Brady POWERMark Specifications

Brady POWERMark Specifications
Copyright
7KLVPDQXDOLVFRS\ULJKWHGZLWKDOOULJKWVUHVHUYHG1RSRUWLRQRIWKLVPDQXDOPD\EHFRSLHGRUUHSURGXFHGE\DQ\
PHDQVZLWKRXWWKHSULRUFRQVHQWRI%UDG\:RUOGZLGH,QF
:KLOHHYHU\SUHFDXWLRQKDVEHHQWDNHQLQSUHSDUDWLRQRIWKLVGRFXPHQW%UDG\DVVXPHVQROLDELOLW\WRDQ\SDUW\IRUDQ\
ORVVRUGDPDJHFDXVHGE\HUURUVRURPLVVLRQVRUE\VWDWHPHQWVUHVXOWLQJIURPQHJOLJHQFHDFFLGHQWRUDQ\RWKHUFDXVH
%UDG\IXUWKHUDVVXPHVQROLDELOLW\DULVLQJRXWRIWKHDSSOLFDWLRQRUXVHRIDQ\SURGXFWRUV\VWHPGHVFULEHGKHUHLQQRUDQ\
OLDELOLW\IRULQFLGHQWDORUFRQVHTXHQWLDOGDPDJHVDULVLQJIURPWKHXVHRIWKLVGRFXPHQW%UDG\GLVFODLPVDOOZDUUDQWLHVRI
PHUFKDQWDELOLW\RUILWQHVVIRUDSDUWLFXODUSXUSRVH
%UDG\UHVHUYHVWKHULJKWWRPDNHFKDQJHVZLWKRXWIXUWKHUQRWLFHWRDQ\SURGXFWRUV\VWHPKHUHLQWRLPSURYHUHOLDELOLW\
IXQFWLRQRUGHVLJQ
5HSURGXFWLRQRIWKLVPDWHULDOLQSDUWRUZKROHLVVWULFWO\SURKLELWHGZLWKRXWWKHZULWWHQSHUPLVVLRQRI%UDG\:RUOGZLGH
,QF)RUPRUHLQIRUPDWLRQFRQWDFW%UDG\:RUOGZLGH,QF6LJQPDUNŠ'LYLVLRQ:&DPGHQ5RDG0LOZDXNHH:,
Disclaimer
(YHU\HIIRUWKDVEHHQPDGHWRPDNHWKLVJXLGHDVDFFXUDWHDQGFRPSOHWHDVSRVVLEOH%UDG\:RUOGZLGH,QFLVQRW
UHVSRQVLEOHIRUODEHOLQJLQDFFXUDFLHVDQGRPLVVLRQVRFFXUULQJGXULQJWKHXVHRIWKLVJXLGH
7KLVPDQXDOLVSURSULHWDU\WR%UDG\:RUOGZLGH,QFDQGPD\EHUHYLVHGIURPWLPHWRWLPHZLWKRXWQRWLFH%UDG\
:RUOGZLGH,QFGLVFODLPVDQ\XQGHUVWDQGLQJWRSURYLGH\RXZLWKUHYLVLRQVLIDQ\
$OOEUDQGRUSURGXFWQDPHVUHIHUHQFHGLQWKLVPDQXDODUHWUDGHPDUNVRUUHJLVWHUHGWUDGHPDUNVRIWKHLUUHVSHFWLYH
FRPSDQLHVRURUJDQL]DWLRQV
‹%UDG\:RUOGZLGH,QF$OOULJKWVUHVHUYHG
ZZZEUDG\FRUSFRP
System Warranty
7KLVV\VWHPLVZDUUDQWHGWREHIUHHRIGHIHFWVLQPDWHULDOVDQGZRUNPDQVKLSXQGHUQRUPDOXVHIRUD
SHULRGRIPRQWKVIURPWKHGDWHRISXUFKDVH
7KLVZDUUDQW\DSSOLHVWRWKHRULJLQDOSXUFKDVHURQO\7KLVZDUUDQW\LVYRLGLIWKHV\VWHPKDVEHHQ
WDPSHUHGZLWKLQDQ\ZD\ZLWKRXWWKHH[SUHVVZULWWHQFRQVHQWRI%UDG\:RUOGZLGH,QF
,IWKHPDFKLQHUHTXLUHVUHSDLUGXULQJWKHZDUUDQW\SHULRGFDOOWRUHFHLYHDUHWXUQ
DXWKRUL]DWLRQQXPEHUWKHQVKLSWKHPDFKLQHEDFNWRXVLQWKHRULJLQDOFRQWDLQHUDORQJZLWKDFRS\RI
WKHVDOHVLQYRLFHWR%UDG\:RUOGZLGH,QF6LJQPDUNŠ'LYLVLRQ:&DPGHQ5RDG0LOZDXNHH
:,$WWHQWLRQ5HSDLU7KHPDFKLQHZLOOEHUHWXUQHGWR\RXDIWHUUHSDLUIUHLJKWSUHSDLGE\
%UDG\:RUOGZLGH,QF
,1&$1$'$FDOOWRUHFHLYHDUHWXUQDXWKRUL]DWLRQQXPEHUWKHQVKLSWKHPDFKLQHWR
XVLQWKHRULJLQDOFRQWDLQHUDORQJZLWKDFRS\RIWKHVDOHVLQYRLFHWR:+%UDG\,QF6LJQPDUNŠ
'LYLVLRQ/HHN&U5LFKPRQG+LOO21/%+$WWHQWLRQ5HSDLU7KHPDFKLQHZLOOEH
UHWXUQHGWR\RXDIWHUUHSDLUIUHLJKWSUHSDLGE\:+%UDG\,QF
Brady Warranty
2XUSURGXFWVDUHVROGZLWKWKHXQGHUVWDQGLQJWKDWWKHEX\HUZLOOWHVWWKHPLQDFWXDOXVHDQGGHWHUPLQH
IRUKLPRUKHUVHOIWKHLUDGDSWDELOLW\WRKLVKHULQWHQGHGXVHV%UDG\ZDUUDQWVWRWKHEX\HUWKDWLWV
SURGXFWVDUHIUHHIURPGHIHFWVLQPDWHULDODQGZRUNPDQVKLSEXWOLPLWVLWVREOLJDWLRQXQGHUWKLV
ZDUUDQW\WRUHSODFHPHQWRIWKHSURGXFWVKRZQWR%UDG\·VVDWLVIDFWLRQWRKDYHEHHQGHIHFWLYHDWWKHWLPH
%UDG\VROGLW7KLVZDUUDQW\GRHVQRWH[WHQGWRDQ\SHUVRQVREWDLQLQJWKHSURGXFWIURPWKHEX\HU
7+,6:$55$17<,6,1/,(82)$1<27+(5:$55$17<(;35(6625,03/,('
,1&/8',1*%87127/,0,7('72$1<,03/,(':$55$17<2)
0(5&+$17$%,/,7<25),71(66)25$3$57,&8/$5385326($1'2)$1<27+(5
2%/,*$7,21625/,$%,/,7<21%5$'<·63$5781'(512&,5&8067$1&(6:,//
%5$'<%(/,$%/()25$1</266'$0$*((;3(16(25&216(48(17,$/
'$0$*(62)$1<.,1'$5,6,1*,1&211(&7,21:,7+7+(86(25,1$%,/,7<
7286(%5$'<·6352'8&76
ii
FCC Notice - US Only
:DUQLQJ7KLVHTXLSPHQWJHQHUDWHVXVHVDQGFDQUDGLDWHUDGLRIUHTXHQF\HQHUJ\,IQRWLQVWDOOHGDQG
XVHGLQDFFRUGDQFHZLWKWKHPDQXIDFWXUHU·VLQVWUXFWLRQVLWPD\FDXVHLQWHUIHUHQFHWRUDGLR
FRPPXQLFDWLRQV,WKDVEHHQWHVWHGDQGIRXQGWRFRPSO\ZLWKWKHOLPLWVIRUD&ODVV$FRPSXWLQJ
GHYLFHSXUVXDQWWR6XESDUW%RI3DUWRIWKH)&&UXOHVZKLFKDUHGHVLJQHGWRSURYLGHUHDVRQDEOH
SURWHFWLRQDJDLQVWLQWHUIHUHQFHZKHQRSHUDWLQJLQDFRPPHUFLDOHQYLURQPHQW2SHUDWLRQRIWKLV
HTXLSPHQWLQDUHVLGHQWLDODUHDLVOLNHO\WRFDXVHLQWHUIHUHQFHLQZKLFKFDVHUHTXLUHGFRUUHFWLYH
PHDVXUHVZLOOEHDWWKHRZQHU·VH[SHQVH
7KHXVHULVFDXWLRQHGWKDWDQ\FKDQJHVRUPRGLILFDWLRQVQRWH[SUHVVO\DSSURYHGE\%UDG\:RUOGZLGH
,QFFRXOGYRLGWKHXVHU·VDXWKRULW\WRXVHWKHHTXLSPHQW
Canada
7KLV&ODVV$GLJLWDODSSDUDWXVPHHWVDOOUHTXLUHPHQWVRIWKH&DQDGLDQ,QWHUIHUHQFH&DXVLQJ(TXLSPHQW
5HJXODWLRQV
&HWDSSDUHLOQXPHULTXHGHODFODVVH$UHVSHFWHWRXWHVOHVH[LJHQFHVGX5HJOHPHQWVXUOHPDWHULDO
EURLOOHXUGX&DQDGD
Europe
7KLVLVD&ODVV$SURGXFW,QDGRPHVWLFHQYLURQPHQWWKLVSURGXFWPD\FDXVHUDGLRLQWHUIHUHQFHLQ
ZKLFKFDVHWKHXVHUPD\EHUHTXLUHGWRWDNHDGHTXDWHPHDVXUHV
iii
International Power Cords
8VHUVLQFRXQWULHVRXWVLGHRI1RUWK$PHULFDPD\KDYHWRVXSSO\WKHLURZQSRZHUFRUGIRUFRQQHFWLQJ
WKHV\VWHPWRDQ$&HOHFWULFDORXWOHW7KHWDEOHEHORZVKRZVWKHVSHFLILFDWLRQVIRUWKHSRZHUFRUGWR
EHXVHGLQYDULRXVFRXQWULHV
In this country:
6ZHGHQ'HQPDUN1RUZD\)LQODQG+ROODQG
6ZLW]HUODQG$XVWULD*HUPDQ\,WDO\%HOJLXP
)UDQFH6SDLQ3RUWXJDO+XQJDU\
Use this power cord:
6SHFLILFDWLRQV
SOXJ
FRQQHFWRU
FRQGXFWRUVL]H
GHVFULSWLRQ
W\SVWUDQGLQJ
FXUUHQWUDWLQJ
YROWDJHUDWLQJ
PD[LPXPOHQJWK
8QLWHG.LQJGRP,UHODQG6RXWK$IULFD
6SHFLILFDWLRQV
SOXJ
FRQQHFWRU
FRQGXFWRUVL]H
GHVFULSWLRQ
W\SVWUDQGLQJ
FXUUHQWUDWLQJ
YROWDJHUDWLQJ
PD[LPXPOHQJWK
$XVWUDOLD1HZ=HDODQG
6SHFLILFDWLRQV
SOXJ
FRQQHFWRU
FRQGXFWRUVL]H
GHVFULSWLRQ
W\SVWUDQGLQJ
FXUUHQWUDWLQJ
YROWDJHUDWLQJ
PD[LPXPOHQJWK
iv
&((
,(&
[PP
+99)*
PP
$
9$&
OHVVWKDQPHWHUV
%6$
,(&
[PP
+99)*
PP
$
9$&
OHVVWKDQPHWHUV
$6
,(&
[PP
$6
PP
$
9$&
OHVVWKDQPHWHUV
Specifications
3K\VLFDOFKDUDFWHULVWLFV
6L]H[[LQFKHV[[FP
:HLJKWSRXQGVNJ
(QYLURQPHQWDOFKDUDFWHULVWLFV
$PELHQWRSHUDWLQJWHPSHUDWXUH°)WR°)°&WR°&
5HODWLYHKXPLGLW\WRQRQFRQGHQVLQJ
6WRUDJHUHTXLUHPHQWV°)WR°)°&WR°&UHODWLYHKXPLGLW\WRQRQ
FRQGHQVLQJ
(OHFWULFDOFKDUDFWHULVWLFV
,QSXWFXUUHQW$PSV
,QSXWYROWDJHV9$&
,QSXWIUHTXHQF\WR+]
v
Contents
System Basics 1-1
6HWWLQJXS\RXUV\VWHP
8QSDFNLQJDQGVHWWLQJXSWKHSULQWHU
,QVHUWLQJDQGUHPRYLQJWDSH
,QVHUWLQJDQGUHPRYLQJULEERQ
8VLQJWKHGLVSOD\VFUHHQ
7KHWH[WHQWU\DUHD
7KHQDYLJDWLRQDUHD
7KHSUHYLHZDUHD
7KHVHOHFWLRQZLQGRZ
0DUNHUV
6\VWHPPHVVDJHV
8VLQJWKHNH\ERDUG
2YHUW\SLQJDQGLQVHUWLQJ
'HOHWLQJDQGFOHDULQJ
7\SLQJDOOFDSLWDOOHWWHUV
8VLQJIXQFWLRQNH\V
7\SLQJVSHFLDOFKDUDFWHUV
7\SLQJDFFHQWHGFKDUDFWHUV
6HWWLQJV\VWHPGHIDXOWV
&KHFNLQJV\VWHPVWDWXV
Label Creation 2-1
&UHDWLQJDEDVLFODEHO
/DEHOFUHDWLRQRSWLRQV
+RZLQVWDOOHGULEERQVDIIHFWODEHOFRPSRVLWLRQ
$GGLQJOLQHVODEHOVDQGDUHDVWRIUHHIRUPODEHOV
&UHDWLQJODEHOVZLWKPXOWLSOHOLQHV
&RUUHFWLQJPXOWLSOHOLQHSUREOHPV
(QWHULQJPXOWLSOHODEHOV
&UHDWLQJODEHOVZLWKPXOWLSOHDUHDV
8VLQJVWDQGDUGOD\RXWV
(QWHULQJWH[WLQDVWDQGDUGOD\RXW
8VLQJODEHORSWLRQVLQVWDQGDUGOD\RXWV
8VLQJVSHFLDOW\DSSOLFDWLRQV
Label Design 3-1
&KDQJLQJWKHORRNRIWKHWH[W
6HOHFWLQJDIRQW
&KDQJLQJW\SHVL]H
&KDQJLQJW\SHRSWLRQV
$GGLQJJUDSKLFV
&KDQJLQJWKHORRNRIWKHODEHO
6HWWLQJODEHOOHQJWK
6HOHFWLQJODEHORSWLRQV
vi
Contents
$GGLQJIUDPHV
8VLQJWKHGDWHDQGWLPHRSWLRQ
(QWHULQJWKHGDWHDQGWLPHRQDODEHO
6HWWLQJWKHWLPH
6HWWLQJWKHGDWH
6HWWLQJWKHGDWHWLPHIRUPDW
&UHDWLQJVHTXHQFHV
:RUNLQJZLWKEDUFRGHV
,QVHUWLQJDEDUFRGHRQDODEHO
6HOHFWLQJEDUFRGHRSWLRQV
Printing 4-1
:RUNLQJZLWKVXSSOLHV
6XSSO\WDSH
6XSSO\ULEERQ
6HOHFWLQJULEERQW\SH
6ZDSSLQJULEERQVGXULQJSULQWLQJ
2SHUDWLQJWKHV\VWHPZLWKRXWVXSSOLHVLQVWDOOHG
&KDQJLQJVXSSOLHV
6XSSO\VWRUDJHDQGKDQGOLQJ
3ULQWLQJODEHOV
3ULQWLQJPXOWLSOHFRSLHV
&KDQJLQJSULQWGHQVLW\WKHUPDOHQHUJ\
Label Storage 5-1
,QVWDOOLQJDQGUHPRYLQJPHPRU\FDUGV
&KHFNLQJDYDLODEOHPHPRU\
6DYLQJILOHV
*HWWLQJVDYHGILOHV
&RS\LQJILOHVWRRUIURPDPHPRU\FDUG
3ULQWLQJDOLVWRIVDYHGILOHV
'HOHWLQJVDYHGILOHV
&OHDULQJDPHPRU\FDUG
Using the Printer With a PC 6-1
5HTXLUHPHQWV
6HWWLQJXSWKHSULQWGULYHU
,QVWDOOLQJWKHSULQWGULYHU
&RQILJXULQJWKHSULQWGULYHU
6HWWLQJXSWKHSULQWGULYHURQRWKHUQHWZRUN3&VUXQQLQJ:LQGRZV17
6HWWLQJXSDQGXVLQJWKHSULQWHUFRQWUROXWLOLW\
,QVWDOOLQJWKHSULQWHUFRQWUROXWLOLW\
8VLQJWKHSULQWHUFRQWUROXWLOLW\
&RQQHFWLQJWKHV\VWHPWRD3&
3ULQWLQJIURPD3&
Cleaning and Maintenance 7-1
&OHDQLQJWKHV\VWHP
0DLQWDLQLQJWKHV\VWHP
vii
Index
Hazardous Waste Labels Application
Pipe Markers Application
Signs Application
Symbols Reference
viii
Contents
Chapter 1: System Basics
:HOFRPH7KLVXVHU·VJXLGHGHVFULEHV\RXUQHZODEHOLQJV\VWHPZKLFKOHWV\RXFUHDWH
DQGSULQWSURIHVVLRQDOORRNLQJODEHOVDQGVLJQVIRUXVHMXVWDERXWDQ\ZKHUH$OO\RX
QHHGWRGRLVSRSLQWKHULEERQDQGWDSH\RXZDQWWRXVHW\SH\RXUWH[WDQGSULQW
<RXUODEHORUVLJQSULQWVRQDGKHVLYHEDFNHGWDSHWKDWFDQEHSODFHGZKHUHYHU\RX
QHHGFOHDUHDV\WRUHDGODEHOVDQGVLJQV
7KHV\VWHPLVGHVLJQHGWRKDQGOHDUDQJHRIWDSHZLGWKVIURPWRLQFKHVWR
PPWRSURYLGHWKHYHUVDWLOLW\\RXQHHG,QDGGLWLRQWKHV\VWHPFDQXVHVSHFLDO
ULEERQVWKDWFRQWDLQPXOWLSOHFRORUVDOORZLQJ\RXWRGHVLJQODEHOVDQGVLJQVWKDWDUH
WUXO\H\HFDWFKLQJ
7RW\SH\RXUODEHOVDQGVLJQV\RXXVHWKHVWDQGDUGNH\ERDUGDWWDFKHGWRWKHSULQWHU
$GLVSOD\VFUHHQRQWKHIURQWRIWKHSULQWHUOHWV\RXSUHYLHZZKDW\RX·YHW\SHG%\
MXVWSUHVVLQJWKHIXQFWLRQNH\VRQWKHNH\ERDUG\RXFDQHDVLO\DSSO\VSHFLDOW\SH
HIIHFWVFKDQJHWKHIRQWDGGJUDSKLFVLQFRUSRUDWHEDUFRGHV³DQGPRUH<RXFDQ
HYHQVDYH\RXUODEHOVDQGVLJQVVRWKDW\RXFDQSULQWPRUHFRSLHVZKHQ\RXQHHG
WKHPE\MXVWSUHVVLQJDIHZNH\V
7KLVXVHU·VJXLGHFRYHUVDOOV\VWHPIHDWXUHV)ROORZWKHVWHSVLQWKLVFKDSWHUIRU
VHWWLQJXS\RXUV\VWHPDQG\RXUV\VWHPZLOOEHUHDG\WRJRLQQRWLPH7KHQPRYHRQ
WR&KDSWHUZKHUH\RX·OOILQGVWHSE\VWHSLQVWUXFWLRQVIRUFUHDWLQJDODEHO:H
HQFRXUDJH\RXWRWU\RXWWKHYDULHW\RIRSWLRQVGHVFULEHGLQWKHUHPDLQLQJFKDSWHUV
DQGVHHMXVWZKDW\RXUV\VWHPFDQGR:KRHYHUVDLGZRUNFRXOGQ·WEHIXQ
1-1
Setting up your system
7KLVVHFWLRQGHVFULEHVKRZWRJHW\RXUV\VWHPXSDQGUXQQLQJ,WLQFOXGHV
LQVWUXFWLRQVIRULQVWDOOLQJRUUHSODFLQJWKHULEERQDQGWDSHVXSSOLHV
Unpacking and setting up the printer
<RXUV\VWHPLVVRHDV\WRVHWXS\RX·OOEHFUHDWLQJODEHOVLQMXVWPLQXWHV)ROORZWKHVH
VWHSVWRJHWVWDUWHG
1) Remove the bag from around the printer.
2) Press the red cover release button and raise the printer cover up and away to the
left.
7KHUHOHDVHEXWWRQLVORFDWHGRQWKHORZHUULJKWVLGHRIWKHSULQWHU
Printer cover
Cover release button
3) Remove and discard the foam piece that surrounds the printhead inside the
printer.
1-2
System Basics
4) Close the printer cover by pressing down on the top right side until you hear it
click into place.
Keyboard plug
5) Plug the keyboard into the lower right side of the printer as shown above.
6) Plug the power cord into the back of the printer as shown below. Plug the other
end of the cord into an AC power outlet.
On/off switch
Power plug
Note: %HVXUHWKH$&SRZHURXWOHWLVORFDWHGQHDUWKHSULQWHUDQGLV
HDVLO\DFFHVVLEOH
Note: 8VHUVLQFRXQWULHVRXWVLGHRI1RUWK$PHULFDPD\QHHGWRVXSSO\
WKHLURZQSRZHUFRUGWRPHHWWKHVSHFLILFDWLRQVUHTXLUHGLQLQGLYLGXDO
FRXQWULHV)RULQIRUPDWLRQRQSRZHUFRUGUHTXLUHPHQWVUHIHUWRWKH
WDEOHRQSDJHYLQWKLVJXLGH
7) Follow the steps in the next two subsections in this chapter to load ribbon and
tape in the printer.
Setting up your system
1-3
8) To turn on the system’s power, push down on the left side of the power switch
(the 1 position). Refer to the illustration in step 6.
