVHGDIWHUGHOLYHU\ Ŷ Product not accessible to provide required service. Ŷ 6HUYLFHWRUHSDLURUUHSODFHOLJKWEXOEVH[FHSWIRU/(' lamps. EXCLUSION OF IMPLIED WARRANTIES <RXUVROHDQGH[FOXVLYHUHPHG\LVSURGXFWUHSDLUDVSURYLGHGLQWKLV/LPLWHG:DUUDQW\$Q\LPSOLHGZDUUDQWLHV including the implied warranties of merchantability or fitness for a particular purpose, are limited to one year or the shortest period allowed by law. 7KLVZDUUDQW\LVH[WHQGHGWRWKHRULJLQDOSXUFKDVHUDQGDQ\VXFFHHGLQJRZQHUIRUSURGXFWVSXUFKDVHGIRUKRPHXVH ZLWKLQWKH86$,IWKHSURGXFWLVORFDWHGLQDQDUHDZKHUHVHUYLFHE\D*($XWKRUL]HG6HUYLFHULVQRWDYDLODEOH\RX PD\EHUHVSRQVLEOHIRUDWULSFKDUJHRU\RXPD\EHUHTXLUHGWREULQJWKHSURGXFWWRDQ$XWKRUL]HG*(6HUYLFHORFDWLRQ IRUVHUYLFH,Q$ODVNDWKHZDUUDQW\H[FOXGHVWKHFRVWRIVKLSSLQJRUVHUYLFHFDOOVWR\RXUKRPH 6RPHVWDWHVGRQRWDOORZWKHH[FOXVLRQRUOLPLWDWLRQRILQFLGHQWDORUFRQVHTXHQWLDOGDPDJHV7KLVZDUUDQW\JLYHV\RX VSHFLILFOHJDOULJKWVDQG\RXPD\DOVRKDYHRWKHUULJKWVZKLFKYDU\IURPVWDWHWRVWDWH7RNQRZZKDW\RXUOHJDOULJKWV DUHFRQVXOW\RXUORFDORUVWDWHFRQVXPHUDIIDLUVRIILFHRU\RXUVWDWH¶V$WWRUQH\*HQHUDO :DUUDQWRU*HQHUDO(OHFWULF&RPSDQ\/RXLVYLOOH.< Extended Warranties:3XUFKDVHD*(H[WHQGHGZDUUDQW\DQGOHDUQDERXWVSHFLDOGLVFRXQWVWKDWDUHDYDLODEOHZKLOH \RXUZDUUDQW\LVVWLOOLQHIIHFW<RXFDQSXUFKDVHLWRQOLQHDQ\WLPH 6WDSOH\RXUUHFHLSWKHUH3URRIRIWKHRULJLQDOSXUFKDVH date is needed to obtain service under the warranty. Ŷ 6HUYLFHWULSVWR\RXUKRPHWRWHDFK\RXKRZWRXVH the product. Ŷ Improper installation, delivery or maintenance. Ŷ )DLOXUHRIWKHSURGXFWLILWLVDEXVHGPLVXVHG modified or used for other than the intended purpose or used commercially. Ŷ 5HSODFHPHQWRIKRXVHIXVHVRUUHVHWWLQJRIFLUFXLW breakers. ZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUWVKRSIRUH[WHQGHGVHUYLFHSODQVKWP RUFDOOGXULQJQRUPDOEXVLQHVVKRXUV*(&RQVXPHU+RPH6HUYLFHVZLOOVWLOOEHWKHUHDIWHU\RXU warranty expires. 49-80741-2 9 ASSISTANCE / ACCESSORIES Have a question or need assistance with your appliance? 7U\WKH*($SSOLDQFHV:HEVLWHwww.geappliances.com/service_and_support/) 24 hours a day, any day of the \HDU)RUJUHDWHUFRQYHQLHQFHDQGIDVWHUVHUYLFH\RXFDQQRZGRZQORDG2ZQHU¶V0DQXDOVRUGHUSDUWVRUHYHQ schedule service on-line. Schedule Service: ([SHUW*(UHSDLUVHUYLFHLVRQO\RQH VWHSDZD\IURP\RXUGRRU*HWRQOLQHDQGVFKHGXOH\RXU VHUYLFHDWZZZJHDSSOLDQFHVFRPVHUYLFHBDQGBVXSSRUW 2UFDOO*(&$5(6GXULQJQRUPDO business hours. Parts and Accessories: Individuals qualified to service their own appliances can have parts or accessories sent GLUHFWO\WRWKHLUKRPHV9,6$0DVWHU&DUGDQG'LVFRYHU FDUGVDUHDFFHSWHG2UGHURQOLQHWRGD\KRXUVHYHU\ day or by phone at 800.626.2002 during normal business hours. Instructions contained in this manual cover procedures WREHSHUIRUPHGE\DQ\XVHU2WKHUVHUYLFLQJJHQHUDOO\ VKRXOGEHUHIHUUHGWRTXDOLILHGVHUYLFHSHUVRQQHO&DXWLRQ must be exercised, since improper servicing may cause unsafe operation. Real Life Design Studio: *(VXSSRUWVWKH8QLYHUVDO 'HVLJQFRQFHSWRISURGXFWVVHUYLFHVDQGHQYLURQPHQWV that can be used by people of all ages, sizes and FDSDELOLWLHV:HUHFRJQL]HWKHQHHGWRGHVLJQIRUDZLGH range of physical and mental abilities and impairments. )RUGHWDLOVRI*(¶V8QLYHUVDO'HVLJQDSSOLFDWLRQVLQFOXGLQJ kitchen design ideas for people with disabilities, check out RXU:HEVLWHWRGD\)RUWKHKHDULQJLPSDLUHGSOHDVHFDOO 7''*($& Contact Us: If you are not satisfied with the service you UHFHLYHIURP*(FRQWDFWXVRQRXU:HEVLWHZLWKDOOWKH details including your phone number, or write to: General Manager, Customer Relations GE Appliances, Appliance Park Louisville, KY 40225 Accessories Looking For Something More? GE offers a variety of accessories to improve your cooking and maintenance experiences! 7RSODFHDQRUGHUYLVLWXVRQOLQHDW www.GEApplianceParts.com86RUwww.GEAppliances.ca&DQDGD or call 800.626.200286800.661.1616&DQDGD 7KHIROORZLQJSURGXFWVDQGPRUHDUHDYDLODEOH Accessories 6PDOO%URLOHU3DQô´[ó´[ò³ /DUJH%URLOHU3DQô´[ó´[ò³ ;/%URLOHU3DQ´[ó´[³ :%;86'*&DQDGD :%;86'*&DQDGD :%;861RWDYDLODEOHLQ&DQDGD Parts *ODVV7UD\ 0HWDO7UD\ 7XUQWDEOH 2YHQUDFNV 2YHQHOHPHQWV /LJKWEXOEV 3DUWQXPEHUVYDU\E\PRGHO :%; 3DUWQXPEHUVYDU\E\PRGHO 3DUWQXPEHUVYDU\E\PRGHO 3DUWQXPEHUVYDU\E\PRGHO 3DUWQXPEHUVYDU\E\PRGHO Cleaning Supplies R]0LFUR%U\WH®$SSOLDQFH&OHDQHU &LWUX6KLQH6WDLQOHVV6WHHO:LSHV &HUDPD%U\WH®6WDLQOHVV6WHHO$SSOLDQFH&OHDQHU *UDSKLWH/XEULFDQW :;; :;; 30; :%7 7KHODUJHEURLOHUSDQGRHVQRWILWLQ´´UDQJHV 7KH;/EURLOHUSDQGRHVQRWILWLQ´ZDOORYHQV´GURSLQVRU´´UDQJHV How to Remove Protective Shipping Film and Packaging Tape &DUHIXOO\JUDVSDFRUQHURIWKHSURWHFWLYHVKLSSLQJILOP with your fingers and slowly peel it from the appliance VXUIDFH'RQRWXVHDQ\VKDUSLWHPVWRUHPRYHWKHILOP 5HPRYHDOORIWKHILOPEHIRUHXVLQJWKHDSSOLDQFHIRUWKH first time. 10 7RDVVXUHQRGDPDJHLVGRQHWRWKHILQLVKRIWKH product, the safest way to remove the adhesive from packaging tape on new appliances is an application of DKRXVHKROGOLTXLGGLVKZDVKLQJGHWHUJHQW$SSO\ZLWKD soft cloth and allow to soak. NOTE: 7KHDGKHVLYHPXVWEHUHPRYHGIURPDOOSDUWV,W cannot be removed if it is baked on. 49-80741-2 Upper Oven Controls 7 9 11 8 10 12 Common Controls 1 6 2 Common Controls 1. 2. 3. 4. Timer On/Off: :RUNVDVDFRXQWGRZQWLPHU3UHVV the Timer On/Off pad, select the timer type (hours and minutes or minutes and seconds), use the selector dial to set the time, and press the selector dial to start the timer FRXQWGRZQ7KHRYHQZLOOFRQWLQXHWRRSHUDWHZKHQWKH WLPHUFRXQWGRZQLVFRPSOHWH7RWXUQWKHWLPHURIISUHVV the Timer On/Off pad. Settings / Lock Controls: )LQGRYHQRSWLRQVIRU +HOS&ORFN6HWWLQJV'LVSOD\0RGH$XWR&RQYHUVLRQ$XWR 6KXW2II%HHSHU9ROXPH5HPLQGHU7HPSHUDWXUH8QLWV 7KHUPRVWDW$GMXVWDQG2YHQ,QIRUPDWLRQXQGHUWKLVVHOHFWLRQ 6HHWKH2YHQ6HWWLQJVVHFWLRQIRUPRUHGHWDLOV3UHVV and hold Settings pad for 3 seconds to lock or unlock the FRQWUROV7KLVORFNVRXWWKHFRQWUROVRWKDWSUHVVLQJDQ\RI WKHFRQWUROSDGVGRHVQRWDFWLYDWHWKHIHDWXUH&OHDU2IILV always active, even when the control is locked. Selector Dial: 7KHVHOHFWRUGLDOLVXVHGIRUERWK WKHXSSHUDQGORZHURYHQV5RWDWHGLDOWRVHOHFWRYHQ VHWWLQJVXSSHUORZHURYHQRSWLRQVDQGFRRNLQJRSWLRQV WKHQSUHVVWRFRQILUPWKHVHOHFWLRQ5RWDWHGLDOWRLQFUHDVH or decrease temperatures or time and then press to confirm the set temperature or time. Back: Press this pad to go back a menu level in the display. 5. Start/Pause: Press the Start/Pause pad to start any cooking, clean or timed function. Press the Start/Pause pad to pause any upper oven features. 6. Display: Information about both the upper and lower ovens is shown in this display window. Upper Oven Controls 7. Microwave: Press the Microwave pad for microwaving RSWLRQV8VHWKHVHOHFWRUGLDOWRILQGWKHPLFURZDYLQJ option desired and press the selector dial to select it. 2SWLRQVDYDLODEOHLQFOXGH&RRNE\7LPH&RRN'HIURVW %HYHUDJH3RSFRUQ0HOW5HKHDW6LPPHUDQG6RIWHQ 8VHWKHFOHDUJODVVWUD\DQGPLFURZDYHVDIHFRRNZDUH ZKHQXVLQJWKHPLFURZDYHIHDWXUHV6HH8SSHU2YHQ 0LFURZDYLQJVHFWLRQIRUPRUHGHWDLO 8. Lower Oven Controls 3 9. 4 13 14 5 18 17 15 16 Speed Cook: Press the Speed Cook pad to access the preset speed cook menu. Place food or oven-safe dish directly on the metal tray when using the speed cook IHDWXUH'RQRWXVHSODVWLFRUVLOLFRQHFRRNZDUHZKHQ XVLQJWKLVIHDWXUHVLQFHWKH\FRXOGPHOWRUGHIRUP6HH 8SSHU2YHQ6SHHGFRRNLQJVHFWLRQIRUPRUHGHWDLO 10. Convection Bake: Press the Convection Bake pad to convection bake in the upper oven. Place food or oven safe dish on the metal tray when using the convection EDNHIHDWXUH:KHQFRQYHFWLRQEDNLQJRQWZROHYHOVSODFH food or oven safe dish on the aluminum baking sheet on WKHZLUHRYHQUDFNDQGSODFHWKHPRQWKHPHWDOWUD\6HH 8SSHU2YHQ%DNLQJ%URLOLQJDQG7RDVWLQJIRUPRUHGHWDLO USING THE OVEN: Oven Controls Oven Controls 11. Cooking Options: )LQGWKH5HSHDW/DVW%URLO3URRI 7RDVWDQG:DUPIHDWXUHVXQGHUWKLVVHOHFWLRQ6HHWKH 2YHQ2SWLRQVVHFWLRQIRUPRUHGHWDLOV 12. Clear/Off: 7KH&OHDU2IISDGFDQFHOV$//XSSHURYHQ programs except the clock and timer. Lower Oven Controls 13. Light: Press the Light pad to turn the oven light on or RIILQWKHORZHURYHQ1RWHWKDWOLJKWLQWKHORZHURYHQZLOO not turn on if the oven is in a clean mode. 14. Bake: Press the Bake pad to bake, rotate selector dial to select baking temperature and press to select. 15. Broil: Press the Broil pad to broil, rotate selector dial to VHOHFW+L/RDQGSUHVVWRVHOHFW 16. Options: )LQGWKH'HOD\6WDUW3UREH3URRI6DEEDWK 6HOI&OHDQ6WHDP&OHDQDQG:DUPIHDWXUHVXQGHUWKLV VHOHFWLRQ6HHWKH2YHQ2SWLRQVVHFWLRQIRUPRUHGHWDLOV 17. Convection Bake: Press the Convection Bake SDGWRFRQYHFWLRQEDNH&RQYHFWLRQFRRNPRGHVXVH LQFUHDVHGDLUFLUFXODWLRQWRLPSURYHSHUIRUPDQFH7KHW\SH RIEHQHILWGHSHQGVRQWKHPRGH<RXUORZHURYHQKDVWKH IROORZLQJFRQYHFWLRQFRRNLQJPRGHV&RQYHFWLRQ%DNH 5DFN0XOWLDQG&RQYHFWLRQ5RDVW6HHWKH/RZHU2YHQ &RRNLQJ0RGHVVHFWLRQIRUPRUHLQIRUPDWLRQ 18. Clear/Off: 7KH&OHDU2IISDGFDQFHOV$//ORZHURYHQ programs except the clock and timer. Add 30 Sec: Press the Add 30 Sec pad for 30 VHFRQGVRIPLFURZDYHFRRNLQJWLPH(DFKWLPHWKLVSDG is pressed an additional 30 seconds is added to the UHPDLQLQJFRRNLQJWLPH7KHRYHQVWDUWVLPPHGLDWHO\ 49-80741-2 11 USING THE OVEN: Oven Settings Oven Settings Help Clock Settings 8VHWKLVIHDWXUHWRILQGRXWPRUHDERXW\RXURYHQDQG its features by pressing the Settings pad and selecting KHOS7XUQWKHVHOHFWRUGLDODQGSUHVVWRVHOHFWWKH feature you want to find out more about. NOTE:1RWDOOIHDWXUHVRIKHOSPD\EHRQ\RXURYHQ PRGHO%HORZDUHIHDWXUHVIRXQGLQWKH+HOSIXQFWLRQ 8VHWKLVIHDWXUHWRVHWWKHWLPHRIGD\DQGWRVSHFLI\ KRZWKHWLPHRIGD\ZLOOEHGLVSOD\HG<RXFDQVHOHFWD standard 12-hour clock (12 hr) or 24-hour military time display (24 hr). Prior to the first use of your oven, the clock must be set. Features found in the Help function. $GGLQJ7LPH 'HIURVWE\:HLJKW 6WDUW3DXVH $XWR&RQYHUVLRQ 'HOD\6WDUW/RZHU 6WHDP&OHDQ $XWR6KXW2II 'LVSOD\0RGH 7HPSHUDWXUH8QLWV %DFN (GLW 7KHUPRVWDW$GMXVW %DNH +HOS 7LPHU2Q2II %HHSHU9ROXPH 0HOW 7RDVW %HYHUDJH 0LFUR6HFV :DUP %URLO 0LFURZDYH &OHDU2II 0\UHFLSHV &ORFN Probe &RQWURO/RFNRXW Proof &RRN 5HKHDW &RRNE\)RRG 5HPLQGHU &RRNE\7LPH 5HSHDW/DVW Display Mode 8VHWKLVIHDWXUHWRVHW3RZHU6DYHURU'LVSOD\$OZD\V 2QGLVSOD\PRGH Auto Conversion 8VHWKLVIHDWXUHWRWXUQ$XWR&RQYHUVLRQRQRII:KHQ $XWR&RQYHUVLRQLVRQLWZLOODXWRPDWLFDOO\FRQYHUWWKH regular baking temperatures entered to convection bake FRRNLQJWHPSHUDWXUHVZKHQXVLQJFRQYHFWLRQEDNH7KLV adjusts the temperature in both ovens. Auto Shut-Off 8VHWKLVIHDWXUHWRDFWLYDWHGHDFWLYDWH$XWR6KXW2II $FWLYDWLQJWKH$XWR6KXW2IIIHDWXUHZLOOWXUQRIIWKH lower oven after 12 hours of continuous operations. 7KHIDFWRU\VHWWLQJIRU$XWR6KXW2IIIHDWXUHLV DFWLYDWHG:KHQLQ6DEEDWKPRGH$XWR6KXW2IIZLOOEH deactivated. &RRNE\7LPH 5HVXPH &RRNLQJ2SWLRQV/RZHU 6DEEDWK &RRNLQJ2SWLRQV8SSHU 6HOI&OHDQ 'HIURVW 6HQVRU&RRNLQJ 'HIURVWE\)RRG 6LPPHU 'HIURVWE\7LPH 6RIWHQ Reminder 6SHHG&RRN 8VHWKLVIHDWXUHWR6HW5HYLHZRU&OHDU5HPLQGHU Beeper Volume 8VHWKLVIHDWXUHWRVHW%HHSHU9ROXPHWR0XWHRU1RUPDO NOTE:6RPHWRQHVDUHQRWPXWDEOH Temperature Units 8VHWKLVIHDWXUHWRVHWWKHGLVSOD\WHPSHUDWXUHXQLWWR°) )DKUHQKHLWRU°&&HOVLXV Thermostat Adjust 7KLVIHDWXUHDOORZVWKHRYHQEDNLQJDQGFRQYHFWLRQ baking temperature to be adjusted up to 35°)KRWWHU or down to 35°)FRROHURQWKHORZHURYHQ7KHXSSHU RYHQFDQQRWEHDGMXVWHG8VHWKLVIHDWXUHLI\RXEHOLHYH your oven temperature is too hot or too cold and wish to FKDQJHLW7KLVDGMXVWPHQWDIIHFWV%DNHDQG&RQYHFWLRQ %DNHPRGHV1RRWKHUFRRNLQJPRGHVDUHDIIHFWHG Oven Information 7KLVIHDWXUHVKRZVWKH2YHQ0RGHODQG6HULDOQXPEHU 12 49-80741-2 Upper Oven Options Repeat Last 7KLVIHDWXUHFDQRQO\EHXVHGIRUXSSHURYHQFRRNLQJ PRGHV8VHWKLVWLPHVDYLQJIHDWXUHIRUFRRNLQJ UHSHWLWLYHLWHPVOLNHFRRNLHVRUDSSHWL]HUV:KHQ selecting this feature, the last preset food will be GLVSOD\HG6HOHFWStart/Pause pad or the selector dial to start cooking. NOTE:7KHODVWSURJUDPXVHGLVVWRUHGIRUWZRKRXUV 1RWDOOIHDWXUHVFDQEHUHSHDWHG Broil 8VHWKLVIHDWXUHWREURLO5HPHPEHUWRXVHWKHPHWDOWUD\ DQGPHWDOUDFN6HH8SSHU2YHQ%DNLQJ%URLOLQJDQG 7RDVWLQJVHFWLRQIRUPRUHGHWDLO Proof 8VHWKLVIHDWXUHWRSURRIEUHDG6HH8SSHU2YHQ :DUPLQJDQG3URRILQJVHFWLRQIRUPRUHGHWDLO Toast 8VHWKLVIHDWXUHWRWRDVW5HPHPEHUWRXVHWKHPHWDO WUD\DQGPHWDOUDFN6HH8SSHU2YHQ%DNLQJ%URLOLQJ DQG7RDVWLQJVHFWLRQIRUPRUHGHWDLO Warm 8VHWKLVIHDWXUHWRZDUP6HOHFW0RLVWRU&ULVS6HH 8SSHU2YHQ:DUPLQJDQG3URRILQJVHFWLRQIRUPRUH detail. Lower Oven Options Delay Start 8VHWKLVIHDWXUHWRGHOD\VWDUWLQJD%DNH&RQY%DNH 3UREHRU6HOI&OHDQIHDWXUH7RXVHWKLVIHDWXUHVHOHFW 'HOD\6WDUWDQGVHWWKHWLPHWRVWDUWWKHQVHOHFWFRRN PRGH<RXFDQDOVRXVHWKH'HOD\6WDUWIHDWXUHZKLOH SURJUDPPLQJD%DNH&RQY%DNHRU3UREHFRRNLQJ feature. Probe 8VHWKLVIHDWXUHWRFRRNE\WKHLQWHUQDOWHPSHUDWXUHRI WKHIRRG)RUPDQ\IRRGVHVSHFLDOO\URDVWDQGSRXOWU\ internal food temperature is the best test for doneness. 7KLVIHDWXUHLVDYDLODEOHIRUWKHORZHURYHQRQO\7RXVH WKLVIHDWXUHLQVHUWSUREHLQWRIRRG6HOHFW3UREHWKHQ enter the desired internal food temperature and program WKH%DNHRU&RQY%DNHFRRNLQJPRGHDVQRUPDO 7KLVIHDWXUHFDQDOVREHDFFHVVHGE\FRQQHFWLQJWKH temperature probe into the oven at any time. Proof 8VHWKLVIHDWXUHWRSURRIGRXJK6HH/RZHU2YHQ &RRNLQJ0RGHVIRUPRUHGHWDLO Sabbath 8VHWKLVIHDWXUHWRHQWHU6DEEDWKPRGH6DEEDWKPRGH VHWVWKHRYHQIRUREVHUYDQFHRIWKH-HZLVK6DEEDWK DQG+ROLGD\V7KLVIHDWXUHFRQIRUPVWRWKH6WDU. -HZLVK6DEEDWKUHTXLUHPHQWV6DEEDWKPRGHGLVDEOHV the oven lights (the oven light will not turn on when the door is opened), all sounds (the control will not beep when a button is pressed, but will still beep if certain oven faults occur), and all upper oven functions and 49-80741-2 ORZHURYHQIXQFWLRQVH[FHSWORZHURYHQ%DNH'XULQJ 6DEEDWKPRGHRQO\ORZHURYHQ%DNHLVDYDLODEOH :KLOHLQ6DEEDWKPRGHDIWHUVHWWLQJFKDQJLQJDEDNH temperature, a random delay of approximately 30 seconds to 1 minute will occur before the oven will begin EDNLQJ7RVWRSFRRNLQJSUHVVWKHBack pad and then the Start/PauseSDG<RXURYHQZLOOVKXWRIIDIWHUD random delay of approximately 30 seconds to 1 minute. 7RLPPHGLDWHO\H[LWORZHURYHQ%DNHSUHVVWKHClear/ Off pad at any time – cooking elements will immediately WXUQRIIDQG6DEEDWK%DNHZLOOFKDQJHWR6DEEDWKRQ WKHGLVSOD\LQGLFDWLQJWKDWWKHRYHQKDVWXUQHGRII7R H[LW6DEEDWKPRGHSUHVVDQGKROGWKHBack pad for 3 VHFRQGV'RQRWSUHVVDQ\RWKHUEXWWRQVXQWLO6DEEDWK PRGHKDVH[LWHGRU6DEEDWKPRGHZLOOEHUHLQLWLDOL]HG DQGZLOOQRWH[LW6HH/RZHU2YHQ6DEEDWK0RGHIRU more detail. NOTE:,ISRZHURXWDJHRFFXUVGXULQJ6DEEDWKPRGHWKH XQLWZLOOUHPDLQLQ6DEEDWKPRGHEXWZLOOQRORQJHUEH cooking when power is restored. USING THE OVEN: Oven Options Oven Options Self Clean 8VHWKLVIHDWXUHWRHQWHU6HOI&OHDQPRGH6HH&OHDQLQJ 7KH2YHQVHFWLRQIRUPRUHGHWDLO Steam Clean 8VHWKLVIHDWXUHWRHQWHU6WHDP&OHDQPRGH6HH &OHDQLQJ7KH2YHQVHFWLRQIRUPRUHGHWDLO Warm 8VHWKLVIHDWXUHWRZDUP6HH/RZHU2YHQ&RRNLQJ 0RGHVIRUPRUHGHWDLO 13 UPPER OVEN: Speedcooking Speedcooking Using Speedcook Features CAUTION: When using speedcook programs, remember that the oven, door and dishes will be very hot! %HIRUH\RXEHJLQPDNHVXUHWKHWXUQWDEOHLVLQSODFH 8VHWKHQRQVWLFNPHWDOWUD\DQG\RXURZQJODVVRU ceramic cookware, if needed. The turntable must always be in place when using the oven. 63(('&22.35(6(7)22'6(/(&7,216 Ŷ$SSHWL]HUV Ŷ%UHDGV Ŷ%UHDNIDVW Ŷ'HVVHUWV Ŷ(QWUHHV Ŷ0HDWV Ŷ3L]]D Ŷ3RWDWRHV Ŷ6DQGZLFK Ŷ3RXOWU\ Ŷ6HDIRRG Ŷ6LGH'LVK Put food directly on the non-stick metal tray to speedcook. To Use A Preset Speedcook Menu 8SSHURYHQLVDOUHDG\SUHVHWWRFRRNRYHUSRSXODUGLVKHV 1. Press the Speedcook pad. If no selection is made within 15 seconds, the display will revert back to the time of day. 7XUQWKHVHOHFWRUGLDOWRVHOHFWWKHW\SHRIIRRG category you want. Press the selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWWKHVSHFLILFIRRGPHQX selection). Press the selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWDPRXQWVL]HDQG or doneness (if required, the oven will prompt you). Press the selector dial after each selection. 2QFHWKHGLVSOD\VKRZV(GLWRU6WDUWHLWKHUSUHVV start or the selector dial to start cooking. 7XUQWKHIRRGRYHUZKHQWKHRYHQVLJQDOV7XUQ)RRG2YHU (for certain foods). :KHQWKHRYHQVLJQDOV&KHFNIRU'RQHQHVVFKHFNWRVHH if your food is done to your liking (for certain foods). 7RUHYLHZVHWWLQJVGXULQJFRRNLQJSUHVVWKHVHOHFWRUGLDO If you enter an undesired selection at any time, simply press the Back pad and reenter the desired selections. Things That Are Normal Ŷ (DUO\LQDVSHHGFRRNSURJUDP\RXZLOOVHH 2SWLPL]LQJ&RRN7LPHRQWKHGLVSOD\7KHRYHQ automatically senses the electrical voltage level in your home and adjusts the cooking time up or down for proper cooking. Ŷ ,IWKHGRRULVRSHQHGGXULQJFRRNLQJWKHRYHQZLOOVWRS DQG3DXVHZLOODSSHDULQWKHGLVSOD\&ORVHWKHGRRU and press the Start/Pause pad to resume cooking. Ŷ $WDQ\WLPHGXULQJFRRNLQJ\RXFDQWXUQWKHVHOHFWRU GLDOWRFKDQJHWKHFRRNLQJWLPH<RXFDQFKDQJH power levels by pressing the selector dial to edit setting. Ŷ 7RDVVXUHFRQVLVWHQWFRRNLQJUHVXOWVWKHRYHQPD\ adjust power levels downward if the oven is hot at the beginning of a program. Ŷ 7RFRRNIRUDGGLWLRQDOWLPHDIWHUDFRRNLQJF\FOHKDV been completed, use the resume feature. 14 Ŷ 7KHIDQZLOOEHRQGXULQJFRRNLQJ$WWKHHQGRI cooking, the automatic fan may continue to run for a VKRUWWLPHDQGWKHGLVSOD\ZLOOUHDG2YHQLV&RROLQJ 7KHIDQZLOODXWRPDWLFDOO\VKXWRIIZKHQWKHLQWHUQDO parts of the oven have cooled. Ŷ 7KHRYHQYHQWZLOOHPLWZDUPDLUZKLOHWKHRYHQLV on. Ŷ 7KHKDORJHQOLJKWVZLOOGLPDQGF\FOHRQDQGRII during a speedcook cycle, sometimes even at full SRZHUOHYHOV7KLVLVQRUPDO7KHRYHQVHQVHVWKH heat level and adjusts automatically. Ŷ 1RSUHKHDWLQJWLPHLVUHTXLUHGGXULQJ6SHHGFRRN F\FOHV7KHRYHQEHJLQVFRRNLQJLPPHGLDWHO\ Ŷ &OLFNVDQGDIDQEORZLQJDUHQRUPDOVRXQGVGXULQJ FRRNLQJ7KHUHOD\ERDUGLVWXUQLQJFRPSRQHQWVRQ and off. 49-80741-2 Preset Speedcook Menu Selections Food Category Menu Selection Food Category Menu Selection $SSHWL]HUV %DJHO%LWHV &KHHVH6WLFNV (JJ5ROOV)UR]HQ +RW'LS±&XSV Jalapeno Poppers 0HDW%DOOV)UR]HQ 1DFKRV 1XWV5RDVWHG 2QLRQ5LQJV 3L]]D5ROOV 6RIW3UHW]HOV)UR]HQ %DJHOVIUR]HQ %LVFXLWV %UHDG6WLFNV &KHHVH%UHDG &UHVFHQW5ROOV 'LQQHU5ROOV *DUOLF%UHDG 4XLFN%UHDG[ 6ZHHW5ROOV'DQLVK 7DFR6KHOOVER[HG 7H[DV7RDVW %DJHOVIUR]HQ %HOJLDQ:DIIOHV %UHDNIDVW3L]]D &DVVHUROHHJJ[ &RIIHH&DNH )UHQFK7RDVW Pancakes (frozen) +DVKEURZQ3DWWLHV 5ROOVUHIULJHUDWHG 6DXVDJH%LVFXLW 6DXVDJH 6WUXGHOIUR]HQ 6ZHHW5ROOV'DQLVK 7XUQRYHUV :DIIOHVIUR]HQ %URZQLHV &DNHVPL[[ &REEOHUIUHVK[ &RIIHH&DNH &RRNLHV Pie (fresh fruit) 5ROOVUHIULJHUDWHG 7XUQRYHUV %XUULWRVIUR]HQ &KLPLFKDQJD &DVVHUROH (JJ5ROOVIUR]HQ (QFKLODGDIUHVK /DVDJQD 0HDWORDI[ 4XHVDGLOODVIUHVK 6WXIIHG3HSSHUV Meats 3L]]D Potatoes Poultry Sandwich Seafood Side Dish )LOHW0LJQRQ +DPEXUJHU /DPE&KRSV 3RUN&KRSV 5RDVW±3RUN 5RDVW±%HHI 5LEH\H6WHDN 6LUORLQ6WHDN 6WULS6WHDN 7%RQH6WHDN 7HQGHUORLQ 'HOL)UHVK 8VH3UHFRRNHG&UXVW )UR]HQ3L]]D %DNHG3RWDWR +DVKEURZQ3DWWLHV )UR]HQ)ULHV )UR]HQ1XJJHW 6ZHHW3RWDWR<DP &KLFNHQ%RQH,Q &KLFNHQ%RQHOHVV &KLFNHQ)LOOHWIUR]HQ &KLFNHQ)LQJHUIUR]HQ &KLFNHQ)ULHGIUR]HQ &KLFNHQ1XJJHWIUR]HQ &KLFNHQ3DWW\IUR]HQ &KLFNHQ7HQGHUIUR]HQ &KLFNHQ:LQJVIUR]HQ &KLFNHQ:KROH 7XUNH\ &RUQ'RJIUR]HQ &UHVFHQW5ROO+RW'RJ *ULOOHG6DQGZLFK +RW'RJLQD%XQ 3RFNHW6DQGZLFK 7DTXLWRVIUR]HQ &RG)LOOHWV )LVK6WLFNVIUR]HQ )UR]HQ%UHDGHG /REVWHU7DLOV 2UDQJH5RXJK\)LOOHW 6DOPRQ 6HD%DVV 6KHOOILVK 6ZRUGILVK6WHDN 7LODSLD 7XQD6WHDNV :KLWHILVK 5HIULHG%HDQVR] 5RDVWHG$VSDUDJXV 5RDVWHG%HOO3HSSHU 5RDVWHG&KLOLV 5RDVWHG&RUQ 5RDVWHG*DUOLF 5RDVWHG0L[HG9HJHWDEOHV 6WXIILQJPL[ 6WXIIHG0XVKURRPV 6WXIIHG7RPDWRHV Breads Breakfast Desserts Entree 49-80741-2 UPPER OVEN: Speedcooking Speedcooking (Cont.) 15 UPPER OVEN: Speedcooking Speedcooking (Cont.) Cooking Tips For Great Tasting Results 7RHQVXUHFRQVLVWHQWDQGHYHQEURZQLQJZKHQFRRNLQJIRRGVGLUHFWO\RQWKHPHWDOWUD\DUUDQJHIRRGDVVKRZQEHORZ Foods can touch but should not overlap. Side by side pattern (Example: meats and poultry) Spoke pattern (Example: crescent rolls, breadsticks) Single layer (Example: appetizers) Circular pattern (Example: biscuits, cookies) )UHVKPHDWFKLFNHQILVKRUVHDIRRGWKDWKDVEHHQIUR]HQVKRXOGEHthawed before cooking (the microwave defrost IHDWXUHFDQEHXVHG)RURWKHUIUR]HQSUHSDFNDJHGIRRGVIROORZSDFNDJHGLUHFWLRQV Ŷ :KHQFRRNLQJEDFRQOD\HUVWULSVRQDSODWH&RYHU each layer with a paper towel. Ŷ :KHQFRRNLQJYHJHWDEOHVXVHDPLFURZDYHVDIH FDVVHUROHRUERZO&RYHUZLWKDPLFURZDYHVDIHOLG or vented plastic wrap. Ŷ )RUIUR]HQYHJHWDEOHVIROORZWKHSDFNDJH instructions for adding water. Ŷ )RUIUHVKYHJHWDEOHVDGGWDEOHVSRRQVRIZDWHUIRU each serving. Speedcook Cookware Ŷ )ROORZFRRNZDUHVXJJHVWLRQVRQWKHRYHQGLVSOD\RU in the cookbook or cooking guide. Ŷ &RRNZDUHZLOOEHFRPHKRWEHFDXVHRIKHDW WUDQVIHUUHGIURPWKHKHDWHGIRRG2YHQPLWWVZLOOEH needed to handle the cookware. Ŷ 3ODFHIRRGGLUHFWO\RQWKHQRQVWLFNPHWDOWUD\ when cooking, unless prompted by the oven to do otherwise. Ŷ 8VHWKHQRQVWLFNPHWDOWUD\LQWKHVDPHZD\\RX would use a shallow baking pan or baking tray. Ŷ ,QDGGLWLRQWRWKHFRRNZDUHSURYLGHG\RXFDQXVH non-metal casserole dishes, pie plates and other heat-safe cookware. Place them directly on the turntable. Ŷ %HVXUHWRVHOHFWDVL]HWKDWZLOOURWDWHHDVLO\ Ŷ 3ODFHWKHQRQVWLFNPHWDOWUD\RQWKHWXUQWDEOH3ODFH glass or ceramic cookware on the tray. Ŷ 'RQRWXVHFRRNZDUHRUFRYHULQJVPDGHRISDSHU plastic or foil when cooking during a speedcook cycle. Speedcook Power Level 8SSHURYHQXVHVSRZHUIURPDKLJKLQWHQVLW\KDORJHQ light, ceramic heaters and microwaves to cook food from the top, bottom and interior simultaneously to seal in moisture and flavor. :KHQXVLQJWKHSUHVHWVSHHGFRRNUHFLSHVRQWKHIRRG menu, the power levels are already selected for you. +RZHYHUWKHVHSRZHUOHYHOVFDQEHDGMXVWHGEHIRUHRU during cooking by using the selector dial to select to edit WKHFRRNPRGHVHWWLQJ7KHP\UHFLSHVIHDWXUHDOORZV you to speedcook items not on the preset food menu by selecting your own cook time and power level settings. (DFKSRZHUOHYHOJLYHV\RXKHDWHUSRZHUDQGPLFURZDYH energy for a certain percentage of the time. 16 8SSHU+HDWHU8+FRQWUROVERWKWKHXSSHUKDORJHQOLJKW DQGXSSHUFHUDPLFKHDWHU$KLJKHU8SSHU+HDWHUVHWWLQJ will utilize more upper heater power, browning food faster on top. 6HOHFWDKLJKHUVHWWLQJIRUIRRGVVXFKDVSL]]DDQG EDNHGJRRGV6HOHFWDORZHUVHWWLQJIRUIRRGVVXFKDV casseroles, meat and fish. /RZHU+HDWHU/+FRQWUROVWKHORZHUKHDWHU 6HOHFWDKLJKHUVHWWLQJWREURZQIRRGVPRUHRQWKHERWWRP 6HOHFWDORZHUVHWWLQJIRUOHVVEURZQLQJRQWKHERWWRP 49-80741-2 Speedcook Power Level (Cont.) 0LFURZDYH0FRQWUROVWKHPLFURZDYHSRZHU$KLJKHU setting will utilize more microwave power shortening cooking time for dense or heavy foods. 1. Press the Speedcook pad and turn the selector dial WRVHOHFW)RRG0HQX)DYRULWH5HFLSHRU&XVWRP 6SHHGFRRNWRPDQXDOO\VHWSRZHUOHYHODQGWLPHU Press the selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWDIRRGWLPHRUSRZHU level as prompted. Press the selector dial to enter. 7RFKDQJHWKHSRZHUOHYHOZKHQSURPSWHGE\WKH display, turn the selector dial clockwise to increase or counterclockwise to decrease the upper power level. Press the selector dial to enter. 0LFURZDYHPD[LPXPOHYHOVDUHVHWDXWRPDWLFDOO\ based on the upper and lower lamp settings. 5. Press the Start/Pause pad or the selector dial to start cooking. If you do not want to change one of the settings, just press the selector dial to move to the next selection. NOTE:%HFDUHIXOZKHQDGMXVWLQJSRZHUOHYHOVVRWKDW you do not over- or undercook food. Ŷ :KHQFRRNLQJIRUDQH[WHQGHGSHULRGRIWLPHWKH oven may automatically reduce the power levels to maintain the appropriate level of oven heat. )ROORZWKHVHJHQHUDOJXLGHOLQHVZKHQVHOHFWLQJWKHEHVW8+/+DQG0VHWWLQJVIRU\RXUIDYRULWHUHFLSH UH 6HOHFWDKLJKHUVHWWLQJIRUWKLQIRRGVUHTXLULQJ a golden brown top (example: fish fillets, toast, ERQHOHVVFKLFNHQEUHDVWV6HOHFWDORZHUVHWWLQJ for thicker foods and foods with high sugar or fat content (example: cakes, roasts). M 6HOHFWDKLJKHUVHWWLQJWRVKRUWHQFRRNLQJWLPHIRU dense or heavy foods (example: casseroles, whole FKLFNHQ6HOHFWDORZHUVHWWLQJIRUGHOLFDWHIRRGV (example: breads) or foods requiring longer cook times for tender results (example: stew, pot roast). LH 6HOHFWDKLJKHUVHWWLQJIRUWKLFNRUGHQVHIRRGV that may not cook quickly in the center (example: FDVVHUROHV6HOHFWDORZHUVHWWLQJIRUWKLQIRRGV (example: cookies) and foods containing high fat or sugar content (example: pastry, cakes). UPPER OVEN: Speedcooking Speedcooking (Cont.) My Recipes 8SSHURYHQJLYHV\RXWKHIOH[LELOLW\WRFRRN\RXUIDYRULWH dishes. If you want to cook a food item that is not among the preset selections, use my recipes. 1. Press the Speedcook pad. If no entries are made within 15 seconds, the display will revert back to the time of day. 7XUQWKHVHOHFWRUGLDOWRVHOHFWP\UHFLSHV3UHVVWKH selector dial to enter. 3. Press selector dial to select new recipe. 7XUQWRVHOHFWFRRNLQJWLPH 7KHGLVSOD\ZLOOSURPSW\RXWRVHOHFWWKHSRZHU level(s). 7XUQWKHVHOHFWRUGLDOFORFNZLVHWRLQFUHDVHRU counterclockwise to decrease the upper heater power level. Press the selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRFKDQJHWKHORZHUKHDWHU power level. Press the selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRFKDQJHWKHPLFURZDYH power level press the selector dial to enter. 8. Press the Start/Pause pad or press the selector dial WRVWDUWFRRNLQJ6HOHFWHGLWWRHGLWVHOHFWLRQV 49-80741-2 )RUSRZHUOHYHODQGFRRNLQJWLPHVXJJHVWLRQVXVH\RXU cooking guide or cookbook. <RXFDQVHOHFWVDYHWRVDYHP\UHFLSH\RXMXVW SURJUDPPHGIRUODWHUXVH6SHOO7KH)RRG1DPH DSSHDUV7XUQWKHVHOHFWRUGLDOWRWKHILUVWOHWWHURI\RXU food description and press the selector dial to enter. &RQWLQXHWKLVSURFHVVWRVSHOOWKHUHVWRIWKHIRRGQDPH Press the Start/Pause pad to save the recipe and its QDPH7RDFFHVVWKHVDYHGUHFLSHSUHVVVSHHGFRRNP\ recipes and select the recipe you saved. To edit/delete stored custom speedcook recipes: 1. Press the Speedcook pad. 7XUQVHOHFWRUGLDOWRP\UHFLSHV3UHVVWKHVHOHFWRU dial to enter. 7XUQVHOHFWRUGLDOWRVHOHFWWKHVWRUHGFXVWRPUHFLSH Press the selector dial to enter. 7XUQVHOHFWRUGLDOWRHGLWRUGHOHWHWRHGLWRUGHOHWH the custom recipe. Press the selector dial to edit or delete. 17 UPPER OVEN: Baking, Broiling and Toasting Baking, Broiling And Toasting Baking, Broiling And Toasting %DNLQJDOORZV\RXWRFRRNIRRGVWKHVDPHZD\DVD conventional oven, using a heating element to raise WKHWHPSHUDWXUHRIWKHDLULQVLGHWKHRYHQ$Q\RYHQ WHPSHUDWXUHIURP)WR)PD\EHVHW %URLOLQJDOORZV\RXWREURLOIRRGVLQWKHVDPHZD\DVD The turntable must always be in Put food or oven-safe cookware place when using the oven. directly on the metal tray to bake. conventional oven. 7RDVWLQJDOORZV\RXWRWRDVWIRRGVWKHVDPHZD\DVD %HIRUH\RXEHJLQPDNHVXUHWKHWXUQWDEOHLVLQSODFH conventional oven. 8VHWKHPHWDOWUD\DWDOOWLPHVZKHQEDNLQJ $IDQJHQWO\FLUFXODWHVKHDWHGDLUWKURXJKRXWWKHRYHQ RYHUDQGDURXQGWKHIRRG%HFDXVHWKHKHDWHGDLULVNHSW When baking, remember that constantly moving, not permitting a layer of cooler air to develop around the food, some foods cook slightly faster the oven, door and dishes will be very hot! than in regular oven cooking. CAUTION: How To Bake 1. Press the Convection Bake pad. 7XUQWKHVHOHFWRUGLDOWRVHWWKHRYHQWHPSHUDWXUH and press to enter. 