:KHQ\RXILUVWWXUQWKHV\VWHPRQDQLQWURGXFWRU\VFUHHQGLVSOD\VEULHIO\DQGWKHQ
WKH$SSOLFDWLRQZLQGRZDSSHDUV7KHLWHPVOLVWHGGHSHQGRQZKLFKDSSOLFDWLRQV
DUHDYDLODEOHLQ\RXUV\VWHP
Application
Freeform
Signs
Hazardous Waste Labels
Pipe Markers
Press ↑↓, ENTER or SETUP
Note: ,IVXSSOLHVDUHQRWLQVWDOOHGZKHQ\RXWXUQRQWKHV\VWHPWKH
´8QNQRZQVXSSO\W\SHµPHVVDJHDSSHDUV5HIHUWR´:RUNLQJZLWK
VXSSOLHVµRQSDJHIRUGHWDLOVRQWKLVPHVVDJHDQGKRZWRUHVSRQGWR
LW$OVRQRWHWKDWLIWKHV\VWHPGRHVQ·WGHWHFWDNH\ERDUGLWDVVXPHV\RX
ZDQWWRFRQWUROLWIURPD3&DQGWKH´2QOLQHµPHVVDJHGLVSOD\V5HIHU
WR&KDSWHU´8VLQJWKH3ULQWHU:LWKD3&µIRUGHWDLOV
5HIHUWR´8VLQJWKHGLVSOD\VFUHHQµRQSDJHIRUGHWDLOVRQXVLQJWKHZLQGRZV
DQGIRURWKHULQWURGXFWRU\LQIRUPDWLRQDERXWWKHV\VWHP7KHQUHIHUWRWKH
UHPDLQLQJFKDSWHUVLQWKLVJXLGHIRUGHWDLOVRQFUHDWLQJODEHOVDQGPDNLQJWKHP
ORRNMXVWWKHZD\\RXZDQW
Inserting and removing tape
7KLVVHFWLRQGHVFULEHVKRZWRLQVHUWDQGUHPRYHWKHV\VWHP·VVXSSO\WDSH7KHVH
GLUHFWLRQVDVVXPHWKDW\RXDUHIDFLQJWKHIURQWRIWKHSULQWHUZKHUHWKHGLVSOD\VFUHHQ
LVORFDWHG
Note: :KHQ\RXRSHQWKHSULQWHU\RX·OOVHHDVHWRILOOXVWUDWLRQVDWWDFKHG
WRWKHLQVLGHRIWKHXQLW7KHVHLOOXVWUDWLRQVVKRZ\RXKRZWRLQVWDOOWKH
WDSHRQWKHULJKWVLGHRIWKHSULQWHUDQGWKHULEERQRQWKHOHIWVLGH
,OOXVWUDWLRQVILYHWKURXJKVHYHQUHIHUWRWDSHORDGLQJ
1) Press the red cover release button and raise the printer cover up and away to the
left.
7KHUHOHDVHEXWWRQLVORFDWHGRQWKHORZHUULJKWVLGHRIWKHSULQWHUDVVKRZQRQ
SDJH
2) If a roll of tape is already installed, remove it.
1-4
System Basics
•
)OLSWKHEOXHPHPRU\FHOOIODJFRXQWHUFORFNZLVHRXWRIWKHUHGPHPRU\FHOO
KROGHU
•
5RWDWHWKHWDSHUROOFORFNZLVHXQWLOWKHOHDGLQJHGJHRIWKHWDSHLVUHPRYHG
IURPWKHWDSHIHHGVORWDQGVWDUWVWRUHZLQGDURXQGWKHWDSHUROO
•
*UDVSWKHWDSHVSRRODQGSXOOLWWRZDUG\RXFRPSUHVVLQJWKHVSULQJRQWKH
QHDUVLGHRIWKHSULQWHU:KHQWKHJUD\WDSHUROOLQVHUWLVQRORQJHUFRYHULQJ
WKHEOXHGULYHFRQHOLIWWKHWDSHVSRRORXWRIWKHSULQWHU
3) If you are inserting a new roll of tape, remove the shrinkwrap from it and pull off
the yellow tab. Hold the tape spool you are inserting so that the blue memory
cell flag is on the far side of the roll.
Blue memory cell flag
Tape spool
4) Place the near end of the gray tape roll insert over the blue drive cone in the
lower right side of the machine. Pull the tape spool toward you, then place the
opposite end of the gray tape roll insert over the blue drive cone on that side.
Setting up your system
1-5
5) Flip the blue memory cell flag clockwise so that it is seated in the red memory
cell holder.
6) Lift and remove the tape wiper from the printer.
,I\RXQHHGWRUHSODFHWKHZLSHUSDGVHH´&OHDQLQJWKHV\VWHPµRQSDJH
Tape wiper
7) Grasp the leading edge of the tape and guide it over the metal bar and black roller
and into the red tape feed slot. (Note that you may need to first slide the two red
tape guides out of the way.)
1-6
System Basics
$VHWRIDUURZVPDUNVWKHWDSHIHHGVORW)HHGWKHWDSHLQEHORZWKRVHDUURZV
Tape feed slot
Black roller
Metal bar
Tape guides
8) Slide the two red tape guides towards the tape so they snap into place along
each side of the tape, as shown above.
9) Replace the tape wiper.
10) Close the printer cover by pressing down on the top right side until you hear it
click into place.
Inserting and removing ribbon
7KLVVHFWLRQGHVFULEHVKRZWRLQVHUWDQGUHPRYHWKHV\VWHP·VVXSSO\ULEERQ7KHVH
GLUHFWLRQVDVVXPHWKDW\RXDUHIDFLQJWKHIURQWRIWKHSULQWHUZKHUHWKHGLVSOD\VFUHHQ
LVORFDWHG
Note: :KHQ\RXRSHQWKHSULQWHU\RX·OOVHHDVHWRILOOXVWUDWLRQVDWWDFKHG
WRWKHLQVLGHRIWKHXQLW7KHVHLOOXVWUDWLRQVVKRZ\RXKRZWRLQVWDOOWKH
WDSHRQWKHULJKWVLGHRIWKHSULQWHUDQGWKHULEERQRQWKHOHIWVLGH
,OOXVWUDWLRQVUHIHUWRULEERQORDGLQJ
1) If this is the first time you have used the printer, unpack the clear plastic ribbon
cartridge case, and remove the wrapping.
2) Press the red cover release button on the printer, and raise the printer cover up
and away to the left.
7KHUHOHDVHEXWWRQLVORFDWHGRQWKHORZHUULJKWVLGHRIWKHSULQWHUDVVKRZQRQ
SDJH
Setting up your system
1-7
3) If a ribbon is already installed, remove the ribbon cartridge case from the printer.
•
/RFDWHWKHFOHDUULEERQFDUWULGJHFDVHLQWKHXSSHUOHIWVLGHRIWKHSULQWHU
•
)OLSWKHEOXHPHPRU\FHOOIODJFRXQWHUFORFNZLVHRXWRIWKHUHGPHPRU\FHOO
KROGHU
•
6QDSWKHKRRNRQWKHPHPRU\FHOOIODJWRWKHULEERQFDUWULGJHFDVH
Ribbon cartridge case
Memory cell flag
•
*UDVSERWKVLGHVRIWKHULEERQFDUWULGJHFDVHDQGSXOOLWWRZDUG\RX
FRPSUHVVLQJWKHVSULQJRQWKHQHDUVLGHRIWKHSULQWHU
•
:KHQWKHIDUVLGHRIWKHJUD\ULEERQUROOLQVHUWVQRORQJHUFRYHUWKHEOXHGULYH
FRQHVOLIWWKHULEERQFDUWULGJHFDVHRXWRIWKHSULQWHU
Ribbon wiper is located here
beneath the ribbon cartridge.
1-8
System Basics
4) Set the ribbon cartridge case on a flat surface and open the case. If the case
contains a ribbon, lift it out of the case. Place the case so that the white “Flag
here” label is on the far side of the case.
“Flag here” label
5) If you’re inserting a new ribbon, remove and discard the shrinkwrap.
Setting up your system
1-9
6) Hold the ribbon cartridge you are inserting so that the blue memory cell flag is
on the far right side of the cartridge. Place the ribbon cartridge into the ribbon
cartridge case, ensuring that the memory cell flag is in the opening indicated by
the label.
7) Place the second groove on the ribbon cartridge insert into the edges of the
ribbon cartridge case.
1-10
System Basics
8) Close the ribbon cartridge case as shown below. Hook the blue memory cell flag
onto the ribbon cartridge case.
9) Place the near end of the gray ribbon roll inserts over each of the blue drive
cones in the upper left side of the printer. Grasp both sides of the case and pull
it toward you so that the spring compresses, then place the opposite ends of the
gray ribbon inserts over the blue drive cones on that side.
Setting up your system
1-11
10) Flip the blue memory cell flag clockwise so that it is seated in the red memory
cell holder.
11) Close the printer cover by pressing down on the top right side until you hear it
click into place.
1-12
System Basics
Using the display screen
$IWHU\RXUV\VWHPKDVVWDUWHGWKHGLVSOD\VFUHHQOLVWVFKRLFHVVLPLODUWRWKHRQHV
VKRZQEHORZ<RXFDQFKRRVHWRUXQDVSHFLDOW\DSSOLFDWLRQVXFKDV6LJQVZKLFK
JXLGHV\RXWKURXJKWKHVWHSVRIFUHDWLQJFHUWDLQNLQGVRIVDIHW\DQGZDUQLQJVLJQV
<RXFDQDOVRFKRRVHWRFUHDWHDIUHHIRUPODEHOZKLFKJLYHV\RXFRPSOHWHFRQWURORYHU
VHWWLQJXSODEHOVDQGVHOHFWLQJRSWLRQV&KDSWHUGLVFXVVHVHDFKRIWKHVHODEHO
FUHDWLRQPHWKRGV
Note: :KHQWKH$SSOLFDWLRQZLQGRZLVGLVSOD\HG\RXFDQSUHVVWKH
6HWXSNH\RQWKHODEHOLQJV\VWHPNH\ERDUGWRFKRRVHVHWWLQJVEHIRUH
VHOHFWLQJDQDSSOLFDWLRQ5HIHUWR´6HWWLQJV\VWHPGHIDXOWVµRQSDJH
Application
Freeform
Signs
Hazardous Waste Labels
Pipe Markers
Press ↑↓, ENTER or SETUP
,I\RXVHOHFWWKH)UHHIRUPRSWLRQLQWKH$SSOLFDWLRQZLQGRZE\PRYLQJWKHFXUVRUWR
WKDWRSWLRQDQGSUHVVLQJ(QWHUWKHGLVSOD\VFUHHQIXQFWLRQVDVGHVFULEHGLQWKLV
VHFWLRQ,I\RXFKRRVHRQHRIWKHVSHFLDOW\DSSOLFDWLRQVWKHGLVSOD\VFUHHQLVXVHGD
OLWWOHGLIIHUHQWO\5HIHUWR´8VLQJVWDQGDUGOD\RXWVµRQSDJHDQGWRWKHVHFWLRQV
GHVFULELQJWKHVSHFLDOW\DSSOLFDWLRQVORFDWHGDWWKHHQGRIWKLVJXLGH
7KHVFUHHQRQ\RXUV\VWHPGLVSOD\VVHYHUDOW\SHVRILQIRUPDWLRQDVVKRZQLQWKH
IROORZLQJLOOXVWUDWLRQVDQGGLVFXVVHGLQWKHIROORZLQJVXEVHFWLRQV
Text entry area: Displays text and
other label elements as you type.
Cursor: Blinking character that
shows current position in the display.
High Pressure Steam=
:
1
:
1
:
1
13.75"
Preview area:
Shows what
the label will
look like when
printed.
High Pressure Steam
Navigation area:
Indicates current
label, area and
line number. Also
displays label
length.
Using the display screen
1-13
High Pressure Steam=
:
1
:
1
:
1
13.75"
Type Options
Color:
Expand/Condense:
Italics:
Underline:
**Black*
100%
Off
Off
Press ↑↓←→, ENTER or ESCAPE
Aa
Selection window: Displays options you
can set and choices you can make.
High Pressure Steam=
:
1
:
1
:
1
13.75"
Printing paused.
Press Enter to continue or Escape
to quit.
Message window: Displays information or
instructions about something you need to do.
The text entry area
$V\RXFUHDWHODEHOVWKHLQIRUPDWLRQ\RXHQWHUVXFKDVWH[WDQGIRUPDWWLQJPDUNHUV
GLVSOD\VLQWKHWH[WHQWU\DUHD,I\RXW\SHPRUHFKDUDFWHUVRQDOLQHWKDQZLOOILWLQWKH
GLVSOD\ZLQGRZWKHGLVSOD\VFUROOVVRWKHQHZFKDUDFWHUVDUHYLVLEOH3UHVVWKH(QWHU
NH\WREHJLQDQHZOLQHRQWKHODEHO8VHWKHXSDQGGRZQ↑ DQG ↓DQGOHIWDQGULJKW
← DQG → DUURZNH\VRQWKHNH\ERDUGWRPRYHWKHFXUVRUDURXQGWKHWH[WHQWU\DUHD
ZLWKLQDODEHO
$V\RXZRUNRQDODEHOWKHLQIRUPDWLRQLVVWRUHGLQWKHV\VWHP·VWHPSRUDU\PHPRU\
ZKLFKLVFDOOHGWKHWH[WEXIIHU7KHWH[WEXIIHUVWRUHVHYHU\WKLQJ\RXHQWHUXQWLO\RX
1-14
System Basics
GHOHWHRUFOHDULWRUWXUQWKHV\VWHPRII$VSUHYLRXVO\QRWHGDOOLQIRUPDWLRQLQWKH
WH[WEXIIHULVQ·WYLVLEOHDWRQFH,I\RXKDYHFUHDWHGVHYHUDOODEHOVRUDUHDVXVLQJWKH
1HZ/DEHODQG1HZ$UHDNH\VRQO\RQHODEHORUDUHDLVYLVLEOHDWDWLPH8VHWKH
1H[W3UHY/DEHODQG1H[W3UHY$UHDNH\VWRPRYHEHWZHHQODEHOVDQGDUHDV
The navigation area
7KHQDYLJDWLRQDUHDLQGLFDWHVWKHQXPEHURIWKHODEHODUHDDQGOLQH\RXDUHFXUUHQWO\
ZRUNLQJLQ,WDOVRGLVSOD\VWKHFXUUHQWODEHOOHQJWKDQGSURYLGHVDZD\WRTXLFNO\
PRYHWRRWKHUODEHOVDUHDVDQGOLQHV1RWHWKDWWKHQDYLJDWLRQDUHDLVXVHGIRUPRYLQJ
EHWZHHQODEHOVDUHDVDQGOLQHVWKDWDOUHDG\H[LVW7RFUHDWHQHZLWHPV\RXQHHGWRXVH
WKH1HZ/DEHO1HZ$UHDDQG(QWHUNH\V
•
7RPRYHWRDVSHFLILFODEHODUHDRUOLQHSUHVVWKH7DENH\WRPRYHWKHFXUVRUIURP
WKHWH[WHQWU\DUHDWRWKHQDYLJDWLRQDUHD8VHWKHXSDQGGRZQDUURZNH\V↑ DQG
↓WRPRYHWRWKHODEHODUHDRUOLQHILHOG7\SHWKHQXPEHURIWKHLWHP\RXZDQW
WRPRYHWRIRUH[DPSOHHQWHULQWKHODEHOILHOGDQGSUHVV(QWHU7KHFXUVRU
PRYHVWRWKHVSHFLILHGOLQHDUHDRUODEHO<RXFDQSUHVV7DEDJDLQWRUHWXUQWKH
FXUVRUWRWKHWH[WHQWU\DUHDZLWKRXWPRYLQJWRDGLIIHUHQWODEHODUHDRUOLQH
•
,IWKHDUHDRUOLQH\RXFKRVHWRPRYHWRGRHVQRWH[LVWWKHFXUVRUPRYHVWRWKH
ILUVWOLQHRUDUHDLQWKHVSHFLILHGODEHO,IWKHUHTXHVWHGODEHOGRHVQRWH[LVWWKH
IROORZLQJPHVVDJHGLVSOD\V
Label does not exist
7KHFXUVRUUHWXUQVWRWKHQDYLJDWLRQDUHDDQG\RXFDQSUHVV(VFDSHWRUHWXUQWKH
FXUVRUWRWKHWH[WHQWU\DUHD
•
7KHERWWRPOLQHLQWKHQDYLJDWLRQDUHDVKRZVWKHOHQJWKRIWKHFXUUHQWODEHO,I\RX
KDYHQ·WVSHFLILHGDODEHOOHQJWKVHH´6HWWLQJODEHOOHQJWKµRQSDJHWKLVYDOXH
LQGLFDWHVWKHOHQJWKRIWKHGDWD\RXKDYHHQWHUHGIRUWKHFXUUHQWODEHO7KLVOHQJWK
LQFOXGHVWKHOHDGHUDQGWUDLOHUZKLFKDUHWKHEODQNWDSHDWWKHEHJLQQLQJDQGHQGRI
DODEHO,I\RXKDYHVSHFLILHGDODEHOOHQJWKWKDWYDOXHLVGLVSOD\HG
7KHODEHOOHQJWKLQGLFDWRUXVHVWKHXQLWRIPHDVXUHVHOHFWHGIRUWKH/HQJWK8QLWV
RSWLRQ6HH´6HWWLQJV\VWHPGHIDXOWVµRQSDJHIRUPRUHLQIRUPDWLRQ
The preview area
7KHSUHYLHZDUHDLVGHVLJQHGWRJLYH\RXDQLGHDRIZKDWDODEHOZLOOORRNOLNHZKHQLW·V
SULQWHG8QOHVV\RXWXUQ2IIWKH$XWRPDWLF3UHYLHZVHWWLQJLQ6HWXSWKHV\VWHP
DXWRPDWLFDOO\GLVSOD\VWKHWH[WDQGV\PEROV\RX·YHHQWHUHGDQGDSSOLHVDQ\IRUPDWWLQJ
FKDQJHV\RX·YHPDGHEDUFRGHV\RX·YHLQVHUWHGGDWHDQGWLPHLQIRUPDWLRQ\RX·YH
HQWHUHGDQGVRRQ1RWHWKDWWKHSUHYLHZDUHDGRHVQRWVKRZDQ\FRORUVWKDW\RX·YH
Using the display screen
1-15
VHOHFWHG5HIHUWR´6HWWLQJV\VWHPGHIDXOWVµRQSDJHIRUPRUHLQIRUPDWLRQDERXW
WKH$XWRPDWLFSUHYLHZVHWWLQJ
The selection window
7KHVHOHFWLRQZLQGRZOHWV\RXFKRRVHRSWLRQVWKDW\RXZDQWWRVHWDQGVHOHFWVHWWLQJV
IRUWKRVHRSWLRQV:KHQ\RXSUHVVDIXQFWLRQNH\RQWKHODEHOLQJV\VWHPNH\ERDUGD
VHOHFWLRQZLQGRZZLWKWKHVDPHQDPHDVWKHNH\\RXSUHVVHGGLVSOD\VLQWKHSUHYLHZ
DUHD)RUH[DPSOHZKHQ\RXSUHVVWKH7\SH2SWLRQVNH\\RXQHHGWRVHOHFWVHWWLQJV
IRUWKHRSWLRQV7KHZLQGRZVKRZQEHORZDSSHDUVZKHQ\RXSUHVVWKH7\SH2SWLRQV
NH\
High Pressure Steam=
:
1
:
1
:
1
13.75"
Type Options
Color:
Expand/Condense:
Italics:
Underline:
**Black*
100%
Off
Off
Press ↑↓←→, ENTER or ESC
Aa
The help line below the
selection window displays
the keys that are available.
In some cases, the sample area
shows you the effect of the setting
that’s currently selected.
,QPRVWVHOHFWLRQZLQGRZV\RXFDQXVHWKHIROORZLQJNH\V
•
3UHVVWKHXSDQGGRZQDUURZNH\V↑ DQG ↓) WRPRYHWKHFXUVRUEHWZHHQWKH
RSWLRQVGLVSOD\HGLQWKHZLQGRZ,IDQDUURZDSSHDUVRQWKHULJKWVLGHRIWKH
ZLQGRZWKHZLQGRZFRQWDLQVRSWLRQVWKDWGRQ·WILWLQWKHGLVSOD\3UHVVWKHDUURZ
NH\VWRGLVSOD\WKHDGGLWLRQDORSWLRQV
•
:KHQDQRSWLRQLVKLJKOLJKWHGSUHVVWKHOHIWDQGULJKWDUURZNH\V← DQG →) WR
GLVSOD\WKHFKRLFHV\RXFDQVHOHFW6RPHRSWLRQVVXFKDVXQGHUOLQLQJKDYHRQRII
RSWLRQV)RURWKHURSWLRQVVXFKDV-XVWLILFDWLRQ\RXFDQVHOHFWIURPVHYHUDO
FKRLFHV&RQWLQXHWRSUHVVWKHNH\VWRVFUROOWKURXJKWKHDYDLODEOHFKRLFHV7KH
VHWWLQJWKDWLVGLVSOD\HGZKHQ\RXFORVHWKHZLQGRZLVWKHRQHWKDWZLOOEHXVHG
1-16
System Basics
•
8VHWKHDOSKDQXPHULFNH\VRQWKHNH\ERDUGWRW\SH\RXUFKRLFHZKHQDQRSWLRQ
UHTXLUHVLW)RUH[DPSOHLI\RXDUHFKDQJLQJWKHW\SHVL]H\RXQHHGWRW\SHWKH
VL]H\RXZDQWWRXVH
•
3UHVVWKH(QWHUNH\WRDFFHSWDQ\FKDQJHV\RX·YHPDGHLQWKHVHOHFWLRQZLQGRZ
7KHV\VWHPWKHQHLWKHUUHWXUQV\RXWRWKHWH[WHQWU\DUHDDQGUHGLVSOD\VWKHSUHYLHZ
DUHDRUFDUULHVRXWWKHIXQFWLRQ\RXFKRVH,QVRPHFDVHVDGGLWLRQDOZLQGRZVRU
SURPSWVPD\DSSHDU
•
3UHVVWKH(VFDSHNH\WRUHWXUQWRWKHWH[WHQWU\DUHDZLWKRXWDFFHSWLQJDQ\
FKDQJHV\RX·YHPDGHLQWKHVHOHFWLRQZLQGRZ
Markers
7KHV\PEROVLOOXVWUDWHGDQGGHVFULEHGLQWKHIROORZLQJWDEOHDUHFDOOHGPDUNHUV7KH\
DSSHDULQWKHWH[WHQWU\DUHDWRVKRZZKHUH\RXKDYHFKDQJHGWKHORRNRIDODEHORU
LQVHUWHGDVSHFLDOIHDWXUHVXFKDVDVHTXHQFHRUDEDUFRGH:KHQ\RXSULQWDODEHO
WKHPDUNHUVGRQRWSULQWEXWWKHLQIRUPDWLRQLQWKHPDUNHULVXVHGWRGHWHUPLQHKRZ
WKHODEHOVKRXOGEHSULQWHG
Marker
What it represents
Change marker
Displays when you use the Type Options key or if you select a type style
or type size for a certain section of text. All text following the marker
uses the setting that was selected at the marker until the setting is
changed again. The system inserts a change marker each time you
make a type change; you could have several markers in a row if you
make multiple changes. (If you make multiple changes in a window at
one time, such as in the Type Options window, all changes are stored in
the same change marker.) If you prefer to have fewer change markers,
make your first type change, place the cursor on that change marker and
make your other changes. This stores the changes in one marker.
Sequence marker
Appears if you have pressed the Sequence key to set up a series of
labels. Refer to “Creating sequences” on page 3-26.
Symbol marker
Appears when you have placed a special symbol within the text by
pressing the Graphics key and entering a symbol number. Refer to
“Adding graphics” on page 3-10.
Date/time marker
Indicates that the time and/or date will be printed at that point on the
label. See “Using the date and time option” on page 3-22.
Using the display screen
1-17
Bar code marker
Appears when you press the Bar Code key. All information between the
two bar code markers is considered to be part of the bar code. Refer to
“Working with bar codes” on page 3-28.
Special bar code
character marker
Appears when you hold down the Alt key and press Bar Code while
entering certain bar code symbologies. Refer to “Working with bar
codes” on page 3-28.
7KHWH[WEXIIHUFDQFRQWDLQXSWRW\SHFKDQJHVPDGHZLWKFKDQJHPDUNHUVVXFKDV
IRQWVW\SHVL]HVDQGXQGHUOLQLQJ,I\RXH[FHHGWKLVQXPEHUWKHIROORZLQJPHVVDJH
GLVSOD\V<RX·OOQHHGWRGHOHWHDQH[LVWLQJW\SHFKDQJHEHIRUH\RXFDQDGGDQRWKHU
RQH
Too many type changes
System messages
6\VWHPPHVVDJHVPD\GLVSOD\LQWKHSUHYLHZDUHDWRJLYHLQIRUPDWLRQDERXW
VRPHWKLQJ\RXKDYHGRQHDVN\RXWRFRQILUPDQDFWLRQVXFKDVGHOHWLQJDILOHRUWHOO
\RXZKDW\RX·YHGRQHZURQJLI\RX·YHPDGHDQHUURU0DQ\RIWKHVHPHVVDJHV
GLVDSSHDUIURPWKHVFUHHQDXWRPDWLFDOO\DOWKRXJKVRPHDVN\RXWRSUHVVDNH\WR
FRQWLQXH
Ribbon out. Reload ribbon. Press any
key to continue.
6RPHPHVVDJHVUHTXLUH\RXWRUHVSRQGWRDTXHVWLRQDVVKRZQEHORZ,ID\HVQR
UHVSRQVHLVUHTXLUHG\RXFDQSUHVV(QWHUWRDFFHSWWKHGLVSOD\HGUHVSRQVHSUHVVWKH
←RU→NH\WRGLVSOD\<HVRU1RDQGWKHQSUHVV(QWHURUW\SHWKHILUVWOHWWHURIWKH
ZRUG
Are you sure?
1-18
System Basics
No
Using the keyboard
<RXUV\VWHP·VNH\ERDUGRSHUDWHVPXFKOLNHDVWDQGDUGFRPSXWHUNH\ERDUG7KLV
VHFWLRQGHVFULEHVNH\ERDUGIHDWXUHVDQGKRZWRSHUIRUPEDVLFWDVNVVXFKDVLQVHUWLQJ
DQGGHOHWLQJWH[W
Overtyping and inserting
$V\RXFUHDWH\RXUODEHOV\RXPD\QHHGWRHGLWRUDGGWRWKHWH[W\RX·YHDOUHDG\
HQWHUHG<RXFDQGRWKLVE\RYHUW\SLQJRULQVHUWLQJWH[W
•
:KHQ\RXILUVWXVH\RXUV\VWHPWKH,QVHUWIXQFWLRQLVRQE\GHIDXOW7KLVPHDQV
WKDWZKHQ\RXVWDUWW\SLQJWH[WWKHWH[WZLOOEHLQVHUWHGDIWHUWKHFKDUDFWHURQZKLFK
WKHFXUVRULVSRVLWLRQHG
•
,I\RXZDQWWKHWH[W\RXW\SHWRRYHUZULWHWKHH[LVWLQJWH[WSUHVVWKH,QVHUWNH\RQ
WKHNH\ERDUGWRWXUQWKH,QVHUWIXQFWLRQRII1RWHWKDW\RXFDQQRWW\SHRYHU
PDUNHUV,I\RXFRPHWRDPDUNHUZKLOH\RXDUHRYHUW\SLQJWKHWH[WZLOODOOEH
LQVHUWHGLQIURQWRIWKHPDUNHU:KHQ\RXZDQWWRVWRSRYHUW\SLQJWH[WSUHVVWKH
,QVHUWNH\DJDLQWRWXUQWKHIXQFWLRQRQ
Note: $VQRWHGDERYHWKH,QVHUWIXQFWLRQLVWXUQHGRQZKHQ\RXILUVW
XVH\RXUV\VWHP:KHQ\RXWXUQWKH,QVHUWIXQFWLRQRQRURIIWKDWPRGH
VWD\VLQHIIHFWXQWLO\RXFKDQJHLWDJDLQHYHQLI\RXWXUQWKHV\VWHPRII
DQGRQDJDLQ
$V\RXZRUNLQWKHWH[WHQWU\DUHDWKHV\VWHPFKHFNVWKDWWKHWH[WZLOOILWRQWKH
LQVWDOOHGVXSSO\DQGZLWKLQWKHVSHFLILHGOHQJWKLI\RX·YHHQWHUHGDODEHOOHQJWK,I
\RXUHQWU\LVLQFRUUHFWIRUWKHODEHO\RXKDYHVSHFLILHGWKHV\VWHPGLVSOD\VDPHVVDJH
LGHQWLI\LQJWKHSUREOHP5HIHUWR´&UHDWLQJODEHOVZLWKPXOWLSOHOLQHVµRQSDJHWR
VHHWKRVHPHVVDJHVDQGIRULQIRUPDWLRQDERXWFRUUHFWLQJSUREOHPV\RXPD\
HQFRXQWHU
Deleting and clearing
7KHUHDUHWKUHHZD\VWRGHOHWHWH[WV\PEROVDQGPDUNHUV.HHSLQPLQGWKDWGHOHWLQJ
DPDUNHUZLOOSUREDEO\FKDQJHWKHORRNRIWKHSULQWHGODEHO
•
3UHVVWKH%DFNVSDFHNH\WRGHOHWHWKHFKDUDFWHUWRWKHOHIWRIWKHFXUVRU
•
3UHVVWKH'HOHWHNH\WRGHOHWHWKHFKDUDFWHURQZKLFKWKHFXUVRULVSRVLWLRQHG
•
3UHVVWKH&OHDUNH\WRFKRRVHIURPDOLVWRIGHOHWLRQRSWLRQV7KHRSWLRQVDUH
Using the keyboard
1-19
OLVWHGLQWKHIROORZLQJWDEOH:KHQ\RXSUHVV&OHDUWKH&OHDUZLQGRZGLVSOD\V
Clear
All labels:
All labels, restore defaults:
Current label:
Current area:
Press ↑↓, ENTER or ESCAPE
8VHWKH↑ RU ↓ NH\WRVHOHFWDQRSWLRQWKHQSUHVV(QWHU7KH´$UH\RXVXUHµ
PHVVDJHWKHQGLVSOD\V,I\RXGHFLGHQRWWRFOHDUFKRRVH1R,I\RXGRZDQWWR
FOHDUFKRRVH<HV
Clear option
What it does
All labels
Clears all text and markers from the text buffer for all labels and all
areas. When you return to the text entry area, the screen is blank
and the cursor is positioned on the first line of the first label.
All labels, restore defaults
Clears all text and markers from the text buffer for all labels and all
areas and resets Setup options to their default settings. (See
“Setting system defaults” on page 1-23.) When you return to the
text entry area, the screen is blank and the cursor is positioned on
the first line of the first label.
Current label
Clears the text and markers from the current label only. All text
and markers are deleted, along with all areas the label contains,
but other labels are not erased. When you return to the text entry
area, the next label in the text buffer displays or the screen is blank
if there are no other labels.
Current area
Clears the text and markers from the current area of the current
label only. All text and markers are deleted, but other areas are
not erased. When you return to the text entry area, the contents of
the next area display or the screen is blank if there are no other
areas in the current label.
Memory card
Erases all stored files from a memory card. See “Clearing a
memory card” on page 5-11.
Typing all capital letters
7RW\SHWH[WLQDOOFDSLWDOOHWWHUVSUHVVWKH&DSV/RFNNH\7KH&DSV/RFNLQGLFDWRURQ
WKHXSSHUULJKWVLGHRIWKHNH\ERDUGOLJKWVXSZKHQ&DSV/RFNLVRQ$OODOSKDEHWLF
FKDUDFWHUVZLOOEHHQWHUHGDVFDSLWDOOHWWHUVWRW\SHDORZHUFDVHOHWWHUKROGGRZQWKH
6KLIWNH\DQGSUHVVWKHOHWWHUNH\
3UHVVWKH&DSV/RFNNH\DJDLQWRUHWXUQWRW\SLQJOHWWHUVLQERWKXSSHUDQGORZHUFDVH
1-20
System Basics
Using function keys
6RPHNH\ERDUGNH\VDFFHVVVSHFLDOIXQFWLRQVDVGHVFULEHGLQWKHIROORZLQJWDEOH
Key
What it does
App
Displays the available applications. This is the same window that appears
when you first turn on the system. This key is available only in the standard
operating system (not in specialty applications).
Bar Code
Starts and ends a bar code. Hold down the Shift key and press this key to
change bar code attributes such as height and density. Refer to “Working with
bar codes” on page 3-28.
Date/Time
Inserts the date and/or time on the label. Hold down the Shift key and press
this key to change the date/time format or change the system date or time.
Refer to “Using the date and time option” on page 3-22.
Density
Lets you adjust the print density by increasing or decreasing the thermal print
energy. Refer to “Changing print density/thermal energy” on page 4-10.
File
Provides access to the filing system, which lets you save, retrieve and delete
files. Refer to Chapter 5, “Label Storage.”
Font
Lets you choose a font. Refer to “Selecting a font” on page 3-2.
Frame
Allows you to frame a label or area and choose framing options such as
frame style and line width. Refer to “Adding frames” on page 3-19.
Graphics
Lets you select a symbol to place on a label. Refer to “Adding graphics” on
page 3-10.
Label Layout
Displays the standard layouts available in the system. Refer to “Using
standard layouts” on page 2-11.
Label Length
Sets the label length. Refer to “Setting label length” on page 3-12.
Label Options
Allows you to select label format options to be applied to all labels in the text
buffer, such as text justification and mirror printing. Refer to “Selecting label
options” on page 3-15.
On Line
Puts the system on line to print data from a PC application. Refer to Chapter
6, “Using the Printer With a PC.”
Print
Starts printing the labels in the text buffer. Refer to Chapter 4, “Printing.”
Print Special
Gets preview image of the formatted label at any time, regardless of the
Automatic preview setting in Setup.
Repeat
Lets you print multiple copies of a label. Refer to “Printing multiple copies” on
page 4-9.
Sequence
Inserts a sequence on a label. Refer to “Creating sequences” on page 3-26.
Setup
Sets default settings for various options, such as pausing between labels
during printing. Refer to “Setting system defaults” on page 1-23.
Status
Displays information about the system, such as the operating system version
number and the installed supply width. Refer to “Checking system status” on
page 1-26.
Using the keyboard
1-21
Type Options
Lets you select a variety of type options, such as underlining and italics.
Refer to “Changing type options” on page 3-5.
Type Size
Changes the size of the font. Refer to “Changing type size” on page 3-3.
Typing special characters
.H\VPD\FRQWDLQIURPRQHWRWKUHHFKDUDFWHUVGHSHQGLQJRQWKHNH\ERDUGOD\RXW
\RXDUHXVLQJ6HH´6HWWLQJV\VWHPGHIDXOWVµRQSDJHIRULQIRUPDWLRQRQWKH
NH\ERDUGOD\RXWRSWLRQ7KHWDEOHEHORZLQGLFDWHVKRZWRW\SHHDFKFKDUDFWHU
Location on key
How to type the character
Lower left corner or bottom of key
(lower case character)
Press the key.
Upper left corner or top of key
(upper case character)
Hold down the Shift key and press the key.
Lower right corner of key
Hold down the Alt key and press the key.
Lower part of keypad key
Press the key.
Upper part of keypad key
Press the NumLock key on the keyboard, then press the key.
Typing accented characters
6RPHODQJXDJHVKDYHOHWWHUVWKDWUHTXLUHDFFHQWPDUNV7RW\SHWKHPUHIHUWRWKH
IROORZLQJWDEOH7\SHWKHDFFHQWPDUNILUVWIROORZHGE\WKHOHWWHU\RXZDQWDFFHQWHG
$FFHQWPDUNVZLOOZRUNIRURQO\WKHFKDUDFWHUVLQGLFDWHGEHORZ
Accent mark
Example
Valid for these characters
Umlaut (diaeresis)
ö
a, e, i, o, u, A, E, I, O, U
Carat (circumflex)
â
a, e, i, o, u, A, E, I, O, U
Grave
è
a, e, i, o, u, A, E, I, O, U
Acute
é
a, e, i, o, u, A, E, I, O, U, C, N, S, Z
Tilde
ñ
a, n, o, A, N, O
Double Acute
´u´
o, u, O, U
1-22
System Basics
Setting system defaults
:KHQ\RXILUVWWXUQ\RXUV\VWHPRQWKHV\VWHPDXWRPDWLFDOO\XVHVFHUWDLQVHWWLQJV
WKDWDUHUHIHUUHGWRDVV\VWHPGHIDXOWV8QOHVV\RXFKDQJHWKHVHVHWWLQJVWKHGHIDXOWVDUH
XVHG8VHWKH6HWXSNH\WRFKDQJH\RXUV\VWHPGHIDXOWV<RXFDQDOVRXVHWKLVNH\WR
VHWXSQDPHVIRUWDSHDQGULEERQFRORUVDQGWRDFFHVVWKHRSHUDWLQJV\VWHPXSJUDGH
URXWLQH
Note: 7KHWH[WEXIIHUQHHGVWREHHPSW\ZKHQ\RXSUHVVWKH6HWXSNH\
,ILWLVQRWWKH´6DYHDQGFOHDUWH[WWRXVHWKLVIXQFWLRQµPHVVDJHGLVSOD\V
3UHVV&OHDUWRHPSW\WKHWH[WEXIIHURUSUHVV)LOHDQGVDYHWKHODEHOV
1) Press the Setup key.
7KH6HWXSZLQGRZGLVSOD\V
Setup
Automatic preview:
Leader/trailer length:
Justification:
Type size:
On
0.500
Center
100
Press ↑↓←→, ENTER or ESC
2) Press the ↑ or ↓ key to move the cursor to the option you want to set.
3) When the option you want to set is highlighted, press the ← or → key to scroll
through the available settings. (Refer to the table below.)
4) When the settings you want to use are displayed, press Enter.
7KH6HWXSRSWLRQVDUHGHVFULEHGLQWKHWDEOHRQWKHIROORZLQJSDJHV
Setting system defaults
1-23
Setup option
What it does
Automatic preview
Allows you to turn the dynamic preview feature On or Off. The default
setting is On.
Dynamic preview allows the system to update your label as you type
from the keyboard, typically when you pause. Sometimes this slows
down your keyboard response time.
If you turn Off dynamic updating, you can increase the keyboard
response speed; that is, it will take less time between when you type a
keystroke in the text area and when those characters appear on the
screen.
You can still get a preview of the formatted label at any time by pressing
the Print Special key. When you press Print Special, you’ll see the
“Please wait” message and the rotating spinner that indicates that the
system is working. Using the Print Special key does not change the
Automatic preview setting in Setup. You can also press the Print Special
key to redraw the preview when the Automatic preview setting is set to
On. This may take a few seconds to update. (If, however, you press any
other key while the system is generating the preview, the preview is
cancelled and you may notice a slight time lag before new characters
appear in the text entry area. )
Note: Automatic preview functions slightly differently in the resident
applications (when you are not running Freeform). Be sure to consult
the appropriate documentation for more information.
Leader/trailer length
Sets the length of the leader and trailer, which is the amount of blank
space inserted at the beginning and end of a label. The unit of measure
is the setting selected for the Length units option (see below). Valid
values are .125 to 2 inches (4 to 50 mm).
Justification
Sets the default justification for text and graphics. Choose Center
(default), Left or Right. You can override this setting at any time by using
the Label Options key. (Refer to “Selecting label options” on page 3-15.)
When you turn the system off and on, the setting selected here is used.
Type size
Sets the type size that is used when the system is first turned on. All text
automatically prints in this type size, unless you change it temporarily.
(See “Changing type size” on page 3-3.) When you turn the system off
and on, the setting selected here is used. The unit of measure is the
Type size units (see below). Valid values are as follows:
0.08 - 8.0 inches (default = 1.0)
8 - 800 points (default = 100)
2 - 203 mm (default = 25)
If you change the Type size units setting, the values shown for the Type
size field automatically change to the new unit values.
Type size units
1-24
System Basics
Sets the unit of measure for displaying type size in the Type Size
window. Choose Inches (default), Points or mm. When you change this
unit, the default Type size value (see above) changes to the new unit
values.
Length units
Sets the unit of measure for displaying label length and other length
values (such as amount of tape remaining). Choose Inches (default) or
mm.
Pause between labels
Controls whether or not the system pauses between labels when
printing multiple labels. Choose Off (default) or On. If you turn this
option on, a message displays after a label prints and asks you to press
a key to continue.
Number of copies
Sets the default number of copies to print for all labels. Enter a value
from 1 (default) to 99. You can change this value for a specific label by
pressing the Repeat key and entering a different value. Refer to
“Printing multiple copies” on page 4-9.
Font
Specifies which font is used when the system is first turned on. All text
automatically prints in this font, unless you change it temporarily. (See
“Selecting a font” on page 3-2.) When you turn the system off and on,
the font selected here is used.
Language
Sets the language in which menus, prompts and messages are
displayed. Choose English (default), French, Spanish, German, Dutch,
Danish, Italian, Swedish, Portuguese, Norwegian or Finnish. The new
selection takes effect as soon as you move the cursor off the Language
option or close the Setup window.
Keyboard style
Sets the type of keyboard layout you want to use: QWERTY, AZERTY
or QWERTZ.
Ribbon color names
Allows you to change the names of ribbon colors you entered when you
installed a ribbon color the system didn’t recognize as described in
“Changing supplies” on page 4-7. Select the color name you want to
change and type a new name. (You cannot change the names of the
colors the system recognizes automatically.) When you install a ribbon
that you previously assigned that name, the new color name will be
used. When the system is upgraded to a new operating system that
includes new colors, the system names overwrite the color names you
entered.
Tape color names
Allows you to change the names of tape colors you entered when you
installed a tape color the system didn’t recognize as described in
“Changing supplies” on page 4-7. Select the color name you want to
change and type a new name. (You cannot change the names of the
colors the system recognizes automatically.) When you install a tape
that you previously assigned that name, the new color name will be
used. When the system is upgraded to a new operating system that
includes new colors, the system names overwrite the color names you
entered.
Upgrade
Allows you to upgrade the operating system, either from a PC or from a
PCMCIA card. Refer to “Checking system status” on page 1-26 for
information about checking your current operating version or board
version.
Setting system defaults
1-25
Checking system status
8VHWKH6WDWXVNH\WRFKHFNFHUWDLQVXSSO\DQGV\VWHPLQIRUPDWLRQ7KHVHYDOXHVDUH
GLVSOD\HGKHUHIRULQIRUPDWLRQRQO\DQGFDQQRWEHFKDQJHGLQWKLVZLQGRZ
1) Press the Status key.
7KH6WDWXVZLQGRZGLVSOD\V
Status
Tape color:
Tape width:
Tape remaining:
Tape type:
White
10 in
50 ft
Continuous
Press ↑↓, ENTER or ESCAPE
2) Press the ↑ or ↓ key to move through the options listed below and view their
current settings.
Status option
What it does
Tape color
Indicates the color of the installed tape.
Tape width
Indicates the width of the installed tape. The unit of measure is the
Length units setting selected in the Setup window. (Refer to “Setting
system defaults” on page 1-23.)
Tape remaining
Indicates the amount of tape remaining on the installed supply. The
unit of measure is the Length units setting selected in the Setup
window. (Refer to “Setting system defaults” on page 1-23.)
Tape type
Indicates the type of tape that is installed (continuous or die-cut).
Ribbon color (1-4)
Indicates the color of the installed ribbon. Paneled ribbon colors are
listed in order. For monochrome ribbons, one color is listed and the
remaining values are None.
Ribbon width
Indicates the width of the installed ribbon supply. The unit of
measure is the Length units setting selected in the Setup window.
(Refer to “Setting system defaults” on page 1-23.)
OS version
Indicates the current operating system version number.
Hardware version
Identifies the current circuit board revision ID number.