6HOHFWStart or Cook Time. Preheat after selecting start: 7KHRYHQVWDUWVSUHKHDWLQJLPPHGLDWHO\'RQRW place the food in the oven. :KHQWKHRYHQLVILQLVKHGSUHKHDWLQJLWZLOOVLJQDO If you do not open the door within 1 hour, the oven ZLOOWXUQRIIDXWRPDWLFDOO\2SHQWKHRYHQGRRUDQG using caution, place the food in the oven. &ORVHWKHRYHQGRRU3UHVVWKHVHOHFWRUGLDOWZLFH to set the cook time and press Start/Pause to start FRRNLQJ:KHQFRRNLQJLVFRPSOHWHWKHRYHQZLOO signal and turn off. <RXPD\FKDQJHWKHRYHQWHPSHUDWXUHGXULQJSUHKHDWLQJ by pressing the selector dial and turning the selector dial to select the new temperature. If the oven door is opened during cooking, Pause will DSSHDULQWKHGLVSOD\&ORVHWKHGRRUDQGSUHVVStart/ Pause/LPLWGRRURSHQLQJVIRURSWLPDOUHVXOWVDWKLJK temperatures. &RRNWLPHVDUHVKRZQLQPLQXWHVDQGFDQEHD PD[LPXPRIPLQXWHV7LPHFDQEHFKDQJHGGXULQJ cooking by turning the selector dial. Preheat after selecting cook time: $IWHUVHOHFWLQJDFRRNWLPHRYHQZLOOSURPSW\RXWR start cook time or start preheat. 2. Press start cook time to skip preheat or press start preheat to preheat. :KHQWKHRYHQLVILQLVKHGSUHKHDWLQJLWZLOOVLJQDO If you do not open the door within 1 hour, the oven ZLOOWXUQRIIDXWRPDWLFDOO\2SHQWKHRYHQGRRUDQG using caution, place the food in the oven. &ORVHWKHRYHQGRRU3UHVVVHOHFWRUGLDOWRHGLW WHPSHUDWXUHRUFRRNWLPHLIQHHGHGDQGRUSUHVV Start/PauseWRVWDUWFRRNLQJ:KHQFRRNLQJLV complete the oven will signal and turn off. For two-level baking, place food in a metal baking dish or directly on the non-stick metal tray. Place the aluminum baking sheet or your baking dish with food on top of the wire rack. Stand the rack with food on the metal tray. How To Broil Or Toast 1. Press the Cooking Options pad. 7XUQWKHVHOHFWRUGLDOWR%URLORU7RDVWDQGSUHVVWR enter. ,I%URLOSUHVVWKHVHOHFWRUGLDOWRVWDUW ,I7RDVWWXUQVHOHFWRUGLDOWRVHOHFWWLPHDQGSUHVVWR select. Press selector dial again to start. If the oven door is opened during cooking, Pause will DSSHDULQWKHGLVSOD\&ORVHWKHGRRUDQGSUHVVStart/ Pause. 18 Put food directly on the aluminum baking sheet on the wire oven rack, and place them on the metal tray, when broiling or toasting foods. 49-80741-2 Warming 7KH:DUPIHDWXUHZLOONHHSKRWFRRNHGIRRGVDWVHUYLQJ To Crisp Stale Items: WHPSHUDWXUH$OZD\VVWDUWZLWKKRWIRRG8VHFRRNZDUH Ŷ 3ODFHIRRGRUGLVKHVGLUHFWO\RQWKHEODFNPHWDOWUD\ DQGXWHQVLOVWKDWFDQZLWKVWDQGWHPSHUDWXUHVXSWRÛ) Ŷ &KHFNFULVSQHVVSHULRGLFDOO\$GGWLPHDVQHHGHG 1. Press the Cooking Options pad. 7XUQWKHVHOHFWRUGLDOWR:DUP3UHVVWKHVHOHFWRU dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFW0RLVW&ULVS3UHVVWKH selector dial to enter. If the oven door is opened during warming, Pause will The turntable must always be in Put food directly on the non-stick DSSHDULQWKHGLVSOD\&ORVHWKHGRRUDQGSUHVVStart/ place when using the oven. metal tray to warm. Pause. Temperature and Moisture Selection Chart Food Type %UHDGKDUGUROOV %UHDGVRIWUROOV &DVVHUROHV )ULHGIRRGV 0HDWVDQGILVK 3DQFDNHVZDIIOHV 3L]]D 3RWDWRHVEDNHG 3RWDWRHVPDVKHG 3RXOWU\ 7RUWLOOD&KLSV 9HJHWDEOHV Moisture Setting &5,63 02,67 02,67 &5,63 &5,63 &5,63 &5,63 &5,63 02,67 02,67 &5,63 02,67 Tips for Crisp Foods: Ŷ /HDYHIRRGXQFRYHUHG Ŷ 'RQRWXVHSODVWLFFRQWDLQHUVRUSODVWLFZUDS Tips for Moist Foods: Ŷ &RYHUIRRGZLWKOLGRUDOXPLQXPIRLO Ŷ 'RQRWXVHSODVWLFFRQWDLQHUVRUSODVWLFZUDS UPPER OVEN: Warming And Proofing Warming And Proofing * USDA/FSIS recommends an internal temperature of 145°F as the minimum doneness for beef. Use a portable meat thermometer to check internal temperatures. Proofing 7KHSURRILQJIHDWXUHDXWRPDWLFDOO\SURYLGHVWKHRSWLPXP temperature for the proofing process, and therefore does not have a temperature adjustment. 1. Press the Cooking Options pad. 7XUQWKHVHOHFWRUGLDOWRVHOHFW3URRI3UHVVWKH VHOHFWRUGLDOWRHQWHU7KHXSSHURYHQVWDUWVSURRILQJ immediately and shows the amount of proofing time completed. Ŷ 7RRSWLPL]HSHUIRUPDQFHDYRLGXQQHFHVVDU\GRRU opening. Ŷ &KHFNEUHDGSURGXFWVHDUO\WRDYRLGRYHUSURRILQJ NOTES: Ŷ 'RQRWXVHWKHSURRILQJPRGHIRUZDUPLQJIRRGRU NHHSLQJIRRGKRW7KHSURRILQJRYHQWHPSHUDWXUHLV not hot enough to hold foods at safe temperatures. 8VHWKH:DUPIHDWXUHWRNHHSIRRGZDUP Ŷ 3URRILQJZLOOQRWRSHUDWHLIWKHRYHQLVWRRKRW$OORZ the oven to cool before proofing. The turntable must always be in place when using the oven. 49-80741-2 Put bread dough in a bowl/bread pan and place on the metal tray to proof. 19 UPPER OVEN: Microwaving Microwaving Using The Microwave Features 0DNHVXUHWKHWXUQWDEOHDQGFOHDUJODVVWUD\DUHLQSODFH Place food or microwavable container directly on the clear glass tray to cook your food. The turntable must always be in place when using the oven. The clear glass tray should always be in place when microwaving. MICROWAVE PRESET SELECTIONS: ŶBeverage ±:DWHUR] ±&RIIHH (8-12 oz.) ±7HDR] ±0LONR] ±+RW&RFRD (8-12 oz.) ŶMelt ±%XWWHU ±&DUDPHO ±&KHHVH ±&KRFRODWH&KLSV ±0DUVKPDOORZ ŶSimmer ŶPopcorn ±3RSFRUQ6HQVRU ŶCook ±%\)RRG7\SH ±%\7LPH ±%\7LPH ŶSoften ±%XWWHU ±&UHDP&KHHVH ±)URVWLQJR] ±,FH&UHDP ŶDefrost ±OE4XLFN ±%\7LPH ±%\:HLJKW ±%\)RRG7\SH ±0HOW ±6RIWHQ ŶReheat ±%HYHUDJH ±&DVVHUROH ±&KLFNHQ – Pasta – Pizza ±3ODWHRI)RRG ±5LFH ±6RXS ±6WHDNV&KRSV ±9HJHWDEOHV How To Use Pre-Set Microwave Selections 1. Press the Microwave pad. If no selection is made within 15 seconds, the display will revert back to the time of day. 7XUQWKHVHOHFWRUGLDOWRILQGWKHIRRGRUEHYHUDJH you want to cook, defrost, soften, melt, simmer or reheat. Press the selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWWKHW\SHDPRXQW ZHLJKWDQGRUVL]H$VUHTXLUHGWKHRYHQZLOOSURPSW you.) Press the selector dial after each selection. 4. Press the selector dial or the Start/Pause pad to start cooking. 7RUHYLHZRUHGLWVHWWLQJVGXULQJFRRNLQJSUHVVWKH selector dial. If the door is opened during cooking, the oven will stop DQG3$86(ZLOODSSHDULQWKHGLVSOD\&ORVHWKHGRRU and press Start/Pause pad to resume cooking. If you enter an undesired selection at any time, simply press the Back pad and reenter the desired selections. Ŷ :KHQWKHRYHQLVRQOLJKWPD\EHYLVLEOHDURXQGWKH door or outer case. Ŷ 7KHRYHQFDYLW\OLJKWZLOOFRPHRQGXULQJD microwave cooking cycle. Ŷ 6WHDPRUYDSRUPD\HVFDSHIURPDURXQGWKHGRRU &RRN%\7LPH$QG&RRN%\7LPH 8VH&RRN%\7LPHDQG&RRN%\7LPHWR microwave food that is not in the recipe section and at the time(s) you set. Ŷ 7KHSRZHUOHYHOLVDXWRPDWLFDOO\VHWDWKLJKEXW\RX can change it for more flexibility. 1. Press the Microwave pad. 7XUQWKHVHOHFWRUGLDOWRVHOHFW&RRN%\7LPHRU &RRN%\7LPHDQGSUHVVWKHVHOHFWRUGLDOWR enter. 7XUQWKHVHOHFWRUGLDOWRVHWWKHFRRNWLPHDQGSUHVV the selector dial to enter. 20 6HOHFWSRZHUOHYHOVHWWLQJ ,I\RXVHOHFWHG&RRN%\7LPHWXUQWKHVHOHFWRU dial to set the second cook time, second power level setting and press the selector dial to enter. 5. Press the selector dial or the Start/Pause pad to start cooking. <RXPD\RSHQWKHGRRUGXULQJ&RRN%\7LPHDQG&RRN %\7LPHWRFKHFNWKHIRRG&ORVHWKHGRRUDQG press Start/Pause to resume cooking. 49-80741-2 Microwave Power Level(s) Ŷ <RXFDQFKDQJHWKHSRZHUOHYHOGXULQJPRVWFRRNLQJ program. 1. Press the selector dial to edit 5RWDWHVHOHFWRUGLDOWRFKDQJHWLPHDQGRUSUHVV selector dial to enter. 7XUQWKHVHOHFWRUGLDOFORFNZLVHWRLQFUHDVHDQG counterclockwise to decrease the power level. Press the selector dial to enter. +HUHDUHVRPHH[DPSOHVRIXVHVIRUYDULRXVSRZHUOHYHOV High 10)LVKEDFRQYHJHWDEOHVERLOLQJOLTXLGV Med-High 7:*HQWOHFRRNLQJRIPHDWDQGSRXOWU\EDNLQJ casseroles and reheating. Medium 5:6ORZFRRNLQJDQGWHQGHUL]LQJIRUVWHZVDQG less tender cuts of meat. Low 2 or 3:'HIURVWLQJVLPPHULQJGHOLFDWHVDXFHV Warm 1:.HHSLQJIRRGZDUPVRIWHQLQJEXWWHU Defrost By Food Type $XWR'HIURVWDXWRPDWLFDOO\VHWVWKHGHIURVWLQJWLPHVDQG power levels to give even defrosting results for meats, poultry and fish weighing up to 6 pounds. 5HPRYHIRRGIURPWKHSDFNDJHDQGSODFHLWRQD microwave-safe dish. 2. Press the Microwave pad and select defrost. 7XUQWKHVHOHFWRUGLDOWR'HIURVW%\)RRG7\SH Press the selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWIRRGW\SH3UHVVWKH selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRWKHIRRGZHLJKWXVLQJWKH &RQYHUVLRQ*XLGHDWWKHULJKW)RUH[DPSOHGLDO for 1.2 pounds (1 pound, 3 oz.) Press the selector dial to enter. 6. Press the selector dial or Start/Pause pad to start defrosting. 7XUQWKHIRRGRYHUZKHQWKHRYHQVLJQDOV7XUQ)RRG 2YHU Ŷ 5HPRYHGHIURVWHGPHDWRUVKLHOGZDUPDUHDVZLWK small pieces of foil for even defrosting. Ŷ $IWHUGHIURVWLQJPRVWPHDWVQHHGWRVWDQGPLQXWHV WRFRPSOHWHGHIURVWLQJ/DUJHURDVWVVKRXOGVWDQGIRU about 30 minutes. UPPER OVEN: Microwaving Microwaving (Cont.) Conversion Guide If the weight of food is stated in pounds and ounces, the ounces must be converted to tenths (.1) of a pound. Weight of Food in Ounces 1–2 3 4–5 6–7 8 9–10 11 12–13 14–15 Enter Food Weight (tenths of a pound) .1 .2 .3 .4 .5 .6 .7 .8 .9 Defrost By Time 8VH'HIURVW%\7LPHWRGHIURVWIRUDVHOHFWHGOHQJWKRI time. 1. Press the Microwave pad and select defrost. 7XUQWKHVHOHFWRUGLDOWR'HIURVW%\7LPH3UHVVWKH selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWWKHWLPH\RXZDQW Press the selector dial to enter. 4. Press the selector dial or Start/Pause pad to start defrosting. 49-80741-2 7XUQWKHIRRGRYHUZKHQWKHRYHQVLJQDOV7XUQ)RRG 2YHU Power level is automatically set at 3, but can be FKDQJHG7RFKDQJHWKHSRZHUOHYHOVVHHWKH 0LFURZDYH3RZHU/HYHOVVHFWLRQ<RXFDQGHIURVW small items quickly by raising the power level after entering the time. Power level 7 cuts the total defrosting time in about half; power level 10 cuts the total time to DERXW:KHQGHIURVWLQJDWKLJKSRZHUOHYHOVIRRG will need more frequent attention than usual. 21 UPPER OVEN: Microwaving Microwaving (Cont.) Defrost By Weight 8VH'HIURVW%\:HLJKWWRGHIURVWIRUDVHOHFWHGOHQJWKRI time. 1. Press the Microwave pad and select defrost. 7XUQWKHVHOHFWRUGLDOWR'HIURVW%\:HLJKW3UHVVWKH selector dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWWKHZHLJKW\RXZDQW Press the selector dial to enter. 3UHVVWKHVHOHFWRUGLDORU6WDUW3DXVHSDGWRVWDUW defrosting. 7XUQWKHIRRGRYHUZKHQWKHRYHQVLJQDOV7XUQ)RRG 2YHU Power level cannot be changed during this setting. OE4XLFN'HIURVW 8VHOE4XLFN'HIURVWIRUTXLFNGHIURVWRIOERI frozen food. 1. Press the MicrowaveSDGDQGVHOHFW/ETXLFN defrost. 2. Press selector dial or Start/Pause pad to start defrosting. Press the selector dial to enter. 7XUQWKHIRRGRYHUZKHQWKHRYHQVLJQDOV7XUQ)RRG 2YHU Power level cannot be changed during this setting. Defrosting Tips Ŷ )RRGVIUR]HQLQSDSHURUSODVWLFFDQEHWLPH defrosted in the package, but foods should be taken RXWRIWKHSDFNDJHZKHQXVLQJ'HIURVW%\)RRG 7\SH&ORVHGSDFNDJHVVKRXOGEHVOLWSLHUFHGRU vented after food has partially defrosted. Plastic storage containers should be partially uncovered. Ŷ )DPLO\VL]HSUHSDFNDJHGIUR]HQGLQQHUVFDQEH defrosted and microwaved. If the food is in a foil container, transfer it to a microwave-safe dish. 22 Ŷ )RRGVWKDWVSRLOHDVLO\VKRXOGQRWEHDOORZHGWR sit out for more than one hour after defrosting. 5RRPWHPSHUDWXUHSURPRWHVWKHJURZWKRIKDUPIXO bacteria. Ŷ )RUPRUHHYHQGHIURVWLQJRIODUJHUIRRGVVXFKDV URDVWVXVH'HIURVW%\7LPH%HVXUHODUJHPHDWV are completely defrosted before cooking. Ŷ :KHQGHIURVWHGIRRGVKRXOGEHFRROEXWVRIWHQHGLQ all areas. If still slightly icy, return to the microwave very briefly, or let it stand a few minutes. 49-80741-2 Microwave Sensor Cooking 7KHVHQVRUIHDWXUHGHWHFWVWKHLQFUHDVLQJKXPLGLW\ UHOHDVHGGXULQJFRRNLQJ7KHRYHQDXWRPDWLFDOO\DGMXVWV the cooking time to various types and amounts of food. 'RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQVXFFHVVLRQ on the same food portion— it may result in severely overcooked or burnt food. If food is undercooked after WKHILUVWFRXQWGRZQXVH&RRN%\7LPHIRUDGGLWLRQDO cooking time. The proper containers and covers are essential for best sensor cooking. Ŷ $OZD\VXVHPLFURZDYHVDIHFRQWDLQHUVDQGFRYHU WKHPZLWKOLGVRUYHQWHGSODVWLFZUDS1HYHUXVHWLJKW sealing plastic containers—they can prevent steam from escaping and cause food to overcook. Ŷ %HVXUHWKHRXWVLGHRIWKHFRRNLQJFRQWDLQHUVDQG the inside of the oven are dry before placing food in WKHRYHQ%HDGVRIPRLVWXUHWXUQLQJLQWRVWHDPFDQ mislead the sensor. Ŷ %HYHUDJHVDUHEHVWKHDWHGXQFRYHUHG Covered Vented UPPER OVEN: Microwaving Microwaving (Cont.) Dry off dishes so they don’t mislead the sensor. MICROWAVE SENSOR PROGRAMS: Ŷ*URXQG0HDW Ŷ3RSFRUQ Ŷ6RXS Ŷ5LFH Ŷ9HJHWDEOHV &DQQHG)UHVK)UR]HQ Ŷ&KLFNHQ5HKHDW Ŷ3DVWD5HKHDW Ŷ3ODWHRI)RRG5HKHDW Ŷ6RXS5HKHDW Ŷ9HJHWDEOH5HKHDW To Use All Sensor Programs 8SSHU2YHQPLFURZDYHPRGHIHDWXUHVVHQVRUFRRNLQJ,W automatically senses when food is done and shuts itself off—eliminating the need to program cook times and power levels. 1. Press the Microwave pad and turn the selector dial WR&RRN%\)RRG7\SHRU5HKHDW3UHVVWKHVHOHFWRU dial to enter. 7XUQWKHVHOHFWRUGLDOWRVHOHFWWKHIRRG\RXZDQW Press the selector dial to enter. 3. Press the selector dial or press the Start/Pause pad to start cooking. 'RQRWRSHQWKHRYHQGRRUXQWLOWLPHLVFRXQWLQJGRZQ in the display or the microwave stop cooking. If the door is opened, close it and press Start/Pause immediately. ,IWKHIRRGLVQRWGRQHHQRXJKXVH&RRN%\7LPHLQWKH microwave selector to cook for more time. NOTE:'RQRWXVHWKH6HQVRU)HDWXUHVWZLFHLQ succession on the same food portion—it may result in severely overcooked or burnt food. Ŷ ,I\RXKDYHEHHQVSHHGFRRNLQJDQGWKHRYHQLV already hot, it may indicate that it is too hot for VHQVRUFRRNLQJ2IFRXUVH\RXFDQDOZD\VFRQWLQXH ZLWK&RRN%\7LPH 49-80741-2 NOTE: If the oven is too hot then it will automatically change to time cooking. Ŷ 7RVKRUWHQRUOHQJWKHQWKHFRRNWLPHZDLWXQWLOWKH WLPHFRXQWGRZQVKRZVLQWKHGLVSOD\7KHQWXUQWKH selector dial to add or subtract time. Ŷ ,I\RXRSHQWKHGRRUZKLOH6HQVRU&RRNLQJ6HQVRU (UURUZLOODSSHDU&ORVHWKHGRRUSUHVVStart/Pause to begin again. Notes about the Reheat program: 5HKHDWHGIRRGVPD\KDYHZLGHYDULDWLRQVLQ WHPSHUDWXUH6RPHDUHDVPD\EHH[WUHPHO\KRW ,WLVEHVWWRXVH&RRN%\7LPHDQGQRW5HKHDWIRUWKHVH foods: Ŷ %UHDGSURGXFWV Ŷ )RRGWKDWPXVWEHUHKHDWHGXQFRYHUHG Ŷ )RRGVWKDWQHHGWREHVWLUUHGRUWXUQHG Ŷ )RRGVFDOOLQJIRUDGU\ORRNRUFULVSVXUIDFHDIWHU reheating. 23 LOWER OVEN: Cooking Modes Cooking Modes <RXUQHZRYHQKDVDYDULHW\RIFRRNLQJPRGHVWRKHOS\RXJHWWKHEHVWUHVXOWV7KHVHPRGHVDUHGHVFULEHGEHORZ5HIHU WRWKH&RRNLQJ*XLGHVHFWLRQIRUUHFRPPHQGDWLRQVIRUVSHFLILFIRRGV5HPHPEHU\RXUQHZRYHQPD\SHUIRUPGLIIHUHQWO\ than the oven it is replacing. Baking and Roasting Modes Broiling Modes 6HOHFWDPRGHIRUEDNLQJDQGURDVWLQJEDVHGRQWKHW\SH DQGTXDQWLW\RIIRRG\RXDUHSUHSDULQJ:KHQSUHSDULQJ baked goods such as cakes, cookies, and pastries always SUHKHDWWKHRYHQILUVW)ROORZUHFLSHUHFRPPHQGDWLRQVIRU food placement. If no guidelines are provided, center food in the oven. $OZD\VEURLOZLWKWKHGRRUFORVHG7KHEURLOHOHPHQWLQWKLV RYHQLVYHU\SRZHUIXO0RQLWRUIRRGFORVHO\ZKLOHEURLOLQJ 8VHFDXWLRQZKHQEURLOLQJRQXSSHUUDFNSRVLWLRQVDV placing food closer to the broil element increases smoking, spattering, and the possibility of fats igniting. Broiling on rack position 6 is not recommended. 7U\EURLOLQJIRRGVWKDW\RXZRXOGQRUPDOO\JULOO$GMXVWUDFN Traditional Bake positions to adjust the intensity of the heat to the food. Place 7KHWUDGLWLRQDOEDNHPRGHLVLQWHQGHGIRUVLQJOHUDFNFRRNLQJ foods closer to the broil element when a seared surface 7KLVPRGHXVHVKHDWSULPDULO\IURPWKHORZHUHOHPHQWEXW DQGUDUHLQWHULRULVGHVLUHG7KLFNHUIRRGVDQGIRRGVWKDW DOVRIURPWKHXSSHUHOHPHQWWRFRRNIRRG7RXVHWKLVPRGH need to be cooked through should be broiled on a rack press the Bake pad, turn the selector dial to set the oven SRVLWLRQIDUWKHUIURPWKHEURLOHURUE\XVLQJ%URLO/R. )RUEHVW temperature and press to enter, then press Start. Preheating performance center food below the broil heating element. is generally recommended when using this mode. Convection Bake 1 Rack 7KH&RQYHFWLRQ%DNH5DFNPRGHLVLQWHQGHGIRUVLQJOH UDFNFRRNLQJ7KLVPRGHXVHVKHDWIURPWKHORZHUHOHPHQW and also the upper and rear elements, along with air movement from the convection fan to enhance evenness. <RXURYHQLVHTXLSSHGZLWK$XWR5HFLSH&RQYHUVLRQVR it is not necessary to convert the temperature when using WKLVPRGH7RXVHWKLVPRGHSUHVVWKHConvection Bake SDGWXUQWKHVHOHFWRUGLDOWRVHOHFW5DFNDQGVHWWKHRYHQ temperature, and press to enter, then press Start. Preheating is generally recommended when using this mode. Convection Bake Multi Rack 7KH&RQYHFWLRQ%DNH0XOWL5DFNPRGHLVLQWHQGHGIRU EDNLQJRQPXOWLSOHUDFNVDWWKHVDPHWLPH7KLVPRGHXVHV heat primarily from the rear element but also heat from the upper and lower elements, along with air movement from WKHFRQYHFWLRQIDQWRHQKDQFHFRRNLQJHYHQQHVV<RXU RYHQLVHTXLSSHGZLWK$XWR5HFLSH&RQYHUVLRQVRLWLV not necessary to convert the temperature when using this PRGH%DNLQJWLPHPLJKWEHVOLJKWO\ORQJHUIRUPXOWLSOHUDFNV WKDQZKDWZRXOGEHH[SHFWHGIRUDVLQJOHUDFN7RXVHWKLV mode press the Convection Bake pad, turn the selector GLDOWRVHOHFW0XOWL5DFNDQGVHWWKHRYHQWHPSHUDWXUHDQG press to enter, then press Start$OZD\VSUHKHDWZKHQ using this mode. Broil Hi 7KH7UDGLWLRQDO%URLO+LPRGHXVHVLQWHQVHKHDWIURPWKH XSSHUHOHPHQWWRVHDUIRRGV8VH%URLO+LIRUWKLQQHUFXWV RIPHDWDQGRUIRRGV\RXSUHIHUOHVVGRQHRQWKHLQWHULRU 7RXVHWKLVPRGHSUHVVWKHBroil pad, turn the selector GLDOWR+LDQGSUHVVWRHQWHUDQGWKHQSUHVVStart. It is not necessary to preheat when using this mode. Broil Lo 7KH7UDGLWLRQDO%URLO/RPRGHXVHVOHVVLQWHQVHKHDWIURP the upper element to cook food thoroughly while also SURGXFLQJVXUIDFHEURZQLQJ8VH%URLO/RIRUWKLFNHUFXWVRI PHDWDQGRUIRRGVWKDW\RXZRXOGOLNHFRRNHGDOOWKHZD\ WKURXJK7RXVHWKLVPRGHSUHVVWKHBroil pad, turn the VHOHFWRUGLDOWR/RDQGSUHVVWRHQWHUDQGWKHQSUHVVStart. It is not necessary to preheat when using this mode. Proof Proof mode is designed for rising (fermenting and proofing) bread dough. Press the Options pad, turn the selector dial to select Proof and press to select, then press Start. &RYHUGRXJKZHOOWRSUHYHQWGU\LQJRXW%UHDGZLOOULVHPRUH UDSLGO\WKDQDWURRPWHPSHUDWXUH1RWHWKDWIRUGRXEOHZDOO ovens, proof cannot be run when running a clean mode in the lower oven. Warm :DUPPRGHLVGHVLJQHGWRNHHSKRWIRRGVKRWIRUXSWR KRXUV7RXVHWKLVPRGHSUHVVWKHOptions pad, turn the 7KH&RQYHFWLRQ5RDVWPRGHLVLQWHQGHGIRUURDVWLQJZKROH VHOHFWRUGLDOWRVHOHFW:DUPDQGSUHVVWRVHOHFWWKHQSUHVV FXWVRIPHDWRQDVLQJOHUDFN7KLVPRGHXVHVKHDWIURPWKH Start&RYHUIRRGVWKDWQHHGWRUHPDLQPRLVWDQGGRQRW lower, upper, and rear elements along with air movement cover foods that should be crisp. Preheating is not required. from the convection fan to improve browning and reduce 'RQRWXVHZDUPWRKHDWFROGIRRGRWKHUWKDQFULVSLQJ cooking time. It is not necessary to convert temperature. crackers, chips or dry cereal. It is also recommended that &KHFNIRRGHDUOLHUWKDQWKHUHFLSHVXJJHVWHGWLPHZKHQ food not be kept warm for more than 2 hours. XVLQJWKLVPRGHRUXVHDPHDWSUREH7RXVHWKLVPRGH press the Convection Bake pad, turn the selector dial to VHOHFW5RDVWDQGVHWWKHRYHQWHPSHUDWXUHDQGSUHVVWR enter, then press Start. It is not necessary to preheat when using this mode. Convection Roast 24 49-80741-2 <RXUQHZRYHQFRQIRUPVWRWKH6WDU.-HZLVK6DEEDWKUHTXLUHPHQWVZLWKWKH6DEEDWKPRGHFRRNLQJIHDWXUH%HORZ GHVFULEHVWKHGHWDLORI6DEEDWKPRGHIHDWXUH To Enter Sabbath Mode Timed Cook Feature In Sabbath Mode Press the lower oven Options pad and turn the selector GLDOWR6DEEDWKDQGSUHVVWRVHOHFW7KHGLVSOD\ ZLOOVKRZ³'XULQJ6DEEDWK0RGHWKHXSSHURYHQLV XQDYDLODEOH´3UHVVWKHVHOHFWRUGLDOWRFRQWLQXH$Q\ upper oven features running will exit, and the lower oven ZLOOLPPHGLDWHO\WUDQVLWLRQLQWR6DEEDWKPRGH 7KH6DEEDWKPRGHLVQRWFDSDEOHRIUXQQLQJDWLPHG cook feature on its own. If there is a desire to run a 7LPHG&RRNWKHIROORZLQJVWHSVPXVWEHIROORZHG To Change Temperature 2QFHLQ6DEEDWKPRGHLQRUGHUWRFKDQJHRYHQ temperature or start a bake feature, the user can change temperature to one of 10 pre-set temperatures as indicated below: UI Key Left Side Keys (Upper Oven) 0LFURZDYH 6SHHG&RRN'HIURVW &RRNLQJ2SWLRQV3RSFRUQ $GG6HF &RQYHFWLRQ%DNH5HKHDW Right Side Keys (Lower Oven) %DFN &OHDU2II /LJKW %DNH %URLO &RQYHFWLRQ%DNH:DUP 2SWLRQV Temp. (°F) 170 200 225 250 300 0 &DQFHOVLPPHGLDWHO\ 325 350 375 400 450 &KDQJLQJWRRQHRIWKHDERYHWHPSHUDWXUHVUHTXLUHVWKH user to press the keypad associated with the desired temperature and then press the Start/PauseSDG)RU H[DPSOHWRVHWD%DNH)WKHXVHUZLOOSUHVVWKHBake pad on the lower oven and then press Start/Pause pad. 7KH%DNHIHDWXUHZLOOVWDUWRULIDOUHDG\UXQQLQJWKH oven temperature will change) at a random time between 30 – 60 seconds after the Start/Pause pad is pressed, with the exception of pressing the Clear/Off pad, which ZLOOLPPHGLDWHO\FDQFHOWKHFRRNLQJVHWWLQJV7KHXQLW ZLOOUHPDLQLQ6DEEDWKPRGH&KDQJHRIWHPSHUDWXUH may be executed at any time in the cooking cycle. To Turn Oven Off Press Clear/Off pad or Back and then Start pads at DQ\WLPH7KHRYHQZLOOLPPHGLDWHO\WXUQRIIEXWZLOOVWD\ LQ6DEEDWKPRGHDQGUHWXUQWRWKHVWDQGE\6DEEDWK display screen. To Exit Sabbath Mode Press and hold the BackSDGIRUVHFRQGV7KHRYHQ will shut down at a random time between 30 – 60 seconds after the Back pad is pressed and held. NOTE'RQRWSUHVVDQ\RWKHUSDGVGXULQJWKLVWLPHRU WKH6DEEDWKPRGHZLOOEHUHLQLWLDOL]HGDQGZLOOQRWH[LW 7KHRYHQZLOOH[LW6DEEDWKPRGHDQGUHWXUQWRLWVGHIDXOW screen. 49-80741-2 8VHWKHSettingsSDGWRVHW\RXU%HHSHU9ROXPHWR 0XWH 8VHWKHLightSDGWRVHW\RXUORZHURYHQ/LJKWWR2Q 8VHBakeWRSURJUDPDWHPSHUDWXUH$IWHU programming a temperature select a cook time and enter your cook time. Press Start to start the oven. NOTE:&RQYHFWLRQ%DNHVKRXOG127EHXVHG 2QFHWKHRYHQLVVWDUWHGGR127RSHQWKHGRRU until the oven has finished preheating and reached a VWHDG\VWDWHWHPSHUDWXUH'RLQJVRSULRUWRSUHKHDWLQJ completing will result in the air distribution fan de-energizing immediately upon door opening. 2QFHWKHIRRGKDVEHHQSODFHGLQWKHRYHQGRQRW RSHQWKHGRRUXQWLOFRRNLQJKDVFRPSOHWHG'RLQJVR will result in the display on the screen changing to prompt you to close your door. 'R127RSHQWKHXSSHURYHQGRRU'RLQJVRZLOOWXUQ the light on immediately. 'RQRWSUHVVDQ\DGGLWLRQDOEXWWRQVRQWKHORZHU oven controls once started or the display will change immediately upon the button press. LOWER OVEN: Sabbath Mode Sabbath Mode NOTES Ŷ 'XULQJ6DEEDWKPRGHRQO\ORZHURYHQ%DNHLV DYDLODEOH%URLO&RQYHFWLRQ%DNH:DUPRURWKHU functions are not available. Ŷ :KHQLQ6DEEDWKPRGHWKHKRXUDXWRVKXWRII is disabled regardless of the setting selected in the Settings. Ŷ 6DEEDWKPRGHFDQEHHQWHUHGRQO\LIQRFRRNLQJ PRGHLVUXQQLQJLQWKHORZHURYHQ(QWHULQJWKH 6DEEDWK0RGHZLOOFDQFHODOOIXQFWLRQVLQWKHORZHU and upper oven (including timer and reminder). Ŷ :KHQDQ\EXWWRQVDUHSUHVVHGLQ6DEEDWK0RGH there are no beeps or tones, no changes to lights or FKDQJHLQWKHGLVSOD\$OVRZKHQWKHGRRULVRSHQHG RUFORVHGLQ6DEEDWK0RGHWKHUHDUHQREHHSVRU tones, no changes to lights or change in the display. Ŷ ,IDSRZHURXWDJHRFFXUVGXULQJ6DEEDWKPRGH EDNLQJWKHXQLWZLOOUHWXUQWR6DEEDWK0RGHZKHQ power comes back, but will not return in the baking mode. 25 LOWER OVEN: Cooking Guide Cooking Guide RECOMMENDED MODE(S) RECOMMENDED 5$&.326,7,216 ADDITIONAL SUGGESTIONS /D\HUFDNHVVKHHWFDNHVEXQGW cakes, muffins, quick breads on D6LQJOH5DFN 7UDGLWLRQDO%DNH 3 8VHVKLQ\FRRNZDUH /D\HUFDNHVRQ0XOWLSOH5DFNV 7UDGLWLRQDO%DNH 2 and 4 ([WHQVLRQUDFNLQKLJKHUSRVLWLRQLIXVHG(QVXUHDGequate airflow (see illustration below). &KLIIRQFDNHVDQJHOIRRG 7UDGLWLRQDO%DNH 1 8VHVKLQ\FRRNZDUH &RRNLHVELVFXLWVVFRQHVRQD 6LQJOH5DFN 7UDGLWLRQDO%DNH 3 8VHVKLQ\FRRNZDUH &RQYHFWLRQ%DNH0XOWL 2 and 4 1, 3 and 5 ([WHQVLRQUDFNSRVLWLRQIRUUDFNVIRUUDFNV (QVXUHDGHTXDWHDLUIORZ %URLO+L 5 8VHWKHH[WHQVLRQUDFNDQGXVHDEURLOSDQPRYH IRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJ:DWFK IRRGFORVHO\ZKHQEURLOLQJ)RUEHVWSHUIRUPDQFH center food below the broil heating element. %URLO+L 5 8VHDEURLOSDQ0RYHIRRGGRZQIRUPRUH GRQHQHVVOHVVVHDULQJ:DWFKIRRGFORVHO\ZKHQ EURLOLQJ)RUEHVWSHUIRUPDQFHFHQWHUIRRGEHORZWKH broil heating element. &RQYHFWLRQ5RDVW 2 or 3 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ Preheating is not necessary. &RQYHFWLRQ5RDVW 2 or 3 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ %URLO+L 1 %URLO/R 7UDGLWLRQDO%DNH &RQYHFWLRQ%DNH5DFN 3 ,IEUHDGHGRUFRDWHGLQVDXFHDYRLG%URLO+LPRGHV %URLOVNLQVLGHGRZQILUVW:DWFKIRRGFORVHO\ZKHQ EURLOLQJ)RUEHVWSHUIRUPDQFHZKHQEURLOLQJFHQWHU food below the broil heating element. FOOD TYPE Baked Goods &RRNLHVELVFXLWVVFRQHVRQ 0XOWLSOH5DFNV Beef & Pork +DPEXUJHUV 6WHDNV&KRSV 5RDVWV Poultry :KROHFKLFNHQ %RQHLQFKLFNHQEUHDVWVOHJV thighs %URLO/R 7UDGLWLRQDO%DNH &RQYHFWLRQ%DNH5DFN 3 0RYHIRRGGRZQIRUPRUHGRQHQHVVOHVVVHDULQJDQG XSIRUJUHDWHUVHDULQJEURZQLQJZKHQEURLOLQJ)RUEHVW performance when broiling, center food below the broil heating element. :KROHWXUNH\ &RQYHFWLRQ5RDVW 1 or 2 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ 7XUNH\EUHDVW &RQYHFWLRQ5RDVW 2 or 3 8VHDORZVLGHGSDQVXFKDVDEURLOSDQ %URLO/R WKLFNRUOHVV !LQFK :DWFKIRRGFORVHO\ZKHQEURLOLQJ)RUEHVWSHUIRUmance center food below the broil heating element. &RQYHFWLRQ%DNH5DFN 7UDGLWLRQDO%DNH 3 Pizza, french fries, tator tots, chicken nuggets, appetizers on D6LQJOH5DFN &RQYHFWLRQ%DNH5DFN 7UDGLWLRQDO%DNH 3 8VHVKLQ\FRRNZDUH Pizza, french fries, tator tots, chicken nuggets, appetizers on 0XOWLSOH5DFNV &RQYHFWLRQ%DNH0XOWL 2 and 4 8VHVKLQ\FRRNZDUH %RQHOHVVFKLFNHQEUHDVWV Fish Casseroles )UR]HQ&RQYHQLHQFH)RRGV :KHQEDNLQJIRXUFDNHOD\HUVDWDWLPHXVHUDFNV and 4. Place the pans as shown so that one pan is not directly above another. &RRNIRRGWKRURXJKO\WRKHOSSURWHFWDJDLQVWIRRG ERUQHLOOQHVV0LQLPXPVDIHIRRGWHPSHUDWXUH recommendations for food safety can be found at www. IsItDoneYet.gov0DNHVXUHWRXVHDIRRGWKHUPRPHWHU to take food temperatures. 26 49-80741-2 <RXURYHQKDVVL[UDFNSRVLWLRQV5HFRPPHQGHGUDFN positions for various types of foods are provided in the &RRNLQJ*XLGH$GMXVWLQJUDFNSRVLWLRQLVRQHZD\WR LPSDFWFRRNLQJUHVXOWV)RUH[DPSOHLI\RXZRXOGSUHIHU darker tops on cakes, muffins, or cookies, try moving food one rack position higher. If you find foods are too brown on top try moving them down next time. The oven has 6 rack positions :KHQEDNLQJZLWKPXOWLSOHSDQVDQGRQPXOWLSOHUDFNV HQVXUHWKHUHLVDWOHDVWòEHWZHHQSDQVWRDOORZ sufficient space for air to flow. Oven Racks <RXURYHQPD\KDYHH[WHQVLRQUDFNVDQGRUWUDGLWLRQDO flat racks. 7RDYRLGSRVVLEOHEXUQVSODFHWKHUDFNVLQWKHGHVLUHG position before you turn the oven on. Handle Extension Racks LOWER OVEN: Racks Racks Handle Upper Front Rail ([WHQVLRQUDFNVKDYHDQLQVWDOOIHDWXUHWKDWORFNVLQWRWKH UDFNVXSSRUWVJXLGHVRQERWKVLGHV2QFHWKHLQVWDOO feature is locked into place, always pull the rack out, by its upper front rail, to its full extension stop position, when placing or removing cookware. If extension racks are difficult to extend, lubricate the racks with the graphite lubricant provided with your RYHQ5HPRYHWKHUDFNIURPWKHRYHQUHPRYHGHEULVLQ the slide tracks with a paper towel, shake the graphite lubricant and place 4 small drops on the two bottom WUDFNVRIWKHOHIWDQGULJKWVLGHV2SHQDQGFORVHWKH rack several times to distribute the lubricant. 