2 - indicates the original PowerMark memory configuration: 2M RAM
3 - indicates the enhanced memory configuration: 4M RAM
This setting affects the maximum length you can designate for a
label, which in turn affects other label options. See “Setting label
length” on page 3-12 for more information.
3) Press Enter to close the Status window.
1-26
System Basics
Chapter 2: Label Creation
7KLVFKDSWHUVWDUWVE\JXLGLQJ\RXWKURXJKDWXWRULDOIRUFUHDWLQJDVLPSOHODEHO<RX·OO
VHHKRZHDV\LWLVWRGHVLJQ\RXURZQODEHOVDQGKRZIDVWLWLVWRXVHWKHWRROV\RXU
V\VWHPSURYLGHVWRFUHDWHODEHOVEDVHGRQH[LVWLQJGHVLJQV
$IWHUWKHEULHIWXWRULDOWKLVFKDSWHUDOVRGHVFULEHVWKHGLIIHUHQWODEHOFUHDWLRQPHWKRGV
DQGSURYLGHVLQIRUPDWLRQRQXVLQJWKHVWDQGDUGOD\RXWVDYDLODEOHWKURXJKWKH/DEHO
/D\RXWNH\7RSLFVLQFOXGH
&UHDWLQJDEDVLFODEHOEHJLQQLQJRQSDJHDVKRUWWXWRULDOWKDWKHOSV\RXFUHDWH
DEDVLFODEHO
/DEHOFUHDWLRQRSWLRQVEHJLQQLQJRQSDJHGHVFULELQJWKHWKUHHPHWKRGV\RX
FDQXVHWRFUHDWHODEHOV
$GGLQJOLQHVODEHOVDQGDUHDVWRIUHHIRUPODEHOVEHJLQQLQJRQSDJHZLWK
VHFWLRQVRQFUHDWLQJODEHOVZLWKPXOWLSOHOLQHVFUHDWLQJPXOWLSOHODEHOVDQGFUHDWLQJ
ODEHOVZLWKPXOWLSOHDUHDV
8VLQJVWDQGDUGOD\RXWVEHJLQQLQJRQSDJHZKLFKJXLGHV\RXWKURXJKWKH
EDVLFVRIXVLQJVSHFLDOW\DSSOLFDWLRQVOLNHWKH6LJQVDSSOLFDWLRQVWKH3LSH0DUNHUV
DSSOLFDWLRQDQGWKH+D]DUGRXV:DVWH/DEHOVDSSOLFDWLRQ
2-1
Creating a basic label
7KLVVHFWLRQJHWV\RXRIIWRDJUHDWVWDUWZLWK\RXUV\VWHPE\OHDGLQJ\RXWKURXJKWKH
FUHDWLRQRIDEDVLFODEHO<RX·OOKDYHDFKDQFHWRVHHKRZVRPHNH\V\VWHPIHDWXUHV
ZRUNDQGWRWU\RXWRSWLRQV\RX·OOXVHDJDLQDQGDJDLQ
$IWHU\RXKDYHXQSDFNHGDQGVHWXS\RXUV\VWHPDQGLQVWDOOHGVRPHULEERQDQGWDSH
\RXUV\VWHPLVUHDG\WRJRWRZRUN5HIHUWR&KDSWHU´6\VWHP%DVLFVµLI\RX
KDYHQ·W\HWGRQHWKHVHWDVNV
)ROORZWKHVWHSVLQWKLVVHFWLRQWRW\SHDQGSULQWWKHODEHOVKRZQEHORZ6LQFHWKLVLV
MXVWDQH[HUFLVHXVHDQ\VL]HWDSH\RXFKRRVH
Emergency Number
Building security: ext 524 (24 hours)
1) Turn the labeling system on.
$IWHUWKHLQWURGXFWRU\VFUHHQGLVDSSHDUVWKH$SSOLFDWLRQZLQGRZGLVSOD\V
Application
Freeform
Signs
Hazardous Waste Labels
Pipe Markers
Press ↑↓, ENTER or SETUP
6HH´/DEHOFUHDWLRQRSWLRQVµRQSDJHIRUPRUHLQIRUPDWLRQDERXWWKHVSHFLDOW\
DSSOLFDWLRQV
2) Press the ↑ or ↓ key to move the cursor to the Freeform option. Then press the
Enter key.
7KHWH[WHQWU\DUHDLVEODQNDQGWKHEOLQNLQJFXUVRUDSSHDUVWRVKRZ\RXUFXUUHQW
SRVLWLRQLQWKHZLQGRZ1RWLFHWKDWWKHQDYLJDWLRQDUHDLQGLFDWHVWKDW\RX·UHLQ
ODEHODUHDDQGOLQH
$WWKLVSRLQW\RXFRXOGFKRRVHDVWDQGDUGOD\RXWE\SUHVVLQJWKH/DEHO/D\RXWNH\
7KH/DEHO/D\RXWZLQGRZOHWV\RXVHOHFWIURPSUHGHILQHGOD\RXWVVRDOO\RXKDYH
WRGRLVHQWHUWH[WDQGSULQW6HH´8VLQJVWDQGDUGOD\RXWVµRQSDJHDQGWKH
DSSOLFDWLRQV·XVHUVJXLGHVIRUGHWDLOV
2-2
Label Creation
3) Type this text: Emergency Number. Then press Enter.
,I\RXPDNHDPLVWDNHXVHWKH%DFNVSDFHNH\RUWKH'HOHWHNH\WRHUDVHFKDUDFWHUV
$IWHU\RXSUHVV(QWHUWKHFXUVRUPRYHVGRZQRQHOLQHLQWKHGLVSOD\WRLQGLFDWH
WKDW\RX·UHVWDUWLQJDQHZOLQHRQWKHODEHO
4) Type Building security: and press the space bar.
5) To underline the next text, press the Type Options key.
7KLVNH\LVRQHRIWKHODEHOHGIXQFWLRQNH\VDWWKHWRSRIWKHODEHOLQJV\VWHP
NH\ERDUG7KH7\SH2SWLRQVZLQGRZDSSHDUVLQWKHSUHYLHZDUHDRIWKH
VFUHHQ3UHVVWKH↓NH\WRPRYHWKHFXUVRUWRWKH8QGHUOLQHRSWLRQ
Type Options
Color:
Expand/Condense:
Italics:
Underline:
*Black*
100%
Off
Off
Press ↑↓←→, ENTER or ESCAPE
6) Press the → key to display “On” in the window. Then press Enter to return to
the text entry area.
1RWLFHWKDWDVSHFLDOFKDUDFWHUDSSHDUVLQWKHWH[WHQWU\DUHD 7KLVLVFDOOHGD
FKDQJHPDUNHUDQGLWLQGLFDWHVZKHUH\RXKDYHWXUQHGWKHXQGHUOLQLQJRQ5HIHUWR
´0DUNHUVµRQSDJHIRULQIRUPDWLRQ
7) Type ext 524 and press the space bar.
'HSHQGLQJRQWKHVXSSOLHV\RXKDYHLQVWDOOHGWKH7H[WWRRORQJPHVVDJHPD\
DSSHDUDV\RXDUHW\SLQJORQJOLQHVOLNHWKLVRQH,IWKLVKDSSHQV\RXFDQSUHVV
(QWHUWRVWDUWDQHZOLQHDQGFRQWLQXHWRW\SH6HH´+RZLQVWDOOHGULEERQVDIIHFW
ODEHOFRPSRVLWLRQµRQSDJHIRUPRUHLQIRUPDWLRQ$OWHUQDWLYHO\\RXFDQ
FKDQJHWKHW\SHVL]HRUIRQWWRDFFRPPRGDWHWKHWH[W\RXZDQWWRHQWHULQWKHVSDFH
\RXKDYH6HH´&KDQJLQJWKHORRNRIWKHWH[WµRQSDJHIRUWKDWLQIRUPDWLRQ
8) Now turn underlining off. To do this, press the Type Options key again. Move
the cursor to the Underline option, and change the setting to “Off.” Press Enter.
8QGHUOLQLQJLVQRZWXUQHGRIIVRWKDWDGGLWLRQDOWH[W\RXW\SHZLOOQRWEH
XQGHUOLQHG$QRWKHUFKDQJHPDUNHUDSSHDUVLQWKHWH[WHQWU\DUHDWRLQGLFDWH
ZKHUHXQGHUOLQLQJZDVWXUQHGRII
9) Type (24 hours).
10) Press the Print key located in the bottom left corner of the keyboard.
7KHSULQWHUGLVSOD\VWKH&RPSRVLQJPHVVDJHDQGGHSHQGLQJRQWKHVXSSOLHV\RX
KDYHLQVWDOOHG\RXPD\VHHWKH6HOHFWLQJULEERQPHVVDJHRURWKHUVDVWKHSULQW
SURFHVVSURFHHGV$IWHU\RXUVLJQSULQWV\RX·OOVHHWKHWH[WDUHDZLWK\RXUFXUUHQW
Creating a basic label
2-3
HQWU\<RXFDQPDNHDQHZODEHOE\SUHVVLQJ1HZ/DEHORU\RXFDQFOHDUWKH
FXUUHQWODEHOE\SUHVVLQJWKH&OHDUNH\DQGIROORZLQJWKHSURPSWV<RXFDQDOVR
VDYH\RXUODEHOWRDILOH6HH´6DYLQJILOHVµRQSDJHIRULQIRUPDWLRQ
2-4
Label Creation
Label creation options
<RXUV\VWHPRIIHUVWKUHHEDVLFODEHOFUHDWLRQPHWKRGV
•
)UHHIRUP³)UHHIRUPODEHOVDUHODEHOV\RXFUHDWHRQ\RXURZQZLWKRXWXVLQJDQ\
SUHGHWHUPLQHGIRUPDWWLQJRUOD\RXW7RFUHDWHDIUHHIRUPODEHOFKRRVHWKH
)UHHIRUPRSWLRQLQWKH$SSOLFDWLRQZLQGRZDV\RXGLGLQWKHH[HUFLVH´&UHDWLQJ
DEDVLFODEHOµRQSDJH
:KHQ\RXZRUNRQIUHHIRUPODEHOV\RXFDQVHWXSDQ\FRPELQDWLRQRIOLQHVDQG
DUHDVWKDW\RXQHHGDVGHVFULEHGLQWKHQH[WVHFWLRQLQWKLVFKDSWHU<RXFDQDOVR
XVHDOORIWKHRSWLRQVGHWDLOHGLQ&KDSWHU´/DEHO'HVLJQµWRPDNH\RXUODEHOV
ORRNH[DFWO\DV\RXZDQWWKHP
•
)UHHIRUPXVLQJVWDQGDUGOD\RXWV³$QRWKHUZD\RIFUHDWLQJIUHHIRUPODEHOVLV
WRXVH\RXUV\VWHP·VVWDQGDUGOD\RXWV7KH/DEHO/D\RXWNH\SURYLGHVDTXLFNZD\
RIFUHDWLQJODEHOVXVLQJOD\RXWVWKDWDUHDOUHDG\VHWXSIRU\RX:KHQ\RXSUHVVWKLV
NH\\RXFDQFKRRVHIURPPDQ\GLIIHUHQWDWWUDFWLYHOD\RXWVWKDWDUHSUHGHILQHG$OO
\RXQHHGWRGRLVHQWHU\RXUWH[WDQGSULQW6HH´8VLQJVWDQGDUGOD\RXWVµRQ
SDJH
•
6SHFLDOW\DSSOLFDWLRQV³7KHDSSOLFDWLRQZLQGRZRQ\RXUV\VWHPOLVWVRWKHU
RSWLRQVLQDGGLWLRQWR)UHHIRUP7KHVHPD\LQFOXGH6LJQV+D]DUGRXV:DVWH
/DEHOV3LSH0DUNHUVDQGRWKHUV7KHVHRSWLRQVDUHUHIHUUHGWRDVVSHFLDOW\
DSSOLFDWLRQVDQGWKH\DOORZ\RXWRTXLFNO\SURGXFHODEHOVIRUDVSHFLILFXVH)RU
H[DPSOHWKH6LJQVDSSOLFDWLRQKHOSV\RXFUHDWHPDQ\GLIIHUHQWW\SHVRIVLJQV
7KHDGYDQWDJHRIVSHFLDOW\DSSOLFDWLRQVLVWKDWWKH\OHDG\RXWKURXJKWKHFUHDWLRQ
RIDQLWHPVWHSE\VWHS)RUH[DPSOHWKH6LJQVDSSOLFDWLRQDVNV\RXWRFKRRVHWKH
VLJQ·VFRQWHQWVXFKDVWH[WDQGJUDSKLFVWKHVLJQ·VVL]HWH[WRSWLRQVDQGVRRQ
6HOHFWLRQZLQGRZVDSSHDURQHDIWHUDQRWKHUDQGDOO\RXQHHGWRGRLVPDNHD
FKRLFHDQGFRQWLQXHZLWKWKHQH[WVWHS³ULJKWXSWRSULQWLQJWKHVLJQ)RUPRUH
LQIRUPDWLRQVHH´8VLQJVWDQGDUGOD\RXWVµRQSDJH
Label creation options
2-5
How installed ribbons affect label composition
7KHV\VWHPXVHVWKHULEERQVXSSOLHVLQVWDOOHGLQ\RXUV\VWHPGXULQJODEHO
FRPSRVLWLRQWRGHWHUPLQHWKHUXOHV\RXPXVWIROORZIRUVHOHFWLQJFRORUVDQGWR
GHWHUPLQHWKHPD[LPXPODEHOOHQJWKVXSSRUWHG
)RUH[DPSOHZKHQ\RXKDYHLQVWDOOHGDSDQHOHGULEERQWKHOHQJWKRIWKHSDQHOV
RQWKHULEERQGHWHUPLQHWKHPD[LPXPOHQJWKRIWKHODEHO\RXDUHFUHDWLQJ%XW
ZKHQ\RXKDYHLQVWDOOHGDFRQWLQXRXVPRQRFKURPHULEERQWKHV\VWHPFDQ·WWHOO
ZKHWKHU\RXDUHSODQQLQJWRFUHDWHDVLQJOHFRORUMRERUZKHWKHU\RXDUHSODQQLQJ
WRVZDSLQYDULRXVULEERQVWRFUHDWHDPXOWLFRORUMRE
%HFDXVHWKHPD[LPXPVXSSRUWHGODEHOOHQJWKLVVXEVWDQWLDOO\GLIIHUHQWLQWKHVHWZR
VLWXDWLRQVWKH3RZHU0DUNV\VWHPPDNHVVRPHDVVXPSWLRQVDFFRUGLQJWRWKH
LQVWDOOHGULEERQ
:KHQWKHV\VWHPGHWHFWVDFRQWLQXRXVFRORUPRQRFKURPHULEERQLQVWDOOHG
LWDVVXPHV\RXDUHFUHDWLQJDVLQJOHFRORUODEHOXQWLO\RXVHOHFWDVHFRQGFRORUZLWKLQ
WKHVDPHODEHO$WWKDWSRLQWWKHV\VWHPFKHFNVWKHODEHOOHQJWKWRVHHLI\RXUODEHO
WH[WDOUHDG\H[FHHGVWKHVXSSRUWHGOHQJWK,ILWLVWRRORQJLWGLVSOD\VDPHVVDJHDQG
\RXQHHGWRFRUUHFWLW6HH´&RUUHFWLQJPXOWLSOHOLQHSUREOHPVµRQSDJHIRU
LQVWUXFWLRQV,IWKHODEHOOHQJWKLVZLWKLQWKHVXSSRUWHGOHQJWKZKHQ\RXVHOHFWWKH
VHFRQGFRORUQRPHVVDJHLVGLVSOD\HGDQG\RXFDQFRQWLQXH%XWRWKHUFKDQJHV
EHVLGHVFRORUFDQDIIHFWWKHOHQJWKRIWKHODEHODVZHOO)RUH[DPSOHFKDQJLQJWKH
IRQWVL]HFRXOGLQFUHDVHWKHOHQJWKRIWKHWH[WRUDGGLQJDQDUHD,QWKRVHFDVHVWKH
V\VWHPGLVSOD\VDPHVVDJHLQIRUPLQJ\RXDQG\RXPXVWFRUUHFWWKHODEHOLQRUGHU
WRSULQWLW
:KHQWKHV\VWHPGHWHFWVDSDQHOHGULEERQLQVWDOOHGLWDXWRPDWLFDOO\UHVWULFWV
WKHOHQJWKRIWKHODEHOWRWKHSDQHOOHQJWKRIWKHLQVWDOOHGULEERQ7KLVGRHVQ·WPHDQ
\RXFDQ·WSULQWWKHODEHOXVLQJDFRPELQDWLRQRIFRQWLQXRXVFRORUPRQRFKURPH
ULEERQV6HH´&KDQJLQJVXSSOLHVµRQSDJHIRULQVWUXFWLRQV,WGRHVPHDQ
KRZHYHUWKDWZKLOH\RXDUHFRPSRVLQJWKHODEHOWKHPD[LPXPOHQJWKLVOLPLWHG
1RWHWKDW\RXUFRORUVDUHQRWUHVWULFWHGKRZHYHU7KHHQWLUHFRORUSDOHWWHLV
DYDLODEOHZLWKDSDQHOHGULEERQ6HH´&KDQJLQJW\SHRSWLRQVµRQSDJHIRUPRUH
LQIRUPDWLRQ
)RUPRUHGHWDLOHGLQIRUPDWLRQVHH´6XSSO\ULEERQµRQSDJH
2-6
Label Creation
Adding lines, labels and areas to freeform labels
7KLVVHFWLRQH[SODLQV
•
+RZWRDGGOLQHVODEHOVDQGDUHDVZKHQ\RXDUHFUHDWLQJDIUHHIRUPODEHO
•
+RZWRFUHDWHPXOWSOHOLQHODEHOVDQGKRZWRFRUUHFWPXOWLSOHOLQHGHVLJQLVVXHV
•
+RZWRFUHDWHODEHOVZLWKPXOWLSOHDUHDV
Creating labels with multiple lines
<RX·OORIWHQZDQWWRFUHDWHODEHOVWKDWFRQWDLQPRUHWKDQRQHOLQHRIWH[W
7RVWDUWDQHZOLQHRIWH[WDV\RXW\SHDODEHOSUHVVWKH(QWHUNH\7KHFXUVRU
PRYHVGRZQRQHOLQHDQG\RXFDQEHJLQW\SLQJWKHWH[WIRUWKHQHZOLQH
7RVSOLWWH[WLQDOLQH\RX·YHDOUHDG\W\SHGXVHWKHDUURZNH\VWRPRYHWKH
FXUVRUWRZKHUHWKHQHZOLQHVKRXOGEHJLQ3UHVV(QWHUDQGDOOWH[WIROORZLQJWKH
FXUVRUPRYHVGRZQRQHOLQH
7RLQVHUWDEODQNOLQHEHWZHHQWZROLQHV\RX·YHDOUHDG\W\SHGPRYHWKH
FXUVRUWRWKHHQGRIWKHILUVWOLQHDQGSUHVV(QWHU$EODQNOLQHDSSHDUVEHWZHHQ
WKHWZROLQHVDQGDOOWH[WIROORZLQJWKHEODQNOLQHPRYHVGRZQRQHOLQH
<RXFDQHQWHUDVPDQ\DVOLQHVRQDODEHOGHSHQGLQJRQWKHZLGWKRIWKHWDSHWKH
W\SHVL]HWKHOLQHVSDFLQJDQGRUWKHDPRXQWRIVSDFHLQWKHDUHDLQDVWDQGDUG
OD\RXW
Correcting multiple line problems
$V\RXW\SHWKHV\VWHPFDOFXODWHVKRZPDQ\OLQHVZLOOILWRQWKHLQVWDOOHGVXSSO\DQG
ZLWKLQWKHVSHFLILHGOHQJWKLI\RXSUHYLRXVO\HQWHUHGDODEHOOHQJWK,I\RXKDYH
HQWHUHGWRRPDQ\OLQHVWKHV\VWHPGLVSOD\VRQHRIVHYHUDOPHVVDJHVGHVFULELQJWKH
HUURU
•
,I\RXVWDUWDQHZOLQHDQGWKDWOLQHZLOOQRWILWRQWKHWDSH\RXKDYHLQVWDOOHGWKH
IROORZLQJPHVVDJHGLVSOD\V7KLVPHVVDJHDOVRGLVSOD\VLI\RXHQWHUPRUHOLQHVWKDQ
ZLOOILWRQRQHODEHOWKHPD[LPXPLV
Type too large or too many lines
Adding lines, labels and areas to freeform labels
2-7
•
,IWKHWH[W\RXHQWHUZRQ·WILWLQWKHVSHFLILHGOHQJWKWKLVPHVVDJHGLVSOD\V
Text too long
7RIL[WKHDERYHSUREOHPV\RXFDQ
•
6HOHFWDVPDOOHUW\SHVL]H6HH´&KDQJLQJW\SHVL]HµRQSDJH
•
&KDQJHWKHOLQHVSDFLQJWR7LJKWDVGHVFULEHGLQ´&KDQJLQJWKHORRNRIWKHODEHOµ
RQSDJH
•
3UHVVWKH1HZ$UHDNH\WRFUHDWHDQHZDUHDRQWKHFXUUHQWODEHO
•
8VHIHZHUOLQHVRQWKHODEHO
,I\RXKDYHDFRQWLQXRXVFRORUPRQRFKURPHULEERQLQVWDOOHGDQG\RXWKHQDGGD
VHFRQGFRORUWRWKHODEHOLI\RXUH[LVWLQJWH[WDOUHDG\H[FHHGVWKHPD[LPXPIRUPXOWL
FRORURXWSXW\RX·OOVHHWKH´7H[WWRRORQJPHVVDJHµVKRZQEHORZ
Text too long for more than one color.
Press any key to continue.