7RRUGHUDGGLWLRQDOJUDSKLWHOXEULFDQWUHDGWKH $VVLVWDQFHDQG$FFHVVRULHVVHFWLRQDWWKHEHJLQQLQJRI this manual. To Remove An Extension Rack: 0DNHVXUHWKHUDFNLVSXVKHGDOOWKHZD\LQWRWKH oven. Lift to unlock from the rack support Handle Handle Upper Front Rail *UDVSWKHUDFNE\ERWKLWVXSSHUIURQWUDLODQGLWV lower handles on two sides and lift straight up to unlock the rack from the rack supports. )LUPO\KROGLQJRQWRERWKWKHXSSHUIURQWUDLODQGORZHU KDQGOHVRQERWKVLGHVSXOOWKHUDFNIRUZDUG*UDVSWKH UDFNRQERWKVLGHVLIQHFHVVDU\7KHQUHPRYHLWIURP the oven. Install Feature To Replace An Extension Rack: 1. Place the rear portion of the rack onto the rack supports (guides) as shown in the picture. +ROGWKHXSSHUIURQWUDLODQGORZHUKDQGOHVDQGSXVK the rack all the way in until the install feature locks into the front rack support. If extension racks are difficult to replace or remove, wipe WKHRYHQUDFNVXSSRUWVZLWKFRRNLQJRLO'RQRWZLSHRLO on the rack slides. 49-80741-2 Hold the upper front rail and lower handles and push the rack all the way in until the install feature locks on the front support Front Rack Lock 27 LOWER OVEN: Racks / Aluminum Foil and Oven Liners / Cookware 28 Racks (Cont.) Traditional Flat Racks 7KHUDFNVKDYHVWRSVVRWKDWZKHQSODFHGFRUUHFWO\RQ the supports they will stop before coming completely out DQGZLOOQRWWLOW:KHQSODFLQJDQGUHPRYLQJFRRNZDUH pull the rack out until it stops. Flat Rack To Remove a Rack Pull it toward you, tilt the front end up and pull it out. To Replace a Rack Locating Post 7LOWWKHIURQWRIWKHUDFNXSKRRNWKHUHDUORFDWLQJSRVWV under the rack supports, push the rack back (past the stop-locks) and lower it into position. Push the rack all the way in. Rack Support Stopper ,IIODWUDFNVDUHGLIILFXOWWRVOLGHDQGRUUHPRYHSODFH some cooking oil on a soft cloth or paper towel and rub onto the sides of the rack and each rack support. CAUTION: Use caution when removing a rack from lowest position as door may be hot. Aluminum Foil and Oven Liners CAUTION: Do not use any type of foil or oven liner to cover the oven bottom. These items can trap heat or melt, resulting in damage to the product and risk of shock, smoke or fire. Damage from improper use of these items is not covered by the product warranty. )RLOPD\EHXVHGWRFDWFKVSLOOVE\SODFLQJDVKHHWRQDORZHUUDFNVHYHUDOLQFKHVEHORZWKHIRRG'RQRWXVHPRUH IRLOWKDQQHFHVVDU\DQGQHYHUHQWLUHO\FRYHUDQRYHQUDFNZLWKDOXPLQXPIRLO.HHSIRLODWOHDVW´IURPRYHQZDOOV to prevent poor heat circulation. Cookware Cookware Guidelines 7KHPDWHULDOILQLVKDQGVL]HRIFRRNZDUHDIIHFWEDNLQJ performance. 'DUNFRDWHGDQGGXOOSDQVDEVRUEKHDWPRUHUHDGLO\ than light, shiny pans. Pans that absorb heat more readily can result in a browner, crisper, and thicker crust. If using dark and coated cookware check food earlier than minimum cook time. If undesirable results are obtained with this type of cookware consider reducing RYHQWHPSHUDWXUHE\)QH[WWLPH 6KLQ\SDQVFDQSURGXFHPRUHHYHQO\FRRNHGEDNHG goods such as cakes and cookies. *ODVVDQGFHUDPLFSDQVKHDWVORZO\EXWUHWDLQKHDWZHOO 7KHVHW\SHVRISDQVZRUNZHOOIRUGLVKHVVXFKDVSLHV and custards. $LULQVXODWHGSDQVKHDWVORZO\DQGFDQUHGXFHERWWRP browning. .HHSFRRNZDUHFOHDQWRSURPRWHHYHQKHDWLQJ 49-80741-2 %HVXUHHOHFWULFDOSRZHULVRIIDQGDOOVXUIDFHVDUHFRROEHIRUHFOHDQLQJDQ\SDUWRIWKHRYHQ Helpful Hints $QRFFDVLRQDOWKRURXJKZLSLQJZLWKDVROXWLRQRI EDNLQJVRGDDQGZDWHUNHHSVWKHLQVLGHIUHVK$OVR we recommend against using cleaners with ammonia or alcohol, as they can damage the appearance of the oven. If you choose to use a common household cleaner, first apply the cleaner directly to a clean cloth, then wipe the soiled area. Control Panel ,W¶VDJRRGLGHDWRZLSHWKHFRQWUROSDQHODIWHUHDFKXVH &OHDQZLWKPLOGVRDSDQGZDWHURUYLQHJDUDQGZDWHU rinse with clean water and polish dry with a soft cloth. 'RQRWXVHDEUDVLYHFOHDQVHUVVWURQJOLTXLGFOHDQVHUV plastic scouring pads or oven cleaners on the control panel—they will damage the finish. Oven Exterior 'RQRWXVHRYHQFOHDQHUVDEUDVLYHFOHDQVHUVVWURQJ liquid cleansers, steel wool, plastic scouring pads, or cleaning powders on the interior or exterior of the oven. &OHDQZLWKDPLOGVRDSDQGZDWHURUYLQHJDUDQGZDWHU VROXWLRQ5LQVHZLWKFOHDQZDWHUDQGGU\ZLWKDVRIWFORWK :KHQFOHDQLQJVXUIDFHVPDNHVXUHWKDWWKH\DUHDW room temperature and not in direct sunlight. If stain on the door vent trim is persistent, use a mild abrasive cleaner and a sponge-scrubber for best results. 6SLOODJHRIPDULQDGHVIUXLWMXLFHVWRPDWRVDXFHVDQG basting liquids containing acids may cause discoloration DQGVKRXOGEHZLSHGXSLPPHGLDWHO\/HWKRWVXUIDFHV cool, then clean and rinse. Stainless Steel Surfaces (on some models) 'RQRWXVHDVWHHOZRROSDGLWZLOOVFUDWFKWKHVXUIDFH 7RFOHDQWKHVWDLQOHVVVWHHOVXUIDFHXVHZDUPVXGV\ ZDWHURUDVWDLQOHVVVWHHOFOHDQHURUSROLVK$OZD\V ZLSHWKHVXUIDFHLQWKHGLUHFWLRQRIWKHJUDLQ)ROORZ the cleaner instructions for cleaning the stainless steel surface. 7RLQTXLUHDERXWSXUFKDVLQJFOHDQLQJSURGXFWVLQFOXGLQJ stainless steel appliance cleaner or polish, read the $VVLVWDQFHDQG$FFHVVRULHVVHFWLRQDWWKHEHJLQQLQJRI this manual. How To Clean The Upper Oven Interior CARE AND CLEANING: Cleaning The Oven Cleaning The Oven Door Seal ,W¶VLPSRUWDQWWRNHHSWKHDUHDFOHDQZKHUHWKHGRRU VHDOVDJDLQVWWKHRYHQ8VHRQO\PLOGQRQDEUDVLYH detergents applied with a clean sponge or soft cloth. 5LQVHZHOO Removable Turntable Walls, Floor, Inside Window, Metal and Plastic Parts on the Door &OHDQWKHLQVLGHRIWKHRYHQRIWHQIRUSURSHUKHDWLQJ performance. 6RPHVSDWWHUVFDQEHUHPRYHGZLWKDSDSHUWRZHO RWKHUVPD\UHTXLUHDZDUPVRDS\FORWK5HPRYHJUHDV\ spatters with a sudsy cloth; then rinse with a damp cloth. 'RQRWXVHDEUDVLYHFOHDQHUVRUVKDUSXWHQVLOVRQRYHQ walls. Never use a commercial oven cleaner on any part of your oven. 'RQRWFOHDQWKHLQVLGHRIWKHRYHQZLWKPHWDOVFRXULQJ pads. Pieces can break off the pad, causing electrical shock. 49-80741-2 Turntable Do not use the oven without the turntable in place. 7KHDUHDXQGHUQHDWKWKHWXUQWDEOHVKRXOGEHFOHDQHG frequently to avoid odors and smoking during a cooking cycle. 7KHWXUQWDEOHFDQEHEURNHQLIGURSSHG:DVKFDUHIXOO\ LQZDUPVXGV\ZDWHU'U\FRPSOHWHO\DQGUHSODFH 7RUHSODFHWKHWXUQWDEOHSODFHLWVFHQWHURYHUWKHVSLQGOH in the center of the oven and turn it until it seats into place. 0DNHVXUHWKHVPRRWKVLGHRIWKHWXUQWDEOHLVIDFLQJXS and that its center seats securely on the spindle.) 29 CARE AND CLEANING: Cleaning The Oven Cleaning The Oven (Cont.) How To Clean The Upper Oven Interior (Cont.) Cooking Trays And Baking Sheet 7RSUHYHQWEUHDNDJHDOORZWKHWUD\VWRFRROFRPSOHWHO\ EHIRUHFOHDQLQJ:DVKFDUHIXOO\LQZDUPVXGV\ZDWHURU in the dishwasher. Clear glass tray for microwaving Non-stick metal tray for speedcooking Put food directly on the aluminum baking sheet on the wire oven rack, and place them on the non-stick metal tray, when baking on two levels, broiling or toasting foods. How To Clean The Lower Oven Interior 7KHLQWHULRURI\RXUQHZRYHQFDQEHFOHDQHGPDQXDOO\ RUE\XVLQJWKH6WHDP&OHDQRU6HOI&OHDQPRGHV 6SLOODJHRIPDULQDGHVIUXLWMXLFHVWRPDWRVDXFHVDQG basting liquids containing acids may cause discoloration DQGVKRXOGEHZLSHGXSLPPHGLDWHO\/HWKRWVXUIDFHV cool, then clean and rinse. Manual Cleaning 'RQRWXVHRYHQFOHDQHUVDEUDVLYHFOHDQHUVVWURQJ liquid cleansers, steel wool, scouring pads, or cleaning SRZGHUVRQWKHLQWHULRURIWKHRYHQ&OHDQZLWKDPLOG VRDSDQGZDWHURUYLQHJDUDQGZDWHUVROXWLRQ5LQVHZLWK FOHDQZDWHUDQGGU\ZLWKDVRIWFORWK:KHQFOHDQLQJ surfaces, make sure that they are at room temperature. Steam Clean Mode 6WHDPFOHDQLVLQWHQGHGWRFOHDQVPDOOVSLOOVXVLQJZDWHU DQGDORZHUFOHDQLQJWHPSHUDWXUHWKDQ6HOI&OHDQ 7RXVHWKH6WHDP &OHDQIHDWXUHZLSHJUHDVHDQGVRLOV from the oven. Pour one cup of water into the bottom RIWKHRYHQ&ORVHWKHGRRU3UHVVWKHOptions pad, VHOHFW6WHDP&OHDQ and then press Start7KHRYHQ GRRUZLOOORFN<RXFDQQRWRSHQWKHGRRUGXULQJWKH 30 minute steam clean as this will decrease the steam FOHDQSHUIRUPDQFH$WWKHHQGRIWKHVWHDPFOHDQF\FOH WKHGRRUZLOOXQORFN:LSHRXWDQ\H[FHVVZDWHUDQGDQ\ remaining soil. 30 'RQRWXVHPHWDOVFRXULQJSDGVRUDEUDVLYHVDVWKH\ PD\GDPDJHWKHILQLVK$VRDSILOOHGVFRXULQJSDGPD\ be used to clean the trays. Self Clean Mode 5HDG6HOI&OHDQLQJ2YHQ6DIHW\,QVWUXFWLRQVDWWKH EHJLQQLQJRIWKLVPDQXDOEHIRUHXVLQJ6HOI&OHDQ0RGH 6HOIFOHDQXVHVYHU\KLJKWHPSHUDWXUHVWRFOHDQWKHRYHQ LQWHULRU7KHRYHQGRRUZLOOORFNZKHQXVLQJWKLVIHDWXUH %HIRUHRSHUDWLQJWKHVHOIFOHDQF\FOHZLSHXSJUHDVH DQGVRLOVIURPWKHRYHQ5HPRYHDOOLWHPVIURPWKH RYHQRWKHUWKDQHQDPHOHGGDUNFRORUUDFNV6KLQ\RU silver racks and any cookware or other items should all be removed from the oven before initiating a self-clean F\FOH&ORVHWKHGRRU3UHVVWKHOptions pad, select 6HOI&OHDQDQGDGHIDXOWVHOIFOHDQWLPHLVGLVSOD\HG 7KHFOHDQWLPHFDQEHFKDQJHGWRRU KRXUVE\XVLQJWKHVHOHFWRUGLDO)RUKHDYLO\VRLOHG ovens, the maximum 5 hour clean time is recommended. If you wish to use the default time, press the Start pad LPPHGLDWHO\DIWHUVHOHFWLQJWKH6HOI&OHDQ7KHRYHQ will turn off automatically when the self-clean cycle is FRPSOHWH7KHGRRUZLOOVWD\ORFNHGXQWLOWKHRYHQKDV FRROHGGRZQ$IWHUWKHRYHQKDVFRROHGGRZQZLSHDQ\ ash out of the oven. IMPORTANT:7KHKHDOWKRIVRPHELUGVLVH[WUHPHO\ sensitive to the fumes given off during the self-cleaning F\FOHRIDQ\UDQJH0RYHELUGVWRDQRWKHUZHOOYHQWLODWHG room. 49-80741-2 7KHUDFNVWKDWZHUHSURYLGHGZLWK\RXURYHQGDUN enameled racks, not shiny) may remain in the oven during the self-cleaning cycle without being damaged. 7RPDQXDOO\FOHDQUDFNVXVHZDUPVRDS\ZDWHU0DNH sure not to wash the rack slides on an extension rack. If racks become more difficult to remove from the oven, put some vegetable oil on a soft cloth or paper towel and UXERQWRWKHRYHQUDFNVXSSRUWV'RQRWZLSHWKHRLORQ an extension rack slide. Periodically, after several self-clean cycles, the extension rack slides may need to be lubricated using the graphite OXEULFDQWVKLSSHGZLWK\RXUZDOORYHQ7RRUGHUDGGLWLRQDO JUDSKLWHOXEULFDQWUHDGWKH$VVLVWDQFHDQG$FFHVVRULHV sections at the beginning of this manual. 5HPRYHH[WHQVLRQUDFNIURPWKHRYHQ6HHWKH ([WHQVLRQ2YHQ5DFNVVHFWLRQ )XOO\H[WHQGWKHUDFNRQDWDEOHRUFRXQWHUWRS 1HZVSDSHUPD\EHSODFHGXQGHUQHDWKWKHUDFNIRU easy clean up. 3. If there is debris in the slide tracks, wipe it away using a paper towel. NOTE: $Q\JUDSKLWHOXEULFDQW wiped away must be replaced. CARE AND CLEANING: Lower Oven Racks Lower Oven Racks 6KDNHWKHJUDSKLWHOXEULFDQWEHIRUHRSHQLQJLW 6WDUWLQJZLWKOHIWVOLGHPHFKDQLVPRIWKHUDFN place four (4) small drops of lubricant on the two (2) bottom tracks of the slide close to the bearing carriers. 5HSHDWIRUWKHULJKWVOLGHPHFKDQLVPRIWKHUDFN 2SHQDQGFORVHWKHUDFNVHYHUDOWLPHVWRGLVWULEXWH the lubricant. 5HSODFHWKHFDSRQWKHOXEULFDQWDQGVKDNHLWDJDLQ 7XUQWKHUDFNRYHUDQGUHSHDWVWHSVDQG &ORVHWKHUDFNWXUQUDFNULJKWVLGHXSDQGSODFHLQ WKHRYHQ6HHWKH([WHQVLRQ2YHQ5DFNVVHFWLRQ 5 HSHDWDERYHVWHSVIRUHDFKUDFN NOTE:'RQRWVSUD\ZLWKFRRNLQJVSUD\RURWKHUOXEULFDQW sprays. 49-80741-2 31 CARE AND CLEANING: Lower Oven Maintenance Lower Oven Maintenance Lower Oven Light Replacement WARNING SHOCK OR BURN HAZARD:%HIRUHUHSODFLQJRYHQOLJKWEXOEGLVFRQQHFWWKHHOHFWULFDO SRZHUWRWKHRYHQDWWKHPDLQIXVHRUFLUFXLWEUHDNHUSDQHO)DLOXUHWRGRVRPD\UHVXOWLQ electric shock or burn. CAUTION BURN HAZARD:7KHJODVVFRYHUDQGEXOEVKRXOGEHUHPRYHGZKHQFRRO7RXFKLQJKRW glass with bare hands or a damp cloth can cause burns. 'LVFRQQHFWSRZHUDWWKHPDLQIXVHRUFLUFXLWEUHDNHU panel. 5HPRYHRYHQUDFNV 6OLGHDIODWEODGHVFUHZGULYHUEHWZHHQWKHKRXVLQJ and the glass light cover. 6XSSRUWWKHJODVVOLJKWFRYHUZLWKWZRILQJHUVWR prevent the cover from falling to the bottom of the RYHQ%HFDUHIXOQRWWRFKLSWKHRYHQFRDWLQJ *HQWO\WZLVWWKHVFUHZGULYHUEODGHWRORRVHQWKH glass light cover. 5HPRYHWKHJODVVOLJKWFRYHU Lift-Off Lower Oven Door 7KHGRRULVYHU\KHDY\%HFDUHIXOZKHQUHPRYLQJDQGOLIWLQJWKHGRRU 'RQRWOLIWWKHGRRUE\WKHKDQGOH To remove the door: )XOO\RSHQWKHGRRU 2. Pull the hinge locks down toward the door frame, to WKHXQORFNHGSRVLWLRQ$WRROVXFKDVDVPDOOIODW blade screwdriver, may be required. )LUPO\ JUDVS ERWK VLGHV RI WKH GRRU DW WKH WRS &ORVHGRRUWRWKHGRRUUHPRYDOSRVLWLRQ7KHGRRU VKRXOGEHRSHQDSSUR[LPDWHO\ZLWKQRREVWUXFWLRQ above the door. /LIWGRRUXSDQGRXWXQWLOERWKKLQJHDUPVDUHFOHDURI the slots. To replace the door: )LUPO\JUDVSERWKVLGHVRIWKHGRRUDWWKHWRS 6WDUWLQJRQWKHOHIWVLGHZLWKWKHGRRUDWWKHVDPH angle as the removal position, seat the indentation of the hinge arm into the bottom edge of the hinge slot. 7KHQRWFKLQWKHKLQJHDUPPXVWEHIXOO\VHDWHGLQWR WKHERWWRPRIWKHVORW5HSHDWIRUULJKWVLGH )XOO\RSHQWKHGRRU,IWKHGRRUZLOOQRWIXOO\RSHQWKH indentation is not seated correctly in the bottom edge of the slot. 4. Push the hinge locks up against the front frame of the oven cavity, to the locked position. &ORVHWKHRYHQGRRU 32 5HPRYHWKHEXOEE\ILUPO\JUDVSLQJDQGVOLGLQJWKH bulb straight out until the two prongs have cleared the ceramic holder. 'RQRWWRXFKWKHJODVVRIWKHQHZUHSODFHPHQWEXOE with your fingers. It will cause the bulb to fail when it OLJKWV*UDVSWKHUHSODFHPHQWEXOEZLWKDFOHDQWRZHO RUIDFLDOWLVVXHZLWKWKHSURQJVIDFLQJGRZQ$OLJQ the two prongs in the ceramic holder, pressing gently until the bulb is securely in the ceramic socket. 6OLGHWKHSURWHFWLYHOHQV LQWRWKHKROGHUDQGSXVK until the clips snap into the housing. 5HFRQQHFWSRZHU Slot Hinge lock Pull hinge locks down to unlock Removal position Bottom edge of slot Hinge arm Hinge lock Hinge arm Indentation Push hinge locks up to lock 49-80741-2 Save time and money! Review the charts on the following pages first and you may not need to call for service. Problem Possible Cause What To Do Light during a speedcook cycle dims and cycles on and off, even at full power levels This is normal. Power level has been automatically reduced because the oven is hot. 7KLVLVQRUPDO7KHRYHQVHQVHVWKHKHDWOHYHODQG adjusts automatically. Light visible around the door and outer case while speedcooking This is normal. :KHQWKHRYHQLVRQOLJKWPD\EHYLVLEOHDURXQGWKH door and outer case. Fan continues to run after cooking stops The oven is cooling. 7KHIDQZLOODXWRPDWLFDOO\VKXWRIIZKHQWKHLQWHUQDO parts of the oven have cooled. Oven vent emits warm air while oven is on This is normal. Fan comes on automatically when using the microwave This is normal. LIGHTS FAN COOKING The oven makes unusual sounds while cooking Clicks and fans blowing are normal. The relay board is turning the components on and off. 7KHVHVRXQGVDUHQRUPDO Smoke comes out of the oven when I open the door Food is high in fat content. Aerosol spray used on the pans. 6PRNHLVQRUPDOZKHQFRRNLQJKLJKIDWIRRGV Food is not fully cooked or browned at the end of a cooking program Programmed times may not match WKHVL]HRUDPRXQWRIIRRG\RXDUH cooking. $GMXVWWLPHIRUGRQHQHVVRUDGMXVWWKHXSSHURU lower lamps for browning and doneness. SENSOR ERROR displayed along with an oven signal Food amount or type placed in the oven does not match the program that was set. Press the Clear/OffSDG6HWWKHRYHQSURJUDPWR match the food or liquid to be cooked or heated. Steam was not sensed by the oven because plastic wrap was not vented, a lid too tight was on the dish or a liquid was covered. 9HQWSODVWLFZUDSXVHDORRVHUOLGRUXQFRYHUOLTXLGV when cooking or heating. Power saver mode may be activated. &KHFNWKHSettings menu for clock display settings. 7XUQWKHGLVSOD\RQ A fuse in your home may be blown or the circuit breaker tripped. 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU Power outage or surge 5HVHWWKHFORFN,IWKHRYHQZDVLQXVH\RXPXVW reset it by pressing the Clear/Off pad, setting the clock and resetting any cooking function. The control has been locked. Press and hold Settings pad for 3 seconds to unlock the control. TROUBLESHOOTING TIPS (Upper Oven) Troubleshooting tips ... Before you call for service DISPLAY The display is blank “Control is LOCKED” appears in display 49-80741-2 33 TROUBLESHOOTING TIPS (Upper Oven) Troubleshooting tips ... Before you call for service Problem Possible Cause What To Do Clock is not set. 6HWWKHFORFN Door not securely closed. 2SHQWKHGRRUDQGFORVHVHFXUHO\ Start/Pause pad or selector dial not pressed after entering cooking selection. Press Start/Pause pad or selector dial. Another selection already entered in oven and Clear/Off pad not pressed to cancel it. Press Clear/Off pad. 6L]HTXDQWLW\RUFRRNLQJWLPHQRW entered after final selection. 0DNHVXUH\RXKDYHHQWHUHGFRRNLQJWLPHDIWHU selecting. Clear/Off pad was pressed accidentally. 5HVHWFRRNLQJSURJUDPDQGSUHVVStart/Pause pad. The door and inside of the oven feels hot The heat lamps produce intense heat in a small space. 7KLVLVQRUPDO8VHRYHQPLWWVWRUHPRYHIRRG when ready. Oven will not start A fuse in your home may be blown or the circuit breaker tripped. 5HSODFHIXVHRUUHVHWFLUFXLWEUHDNHU Cannot edit cooking features Some pre-programmed cooking features may not be able to be edited to prevent degradation of cooking performance. 7KLVLVQRUPDO The pads on one side of the control do not function The control has locked out the use of these pads and need to be reset. Press and hold the Clear/Off pad on the other side of the display for 30 seconds. If this does not reset the control, it may be necessary to cycle the circuit breaker. DISPLAY Control display is lit yet oven will not start OTHER PROBLEMS )&&5$',2)5(48(1&<,17(5)(5(1&( 7KLVHTXLSPHQWJHQHUDWHVDQGXVHV,60 frequency energy and if not installed and used properly, that is in strict accordance with the manufacturer's instructions, may cause interference to radio and television reception. It has been type tested and found to comply with OLPLWVIRUDQ,60(TXLSPHQWSXUVXDQWWRSDUW RI)&&5XOHVZKLFKDUHGHVLJQHGWRSURYLGH reasonable protection against such interference LQDUHVLGHQWLDOLQVWDOODWLRQ+RZHYHUWKHUHLVQR guarantee that interference will not occur in a particular installation. If this equipment does cause interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following: 34 Ŷ5HRULHQWWKHUHFHLYLQJDQWHQQDRIUDGLRRU television. Ŷ5HORFDWHWKH0LFURZDYHRYHQZLWKUHVSHFWWR the receiver. Ŷ0RYHWKHPLFURZDYHRYHQDZD\IURPWKH receiver. ŶPlug the microwave oven into a different outlet so that microwave oven and receiver are on different branch circuits. The manufacturer is not responsible for any UDGLRRU79LQWHUIHUHQFHFDXVHGE\XQDXWKRUL]HG modification to this microwave oven. It is the responsibility of the user to correct such interference. 49-80741-2 Problem Possible Cause What To Do My new oven doesn't cook like my old one. Is something wrong with the temperature settings? Your new oven has a different cooking system from your old oven and therefore may cook differently than your old oven. )RUWKHILUVWIHZXVHVIROORZ\RXUUHFLSHWLPHV and temperatures carefully. If you still think your new oven is too hot or too cold, you can adjust the temperature yourself to meet your specific cooking preference. NOTE:7KLVDGMXVWPHQWDIIHFWV%DNH &RQYHFWLRQ%DNH5DFNDQG&RQYHFWLRQ%DNH0XOWL WHPSHUDWXUHVLWZLOOQRWDIIHFW&RQYHFWLRQ5RDVW %URLORU&OHDQ Food does not bake properly Oven controls improperly set. 6HHWKH&RRNLQJ0RGHVVHFWLRQ Rack position is incorrect or rack is not level. 6HHWKH&RRNLQJ0RGHVVHFWLRQDQG&RRNLQJ*XLGH Incorrect cookware or cookware of LPSURSHUVL]HEHLQJXVHG 6HHWKH&RRNZDUHVHFWLRQ Oven temperature needs adjustment. 6HHWKHSettings section. Ingredient substitution 6XEVWLWXWLQJLQJUHGLHQWVFDQFKDQJHWKHUHFLSH outcome. Oven controls improperly set. 0DNHVXUH\RXVHOHFWWKHDSSURSULDWHEURLOPRGH Improper rack position being used. 6HH&RRNLQJ*XLGHIRUUDFNORFDWLRQVXJJHVWLRQV Food being cooked in a hot pan. 0DNHVXUHFRRNZDUHLVFRRO Cookware not suited for broiling. 8VHDSDQVSHFLILFDOO\GHVLJQHGIRUEURLOLQJ Aluminum foil used on the broiling pan and grid has not been fitted properly and slit as recommended. If using aluminum foil conform to pan slits. In some areas the power (voltage) may be low. Preheat the broil element for 10 minutes. Oven temperature too hot or too cold Oven temperature needs adjustment. 6HHWKHSettings section. Oven does not work or appears not to work A fuse in your home may be blown or the circuit breaker tripped. 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU Oven controls improperly set. 6HHWKH8VLQJWKH2YHQVHFWLRQ Oven is in Sabbath Mode. 9HULI\WKDWWKHRYHQLVQRWLQ6DEEDWK0RGH 6HHWKHSabbath Mode section. “Crackling” or “popping” sound This is the sound of the metal heating and cooling during both the cooking and cleaning functions. 7KLVLVQRUPDO Why is my range making a "clicking" noise when using my oven? Your range has been designed to maintain a tighter control over your oven's temperature. You may hear your oven's heating elements "click" on and off more frequently than in older ovens to achieve better results during baking, broiling, convection, and self-clean cycles. 7KLVLVQRUPDO Clock and timer do not work A fuse in your home may be blown or the circuit breaker tripped. 5HSODFHWKHIXVHRUUHVHWWKHFLUFXLWEUHDNHU Food does not broil properly 49-80741-2 TROUBLESHOOTING TIPS (Lower Oven) Troubleshooting tips ... Before you call for service 35 TROUBLESHOOTING TIPS (Lower Oven) 36 Troubleshooting tips ... Before you call for service Problem Possible Cause What To Do Oven light does not work Light bulb is loose or defective. 7LJKWHQRUUHSODFHEXOE Pad operating light is broken. &DOOIRUVHUYLFH Oven will not selfclean The temperature is too high to set a self-clean operation. $OORZWKHRYHQWRFRRODQGUHVHWWKHFRQWUROV Oven controls improperly set. 6HHWKH&OHDQLQJWKH2YHQVHFWLRQ Excessive smoking during clean cycle Excessive soil or grease. Press the Clear/Off SDG2SHQWKHZLQGRZVWRULGWKH URRPRIVPRNH:DLWXQWLOWKH29(1,6&22/,1*'225 IS LOCKEDGLVSOD\JRHVRII:LSHXSWKHH[FHVVVRLO and reset the clean cycle. Excessive smoking during broiling Food too close to burner element. /RZHUWKHUDFNSRVLWLRQRIWKHIRRG Oven door will not open after a clean cycle Oven too hot. $OORZWKHRYHQWRFRROEHORZORFNLQJWHPSHUDWXUH Oven not clean after a clean cycle Oven controls improperly set. 6HHWKH&OHDQLQJWKH2YHQVHFWLRQ Oven was heavily soiled. &OHDQXSKHDY\VSLOORYHUVEHIRUHVWDUWLQJWKHFOHDQF\FOH +HDYLO\VRLOHGRYHQVPD\QHHGWRVHOIFOHDQDJDLQRUIRU a longer period of time. "CLOSE DOOR TO CONTINUE COOKING" show on display section The door is open during a cooking or cleaning feature. &ORVHWKHRYHQGRRU 29(1,6&22/,1* DOOR IS LOCKED" show on display section The oven door is locked because the temperature inside the oven has not dropped below the unlocking temperature. Press the Clear/OffSDG$OORZWKHRYHQWRFRRO An oven error and 6(59,&(0$<%( NEEDED" show in the display You have a function error code. Press the Clear/OffSDG$OORZWKHRYHQWRFRROIRURQH hour. Put the oven back into operation. If the function code repeats. 'LVFRQQHFWDOOSRZHUWRWKHRYHQIRUDWOHDVWVHFRQGV and then reconnect power. If the function error code repeats, call for service. “Burning” or “oily” odor emitting from the vent This is normal in a new oven and will disappear in time. 7RVSHHGWKHSURFHVVVHWDVHOIFOHDQF\FOHIRUD PLQLPXPRIKRXUV6HHWKH&OHDQLQJWKH2YHQ VHFWLRQ Strong odor An odor from the insulation around the inside of the oven is normal for the first few times the oven is used. 7KLVLVWHPSRUDU\DQGZLOOJRDZD\DIWHUVHYHUDOXVHVRU a self-clean cycle. Fan noise A cooling fan may automatically turn on. 7KLVLVQRUPDO7KHFRROLQJIDQZLOOWXUQRQWRFRRO LQWHUQDOSDUWV,WPD\UXQIRUXSWRKRXUVDIWHUWKH oven is turned off. My oven door glass appears to be "tinted" or have a "rainbow" color. Is this defective? No. The inner oven glass is coated with a heat barrier to reflect the heat back into the oven to prevent heat loss and keep the outer door cool while baking. 7KLVLVQRUPDO8QGHUFHUWDLQOLJKWRUDQJOHV\RXPD\ see this tint or rainbow color. Sometimes the oven takes longer to preheat to the same temperature Cookware or food in oven 7KHFRRNZDUHRUIRRGLQWKHRYHQZLOOFDXVHWKHRYHQWR WDNHORQJHUWRSUHKHDW5HPRYHLWHPVWRUHGXFHSUHKHDW time. Number of racks in oven $GGLQJPRUHUDFNVWRWKHRYHQZLOOFDXVHWKHRYHQWR WDNHORQJHUWRSUHKHDW5HPRYHVRPHUDFNV Different cooking modes 7KHGLIIHUHQWFRRNLQJPRGHVXVHGLIIHUHQWSUHKHDW methods to heat the oven for the specific cooking mode. 6RPHPRGHVZLOOWDNHORQJHUWKDQRWKHUVLHFRQYHFWLRQ bake multi). 49-80741-2 Incorporado con Combinación Advantium®/Convección Horno de Pared GEAppliances.com Información de Seguridad . . . . . . 2 Garantía . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Asistencia / Accesorios . . . . . . . . .10 Manual del Propietario Horno de Pared Doble PT9800 de 30” Horno de Pared Doble CT9800 de 30” Uso del Horno Controles del Horno . . . . . . . . . . . . . . . . .11 Configuraciones del Horno . . . . . . . . . .12 Opciones del Horno . . . . . . . . . . . . . . . . .13 Horno Superior Cocción Rápida . . . . . . . . . . . . . . . . . . . . .14 Hornear, Asar y Dorar . . . . . . . . . . . . . . .18 Calentar y Leudar . . . . . . . . . . . . . . . . . . .19 Cocción con Microondas . . . . . . . . . . . .20 Horno Inferior Modos de Cocción . . . . . . . . . . . . . . . . . .24 Modo Sabático . . . . . . . . . . . . . . . . . . . . . .25 Guía de Cocción. . . . . . . . . . . . . . . . . . . . .26 Estantes . . . . . . . . . . . . . . . . . . . . . . . . . . . .27 Papel de Aluminio y Cobertores del Horno . . . . . . . . . . . . . .28 Utensilios . . . . . . . . . . . . . . . . . . . . . . . . . . .28 Cuidado y Limpieza Limpieza del Horno . . . . . . . . . . . . . . . . . .29 Estantes del Horno Inferior . . . . . . . . . .31 Mantenimiento del Horno Inferior . . . .32 Consejos para la Solución de Problemas . . . . . . . . .33 Escriba los números de modelo y de serie aquí: Nº de Modelo ______________ Nº de Serie ________________ Los podrá encontrar en una etiqueta en el borde lateral o en el frente del horno detrás de la puerta del horno. Impreso en Estados Unidos 49-80741-2 06-15 GE INFORMACIÓN DE SEGURIDAD (Horno Superior) 2 INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR PRECAUCIONES PARA EVITAR LA POSIBLE EXPOSICIÓN A ENERGÍA DE MICROONDAS EXCESIVA (a) No intente hacer funcionar el horno con la compuerta abierta ya que ésto puede provocar exposición peligrosa a la energía de microondas. Es importante no forzar ni dañar los seguros. (b) No coloque ningún objeto entre la parte frontal del horno y la compuerta, ni permita que se acumulen residuos de producto limpiador o detergente, suciedad o polvo en las superficies de sellado. (c) No haga funcionar el horno si se encuentra dañado. Es particularmente importante cerrar bien la compuerta del horno y que no haya daños en: (1) la compuerta (doblada o curvada), (2) las bisagras y pestillos (rotos o flojos), (3) sellos de la compuerta y superficies de sellado. (d) El horno no debe ser ajustado o reparado por ninguna persona, excepto por personal de mantenimiento calificado. Para reducir el riesgo de quemaduras, descargas eléctricas, incendio, lesiones o exposición a energía de microondas excesiva: ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD Ŷ Lea todas las instrucciones antes de utilizar este aparato. Cuando utilice aparatos eléctricos, se deben seguir las precauciones de seguridad básicas, entre las que se incluyen las siguientes: Ŷ /HD\VLJDODVSUHFDXFLRQHVHVSHFtILFDVGHVFULWDV en la sección PRECAUCIONES PARA EVITAR /$326,%/((;326,&,Ï1$(1(5*Ë$'( 0,&5221'$6(;&(6,9$ Ŷ $VHJ~UHVHTXHVXDSDUDWRHVWpLQVWDODGR\SXHVWRD tierra apropiadamente por un técnico cualificado de acuerdo a las instrucciones de instalación suministradas. Ŷ ,QVWDOHRXELTXHHVWHDSDUDWR~QLFDPHQWHGHDFXHUGR a las instrucciones de instalación suministradas. GUARDE ESTAS INSTRUCCIONES 49-80741-2 Ŷ $OJXQRVSURGXFWRVWDOHVFRPRKXHYRVHQWHURV\ contenedores sellados (por ejemplo, frascos sellados) son propensos a explotar y no deben calentarse en este horno. Tal uso del horno puede resultar en lesiones personales. Ŷ 1RPRQWHHVWHDSDUDWRVREUHHOIUHJDGHUR Ŷ (VWHKRUQRQRKDVLGRDSUREDGRQLSUREDGRSDUD utilización marina. Ŷ (VWHKRUQRHVWiOLVWDGRSRU8/SDUDODLQVWDODFLyQGH SDUHGHVWiQGDU Ŷ 1RKDJDIXQFLRQDUHVWHDSDUDWRVLKDVLGRGDxDGRR dejado caer. Ŷ &RPRFRQFXDOTXLHUDSDUDWRFXDQGRVHDXWLOL]DGR por niños es necesaria una estrecha vigilancia. Ŷ 8WLOLFHHVWHDSDUDWRVRODPHQWHSDUDHOILQSUHYLVWR como se describe en este manual. Ŷ 1RXWLOLFHTXtPLFRVQLYDSRUHVFRUURVLYRVHQHVWHDSDUDWR Ŷ (VWHKRUQRHVWiHVSHFtILFDPHQWHGLVHxDGRSDUDFDOHQWDU VHFDURFRFLQDUDOLPHQWRV\EHELGDV\QRHVWiGLVHxDGR para usarse en un laboratorio ni para uso industrial. Ŷ 6yORSHUVRQDOFXDOLILFDGRGHEHUHSDUDUHVWH aparato. Póngase en contacto con el centro de PDQWHQLPLHQWRDXWRUL]DGRPiVFHUFDQRHQFDVRGH necesitar revisión, reparación o ajuste. Ŷ 1RFXEUDQLEORTXHHQLQJXQDDSHUWXUDGHHVWHDSDUDWR Ŷ 1RDOPDFHQHHVWHDSDUDWRDODLUHOLEUH1RXWLOLFH este producto cerca del agua; por ejemplo, en un sótano húmedo, cerca de una piscina, cerca de un lavabo o lugares similares. Ŷ &RQVXOWHODVLQVWUXFFLRQHVGHOLPSLH]DGHODVXSHUILFLH de la puerta en la sección de Mantenimiento y limpieza del horno de este manual. Ŷ 3DUDUHGXFLUHOULHVJRGHLQFHQGLRGHQWURGHOKRUQR — No cocine excesivamente los alimentos. Vigile cuidadosamente el aparato cuandose coloque SDSHOSOiVWLFRXRWURVPDWHULDOHVFRPEXVWLEOHV dentro del microondas mientras se cocina. — Quite las tiritas de seguridad (twist-ties) y asas PHWiOLFDVGHORVUHFLSLHQWHVGHSDSHORSOiVWLFR antes de colocarlos dentro del microondas. — No utilice el horno para propósitos de almacenamiento. No deje productos de papel, utensilios de cocina ni comestibles dentro del horno cuando no se utilicen. — Si los materiales que se encuentran dentro del horno prenden fuego, mantenga la compuerta del microondas cerrada, apague el horno y corte el Ŷ Ŷ Ŷ Ŷ Ŷ Ŷ suministro eléctrico a nivel del fusible o del panel de interruptores de su hogar. Puede propagar el fuego si abre la compuerta del microondas. — No utilice las funciones del sensor dos veces sucesivamente en la misma porción de alimento. Si el alimento no se cocina completamente después del primer conteo regresivo, utilice la función &22.%<7,0(&2&,1$53257,(032SDUD permitir tiempo de cocción adicional. 1RKDJDIXQFLRQDUHOKRUQRVLQWHQHUFRORFDGDHQVX OXJDUODEDVHJLUDWRULD/DEDVHJLUDWRULDGHEHHVWDU libre de bloqueos para poder girar. (QWUHODVVXSHUILFLHVSRWHQFLDOPHQWHFDOLHQWHV se incluye la compuerta, base, paredes, parrilla y base giratoria del horno. 1RGHVFRQJHOHEHELGDVHQERWHOODVFRQFXHOORV angostos (especialmente bebidas gaseosas/ carbonatadas). Incluso si el recipiente se encuentra abierto, se puede acumular presión. Esto puede ocasionar que el recipiente explote, dando posiblemente como resultando una lesión. /RVDOLPHQWRVFRFLQDGRVHQOtTXLGRVWDOHVFRPR ODSDVWDSXHGHQWHQHUODWHQGHQFLDGHKHUYLUPiV UiSLGDPHQWHTXHORVDOLPHQWRVTXHFRQWLHQHQPHQRV humedad. En caso de que ocurra esto, consulte la sección de Mantenimiento y limpieza del horno para las instrucciones de cómo limpiar el interior del horno. /RVDOLPHQWRVFDOLHQWHV\HOYDSRUSXHGHQSURYRFDU quemaduras. Tenga cuidado al abrir cualquier tipo de recipiente que contenga alimentos calientes, incluyendo bolsas de palomitas de maíz, bolsas y cajas de cocina. Para prevenir la posibilidad de lesiones, dirija el vapor en dirección contraria a las manos y el rostro. 1RFRFLQHODVSDSDVH[FHVLYDPHQWH3XHGHQ deshidratarse y provocar fuego, causando daños al horno. Ŷ (YLWHFDOHQWDUORVDOLPHQWRVSDUDEHEpHQIUDVFRVGH vidrio, incluso sin la tapa. Asegúrese de cocinar bien toda la comida del bebé. Remueva los alimentos para distribuir el calor uniformemente. Tenga cuidado de evitar las escaldaduras al calentar la fórmula. (OUHFLSLHQWHSXHGHVHQWLUVHPiVIUtRGHORTXHOD IyUPXODUHDOPHQWHHVWi5HYLVHVLHPSUHODIyUPXOD antes de alimentar al bebé. Ŷ 1XQFDLQWHQWHIUHtUHQDEXQGDQWHDFHLWHHQHO microondas. GUARDE ESTAS INSTRUCCIONES 49-80741-2 INFORMACIÓN DE SEGURIDAD (Horno Superior) ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD 3 INFORMACIÓN DE SEGURIDAD (Horno Superior) 4 INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ADVERTENCIA AVISO: MARCAPASOS Ŷ /DPD\RUtDGHORVPDUFDSDVRVVHHQFXHQWUDQ protegidos contra la interferencia de productos electrónicos, incluyendo los microondas. Sin embargo, los pacientes que tengan marcapasos deberían consultar a sus médicos si tienen alguna duda. ADVERTENCIA ARQUEO VOLTAICO (ODUTXHRYROWDLFRSXHGHRFXUULUWDQWRGXUDQWHODFRFFLyQUiSLGDVSHHGFRRNLQJ\GHPLFURRQGDV6LQRWDTXHRFXUUH DUTXHRYROWDLFRDSULHWHHOERWyQWiFWLOClear/Off (Borrar/ Apagar) y corrija el problema. El arqueo voltaico es el término técnico que define las Ŷ 8WHQVLOLRVGHFRFLQDGHPHWDOXWLOL]DGRVGXUDQWH chispas en el horno. El arqueo voltaico es causado por: ODFRFFLyQUiSLGDRGHPLFURRQGDVH[FHSWRROODV suministradas con el horno). Ŷ 0HWDOROiPLQDGHPHWDOHQFRQWDFWRFRQHOFRVWDGR del horno. Ŷ 0HWDOWDOFRPRWLULWDVPHWiOLFDVGHVHJXULGDG sujetadores para carne de ave o platos con borde de Ŷ /iPLQDGHPHWDOPROGHDGDDODOLPHQWRORVERUGHV oro en el horno. doblados hacia arriba actúan como antenas). Ŷ 7RDOODVGHSDSHOUHFLFODGRTXHFRQWHQJDQSHGD]RV Ŷ 8WLOLFHODOiPLQDGHPHWDOVHJ~QODV de metal pequeños que se utilizan en el horno. recomendaciones de este manual. ADVERTENCIA ALIMENTOS Ŷ &XDQGRXWLOLFHHOPLFURRQGDVFRORTXHWRGRVORV alimentos y contenedores en la bandeja de vidrio transparente. Ŷ 1RFRFLQHSDORPLWDVGHPDt]HQHOKRUQRDPHQRV que se coloquen en un accesorio de palomitas de maíz para microondas especial o a menos que utilice palomitas de maíz aptas para hornos de microondas. Ŷ 1RKLHUYDKXHYRVHQHVWHKRUQR6HDFXPXODUi SUHVLyQGHQWURGHOD\HPDGHOKXHYR\FDXVDUiTXH explote, posiblemente causando lesiones. Ŷ 1RSRQJDDIXQFLRQDUHOKRUQRVLQDOLPHQWRVHQHO interior. Esto podría dañar el horno. Aumenta el calor alrededor del magnetrón y puede acortar la vida útil del microondas. Ŷ $OLPHQWRVFRQODFiVFDUDQRFRUWDGDFRPRSDSDV salchichas, embutidos, tomates, manzanas, hígado de pollo y otras menudencias y yemas de huevo deben perforarse para permitir que el vapor escape durante la cocción. Ŷ AGUA SOBRECALENTADA /tTXLGRVWDOHVFRPRDJXDFDIpRWpVRQFDSDFHV GHVREUHFDOHQWDUVHPiVDOOiGHOSXQWRGHHEXOOLFLyQ sin parecer que estén hirviendo. No siempre hay burbujeo o hervor visible cuando se saca el UHFLSLHQWHGHOKRUQRPLFURRQGDV(67238('( 5(68/7$5(1/$(%8//,&,Ï15(3(17,1$'( /Ë48,'2608<&$/,(17(6&8$1'26(08(9( (/5(&,3,(17(26(,16(57$81$&8&+$5$8 275287(16,/,2'(1752'(//Ë48,'2 Para reducir el riesgo de lesión física: — No sobrecaliente el líquido. — Revuelva el líquido antes y a la mitad del tiempo de calentamiento. — No utilice recipientes con costados rectos y cuellos angostos. ² 'HVSXpVGHFDOHQWDUHOUHFLSLHQWHGpMHORHQ el horno microondas por un período corto de tiempo antes de sacarlo. — Tenga extrema precaución cuando introduzca una cuchara u otro utensilio en el recipiente. GUARDE ESTAS INSTRUCCIONES 49-80741-2 Utensilio de uso seguro en el microondas para Speedcooking (Cocción Rápida), Baking (Hornear), Broiling (Asar), Warming (Calentar), Proofing (Leudar) y Toasting (Dorar) Ŷ El horno y la puerta alcanzarán una temperatura alta al usar la cocción rápida, hornear, asar, calentar, leudar o tostar. Ŷ Los recipientes de cocina se tornarán muy calientes.6HUHTXHULUiQJXDQWHVGHFRFLQD protectores para manipular los recipientes de cocina. Ŷ 1RXWLOLFHWDSDVUHFLSLHQWHVQLEROVDVGHFRFFLyQ DVDGRIDEULFDGDVGHOiPLQDVGHPHWDOSOiVWLFRFHUD o papel cuando cocine con la función de cocción UiSLGD Ŷ 1RFXEUDODEDVHJLUDWRULDSDUULOODGHDODPEUH EDQGHMDVQLQLQJXQDSLH]DGHOKRUQRFRQOiPLQDVGH PHWDO(VWRFDXVDUiDUTXHRYROWDLFRHQHOKRUQR Ŷ 8WLOLFHODEDQGHMDPHWiOLFDDQWLDGKHUHQWHGHOD misma forma que utilizaría una bandeja o charola para hornear plana. Ŷ 8WLOLFHODOiPLQDGHKRUQHDUGHDOXPLQLRHQODSDUULOOD de alambre del horno y colóquela en la bandeja PHWiOLFDDQWLDGKHUHQWHFXDQGRKRUQHHHQGRV niveles, ase o tueste alimentos. La base giratoria siempre debe estar colocada en su lugar cuando se utiliza el horno. Ŷ &RORTXHORVDOLPHQWRVGLUHFWDPHQWHHQODVEDQGHMDV cuando cocine, a menos que el horno le indique hacer otra cosa. Ŷ 3XHGHXWLOL]DUHQHOKRUQRFXDOTXLHUSODWRGLVHxDGR SDUDPLFURRQGDV/DVUHFHWDVGHO/LEURGHFRFLQD Advantium se probaron en recipientes de cocina de vidrio Pyrex®\FDFHURODVGHFHUiPLFD&RUQLQJZDUH®. /RVWLHPSRV\UHVXOWDGRVGHFRFFLyQSXHGHQ variar cuando se utilizan otros tipos de recipientes diseñados para hornos microondas. Colóquelos directamente en las bandejas. Ŷ 1RXWLOLFHHOKRUQRSDUDVHFDUSHULyGLFRV Ŷ 8WLOL]DUODEDQGHMDGHYLGULRWUDQVSDUHQWHFXDQGR hornea, asa, calienta, activa o tuesta puede producir resultados insatisfactorios. Coloque los alimentos directamente en la bandeja antiadherente de metal para hornear a un solo nivel o usar la cocción rápida. Coloque los alimentos directamente en la hoja para hornear de aluminio en la parrilla de alambre del horno y colóquelos en la bandeja metálica antiadherente cuando hornee a dos niveles, ase o tueste alimentos. GUARDE ESTAS INSTRUCCIONES 49-80741-2 INFORMACIÓN DE SEGURIDAD (Horno Superior) ADVERTENCIA 5 INFORMACIÓN DE SEGURIDAD (Horno Superior) INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ADVERTENCIA Recipientes de cocina seguros diseñados para microondas Asegúrese de utilizar recipientes de cocina adecuados durante la cocción a microondas. Se pueden utilizar la mayoría GHODVFDFHURODVSODWRVSDUDFRFLQDUWD]DVGHPHGLUWD]DVQRUPDOHVFHUiPLFDROR]DTXHQRWHQJDQERUGHVPHWiOLFRV RYLGULDGRVFRQXQUHFXEULPLHQWRPHWiOLFR$OJXQRVUHFLSLHQWHVGHFRFLQDVHHQFXHQWUDQPDUFDGRVFRPRDGHFXDGRV para microondas. Ŷ /DXWLOL]DFLyQGHODEDQGHMDPHWiOLFDDQWLDGKHUHQWH Ŷ 6HSXHGHXWLOL]DUWRDOODVGHSDSHOSDSHOHQFHUDGR durante la cocción en microondas puede producir \ODVHQYROWXUDVSOiVWLFDVSDUDFXEULUORVSODWRVFRQ resultados insatisfactorios. el propósito de mantener la humedad y prevenir los salpicones. Asegúrese de ventilar cortando la Ŷ 6LQRHVWiVHJXURGHTXHVXUHFLSLHQWHGHFRFLQD HQYROWXUDSOiVWLFDSDUDTXHSXHGDHVFDSDUHOYDSRU sea adecuado para microondas, realice la siguiente prueba: coloque en el horno el plato que desee Ŷ 1RWRGDVODVFXELHUWDVSOiVWLFDVVRQDGHFXDGDVSDUD probar y una taza de medida KRUQRVPLFURRQGDV/HDHQODFDMDODVLQVWUXFFLRQHV de vidrio llena con 1 taza de correspondientes. agua coloque la taza junto Ŷ 6HGHEHQFRUWDUSHUIRUDURYHQWLODUFRPRVHLQGLFD o sobre el plato. Prenda el en la caja las bolsas de cocina “hervibles” y bolsas microondas durante 30–45 SOiVWLFDVFHUUDGDVKHUPpWLFDPHQWH'HORFRQWUDULRHO segundos a alta potencia. Si Cómo probar si un envase SOiVWLFRSXHGHUHYHQWDUVHGXUDQWHRLQPHGLDWDPHQWH el plato se calienta, no debe es seguro para usarse en un después de la cocción, resultando en una posible utilizarse en el microondas. horno de microondas lesión. También, los recipientes de almacenamiento Si el plato permanece frío y SOiVWLFRVGHEHQDOPHQRVHVWDUSDUFLDOPHQWH sólo se calienta el agua de la taza, entonces el plato descubiertos debido a que forman un sello muy es adecuado para microondas. ajustado. Al cocinar con recipientes cubiertos con HQYROWXUDSOiVWLFDGHPDQHUDPX\DMXVWDGDTXLWH Ŷ /RVXWHQVLOLRVGHFRFLQDSXHGHQWRUQDUVHPX\ cuidadosamente la cubierta y dirija el vapor fuera y calientes debido a la transferencia de calor alejado de manos y rostro. proveniente de los alimentos calentados. Podrían requerirse guantes de cocina para manipular los Ŷ 5HFLSLHQWHVGHFRFLQDSOiVWLFRV²/RVUHFLSLHQWHV recipientes de cocina. de cocina diseñados para microondas son muy útiles, pero deben utilizarse con cuidado. Incluso Ŷ 1RXWLOLFHSURGXFWRVGHSDSHOUHFLFODGR/DVWRDOODV HOSOiVWLFRGLVHxDGRSDUDPLFURRQGDVSRGUtDQR servilletas y papel encerado fabricados de material tolerar condiciones de sobre cocción, así como los UHFLFODGRSXHGHQFRQWHQHUSDUWtFXODVPHWiOLFDVTXH PDWHULDOHVGHYLGULRRFHUiPLFD\SRGUtDQVXDYL]DUVH pueden causar arqueo voltaico o prender fuego. Se o carbonizarse si se exponen a períodos cortos de deben evitar los productos de papel que contienen VREUHFRFFLyQ(QH[SRVLFLRQHVPiVSURORQJDGDVDOD nylon o filamentos de nylon, ya que también pueden sobrecocción, los alimentos y los recipientes incendiarse. de cocina podrían coger fuego. Ŷ 8WLOLFHODVOiPLQDVPHWiOLFDV~QLFDPHQWHFRPRVH Siga las siguientes pautas: LQGLFDHQHVWHPDQXDO&XDQGRXWLOLFHODOiPLQDGH PHWDOHQHOKRUQRPDQWHQJDODOiPLQDSRUORPHQRV 8WLOLFHSOiVWLFRVVHJXURVSDUDPLFURRQGDV~QLFDPHQWH ƎDOHMDGDGHORVFRVWDGRVGHOKRUQR y utilícelos estrictamente según las especificaciones del fabricante. Ŷ 1RXWLOLFHHOKRUQRSDUDVHFDUSHULyGLFRV 2. No cocine en el microondas recipientes vacíos. Ŷ 6LXWLOL]DXQWHUPyPHWURGHFDUQHPLHQWUDVFRFLQD asegúrese que sea seguro para utilizarse en hornos 3. No permita que los niños utilicen recipientes microondas. GHSOiVWLFRVLQYLJLODUORVELHQ Ŷ $OJXQDVEDQGHMDVGHHVSXPDFRPRDTXHOODVHQODV que se empaca la carne) tienen una tirita de metal delgada empotrada en la parte inferior. Cuando se cocinan con microondas, el metal puede quemar el fondo del horno o hacer que arda una toalla de papel. La base giratoria siempre debe estar colocada en su lugar cuando se utiliza el horno. 6 La bandeja de cristal transparente siempre deberá estar en su lugar cuando se cocina con microondas. GUARDE ESTAS INSTRUCCIONES 49-80741-2 /HDWRGDVODVLQVWUXFFLRQHVDQWHVGHXVDUHOSURGXFWR6LQRVHVLJXHQHVWDVLQVWUXFFLRQHVVHSRGUiQSURGXFLULQFHQGLRV descargas eléctricas, lesiones graves o la muerte. ADVERTENCIA DE LA PROPOSICIÓN 65 DEL ESTADO DE CALIFORNIA /D/H\VREUH$JXD3RWDEOH,QRFXD\7UDWDPLHQWRGH5HVLGXRV7y[LFRVGH&DOLIRUQLD&DOLIRUQLD6DIH'ULQNLQJ:DWHU DQG7R[LF(QIRUFHPHQW$FWVROLFLWDDO*REHUQDGRUGH&DOLIRUQLDTXHSXEOLTXHXQDOLVWDGHVXVWDQFLDVTXHHOHVWDGR UHFRQRFHTXHSURGXFHQFiQFHUGHIHFWRVGHQDFLPLHQWRXRWURVGDxRVUHSURGXFWLYRV\VROLFLWDDORVHPSUHVDULRVTXH adviertan a sus clientes sobre la posible exposición a tales sustancias. ADVERTENCIA (VWHSURGXFWRFRQWLHQHXQRRPiVTXtPLFRVTXHHO(VWDGRGH&DOLIRUQLDHQWLHQGH TXHSURGXFHQFiQFHUGHIHFWRVHQHOQDFLPLHQWRXRWURVGDxRVUHSURGXFWLYRV /RVKRUQRVFRQOLPSLH]DDXWRPiWLFDSXHGHQRFDVLRQDUH[SRVLFLRQHVGHEDMRQLYHODDOJXQDVGHHVWDVVXVWDQFLDV LQFOX\HQGRPRQy[LGRGHFDUERQRGXUDQWHHOFLFORGHOLPSLH]D/DH[SRVLFLyQSXHGHVHUPLQLPL]DGDVLVHYHQWLODFRQ una ventana abierta o si se usa un ventilador o campana. ADVERTENCIA INSTRUCCIONES GENERALES DE SEGURIDAD Ŷ Use este electrodoméstico sólo para su propósito original, como se describe en el Manual del Propietario. Ŷ Solicite que un instalador calificado instale su electrodoméstico y que esté adecuadamente conectado a tierra, de acuerdo con las instrucciones de instalación provistas. Ŷ No intente reparar o reemplazar ninguna parte del horno, a menos que se recomiende específicamente HQHVWHPDQXDO&XDOTXLHURWUDUHSDUDFLyQGHEHUiVHU realizada por un técnico calificado. Ŷ Antes de realizar cualquier servicio técnico, desconecte el suministro de corriente desde el panel de distribución del hogar, retirando el fusible o desconectando el disyuntor. Ŷ1RGHMHDORVQLxRVVRORV±QRVHGHEHUiGHMDUDORV QLxRVVRORVRIXHUDGHVXUDGLRGHDWHQFLyQHQHOiUHD donde el electrodoméstico se encuentre en uso. Nunca VHOHVGHEHUiSHUPLWLUWUHSDUVHQWDUVHRSDUDUVHVREUH ninguna parte del electrodoméstico. Ŷ PRECAUCIÓN : No coloque artículos de LQWHUpVSDUDORVQLxRVVREUHORVJDELQHWHVTXHHVWiQ sobre un horno – si los niños se trepan sobre el horno para llegar a estos artículos podrían sufrir lesiones graves. Ŷ Use sólo mangos de ollas secas – los mangos húmedos sobre superficies calientes pueden producir quemaduras debido al vapor. No deje que los mangos de las ollas WRTXHQORVHOHPHQWRVTXHHVWiQFDOLHQWHV1RXVHXQD toalla u otra tela voluminosa para reemplazar el mango de las cacerolas. Ŷ Nunca use el electrodoméstico para calentar o calefaccionar la habitación. Ŷ No toque el elemento calentador ni la superficie interior Ŷ Ŷ Ŷ Ŷ del horno. Es posible que estas superficies estén demasiado calientes como para quemar, aunque su FRORUVHDRVFXUR'XUDQWH\GHVSXpVGHOXVRQRWRTXH ni permita que telas u otros materiales inflamables WRTXHQFXDOTXLHUiUHDLQWHULRUGHOKRUQRHVSHUHDTXH haya pasado un tiempo suficiente para que se enfríen. 2WUDVVXSHUILFLHVGHOHOHFWURGRPpVWLFRVHSRGUiQ FDOHQWDUORVXILFLHQWHFRPRSDUDRFDVLRQDUOHVLRQHV/DV superficies potencialmente calientes incluyen la abertura de la ventilación del horno, superficies cercanas a la abertura y grietas alrededor de la puerta del horno. No caliente envases de comida que no hayan sido abiertos. Se podría acumular presión y el envase podría explotar, ocasionando una lesión. No use ningún tipo de aluminio o cobertor para cubrir el fondo del horno o cualquier parte del horno, excepto FRPRVHGHVFULEHHQHVWHPDQXDO/RVFREHUWRUHVGH horno pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. Evite las ralladuras o impactos sobre las puertas GHYLGULRRORVSDQHOHVGHFRQWURO+DFHUHVWRSRGUi producir la rotura de vidrios. No cocine sobre ni en un producto con un vidrio roto. Es posible que se produzcan descargas, incendios o cortes. Cocine carnes y carnes de ave en forma completa – la carne por lo menos a una temperatura interna de 160º F y la carne de ave por lo menos a una temperatura interna de 180º F. Normalmente la cocción a estas temperaturas es una protección contra las enfermedades transmitidas por la comida. GUARDE ESTAS INSTRUCCIONES 49-80741-2 INFORMACIÓN DE SEGURIDAD (Horno Inferior) ADVERTENCIA 7 INFORMACIÓN DE SEGURIDAD (Horno Inferior) INFORMACIÓN IMPORTANTE DE SEGURIDAD LEA TODAS LAS INSTRUCCIONES ANTES DE USAR ADVERTENCIA MANTENGA LOS MATERIALES INFLAMABLES ALEJADOS DE LA COCINA Si esto no se cumple, se podrán sufrir lesiones personales graves o incendios. Ŷ No guarde ni use materiales inflamables en o cerca GHXQKRUQRLQFOX\HQGRSDSHOSOiVWLFRPDQJRVGH ollas, trapos, cobertores de pared, cortinas, paños y gasolina u otros vapores y líquidos inflamables. Ŷ Nunca use prendas holgadas o que cuelguen mientras usa el electrodoméstico. Estas prendas se ADVERTENCIA SRGUiQLQFHQGLDUVLHQWUDQHQFRQWDFWRFRQVXSHUILFLHV calientes, ocasionando quemaduras graves. Ŷ No permita que la grasa de la cocción u otros materiales inflamables se acumulen en o cerca del KRUQR/DJUDVDTXHHVWiHQRFHUFDGHOKRUQRVH SRGUiLQFHQGLDU EN CASO DE INCENDIO, SIGA LOS SIGUIENTES PASOS PARA EVITAR LESIONES O LA PROPAGACIÓN DEL FUEGO Ŷ No use agua sobre el fuego de la grasa. Nunca tome una olla que se esté incendiando. Ŷ Si hay un incendio en el horno durante el horneado, ahogue el fuego cerrando la puerta del horno y apagando el mismo o usando un químico seco multipropósito o un extintor de incendio con espuma. Ŷ En caso de que haya fuego en el horno durante el ciclo GHOLPSLH]DDXWRPiWLFDDSDJXHHOKRUQR\HVSHUHDTXH el fuego se extinga. No fuerce la puerta para abrirla. /DHQWUDGDGHDLUHIUHVFRVREUHODVWHPSHUDWXUDVGHOD OLPSLH]DDXWRPiWLFDSRGUiFRQGXFLUDODSURGXFFLyQGH llamas en el horno. Si no se siguen estas instrucciones, VHSRGUiQSURGXFLUTXHPDGXUDVJUDYHV ADVERTENCIA INSTRUCCIONES DE SEGURIDAD DEL HORNO Ŷ Manténgase alejado del horno al abrir la puerta del mismo. El aire caliente o el vapor que sale puede causar quemaduras en las manos, rostro y/u ojos. Ŷ Mantenga desobstruida la ventilación del horno. Ŷ 0DQWHQJDHOKRUQROLEUHGHDFXPXODFLyQGHJUDVD/D grasa del horno se puede incendiar. Ŷ Coloque los estantes del horno en la ubicación deseada mientras éste se encuentra frío. Si es QHFHVDULRPRYHUHOHVWDQWHPLHQWUDVHOKRUQRHVWi caliente, evite que el mango de la olla tenga contacto con el elemento calentador en el horno. Ŷ Al usar las bolsas para cocinar o dorar en el horno, siga las instrucciones del fabricante. ADVERTENCIA Ŷ Es conveniente empujar hacia afuera los estantes HVWiQGDUHVKDVWDHOWRSHRHPSXMDUHOHVWDQWH extensible hasta la posición completamente abierta para levantar comidas pesadas. Esto también es una precaución contra quemaduras por tocar superficies calientes de la puerta o las paredes del horno. Ŷ No deje productos tales como papel, utensilios de cocina ni comida en el horno cuando éste no se HQFXHQWUHHQXVR/RVDUWtFXORVJXDUGDGRVHQHO horno se pueden incendiar. Ŷ Nunca coloque los utensilios de cocina, piedras para pizza u horneado o cualquier otro tipo de aluminio o cobertor en la base del horno. Estos ítems pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. INSTRUCCIONES DE SEGURIDAD DEL HORNO CON LIMPIEZA AUTOMÁTICA /DIXQFLyQGHOLPSLH]DDXWRPiWLFDXVDHOKRUQRHQWHPSHUDWXUDVORVXILFLHQWHPHQWHDOWDVFRPRSDUDFRQVXPLUOD suciedad de comida que haya dentro del horno. Para un funcionamiento seguro, siga estas instrucciones. Ŷ No toque las superficies del horno durante el ciclo de OLPSLH]DDXWRPiWLFD0DQWHQJDDORVQLxRVDOHMDGRV GHOKRUQRGXUDQWHODOLPSLH]DDXWRPiWLFD6LQR VHVLJXHQHVWDVLQVWUXFFLRQHVVHSRGUiQSURGXFLU quemaduras. Ŷ $QWHVGHXVDUHOFLFORGHOLPSLH]DDXWRPiWLFDGHO horno, retire los estantes de color gris brillante (en algunos modelos), la sonda, cualquier papel de aluminio, y cualquier bandeja para asar, rejilla, u otros utensilios. Sólo se pueden dejar dentro del horno los estantes para horno cubiertos de porcelana. Ŷ $QWHVGHXWLOL]DUHOFLFORGHOLPSLH]DDXWRPiWLFD limpie la grasa y restos de comida que haya en el horno. Una cantidad excesiva de grasa se puede 8 incendiar, lo cual puede producir daños con humo en su hogar. Ŷ 6LHOPRGRGHOLPSLH]DDXWRPiWLFDIXQFLRQDGH forma incorrecta, apague el horno y desconecte el suministro de corriente. Solicite el servicio de un técnico calificado. Ŷ 1ROLPSLHODMXQWDGHODSXHUWD/DMXQWDGHODSXHUWD es esencial para un buen sellado. Se debe tener cuidado de no frotar, dañar ni mover la junta. Ŷ 1RXVHOLPSLDGRUHVSDUDKRUQR1RVHGHEHUiXVDU limpiadores comerciales para horno ni revestimientos de protección para hornos de ningún tipo en o alrededor de cualquier parte del horno. GUARDE ESTAS INSTRUCCIONES 49-80741-2 Registre su Electrodoméstico: ¡Registre su electrodoméstico nuevo a través de Internet, según su conveniencia! www.geappliances.com/service_and_support/register/ 8QUHJLVWURSXQWXDOGHVXSURGXFWRSHUPLWLUiXQDPHMRUFRPXQLFDFLyQ\XQVHUYLFLRPiVSXQWXDOGHDFXHUGRFRQORVWpUPLQRVGHVX garantía, en caso de surgir la necesidad. También puede enviar una carta en la tarjeta de inscripción pre-impresa que se incluye con el material embalado. GARANTÍA ¡Gracias! ... por su compra de un electrodoméstico de la Marca GE Garantía de la Cocina Eléctrica de GE GEAppliances.com Todo el servicio de garantía es provisto por nuestros Centros de Servicio de Fabricación, o un técnico autorizado de Servicio al Cliente (Customer Care®). Para programar una visita del servicio técnico a través de Internet, visítenos en www.geappliances. FRPVHUYLFHBDQGBVXSSRUWROODPHDO*(&$5(6&XDQGROODPHSDUDVROLFLWDUHOVHUYLFLRWHQJDORVQ~PHURV de serie y de modelo disponibles. 3DUDUHDOL]DUHOVHUYLFLRWpFQLFRGHVXHOHFWURGRPpVWLFRVHSRGUiUHTXHULUHOXVRGHGDWRVGHOSXHUWRGHDERUGDMHSDUDVX GLDJQyVWLFR(VWRGDDOWpFQLFRGHOVHUYLFLRGHIiEULFDGH*(ODKDELOLGDGGHGLDJQRVWLFDUGHIRUPDUiSLGDFXDOTXLHUSUREOHPDFRQ VXHOHFWURGRPpVWLFR\GHD\XGDUD*(DPHMRUDUVXVSURGXFWRVDOEULQGDUOHD*(ODLQIRUPDFLyQVREUHVXHOHFWURGRPpVWLFR6LQR GHVHDTXHORVGDWRVGHVXHOHFWURGRPpVWLFRVHDQHQYLDGRVD*(VROLFLWDPRVTXHOHLQGLTXHDVXWpFQLFRQRHQWUHJDUORVGDWRVD *(HQHOPRPHQWRGHOVHUYLFLR 'XUDQWHHOSHUtRGRGHXQDxRGHVGHODIHFKDRULJLQDOGHFRPSUD*(OHEULQGDUiFXDOTXLHUSDUWHGHODFRFLQDTXHIDOOHGHELGRD XQGHIHFWRHQORVPDWHULDOHVRODIDEULFDFLyQ'XUDQWHHVWDJDUDQWtDOLPLWDGDGHXQDxR*(WDPELpQSURYHHUiVLQFRVWRWRGRHO trabajo y el servicio en el hogar relacionado con el reemplazo de la parte que presente defectos. Qué no cubrirá GE: Ŷ Viajes del técnico del servicio a su hogar para enseñarle Ŷ Ŷ Ŷ 'DxRVLQFLGHQWDOHVRFRQVHFXHQWHVFDXVDGRVSRUSRVLEOHV defectos sobre este producto. Ŷ 'DxRFDXVDGRGHVSXpVGHODHQWUHJD Ŷ Producto no accesible para brindar el servicio requerido. Ŷ Solicite el servicio técnico para reparar o reemplazar las OiPSDUDVH[FHSWRODVOiPSDUDV/(' EXCLUSIÓN DE GARANTÍAS IMPLÍCITAS 6X~QLFD\H[FOXVLYDDOWHUQDWLYDHVODUHSDUDFLyQGHOSURGXFWRFRPRVHLQGLFDHQOD*DUDQWtD/LPLWDGD/DVJDUDQWtDVLPSOtFLWDV incluyendo garantías implícitas de comerciabilidad o conveniencia sobre un propósito particular, se limitan a un año o al período PiVFRUWRSHUPLWLGRSRUODOH\ Esta garantía se extiende al comprador original y a cualquier dueño subsiguiente de productos comprados para uso hogareño GHQWURGH((886LHOSURGXFWRHVWiHQXQiUHDGRQGHQRVHHQFXHQWUDGLVSRQLEOHXQ3URYHHGRU$XWRUL]DGRGHO6HUYLFLR7pFQLFR GH*(XVWHGVHUiUHVSRQVDEOHSRUHOFRVWRGHXQYLDMHRVHSRGUiUHTXHULUTXHWUDLJDHOSURGXFWRDXQDXELFDFLyQGHO6HUYLFLR 7pFQLFRGH*($XWRUL]DGRSDUDUHFLELUHOVHUYLFLR(Q$ODVNDODJDUDQWtDH[FOX\HHOFRVWRGHHQYtRROODPDGDVGHOVHUYLFLRDVX hogar. Algunos estados no permiten la exclusión o limitación de daños fortuitos o consecuentes. Esta garantía le da derechos legales HVSHFtILFRV\HVSRVLEOHTXHWHQJDRWURVGHUHFKRVOHJDOHVTXHYDUtDQHQWUHXQHVWDGR\RWUR3DUDFRQRFHUFXiOHVVRQVXV derechos legales, consulte a la oficina de asuntos del consumidor local o estatal o al Fiscal de su estado. Garante: General Electric Company. Louisville, KY 40225 Garantías Extendidas:$GTXLHUDXQDJDUDQWtDH[WHQGLGDGH*(\DSUHQGDVREUHGHVFXHQWRVHVSHFLDOHVTXHHVWiQGLVSRQLEOHV PLHQWUDVVXJDUDQWtDD~QHVWiYLJHQWH/DSXHGHDGTXLULUHQFXDOTXLHUPRPHQWRDWUDYpVGH,QWHUQHWHQ Abroche su recibo aquí. Para acceder al servicio técnico de acuerdo con ODJDUDQWtDGHEHUiFRQWDUFRQODSUXHEDGHODIHFKDRULJLQDOGHFRPSUD Ŷ Ŷ sobre cómo usar el producto. Instalación, entrega o mantenimiento inadecuados. Fallas del producto en caso de abuso, mal uso, modificación o uso para propósitos diferentes al original o uso comercial. Reemplazo de fusibles de la casa o reinicio de disyuntores. 