7KHPD[LPXPPXOWLFRORURXWSXWLV
LQFKHVLI\RXUV\VWHPKDVEHHQXSJUDGHGZLWKDGGLWLRQDOPHPRU\
LQFKHVLILWKDVWKHVWDQGDUGPHPRU\DOORWPHQW
<RXFDQILQGRXWZKHWKHU\RXUV\VWHPKDVDGGLWLRQDOPHPRU\E\FKHFNLQJWKH
+DUGZDUHYHUVLRQRQWKH6WDWXVZLQGRZ6HH´&KHFNLQJV\VWHPVWDWXVµRQSDJH
IRULQVWUXFWLRQV
:KHQ\RXSUHVVDQ\NH\WRFRQWLQXHWKHPHVVDJHGLVDSSHDUV7RIL[WKLVSUREOHP\RX
FDQHLWKHUUHGXFHWKHOHQJWKRIWKHWH[WRULQVWDOODSDQHOHGULEERQ)RULQIRUPDWLRQ
DERXWSDQHOHGULEERQVVHH´6HOHFWLQJULEERQW\SHµRQSDJH
Entering multiple labels
8VHWKH1HZ/DEHONH\WRHQWHUPDQ\ODEHOVDWDWLPHWKHQSULQWWKHPDOODWRQFH$V
\RXHQWHUODEHOVMXVWSUHVV1HZ/DEHOZKHQ\RXZDQWWRVWDUWDQHZRQH1RWHWKDW
•
2-8
7KHFXUVRUPXVWEHSRVLWLRQHGWRWKHULJKWRIWKHODVWFKDUDFWHURQWKHODEHOZKHQ
\RXSUHVV1HZ/DEHO$IWHU\RXSUHVV1HZ/DEHOWKHFXUVRULVSRVLWLRQHGLQWKH
ILUVWOLQHRIWKHQHZODEHO
Label Creation
•
:KHQ\RXVWDUWDQHZODEHOWKHFKDQJHPDUNHUVIURPWKHSUHYLRXVODEHODUHVWLOOLQ
HIIHFW)RUH[DPSOHLI\RXFKRVHDQHZW\SHVL]HRQWKHSUHYLRXVODEHOWKDWVL]H
DSSOLHVRQWKHQHZODEHO$OVRUHPHPEHUWKDWDQ\ODEHORSWLRQV\RXFKRRVHVXFK
DVFKDQJLQJWKHMXVWLILFDWLRQDIIHFWHYHU\ODEHOLQWKHWH[WEXIIHU
•
7RPRYHEHWZHHQWKHODEHOVLQWKHWH[WEXIIHUXVHWKH1H[W/DEHODQG3UHY/DEHO
NH\V7KHDUHDDQGODEHOQXPEHUVLQWKHQDYLJDWLRQDUHDDUHXSGDWHGDV\RXPRYH
EHWZHHQODEHOV
Creating labels with multiple areas
6RPHWLPHV\RXQHHGWRFUHDWHODEHOVWKDWFRQWDLQPRUHWKDQRQHDUHD)RUH[DPSOH
\RXPD\QHHGDODEHOWKDWFRQWDLQVDZDUQLQJPHVVDJHLQODUJHW\SHQH[WWRDIUDPHG
H[SODQDWLRQLQVPDOOHUW\SHDVVKRZQEHORZ
Area 1
SECURITY
CLEARANCE
REQUIRED
Insert identification card
into reader, text side up.
If entry is approved, gates
will open automatically
within five seconds.
Area 2
7RGRWKLVSUHVVWKH1HZ$UHDNH\ZKHUH\RXZDQWWRVWDUWWKHQHZDUHD
$IWHU\RXSUHVVWKH1HZ$UHDNH\WKHFXUVRULVSRVLWLRQHGRQWKHILUVWOLQHRIWKHQHZ
DUHD7KHDUHDOLQHLQWKHQDYLJDWLRQDUHDWHOOV\RXZKLFKDUHD\RXDUHFXUUHQWO\
ZRUNLQJLQ7KHRWKHUDUHDV\RXFUHDWHGDUHVWLOOLQWKHWH[WEXIIHU\RXFDQPRYH
EHWZHHQWKHPE\SUHVVLQJWKH1H[W$UHDDQG3UHY$UHDNH\V
:KHQ\RXVWDUWDQHZDUHDWKHFKDQJHPDUNHUVIURPWKHSUHYLRXVDUHDDUHVWLOOLQ
HIIHFW)RUH[DPSOHLI\RXFKRVHDQHZW\SHVL]HLQWKHSUHYLRXVDUHDWKDWVL]HDSSOLHV
LQWKHQHZDUHD$OVRUHPHPEHUWKDWDQ\ODEHORSWLRQV\RXFKRRVHVXFKDVFKDQJLQJ
WKHMXVWLILFDWLRQDIIHFWHYHU\ODEHODQGDUHDLQWKHWH[WEXIIHU
Note: ,I\RXDGGDVHFRQGFRORULQDQHZDUHDZKHQ\RXKDYHD
FRQWLQXRXVFRORUPRQRFKURPHULEERQLQVWDOOHGDQGLIWKHH[LVWLQJWH[W
LVDOUHDG\ORQJHUWKDQWKHVXSSRUWHGPD[LPXPODEHOOHQJWK\RX·OOVHHWKH
PHVVDJHVKRZQKHUH
Text too long for more than one color.
Press any key to continue.
6HH´&RUUHFWLQJPXOWLSOHOLQHSUREOHPVµRQSDJHIRUPRUH
LQIRUPDWLRQ
Adding lines, labels and areas to freeform labels
2-9
•
:KHQ\RXSULQWODEHOVWKDWFRQWDLQPXOWLSOHDUHDVWKHV\VWHPDXWRPDWLFDOO\VSDFHV
WKHDUHDVVRWKHWH[WGRHVQ·WUXQWRJHWKHU
Note: <RXUV\VWHPFRPHVZLWKWZHOYHFRPPRQO\XVHGVWDQGDUGODEHO
OD\RXWVWKDWDOORZ\RXWRTXLFNO\FUHDWHODEHOVZLWKPXOWLSOHDUHDV2QH
DGYDQWDJHRIXVLQJWKHVWDQGDUGOD\RXWVLVWKDWZKHQ\RXPRYHWRDQHZ
DUHD\RXFDQFKDQJHVRPHODEHORSWLRQVIRUWKDWDUHDZKLFKJLYHV\RX
HYHQPRUHIOH[LELOLW\LQ\RXUODEHOGHVLJQV)RUPRUHLQIRUPDWLRQVHH
´8VLQJVWDQGDUGOD\RXWVµRQSDJH
2-10
Label Creation
Using standard layouts
<RXUV\VWHPSURYLGHVDVHWRIVWDQGDUGODEHOOD\RXWVWKDW\RXFDQXVHWRFUHDWH
DGYDQFHGGHVLJQVVXFKDVODEHOVZLWKPDQ\DUHDV7KHUHDUHRIWKHVHOD\RXWV
DYDLODEOHDQGWKH\DUHDFFHVVHGZLWKWKH/DEHO/D\RXWNH\7KHOD\RXWVDUHVHWXS
XVLQJSUHGHILQHGIRUPDWVWRKHOS\RXSURGXFHODEHOVDVTXLFNO\DVSRVVLEOH7KH
V\VWHPWDNHVFDUHRISRVLWLRQLQJODEHOHOHPHQWVVXFKDVWH[WJUDSKLFVDQGEDUFRGHV
DQGVHWVXSPXOWLSOHOLQHVDQGDUHDVZKHUHQHFHVVDU\
7KLVVHFWLRQWDNHV\RXWKURXJKHQWHULQJWH[WDQGXVLQJWKHODEHORSWLRQVLQDVWDQGDUG
OD\RXW)LUVWKHUHDUHVRPHSRLQWVWRNHHSLQPLQGZKHQZRUNLQJZLWKVWDQGDUG
OD\RXWV
•
7KHWH[WHQWU\DUHDQDYLJDWLRQDUHDDQGSUHYLHZDUHDZRUNMXVWDVWKH\GRZKHQ
\RXDUHFUHDWLQJDQ\RWKHUW\SHRIIUHHIRUPODEHO)RUH[DPSOH\RXFDQXVHWKH
1H[W$UHDDQG3UHY$UHDNH\VWRPRYHEHWZHHQDUHDV<RXFDQDOVRSUHVV7DEWR
PRYHWRWKHQDYLJDWLRQDUHDDQGHQWHUDGLIIHUHQWDUHDQXPEHU
•
<RXFDQXVHRQHODEHOOD\RXWDWDWLPHLQWKHWH[WEXIIHUEXW\RXFDQFUHDWHPXOWLSOH
ODEHOVXVLQJWKDWOD\RXW-XVWSUHVVWKH1HZ/DEHONH\WREHJLQDQHZODEHO1RWH
WKDWDUHDVHWWLQJVIRUWKHQHZODEHODUHWKHRQHVIURPWKHSUHYLRXVDUHDQRWIURP
WKHFRUUHVSRQGLQJDUHDRQWKHSUHYLRXVODEHO
•
:KHQWKHFXUVRULVLQWKHWH[WHQWU\DUHD\RXFDQSUHVVWKH(VFDSHNH\WRUHGLVSOD\
WKH/DEHO/D\RXWZLQGRZDQGVHOHFWDQHZOD\RXW,I\RXFKRRVHDQHZOD\RXWDOO
WH[WLQWKHWH[WEXIIHULVGHOHWHG
•
/D\RXWVXVHDSUHGHILQHGDPRXQWRIYHUWLFDOVSDFHEXWWKHKRUL]RQWDOZLGWKRIDQ
DUHDDGMXVWVWRHQFRPSDVVWKHORQJHVWOLQHRIWH[W\RXHQWHU<RXFDQSUHVVWKH
/DEHO/HQJWKNH\WRFKRRVHDVSHFLILFOHQJWKIRUWKHODEHO,I\RXGRVRHYHU\
KRUL]RQWDODUHDLQWKHOD\RXWZLOOEHGLYLGHGHYHQO\WRXVHXSWKHOHQJWK\RX
VHOHFWHG)RUH[DPSOHLIWKHOD\RXWFRQWDLQVWZRVLGHE\VLGHDUHDVHDFKDUHDZLOO
WDNHXSKDOIRIWKHOHQJWK\RXVHOHFWHG5HIHUWR´6HWWLQJODEHOOHQJWKµRQSDJH
IRUPRUHLQIRUPDWLRQ
•
:KHQ\RXVHOHFWDOD\RXWWKHV\VWHPFKHFNVWKDWWKHFXUUHQWW\SHVL]HZLOOILWLQWKH
OD\RXW,IWKHW\SHVL]HZRQ·WILWWKHIROORZLQJPHVVDJHGLVSOD\VDQG\RXQHHGWR
UHVHWWKHVL]H5HIHUWR´&KDQJLQJW\SHVL]HµRQSDJHIRUPRUHLQIRUPDWLRQ
Type too large. Try a type size of
XX in.
•
<RXFDQVDYHDQGUHWULHYHODEHOVWKDWXVHVWDQGDUGOD\RXWVMXVWDV\RXFDQDQ\RWKHU
ODEHO5HIHUWR&KDSWHU´/DEHO6WRUDJHµ
Using standard layouts
2-11
Entering text in a standard layout
)ROORZWKHVHVWHSVWRFUHDWHODEHOVXVLQJDVWDQGDUGOD\RXW
1) Press the Label Layout key.
7KH/DEHO/D\RXWZLQGRZGLVSOD\V
:
1
:
1
:
1
13.75"
Label Layout
Press ↑↓←→, ENTER or ESC
2) Press the ↑ or ↓ and ← or → keys to move the cursor to the representation of the
layout you want to use.
3) When the layout you want to use is highlighted, press Enter.
4) Type your label information and select label options for the first area in the
layout.
6HHWKH´8VLQJ/DEHO2SWLRQVLQVWDQGDUGOD\RXWVµVHFWLRQWKDWIROORZVWKLVVHFWLRQ
5) Press the New Area key to move to the next area in the layout. Enter the
information for that area. Continue to do this until you’ve entered information for
all areas in the layout.
7KHQDYLJDWLRQDUHDXSGDWHVWRLQGLFDWHZKLFKDUHD\RX·UHZRUNLQJLQ
6) To create another label using the same standard layout, press the New Label key
and repeat this procedure.
Using label options in standard layouts
:KHQ\RXXVHDVWDQGDUGOD\RXW\RXFDQDSSO\PDQ\ODEHORSWLRQVWRVSHFLILFDUHDVRI
DQ\ODEHO7KLVGLIIHUVIURPHQWHULQJDW\SLFDOIUHHIRUPODEHOZKHUHODEHORSWLRQV
DSSO\WRDOOODEHOVDQGDUHDVLQWKHWH[WEXIIHU<RXFDQVHOHFWMXVWLILFDWLRQWH[W
SRVLWLRQWH[WGLUHFWLRQOLQHVSDFLQJDQGEDVHOLQHVHWWLQJVIRUVSHFLILFDUHDV\RX
FDQQRWVHWWKHPLUURURSWLRQIRUVSHFLILFDUHDV7RVHHH[DPSOHVRIHDFKRSWLRQUHIHU
WR´6HOHFWLQJODEHORSWLRQVµRQSDJH
2-12
Label Creation
To select label options for a specific area in a standard layout:
1) Place the cursor in the standard layout area in which you want to make a change.
Press the Label Options key.
7KH/DEHO2SWLRQVZLQGRZGLVSOD\V
Label Options
Justification:
Text position:
Text direction:
Line spacing:
Center
Middle
Along tape
Normal
Press ↑↓←→, ENTER or ESC
2) Press the ↑ or ↓ key to move the cursor to the option you want to change.
3) When the option you want to set is highlighted, press the ← or → key to scroll
through the available option settings.
Label option
What to do
Justification
Choose Left, Center or Right. The default justification value is set
through the Setup options as described in “Setting system defaults”
on page 1-23.
Text position
Choose Top, Middle (default) or Bottom to control whether the text is
vertically centered in the top third, middle third or bottom third of the
label.
Text direction
Choose Along tape (default), Up tape or Down tape.
Line spacing
Choose Normal (default), Tight or Loose. The Loose setting may
provide better results when printing accented characters.
Baseline
Choose Center (default) or Fixed.
4) Repeat these steps if you want to choose settings for other label options.
5) Press Enter when all of the settings you want to use are displayed.
7KH0DNH&KDQJHZLQGRZGLVSOD\V3UHVVWKH↑RU↓NH\WRKLJKOLJKWWKHRSWLRQ
\RXZDQWWRXVHVHHWKHWDEOHEHORZ7KHQSUHVVWKH(QWHUNH\
Make Change
At beginning of text
At beginning of area
Press ↑↓, ENTER or ESCAPE
Make Change option
What it does
At beginning of text
Changes the option for all text in the text buffer.
At beginning of area
Changes the option for all text starting with the current area.
Using standard layouts
2-13
$IWHUPDNLQJDVHOHFWLRQ\RXUHWXUQWRWKHWH[WHQWU\DUHD,I\RXDSSOLHGWKHRSWLRQ
WRWKHEHJLQQLQJRIWKHDUHDDFKDQJHPDUNHUUHSUHVHQWLQJWKHRSWLRQFKDQJH
DSSHDUVLQWKHWH[WHQWU\DUHD 5HSHDWWKHVHVWHSVZKHQ\RXZDQWWRUHVHWDQ
RSWLRQ
Note: 7KHRQO\ODEHORSWLRQ\RXFDQQRWVHWIRUDQLQGLYLGXDODUHDLV
WKH0LUURURSWLRQ,I\RXFKDQJHWKLVRSWLRQZLWKLQDVWDQGDUGOD\RXW
\RX·OOVHHDPHVVDJHVWDWLQJWKDWWKHFKDQJHZLOODIIHFWDOOODEHOVLQWKH
WH[WEXIIHU
2-14
Label Creation
Using specialty applications
<RXUV\VWHPLVHTXLSSHGZLWKVHYHUDOVSHFLDOW\DSSOLFDWLRQVWKDWDOORZ\RXWRTXLFNO\
SURGXFHODEHOVIRUDVSHFLILFXVH7KH6LJQV+D]DUGRXV:DVWH/DEHOVDQG3LSH
0DUNHUVDSSOLFDWLRQVDUHVWDQGDUGRQHYHU\V\VWHP7KHVHVSHFLDOW\DSSOLFDWLRQVOHDG
\RXWKURXJKWKHFUHDWLRQRIDQLWHPVXFKDVDVLJQVWHSE\VWHS
Note: $OOVSHFLDOW\DSSOLFDWLRQVZRUNVLPLODUO\EXW\RXVKRXOG
FRQVXOWHDFKDSSOLFDWLRQ·VVSHFLILFGRFXPHQWDWLRQIRUGHWDLOHG
LQVWUXFWLRQDVWKHUHDUHGLIIHUHQFHV\RXZLOOQHHGWRNQRZ
7KHIROORZLQJLQIRUPDWLRQLVFRQVLVWHQWIRUDOOVSHFLDOW\DSSOLFDWLRQV
•
7KHODEHOQXPEHUVWHSQXPEHULQGLFDWRULQWKHWRSULJKWFRUQHURIWKHGLVSOD\
VKRZVZKLFKODEHOLQWKHWH[WEXIIHU\RXDUHZRUNLQJRQDQGZKLFKVWHSLQWKH
SURFHVV\RXDUHFRPSOHWLQJ<RXFDQQRWWDEWRWKLVDUHDDQGFKRRVHDGLIIHUHQW
ODEHORUVWHSDV\RXFDQLQWKHVWDQGDUGV\VWHPGLVSOD\
•
$IWHU\RXHQWHUWKHUHTXLUHGLQIRUPDWLRQRUPDNHDVHOHFWLRQSUHVVWKH1H[W6WHS
NH\WRFRQWLQXHWKHSURFHVV
•
7RUHWXUQWRDSUHYLRXVVWHSLQWKHSURFHVVSUHVVWKH3UHY6WHSNH\
•
$VLQWKHVWDQGDUGV\VWHPGLVSOD\WKHKHOSOLQHEHORZHDFKZLQGRZOLVWVWKHNH\V
\RXFDQXVHDWDQ\SRLQWLQWKHSURFHVVDQGWKHSUHYLHZDUHDJLYHV\RXDQLGHDRI
ZKDWDVHOHFWLRQZLOOORRNOLNHZKHQSULQWHG
To use a specialty application, follow these basic steps:
1) Press the App key located on the far right side of the labeling system keyboard.
7KH$SSOLFDWLRQZLQGRZGLVSOD\VDQGORRNVVLPLODUWRWKHH[DPSOHEHORZ
Application
Freeform
Signs
Hazardous Waste Labels
Pipe Markers
Press ↑↓, ENTER or SETUP
2) Press the ↑ or ↓ key to move the cursor to the application you want to use. Press
Enter.
7KHDSSOLFDWLRQRSHQVDQGLWVWLWOHGLVSOD\VLQWKHXSSHUOHIWFRUQHURIWKHZLQGRZ
7KHV\VWHPEHJLQVGLVSOD\LQJDVHULHVRIVFUHHQVLQZKLFK\RXQHHGWRVHOHFWRSWLRQV
IRUWKHVLJQRUODEHO\RXZDQWWRFUHDWH
Using specialty applications
2-15
2-16
Label Creation
Chapter 3: Label Design
7KLVFKDSWHUGHVFULEHVDYDULHW\RIODEHOGHVLJQRSWLRQV\RXFDQXVHWRGHVLJQ\RXU
ODEHO,WFRQWDLQV
&KDQJLQJWKHORRNRIWKHWH[WEHJLQQLQJRQSDJHZLWKLQVWUXFWLRQVIRU
FKDQJLQJIRQWVDQGIRQWVL]HVDQGIRUXVLQJW\SHRSWLRQVOLNHUHYHUVHWH[WDQG
EDFNJURXQGFRORU
$GGLQJJUDSKLFVEHJLQQLQJRQSDJHZLWKLQVWUXFWLRQVIRUDGGLQJV\PEROV
IURPWKH6\PERO5HIHUHQFHLQFOXGHGZLWKWKLV8VHU·V*XLGHDQGLQVRPHFDVHV
FKRRVLQJFRORUVIRUWKHV\PEROV
&KDQJLQJWKHORRNRIWKHODEHOEHJLQQLQJRQSDJHZLWKLQVWUXFWLRQVIRU
VHWWLQJODEHOOHQJWKVHOHFWLQJODEHORSWLRQVOLNHWH[WSRVLWLRQDQGMXVWLILFDWLRQWH[W
GLUHFWLRQDQGPLUURULPDJLQJDQGDGGLQJIUDPHVDQGERUGHUVWR\RXUODEHOV
8VLQJWKHGDWHDQGWLPHRSWLRQEHJLQQLQJRQSDJHZKLFKWHOOV\RXKRZWR
VHWDQGIRUPDWWKHGDWHDQGWLPHDQGHQWHULWRQDODEHO
&UHDWLQJVHTXHQFHVEHJLQQLQJRQSDJHZKLFK\RXFDQXVHWRFUHDWHDVHULHHV
RIODEHOVZKLOHW\SLQJWKHLQIRUPDWLRQRQO\RQFH
:RUNLQJZLWKEDUFRGHVEHJLQQLQJRQSDJHZLWKLQVWUXFWLRQVIRUVHOHFWLQJ
FKRRVLQJDWWULEXWHVDQGHQWHULQJEDUFRGHVRQ\RXUODEHOV
3-1
Changing the look of the text
8VHWKHSURFHGXUHVLQWKLVVHFWLRQWRVHOHFWWH[WRSWLRQVVXFKDVWKHIRQWFRORUDQG
W\SHRSWLRQV
Selecting a font
<RXUV\VWHPDOORZV\RXWRFUHDWHODEHOVWKDWXVHDYDULHW\RIW\SHVW\OHVZKLFKDUH
XVXDOO\UHIHUUHGWRDVIRQWVDQGWRFRPELQHW\SHVW\OHVRQDODEHO Authorized Personnel Only
Photo identification required
Note: :KHQ\RXILUVWZRUNRQDODEHOWKHGHIDXOWIRQWVHOHFWHGWKURXJK
WKH6HWXSZLQGRZLVDXWRPDWLFDOO\XVHGXQOHVV\RXFKRRVHDGLIIHUHQW
IRQW<RXFDQFKDQJHWKHGHIDXOWIRQWDVGHVFULEHGLQ´6HWWLQJV\VWHP
GHIDXOWVµRQSDJH
To change the font:
1) From the text area of a label, press the Font key at the point in the text where you
want the font to take effect. If you have already typed the text, first move the
cursor to the first letter you want printed in the font you are going to select.