'DxRVRFDVLRQDGRVVREUHHOSURGXFWRSRUDFFLGHQWH LQFHQGLRLQXQGDFLRQHVRFDWiVWURIHVQDWXUDOHV www.geappliances.com/service_and_support/shop-for-extended-service-plans.htm ROODPDQGRDOGXUDQWHHOKRUDULRFRPHUFLDOKDELWXDO/RV6HUYLFLRVSDUDHO&RQVXPLGRU+RJDUHxRGH*(D~QHVWDUiQ allí cuando su garantía caduque. 49-80741-2 9 ASISTENCIA / ACCESORIOS ¿Desea realizar una consulta o necesita ayuda con su electrodoméstico? £&RQVXOWHHO6LWLR:HEGH(OHFWURGRPpVWLFRVGH*(www.geappliances.com/service_and_support/) durante las 24 horas, cualTXLHUGtDGHODxR3DUDPD\RUFRQYHQLHQFLD\XQVHUYLFLRPiVUiSLGRDKRUDSXHGHGHVFDUJDUHO0DQXDOGHO3URSLHWDULRRUGHQDU piezas o incluso programar el servicio técnico a través de Internet. Servicio Programado: El servicio de reparación de expertos de *(HVWiDVyORXQSDVRGHVXSXHUWD(QWUHD,QWHUQHW\SURJUDPH su servicio en www.geappliances.com/service_and_ support/ o OODPHDO*(&$5(6GXUDQWHHOKRUDULRGH atención comercial. Piezas y Accesorios: Aquellas personas calificadas para realizar el servicio técnico sobre sus propios electrodomésticos SRGUiQVROLFLWDUHOHQYtRGHSLH]DVRDFFHVRULRVGLUHFWDPHQWH a sus hogares (se aceptan las tarjetas VISA; MasterCard y 'LVFRYHU2UGHQHDWUDYpVGH,QWHUQHWKR\GXUDQWHODV horas o en forma telefónica al 800.626.2002 durante el horario de atención comercial. /DVLQVWUXFFLRQHVTXHILJXUDQHQHVWHPDQXDOFXEUHQORV SURFHGLPLHQWRVTXHVHUiQUHDOL]DGRVSRUFXDOTXLHUXVXDULR Otros servicios técnicos generalmente deberían ser GHULYDGRVDSHUVRQDOFDOLILFDGRGHOVHUYLFLR6HGHEHUiWHQHU FXLGDGR\DTXHXQDUHSDUDFLyQLQGHELGDSRGUiKDFHUTXHHO funcionamiento no sea seguro. Estudio de Diseño de la Vida Real: *(DSR\DHOFRQFHSWR GH'LVHxR8QLYHUVDOHQSURGXFWRVVHUYLFLRV\DPELHQWHVTXH pueden ser usados por personas de todas las edades, tamaños y capacidades. Reconocemos la necesidad de realizar diseños para una amplia gama de habilidades e incapacidades físicas y PHQWDOHV3DUDPiVGHWDOOHVVREUHODVDSOLFDFLRQHVGH'LVHxR 8QLYHUVDOGH*(LQFOX\HQGRLGHDVGHGLVHxRGHFRFLQDVSDUD personas con incapacidades, visite nuestro sitio web hoy. Sobre FDVRVGHLQFDSDFLGDGDXGLWLYDFRPXQtTXHVHDO7''*($& (800.833.4322). Contáctenos: Si no se encuentra satisfecho con el servicio TXHUHFLELyGH*(FRPXQtTXHVHFRQQRVRWURVDWUDYpVGH nuestro sitio web con todos los detalles, incluyendo su número telefónico, o escriba a: General Manager, Customer Relations GE Appliances, Appliance Park Louisville, KY 40225 Accesorios ¿Busca Algo Más? ¡GE ofrece una variedad de accesorios para mejorar sus experiencias de cocción y mantenimiento! Para realizar una orden, visítenos a través de Internet en: www.GEApplianceParts.com (EE.UU.) o en www.GEAppliances.ca&DQDGi o llame al 800.626.2002 (EE.UU.) 800.661.1616&DQDGi (VWRV\RWURVSURGXFWRVHVWiQGLVSRQLEOHV Accesorios 2OODSDUD$VDU3HTXHxDô´[ó´[ò³ 2OODSDUD$VDU*UDQGHô´[ó´[ò³ 2OODSDUD$VDU([WUD*UDQGHô´[ó´[ò³ :%;((88'*&DQDGi :%;((88'*&DQDGi :%;((881RGLVSRQLEOHHQ&DQDGi Piezas %DQGHMDGH9LGULR %DQGHMDGH0HWDO 3ODWR*LUDWRULR (VWDQWHVGHOKRUQR (OHPHQWRVGHOKRUQR /iPSDUDVGHOX] /RVQ~PHURVGHSLH]DYDUtDQVHJ~QHOPRGHOR :%; /RVQ~PHURVGHSLH]DYDUtDQVHJ~QHOPRGHOR /RVQ~PHURVGHSLH]DYDUtDQVHJ~QHOPRGHOR /RVQ~PHURVGHSLH]DYDUtDQVHJ~QHOPRGHOR /RVQ~PHURVGHSLH]DYDUtDQVHJ~QHOPRGHOR Suministros de Limpieza /LPSLDGRUSDUD(OHFWURGRPpVWLFRV0LFUR%U\WH®GHRQ]DV :;; /LPSLDGRUHVGH$FHUR,QR[LGDEOH&LWUL6KLQH :;; /LPSLDGRUGH(OHFWURGRPpVWLFRVGH$FHUR,QR[LGDEOH&HUDPD%U\WH®30; /XEULFDQWHGH*UDILWR :%7 7KHODUJHEURLOHUSDQGRHVQRWILWLQ´´UDQJHV 7KH;/EURLOHUSDQGRHVQRWILWLQ´ZDOORYHQV´GURSLQVRU´´UDQJHV Cómo Retirar la Película Protectora de Envío y la Cinta de Embalaje Con cuidado tome un extremo de la película protectora de envío con los dedos y lentamente retire la misma de la superficie del electrodoméstico. No utilice ningún producto filoso para retirar la película. Retire toda la película antes de usar el electrodoméstico por primera vez. 10 Para asegurar que no haya daños sobre el acabado del SURGXFWRODIRUPDPiVVHJXUDGHUHWLUDUHODGKHVLYRGHODFLQWD de embalaje en electrodomésticos nuevos es aplicando un detergente líquido hogareño para lavar platos. Aplique con una tela suave y deje que se seque. NOTA: (ODGKHVLYRGHEHUiVHUHOLPLQDGRGHWRGDVODVSDUWHV No se puede retirar si se hornea con éste dentro. 49-80741-2 Controles del Horno Superior 7 9 11 8 10 12 Controles Comunes 1 6 2 Controles Comunes 1. Timer On/Off (Temporizador Encendido/ Apagado): Funciona como un temporizador con cuenta regresiva: Presione la tecla Timer On/Off (Temporizador Encendido/ Apagado), seleccione el tipo de temporizador (horas y minutos o minutos y segundos), use el dial de selección para configurar la hora, y presione el dial del selector para iniciar ODFXHQWDUHJUHVLYDGHOWHPSRUL]DGRU(OKRUQRFRQWLQXDUiIXQFLRQDQGR cuando la cuenta regresiva del temporizador se haya completado. Para apagar el temporizador, presione la tecla Timer On/Off (Temporizador Encendido/ Apagado). 2. Settings/Lock Controls (Controles de Configuraciones/ Bloqueo): %XVTXHODVRSFLRQHVGHOKRUQRSDUD+HOS$\XGD &ORFN6HWWLQJV&RQILJXUDFLRQHVGHO5HORM'LVSOD\0RGH0RGRGH 3DQWDOOD$XWR&RQYHUVLRQ&RQYHUVLyQ$XWRPiWLFD$XWR6KXW2II $SDJDGR$XWRPiWLFR%HHSHU9ROXPH9ROXPHQGHO3LWLGR5HPLQGHU (Recordatorio), Temperature Units (Unidades de Temperatura), Thermostat $GMXVW$MXVWDUHO7HUPRVWDWR\2YHQ,QIRUPDWLRQ,QIRUPDFLyQGHO+RUQR EDMRHVWDVHOHFFLyQ3DUDPiVGHWDOOHVFRQVXOWHODVHFFLyQ2YHQ6HWWLQJV &RQILJXUDFLRQHVGHO+RUQR0DQWHQJDSUHVLRQDGDODWHFODSettings (Configuraciones) durante 3 segundos para bloquear o desbloquear los controles. Esto bloquea el control, de modo que al presionar las teclas de FRQWUROQRVHDFWLYHHVWDIXQFLyQ/DIXQFLyQ&OHDU2II%RUUDU$SDJDU VLHPSUHHVWiDFWLYDLQFOXVRFXDQGRHOFRQWUROHVWiEORTXHDGR 3. Selector Dial (Dial de Selección): El dial de selección se XVDWDQWRSDUDHOKRUQRVXSHULRUFRPRSDUDHOLQIHULRU*LUHHOGLDOSDUD seleccionar las configuraciones del horno, opciones del horno superior/ inferior y opciones de cocción, y luego presione el mismo para confirmar ODVHOHFFLyQ*LUHHOGLDOSDUDLQFUHPHQWDURUHGXFLUODVWHPSHUDWXUDVR el tiempo y luego presione el mismo para configurar la temperatura o el tiempo configurados. 4. Back (Retroceder): 3UHVLRQHHVWDWHFODSDUDLUKDFLDDWUiVHQXQ nivel del menú en la pantalla. 5. 6. 9. 13 14 5 18 17 15 16 Speed Cook (Cocción Rápida): Presione la tecla Speed Cook (Cocción Rápida)SDUDDFFHGHUDOPHQ~GHFRFFLyQUiSLGDFRQILJXUDGR SUHYLDPHQWH&XDQGRXVHODIXQFLyQGHFRFFLyQUiSLGDFRORTXHODFRPLGD o el plato para uso seguro en el horno sobre la bandeja de metal. No use XWHQVLOLRVGHSOiVWLFRRVLOLFRQDDOXVDUHVWDIXQFLyQ\DTXHVHSRGUtDQ GHUUHWLURGHIRUPDU3DUDPiVGHWDOOHVFRQVXOWHODVHFFLyQGH&RFFLyQ 5iSLGDHQHOKRUQRVXSHULRU 10. Convection Bake (Hornear por Convección): Presione la tecla Convection Bake (Hornear por Convección) para realizar un horneado por convección en el horno superior. Cuando use la función de horneado por convección, coloque la comida o el plato para uso seguro en el horno sobre la bandeja de metal. Cuando hornee por convección en dos niveles, coloque la comida o el plato de uso seguro en el horno sobre la bandeja de horneado de aluminio en la parrilla de alambre, y coloque los PLVPRVHQODEDQGHMDGHPHWDO3DUDPiVGHWDOOHVFRQVXOWH8SSHU2YHQ %DNLQJ+RUQHDUHQHO+RUQR6XSHULRU%URLOLQJ$VDU\7RDVWLQJ7RVWDU 11. Cooking Options (Opciones de Cocción): %XVTXHODV IXQFLRQHV5HSHDW/DVW5HSHWLUÒOWLPR%URLO$VDU3URRI/HXGDU7RDVW 7RVWDU\:DUP&DOHQWDUHQHVWDVHOHFFLyQ3DUDPiVGHWDOOHVFRQVXOWH ODVHFFLyQ2YHQ2SWLRQV2SFLRQHVGHO+RUQR 12. Clear/Off (Borrar/ Apagar): /DWHFOD&OHDU2II%RUUDU$SDJDU FDQFHOD72'26ORVSURJUDPDVGHOKRUQRVXSHULRUH[FHSWRHOUHORM\HO temporizador. Controles del Horno Inferior 13. Light (Luz): Presione la tecla Light (Luz) para encender o apagar la luz del horno en el horno inferior. Observe que la luz del horno inferior no VHHQFHQGHUiVLpVWHVHHQFXHQWUDHQHOPRGRGHOLPSLH]D 14. Bake (Hornear): Presione la tecla Bake (Hornear) para hornear, gire el dial para seleccionar la temperatura de horneado y presione el dial para hacer la selección. 15. Broil (Asar): Presione la tecla Broil (Asar) para asar, gire el dial para (Iniciar/ Pausar) para iniciar cualquier función de cocción, limpieza o con temporizador. Presione la tecla Start/Pause (Iniciar/ Pausar) para pausar cualquier función del horno superior. 16. Options (Opciones): %XVTXHODVIXQFLRQHV'HOD\6WDUW5HWUDVDU Display (Pantalla): /DLQIRUPDFLyQVREUHHOKRUQRVXSHULRU\HO Controles del Horno Superior Microwave (Cocinar con Microondas): Presione la tecla Microwave (Cocinar con Microondas) para acceder a las opciones de cocción con microondas. Use el dial de selección para buscar la opción de cocción con microondas deseada y presione el dial para seleccionar ODPLVPD/DVRSFLRQHVGLVSRQLEOHVLQFOX\HQ&RRNE\7LPH&RFLQDUSRU 7LHPSR&RRN&RFLQDU'HIURVW'HVFRQJHODU%HYHUDJH%HELGD 3RSFRUQ3DORPLWDVGH0Dt]0HOW'HUUHWLU5HKHDW5HFDOHQWDU 6LPPHU+HUYLU\6RIWHQ$EODQGDU8VHODEDQGHMDGHYLGULRWUDVSDUHQWH y el utensilio para uso seguro en el microondas al usar las funciones GHFRFFLyQFRQPLFURRQGDV3DUDPiVGHWDOOHVFRQVXOWHODVHFFLyQGH Cocción con microondas en el horno superior. 8. 3 4 Start/Pause (Iniciar/ Pausar): Presione la tecla Start/Pause horno inferior se muestra en la ventana de esta pantalla. 7. Controles del Horno Inferior USO DEL HORNO: Controles del Horno Controles del Horno VHOHFFLRQDU+L/R$OWR%DMR\SUHVLRQHHOGLDOSDUDKDFHUODVHOHFFLyQ ,QLFLR3UREH6RQGD3URRI/HXGDU6DEEDWK6DEiWLFR6HOI&OHDQ /LPSLH]D$XWRPiWLFD6WHDP&OHDQ/LPSLH]DFRQ9DSRU\:DUP &DOHQWDUHQHVWDVHOHFFLyQ3DUDPiVGHWDOOHVFRQVXOWHODVHFFLyQ2YHQ 2SWLRQV2SFLRQHVGHO+RUQR 17. Convection Bake (Horneado por Convección): Presione la tecla Convection Bake (Hornear por Convección) para hornear por FRQYHFFLyQ/RVPRGRVGHFRFFLyQSRUFRQYHFFLyQXWLOL]DQXQDFLUFXODFLyQ de aire incrementada para mejorar el rendimiento. El tipo de beneficio depende del modo. Su horno inferior cuenta con los siguientes modos GHFRFFLyQSRUFRQYHFFLyQ&RQYHFWLRQ%DNH5DFN0XOWL+RUQHDU por Convección, 1 o múltiples estantes) y Convection Roast (Asar por &RQYHFFLyQ3DUDPiVLQIRUPDFLyQFRQVXOWHODVHFFLyQGH0RGRVGH &RFFLyQHQHO+RUQR,QIHULRU 18. Clear/Off (Borrar/ Apagar): /DWHFOD&OHDU2II%RUUDU$SDJDU FDQFHOD72'26ORVSURJUDPDVGHOKRUQRLQIHULRUH[FHSWRHOUHORM\HO temporizador. Add 30 Sec (Agregar 30 Segundos): Presione la tecla Add 30 Sec (Agregar 30 Segundos) de tiempo de cocción en el microondas. Cada vez que se presiona esta tecla, se suman 30 segundos al tiempo de cocción restante. El horno se inicia de inmediato. 49-80741-2 11 USO DEL HORNO: Configuraciones del Horno Configuraciones del Horno Ayuda Clock Settings (Configuraciones del Reloj) 8VHHVWDIXQFLyQSDUDVDEHUPiVVREUHVXKRUQR\VXV funciones, presionando la tecla Settings (Configuraciones) y seleccionando Help (Ayuda)*LUHHOGLDOGHVHOHFFLyQ\ SUHVLRQHHOPLVPRSDUDVHOHFFLRQDUODIXQFLyQVREUHODFXiO GHVHHVDEHUPiV NOTA: Es posible que su horno no cuente con todas las funciones de ayuda. A continuación figuran funciones de la IXQFLyQ+HOS$\XGD Use esta función para configurar la hora del día y para especificar FyPRpVWDVHUiH[KLELGD3XHGHVHOHFFLRQDUHOUHORMHVWiQGDUGH 12 horas (12 hrs.) o el reloj militar de 24 horas (24 hrs.). El reloj GHEHUiVHUFRQILJXUDGRDQWHVGHOSULPHUXVRGHOKRUQR Funciones que se encuentran en la función HELP (AYUDA). Display Mode (Modo de Pantalla) Use esta función para configurar el modo de pantalla Power 6DYHU$KRUURGH(QHUJtDR'LVSOD\$OZD\V0RVWUDU Siempre). Auto Conversion (Conversión Automática) Adding time (Añadir tiempo) 'HIURVWE\:HLJKW 'HVFRQJHODFLyQ por peso) Start/Pause (Iniciar/ Pausar) Auto Convection (Convección $XWRPiWLFD 'HOD\6WDUW/RZHU (Retrasar Inicio, Inferior) Steam Clean /LPSLH]DDO9DSRU Auto Shut-Off $SDJDGR$XWRPiWLFR 'LVSOD\0RGH (Modo de Pantalla) Temperature Units (Unidades de Temperatura) %DFN5HJUHVDU Edit (Editar) Thermostat Adjust (Ajustar el Termostato) %DNH+RUQHDU +HOS$\XGD Timer On/Off (Temporizador Encendido/ Apagado) %HHSHU9ROXPH (Volumen del Pitido) 0HOW'HUUHWLU Toast (Tostar) %HYHUDJH%HELGD Micro 30 Secs (30 seg. de Microondas) :DUP&DOHQWDU %URLO$VDU Microwave (Cocinar con Microondas) Clear/Off %RUUDU$SDJDU My recipes (Mis recetas) &ORFN5HORM Probe (Sonda) &RQWURO/RFNRXW %ORTXHRGHO&RQWURO 3URRI/HXGDU Reminder (Recordatorio) &RRN&RFLQDU Reheat (Recalentar) Use esta función con Set (Configurar), Review (Revisar), o &OHDU5HPLQGHU%RUUDU5HFRUGDWRULR &RRNE\WLPH (Cocción por tiempo) Reminder (Recordatorio) &RRNE\7LPH (Cocinar por Tiempo) 5HSHDW/DVW5HSHWLU HOÒOWLPR3DVR &RRNE\7LPH (Cocinar por Tiempo 1 y 2) Resume (Reiniciar) &RRNLQJ2SWLRQV (Opciones de Cocción) (Inferior) 6DEEDWK6DEiWLFR &RRNLQJ2SWLRQV (Opciones de Cocción) (Superior) 6HOI&OHDQ/LPSLH]D $XWRPiWLFD 'HIURVW'HVFRQJHODU 6HQVRU&RRNLQJ (Cocción por sensor) 'HIURVWE\)RRG 'HVFRQJHODUSRU Comida) 6LPPHU+HUYLU 'HIURVWE\7LPH 'HVFRQJHODFLyQSRU tiempo) Soften (Ablandar) Use esta función para encender/ apagar el modo Auto &RQYHUVLRQ&RQYHUVLyQ$XWRPiWLFD&XDQGRODIXQFLyQ $XWR&RQYHUVLRQ&RQYHUVLyQ$XWRPiWLFDHVWpDFWLYDGDGH IRUPDDXWRPiWLFDFRQYHUWLUiODVWHPSHUDWXUDVLQJUHVDGDVGH horneado regular a temperaturas de cocción de horneado por convección, cuando use la función hornear por convección. Esto ajusta la temperatura de ambos hornos. Auto Shut-Off (Apagado Automático) Use esta función para activar/ desactivar la función Auto 6KXW2II$SDJDGR$XWRPiWLFR$FWLYDUODIXQFLyQ$XWR6KXW 2II$SDJDGR$XWRPiWLFRDSDJDUiHOKRUQRLQIHULRUOXHJRGH 12 horas de funcionamiento continuo. Esta configuración de IiEULFDSDUDODIXQFLyQ$XWR6KXW2II$SDJDGR$XWRPiWLFR HVWiDFWLYDGD&XDQGRHVWpHQHOPRGR6DEEDWK6DEiWLFROD IXQFLyQ$XWR6KXW2II$SDJDGR$XWRPiWLFRVHUiGHVDFWLYDGD Beeper Volume (Volumen del Pitido) Use esta función para configurar el volumen del pitido en Mute (Mudo) o Normal (Normal). NOTA: Algunos tonos no se pueden enmudecer. Temperature Units (Unidades de Temperatura) Use esta función para configurar la unidad de temperatura en pantalla a ºF (Fahrenheit) o ºC (Celsius). Thermostat Adjust (Ajustar el Termostato) Esta función permite que la temperatura de horneado del horno y de horneado por convección sean ajustadas hasta )PiVFDOLHQWHR)PiVIUtDHQHOKRUQRLQIHULRU(O horno superior no puede ser ajustado. Use esta función si piensa que la temperatura de su horno es demasiado caliente o demasiado fría y desea modificarla. Este ajuste afecta los PRGRV%DNH+RUQHDU\&RQYHFWLRQ%DNH+RUQHDUSRU Convección). Ningún otro modo de cocción se ve afectado. Oven Information (Información del Horno) Esta función muestra el modelo y número de serie del horno. 6SHHG&RRN &RFFLyQ5iSLGD 12 49-80741-2 Opciones del Horno Superior Repeat Last (Repetir el Último Paso) Esta función sólo puede ser usada con los modos de cocción del horno superior. Use esta función de ahorro de tiempo para aquellas cocciones que se repiten, tales como galletas o DSHULWLYRV$OVHOHFFLRQDUHVWDIXQFLyQVHPRVWUDUiOD~OWLPD comida preconfigurada. Seleccione la tecla Start/Pause (Iniciar/ Pausar) o el dial de selección para iniciar la cocción. NOTA: El ultimo programa usado queda guardado durante dos horas. No todas las funciones pueden ser repetidas. Proof (Leudar) 8VHHVWDIXQFLyQSDUDOHXGDUSDQ3DUDPiVGHWDOOHVFRQVXOWH ODVVHFFLRQHVSDUD&DOHQWDUHO+RUQR6XSHULRU\/HXGDGR Broil (Asar) Use esta función para asar. Recuerde usar la bandeja de PHWDO\HOHVWDQWHGHPHWDO3DUDPiVGHWDOOHVFRQVXOWH8SSHU 2YHQ%DNLQJ+RUQHDUHQHO+RUQR6XSHULRU%URLOLQJ$VDU\ Toasting (Tostar). Warm (Calentar) 8VHHVWDIXQFLyQSDUDFDOHQWDU6HOHFFLRQH0RLVW+~PHGRR &ULVS&URFDQWH3DUDPiVGHWDOOHVFRQVXOWHODVVHFFLRQHV SDUD&DOHQWDUHO+RUQR6XSHULRU\/HXGDGR Toast (Tostar) Use esta función para tostar. Recuerde usar la bandeja de PHWDO\HOHVWDQWHGHPHWDO3DUDPiVGHWDOOHVFRQVXOWH8SSHU 2YHQ%DNLQJ+RUQHDUHQHO+RUQR6XSHULRU%URLOLQJ$VDU\ Toasting (Tostar). Opciones del Horno Inferior Delay Start (Iniciar con Retraso) 8VHHVWDIXQFLyQSDUDUHWUDVDUHOLQLFLRGHODVIXQFLRQHV%DNH +RUQHDU&RQY%DNH+RUQHDUSRU&RQYHFFLyQ3UREH 6RQGDR6HOI&OHDQ/LPSLH]D$XWRPiWLFD3DUDXVDUHVWD IXQFLyQVHOHFFLRQH'HOD\6WDUW,QLFLDUFRQ5HWUDVR\FRQILJXUH la hora de inicio, y luego seleccione el modo de cocción. 7DPELpQSXHGHXVDUODIXQFLyQ'HOD\6WDUW,QLFLDUFRQ5HWUDVR PLHQWUDVSURJUDPDXQDIXQFLyQGHFRFFLyQFRQ%DNH+RUQHDU &RQY%DNH+RUQHDUSRU&RQYHFFLyQR3UREH6RQGD Probe (Sonda) Use esta función para cocinar regulando la temperatura interna de la comida. Para muchas comidas, especialmente comidas tostadas y ave, la temperatura interna de la comida es la mejor SUXHEDGHTXHHVWiKHFKD(VWDIXQFLyQHVWiGLVSRQLEOHSDUD el horno inferior únicamente. Para usar esta función, inserte la sonda en la comida. Seleccione Probe (Sonda), luego ingrese la temperatura interna de la comida que desee y programe los PRGRVGHFRFFLyQ%DNH+RUQHDUR&RQY%DNH+RUQHDUSRU Convección) como lo hace normalmente. También se puede acceder a esta función conectando la sonda de temperatura en el horno al mismo tiempo. Proof (Leudar) 8VHHVWDIXQFLyQSDUDOHXGDUPDVD3DUDPiVGHWDOOHV FRQVXOWHORV0RGRVGH&RFFLyQHQHO+RUQR,QIHULRU Sabbath (Modo Sabático) 8VHHVWDIXQFLyQSDUDLQJUHVDUHOPRGR6DEEDWK6DEiWLFR (VWHPRGRFRQILJXUDHOKRUQRSDUDHO)HVWHMR6DEiWLFR-XGtR\ Feriados. Esta función cumple con los requisitos de la Estrella .GHO)HVWHMR6DEiWLFR-XGtR(OPRGRVDEiWLFRGHVDFWLYDODV OXFHVGHOKRUQRODOX]GHOKRUQRQRVHHQFHQGHUiFXDQGROD SXHUWDVHDDELHUWDWRGRVORVVRQLGRVHOFRQWUROQRHPLWLUi QLQJ~QSLWLGRFXDQGRXQERWyQVHDSUHVLRQDGRSHURHPLWLUi un pitido si ciertas fallas del horno se producen), y todas las IXQFLRQHVGHOKRUQRVXSHULRUHLQIHULRUH[FHSWR%DNH+RQHDU HQHOKRUQRLQIHULRU'XUDQWHHOPRGR6DEEDWK6DEiWLFRVyOR 49-80741-2 %DNH+RUQHDUHQHOKRUQRLQIHULRUHVWiGLVSRQLEOH'XUDQWH este modo, luego de configurar/ modificar una temperatura de horneado, un retraso al azar de aproximadamente entre VHJXQGRV\PLQXWRVHSURGXFLUiDQWHVGHTXHHOKRUQR comience a hornear. Para detener la cocción, presione la tecla Back (Retroceder) y luego la tecla Start/Pause (Iniciar/ Pausar)(OKRUQRVHDSDJDUiOXHJRGHXQUHWUDVRDOD]DU de aproximadamente entre 30 segundos y 1 minuto. Para VDOLULQPHGLDWDPHQWHGH%DNH+RUQHDUHQHOKRUQRLQIHULRU presione la tecla Clear/Off (Borrar/ Apagar) en cualquier PRPHQWRORVHOHPHQWRVGHFRFFLyQVHDSDJDUiQGHIRUPD LQPHGLDWD\6DEEDWK%DNH+RUQHDUHQHO0RGR6DEiWLFR FDPELDUiD6DEEDWK6DEiWLFRHQODSDQWDOODLQGLFDQGRTXH HOKRUQRIXHDSDJDGR3DUDVDOLUGHOPRGR6DEEDWK6DEiWLFR mantenga presionada la tecla Back (Retroceder) durante 3 segundos. No presione ningún otro botón hasta que se KD\DVDOLGRGHOPRGR6DEEDWK6DEiWLFRRHOPRGR6DEEDWK 6DEiWLFRVHYROYHUiDLQLFLDU\QRVHVDOGUiGHOPLVPR3DUD PiVGHWDOOHVFRQVXOWHODVHFFLyQGH0RGR6DEiWLFRHQHO +RUQR,QIHULRU NOTA: Si se produce un corte de corriente durante el modo 6DEiWLFRODXQLGDGSHUPDQHFHUiHQHOPRGR6DEiWLFRSHUR apagada cuando vuelva la corriente. USO DEL HORNO: Opciones del Horno Opciones del Horno Self Clean (Limpieza Automática) 8VHHVWDIXQFLyQSDUDLQJUHVDUHOPRGR6HOI&OHDQ/LPSLH]D $XWRPiWLFD3DUDPiVGHWDOOHVFRQVXOWHODVHFFLyQGH /LPSLH]DGHO+RUQR Steam Clean (Limpieza al Vapor) 8VHHVWDIXQFLyQSDUDLQJUHVDUHOPRGR6HOI&OHDQ/LPSLH]D $XWRPiWLFD3DUDPiVGHWDOOHVFRQVXOWHODVHFFLyQGH /LPSLH]DGHO+RUQR Warm (Calentar) 8VHHVWDIXQFLyQSDUDFDOHQWDU3DUDPiVGHWDOOHVFRQVXOWHORV 0RGRVGH&RFFLyQHQHO+RUQR,QIHULRU 13 Horno Superior: Cocción Rápida Cocción Rápida Cómo Utilizar las Funciones de Cocción Rápida PRECAUCIÓN: cuando utilice los programas de cocción rápida, recuerde que el horno, compuerta y los platos se ¡encontrarán muy calientes! SELECCIONES DE PRE-SET FOOD SELECTIONS (SELECCIONES DE ALIMENTOS PREPROGRAMADOS) DE COCCIÓN RÁPIDA: Antes de empezar, asegúrese que se encuentre colocada la base giratoria. Si es necesario, utilice la bandeja de metal DQWLDGKHUHQWH\VXVSURSLRVUHFLSLHQWHVGHFRFLQDGHFHUiPLFD o vidrio. La base giratoria siempre debe estar colocada en su lugar cuando se utiliza el horno. Ŷ$SSHWL]HUV (Aperitivos) Ŷ%UHDGV (Panes) Ŷ%UHDNIDVW (Desayuno) Ŷ'HVVHUWV (Postres) Coloque la comida directamente en la bandeja antiadherente de metal para realizar la cocción rápida. Ŷ(QWUHHV (Entrantes) Ŷ0HDWV (Carnes) Ŷ3L]]D Ŷ3RWDWRHV (Papas) Ŷ3RXOWU\$YHV Ŷ6DQGZLFK (Emparedado) Ŷ6HDIRRG (Pescados y mariscos) Ŷ6LGH'LVK (Guarniciones) Cómo Utilizar el Menú de Cocción Rápida Preestablecido (OKRUQRVXSHULRU\DHVWiSUHFRQILJXUDGRFRFLQDUPiVGHSODWRVSRSXODUHV 1. Apriete el botón Speedcook (Cocción rápida). Si no se realiza una selección dentro del plazo de 15 VHJXQGRVODSDQWDOODUHJUHVDUiDODKRUDGHOGtD *LUHHOGLDOSDUDVHOHFFLRQDUODFDWHJRUtDGHFRPLGDTXH desee. Presione el dial de selección para ingresar. *LUHHOGLDOGHVHOHFFLyQSDUDVHOHFFLRQDUODFRPLGD específica (selección de menú). Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUODFDQWLGDGWDPDxR\R ILQDOL]DFLyQVLHVQHFHVDULRHOKRUQRGDUiXQDYLVR Presione el dial luego de cada selección. 5. Una vez que la pantalla muestre Edit (Editar) o Start (Iniciar), presione iniciar o el dial de selección para iniciar la cocción. *LUHORVDOLPHQWRVFXDQGRHOKRUQROHLQGLTXH7XUQ)RRG2YHU 'p9XHOWD$/RV$OLPHQWRVSDUDFLHUWRVDOLPHQWRV &XDQGRHOKRUQRLQGLFD&KHFNIRU'RQHQHVV5HYLVDU1LYHO'H Cocción), revise para ver si sus alimentos se encuentran listos del modo que prefiere (para ciertos alimentos). Para revisar la configuración durante la cocción, presione el dial de selección. Si ingresa una selección incorrecta en cualquier momento, simplemente apriete el botón Back (Regresar) y reingrese las selecciones deseadas. Cosas Que Son Normales Ŷ Ŷ Ŷ Ŷ Ŷ $OLQLFLDUVHXQSURJUDPDGHFRFFLyQUiSLGDODSDQWDOOD PRVWUDUi2SWLPL]LQJ&RRN7LPH2SWLPL]DQGR7LHPSR'H &RFFLyQ(OKRUQRGHWHFWDDXWRPiWLFDPHQWHHOQLYHOGH voltaje eléctrico en su hogar y aumenta y disminuye el tiempo de cocción para la cocción adecuada. 6LVHDEUHODFRPSXHUWDGXUDQWHODFRFFLyQHOKRUQRVH GHWHQGUiDXWRPiWLFDPHQWH\VHPRVWUDUi3DXVH3DXVD en la pantalla. Cierre la compuerta y apriete el botón Start/ Pause (Iniciar/Pausar) para continuar cocinando. (QFXDOTXLHUPRPHQWRGXUDQWHODFRFFLyQSRGUiJLUDU el dial de selección para cambiar el tiempo de cocción. Puede cambiar los niveles de potencia, presionando el dial de selección para editar la configuración. 3DUDDVHJXUDUUHVXOWDGRVGHFRFFLyQFRQVWDQWHVHOKRUQR puede ajustar los niveles de potencia a menor nivel si el horno se encuentra caliente al inicio de un programa. 3DUDFRFLQDUGXUDQWHXQWLHPSRDGLFLRQDOGHVSXpVGHTXH se ha completado el ciclo de cocción, utilice la función Resume (continuar). Ŷ (OYHQWLODGRUHVWDUiHQFHQGLGRGXUDQWHODFRFFLyQ$O ILQDOGHODFRFFLyQHOYHQWLODGRUDXWRPiWLFRSXHGH continuar funcionando por un período corto de 14 Ŷ Ŷ Ŷ Ŷ WLHPSR\VHLQGLFDUiHQODSDQWDOODHOPHQVDMH2YHQ LV&RROLQJ+RUQRHQIULiQGRVH(OYHQWLODGRUVH DSDJDUiDXWRPiWLFDPHQWHFXDQGRVHKD\DQHQIULDGR las piezas internas del horno. /DUHMLOODGHYHQWLODFLyQGHOKRUQRHPLWLUiDLUHFDOLHQWH mientras el horno se encuentra encendido. /DVOXFHVKDOyJHQDVVHRSDFDUiQ\FLFODUiQ HQFHQGLpQGRVH\DSDJiQGRVHGXUDQWHXQFLFORGH FRFFLyQUiSLGDDOJXQDVYHFHVLQFOXVRDQLYHOHVGH SRWHQFLDPiVDOWRV(VWRHVQRUPDO(OKRUQRSHUFLEH HOQLYHOGHFDORU\VHDMXVWDDXWRPiWLFDPHQWH 1RVHQHFHVLWDWLHPSRGHSUHFDOHQWDPLHQWRGXUDQWH ORVFLFORVGH&RFFLyQUiSLGD(OKRUQRFRPLHQ]DD cocinar inmediatamente. /RVFKDVTXLGRV\HOVRQLGRGHYHQWLODGRU funcionando son sonidos normales durante la cocción. El tablero de relé y sus componentes se apagan y se encienden. 