7KH)RQWZLQGRZGLVSOD\VWKHDYDLODEOHW\SHVW\OHV
Font
Swiss Medium
Swiss Bold
Alternate Gothic
Dutch Roman
Your printer may
include these or
other fonts
Press ↑↓, ENTER or ESC
2) Press the ↑ or ↓ key to highlight the name of the font you want to use. Then press
Enter.
7KH0DNH&KDQJHZLQGRZGLVSOD\V
Make Change
At beginning of text
At cursor
Press ↑↓, ENTER or ESC
3-2
Label Design
3) Press the ↑ or ↓ key to highlight the option you want to use. Then press Enter.
Make Change option
What it does
At beginning of text
Changes the font for all text in the text buffer. However, if
you’ve already changed the font within the text, that font will
remain in effect; this change will apply only to the text
preceding the first font change marker.
At cursor
Changes the font for all text starting at the current cursor
position.
$FKDQJHPDUNHUUHSUHVHQWLQJWKHIRQWFKDQJHDSSHDUVLQWKHWH[WHQWU\DUHD Note: 5HSHDW6WHSVWRFKDQJHWKHIRQWDJDLQ
Changing type size
,QDGGLWLRQWRFKDQJLQJWKHW\SHVW\OHIRQWRQDODEHO\RXFDQDOVRFKDQJHWKHW\SH
VL]H<RXFDQXVHDYDULHW\RIW\SHVL]HVRQDVLQJOHODEHO
NOTICE
This office will close at noon
on Friday, May 15.
(DFKIRQWLVDYDLODEOHLQDUDQJHRIW\SHVL]HV³WKHODUJHUWKHVL]HWKHWDOOHUWKHOHWWHUV
7\SHVL]HFDQEHPHDVXUHGLQSRLQWVLQFKHVRUPLOOLPHWHUV7RFKDQJHWKHXQLWRI
PHDVXUHXVHWKH6HWXSNH\DVGHVFULEHGLQ´6HWWLQJV\VWHPGHIDXOWVµRQSDJH
Note: :KHQ\RXILUVWZRUNRQDODEHOWKHGHIDXOWW\SHVL]HVHOHFWHG
WKURXJKWKH6HWXSZLQGRZLVDXWRPDWLFDOO\XVHGXQOHVV\RXFKRRVHD
GLIIHUHQWVL]H<RXFDQFKDQJHWKHGHIDXOWW\SHVL]HDVGHVFULEHGLQ
´6HWWLQJV\VWHPGHIDXOWVµRQSDJH
To change the type size:
1) Press the Type Size key where you want the size to take effect. If you have
already typed the text, first move the cursor to the first letter you want printed in
the size you are going to select.
7KH7\SH6L]HZLQGRZGLVSOD\VWKHUDQJHRIW\SHVL]HV\RXFDQXVH
Type Size
Size (.08 - 8.0 in.):
0.00
Type values, press ENTER or ESCAPE
Changing the look of the text
3-3
2) Type a number within the valid size range.
1RWHWKHIROORZLQJDERXWW\SHVL]H
•
7KHW\SHVL]H\RXFDQXVHGHSHQGVRQWKHZLGWKRIWKHVXSSO\WKDW·VFXUUHQWO\
LQVWDOOHG)RUH[DPSOH\RXZRQ·WEHDEOHWRVHOHFWDQLQFKVL]HLIWKHVXSSO\
LVRQO\LQFKHVZLGH
•
,I\RX·YHDOUHDG\W\SHGWH[WDQG\RXVHOHFWDW\SHVL]HWKDWZRXOGPDNHWKHWH[W
QRWILWRQWKHLQVWDOOHGVXSSO\DQHUURUPHVVDJHGLVSOD\V
•
$ERYHFHUWDLQW\SHVL]HVIRUHDFKVXSSO\ZLGWKWKHV\VWHPZLOOSULQWWKHWH[WLQ
DOOFDSLWDOOHWWHUV,IWKLVRFFXUV\RX·OOVHHD´&DSVRQO\µPHVVDJH
3) Press Enter.
7KH0DNH&KDQJHZLQGRZDSSHDUV
Make Change
At beginning of text
At cursor
Press ↑↓, ENTER or ESCAPE
4) Press the ↑ or ↓ key to highlight the option you want to use. Then press Enter.
Make Change option
What it does
At beginning of text
Changes the type size for all text in the text buffer. However, if
you’ve already changed the size within the text, that size will
remain in effect; this change will apply only to the text
preceding the first type size change marker.
At cursor
Changes the type size for all text starting at the current cursor
position.
$FKDQJHPDUNHUUHSUHVHQWLQJWKHW\SHVL]HFKDQJHDSSHDUVLQWKHWH[WHQWU\DUHD
Note: 5HSHDWWKHVHVWHSVZKHQ\RXZDQWWRFKDQJHWKHW\SHVL]H
DJDLQ
3-4
Label Design
Changing type options
<RXUV\VWHPJLYHV\RXVHYHUDOGLIIHUHQWZD\VRIFKDQJLQJWKHORRNRIFHUWDLQWH[WRQ
\RXUODEHOV8VLQJWKH7\SH2SWLRQVNH\\RXFDQHDVLO\VHOHFWRQHRIWKHIROORZLQJ
RSWLRQVRUFRPELQHVHYHUDORIWKHP
•
&RORU³7RFKDQJHWH[WFRORU
•
([SDQGFRQGHQVHWH[W³7RVWUHWFKRUFRPSUHVVWH[WKRUL]RQWDOO\DVVKRZQ
EHORZ7KHKHLJKWRIWKHWH[WVWD\VWKHVDPH
Expanded text
•
Condensed text
,WDOLFVRU8QGHUOLQH
Italicized text
Underlined text
•
&KDUDFWHUSRVLWLRQ³7RSULQWWH[WLQVXEVFULSWDQGVXSHUVFULSWSRVLWLRQV
Subscript: H2O
•
t
e
x
t
9HUWLFDOSULQW³7RURWDWHDOOWH[WWRSULQWYHUWLFDOO\RQWKHWDSHDVVKRZQEHORZ V
e
r
t
i
c
a
l
•
Superscript: 104
5HYHUVHFRORU³7RSULQWWKHODEHOUHYHUVLQJWKHEDFNJURXQGFRORUDQGWKHWH[W
FRORU)RUH[DPSOH
5HYHUVH2II
5HYHUVH2Q
Changing the look of the text
3-5
6RPHSRLQWVWRQRWHDERXW5HYHUVH
•
,IWKHUHDUHPXOWLSOHWH[WFRORUVLQWKHDUHDWREHUHYHUVHGWKHV\VWHPXVHVWKH
ILUVWWH[WFRORULWILQGVLQWKHDUHDDVWKHUHYHUVHFRORU7H[WLQRWKHUFRORUV
UHPDLQVLQWKHRULJLQDOFRORUVDQGLVQRWUHYHUVHG
•
7KH5HYHUVHRSWLRQGRHVQRWWDNHHIIHFWDW\RXUFXUVRUSRVLWLRQLWZLOODSSO\WR
WKHHQWLUHDUHDLQZKLFK\RXDUHZRUNLQJZKHQ\RXWXUQWKHVHWWLQJRQ,IWKHUH
DUHQRDGGLWLRQDODUHDVRQWKHODEHO5HYHUVHDSSOLHVWRWKHHQWLUHODEHO
•
2QFH5HYHUVHLVVHWWR2QLWUHPDLQVLQHIIHFWXQWLO\RXWXUQLW2IIDJDLQ,I
\RXFUHDWHQHZDUHDVZLWKRXWILUVWWXUQLQJ5HYHUVH2IIWKRVHZLOOSULQWLQ
UHYHUVHDVZHOO2IILVWKHGHIDXOWVHWWLQJ
$OVRQRWHWKHIROORZLQJUHVWULFWLRQVIRUXVLQJWKH5HYHUVHFRORURSWLRQ
•
3-6
•
<RXPD\QRWXVH5HYHUVHLI\RXKDYHVHWD%DFNJURXQGFRORURSWLRQIRUWKH
ODEHODQGYLFHYHUVD
•
<RXPD\QRWXVH5HYHUVHLIWKHODEHOOHQJWKRUH[LVWLQJWH[WDOUHDG\H[FHHGVWKH
PD[LPXPVXSSRUWHGOHQJWKIRUPXOWLFRORURXWSXWZKLFKLVLQFKHVLI\RXU
V\VWHPKDVDGGHGPHPRU\DQGLQFKHVLILWGRHVQRW7RILQGRXWZKHWKHU
\RXUV\VWHPKDVDGGHGPHPRU\VHH´&KHFNLQJV\VWHPVWDWXVµRQSDJH
7KLVUHVWULFWLRQDSSOLHVUHJDUGOHVVRIWKHQXPEHURIFRORUVRQ\RXUODEHO
•
<RXPD\QRWXVH5HYHUVHLIWKHDUHD\RXKDYHVHOHFWHGRUWKHODEHOFRQWDLQV
PXOWLSOHWH[WFRORUV<RX·OOVHHDPHVVDJHLQIRUPLQJ\RXWKDW\RXFDQ
KRZHYHUXVH%DFNJURXQGFRORUZKHQ\RXDUHXVLQJPXOWLSOHWH[WFRORUV
•
<RXPD\QRWXVH5HYHUVHLI\RXKDYHDPRQRFKURPHULEERQLQVWDOOHG\RXSLFN
DVHFRQGFRORUIRUWKHODEHODQGWKHDPRXQWRIH[LVWLQJWH[WDOUHDG\H[FHHGV
WKHPD[LPXPIRUPXOWLFRORURXWSXWZKLFKLVLQFKHVLI\RXUV\VWHPKDV
DGGHGPHPRU\DQGLQFKHVLILWGRHVQRW7RILQGRXWZKHWKHU\RXUV\VWHP
KDVDGGHGPHPRU\VHH´&KHFNLQJV\VWHPVWDWXVµRQSDJH
•
<RXPD\QRWXVH5HYHUVHLI\RXKDYHDPRQRFKURPHULEERQLQVWDOOHG\RXSLFN
DVHFRQGFRORUIRUWKHODEHODQGDODEHOOHQJWKORQJHUWKDQWKHPD[LPXPIRU
PXOWLFRORUSULQWLQJKDVDOUHDG\EHHQVHWZKLFKLVLQFKHVLI\RXUV\VWHP
KDVDGGHGPHPRU\DQGLQFKHVLILWGRHVQRW7RILQGRXWZKHWKHU\RXU
V\VWHPKDVDGGHGPHPRU\VHH´&KHFNLQJV\VWHPVWDWXVµRQSDJH
%DFNJURXQGFRORU³7RSULQWDEDFNJURXQGFRORUIRUWKHFXUUHQWDUHD7KH
VHWWLQJVUHPDLQWKHVDPHUHJDUGOHVVRIZKDWW\SHULEERQ\RXKDYHLQVWDOOHGDQGWKH
HQWLUHFRORUSDOHWWHLVDYDLODEOH,I\RXVHWERWKWKHWH[WDQGWKHEDFNJURXQGWRWKH
VDPHFRORU\RXZLOOFUHDWHD5HYHUVHHIIHFWWKHVDPHDVLI\RXKDGVHWWKH5HYHUVH
RSWLRQ2QZKLFKLVGHVFULEHGDERYH
Label Design
6RPHSRLQWVWRQRWHDERXW%DFNJURXQGFRORU
•
7KH%DFNJURXQGRSWLRQGRHVQRWWDNHHIIHFWDW\RXUFXUVRUSRVLWLRQ,WZLOO
DSSO\WRWKHHQWLUHDUHDLQZKLFK\RXDUHZRUNLQJZKHQ\RXWXUQWKHVHWWLQJRQ
•
,IWKHUHDUHQRDGGLWLRQDODUHDVRQWKHODEHO%DFNJURXQGDSSOLHVWRWKHHQWLUH
ODEHO
•
2QFH%DFNJURXQGLVVHWWR2QLWUHPDLQVLQHIIHFWXQWLO\RXWXUQLW2IIDJDLQ
,I\RXFUHDWHQHZDUHDVZLWKRXWILUVWWXUQLQJ%DFNJURXQG2IIWKRVHZLOOSULQW
LQEDFNJURXQGVW\OHDVZHOO2IILVWKHGHIDXOWVHWWLQJ
$OVRQRWHWKHIROORZLQJUHVWULFWLRQVIRUXVLQJWKH%DFNJURXQGFRORURSWLRQ
•
<RXPD\QRWXVH%DFNJURXQGLI\RXKDYHVHWD5HYHUVHFRORURSWLRQIRUWKH
ODEHODQGYLFHYHUVD
•
<RXPD\QRWXVH%DFNJURXQGLIWKHODEHOOHQJWKRUH[LVWLQJWH[WDOUHDG\H[FHHGV
WKHPD[LPXPVXSSRUWHGOHQJWKIRUPXOWLFRORURXWSXWZKLFKLVLQFKHVLI
\RXUV\VWHPKDVDGGHGPHPRU\DQGLQFKHVLILWGRHVQRW7RILQGRXW
ZKHWKHU\RXUV\VWHPKDVDGGHGPHPRU\VHH´&KHFNLQJV\VWHPVWDWXVµRQSDJH
7KLVUHVWULFWLRQDSSOLHVUHJDUGOHVVRIWKHQXPEHURIFRORUVRQ\RXUODEHO
•
<RXPD\QRWXVH%DFNJURXQGLI\RXKDYHDPRQRFKURPHULEERQLQVWDOOHG\RX
SLFNDVHFRQGFRORUIRUWKHODEHODQGWKHDPRXQWRIH[LVWLQJWH[WDOUHDG\
H[FHHGVWKHPD[LPXPIRUPXOWLFRORURXWSXWZKLFKLVLQFKHVLI\RXU
V\VWHPKDVDGGHGPHPRU\DQGLQFKHVLILWGRHVQRW7RILQGRXWZKHWKHU
\RXUV\VWHPKDVDGGHGPHPRU\VHH´&KHFNLQJV\VWHPVWDWXVµRQSDJH
•
<RXPD\QRWXVH%DFNJURXQGLI\RXKDYHDPRQRFKURPHULEERQLQVWDOOHG\RX
SLFNDVHFRQGFRORUIRUWKHODEHODQGDODEHOOHQJWKORQJHUWKDQWKHPD[LPXP
IRUPXOWLFRORUSULQWLQJKDVDOUHDG\EHHQVHWZKLFKLVLQFKHVLI\RXU
V\VWHPKDVDGGHGPHPRU\DQGLQFKHVLILWGRHVQRW7RILQGRXWZKHWKHU
\RXUV\VWHPKDVDGGHGPHPRU\VHH´&KHFNLQJV\VWHPVWDWXVµRQSDJH
To change one or more type options:
1) Press the Type Options key where you want the option(s) to take effect.
7KH7\SH2SWLRQVZLQGRZGLVSOD\V
Type Options
Color:
Expand/Condense:
Italics:
Underline:
*Black*
100%
Off
Off
Press ↑↓←→, ENTER or ESCAPE
2) Press the ↑ or ↓ key to move the cursor to the option you want to set.
Changing the look of the text
3-7
3) When the option you want to set is highlighted, press the ← or → key to scroll
through the available option settings.
Type option
What to do
Color
Select a color for the text. The default is the first color value
stored in the memory cell of the installed ribbon, or black if no
ribbon is installed.
•
If either a paneled ribbon or a continuous color monochrome
ribbon is installed, you can choose from the entire color
palette. The colors available on that ribbon are listed first, and
are identified by asterisks around the color name, as shown on
the Type Options screen example above. When you print, you
will be prompted when you need to install a different color
ribbon. You can cycle through the color list.
•
If a continous color monochrome ribbon is installed, the color
of the installed ribbon is displayed but you cannot change the
color setting.
•
If no ribbon is installed, when you turned on the system you
were asked to choose whether you wanted to create labels
based on a paneled or monochrome ribbon type. If you chose
Paneled, you also chose the paneled ribbon colors you wanted
to use; those colors are available for selection.
For more information, see “How installed ribbons affect label
composition” on page 2-6.
3-8
Expand/Condense
Choose a number. Text can be expanded from 110% to 200% in
10% increments; the larger the number, the more the text is
expanded. Text can be condensed from 90% to 50% in 5%
increments; the smaller the number, the more the text is
condensed. You cannot change this value if the Condense to fit
option is on and a length for the label has been entered. Also
note that expanding the text may cause the label length to
exceed the maximum supported, and a message will display.
Italics
Choose On or Off (default).
Underline
Choose On or Off (default).
Vertical print
Choose On or Off (default). If there are multiple lines of text,
subsequent lines print to the left of the first line; in other words,
they are printed from right to left when you hold the tape
vertically. If you want the lines to print from left to right, enter the
lines in reverse order starting with the line you want to appear on
the left when you hold the tape vertically.
Character position
Choose Normal (default), Subscript or Superscript.
Label Design
Reverse
Choose On or Off. Off is the Default. On prints the text in the
current area in reverse, using the former background color for
the text and the former text color for the background.
Background color
Choose a background color for the selected area on the label, or
for the entire label if the label contains one area. The available
colors are described in the Color option at the beginning of this
table. Choose Off (default) if you don’t want a background color
used. To print the text in reverse as shown on page 3-6, select
the same colors for the text and background.
4) Repeat steps 2 and 3 if you want to choose settings for other type options.
5) Press Enter when all of the settings you want to use are displayed.
$FKDQJHPDUNHUUHSUHVHQWLQJWKHRSWLRQFKDQJHVDSSHDUVLQWKHWH[WHQWU\DUHD
Note: 5HSHDW6WHSVZKHQ\RXZDQWWRUHVHWDQRSWLRQ
Changing the look of the text
3-9
Adding graphics
7KHNH\ERDUGRQ\RXUV\VWHPFRQWDLQVPDQ\FRPPRQO\XVHGV\PEROVWKDW\RXFDQ
LQFOXGHRQODEHOVVXFKDV↓DQG<RXFDQDOVRXVHDYDULHW\RIRWKHUV\PEROV
IURPDUDQJHRIFDWHJRULHVE\XVLQJWKH*UDSKLFVNH\7KH6\PERO5HIHUHQFHVHFWLRQ
LQFOXGHGZLWKWKLVPDQXDOFRQWDLQVDFRPSOHWHOLVWRIV\PEROFDWHJRULHVDQGQXPEHUV
Note: 7KH,WDOLFVDQG([SDQG&RQGHQVHRSWLRQVDUHLJQRUHGIRU
V\PEROVDOWKRXJKV\PEROVPD\EHXQGHUOLQHG
To insert a graphics symbol on a label:
1) Move the cursor to where you want the symbol to print on the label. Press the
Graphics key.
7KH6\PEROZLQGRZGLVSOD\V
Category:
Symbol:
Color 1:
Color 2:
Symbol
Hazard Warning Diamonds
10
Black
None
Type values, ↑↓←→, ENTER or ESCAPE
As you scroll through the
list, the symbols are displayed in the preview area.
2) Press the ↑ or ↓ key to move the cursor to the Category option.
3) Press the ← or → key to scroll through the available option settings until you’ve
displayed the name of the category you want to use.
4) Press the ↑ or ↓ key to move the cursor to the Symbol option.
5) Press the ← or → key to scroll through the available symbols until you’ve
displayed the number of the one you want to use, or type the symbol number if
you know it.
7KH6\PERO5HIHUHQFHVHFWLRQFRQWDLQVDFRPSOHWHOLVWRIV\PEROFDWHJRULHVDQG
QXPEHUV
6) Press the ↑ or ↓ key to move the cursor to the Color 1 or Color 2 option.
7) Press the ← or → key to scroll through the available colors until you’ve displayed
the name of the one you want to use for the symbol.
7KHHQWLUHFRORUSDOHWWHLVDYDLODEOHWR\RXKHUHGHVSLWHWKHULEERQW\SHLQVWDOOHG
+RZHYHUWKHV\VWHPXVHVWKHULEERQVXSSOLHVLQVWDOOHGLQ\RXUV\VWHPGXULQJODEHO
3-10
Label Design
FRPSRVLWLRQWRGHWHUPLQHWKHUXOHV\RXPXVWIROORZIRUVHOHFWLQJFRORUVDQGDOVR
WRGHWHUPLQHWKHPD[LPXPODEHOOHQJWKVXSSRUWHG7KHV\VWHPUHDFWVWR\RXU
FRORUFKRLFHVGHSHQGLQJRQWKHW\SHRIULEERQLQVWDOOHG6HH´+RZLQVWDOOHG
ULEERQVDIIHFWODEHOFRPSRVLWLRQµRQSDJHIRUGHWDLOV
6RPHV\PEROVFRQVLVWRIPXOWLSOHSDUWVIRUZKLFK\RXFDQVHOHFWGLIIHUHQWFRORUV
7KH&RORUDQGWKH&RORUDQGSRVVLEOH&RORUDQGVRRQRSWLRQVOHW\RX
VHOHFWWKHFRORUIRULQGLYLGXDOSDUWVRIWKHV\PERO)RUV\PEROVWKDWDUHQRW
PXOWLSOHSDUWV\PEROVWKHFRORUOLVWHGLQWKH&RORURSWLRQLVWKHFRORURIWKH
HQWLUHV\PERODQGWKH&RORURSWLRQLQGLFDWHV1RQH)RUPXOWLSDUWV\PEROV\RX
FDQDOVRVHOHFWDYDOXHIRU&RORU:KHQ\RXPRYHWKHFXUVRUWRWKH&RORURU
&RORURSWLRQIRUPXOWLSDUWV\PEROVWKHSUHYLHZDUHDVKRZVZKLFKSDUWRIWKH
V\PEROZLOOSULQWLQWKHVHOHFWHGFRORU
7KHGHIDXOWFRORULVWKHILUVWRURQO\FRORUGHILQHGLQWKHFXUUHQWO\LQVWDOOHGULEERQ
RUWKHILUVWFRORULQWKHVXSSO\EHLQJXVHGWRFUHDWHWKHODEHO%ODFNLVWKHGHIDXOW
LIQRULEERQLVFXUUHQWO\LQVWDOOHG
8) Press Enter when all of the settings you want to use are displayed.
7KLVPDUNHUUHSUHVHQWLQJWKHV\PERODSSHDUVLQWKHWH[WHQWU\DUHD
Adding graphics
3-11
Changing the look of the label
<RXFDQFKDQJHWKHORRNRIDODEHOE\FKDQJLQJWKHOHQJWKRUFRQGHQVLQJWKH
FRQWHQWVE\DGGLQJIUDPHVDQGE\VHWWLQJRSWLRQVVXFKDVMXVWLILFDWLRQWH[WSRVLWLRQ
DQGGLUHFWLRQOLQHVSDFLQJDQGVRRQ
Setting label length
<RXXVHWKH/DEHO/HQJWKNH\WRVHWOHQJWK7KHOHQJWKV\RXPD\FKRRVHGHSHQGRQ
\RXUV\VWHPPHPRU\DQGWKHULEERQW\SH\RXKDYHLQVWDOOHG,QIRUPDWLRQRQWKRVH
VXEMHFWVIROORZVEHORZ
7KH/DEHO/HQJWKNH\VKRZV\RXWZRRSWLRQVWKDWKHOS\RXWRDXWRPDWLFDOO\FUHDWH
ODEHOVLQMXVWWKHVL]H\RXQHHG
•
/HQJWK³7KH/HQJWKRSWLRQOHWV\RXVSHFLI\WKHH[DFWOHQJWKRIWKHODEHOV\RX
ZDQWWRFUHDWH7KLVLVXVHIXOZKHQ\RXQHHGODEHOVWRILWLQDIL[HGVSDFHVXFKDVD
VORWRQDVKHOI,IQRODEHOOHQJWKLVHQWHUHGWKHV\VWHPXVHVDVPXFKWDSHDVLWQHHGV
WRSULQWWKHFRQWHQWVRIDODEHO
•
&RQGHQVHWRILW³,I\RXHQWHUDODEHOOHQJWK\RXFDQDOVRFKRRVHWRKDYHWKH
V\VWHPDXWRPDWLFDOO\FRQGHQVHWKHFRQWHQWWRILWLQWKDWOHQJWK,I\RXHQWHUPRUH
FRQWHQWIRUDODEHOWKDQZLOOILWLQWKHVHOHFWHGOHQJWKWKHFRQWHQWLVFRQGHQVHG,I
\RXGRQRWXVHWKHFRQGHQVHWRILWRSWLRQDQG\RXHQWHUPRUHFRQWHQWWKDQZLOOILW
LQWKHVHOHFWHGOHQJWKDQHUURUPHVVDJHGLVSOD\V
:KHQ\RXVHWDODEHOOHQJWKWKDWOHQJWKLVXVHGIRUHDFKODEHOLQWKHWH[WEXIIHU
Note: 7KH/HQJWKRSWLRQFDQEHFKDQJHGDWDQ\WLPHZKHWKHURUQRW
WKHUHLVWH[WLQWKHWH[WEXIIHUDVORQJDVWKH&RQGHQVHWRILWRSWLRQLVRII
+RZHYHUWKH&RQGHQVHWRILWRSWLRQFDQQRWEHFKDQJHGRQFH\RX·YH
W\SHGWH[WLQWKHWH[WEXIIHU
$VPHQWLRQHGDERYHWKHPD[LPXPOHQJWK\RXFDQGHVLJQDWHIRUDODEHOGHSHQGVRQ
\RXUV\VWHPPHPRU\DQGWKHW\SHRIULEERQ\RXKDYHLQVWDOOHG
6\VWHPPHPRU\<RXUV\VWHPPXVWEHXSGDWHGZLWKDGGLWLRQDOPHPRU\WRVXSSRUW
WKHORQJHUPXOWLFRORUOHQJWKVKRZQLQWKHWDEOHLQ´0D[LPXPODEHOOHQJWKDQG
V\VWHPPHPRU\µRQSDJH<RXFDQILQGRXWZKHWKHU\RXUV\VWHPKDVDGGLWLRQDO
PHPRU\E\FKHFNLQJWKH6WDWXV6HH´&KHFNLQJV\VWHPVWDWXVµRQSDJHIRU
LQVWUXFWLRQV
5LEERQW\SH:KHQ\RXKDYHDFRQWLQXRXVFRORUPRQRFKURPHULEERQLQVWDOOHG
FHUWDLQUHVWULFWLRQVDSSO\IRUWKHODEHOOHQJWK6HH´0D[LPXPODEHOOHQJWKDQG
3-12
Label Design
FRQWLQXRXVFRORUPRQRFKURPHULEERQVµRQSDJHIRUDOLVWRIWKRVHUHVWULFWLRQV
)RUPRUHLQIRUPDWLRQDERXWULEERQW\SHVVHH´6HOHFWLQJULEERQW\SHµRQSDJH
$OVRQRWHWKHIROORZLQJLPSRUWDQWSRLQWVDERXWODEHOOHQJWK
•
7KHXQLWRIPHDVXUHLVGHWHUPLQHGE\WKH/HQJWKXQLWVYDOXHGHVFULEHGLQ
´6HWWLQJV\VWHPGHIDXOWVµRQSDJH
•
$YDOXHRI]HURPHDQVWKDWQROHQJWKLVVHOHFWHGDQGWKHOHQJWKRIWKHODEHOZLOO
EHGHWHUPLQHGE\KRZPXFKFRQWHQWWKHUHLVRQWKHODEHOXSWRWKHPD[LPXP
RILQFKHVRUPP
•
,IWKHUHLVDOUHDG\WH[WLQWKHWH[WEXIIHUDQGWKHOHQJWK\RXHQWHUZRQ·WDOORZ
DOOWKHWH[WWRILWRQWKHODEHOWKH´7H[WWRRORQJµPHVVDJHGLVSOD\V
6HH´&RUUHFWLQJPXOWLSOHOLQHSUREOHPVµRQSDJHIRUPRUHLQIRUPDWLRQ
•
,I\RXVHWDODEHOOHQJWKLQDVWDQGDUGOD\RXWDOOKRUL]RQWDODUHDVZLOOEHGLYLGHG
LQWRHTXDOSDUWVDORQJWKDWOHQJWK5HIHUWR´8VLQJVWDQGDUGOD\RXWVµRQSDJH
Note: ,I\RXFKDQJHULEERQVRUWDSHGXULQJODEHOFRPSRVLWLRQWKH
V\VWHPNHHSVWKHOHQJWKUHVWULFWLRQVLQSODFHIURPWKHRULJLQDOULEERQ
DQGWDSHLQVWDOOHG)RULQVWDQFHLI\RXVWDUWZLWKDµSDQHOHGULEERQ
DQGGHFLGHWRLQVWDOODFRQWLQXRXVFRORUPRQRFKURPHULEERQWKHRULJLQDO
µOLPLWDWLRQVWLOOH[LVWVDQGZLOOFRQWLQXHIRUWKDWODEHODQGDOORWKHU
ODEHOVLQWKDWILOH6HH´&KDQJLQJVXSSOLHVµRQSDJHIRULQIRUPDWLRQ
DERXWFKDQJLQJULEERQVRUWDSH&RORUOLVWLQJVKRZHYHUDUHXSGDWHGWR
VKRZWKHFXUUHQWO\LQVWDOOHGULEERQFRORUV
Maximum label length and system memory
7KHIROORZLQJWDEOHSURYLGHVDTXLFNUHIHUHQFHIRUPD[LPXPODEHOOHQJWKVDYDLODEOH
ZLWKDQGZLWKRXWDGGLWLRQDOPHPRU\LQVWDOOHG
Maximum Label Length
PowerMark without
additional memory
PowerMark with
additional memory
Single color printing, monochrome ribbons
200 inches or 5080 mm.
Unchanged
Multi-color printing by
switching monochrome ribbons
14 inches or 350 mm
60 cm or approximately
23.6 inches
Multi-color printing with
paneled ribbons
Panel length, either 8 inches
or 14 inches, depending on
panel configuration
Unchanged
Output type
Changing the look of the label
3-13
Note: 7KHODEHOSUHYLHZIXQFWLRQVKRZVDPD[LPXPRILQFKHVHYHQ
ZKHQ\RXKDYHDGGLWLRQDOPHPRU\LQVWDOOHG,QWKDWFDVH\RX·OOVHHWKH
ILUVWLQFKHVRIWKHODEHO
Maximum label length and continuous color monochrome ribbons
7KHIROORZLQJODEHOOHQJWKUHVWULFWLRQVDSSO\ZKHQ\RXKDYHDFRQWLQXRXVFRORU
PRQRFKURPHULEERQLQVWDOOHG
3-14
•
<RXPD\QRWDGGDVHFRQGFRORUIRUWH[WWH[WEDFNJURXQGJUDSKLFVODEHO
IUDPHRUDUHDIUDPHWRWKHODEHOLI\RXUH[LVWLQJWH[WLVDOUHDG\ORQJHUWKDQWKH
VXSSRUWHGPD[LPXPODEHOOHQJWKIRUPXOWLFRORUSULQWHU
•
<RXPD\QRWDGGDVHFRQGFRORUWRWKHODEHOZKHQDODEHOOHQJWKORQJHUWKDQ
WKHVXSSRUWHGPD[LPXPOHQJWKIRUPXOWLFRORUSULQWHGLVDOUHDG\DVVLJQHG
•
<RXPD\QRWVHWDODEHOOHQJWKORQJHUWKDQWKHVXSSRUWHGPD[LPXPOHQJWKIRU
PXOWLFRORUSULQWLQJZKHQPXOWLSOHFRORUVDUHDOUHDG\LQFOXGHGLQWKHODEHO
•
<RXPD\QRWVHWDODEHOOHQJWKORQJHUWKDQWKHVXSSRUWHGPD[LPXPOHQJWKIRU
PXOWLFRORUSULQWLQJZKHQHLWKHUWKH5HYHUVHRU%DFNJURXQGFRORURSWLRQLV
DOUHDG\WXUQHG2Q
•
<RXPD\QRWW\SHWH[WORQJHUWKDQWKHVXSSRUWHGPD[LPXPOHQJWKIRUPXOWL
FRORUSULQWLQJZKHQPXOWLSOHFRORUVDUHDOUHDG\LQFOXGHGLQWKHODEHORUHLWKHU
WKH5HYHUVHRU%DFNJURXQGFRORURSWLRQLVDOUHDG\WXUQHG2Q
•
<RXPD\QRWDGGEDUFRGHVRUJUDSKLFVWKDWPDNHWKHODEHOORQJHUWKDQWKH
VXSSRUWHGPD[LPXPOHQJWKIRUPXOWLFRORUSULQWLQJZKHQPXOWLSOHFRORUVDUH
DOUHDG\LQFOXGHGLQWKHODEHORUHLWKHUWKH5HYHUVHRU%DFNJURXQGFRORURSWLRQ
LVDOUHDG\WXUQHG2Q
•
<RXPD\QRWFKDQJHWH[WVL]HRUIRUPDWWLQJWRH[WHQGWKHODEHOEH\RQGWKH
VXSSRUWHGPD[LPXPOHQJWKIRUPXOWLFRORUSULQWLQJKHQPXOWLSOHFRORUVDUH
DOUHDG\LQFOXGHGLQWKHODEHORUHLWKHUWKH5HYHUVHRU%DFNJURXQGFRORURSWLRQ
LVDOUHDG\WXUQHG2Q
Label Design
To change the Length or the Condense to fit option:
1) Press the Label Length key.
7KH/DEHO/HQJWKZLQGRZGLVSOD\V
Label Length
Length (inches):
Condense to fit:
00.00.00
Off
Type values, press ↑↓, ENTER or ESC
2) To change the length, type a number within the valid range (as shown in the table
above).
3) To change the Condense to fit option, press the ↓ key to move the cursor to that
option. Then press the ← or → key to change the setting to On or Off.
1RWHWKHIROORZLQJSRLQWVDERXWWKH&RQGHQVHWRILWRSWLRQ
•
,I\RXWU\WRFKDQJHWKLVVHWWLQJZKHQWKHUHLVDOUHDG\WH[WLQWKHWH[WEXIIHUDQ
HUURUPHVVDJHGLVSOD\VLQVWUXFWLQJ\RXWRFOHDUWKHWH[W
•
$OOOLQHVRQDODEHODUHFRQGHQVHGE\WKHVDPHDPRXQW
•
7KLVVHWWLQJLVLJQRUHGLI\RXDUHZRUNLQJLQDVWDQGDUGOD\RXW
4) Press Enter when the settings you want to use are displayed.
7KHIROORZLQJPHVVDJHGLVSOD\V
This change affects all labels in the
file. Continue?
Yes
5) To apply the change, choose Yes. If you don’t want to make the change, choose
No.
,I\RXDSSOLHGWKHFKDQJHDFKDQJHPDUNHUUHSUHVHQWLQJWKHRSWLRQFKDQJHDSSHDUV
LQWKHWH[WHQWU\DUHD Note: 7KHVHWWLQJ\RXFKRVHVWD\VLQHIIHFWIRUDOOODEHOVXQWLO\RX
HLWKHUFKDQJHWKHVHWWLQJRUWXUQWKHV\VWHPRII5HSHDWWKHVWHSV
DERYHZKHQ\RXZDQWWRUHVHWDQRSWLRQ
Selecting label options
<RXUV\VWHPSURYLGHVPDQ\ZD\VRIFKDQJLQJWKHORRNRIDOOODEHOVWKDW\RXW\SH7KLV
PDNHVLWHDV\WRPDNHDOOODEHOVORRNWKHVDPHZLWKRXWKDYLQJWRVHWRSWLRQVIRUHDFK
LQGLYLGXDOODEHO7KHVHRSWLRQVLQFOXGH
Changing the look of the label
3-15
•
-XVWLILFDWLRQ³/HWV\RXSRVLWLRQWKHWH[WRQODEHOVLQRQHRIWKUHHKRUL]RQWDO
SRVLWLRQV
Left
Justification
•
Center
Justification
Right
Justification
7H[WSRVLWLRQ³'HWHUPLQHVZKHWKHUODEHOWH[WSULQWVDWWKHWRSPLGGOHRUERWWRP
RIWKHWDSH7KLVRSWLRQGHWHUPLQHVZKHWKHUDQ\XQXVHGVSDFHRQWKHWDSHDSSHDUV
DERYHWKHWH[WRUEHORZWKHWH[WRULVGLYLGHGHYHQO\DERYHDQGEHORZWKHWH[W
Top
Middle
Bottom
7H[WGLUHFWLRQ³&RQWUROVWKHGLUHFWLRQLQZKLFKWH[WLVSULQWHGRQWKHODEHO
1RUPDOO\WH[WSULQWVIURPOHIWWRULJKW$ORQJWDSH<RXFDQFKRRVH8SWDSHWR
URWDWHWKHWH[WVRLWSULQWVIURPWKHERWWRPRIWKHODEHOWRWKHWRSRUFKRRVH'RZQ
WDSHWRSULQWLWIURPWKHWRSRIWKHODEHOWRWKHERWWRP
•
Down tape
Along tape
Up tape
•
/LQHVSDFLQJ³6SHFLILHVKRZFORVHWRJHWKHUWKHOLQHVRQDODEHODUHSULQWHG
:KHQSULQWLQJDFFHQWHGFKDUDFWHUV\RXPD\JHWEHWWHUUHVXOWVLI\RXXVHWKH/RRVH
VHWWLQJ
Normal
spacing
Tight
spacing
Loose
spacing
•
0LUURU³3ULQWVDPLUURULPDJHRIDODEHORQZKLFKWKHFKDUDFWHUVDUHLQYHUWHGVR
WKDWWKHODEHOLVUHDGDEOHLQDPLUURU<RXPD\KDYHVHHQPLUURUHGWH[WRQWKHIURQW
RIDQDPEXODQFHRURQDORDGLQJGRFN
•
%DVHOLQH³'HWHUPLQHVKRZWH[WLVDOLJQHGLI\RXXVHGLIIHUHQWW\SHVL]HVZLWKLQ
WKHVDPHOLQH1RUPDOO\WKHEDVHOLQHLVFHQWHUHGVRFKDUDFWHUVLQDOOW\SHVL]HVDOLJQ
LQWKHPLGGOH<RXFDQFKDQJHWKHVHWWLQJWR)L[HGVRWKDWFKDUDFWHUVLQGLIIHUHQW
3-16
Label Design
W\SHVL]HVOLQHXSRQWKHERWWRP
Centered
•
baseline
Fixed
baseline
1RWHWKDWWKHEDVHOLQHGRHVQ·WDIIHFWWKH7H[WSRVLWLRQRSWLRQ,WRQO\DIIHFWVKRZ
GLIIHUHQWVL]HFKDUDFWHUVDOLJQLQUHODWLRQWRRQHDQRWKHU
$OORIWKHVHIHDWXUHVDUHDYDLODEOHWKURXJKWKH/DEHO2SWLRQVNH\:KHQ\RXVHOHFWDQ\
RIWKHVHRSWLRQVWKHRSWLRQDSSOLHVWRDOOODEHOVHQWHUHGLQWKHWH[WEXIIHUXQOHVV\RX
DUHZRUNLQJLQDVWDQGDUGOD\RXW,QWKDWFDVH\RXFDQFKRRVHZKHWKHUWKHRSWLRQ
VKRXOGDSSO\WRDOOWH[WRURQO\WKHFXUUHQWDUHD<RXFDQVHOHFWRQHRIWKHRSWLRQV
RUFRPELQHVHYHUDORIWKHP
To choose Label Options:
1) Press the Label Options key.
7KH/DEHO2SWLRQVZLQGRZGLVSOD\V
Label Options
Justification:
Text position:
Text direction:
Line spacing:
Center
Middle
Along tape
Normal
Press ↑↓←→, ENTER or ESC
2) Press the ↑ or ↓ key to move the cursor to the option you want to change.
3) When the option you want to set is highlighted, press the ← or → key to scroll
through the available option settings.
Label option
What to do
Justification
Choose Left, Center or Right. The default justification value is set
through the Setup options as described in “Setting system defaults”
on page 1-23.
Text position
Choose Top, Middle (default) or Bottom to control whether the text is
vertically centered in the top third, middle third or bottom third of the
label.
Text direction
Choose Along tape (default), Up tape or Down tape.
Line spacing
Choose Normal (default), Tight or Loose. The Loose setting may
provide better results when printing accented characters.
Mirror
Choose On or Off (default).
Baseline
Choose Center (default) or Fixed.
4) Repeat steps 2 and 3 if you want to choose settings for other label options.
Changing the look of the label
3-17
5) Press Enter when all of the settings you want to use are displayed.
2QHRIWKHIROORZLQJDSSHDUV
•
,I\RXDUHZRUNLQJLQWKHQRUPDOWH[WHQWU\DUHDQRWLQDVWDQGDUGOD\RXWWKH
IROORZLQJPHVVDJHDSSHDUV7RDSSO\WKHFKDQJHFKRRVH<HV,I\RXGRQ·WZDQW
WRPDNHWKHFKDQJHFKRRVH1R
This change affects all labels in the
file. Continue?
•
Yes
,I\RXDUHZRUNLQJLQDVWDQGDUGOD\RXWWKH0DNH&KDQJHZLQGRZGLVSOD\V
3UHVVWKH↑RU↓NH\WRKLJKOLJKWWKHRSWLRQ\RXZDQWWRXVHVHHWKHWDEOH
EHORZ7KHQSUHVVWKH(QWHUNH\
Make Change
At beginning of text
At beginning of area
Press ↑↓, ENTER or ESC
Make Change option
What it does
At beginning of text
Changes the option for all text in the text buffer.
At beginning of area
Changes the option for all text starting with the current
area.
$IWHUPDNLQJDVHOHFWLRQLQRQHRIWKHZLQGRZV\RXDUHUHWXUQHGWRWKHWH[WHQWU\
DUHD,I\RXDSSOLHGWKHRSWLRQDFKDQJHPDUNHUUHSUHVHQWLQJWKHRSWLRQFKDQJH
DSSHDUVLQWKHWH[WHQWU\DUHD Note: 7KHVHWWLQJ\RXFKRVHVWD\VLQHIIHFWIRUDOOODEHOVXQWLO\RX
HLWKHUFKDQJHWKHVHWWLQJRUWXUQWKHV\VWHPRII5HSHDWWKHVHVWHSV
ZKHQ\RXZDQWWRUHVHWDQRSWLRQ
3-18
Label Design
Adding frames
8VHWKH)UDPHIXQFWLRQWRSULQWERUGHUVDURXQGDQHQWLUHODEHORULQGLYLGXDODUHDRQD
ODEHO<RXFDQFKRRVHGLIIHUHQWIUDPLQJRSWLRQVIRUHDFKODEHOLQWKHWH[WEXIIHUDQG
\RXFDQFKRRVHVHSDUDWHRSWLRQVIRUODEHOIUDPHVDQGDUHDIUDPHV
•
7KHODEHOIUDPHRSWLRQVOHW\RXSULQWDERUGHUDURXQGWKHZKROHODEHO<RXFDQ
VHOHFWWKHWKLFNQHVVDQGFRORURIWKHERUGHUOLQHVDVZHOODVWKHVKDSHRIWKHERUGHU
•
7KHDUHDIUDPHRSWLRQVOHW\RXSULQWDUHFWDQJXODUERUGHUDURXQGLQGLYLGXDODUHDV
RQDODEHO<RXFDQVHOHFWWKHWKLFNQHVVDQGFRORURIWKHERUGHUOLQHVEXW\RX
FDQQRWFKRRVHWKHERUGHU·VVKDSH
Note: ,I\RXIUDPHDUHDVIRUDODEHOLQZKLFKDQRQUHFWDQJXODU
IUDPHLVXVHGWKHODEHO·VIUDPHVHWWLQJLVLJQRUHG$URXQGHG
UHFWDQJOHHOOLSVHRUDUURZODEHOIUDPHZRQ·WSULQWLILQGLYLGXDODUHDV
RQWKHODEHODUHDOVRIUDPHG
7KHVL]HRIDODEHO·VIUDPHGHSHQGVRQDYDULHW\RIIDFWRUV
•
)UDPHVDGMXVWKRUL]RQWDOO\WRHQFRPSDVVWKHORQJHVWOLQHRIWH[W+RZHYHULID
ODEHOOHQJWKLVVSHFLILHGWKHHQWLUHOHQJWKRIWKHODEHOLVIUDPHG
•
,IWKHODEHOGRHVQ·WFRQWDLQDUHDVWKHIUDPHDGMXVWVYHUWLFDOO\EDVHGRQWKHDPRXQW
DQGVL]HRIWKHWH[WRQWKHODEHO7KHIUDPHLVQRWEDVHGRQWKHZLGWKRIWKH
LQVWDOOHGVXSSO\
•
,IWKHODEHOXVHVDVWDQGDUGOD\RXWWKHIUDPH·VKHLJKWLVEDVHGRQWKHZLGWKRIWKH
LQVWDOOHGVXSSO\UHJDUGOHVVRIWKHKHLJKWRIWKHWH[W
•
,IWKHODEHOFRQWDLQVDUHDVEXWGRHVQRWXVHDVWDQGDUGOD\RXWWKHIUDPH·VKHLJKWLV
EDVHGRQWKHPD[LPXPWH[WKHLJKWLQWKHDUHDZLWKWKHPRVWWH[W+RZHYHULIWKH
DUHDVDUHDOVRIUDPHGWKHKHLJKWRIWKHODEHOIUDPHLVEDVHGRQWKHZLGWKRIWKH
LQVWDOOHGVXSSO\UHJDUGOHVVRIWKHKHLJKWRIWKHWH[W
Changing the look of the label
3-19
)ROORZWKHVHVWHSVWRIUDPHDODEHORUDQDUHDRQDODEHO
1) Display the label or area you want to frame and press the Frame key.