49-80741-2 Selecciones De Menú De Cocción Rápida Preprogramados Categoría de alimentos Selección de menú Categoría de alimentos Selección de menú Aperitivos $OEyQGLJDV0HDW%DOOV (Congeladas) Anillos de cebolla %HVRVGHMDODSHxR -DODSHxR3RSSHUV %ROORV%DJHO%LWHV Nachos Nueces tostadas 3DOLWRVGHTXHVR&KHHVH6WLFNV Pretzels suaves (Congelados) Rollitos de huevo (Egg Rolls) (Congelados) Rollitos de pizza 6DOVDFDOLHQWH+RW'LS7D]DV %LVWHFGHOFXDUWRWUDVHUR de res (Sirloin) %LVWHFWLSRULEH\H %LVWHFWLSR6WULS %LVWHFWLSR7%RQH Carne asada Chuletas de cordero Chuletas de puerco Filet Mignon +DPEXUJXHVD /RPR Puerco asado Alitas de pollo (congeladas) Filete de pollo (congelado) Nugget de pollo (congelado) Pastelito de pollo (congelado) Pavo Pollo, con hueso Pollo entero Pollo frito (congelado) Pollo, sin hueso Tira de pollo (congelada) Tiritas de pollo (congeladas) %LVFRFKRGHVDOFKLFKD 6DXVDJH%LVFXLW %RFDGLWRV7XUQRYHUV %ROORV%DJHOV&RQJHODGRV Chorizo *XLVDGRKXHYR[ Panqueques (Congelados) Pan tostado a la francesa Pastel de café Pastel de hoja relleno (congelado) Pastelitos de patata +DVKEURZQ3DWWLHV Pizza de desayuno Rollitos (refrigerados) Rollitos dulces/Pan danés :DIIOHVFRQJHODGRV :DIOHVEHOJDV &RUQ'RJFRQJHODGR Emparedado asado a la parrilla (PSDUHGDGRGHEROVLOORSRFNHW +RW'RJFRQUROOLWRGHPHGLDOXQD (Crescent) +RW'RJHQEROOR Taquitos (congelados) Guarniciones Ajo asado Champiñones rellenos Chiles asados (6) (VSiUUDJRVDVDGRV Frijoles refritos (16 oz) Maíz asado Pimiento asado Relleno (mezcla) Tomates rellenos Verduras mixtas asadas %ROORV%DJHOV&RQJHODGRV %ROORVGHFHQD'LQQHU5ROOV 3DOLWRVGHSDQ%UHDG6WLFNV Pan de ajo 3DQGHTXHVR&KHHVH%UHDG 3DQUiSLGR[ 3DQHFLOORV%LVFXLWV Rollitos de media luna (Crescent Rolls) Rollitos dulces/Pan danés Tacos (en caja) Tostada tejana (Texas Toast) Camote/—ame Nugget congelado Papa al horno Papas fritas congeladas Pastelitos de patata +DVKEURZQ3DWWLHV Colas de langosta Congeladas empanizadas Filetes de atún Filetes de bacalao Filete de pez espada Filete Orange Roughy /XELQD Mariscos Pescado blanco Salmón Tilapia Tiritas de pescado (congeladas) 'HOL)UHVFD Pizza congelada Utilizar masa precocida %XUULWRVFRQJHODGRV Chiles rellenos (6) Chimichanga Enchilada (fresca) *XLVDGR /DVDxD 3DVWHOGHFDUQH0HDWORDI[ Quesadillas (frescas) Rollitos de huevo (congelados) %RFDGLWRV7XUQRYHUV %URZQLHV *DOOHWDV 3DVWHOIUHVFR[ Pastel de café 3DVWHOHVPH]FOD[ Rollitos (refrigerados) Tarta (fruta fresca) Carnes Carne de ave Desayuno Emparedado 49-80741-2 Panes Papas Pescado y mariscos Pizza Platos fuertes Postres Horno Superior: Cocción Rápida Cocción Rápida (Continúa) 15 Horno Superior: Cocción Rápida Cocción Rápida (Continúa) Consejos de Cocción Para Obtener Resultados de Sabor Fantásticos Para asegurar la consistencia e incluso el dorado al cocinar comidas directamente en la bandeja de metal, coloque la comida como se muestra a continuación. Los alimentos pueden estar juntos pero no se deben montar unos sobre otros. Patrón de lado a lado (Ejemplo: carnes y aves) Patrón radial (Ejemplo: rollitos de media luna [crescent]) Capa sencilla (Ejemplo: aperitivos) Patrón circular (Ejemplo: biscochos, galletas) Se deben descongelar antes de cocinar la carne fresca, pollo, pescado o mariscos que han sido congelados (se puede utilizar la función de descongelación de microondas). Para otros alimentos preempacados congelados, siga las instrucciones de la caja. Ŷ Ŷ &XDQGRFRFLQHWRFLQRFRORTXHODVWLUDVHQXQSODWR&XEUD cada capa con una toalla de papel. &XDQGRFRFLQHYHUGXUDVXWLOLFHXQDFDFHURODRWD]yQ adecuados para microondas. Cúbralas con una tapa DGHFXDGDSDUDPLFURRQGDVRHQYROWXUDGHSOiVWLFRYHQWLODGD Ŷ Ŷ 3DUDYHUGXUDVFRQJHODGRVVLJDODVLQVWUXFFLRQHVGHOD caja para añadir agua. 3DUDYHUGXUDVIUHVFDVDxDGDFXFKDUDGDVGHDJXDSDUD cada porción. Recipientes Para Cocción Rápida Ŷ 6LJDODVVXJHUHQFLDVLQGLFDGDVHQODSDQWDOODGHO KRUQRRHQHO/LEURGHFRFLQDR*XtDGHFRFLQD Ŷ /RVUHFLSLHQWHVGHFRFLQDVHWRUQDUiQPX\FDOLHQWHV debido a la transferencia de calor proveniente de los DOLPHQWRVFDOHQWDGRV6HUHTXHULUiQJXDQWHVGHFRFLQD protectores para manipular los recipientes de cocina. Ŷ &RORTXHORVDOLPHQWRVGLUHFWDPHQWHHQODEDQGHMD de metal antiadherente cuando cocine, a menos que el horno le indique realizar otra cosa. Ŷ 8WLOLFHODEDQGHMDGHPHWDODQWLDGKHUHQWHGHOD misma manera que utilizaría una charola o bandeja de hornear plana. Ŷ $GHPiVGHORVUHFLSLHQWHVIDFLOLWDGRVSXHGHXWLOL]DU SODWRVQRPHWiOLFRVSDUDJXLVDGRVSODWRVSDUDWDUWDV y otros recipientes resistentes y seguros contra el calor. Colóquelos directamente en la base giratoria. Ŷ $VHJ~UHVHGHVHOHFFLRQDUXQWDPDxRTXHURWH IiFLOPHQWH Ŷ &RORTXHODEDQGHMDGHPHWDODQWLDGKHUHQWHHQOD base giratoria. Coloque los recipientes de vidrio o FHUiPLFDHQODEDQGHMD Ŷ 1RXWLOLFHORVUHFLSLHQWHVGHFRFLQDRFXELHUWDV WDSDVKHFKDVGHSDSHOSOiVWLFRROiPLQDVGH aluminio cuando cocine utilizando un ciclo de FRFFLyQUiSLGD Nivel de Potencia de la Función de Cocción Rápida El horno superior usa la potencia de una luz halógena de DOWDLQWHQVLGDGFDOHQWDGRUHVGHFHUiPLFD\PLFURRQGDVSDUD cocinar la comida sobre su parte superior, inferior e interna de IRUPDVLPXOWiQHD\VHOODUODKXPHGDG\HOVDERU &XDQGRXWLOL]DODVUHFHWDVGHFRFFLyQUiSLGDSUHSURJUDPDGDV en el menú de alimentos, los niveles de potencia ya han sido seleccionados para usted. Sin embargo, estos niveles de potencia pueden ser ajustados antes o durante la cocción, usando el dial para seleccionar y editar la configuración del PRGRGHFRFFLyQ/DIXQFLyQ0\5HFLSHV0LV5HFHWDV OHSHUPLWHFRFLQDUGHIRUPDUiSLGDFRPLGDVTXHQRHVWpQ en el menú preconfigurado, seleccionando sus propias configuraciones de tiempo de cocción y niveles de potencia. Cada nivel de potencia le brinda potencia de calentamiento y energía de microondas durante cierto porcentaje de tiempo. 16 (O&DOHQWDGRU6XSHULRU8+FRQWURODWDQWRODOX]KDOyJHQD VXSHULRUFRPRHOFDOHQWDGRUGHFHUiPLFDVXSHULRU8QD FRQILJXUDFLyQPiVDOWDGHOFDOHQWDGRUVXSHULRUXWLOL]DUiPiV SRWHQFLDGHOFDOHQWDGRUVXSHULRUGRUDQGRODFRPLGDPiV UiSLGRHQVXSDUWHVXSHULRU 6HOHFFLRQHXQDMXVWHPiVDOWRSDUDDOLPHQWRVWDOHVFRPRSL]]D \DOLPHQWRVKRUQHDGRV6HOHFFLRQHXQDMXVWHPiVEDMRSDUD alimentos tales como guisados, carne de res y pescado. &DOHQWDGRU,QIHULRU/+FRQWURODHOFDOHQWDGRULQIHULRU 6HOHFFLRQHXQDMXVWHPiVDOWRSDUDGRUDUDOLPHQWRVPiVHQHO ODGRLQIHULRU6HOHFFLRQHXQDMXVWHPiVEDMRSDUDGRUDUPHQRVOD parte inferior. 49-80741-2 Nivel de Potencia de la Función de Cocción Rápida (Continúa) Microwave (Cocción con Microondas, M) controla la potencia GHOPLFURRQGDV8QDFRQILJXUDFLyQPiVDOWDXWLOL]DUiPiV potencia de microondas, acortando el tiempo de cocción de comidas densas o pesadas. 1. Presione la tecla Speedcook (Cocción Rápida) y gire el dial para seleccionar Food Menu (Menú de Comidas), )DYRULWH5HFLSH5HFHWD)DYRULWDR&XVWRP6SHHGFRRN &RFFLyQ5iSLGD(VWiQGDUSDUDFRQILJXUDUGHIRUPD manual el nivel de corriente y el temporizador. Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUXQDFRPLGDXQWLHPSRRXQ nivel de potencia, según se indique. Presione el dial de selección para ingresar. 3. Para cambiar el nivel de potencia cuando se indique en la pantalla, gire el dial de selección a favor de las agujas del reloj para incrementar o en contra de las agujas del reloj para reducir el nivel de potencia superior. Presione el dial de selección para ingresar. /RVQLYHOHVPiVDOWRVGHPLFURRQGDVHVWiQFRQILJXUDGRVGH IRUPDDXWRPiWLFDHQEDVHDODVFRQILJXUDFLRQHVVXSHULRUH LQIHULRUGHODOiPSDUD 5. Presione la tecla Start/Pause (Iniciar/ Pausar) o el dial de selección para iniciar la cocción. Si no desea cambiar una de las configuraciones, sólo presione el dial de selección para pasar a la siguiente selección. NOTA: Tenga cuidado al ajustar los niveles de potencia de modo que no cocine demasiado o muy poco los alimentos. Ŷ &XDQGRFRFLQDSRUXQSHUtRGRSURORQJDGRGH tiempo, el horno puede reducir los niveles de SRWHQFLDDXWRPiWLFDPHQWHSDUDPDQWHQHUHOQLYHO apropiado de calor. 6LJDHVWDVSDXWDVJHQHUDOHVDOVHOHFFLRQDUODVPHMRUHVFRQILJXUDFLRQHVGH8+/+\0SDUDVXUHFHWDIDYRULWD UH 6 HOHFFLRQHXQDMXVWHPiVDOWRSDUDDOLPHQWRVGHOJDGRV que requieren de una cubierta dorada (por ejemplo: filetes de pescado, pan tostado, pechuga de pollo GHVKXHVDGD6HOHFFLRQHXQDMXVWHPiVEDMRSDUD DOLPHQWRVRFRPLGDVPiVJUXHVDVFRQXQFRQWHQLGR GHJUDVDRD]~FDUPiVDOWRSRUHMHPSORSDVWHOHV asados). M = Seleccione un ajuste superior para acortar el tiempo de cocción para comidas densas o pesadas (por ejemplo: cazuelas, pollo entero). Seleccione un ajuste inferior para comidas delicadas (por ejemplo: panes) o comidas que requieran mayor tiempo de cocción para que queden PiVWLHUQDVSRUHMHPSORHVWRIDGRVFDUQHSDUDDVDU LH 6 HOHFFLRQHXQDMXVWHPiVDOWRSDUDORVDOLPHQWRV JUXHVRVRGHQVRVTXHTXL]iVQRVHFRFLQHQ UiSLGDPHQWHHQHOFHQWURSRUHMHPSORJXLVDGRV 6HOHFFLRQHXQDMXVWHPiVEDMRSDUDDOLPHQWRVGHOJDGRV (por ejemplo: galletas) y comidas con contenido de grasa o azúcar alto (por ejemplo: bollos, pasteles). Horno Superior: Cocción Rápida Cocción Rápida (Continúa) My Recipes (Mis Recetas) El horno superior le brinda la flexibilidad para cocinar sus platos favoritos. 6LGHVHDFRFLQDUXQDFRPLGDTXHQRHVWiHQWUHODVVHOHFFLRQHV preconfiguradas, use la función My Recipes (Mis Recetas). 1. Presione la tecla Speedcook (Cocción Rápida). Si no se realiza una selección dentro del plazo de 15 VHJXQGRVODSDQWDOODUHJUHVDUiDODKRUDGHOGtD *LUHHOGLDOSDUDVHOHFFLRQDU0\5HFLSHV0LV5HFHWDV Presione el dial de selección para ingresar. 3. Presione el dial para seleccionar una receta nueva. *LUHSDUDVHOHFFLRQDUHOWLHPSRGHFRFFLyQ /DSDQWDOODOHSHGLUiTXHVHOHFFLRQHHOQLYHOGHSRWHQFLD *LUHHOGLDOHQGLUHFFLyQGHODVDJXMDVGHOUHORMSDUD incrementar y en contra de las agujas del reloj para reducir el nivel de energía del calentador. Presione el dial de selección para ingresar. *LUHHOGLDOSDUDFDPELDUHOQLYHOGHSRWHQFLDGHO calentador inferior. Presione el dial de selección para ingresar. *LUHHOGLDOGHVHOHFFLyQSDUDFDPELDUHOQLYHOGHSRWHQFLD del microondas; presione el mismo para ingresar. 8. Presione la tecla Start/Pause (Iniciar/ Pausar) o el dial de selección para iniciar la cocción. Seleccionar Edit (Editar) para editar las selecciones. 49-80741-2 Para obtener sugerencias sobre el nivel y tiempo de cocción, utilice su guía o libro de cocina. 3XHGHVHOHFFLRQDU6DYH*XDUGDUSDUDJXDUGDUODUHFHWDTXH DFDEDGHSURJUDPDUSDUDXQXVRSRVWHULRU$SDUHFHUi6SHOO 7KH)RRG1DPH'HOHWUHDU(O1RPEUH'H/D&RPLGD*LUH el dial de selección a la primera letra de su descripción de comidas y presione el mismo para ingresar. Continúe este proceso para deletrear el resto del nombre de la comida. Apriete el botón Start/Pause (Iniciar/Pausar) para almacenar la receta y su nombre. Para acceder a la receta guardada, SUHVLRQH6SHHGFRRN&RFFLyQ5iSLGD0\5HFLSHV0LV Recetas) y seleccione la receta que guardó. Para editar/ borrar recetas de cocción rápida estándar que haya guardado: 1. Presione la tecla Speedcook (Cocción Rápida). *LUHHOGLDOGHVHOHFFLyQD0\5HFLSHV0LV5HFHWDV Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUODUHFHWDHVWiQGDUJXDUGDGD Presione el dial de selección para ingresar. *LUHHOGLDOGHVHOHFFLyQSDUDHGLWDURERUUDUODUHFHWD HVWiQGDU3UHVLRQHHOGLDOGHVHOHFFLyQSDUDHGLWDUR borrar. 17 Horno Superior: Hornear, Asar y Dorar Hornear, Asar y Dorar Cómo Hornear, Asar y Tostar /DIXQFLyQGHKRUQHDUOHSHUPLWHFRFLQDUORVDOLPHQWRVGH la misma forma que un horno convencional, utilizando un elemento de calentamiento para incrementar la temperatura del aire dentro del horno. Se puede ajustar cualquier temperatura de horno de 250 a 450° F. /DIXQFLyQ%URLOLQJDVDUOHSHUPLWHDVDUDOLPHQWRVGHOD misma manera que un horno convencional. /DIXQFLyQ7RDVWLQJWRVWDUOHSHUPLWHWRVWDUDOLPHQWRVGHOD misma manera que un horno convencional. Un ventilador circula aire caliente suavemente dentro del KRUQRVREUH\DOUHGHGRUGHORVDOLPHQWRV'HELGRDTXHHODLUH caliente se mantiene en constante movimiento, no permitiendo TXHVHGHVDUUROOHXQDFDSDGHDLUHPiVIUtRDOUHGHGRUGHORV DOLPHQWRVDOJXQRVDOLPHQWRVVHFRFLQDUiQOHYHPHQWHPiV UiSLGRTXHODFRFFLyQUHDOL]DGDHQKRUQRUHJXODU La base giratoria siempre debe estar colocada en su lugar cuando se utiliza el horno. Coloque la comida en un utensilio de uso seguro en el microondas, directamente sobre la bandeja de metal para hornear. Antes de empezar, asegúrese de que se encuentra colocada la base giratoria. Use la bandeja de metal cada vez que hornee. PRECAUCIÓN: ¡Cuando hornee, recuerde que el horno, compuerta y los platos estarán muy calientes! Cómo Hornear 1. Presione la tecla Convection Bake (Hornear por Convección). *LUHHOGLDOGHVHOHFFLyQSDUDFRQILJXUDUODWHPSHUDWXUDGHO horno y presione el mismo para ingresar. 3. Seleccione Start (Iniciar) o Cook Time. Preheat (Precalentamiento con Tiempo de Cocción) luego de seleccionar iniciar: El horno empieza a funcionar inmediatamente. No coloque alimentos en el horno. & XDQGRHOKRUQRWHUPLQHHOSUHFDOHQWDPLHQWRHPLWLUiXQD señal. Si no abre la puerta en el plazo de una hora, el horno VHDSDJDUiDXWRPiWLFDPHQWH$EUDODFRPSXHUWDGHOKRUQR y, con cuidado, coloque los alimentos dentro del horno. 3. Cierre la compuerta del horno. Presione el dial para configurar dos veces, a fin de configurar el tiempo de cocción y presione Start/Pause (Iniciar/ Pausar) para iniciar la cocción. Cuando se ha completado la cocción, el KRUQRLQGLFDUiXQDVHxDO\VHDSDJDUi 3RGUiFDPELDUODWHPSHUDWXUDGHOKRUQRGXUDQWHHO precalentamiento, y presionando y girando el dial para seleccionar la nueva temperatura. Si la compuerta del horno se encuentra abierta durante la cocción, DSDUHFHUi3DXVH3DXVDHQODSDQWDOOD&LHUUHODFRPSXHUWD\ apriete Start/Pause (Iniciar/Pausar). Para alcanzar resultados óptimos en altas temperaturas, limite las aperturas de la puerta. /RVWLHPSRVGHFRFFLyQVHPXHVWUDQHQPLQXWRV\SXHGHQVHU GHPLQXWRVFRPRPi[LPR(OWLHPSRSRGUiVHUPRGLILFDGR durante la cocción girando el dial de selección. Precaliente luego de seleccionar el tiempo de cocción: / XHJRGHVHOHFFLRQDUXQWLHPSRGHFRFFLyQHOKRUQROH LQGLFDUiTXHGHEHLQLFLDUODFRFFLyQSRUWLHPSRRLQLFLDUHO precalentamiento. 2. Presione iniciar el tiempo de cocción para saltear el precalentamiento, o presione iniciar el precalentamiento si desea precalentar. 3. Cuando el horno termine el SUHFDOHQWDPLHQWRHPLWLUiXQD señal. Si no abre la puerta en el plazo de una hora, el horno VHDSDJDUiDXWRPiWLFDPHQWH Abra la compuerta del horno Para hornear a dos niveles, y, con cuidado, coloque los coloque los alimentos en un plato de hornear metálico o alimentos dentro del horno. directamente en la bandeja 4. Cierre la compuerta del horno. metálica antiadherente. Presione el dial de selección Coloque la lámina de hornear para editar una temperatura de aluminio o su plato de o tiempo de cocción si es hornear con alimentos sobre la parte superior de la parrilla necesario y/o presione Start/ de alambre. Coloque la Pause (Iniciar/ Pausar) para parrilla con alimentos en la iniciar la cocción. Una vez bandeja de metal. completada la cocción, el KRUQRHPLWLUiXQDVHxDO\VH DSDJDUi Cómo Asar o Tostar 1. Presione la tecla Cooking Options (Opciones de Cocción). *LUHHOGLDOGHVHOHFFLyQD%URLO$VDUR7RDVW7RVWDU\ presione el mismo para ingresar. 6LHOLJH%URLO$VDUSUHVLRQHHOGLDOGHVHOHFFLyQSDUD iniciar esta función. 4. Si elige Toast (Tostar), gire el dial para seleccionar el tiempo y presione el mismo para seleccionar la función. Vuelva a presionar el dial de selección para iniciar la función. 18 Si se abre la compuerta del horno durante la cocción, DSDUHFHUi3DXVH3DXVDHQOD pantalla. Cierre la compuerta y apriete Start/Pause (Iniciar/ Pausar). Coloque la comida directamente en la bandeja de horneado de aluminio sobre la parrilla de alambre, y coloque ambos sobre la bandeja de metal, cuando ase o tueste comidas. 49-80741-2 Calentamiento /DIXQFLyQ:DUP&DOLHQWHPDQWHQGUiFDOLHQWHVORVDOLPHQWRV cocinados a una temperatura de servir. Empiece siempre con comida caliente. Utilice recipientes de cocina y utensilios que puedan soportar temperaturas de hasta 230° F. 1. Presione la tecla Cooking Options (Opciones de Cocción). *LUHHOGLDOGHVHOHFFLyQD:DUP&DOHQWDU3UHVLRQHHO dial de selección para ingresar. *LUHHOVHOHFWRUGHOGLDOSDUDVHOHFFLRQDU0RLVW&ULVS +~PHGR&URFDQWH3UHVLRQHHOGLDOGHVHOHFFLyQSDUD ingresar. Si se abre la compuerta del horno durante el calentamiento, DSDUHFHUi3DXVH3DXVDHQODSDQWDOOD&LHUUHODFRPSXHUWD\ apriete Start/Pause (Iniciar/Pausar). Para hacer que los alimentos secos estén crujientes: Ŷ &RORTXHORVDOLPHQWRVRSODWLOORVGLUHFWDPHQWHHQOD EDQGHMDPHWiOLFDQHJUD Ŷ &RQWUROHTXHHVWpFURFDQWHGHIRUPDSHULyGLFD$JUHJXH tiempo según sea necesario. La base giratoria siempre debe estar colocada en su lugar cuando se utiliza el horno. Coloque la comida directamente en la bandeja antiadherente de metal para calentar. Tabla de selección de temperatura y humedad Tipo de alimento Ajuste de humedad &DUQHGHDYHV &DUQHV\SHVFDGR &RPLGDVIULWDV *XLVDGRV 3DQUROOLWRVGXURV 3DQUROOLWRVVXDYHV 3DQTXHTXHVZDIOHV 3DSDVKRUQHDGDV 3DSDVSXUp 3L]]D 7UR]RVGHWRUWLOOD 9HUGXUDV 02,67+Ò0('2 &5,63&58-,(17( &5,63&58-,(17( 02,67+Ò0('2 &5,63&58-,(17( 02,67+Ò0('2 &5,63&58-,(17( &5,63&58-,(17( 02,67+Ò0('2 &5,63&58-,(17( &5,63&58-,(17( 02,67+Ò0('2 Consejos para alimentos crujientes: Ŷ 'HMHORVDOLPHQWRVGHVFXELHUWRV Ŷ 1RXWLOLFHUHFLSLHQWHVGHSOiVWLFRRHQYROWXUDSOiVWLFD Consejos para alimentos húmedos: Ŷ &XEUDORVDOLPHQWRVFRQXQDWDSDROiPLQDSDSHOGH aluminio. Ŷ 1RXWLOLFHUHFLSLHQWHVGHSOiVWLFRRHQYROWXUDSOiVWLFD Horno Superior: Calentar y Leudar Calentar y Leudar * La USDA/FSIS recomienda una temperatura interna de 145° F como el nivel de cocción mínimo para carne de res. Utilice un termómetro portátil de carne para revisar las temperaturas internas. Activación (Proofing) /DIXQFLyQGHDFWLYDFLyQSURRILQJSURYHHDXWRPiWLFDPHQWHOD temperatura óptima para el proceso de activación, por lo que no tiene ajuste de temperatura. 1. Presione la tecla Cooking Options (Opciones de Cocción). *LUHHOGLDOSDUDVHOHFFLRQDU3URRI/HXGDU3UHVLRQHHO dial de selección para ingresar. El horno superior inicia el leudado de forma inmediata y muestra la cantidad de tiempo de leudado completada. Ŷ 3DUDRSWLPL]DUHOUHQGLPLHQWRHYLWHDSHUWXUDVGHSXHUWD innecesarias. Ŷ 5HYLVHORVSURGXFWRVGHSDQWHPSUDQRSDUDHYLWDUOD sobreactivación. NOTAS: Ŷ 1RXWLOLFHODPRGDOLGDGGHDFWLYDFLyQSDUDFDOHQWDU DOLPHQWRVRPDQWHQHUORVDOLPHQWRVFDOLHQWHV/D temperatura de activación del horno es lo suficientemente caliente como para mantener los alimentos a temperaturas VHJXUDV8WLOLFHODIXQFLyQ:DUP&DOHQWDUSDUDPDQWHQHU los alimentos calientes. Ŷ /DIXQFLyQGHDFWLYDFLyQQRIXQFLRQDUiVLHOKRUQRHVWi muy caliente. Permita que el horno se enfríe antes de usar la función de activación. La base giratoria siempre debe estar colocada en su lugar cuando se utiliza el horno. 49-80741-2 Coloque la masa de pan en un recipiente para panes y ubique la misma en una bandeja de metal para dejar leudar la misma. 19 Horno Superior: Cocción con Microondas Cocción con Microondas Cómo Utilizar las Funciones de Microondas Asegúrese de que la base giratoria y la bandeja de vidrio transparente se encuentran colocadas. Coloque los alimentos o recipiente para microondas directamente en la bandeja de vidrio transparente para cocinar sus alimentos. La base giratoria siempre debe estar colocada en su lugar cuando se utiliza el horno. La bandeja de cristal transparente siempre deberá estar en su lugar cuando se cocina con microondas. SELECCIONES MICROWAVE PRE-SET (PREPROGRAMACIONES DE MICROONDAS) Ŷ Bebidas – Agua (8-12 onzas) – Café (8-12 onzas) – Té (8-12 onzas) ±/HFKH (8-12 onzas) – Cacao Caliente (8-12 onzas) ŶPalomitas de Maíz – Sensor de palomitas de maíz Ŷ Derretir – Manteca – Caramelo – Queso – Trozos de Chocolate – Malvavisco ŶHervir Ŷ Cocinar – Por tipo de alimento – Por tiempo – Por tiempo 1 y 2 Ŷ Suavizar – Manteca – Queso Crema ±*ODVHDGR (16 onzas) ±+HODGR Ŷ Descongelar ±OE5iSLGR – Por tiempo – Por peso – Por tipo de alimento ±'HUUHWLU – Suavizar Ŷ Recalentar ±%HELGDV – Cazuela – Pollo – Pasta – Pizza – Plato de comida – Arroz – Sopa ±%LVWHFV&KXOHWDV – Verduras Cómo Utilizar las Selecciones de Microondas Preprogramadas 1. Presione la tecla Microwave (Cocinar con Microondas). Si no se realiza una selección dentro del plazo de 15 VHJXQGRVODSDQWDOODUHJUHVDUiDODKRUDGHOGtD *LUHHOGLDOGHVHOHFFLyQSDUDEXVFDUODFRPLGDREHELGD que desee cocinar, descongelar, ablandar, derretir, hervir o recalentar. Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUHOWLSRFDQWLGDGSHVR\R WDPDxR(OKRUQROHFRQVXOWDUiHQODPHGLGDTXHVHD necesario.) Presione el dial luego de cada selección. 4. Presione el dial de selección o la tecla Start/Pause (Iniciar/ Pausar) para iniciar la cocción. Para revisar o editar las configuraciones durante la cocción, presione el dial de selección. Si se abre la compuerta durante la cocción, el horno se GHWHQGUi\VHPRVWUDUi3DXVH3DXVDHQODSDQWDOOD&LHUUH la compuerta y apriete el botón Start/Pause (Iniciar/Pausar) para continuar cocinando. Si ingresa una selección no deseada en cualquier momento, simplemente apriete el botón Back (Regresar) y reingrese las selecciones deseadas. Ŷ &XDQGRHOKRUQRHVWiHQFHQGLGRVHSRGUiYHUODOX] alrededor de la compuerta o de la cubierta externa. Ŷ /DOX]GHOLQWHULRUGHOKRUQRVHHQFHQGHUiGXUDQWHXQFLFOR de cocción por microondas. Ŷ 3RGUtDHVFDSDUYDSRUGHOUHGHGRUGHODFRPSXHUWD Cook By Time (Cocinar Por Tiempo) y Cook By Time 1 & 2 (Cocinar Por Tiempo 1 y 2) 8WLOLFHODVIXQFLRQHVGH&RRN%\7LPH&RFLQDU3RU7LHPSR\ &RRN%\7LPHSDUDFRFLQDUSRUPLFURRQGDVORVDOLPHQWRV que no se encuentran en la sección de recetas y en el tiempo que programó. Ŷ (OQLYHOGHSRWHQFLDVHHQFXHQWUDDMXVWDGR DXWRPiWLFDPHQWHHQ+LJK$OWRSHURSXHGHFDPELDUOR para dar mayor flexibilidad. 1. Presione la tecla Microwave (Cocinar con Microondas). *LUHHOGLDOSDUDVHOHFFLRQDU&RRN%\7LPH&RFLQDUSRU 7LHPSRR&RRN%\7LPH&RFLQDUSRU7LHPSR\ y presione el dial de selección para ingresar. *LUHHOGLDOGHVHOHFFLyQSDUDFRQILJXUDUHOWLHPSRGH cocción y presione el mismo para ingresar. 20 4. Seleccione la configuración del nivel de potencia. 6LVHOHFFLRQy&RRN%\7LPH&RFLQDUSRU7LHPSR y 2), gire el dial de selección para configurar el segundo tiempo de cocción, la segunda configuración de nivel de potencia y presione el dial para ingresar. 5. Presione el dial de selección o la tecla Start/Pause (Iniciar/ Pausar) para iniciar la cocción. 'XUDQWHODVIXQFLRQHVGH&RRN%\7LPH&RFLQDU3RU7LHPSR R&RRN%\7LPH&RFLQDU3RU7LHPSRSXHGHDEULU la compuerta para revisar la comida. Cierre la compuerta y apriete el botón Start/Pause (Iniciar/Pausar) para continuar cocinando. 49-80741-2 Nivel(es) De Potencia Del Horno Microondas Ŷ 3XHGHPRGLILFDUHOQLYHOGHSRWHQFLDGXUDQWHODPD\RU parte del programa de cocción. 1. Presione el dial de selección para editar. *LUHHOGLDOGHVHOHFFLyQSDUDFDPELDUODKRUD\RSUHVLRQH el dial de selección para ingresar. *LUHHOGLDOGHVHOHFFLyQHQGLUHFFLyQGHODVDJXMDVGHO reloj para incrementar el nivel de potencia y en contra de las agujas del reloj para reducir el mismo. Presione el dial de selección para ingresar. Aquí se presentan algunos ejemplos de utilizaciones para varios niveles de potencia: High (Alto) 10: Pescado, tocino, verduras, líquidos hirvientes. Med (Medio) - High (Alto) 7: Cocción moderada de carne de res y pollo; hornear guisados y recalentamiento. Med (Medio) 5: Cocción lenta y ablandamiento para guisados y cortes de carne de res menos suaves. Low (Bajo) 2 o 3:'HVFRQJHODFLyQKHUYLUDIXHJROHQWRVDOVDV delicadas. Warm (Caliente) 1: Mantener comidas calientes; suavizar mantequilla. Descongelación Por Tipo De Alimento /DIXQFLyQ$XWR'HIURVW'HVFRQJHODFLyQDXWRPiWLFDDMXVWD los tiempos de descongelación y los niveles de potencia para ofrecer resultados de descongelación uniformes para carnes de res, pollo y pescado de hasta 6 libras de peso. 1. Saque los alimentos de la caja y colóquelos en un plato adecuado para microondas. 2. Presione la tecla Microwave (Cocinar con Microondas) \VHOHFFLRQH'HIURVW'HVFRQJHODU *LUHHOVHOHFWRUGHOGLDOD'HIURVW'HVFRQJHODU\D)RRG Type (Tipo de Comida). Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUHOWLSRGHFRPLGD3UHVLRQHHO dial de selección para ingresar. *LUHHOGLDOGHVHOHFFLyQDOSHVRGHODFRPLGDXVDQGROD *XtDGH&RQYHUVLyQTXHILJXUDDODGHUHFKD3RUHMHPSOR seleccione 1.2 para 1.2 libras (1 libra, 3 onzas). Presione el dial de selección para ingresar. 6. Presione el dial de selección o la tecla Start/Pause (Iniciar/ Pausar) para iniciar la descongelación. *LUHORVDOLPHQWRVFXDQGRHOKRUQROHLQGLTXH7XUQ)RRG 2YHU'DU9XHOWD$/RV$OLPHQWRV Ŷ Ŷ 6DTXHODFDUQHGHVFRQJHODGDRFXEUDODViUHDVFDOLHQWHV FRQSHGD]RVSHTXHxRVGHOiPLQDGHDOXPLQLRSDUDORJUDU una descongelación uniforme. 'HVSXpVGHGHVFRQJHODUODPD\RUtDGHODVFDUQHV necesitan dejarse en reposo durante 5 minutos para completar la descongelación. Asados de mayor tamaño deben permanecer en reposo por cerca de 30 minutos. Guía de conversión Si se indica el peso de los alimentos en libras y onzas, se deben convertir las onzas a décimos (.1) de libra. Ingresar el peso Peso del alimento del alimento en onzas (décimos de libra) 1–2 .1 3 .2 4–5 .3 6–7 .4 8 .5 9–10 .6 11 .7 12–13 .8 14–15 .9 Horno Superior: Cocción con Microondas Cocción con Microondas (Continúa) Descongelación Por Tiempo 8VH'HIURVW%\7LPH'HVFRQJHODUSRU7LHPSRSDUD descongelar durante un período de tiempo seleccionado. 1. Presione la tecla Microwave (Cocinar con Microondas) \VHOHFFLRQH'HIURVW'HVFRQJHODU *LUHHOGLDOGHVHOHFFLyQD'HIURVW%\7LPH'HVFRQJHODU por Tiempo). Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUHOWLHPSRTXHGHVHH Presione el dial de selección para ingresar. 4. Presione el dial de selección o la tecla Start/Pause (Iniciar/ Pausar) para iniciar la descongelación. *LUHORVDOLPHQWRVFXDQGRHOKRUQROHLQGLTXH7XUQ)RRG 2YHU'DU9XHOWD$/RV$OLPHQWRV 49-80741-2 (OQLYHOGHSRWHQFLDVHDMXVWDDXWRPiWLFDPHQWHDSHUR puede cambiarse. Para cambiar los niveles de potencia, consulte la sección Nivel de potencia del microondas. Puede descongelar alimentos pequeños aumentando el nivel de SRWHQFLDGHVSXpVGHLQJUHVDUHOWLHPSR(OQLYHOGHSRWHQFLD corta el tiempo de descongelación total a cerca de la mitad; el nivel de potencia 10 corta el tiempo total de descongelación a cerca de un tercio. Cuando descongela a niveles de potencia PiVDOWRVORVDOLPHQWRVQHFHVLWDUiQDWHQFLyQPiVIUHFXHQWH de la normal. 21 Horno Superior: Cocción con Microondas Cocción con Microondas (Continúa) Defrost By Weight (Descongelar por Peso) 8VH'HIURVW%\:HLJKW'HVFRQJHODUSRU3HVRSDUD descongelar durante un período de tiempo seleccionado. 1. Presione la tecla Microwave (Cocinar con Microondas) y VHOHFFLRQH'HIURVW'HVFRQJHODU *LUHHOGLDOGHVHOHFFLyQD'HIURVW%\:HLJKW'HVFRQJHODU por Peso). Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUHOSHVRTXHGHVHH3UHVLRQH el dial de selección para ingresar. Presione el dial de selección o la tecla Start/Pause (Iniciar/ Pausar) para iniciar la descongelación. *LUHORVDOLPHQWRVFXDQGRHOKRUQROHLQGLTXH7XUQ)RRG 2YHU'DU9XHOWD$/RV$OLPHQWRV El nivel de potencia no puede ser modificado durante esta configuración. Quick Defrost (Descongelación Rápida) con 1.0 lbs. 8VH4XLFN'HIURVW'HVFRQJHODFLyQ5iSLGDFRQOEVSDUD XQDGHVFRQJHODFLyQUiSLGDGHOEVGHFRPLGDFRQJHODGD 1. Presione la tecla Microwave (Cocinar con Microondas) \VHOHFFLRQHODGHVFRQJHODFLyQUiSLGDFRQOEV 2. Presione el dial de selección o la tecla Start/Pause (Iniciar/ Pausar) para iniciar la descongelación. Presione el dial de selección para ingresar. *LUHORVDOLPHQWRVFXDQGRHOKRUQROHLQGLTXH7XUQ)RRG 2YHU'DU9XHOWD$/RV$OLPHQWRV El nivel de potencia no puede ser modificado durante esta configuración. Consejos Para Descongelar Ŷ Ŷ 22 4. 6HSXHGHQGHVFRQJHODUDOLPHQWRVFRQJHODGRVHQSDSHOR SOiVWLFRHQHOSDTXHWHFXDQGRVHXWLOL]DODIXQFLyQ'HIURVW %\)RRG7\SH'HVFRQJHODU3RU7LSR'H&RPLGD6H deben cortar, perforar o ventilar los paquetes cerrados después de que se hayan descongelado los alimentos parcialmente. Se deben descubrir parcialmente los UHFLSLHQWHVGHDOPDFHQDPLHQWRSOiVWLFRV 6HSXHGHQGHVFRQJHODU\FRFLQDUFRQPLFURRQGDV las meriendas preempacadas, de tamaño familiar, congeladas. Si el alimento se encuentra en un recipiente GHOiPLQDGHDOXPLQLRWUDQVILpUDORDXQSODWRDGHFXDGR para microondas. Ŷ Ŷ Ŷ /RVDOLPHQWRVTXHVHHFKDQDSHUGHUIiFLOPHQWHQRVH GHEHQGHMDUIXHUDGHOUHIULJHUDGRUGXUDQWHPiVGHXQD KRUDGHVSXpVGHVFRQJHODUVH/DWHPSHUDWXUDDPELHQWH promueve el crecimiento de bacterias nocivas. 3DUDXQDGHVFRQJHODFLyQPiVXQLIRUPHGHDOLPHQWRVPiV JUDQGHVWDOHVFRPRDVDGRVXWLOLFHODIXQFLyQ'HIURVW%\ 7LPH'HVFRQJHODFLyQ3RU7LHPSR$VHJ~UHVHTXHODV carnes se encuentran completamente descongeladas antes de cocinarlas. &XDQGRORVDOLPHQWRVVHHQFXHQWUDQGHVFRQJHODGRV GHEHQHQFRQWUDUVHIUtRVSHURVXDYHVHQWRGDVODViUHDV Si aún se encuentran restos de hielo, vuélvalos a colocar en el microondas pero por un período muy corto de tiempo o déjelos reposar durante un par de minutos. 49-80741-2 Cocción De Microondas Por Sensor /DIXQFLyQGHVHQVRUGHWHFWDHODXPHQWRGHKXPHGDGOLEHUDGD durante la cocción. El horno ajusta el tiempo de cocción DXWRPiWLFDPHQWHDORVGLIHUHQWHVWLSRV\FDQWLGDGHVGHFRPLGD No utilice las funciones de sensor dos veces en sucesión en la misma porción de comida ya que puede tener como resultado comida severamente sobrecocinada o quemada. Si el alimento no se cocina completamente después del primer conteo UHJUHVLYRXWLOLFHODIXQFLyQGH&RRN%\7LPH&RFLQDU3RU Tiempo) para permitir tiempo de cocción adicional. Ŷ humedad que se convierten en vapor pueden dar lecturas incorrectas al sensor. /DVEHELGDVVHFDOLHQWDQPHMRUGHVFXELHUWDV Cubiertas Los recipientes y tapas o cubiertas apropiadas son esenciales para obtener los mejores resultados con la cocción por sensor. Ŷ 8WLOLFHVLHPSUHUHFLSLHQWHVDGHFXDGRVSDUDPLFURRQGDV\ F~EUDORVFRQWDSDVRHQYROWXUDSOiVWLFDYHQWLODGD1XQFD XWLOLFHUHFLSLHQWHVGHSOiVWLFRFRQVHOODGRDMXVWDGR\DTXH pueden prevenir que el vapor escape ocasionando que se sobrecocinen los alimentos. Ŷ $VHJ~UHVHGHTXHHOH[WHULRUGHORVUHFLSLHQWHVGH cocina y el interior del horno se encuentren secos antes GHFRORFDUORVDOLPHQWRVHQHOKRUQR/DVJRWDVGH Ventiladas Seque los platos de modo que no den lecturas incorrectas al sensor. PROGRAMAS DE SENSOR PARA COCCIÓN POR MICROONDAS: Ŷ*URXQG0HDW&DUQHPROLGD Ŷ3RSFRUQ3DORPLWDV Ŷ6RXS6RSD Ŷ5LFH$UUR] Ŷ9HJHWDEOHV9HUGXUDV (enlatadas, frescas, congeladas) Ŷ&KLFNHQ5HKHDW5HFDOHQWDPLHQWR de pollo) Ŷ3DVWD5HKHDW (Recalentamiento de pasta) Ŷ3ODWHRI)RRG5HKHDW (Plato de recalentamiento de comida Ŷ6RXS5HKHDW5HFDOHQWDPLHQWRGH sopa) Ŷ9HJHWDEOH5HKHDW (Recalentamiento de verduras) Horno Superior: Cocción con Microondas Cocción con Microondas (Continúa) Para Utilizar Todos Los Programas De Sensor El modo de microondas del horno superior cuenta con cocción FRQVHQVRU'HIRUPDDXWRPiWLFDGHWHFWDFXiQGRODFRPLGD HVWiOLVWD\VHDSDJDHOLPLQDQGRODQHFHVLGDGGHSURJUDPDU tiempos de cocción y niveles de potencia. 1. Presione la tecla Microwave (Cocinar con Microondas) \JLUHHOGLDOGHVHOHFFLyQD&RRN%\)RRG7\SH&RFLQDU por Tipo de Comida) o Reheat (Recalentar). Presione el dial de selección para ingresar. *LUHHOGLDOSDUDVHOHFFLRQDUODFRPLGDTXHGHVHH Presione el dial de selección para ingresar. 3. Presione el dial de selección o la tecla Start/Pause (Iniciar/ Pausar) para iniciar la cocción. No abra la puerta del horno hasta que se esté realizando la cuenta regresiva en la pantalla o hasta que el microondas finalice la cocción. Si la compuerta se encuentra abierta, ciérrela y apriete Start/Pause (Iniciar/Pausar) inmediatamente. Si los alimentos aún no se encuentran lo suficientemente cocinados, XWLOLFHODIXQFLyQ&RRN%\7LPH&RFFLyQ3RU7LHPSRHQHO VHOHFWRUGHPLFURRQGDVSDUDFRFLQDUSRUPiVWLHPSR NOTA: No utilice las funciones de sensor dos veces en sucesión en la misma porción de comida ya que puede dar como resultado comida severamente sobrecocinada o quemada. Ŷ 6LKDHVWDGRXWLOL]DQGRODIXQFLyQGHFRFFLyQUiSLGD\HO horno se encuentra caliente, esto puede ser una indicación GHTXHHVWiGHPDVLDGRFDOLHQWHFRPRSDUDFRFLQDUSRU 49-80741-2 sensor. Por supuesto, siempre puede proceder a cocinar FRQODIXQFLyQ&RRN%\7LPH&RFFLyQ3RU7LHPSR NOTA:6LHOKRUQRVHHQFXHQWUDGHPDVLDGRFDOLHQWHFDPELDUi DXWRPiWLFDPHQWHDFRFFLyQSRUWLHPSR Ŷ 3DUDGLVPLQXLURDXPHQWDUHOWLHPSRGHFRFFLyQHVSHUH hasta que se muestre el conteo de tiempo regresivo en ODSDQWDOOD/XHJRJLUHHOGLDOGHVHOHFFLyQSDUDDJUHJDUR restar tiempo. Ŷ 6LDEUHODFRPSXHUWDPLHQWUDVVHHQFXHQWUDXWLOL]DQGROD IXQFLyQ6HQVRU&RRNLQJ&RFFLyQ3RU6HQVRUDSDUHFHUi HOPHQVDMH6HQVRU(UURU(UURU'H6HQVRU&LHUUHOD compuerta y apriete el botón Start/Pause (Iniciar/Pausar) para comenzar nuevamente. Notas sobre el programa de Recalentamiento: /RVDOLPHQWRVUHFDOHQWDGRVSRGUtDQWHQHUDPSOLDVYDULDFLRQHV GHWHPSHUDWXUD$OJXQDViUHDVVHSXHGHQHQFRQWUDU extremadamente calientes. (VPHMRUXWLOL]DUODIXQFLyQ&RRN%\7LPH&RFFLyQ3RU Tiempo) y no Recalentar estos alimentos: Ŷ 3URGXFWRVGHSDQ Ŷ /RVDOLPHQWRVTXHGHEHQUHFDOHQWDUVHFXELHUWRV Ŷ /RVDOLPHQWRVTXHQHFHVLWDQUHYROYHUVHRYROWHDUVH Ŷ /RVDOLPHQWRVTXHQHFHVLWDQWHQHUXQDVSHFWRVHFRR superficie crujiente después del recalentamiento. 23 Horno Inferior: Modos de Cocción Modos de Cocción Su nuevo horno posee una variedad de modos de cocción para que pueda obtener los mejores resultados. Estos modos se describen a FRQWLQXDFLyQ3DUDDFFHGHUDUHFRPHQGDFLRQHVSDUDFRPLGDVHVSHFtILFDVFRQVXOWHODVHFFLyQGHOD*XtDGH&RFFLyQ5HFXHUGHTXHHV SRVLEOHTXHVXQXHYRKRUQRIXQFLRQHGHPDQHUDGLIHUHQWHTXHDTXHOTXHHVWiUHHPSOD]DQGR Modos de Horneado y Dorado Modo para Asar Seleccione un modo para hornear y dorar basado en el tipo y FDQWLGDGGHFRPLGDTXHHVWiSUHSDUDQGR$OSUHSDUDUFRPLGDV horneadas tales como tartas, galletas y masas, siempre precaliente el horno primero. Siga las recomendaciones de la receta sobre la colocación de la comida. Si no se brindan pautas, centre la comida en el horno. (OPRGRGHKRUQHDGRWUDGLFLRQDOHVWiSHQVDGRSDUDODFRFFLyQHQ un solo estante. Este modo usa el calor principalmente desde el elemento inferior, pero también desde el elemento superior para cocinar la comida. Para usar este modo presione la tecla Bake (Hornear), gire el dial de selección para configurar la temperatura del horno y presione el dial para ingresar, y luego presione Start (Iniciar). El precalentamiento generalmente se recomienda al usar este modo. Siempre ase con la puerta cerrada. El elemento para asar en el horno es muy potente. Monitoree la comida de cerca al asar. Tenga cuidado al asar en posiciones de estantes superiores, ya que FRORFDUODFRPLGDPiVFHUFDGHOHOHPHQWRSDUDDVDULQFUHPHQWDHO humo, salpicaduras y la posibilidad de que se incendien las grasas. No se recomienda asar en el estante de la posición 6. Intente asar las comidas que normalmente haría a la parrilla. Ajuste las posiciones de los estantes para ajustar la intensidad del FDORUDODFRPLGD&RORTXHODVFRPLGDVPiVFHUFDGHOHOHPHQWR SDUDDVDUFXDQGRVHGHVHHXQDVXSHUILFLHPiVFRFLQDGD\XQ LQWHULRUSRFRFRFLGR/DVFRPLGDVPiVJUXHVDV\ODVFRPLGDVFX\R interior debe ser cocinado deberían ser asadas en un estante en una posición alejada del usado para asar, o usando las funciones %URLO/R$VDU%DMR3DUDXQPHMRUUHQGLPLHQWRFHQWUHODFRPLGD debajo del elemento calentador para asar. Horneado por Convección en 1 Estante Asar Alto Horneado Tradicional (OPRGR&RQYHFWLRQ%DNH5DFN+RUQHDGRSRU&RQYHFFLyQ HQ(VWDQWHHVWiSHQVDGRSDUDODFRFFLyQHQXQVRORHVWDQWH Este modo utiliza el calor del elemento inferior y también de los elementos superior y trasero, junto con el movimiento del ventilador GHODFRQYHFFLyQSDUDTXHODFRFFLyQVHDPiVSDUHMD(OKRUQR HVWiHTXLSDGRFRQODIXQFLyQ$XWR5HFLSH&RQYHUVLRQ&RQYHUVLyQ GH5HFHWD$XWRPiWLFDGHPRGRTXHQRHVQHFHVDULRFRQYHUWLUOD temperatura al usar este modo. Para usar este modo presione la tecla Convection Bake (Hornear por Convección), gire el dial para VHOHFFLRQDU5DFN(VWDQWH\FRQILJXUHODWHPSHUDWXUDGHOKRUQR y presione el dial para ingresar, y luego presione Start (Iniciar). El precalentamiento generalmente se recomienda al usar este modo. Honeado por Convección en Estantes Múltiples (OPRGR&RQYHFWLRQ%DNH0XOWL5DFN+RQHDGRSRU&RQYHFFLyQHQ (VWDQWHV0~OWLSOHVHVWiSHQVDGRSDUDKRQHDUHQP~OWLSOHVHVWDQWHV al mismo tiempo. Este modo utiliza el calor principalmente desde el elemento trasero, pero también calienta desde los elementos superior e inferior, junto con el movimiento de aire desde el ventilador por convección para mejorar una cocción pareja. El KRUQRHVWiHTXLSDGRFRQODIXQFLyQ$XWR5HFLSH&RQYHUVLRQ &RQYHUVLyQGH5HFHWD$XWRPiWLFDGHPRGRTXHQRHVQHFHVDULR convertir la temperatura al usar este modo. Es posible que el WLHPSRGHKRUQHDGRVHDXQSRFRPiVSURORQJDGRFRQHVWDQWHV múltiples, en comparación con lo que se espera con un solo estante. Para usar este modo presione la tecla Convection Bake (Hornear por Convección)JLUHHOGLDOSDUDVHOHFFLRQDU0XOWL5DFN (Estantes Múltiples) y configure la temperatura del horno y presione el dial para ingresar, y luego presione Start (Iniciar). Siempre realice el precalentamiento al usar este modo. Dorar por Convección (OPRGR&RQYHFWLRQ5RDVW'RUDGRSRU&RQYHFFLyQHVWiSHQVDGR para dorar cortes enteros de carne en un solo estante. Este modo utiliza el calor de los elementos inferior, superior y trasero, junto con el movimiento del ventilador por convección, a fin de mejorar el dorado y reducir el tiempo de cocción. No es necesario convertir la temperatura. Cuando use este modo, o si usa la sonda, controle la comida antes que el tiempo sugerido en la receta. Para usar este modo presione la tecla Convection Bake (Hornear por Convección), gire el dial para seleccionar Roast 'RUDU\FRQILJXUHODWHPSHUDWXUDGHOKRUQR\SUHVLRQHHOGLDOSDUD ingresar, y luego presione Start (Iniciar). No es necesario realizar el precalentamiento al usar este modo. 24 (OPRGR%URLO+L$VDU$OWRXVDFDORULQWHQVRGHOHOHPHQWR VXSHULRUSDUDVRDVDUODVFRPLGDV8VHODIXQFLyQ%URLO+L$VDGR $OWRSDUDFRUWHVPiVGHOJDGRVGHFDUQH\RFRPLGDVTXHSUHILHUD que quedan menos cocinadas en su interior. Para usar este modo presione la tecla Broil (Asar)JLUHHOGLDOGHVHOHFFLyQD+L$OWR\ presione el dial para ingresar, y luego presione Start (Iniciar). No es necesario realizar el precalentamiento al usar este modo. Asar Bajo (OPRGR%URLO/R$VDU%DMRXVDPHQRVFDORULQWHQVRGHOHOHPHQWR superior para cocinar la comida completamente mientras también VHUHDOL]DHOGRUDGRVXSHUILFLDO8VHODIXQFLyQ%URLO/R$VDGR %DMRSDUDFRUWHVGHFDUQHPiVJUXHVRV\RFRPLGDVTXHGHVHH que queden completamente cocinadas. Para usar este modo presione la tecla Broil (Asar)JLUHHOGLDOGHVHOHFFLyQD/R%DMR y presione el dial para ingresar, y luego presione Start (Iniciar). No es necesario realizar el precalentamiento al usar este modo. Leudar (OPRGR3URRI/HXGDUHVWiGLVHxDGRSDUDHOHYDUIHUPHQWDU\ leudar) masas de pan. Presione la tecla Options (Opciones), gire HOGLDOSDUDVHOHFFLRQDU3URRI/HXGDU\SUHVLRQHHOGLDOSDUDKDFHU la selección, y luego presione Start (Iniciar). Cubra bien la masa SDUDHYLWDUTXHVHVHTXH(OSDQVHHOHYDUiPiVUiSLGDPHQWHTXH DWHPSHUDWXUDDPELHQWH6HGHEHUiREVHUYDUTXHFRQORVKRUQRV GHSDUHGGREOHODIXQFLyQSDUDOHXGDUQRVHSRGUiDFWLYDUFXDQGR se esté usando un modo de limpieza en el horno inferior. Calentar (OPRGR:DUP&DOHQWDUHVWiGLVHxDGRSDUDPDQWHQHUFRPLGDV calientes hasta durante 3 horas. Para usar este modo presione la tecla Options (Opciones)JLUHHOGLDOSDUDVHOHFFLRQDU:DUP (Caliente) y presione el dial para hacer la selección, y luego presione Start (Iniciar). Cubra las comidas que necesitan mantener la humedad y no cubra aquellas comidas que deberían quedar crocantes. No se requiere precalentar las mismas. No use la IXQFLyQ:DUP&DOHQWDUSDUDFDOHQWDUFRPLGDIUtDH[FHSWRJDOOHWDV crujientes, papas fritas o cereales secos. También se recomienda TXHODFRPLGDQRVHPDQWHQJDFDOLHQWHSRUPiVGHGRVKRUDV 49-80741-2 6XQXHYRKRUQRFXPSOHFRQORVUHTXLVLWRVGHO)HULDGR6DEiWLFR-XGtRGHOD(VWUHOOD.FRQWDQGRFRQODIXQFLyQGHFRFFLyQGHO PRGR6DEEDWK6DEiWLFR$FRQWLQXDFLyQVHGHVFULEHHQGHWDOOHODIXQFLyQGHOPRGR6DEEDWK6DEiWLFR Para Ingresar a Sabbath Mode (Modo Sabático) Presione la tecla Options (Opciones) del horno inferior y gire HOGLDOD6DEEDWK6DEiWLFR\SUHVLRQHHOPLVPRSDUDKDFHUOD VHOHFFLyQ(QODSDQWDOODDSDUHFHUi³'XULQJ6DEEDWK0RGHWKH XSSHURYHQLVXQDYDLODEOH´'XUDQWHHO0RGR6DEiWLFRHOKRUQR VXSHULRUQRHVWiGLVSRQLEOH3UHVLRQHHOGLDOGHVHOHFFLyQ para continuar. Cualquier función del horno superior que esté IXQFLRQDQGRVHGHWHQGUi\HOKRUQRLQIHULRUKDUiXQDWUDQVLFLyQ LQPHGLDWDDOPRGR6DEEDWK6DEiWLFR Para Cambiar la Temperatura 8QDYH]HQHOPRGR6DEEDWK6DEiWLFRDILQGHPRGLILFDUOD temperatura del horno o de iniciar una función de horneado, el XVXDULRSRGUiFDPELDUODWHPSHUDWXUDDXQDGHODVWHPSHUDWXUDV configuradas previamente, como se indica a continuación: Tecla UI Teclas del Lado Izquierdo (Horno Superior) Microwave (Cocinar en el Microondas) 6SHHG&RRN'HIURVW &RFFLyQ5iSLGD'HVFRQJHODU &RRNLQJ2SWLRQV3RSFRUQ (Opciones de Cocción/ Palomitas de Maíz) Add 30 Sec (Agregar 30 Segundos) &RQYHFWLRQ%DNH5HKHDW +RUQHDUSRU&RQYHFFLyQ5HFDOHQWDU Teclas del Lado Derecho (Horno Inferior) %DFN5HWURFHGHU &OHDU2II%RUUDU$SDJDU /LJKW/X] %DNH+RUQHDU %URLO$VDU &RQYHFWLRQ%DNH:DUP +RUQHDUSRU&RQYHFFLyQ&DOHQWDU Options (Opciones) Temperatura (ºF) 200 225 250 300 0 Se cancela inmediatamente 325 350 400 450 El cambio a una de las temperaturas anteriores requiere que el usuario presione la tecla asociada con la temperatura deseada y que luego presione la tecla Start/Pause (Iniciar/ Pausar). 3RUHMHPSORSDUDFRQILJXUDU+RUQHDU)HOXVXDULRGHEHUi presionar la tecla Bake (Hornear) en el horno inferior y luego presionar la tecla Start/Pause (Iniciar/ Pausar). /DIXQFLyQ%DNH+RUQHDUVHLQLFLDUiRVL\DHVWiIXQFLRQDQGR ODWHPSHUDWXUDGHOKRUQRFDPELDUiHQXQPRPHQWRDOD]DUHQWUH los 30 y 60 segundos luego de que la tecla Start/Pause (Iniciar/ Pausar) haya sido presionada, con la excepción de presionar la tecla Clear/Off (Borrar/ Apagar)ORFXDOFDQFHODUiGHLQPHGLDWR ODVFRQILJXUDFLRQHVGHFRFFLyQ/DXQLGDGSHUPDQHFHUiHQHO PRGR6DEiWLFR(OFDPELRGHWHPSHUDWXUDSXHGHVHUHMHFXWDGR en cualquier momento durante el ciclo de cocción. Para Apagar el Horno Presione la tecla Clear/Off (Borrar/ Apagar) o Back (Retroceder) y luego la tecla Start (Iniciar) en cualquier PRPHQWR(OKRUQRVHDSDJDUiGHLQPHGLDWRSHUR SHUPDQHFHUiHQHOPRGR6DEEDWK6DEiWLFR\UHJUHVDUiDOD SDQWDOODGHVXVSHQVLyQGH6DEEDWK6DEiWLFR Para Salir del Modo Sabático Mantenga presionada la tecla Back (Retroceder) durante VHJXQGRV(OKRUQRVHDSDJDUiHQXQPRPHQWRDOD]DU entre los 30 y 60 segundos, luego de que la tecla Back (Retroceder) se mantenga presionada. 49-80741-2 NOTA: No presione ninguna otra tecla durante este momento, \DTXHGHORFRQWUDULRHOPRGR6DEEDWK6DEiWLFRVHUi UHLQLFLDGR\QRVHSRGUiVDOLUGHOPLVPR (OKRUQRVDOGUiGHOPRGR6DEEDWK6DEiWLFR\UHJUHVDUiDOD pantalla por omisión. Función de Cocción por Tiempo en el Modo Sabático (OPRGR6DEEDWK6DEiWLFRQRSXHGHDFWLYDUXQDIXQFLyQGH FRFFLyQSRUWLHPSRSRUVtVROR6LVHGHVHDDFWLYDU7LPHG&RRN &RFLQDUSRU7LHPSRVHGHEHUiQUHDOL]DUORVVLJXLHQWHVSDVRV 1. Use la tecla Settings (Configuraciones) para configurar %HHSHU9ROXPHQ9ROXPHQGHO3LWLGRHQ0XWH0XGR 2. Use la tecla Light (Luz) para configurar la luz de su horno inferior en On (Encender). 3. Use Bake (Hornear) para programar una temperatura. /XHJRGHSURJUDPDUXQDWHPSHUDWXUDVHOHFFLRQHXQ tiempo de cocción e ingrese su tiempo de cocción. Presione la tecla Start (Iniciar) para iniciar el horno. NOTA:12VHGHEHUiXVDU&RQYHFWLRQ%DNH+RUQHDUSRU Convección). 4. Una vez iniciado el horno, NO abra la puerta hasta que el mismo se haya terminado de precalentar y haya alcanzado XQDWHPSHUDWXUDSDUHMD+DFHUHVWRDQWHVGHTXHVHFRPSOHWH HOSUHFDOHQWDPLHQWRKDUiTXHHOYHQWLODGRUGHGLVWULEXFLyQGHO aire pierda potencia de forma inmediata al abrir la puerta. 5. Una vez que la comida fue colocada en el horno, no abra ODSXHUWDKDVWDTXHODFRFFLyQVHKD\DFRPSOHWDGR+DFHU HVWRKDUiTXHODLPDJHQGHODSDQWDOODFDPELH\OHLQGLTXH que cierre la puerta. 12DEUDODSXHUWDGHOKRUQRVXSHULRU+DFHUHVWR HQFHQGHUiODOX]GHIRUPDLQPHGLDWD No presione ningún botón adicional en los controles del horno inferior una vez iniciada la cocción, ya que de lo contrario la SDQWDOODFDPELDUiLQPHGLDWDPHQWHDOSUHVLRQDUHOERWyQ Horno Inferior: Modo Sabático Modo Sabático NOTAS Ŷ 'XUDQWHODIXQFLyQ6DEEDWK0RGH0RGR6DEiWLFRVyOR %DNH+RUQHDUHQHOKRUQRLQIHULRUHVWiGLVSRQLEOH%URLO $VDU&RQYHFWLRQ%DNH+RUQHDUSRU&RQYHFFLyQ:DUP &DOHQWDUXRWUDVIXQFLRQHVQRHVWiQGLVSRQLEOHV Ŷ (QHOPRGR6DEEDWK6DEiWLFRHODSDJDGRDXWRPiWLFR OXHJRGHKRUDVHVWiGHVDFWLYDGRVLQLPSRUWDU qué configuración fue seleccionada en Settings (Configuraciones). Ŷ (OPRGR6DEEDWK6DEiWLFRSXHGHVHULQJUHVDGRVyORVL QLQJ~QPRGRGHFRFFLyQHVWiIXQFLRQDQGRHQHOKRUQR LQIHULRU,QJUHVDUD6DEEDWK0RGR0RGR6DEiWLFR FDQFHODUiWRGDVODVIXQFLRQHVGHOKRUQRLQIHULRU\VXSHULRU (incluyendo el temporizador y el recordatorio). Ŷ &XDQGRXQERWyQHVSUHVLRQDGRHQ6DEEDWK0RGH0RGR 6DEiWLFRQRKD\SLWLGRVQLWRQRVQLFDPELRVHQODVOXFHV RHQODSDQWDOOD$GHPiVFXDQGRODSXHUWDHVDELHUWDR FHUUDGDHQ6DEEDWK0RGH0RGR6DEiWLFRQRKD\SLWLGRV ni tonos, ni cambios en las luces o en la pantalla. Ŷ 6LVHSURGXFHXQFRUWHGHFRUULHQWHGXUDQWHHOKRUQHDGRHQ HOPRGR6DEEDWK6DEiWLFRODXQLGDGUHJUHVDUiDGLFKR modo cuando el suministro de corriente sea restablecido, SHURQRUHJUHVDUiDOPRGRGHKRUQHDGR 25 Horno Inferior: Guía de Cocción Guía de Cocción MODO(S) RECOMENDADO(S) POSICIÓN(ES) DE ESTANTES RECOMENDADA SUGERENCIAS ADICIONALES Tortas con capas, tortas rectangulares, roscas, panecillos, pan UiSLGRHQXQ6ROR(VWDQWH +RUQHDGR7UDGLFLRQDO 3 Use utensilios brillantes. 7RUWDVFRQFDSDVHQ0~OWLSOHV Estantes +RUQHDGR7UDGLFLRQDO 2y4 (VWDQWHH[WHQVLEOHHQODSRVLFLyQPiVDOWDVLVHXVD Asegúrese de que haya un flujo de aire adecuado (Vea la ilustración). 7RUWDVGHJUDVDSDVWHOGHiQJHO +RUQHDGR7UDGLFLRQDO 1 Use utensilios brillantes. *DOOHWDVJDOOHWLWDVEL]FRFKLWRVHQ un Solo Estante +RUQHDGR7UDGLFLRQDO 3 Use utensilios brillantes. *DOOHWDVJDOOHWLWDVEL]FRFKLWRVHQ Múltiples Estantes +RUQHDGRSRU&RQYHFFLyQ Múltiples Estantes 2y4 1, 3 y 5 Use la posición 4 para 2 estantes extensibles, y la posición 1 para 3 estantes. Asegúrese de que haya un flujo de aire adecuado. TIPO DE COMIDA Productos Horneados Bife y Cerdo +DPEXUJXHVDV Asar Alto 5 Use una olla para asar y use una olla para asar; precaliente PLQXWRVVLXVDUiHO0RGRSDUD$VDUSRU&RQYHFFLyQ0XHYDODFRPLGDKDFLDDEDMRSDUDTXHTXHGHPiVSUHSDUDGD\ menos soasada. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. %LIHV\&KXOHWDV Asar Alto 5 Use una olla para asar; Mueva la comida hacia abajo para TXHTXHGHPiVSUHSDUDGD\PHQRVVRDVDGD3UHVWHDWHQción a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. 'RUDGRV 'RUDGRSRU&RQYHFFLyQ 2o3 Use una olla chata tal como una olla para asar. No se requiere precalentarla. Pollo entero 'RUDGRSRU&RQYHFFLyQ 2o3 Use una olla chata tal como una olla para asar. Asar Alto 1 $VDGR%DMR +RUQHDGR7UDGLFLRQDO +RUQHDGRSRU&RQYHFFLyQ en 1 Estante 3 $VDGR%DMR +RUQHDGR7UDGLFLRQDO +RUQHDGRSRU&RQYHFFLyQ en 1 Estante 3 Ave Pechugas, patas, muslos con huesos Pechugas de pollo deshuesadas 6LVHHPSDQyRFXEULyFRQVDOVDHYLWHORVPRGRV%URLO+L (Asar Alto). Ase del lado de la piel hacia abajo primero. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. 0XHYDODFRPLGDPiVDEDMRSDUDTXHTXHGHPiVSUHSDUDGD \PHQRVVRDVDGD\PiVDUULEDSDUDVRDVDUGRUDUDODVDU Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Pavo entero 'RUDGRSRU&RQYHFFLyQ 1o2 Usa una olla chata tal como una olla para asar. Pechuga de pavo 'RUDGRSRU&RQYHFFLyQ 2o3 Use una olla chata tal como una olla para asar. Pescado $VDGR%DMR 5 (mitad del grosor o menos) 4 (>1/2 pulgada) Precaliente 5 minutos al Asar por Convección. Preste atención a la comida al asarla. Para un mejor rendimiento, centre la comida debajo del elemento calentador para asar. Cazuelas +RUQHDGRSRU&RQYHFFLyQ en 1 Estante +RUQHDGR7UDGLFLRQDO 3 Pizza, papas fritas, tator tots, patitas de pollo fritas, aperitivos en un Solo Estante +RUQHDGRSRU&RQYHFFLyQ en 1 Estante +RUQHDGR7UDGLFLRQDO 3 Use utensilios brillantes. Pizza, papas fritas, tator tots, patitas de pollo fritas, aperitivos en Múltiples Estantes +RUQHDGRSRU&RQYHFFLyQ Múltiples Estantes 2y4 Use utensilios brillantes. Comidas Congeladas a Conveniencia $OKRUQHDUFXDWURWRUWDVFRQFDSDVDODYH]XVHORVHVWDQWHV 2 y 4. Coloque las ollas como se muestra, de modo que no quede una olla encima de la otra. Cocine la comida completamente para evitar que se produzcan enfermedades a partir de la comida. Puede encontrar recomendaciones sobre temperatura mínima para cocinar de forma segura en www.IsItDoneYet.gov. Asegúrese de usar un termómetro de comidas para medir la temperatura de las mismas. 26 49-80741-2 (OKRUQRFXHQWDFRQVHLVSRVLFLRQHVGHHVWDQWHV(QOD*XtD de Cocción, se brindan recomendaciones de posiciones de los estantes para diferentes tipos de comidas. Se ajusta un estante en una dirección para afectar los resultados de FRFFLyQ3RUHMHPSORVLVHSUHILHUHQSDUWHVVXSHULRUHVPiV oscuras en tartas, panecillos o galletas, pruebe moviendo ODFRPLGDDXQHVWDQWHTXHVHHQFXHQWUHXQDSRVLFLyQPiV DUULED6LHQFXHQWUDTXHODVFRPLGDVHVWiQGHPDVLDGRGRUDGDV HQODSDUWHVXSHULRUSUXHEHPRYLHQGRODVPLVPDVPiVDEDMR la próxima vez. El horno tiene 6 posiciones de estantes Al hornear con múltiples ollas y en múltiples estantes, asegúrese de que haya por lo menos 11/2” entre las ollas, a fin de dejar suficiente espacio para que fluya el aire. Estantes del Horno Es posible que su horno cuente con estantes extensibles y/o estantes planos tradicionales. Para evitar posibles quemaduras, coloque los estantes en la posición deseada antes de encender el horno. Manija Horno Inferior: Estantes Estantes Manija Riel Frontal Superior Estantes Extensibles /RVHVWDQWHVH[WHQVLEOHVFXHQWDQFRQODIXQFLyQ,QVWDOO (Instalar), que se bloquea en los soportes de los estantes (guías) a ambos lados. Una vez que la función Install (Instalación) queda correctamente bloqueada, siempre empuje hacia afuera el estante desde el riel frontal superior hasta la SRVLFLyQGHGHWHQFLyQHQVXPi[LPDH[WHQVLyQDOFRORFDUR retirar utensilios. Si resulta difícil extender estos estantes, lubrique los mismos con lubricante de grafito, provisto con el horno. Retire el estante del horno, retire cualquier obstrucción en el recorrido deslizable con una toalla de papel, agite el lubricante de grafito y coloque 4 gotitas en los dos recorridos inferiores de los lados izquierdo y derecho. Abra y cierre el estante varias veces para distribuir el lubricante. Riel Frontal Superior 3DUDRUGHQDUPiVOXEULFDQWHGHJUDILWROHDODVHFFLyQGH Asistencia y Accesorios en el comienzo de este manual. Para Retirar un Estante Extensible: 1. Asegúrese de que el estante sea empujado totalmente dentro del horno. 2. Tome el estante tanto desde su riel frontal superior como de sus manijas inferiores y levante directamente para desbloquear el estante de los soportes del estante. 'HPDQHUDILUPHPLHQWUDVVRVWLHQHWDQWRHOULHOIURQWDO superior como las manijas inferiores, empuje el estante hacia adelante. En caso de ser necesario, tome el estante sobre DPERVODGRV/XHJRUHWLUHHOPLVPRGHOKRUQR Levante para desbloquear desde el soporte del estante Manija Manija Riel Frontal Superior Función de Instalación Para Reemplazar un Estante Extensible: 1. Coloque la posición trasera del estante sobre los soportes del estante (guías), como se muestra en la imagen. 2. Sostenga el riel frontal superior y las manijas inferiores y empuje el estante hasta que la función de instalación se bloquee en el soporte del estante frontal. Si resulta difícil reemplazar o retirar los estantes extensibles, limpie los soportes de los estantes del horno con aceite de cocina. No quite el aceite de cocina del espacio de deslizamiento. 49-80741-2 Sostenga el riel frontal superior y las manijas inferiores y empuje el estante hasta que la función de instalación se bloquee en el soporte frontal. Bloqueo del Estante Frontal 27 Horno Inferior: Estantes / Papel de Aluminio y Cobertores del Horno / Utensilios 28 Estantes (Continúa) Estantes Planos Tradicionales /RVHVWDQWHVSRVHHQEORTXHDGRUHVGHPRGRTXHDOFRORFDUORV FRUUHFWDPHQWHVREUHORVVRSRUWHVVHGHWHQGUiQDQWHVGH VDOLUVHFRPSOHWDPHQWH\QRVHLQFOLQDUiQ$OFRORFDU\UHWLUDU utensilios de cocina, empuje la parrilla hasta que se detenga. Estante plano Para Retirar un Estante Empuje el mismo hacia usted, incline el frente hacia arriba y empuje hacia afuera. Para Reemplazar un Estante Incline el frente del estante hacia arriba, cuelgue la parte trasera ubicando los enlaces debajo de los soportes de ORVHVWDQWHVHPSXMHHOHVWDQWHKDFLDDWUiVKDVWDWUDEDUOR en los bloqueadores) y haga que descienda hasta su posición. Empuje el estante hasta que quede introducido completamente. Enlace de ubicación Bloqueador Soporte del estante Si resulta difícil deslizar y/o retirar estantes planos, coloque un poco de aceite de cocina en una tela suave o en una toalla de papel y frote los costados del estante y cada soporte del mismo. PRECAUCIÓN: Tenga cuidado al retirar un estante de la posición más baja, ya que la puerta podrá estar caliente. Papel de Aluminio y Cobertores del Horno PRECAUCIÓN: No use ningún tipo de aluminio o cobertor de horno para cubrir el fondo del horno. Estos ítems pueden atrapar el calor o derretirse, ocasionando daños sobre el producto y el riesgo de descargas, humo o incendios. Los daños por uso inadecuado de estos ítems no están cubiertos por la garantía del producto. 6HSRGUiXVDUDOXPLQLRSDUDHYLWDUGHUUDPHVFRORFDQGRXQDKRMDVREUHXQHVWDQWHLQIHULRUYDULDVSXOJDGDVGHEDMRGHODFRPLGD 1RXVHPiVDOXPLQLRTXHHOQHFHVDULR\QXQFDFXEUDWRWDOPHQWHHOHVWDQWHGHXQKRUQRFRQSDSHOGHDOXPLQLR0DQWHQJDHO aluminio a por lo menos 1 1/2” de las paredes del horno, para evitar una circulación deficiente del calor. Utensilios Pautas de Uso de Utensilios El material, el acabado y el tamaño de los utensilios afectan el horneado. /DVROODVRVFXUDVUHYHVWLGDV\RSDFDVDEVRUEHQHOFDORUPiV UiSLGDPHQWHTXHODVROODVFODUDV\EULOODQWHV$OXVDUROODVTXH DEVRUEHQHOFDORUPiVUiSLGDPHQWHODVFRPLGDVSRGUiQUHVXOWDU PiVGRUDGDVFURFDQWHV\FRQXQDFDSDPiVJUXHVD Si utiliza utensilios oscuros y revestidos, controle la comida antes del tiempo mínimo de cocción. Si se obtienen resultados no deseados con este tipo de utensilios, considere la posibilidad de reducir la temperatura del horno en 25º F la próxima vez. /DVROODVEULOODQWHVSXHGHQSURGXFLUUHVXOWDGRVGHKRUQHDGRPiV parejos en tortas y galletas. /DVROODVGHYLGULR\FHUiPLFDFDOLHQWDQFRQOHQWLWXGSHURUHWLHQHQ bien el calor. Estos tipos de ollas funcionan bien con platos tales como tartas y postres con natilla. /DVROODVFRQDLVODQWHGHDLUHFDOLHQWDQOHQWDPHQWH\SXHGHQ producir fondos dorados. 0DQWHQJDORVXWHQVLOLRVOLPSLRVSDUDXQDFRFFLyQPiVSDUHMD 49-80741-2 Asegúrese de que la corriente eléctrica esté apagada y que todas las superficies estén frías antes de limpiar cualquier parte del horno. Consejos Útiles Una limpieza minuciosa ocasional con un trapo empapado GHELFDUERQDWRVyGLFR\DJXDPDQWHQGUiHOLQWHULRUIUHVFR También recomendamos no usar limpiadores con amoníaco o alcohol, ya que pueden dañar el aspecto del horno. Si elige usar un limpiador hogareño común, primero aplique el limpiador directamente sobre una tela seca, y luego limpie el iUHDTXHVHHQFXHQWUHVXFLD Panel de Control Una buena idea es limpiar el panel de control luego de cada XVR/LPSLHFRQXQMDEyQVXDYH\DJXDRYLQDJUH\DJXD enjuague con agua limpia y pula en seco con una tela suave. No use limpiadores abrasivos, limpiadores líquidos fuertes, DOPRKDGLOODVSDUDIUHJDUGHSOiVWLFRQLOLPSLDGRUHVGHKRUQRHQ HOSDQHOGHFRQWUROGDxDUiQHODFDEDGR Exterior del Horno No use limpiadores de horno, limpiadores abrasivos, limpiadores líquidos fuertes, estropajos de acero, almohadillas SDUDIUHJDUGHSOiVWLFRQLSROYRVOLPSLDGRUHVHQHOLQWHULRU RHOH[WHULRUGHOKRUQR/LPSLHHOPLVPRFRQDJXD\MDEyQR una solución de vinagre y agua. Enjuague con agua limpia y seque con una tela seca. Al limpiar supeficies, asegúrese de que estén a temperatura ambiente y fuera del contacto con la luz solar. Si las manchas en el borde de la ventana de la puerta son persistentes, use un limpiador abrasivo suave o una esponja con estropajo para obtener un mejor resultado. El derrame de adobo, jugos de fruta, salsas de tomate y líquidos SDUDKXPHGHFHUTXHFRQWHQJDQiFLGRVSXHGHQRFDVLRQDU GHVFRORUDFLyQ\VHGHEHUiQOLPSLDUGHLQPHGLDWR'HMHTXHODV superficies calientes se enfríen, y luego limpie y enjuague. Superficies de Acero Inoxidable (en algunos modelos) 1RXVHYLUXWDVGHDFHURpVWDVGDxDUiQODVXSHUILFLH3DUD limpiar la superficie de acero inoxidable, use agua tibia con jabón o un limpiador o pulidor para acero inoxidable. Siempre limpie la superficie en la dirección del veteado. Siga las instrucciones del limpiador para limpiar la superficie de acero inoxidable. Para realizar consultas sobre la adquisición de productos, incluyendo limpiadores o pulidores para electrodomésticos de acero inoxidable, lea las secciones de Asistencia y Accesorios, en el comienzo de este manual. Cómo Limpiar el Interior del Horno Superior Sello de la compuerta (VLPSRUWDQWHPDQWHQHUHOiUHDOLPSLDHQHOOXJDUGRQGH la compuerta se sella contra el horno. Utilice únicamente detergentes de acción mediana, no abrasivos aplicados con XQDHVSRQMDRWUDSRK~PHGR(QMXiJXHODELHQ CUIDADO Y LIMPIEZA: Limpieza del Horno Limpieza del Horno Base Giratoria Desmontable Paredes, piso, ventanilla interna, piezas de metal y plástico en la compuerta /LPSLHHOLQWHULRUGHOKRUQRFRQIUHFXHQFLDSDUDTXH caliente bien. Se pueden remover algunas partículas con una toalla de papel; otras pueden requerir un trapo caliente con una solución jabonosa. Elimine las partículas de grasa con un trapo humedecido con agua jabonosa, luego enjuague con un trapo húmedo. No utilice limpiadores abrasivos o utensilios puntiagudos en las paredes del horno. Nunca utilice un limpiador de horno comercial en ninguna pieza del horno. 1ROLPSLHHOLQWHULRUGHOKRUQRFRQHVSRQMLOODVPHWiOLFDV para fregar. Pueden desprenderse piezas de la esponjilla PHWiOLFDRFDVLRQDQGRXQDGHVFDUJDHOpFWULFD 49-80741-2 Base giratoria No haga funcionar el horno sin tener colocada en su lugar la base giratoria. 6HGHEHOLPSLDUFRQIUHFXHQFLDHOiUHDORFDOL]DGDGHEDMRGH la base giratoria para evitar olores y humo durante un ciclo de cocción. Si se deja caer, la base giratoria se puede romper. /iYHODFXLGDGRVDPHQWHHQDJXDWLELDMDERQRVD6pTXHOD completamente y vuelva a colocarla. Para colocar la base giratoria, coloque su centro sobre el rotor ubicado en el centro del horno y gírela hasta que se asiente en su lugar. (Asegúrese de que la superficie lisa de la base giratoria se encuentre colocada hacia arriba y que el centro se encuentre asentado de manera segura en el rotor.) 29 CUIDADO Y LIMPIEZA: Limpieza del Horno Limpieza del Horno (Continúa) How To Clean The Upper Oven Interior (Continúa) Bandejas Para Cocinar Y Lámina De Hornear Para evitar que se rompan las bandejas, deje que se enfríen FRPSOHWDPHQWHDQWHVGHOLPSLDUODV/DYHODVEDQGHMDVHQ DJXDMDERQRVDWLELDRHQODPiTXLQDODYDSODWRV Bandeja de vidrio transparente para la función de microondas Bandeja antiadherente de metal para cocción rápida Coloque los alimentos directamente en la hoja para hornear de aluminio en la parrilla de alambre del horno y colóquelos en la bandeja metálica antiadherente cuando hornee a dos niveles, ase o tueste alimentos. Cómo Limpiar el Interior del Horno Inferior El interior de su nuevo horno puede ser limpiado de forma PDQXDORXWLOL]DQGRORVPRGRV6WHDP&OHDQ/LPSLH]DFRQ 9DSRUR6HOI&OHDQ/LPSLH]D$XWRPiWLFD El derrame de adobo, jugos de fruta, salsas de tomate y OtTXLGRVSDUDKXPHGHFHUTXHFRQWHQJDQiFLGRVSXHGHQ RFDVLRQDUGHVFRORUDFLyQ\VHGHEHUiQOLPSLDUGHLQPHGLDWR Espere a que las superficies calientes se enfríen, y luego limpie y enjuague. Limpieza Manual No use limpiadores de horno, limpiadores abrasivos, limpiadores líquidos fuertes, estropajos de acero, almohadillas para fregar, ni polvos limpiadores en el interior del horno. /LPSLHHOPLVPRFRQDJXD\MDEyQRXQDVROXFLyQGHYLQDJUH y agua. Enjuague con agua limpia y seque con una tela seca. Al limpiar supeficies, asegúrese de que estén a temperatura ambiente y fuera del contacto con la luz solar. Modo de Limpieza con Vapor /DOLPSLH]DFRQYDSRUHVWiSHQVDGDSDUDOLPSLDUSHTXHxRV GHUUDPHVXVDQGRDJXD\DXQDWHPSHUDWXUDGHOLPSLH]DPiV EDMDTXHODIXQFLyQ6HOI&OHDQ/LPSLH]D$XWRPiWLFD 3DUDXVDUODIXQFLyQ6WHDP&OHDQ/LPSLH]DFRQ9DSRUOLPSLH las grasas y suciedades del horno. Vierta una taza de agua en la parte inferior del horno. Cierre la puerta. Presione la tecla Options (Opciones)VHOHFFLRQH6WHDP&OHDQ/LPSLH]DFRQ Vapor), y luego presione Start (Iniciar)/DSXHUWDGHOKRUQR VHWUDEDUi1RSRGUiDEULUODSXHUWDGXUDQWHORVPLQXWRVGH ODOLPSLH]DFRQYDSRU\DTXHHVWRUHGXFLUiVXUHQGLPLHQWR$O ILQDOL]DUHOFLFORGHOLPSLH]DDOYDSRUODSXHUWDVHGHVWUDEDUi /LPSLHFXDOTXLHUH[FHVRGHDJXD\FXDOTXLHUVXFLHGDGTXH haya quedado. 30 1RXWLOLFHHVSRQMLOODVPHWiOLFDVSDUDIUHJDUROLPSLDGRUHV abrasivos, ya que pueden dañar el acabado. Se puede utilizar una esponjilla cubierta de jabón para limpiar las bandejas. Modo de Limpieza Automática /HDODV,QVWUXFFLRQHVGH6HJXULGDGGHO+RUQRFRQ/LPSLH]D $XWRPiWLFDHQHOFRPLHQ]RGHHVWHPDQXDODQWHVGHXVDU HOPRGR6HOI&OHDQ/LPSLH]D$XWRPiWLFD(VWHPRGRXVD temperaturas muy altas para limpiar el interior del horno. Cuando XVHHVWDIXQFLyQODSXHUWDGHOKRUQRVHWUDEDUi$QWHVGH XWLOL]DUHOFLFORGHOLPSLH]DDXWRPiWLFDOLPSLHODJUDVD\UHVWRV de comida que haya en el horno. Retire todos los artículos del horno, excepto los estantes esmaltados (color oscuro). /RVHVWDQWHVEULOODQWHVRGHSODWD\FXDOTXLHUXWHQVLOLRXRWURV artículos deberían ser retirados del horno antes de iniciar un ciclo GHOLPSLH]DDXWRPiWLFD3UHVLRQHODWHFODOptions (Opciones), VHOHFFLRQH6HOI&OHDQ/LPSLH]D$XWRPiWLFD\VHH[KLELUi XQWLHPSRGHOLPSLH]DDXWRPiWLFDSRURPLVLyQ(OWLHPSRGH limpieza puede ser modificado a 3, 4 o 5 horas, usando el dial de selección. Cuando el nivel de suciedad en el horno sea muy alto, VHUHFRPLHQGDXVDUHOWLHPSRGHOLPSLH]DPi[LPRGHKRUDV Si desea usar el tiempo por omisión, presione la tecla Start (Iniciar) inmediatamente luego de seleccionar la tecla Self Clean /LPSLH]D$XWRPiWLFD(OKRUQRVHDSDJDUiGHIRUPDDXWRPiWLFD FXDQGRHOFLFORGHOLPSLH]DDXWRPiWLFDVHDFRPSOHWDGR/D SXHUWDSHUPDQHFHUiEORTXHDGDKDVWDTXHHOKRUQRVHKD\D enfriado. Una vez que el horno se haya enfriado, limpie cualquier ceniza que haya quedado en el horno. IMPORTANTE:/DVHPDQDFLRQHVSURGXFLGDVSRUHOFLFORGH autolimpieza de cualquier horno afectan la salud de algunas aves de manera notoria. Procure llevar sus aves a otra habitación bien ventilada. 49-80741-2 /RVHVWDQWHVTXHIXHURQSURYLVWRVFRQHOKRUQRHVWDQWHV oscuros esmaltados, no brillantes) pueden permanecer en el KRUQRGXUDQWHHOFLFORGHOLPSLH]DDXWRPiWLFD\DTXHHVWHFLFOR QRORVGDxDUi Para limpiar los estantes de forma manual, use agua caliente y jabón. Asegúrese de no lavar el espacio de deslizamiento de un estante extensible. Si resulta difícil retirar los estantes del horno, coloque un poco de aceite vegetal en una tela seca o toalla de papel y frote sobre los soportes de los estantes del horno. No limpie el aceite en el espacio de deslizamiento del estante extensible. 'HIRUPDSHULyGLFDOXHJRGHYDULRVFLFORVGHOLPSLH]D DXWRPiWLFDORVHVSDFLRVGHGHVOL]DPLHQWRGHOHVWDQWH H[WHQVLEOHGHEHUiQVHUOXEULFDGRVXWLOL]DQGROXEULFDQWHGH grafito, enviado junto con su horno de pared. Para ordenar PiVOXEULFDQWHGHJUDILWROHDODVHFFLyQGH$VLVWHQFLD\ Accesorios en el comienzo de este manual. 1. Retire el estante extensible del horno. Consulte la sección GH(VWDQWHV([WHQVLEOHVGHO+RUQR 2. Extienda totalmente el estante sobre una mesa o mesada. 6HSRGUiFRORFDUSDSHOGHSHULyGLFRGHEDMRGHOHVWDQWH SDUDXQDOLPSLH]DIiFLO 3. Si hay restos en las pistas de deslizamiento, limpie los mismos con una toalla de papel. NOTA: Cuando HOOXEULFDQWHGHJUDILWRVHKD\DDFDEDGRGHEHUiVHU reemplazado. 4. Agite el lubricante de grafito antes de abrir el mismo. Comenzando con el mecanismo de deslizamiento del lado izquierdo del estante, coloque cuatro (4) gotas pequeñas de lubricante en los dos (2) espacios inferiores de deslizamiento, cerca de los rulemanes de apoyo. 5. Repita esto sobre el mecanismo del lado derecho del estante. 6. Abra y cierre el estante varias veces para distribuir el lubricante. CUIDADO Y LIMPIEZA: Estantes del Horno Inferior Estantes del Horno Inferior 5HHPSODFHODWDSDGHOOXEULFDQWH\DJLWHHOPLVPR QXHYDPHQWH'pYXHOWDHOHVWDQWH\UHSLWDORVSDVRV y 6. 8. Cierre el estante, gire el estante con el lado derecho hacia arriba y coloque el mismo en el horno. Consulte la sección GH(VWDQWHV([WHQVLEOHVGHO+RUQR 5HSLWDORVSDVRVDQWHULRUHVFRQFDGDHVWDQWH NOTA:1RURFtHFRQHVSUiLGHFRFLQDRFXDOTXLHURWUR OXEULFDQWHHQHVSUiL 49-80741-2 31 CUIDADO Y LIMPIEZA: Mantenimiento del Horno Inferior Mantenimiento del Horno Inferior Reemplazo de la Lámpara del Horno Inferior ADVERTENCIA PELIGRO DE DESCARGA O QUEMADURAS:$QWHVGHUHHPSOD]DUODOiPSDUDGHOX] del horno, desconecte la conexión eléctrica del horno del fusible principal o del panel del GLV\XQWRU6LHVWRQRVHFXPSOHVHSRGUiSURGXFLUXQDGHVFDUJDHOpFWULFDRXQLQFHQGLR PRECAUCIÓN RIESGO DE INCENDIO:/DWDSDGHYLGULR\ODOiPSDUDGHOX]VHGHEHUiQUHWLUDUFXDQGR estén frías. Tocar el vidrio caliente sin protección en las manos o con un trapo húmedo puede ocasionar quemaduras. 'HVFRQHFWHODFRUULHQWHGHVGHHOIXVLEOHSULQFLSDORHOSDQHO del disyuntor. 2. Retire los estantes del horno. 'HVOLFHXQGHVWRUQLOODGRUGHSXQWDSODQDHQWUHODFDMD\OD tapa de luz de vidrio. 4. Apoye la tapa de luz de vidrio con dos dedos para evitar que se caiga al fondo del horno. Tenga cuidado de no astillar la cubierta del horno. 'HIRUPDVXDYHJLUHODSXQWDGHOGHVWRUQLOODGRUSDUDDIORMDU la tapa de luz de vidrio. 6. Retire la tapa de luz de vidrio. 5HWLUHODOiPSDUDVRVWHQLHQGRILUPHPHQWH\GHVOL]DQGR la misma hacia afuera, hasta que las dos clavijas hayan GHMDGRHOVRSRUWHGHFHUiPLFD 1RWRTXHHOYLGULRGHODQXHYDOiPSDUDFRQORVGHGRV(VWR KDUiTXHODOiPSDUDIDOOHDOGDUOX]7RPHODOiPSDUDGH reemplzado con una toalla limpia o un pañuelo de papel con las clavijas hacia abajo. Aliñe las dos clavijas en el VRSRUWHGHFHUiPLFDSUHVLRQDQGRVXDYHPHQWHKDVWDTXHOD OiPSDUDTXHGHDVHJXUDGDHQODILFKDGHFHUiPLFD 'HVOLFHODVOHQWHVSURWHFWRUDVGHOVRSRUWH\SUHVLRQHKDVWD que las pinzas queden enganchadas en la caja. 10. Vuelva a conectar la corriente. Levante la Puerta del Horno Inferior /DSXHUWDHVPX\SHVDGD7HQJDFXLGDGRDOUHWLUDU\OHYDQWDUODSXHUWD No levante la puerta usando la manija. Para retirar la puerta: 1. Abra la puerta totalmente. 2. Empuje los bloqueos de la bisagra hacia abajo en Ranura dirección a la estructura de la puerta, hasta la posición desbloqueada. Es posible que necesite una herramienta tal como un destornillador pequeño de punta plana. 3. Firmemente tome ambos lados de la puerta por la parte superior. 4. Cierre la puerta hasta la posición de retiro de la misma. /DSXHUWDGHEHUtDVHUDELHUWDDSUR[LPDGDPHQWHD´VLQ Bloqueo de la bisagra obstrucción sobre la misma. Empuje los bloqueos de la bisagra /HYDQWHODSXHUWDKDFLDDUULED\DIXHUDKDVWDTXHORV hacia abajo para desbloquear brazos de las bisagras queden fuera de las ranuras. Posición de retiro Para reemplazar la puerta: 1. Firmemente tome ambos lados de la puerta por la parte superior. 2. Comenzando desde el lado izquierdo, con la puerta en el PLVPRiQJXORGHODSRVLFLyQGHUHWLURDSR\HODKHQGLGXUD del brazo de la bisagra en el extremo inferior de la ranura Brazo de GHODELVDJUD/DDEHUWXUDHQHOEUD]RGHODELVDJUDGHEHUi la bisagra estar totalmente apoyada en la parte inferior de la ranura. Repita el procedimiento del lado derecho. 3. Abra la puerta totalmente. Si la puerta no se abre Bloqueo de WRWDOPHQWHODKHQGLGXUDQRHVWiFRUUHFWDPHQWHDSR\DGDHQ la bisagra el extremo inferior de la ranura. Extremo inferior de la ranura 4. Empuje los bloqueos de la bisagra contra la estructura frontal de la cavidad del horno, hasta la posición de bloqueo. 5. Cierre la puerta del horno. 32 Empuje el bloqueo de la bisagra hacia arriba hasta que quede bloqueado Brazo de la bisagra Hendidura 49-80741-2 ¡Ahorre tiempo y dinero! Primero revise los cuadros que aparecen en las siguientes páginas y es posible que no necesite solicitar reparaciones. Problema Causa Posible Qué Hacer La luz durante un ciclo de cocción rápida se atenúa y se cicla incluso a máximos niveles de potencia Esto es normal. El nivel de potencia ha sido se reduce automáticamente debido a que el horno se encuentra caliente. Esto es normal. El horno detecta el nivel de calor y se DMXVWDDXWRPiWLFDPHQWH Luz visible alrededor la compuerta y cubierta externa mientras cocción rápida Esto es normal. Cuando el horno se encuentra encendido la luz sea visible alrededor de la compuerta y cubierta externa. El ventilador continúa funcionando después de terminar de cocinar El horno se está enfriando. (OYHQWLODGRUVHDSDJDUiDXWRPiWLFDPHQWHFXDQGRODV piezas internas del horno se hayan enfriado. El ventilador del horno irradia aire caliente mientras el horno se encuentra encendido Esto es normal. El ventilador se enciende automáticamente cuando utilizando el microondas Esto es normal. LUCES VENTILADOR COCCIÓN El horno hace sonidos inusuales mientras se cocina Chasquidos y ventiladores soplando son normales. El tablero de relés está encendiendo y apagando los componentes. Estos sonidos son normales. Se expulsa humo del horno cuando abro la compuerta Los alimentos tienen alto contenido de grasa. Pulverizador en aerosol utilizado en las bandejas. El humo es normal cuando se cocina alimentos con alto contenido de grasa. La comida no está completamente cocinada o dorada al finalizar un programa de cocción Los tiempos programados podrían no corresponder al tamaño o cantidad de comida que está cocinando. Ajustar el tiempo para nivel de cocción o ajuste las luces superiores o inferiores para asar y para el nivel de cocción. SENSOR ERROR (ERROR DE SENSOR) mostrado junto con una señal del horno Cantidad o tipo de comida colocado en el horno no corresponde con la programación que fue elegido. Apriete el botón Clear/Off (Borrar/ Apagar) Ajuste el programa del horno corresponda con la comida o líquido a ser cocinado o calentado. Vapor no detectado por el horno porque la envoltura plástico no se ventiló, una tapa muy ajustada estaba sobre el plato o se cubrió un líquido. 9HQWLOHODHQYROWXUDGHSOiVWLFRXWLOLFHXQDWDSDPiVIORMDR destape los líquidos cuando los cocine o caliente. Es posible que el modo de ahorro de corriente esté activado. Revise el menú Settings (Configuraciones) para el reloj ajustes de la pantalla. Encienda la pantalla. Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. Corte o exceso de corriente 5HLQLFLHHOUHORM6LHOKRUQRHVWXYRHQXVRGHEHUiUHLQLFLDU el mismo presionando la tecla Clear/Off (Borrar/ Apagar) configurando el reloj y reiniciando cualquier función de cocción. El control ha sido bloqueado. Mantenga presionada la tecla Settings (Configuraciones) durante 3 segundos para desbloquear el control. PANTALLA La pantalla se encuentra en blanco Control is LOCKED (Control BLOQUEADO) aparece en la pantalla 49-80741-2 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS (Horno Superior) Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico 33 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS (Horno Superior) 34 Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico Problema Causa Posible Qué Hacer No se ha programado el reloj. Programe el reloj. Compuerta no cerrada bien. Abra la compuerta y ciérrela bien. La tecla Start/Pause (Iniciar/ Pausar) no se presionó luego de ingresar la configuración de la cocción. Presione la tecla Start/Pause (Iniciar/ Pausar) o el dial de selección. Ya se ha ingresado otra selección en el horno y no se ha apretado el botón Clear/Off (Borrar/ Apagar) para cancelarla. 3UHVLRQHODWHFOD&OHDU2II%RUUDU$SDJDU Tamaño, cantidad o tiempo de cocción no ingresado después de la selección final. Asegúrese que ha ingresado el tiempo después de seleccionar. Se apretó Clear/Off (Borrar/ Apagar) accidentalmente. Reinicie el programa de cocción y presione la tecla Start/ Pause (Iniciar/ Pausar). La compuerta y el interior del horno se sienten calientes Las lámparas térmicas producen calor intenso en un espacio reducido. Esto es normal. Use guantes térmicos de cocina para sacar la comida cuando esté lista. El horno no enciende Un fusible en su hogar puede haberse fundido o el interruptor de circuitos fue activado. Reemplace el fusible o reinicie sus interruptores de circuitos. No puede editar las funciones de cocción Es posible que algunas funciones de cocción programadas previamente no se puedan editar a fin de evitar la degradación del rendimiento de la cocción. Esto es normal. La teclas de este lado del control no funcionan El control bloqueó el uso de estas teclas y se debe reiniciar. Mantenga presionada la tecla Clear/Off (Borrar/ Apagar) del otro lado de la pantalla durante 30 VHJXQGRV6LHVWRQRUHLQLFLDHOFRQWUROSRGUiVHU necesario hacer que el disyuntor realice ciclos. PANTALLA La pantalla de control está iluminada pero el horno no se inicia OTROS PROBLEMAS DECLARACIÓN DE LA FCC SOBRE INTERFERENCIA DE FRECUENCIAS RADIALES Este equipo genera y usa potencia de frecuencia ISM y si no es instalado y usado de forma adecuada, en cumplimiento estricto con las instrucciones del IDEULFDQWHVHSRGUiQRFDVLRQDULQWHUIHUHQFLDVHQ la recepción de radio y televisión. Se realizó una evaluación por tipo y se encontró en cumplimiento con los límites de un equipo ISM, de acuerdo con la parte 18 de las Reglas FCC, que fueron diseñadas para brindar una protección razonable contra dichas interferencias en una instalación residencial. Sin embargo, no se garantiza que no se presenten interferencias en una instalación en particular. Si el equipo provoca interferencias en la recepción de radio o televisión, lo que se puede determinar encendiendo y apagando el equipo, se aconseja al usuario que intente FRUUHJLUODLQWHUIHUHQFLDDWUDYpVGHXQDRPiVGHODV siguientes medidas: ŶReoriente la antena receptora de radio o televisión. Ŷ5HXELTXHHOKRUQRPLFURRQGDVFRQUHVSHFWRDO receptor. Ŷ8ELTXHHOKRUQRPLFURRQGDVHQXQDSRVLFLyQDOHMDGD del receptor. Ŷ(QFKXIHHOKRUQRPLFURRQGDVHQXQWRPDFRUULHQWH diferente, de modo que el horno microondas y el receptor estén en diferentes circuitos de empalmes. El fabricante no es responsable por cualquier interferencia de radio o TV ocasionada por una modificación no autorizada sobre este horno microondas. Es responsabilidad del usuario corregir dicha interferencia. 49-80741-2 Problema Causa Posible Qué Hacer Mi horno nuevo no cocina como el anterior. ¿Hay algún problema con las configuraciones de temperatura? Su horno nuevo cuenta con un sistema de cocción diferente con relación al anterior y, por lo tanto, es posible que cocine de forma diferente. En los primeros usos, use los tiempos y temperaturas de su receta con cuidado. Si aún piensa que su horno nuevo cocina con demasiado FDORURGHPDVLDGRIUtRSRGUiDMXVWDUHOWHUPRVWDWR usted mismo para aplicar su preferencia de cocción específica. NOTA: Este ajuste afecta las WHPSHUDWXUDVGH%DNH+RUQHDU&RQYHFWLRQ%DNH 5DFN+RUQHDUSRU&RQYHFFLyQHQ(VWDQWH\ &RQYHFWLRQ%DNH0XOWL+RUQHDUSRU&RQYHFFLyQ 0~OWLSOHQRDIHFWDUiODVIXQFLRQHV&RQYHFWLRQ 5RDVW'RUDUSRU&RQYHFFLyQ%URLO$VDUR &OHDQ/LPSLDU La comida no se hornea de forma apropiada Controles del horno configurados de forma incorrecta. Consulte la sección Modos de Cocción. La posición del estante es incorrecta o el estante no está nivelado. 6H&RQVXOWHODVHFFLyQ0RGRVGH&RFFLyQ\OD*XtD de Cocción. Uso de una cacerola incorrecta o de una cacerola de tamaño incorrecto. Consulte la sección Utensilios. La temperatura del horno debe ser ajustada. Consulte la sección Settings (Configuraciones). Sustitución de ingredientes Sustituir ingredientes puede modificar el resultado de la receta. Controles del horno configurados de forma incorrecta. Asegúrese de seleccionar el modo correcto para asar. Se usó una posición incorrecta del estante. Para acceder a sugerencias de ubicación de HVWDQWHVFRQVXOWHOD*XtDGH&RFFLyQ Se cocinó comida en una olla caliente. Asegúrese de que el utensilio esté frío Utensilio de cocina inadecuado para asar. Use una olla específicamente diseñada para asar El papel de aluminio usado para la olla y la rejilla para asar no se ajustó ni cortó de forma apropiada, según lo recomendado. 6LXVDUiSDSHOGHDOXPLQLRGHEHUiXVDUVH conforme con las aberturas de la olla. En algunas áreas, es posible que el nivel de corriente (voltaje) sea bajo. Precaliente el elemento para asar durante 10 minutos. La temperatura del horno es demasiado caliente o demasiado fría La temperatura del horno debe ser ajustada. Consulte la sección Settings (Configuraciones). El horno no funciona o parece no funcionar Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. Controles del horno configurados de forma incorrecta. &RQVXOWHODVHFFLyQ8VRGHO+RUQR El horno se encuentra en Sabbath Mode (Modo Sabático) Verifique que el horno no esté en Sabbath Mode 0RGR6DEiWLFR&RQVXOWHODVHFFLyQGHO0RGR 6DEiWLFR Sonido de “chisporroteo” o “traqueo” Éste es el sonido de metal calentándose o enfriándose durante las funciones de cocción y limpieza. Esto es normal. ¿Por qué la estufa hace un sonido de “clic” cuando uso el horno? Su estufa fue diseñada para mantener un control más ajustado sobre la temperatura del horno. Es posible que escuche que los elementos de calentamiento del horno hagan sonidos de “clic” con mayor frecuencia que con hornos más antiguos para lograr mejores resultados durante los ciclos de horneado, asado, convección y limpieza automática. Esto es normal. El reloj y el temporizador no funcionan Es posible que un fusible de su hogar se haya quemado o que el disyuntor se haya desconectado. Reemplace el fusible o reinicie el disyuntor. La comida no asa de forma apropiada 49-80741-2 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS (Horno Inferior) Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico 35 CONSEJOS PARA LA SOLUCIÓN DE PROBLEMAS (Horno Inferior) 36 Consejos para la Solución de Problemas... Antes de solicitar el servicio técnico Problema Causa Posible Qué Hacer La luz del horno no funciona La lámpara está floja o presenta defectos. $MXVWHRUHHPSODFHODOiPSDUD La luz de funcionamiento del interruptor está rota. /ODPHDOVHUYLFLRWpFQLFR La temperatura del horno es demasiado caliente como para configurar la limpieza automática. Espere a que el horno se enfríe y reinicie los controles. Los controles del horno están configurados de forma incorrecta. &RQVXOWHODVHFFLyQGH/LPSLH]DGHO+RUQR Exceso de humo durante un ciclo de limpieza Suciedad o grasa excesiva. Presione la tecla Clear/Off (Borrar/ Apagar) Abra las ventanas para liberar el humo en la habitación. Espere hasta que la SDQWDOOD29(1,6&22/,1*'225,6/2&.('(OKRUQRVH HVWiHQIULDQGRODSXHUWDHVWiEORTXHDGDGHVDSDUH]FD/LPSLH el exceso de suciedad y reinicie el ciclo de limpieza. Humo excesivo al asar La comida está demasiado cerca del quemador. %DMHODSRVLFLyQGHOHVWDQWHFRQFRPLGD La puerta del horno no se abrirá luego de un ciclo de limpieza El horno está demasiado caliente. Espere a que el horno se enfríe por debajo de la temperatura de bloqueo. El horno no limpia luego de un ciclo de limpieza Los controles del horno están configurados de forma incorrecta. &RQVXOWHODVHFFLyQGH/LPSLH]DGHO+RUQR El horno estaba demasiado sucio. /LPSLHGHUUDPHVH[FHVLYRVDQWHVGHLQLFLDUHOFLFORGH limpieza. Es posible que, en hornos con mucha suciedad, VHDQHFHVDULRXVDUODOLPSLH]DDXWRPiWLFDQXHYDPHQWHR XVDUODGXUDQWHXQSHUtRGRGHWLHPSRPiVSURORQJDGR Aparece “CLOSE DOOR TO CONTINUE COOKING” (Cierre la puerta para continuar cocinando) en la sección de pantalla La puerta está abierta durante una función de cocción o limpieza. Cierre la puerta del horno. Aparece “OVEN IS COOLING DOOR IS LOCKED” (El horno se está enfriando; la puerta está bloqueada) en la sección de pantalla. La puerta del horno está bloqueada debido a que la temperatura interior del horno no descendió por debajo de la temperatura de bloqueo. Presione la tecla Clear/Off (Borrar/ Apagar) 'HMHTXHHO horno se enfríe. En la pantalla se muestra un error del horno y “SERVICE MAY BE NEEDED” (Es posible que necesite el servicio técnico). Tiene un código de error de función. Presione la tecla Clear/Off (Borrar/ Apagar) Permita que el horno se enfríe durante una hora. Vuelva a poner el horno en funcionamiento. Si el código de función se repite. 'HVFRQHFWHWRWDOPHQWHODFRUULHQWHGHODFRFLQDGXUDQWHSRU lo menos 30 minutos y vuelva a conectar la misma. Si el código de error de función se repite, llame al servicio técnico. Olor a “quemado” o “aceite” desde la ventilación Esto es normal en un horno nuevo y desaparecerá con el tiempo. Para acelerar el proceso, configure un ciclo de limpieza DXWRPiWLFDSRUXQPtQLPRGHKRUDV&RQVXOWHODVHFFLyQGH /LPSLH]DGHO+RUQR Olor fuerte Un olor en la aislación alrededor del interior del horno es normal desde las primeras veces en que el horno es usado. (VWRHVWHPSRUDULR\GHVDSDUHFHUiOXHJRGHYDULRVXVRVRGH XQFLFORGHOLPSLH]DDXWRPiWLFD Ruido del ventilador Es posible que un ventilador de enfriamiento se active automáticamente. (VWRHVQRUPDO(OYHQWLODGRUGHHQIULDPLHQWRVHHQFHQGHUi para enfriar las partes internas. Es posible que funcione hasta durante una hora y media, una vez que el horno se haya apagado. La puerta de vidrio del horno parece estar “teñida” o tener un color “arcoíris”. ¿Es esto un defecto? No. El vidrio del horno interno está cubierto con una barrera de calor que refleja este último nuevamente hacia el horno, a fin de evitar la pérdida de calor y de mantener fría la puerta externa mientras se hornea. (VWRHVQRUPDO%DMRFLHUWDVOXFHV\iQJXORVHVSRVLEOHTXH visualice esta tinta o arcoíris. A veces el horno tarda más en precalentarse a la misma temperatura Utensilio o comida en el horno (OXWHQVLOLRRODFRPLGDHQHOKRUQRKDUiTXHpVWHWDUGH PiVHQSUHFDOHQWDUVH5HWLUHHVWRVDUWtFXORVSDUDUHGXFLUHO tiempo de precalentamiento. Número de estantes en el horno $JUHJDUPiVHVWDQWHVDOKRUQRKDUiTXHpVWHWDUGHPiVHQ precalentarse. Retire algunos estantes. Diferentes modos de cocción /RVGLIHUHQWHVPRGRVGHFRFFLyQXWLOL]DQGLIHUHQWHVPpWRGRV de precalentamiento para calentar el horno en un modo de FRFFLyQHVSHFtILFR$OJXQRVPRGRVWDUGDUiQPiVTXHRWURV (tales como: horneado por convección múltiple). El modo de limpieza automática del horno no funciona 49-80741-2
advertisement
* Your assessment is very important for improving the workof artificial intelligence, which forms the content of this project
Related manuals
advertisement