7KH)UDPH2SWLRQVZLQGRZGLVSOD\V
Frame Options
Label:
Label line width:
Label frame color:
Label frame shape:
Off
Thin
Black
Rectangle
Press ↑↓←→, ENTER or ESC
2) Press the ↑ or ↓ key to move the cursor to an option you want to set. Then press
the ← or → key to select a value as shown in the following table.
Frame option
What it does
Label
Controls whether a frame prints for the current label and whether
the frame from the previous label will be used for the current
label. Choose Off (default), On or Use previous.
Label line width
Sets the line width for the label frame. Choose Thin (default),
Medium or Wide.
Label frame color
Sets the color for the label frame. The default is the first color
value stored in the memory cell of the installed ribbon, or black if
no ribbon is installed.
•
If either a paneled ribbon or continuous color monochrome
ribbon is installed, you can choose from the entire color
palette. The colors available on that ribbon are listed first, and
are identified by asterisks around the color name, as shown on
the Frame Options window example above. When you print,
you will be prompted when you need to install a different color
ribbon. You can cycle through the color list.
•
If a monochrome ribbon is installed, the color of the installed
ribbon is displayed, but you cannot change the color setting.
•
If no ribbon is installed, when you turned on the system you
were asked to choose whether you wanted to create labels
based on a paneled or monochrome ribbon type. If you chose
Paneled, you are prompted to also choose the paneled ribbon
colors you wanted to use; those colors are available for
selection. If you chose monochrome, see the information in the
previous paragraph.
For more information, see “How installed ribbons affect label
composition” on page 2-6.
3-20
Label Design
Label frame shape
Determines the shape of the label frame. Choose Rectangle
(default), Rounded Rectangle, Ellipse, Left Arrow or Right Arrow.
Area
Controls whether a rectangular border prints around each
individual area on the label and whether the frame from the
previous area will be used for the current area. Choose Off
(default), On or Use previous.
Area line width
Sets the line width for the area frame. Choose Thin (default),
Medium or Wide.
Area frame color
Sets the color for the area frame and works the same as the
Label frame color option. If both area frames and label frames
are turned on, the label frame color overrides the area frame
color. This applies even for internal area frame lines.
3) Press Enter to close the Frame Options window.
$FKDQJHPDUNHUDSSHDUVLQWKHWH[WEXIIHUWRLQGLFDWHZKHUHIUDPHRSWLRQVZHUH
FKDQJHG Changing the look of the label
3-21
Using the date and time option
8VHWKH'DWH7LPHNH\WRTXLFNO\DGGWKHFXUUHQWGDWHDQGRUWLPHWR\RXUODEHOV
:KHQ\RXXVHWKLVIXQFWLRQDPDUNHULVSODFHGRQWKHODEHOZKHQHYHU\RXSULQWWKH
ODEHOWKHFXUUHQWGDWHDQGRUWLPHZLOOEHSULQWHGLQSODFHRIWKHPDUNHU
7KHILUVWVXEVHFWLRQLQWKLVVHFWLRQGHVFULEHVKRZWRDGGWKHGDWHRUWLPHWRDODEHO
7KHUHPDLQLQJVXEVHFWLRQVH[SODLQKRZWRVHWWKHGDWHDQGWLPHDQGKRZWRVHWXSWKH
IRUPDWLQZKLFKWKH\DUHGLVSOD\HG
Entering the date and time on a label
)ROORZWKHVHVWHSVWRHQWHUWKHGDWHDQGWLPHRQDODEHO
1) Move the cursor to where you want the date and/or time to appear on the label.
2) Press the Date/Time key.
7KHGDWHWLPHPDUNHUVKRZQEHORZGLVSOD\VLQWKHWH[WHQWU\DUHD:KHQ\RXSULQW
WKHODEHOWKHFXUUHQWGDWHDQGRUWLPHSULQWVLQSODFHRIWKHPDUNHU+RZWKH
LQIRUPDWLRQLVSULQWHGGHSHQGVRQWKHRSWLRQV\RX·YHVHOHFWHGIRUWKHGDWHWLPH
IRUPDW5HIHUWR´6HWWLQJWKHGDWHWLPHIRUPDWµRQSDJH7KHGDWHDQGWLPH
ZLOOEHSULQWHGXVLQJWKHIRQWW\SHVL]HDQGRWKHURSWLRQVWKDWDUHLQHIIHFWZKHQ
\RXSUHVVWKH'DWH7LPHNH\
3-22
Label Design
Setting the time
)ROORZWKHVHVWHSVWRFKDQJHWKHWLPHRQ\RXUV\VWHP
1) Hold down the Shift key and press the Date/Time key.
7KH'DWHDQG7LPHZLQGRZGLVSOD\V
Date and Time
Format setup . . .
Set time . . .
Set date . . .
Done
Press ↑↓, ENTER or ESC
2) Press the ↑ or ↓ key to move the cursor to the Set time option. Press Enter.
7KH6HW7LPHZLQGRZDSSHDUVDQGGLVSOD\VWKHFXUUHQWV\VWHPWLPH
Set Time
Hours (1-12):
Minutes (0-59):
Seconds:
AM/PM:
10
45
39
AM
Type values, press ↑↓, ENTER or ESC
3) Press the ↑ or ↓ key to move the cursor to an option you want to set. Then type
a value as shown in the following table.
Date option
What it does
Hours
Sets the hour value. If the Time format option in the Format Setup
window is 12 hours, enter a value between 1 and 12; if that option is 24
hours, enter a value between 0 and 23.
Minutes
Sets the minute value. Enter a value between 0 and 59.
Seconds
Sets the seconds value. Enter a value between 0 and 59.
AM/PM
Sets the current time to AM or PM. This option does not appear if the
Time format option in the Format Setup window is 24 hours.
4) Press Enter to close the Set Time window.
Using the date and time option
3-23
Setting the date
)ROORZWKHVHVWHSVWRFKDQJHWKHGDWHRQ\RXUV\VWHP
1) Hold down the Shift key and press the Date/Time key.
7KH'DWHDQG7LPHZLQGRZGLVSOD\V
Date and Time
Format setup . . .
Set time . . .
Set date . . .
Done
Press ↑↓, ENTER or ESC
2) Press the ↑ or ↓ key to move the cursor to the Set date option. Press Enter.
7KH6HW'DWHZLQGRZDSSHDUVDQGGLVSOD\VWKHFXUUHQWV\VWHPGDWH
Set Date
Year (0000-9999):
Month (1-12):
Day (1-31):
1999
8
10
Type values, press ↑↓, ENTER or ESC
3) Press the ↑ or ↓ key to move the cursor to an option you want to set. Then type
a value as shown in the following table.
Date option
What it does
Year
Sets the year value. Enter a value between 0000 and 9999.
Month
Sets the month value. Enter a value between 1 and 12.
Day
Sets the day value. Enter a value between 1 and 31.
4) Press Enter to close the Set Date window.
3-24
Label Design
Setting the date/time format
)ROORZWKHVHVWHSVWRFKRRVHWKHIRUPDWLQZKLFKWKHGDWHDQGRUWLPHZLOOEHSULQWHG
ZKHQ\RXLQVHUWLWRQ\RXUODEHOV
1) Hold down the Shift key and press the Date/Time key.
7KH'DWHDQG7LPHZLQGRZGLVSOD\V
Date and Time
Format setup . . .
Set time . . .
Set date . . .
Done
Press ↑↓, ENTER or ESCAPE
2) Press the ↑ or ↓ key to move the cursor to the Format setup option. Press Enter.
7KH)RUPDW6HWXSZLQGRZGLVSOD\V
Format Setup
Print:
Time format:
Date format:
Time and date
12 hours
mm/dd/yy
Press ↑↓←→, ENTER or ESCAPE
3) Press the ↑ or ↓ key to move the cursor to an option you want to set. Then press
the ← or → key to select a value as shown in the following table.
Date/time format option
What it does
Print
Specifies which time and date elements print on the label.
Choose time and date (default), date and time, date, or time.
Time format
Sets whether time is displayed using a 12 (default) or 24
hour clock.
Date format
Sets the format in which the date is printed. Choose from
the following:
mm/dd/yy (default) (08/12/99)
dd/mm/yy (12/08/99)
mm.dd.yy (08.12.99)
dd.mm.yy (12.08.99)
mm-dd-yy (08-12-99)
dd-mm-yy (12-08-99)
dd mmmmmmmm yyyy (12 August 1999)
mmmmmmmm dd, yyyy (August 12, 1999)
4) Press Enter to close the Format Setup window.
Using the date and time option
3-25
Creating sequences
7KH6HTXHQFHIXQFWLRQLVDSRZHUIXOIHDWXUHWKDWPDNHVLWHDV\WRFUHDWHDVHULHVRI
ODEHOV)RULQVWDQFH\RXPD\QHHGWRFUHDWHDVHWRIODEHOVOLNHWKLV
Part W300-96
Part W305-96
Part W310-96
,I\RXRQO\KDGWKLVVHULHVRIWKUHHODEHOVWRSULQWLWZRXOGQRWEHWKDWKDUGWRW\SHWKH
WH[WWKUHHWLPHV%XWLI\RXQHHGHGODEHOVXSWR3DUW:\RXZRXOGVDYHDORWRI
ZRUNE\FUHDWLQJDVHTXHQFH
7KH6HTXHQFHIXQFWLRQDOORZV\RXWRSULQWODEHOVOLNHWKHVHULHVDERYHE\W\SLQJWKH
LQIRUPDWLRQRQO\RQFH$OO\RXQHHGWRGRLVWHOOWKHV\VWHPZKLFKLQIRUPDWLRQVKRXOG
FKDQJHRQHDFKODEHODQGLWDXWRPDWLFDOO\FUHDWHVWKHVHULHVZKHQ\RXSULQW<RXFDQ
KDYHXSWRWKUHHLQGHSHQGHQWVHTXHQFHVLQWKHWH[WEXIIHURUDILOH7KHVHTXHQFH
QXPEHUVFDQEHLQFUHPHQWHGRUGHFUHPHQWHG
%HIRUH\RXFUHDWHVHTXHQFHGODEHOVMXVWGHWHUPLQHZKLFKWH[WUHPDLQVWKHVDPHRQ
HDFKODEHODQGZKLFKWH[WFKDQJHV
To print a sequence:
1) Type the text, if any, that comes before the sequenced text. If you need a space
between this text and the sequenced text, type the space also.
7RFUHDWHWKHH[DPSOHDERYH\RXZRXOGW\SH3DUW:
2) Press the Sequence key.
7KH6HTXHQFHZLQGRZGLVSOD\V
Sequence
Starting point:
Change by:
Ending point:
Number of labels:
Type values, press ↑↓, ENTER or ESCAPE
3) For the Starting point option, type the sequenced number(s) or letter(s) for the
first label you want printed.
<RXFDQHQWHUDQXPEHUEHWZHHQDQGDOHWWHUEHWZHHQDDQG]RUDOHWWHU
EHWZHHQ$DQG=7RSULQWDVHTXHQFHZLWKOHDGLQJ]HURVW\SHDVPDQ\DV\RXZDQW
KHUH7KHV\VWHPEHHSVLI\RXWU\W\SLQJERWKOHWWHUVDQGQXPEHUVVXFKDV%RU
LI\RXOHDYHWKLVRSWLRQEODQN7RFUHDWHRXUH[DPSOH\RXZRXOGW\SH
3-26
Label Design
4) Move the cursor to the Change by option. Enter the increment by which the
sequenced text should increase in each new label.
7\SHDQXPEHUEHWZHHQDQG7RFUHDWHRXUH[DPSOH\RXZRXOGW\SH
VLQFHWKHQXPEHULQFUHDVHVE\ILYHLQHDFKODEHO
5) Move the cursor to the Number of labels option. Type the number of labels you
want printed with this sequence (from 1 to 999).
)RULQVWDQFHWRFUHDWHRXUH[DPSOH\RXZRXOGW\SH7KLVZRXOGFUHDWHODEHOV
ZLWKWKHVHQXPEHUV
,QRXUH[DPSOHWKH(QGLQJSRLQWRSWLRQQRZVKRZVWKHODVWVHTXHQFHGODEHO
QXPEHU7KLVYDOXHLVDXWRPDWLFDOO\ILOOHGLQLI\RXHQWHUD1XPEHURIODEHOV
YDOXH<RXFDQDOVRW\SHWKLVYDOXH\RXUVHOIDVZLWKWKH6WDUWLQJSRLQWYDOXH,I\RX
KDGW\SHGWKLVQXPEHU\RXUVHOIWKH1XPEHURIODEHOVRSWLRQZRXOGDXWRPDWLFDOO\
GLVSOD\WKHQXPEHURIODEHOVWRSULQW
Note: <RXFDQHQWHUD6WDUWLQJSRLQWQXPEHUJUHDWHUWKDQWKH
(QGLQJSRLQWQXPEHUWRGHFUHPHQWDVHTXHQFH)RUH[DPSOHLI\RX
W\SHD6WDUWLQJSRLQWRID&KDQJHE\YDOXHRIDQGDQ(QGLQJ
SRLQWRIWKHV\VWHPZLOOSULQWWKHVHODEHOVDQG7R
GHFUHPHQWDVHTXHQFH\RXPXVWHQWHUDQ(QGLQJSRLQWYDOXH
6) After selecting all options, press Enter.
7KHIROORZLQJPDUNHUDSSHDUVLQWKHWH[WHQWU\DUHD
7RFKHFNRUFKDQJHDQ\RIWKHVHTXHQFHYDOXHVSRVLWLRQWKHFXUVRURQWKH
VHTXHQFHPDUNHUDQGSUHVVWKH6HTXHQFHNH\0DNHDQ\QHFHVVDU\FKDQJHVDQG
SUHVVWKH(QWHUNH\
7) Type the text, if any, that comes after the sequenced text.
7RFUHDWHRXUH[DPSOH\RXZRXOGW\SH
Creating sequences
3-27
Working with bar codes
8VHWKH%DU&RGHIXQFWLRQWRLQVHUWDEDUFRGHRQDODEHO$OO\RXQHHGWRGRLVVHOHFW
EDUFRGHRSWLRQVDQGHQWHUWKHW\SHRILQIRUPDWLRQWKHEDUFRGHZLOOFRQWDLQ7KH
V\VWHPFRQYHUWVWKHLQIRUPDWLRQLQWREDUFRGHFKDUDFWHUVDVVKRZQLQWKHIROORZLQJ
H[DPSOH
Part Number:
=
12345
:
1
:
1
:
2
013.75"
,QWKHH[DPSOHDERYHQRWLFHWKHWH[W´µLQWKHWH[WHQWU\DUHD7KLVWH[WLV
VXUURXQGHGE\EDUFRGHPDUNHUV $OOFKDUDFWHUVIROORZLQJDEDUFRGHPDUNHUDUH
WUHDWHGDVEDUFRGHLQIRUPDWLRQDQGSULQWDVDEDUFRGHXQWLODVHFRQGEDUFRGH
PDUNHULVHQFRXQWHUHGDQGEDUFRGLQJLVWXUQHGRII
<RXFDQVHOHFWDYDULHW\RIEDUFRGHRSWLRQVRUDWWULEXWHV7KHVHLQFOXGHWKHEDUFRGH
V\PERORJ\EDUFRGHKHLJKWDQGZKHWKHURUQRWWKHKXPDQUHDGDEOHWH[WSULQWVEHORZ
WKHEDUFRGH Note: 2QO\RQHEDUFRGHV\PERORJ\DQGRQHVHWRIDWWULEXWHVFDQEHLQ
HIIHFWLQWKHWH[WEXIIHUDWRQHWLPH7RFKDQJHWKHV\PERORJ\RURWKHU
DWWULEXWHVVDYHWKHFXUUHQWEDUFRGHODEHOLQDILOHFOHDUWKHWH[WEXIIHU
DQGFUHDWHDQHZODEHO
7KHOLQHVSDFLQJVHWWLQJW\SHVW\OHW\SHVL]HDQGDOOW\SHRSWLRQVDUHLJQRUHGIRUWKH
EDUFRGHLWVHOIEXWDUHDSSOLHGWRWH[WEHIRUHRUDIWHUWKHEDUFRGH,IWKHDUHD
FRQWDLQLQJWKHEDUFRGHXVHVDEDFNJURXQGFRORUWKHFRORULVLJQRUHGIRUWKHEDU
FRGH
3-28
Label Design
Inserting a bar code on a label
1) Select the bar code options you want to use.
5HIHUWR´6HOHFWLQJEDUFRGHRSWLRQVµRQSDJH
2) Press the Bar Code key.
$EDUFRGHPDUNHUDSSHDUVLQWKHWH[WHQWU\DUHD
3) Type the bar code characters.
7KHVXSSRUWHGEDUFRGHV\PERORJLHVFDQHDFKFRQWDLQDPD[LPXPRI
FKDUDFWHUV
4) If you are using a Code 128 symbology, type any necessary special characters.
7KLVIHDWXUHDSSOLHV21/<WR&RGHEDUFRGHV
•
+ROGGRZQWKH$OWNH\DQGSUHVVWKH%DU&RGHNH\
•
,QWKH(QWHU$6&,,6SHFLDO&KDUVZLQGRZW\SHWKHFKDUDFWHUV&KDUDFWHUV
LQFOXGH$6&,,FKDUDFWHUVOHVVWKDQGHFLPDOFRGH$6&,,FKDUDFWHUVWR
DQGIRXUQRQGDWDIXQFWLRQFKDUDFWHUV)))DQG)
•
3UHVV(QWHUWRFORVHWKHZLQGRZ7KHVSHFLDOEDUFRGHFKDUDFWHUPDUNHU
DSSHDUVLQWKHWH[WHQWU\DUHD
5) Press the Bar Code key.
$EDUFRGHPDUNHUDSSHDUVDIWHUWKHEDUFRGHFKDUDFWHUV\RXW\SHG:KHQ\RXSULQW
WKHODEHOWKHFKDUDFWHUVEHWZHHQWKHPDUNHUVDUHXVHGWRFUHDWHDEDUFRGHZLWKWKH
V\PERORJ\\RXVHOHFWHG
Selecting bar code options
)ROORZWKLVSURFHGXUHWRFKRRVHEDUFRGHDWWULEXWHVLQFOXGLQJWKHV\PERORJ\IRUDOO
ODEHOVLQWKHWH[WEXIIHU
1) Hold down the Shift key and press the Bar Code key.
Working with bar codes
3-29
7KH%DU&RGH$WWULEXWHVZLQGRZGLVSOD\V
Bar Code Attributes
Symbology:
Height (1.0 - 8.5 inches):
Density:
Human readable text:
Code 39
3.50
20 mil
Below
Press ↑↓←→, ENTER or ESC
2) Press the ↑ or ↓ key to move the cursor to the option you want to set.
3) When the option you want to set is highlighted, press the ← or → key to scroll
through the available settings. (Refer to the table below.)
4) When the settings you want to use are displayed, press Enter.
Bar code option
What it does
Symbology
Sets the bar code symbology. The available symbologies are Code
39, Code 128A, Code 128B, Code 128C and Interleaved 2 of 5.
Height
Determines the bar code height. Enter values from 0.25 to 8.5
inches (default is 1.0) or from 6 to 215 mm. The unit of measure is
the Length units setting. (Refer to “Setting system defaults” on page
1-23.) This height does not include the human-readable text.
Density
Controls the width of the bar code’s narrow elements. This setting
determines the width of the quiet zone (the clear space that
precedes the bar code’s start character and follows the stop
character). The quiet zone width is ten times the density value you
select. Choose 10, 20, 40, 50, 60, 80 or 100 mils.
Human readable text
Specifies whether or not human-readable text is printed with the bar
code. Choose Below (default) or None.
Start/Stop in HR text
Determines whether or not the start and stop characters are printed
in the human-readable text. Choose Off (default) or On.
Check character
Controls whether or not a check character is printed for the bar
code. Choose Off (default) or On.
Human readable text size
Sets the size of the human-readable text. You can select a type
size from the available settings. You can also select the Auto
setting, which scales the text to 25 percent of the bar code height. If
the Human readable text option is set to None, this setting is
ignored. The unit of measure is the Type size units setting. (See
“Setting system defaults” on page 1-23.)
3-30
Label Design
Chapter 4: Printing
7KLVFKDSWHUSURYLGHVLQIRUPDWLRQRQSULQWLQJODEHOVDQGDERXWWKHV\VWHP·VULEERQ
DQGWDSHVXSSOLHV7RSLFVLQFOXGH
:RUNLQJZLWKVXSSOLHVEHJLQQLQJRQSDJHZLWKVHFWLRQVRQVXSSO\WDSHVXSSO\
ULEERQDQGVHOHFWLQJDULEERQW\SHKRZWRVZDSULEERQVGXULQJSULQWLQJKRZWR
FKDQJHVXSSOLHVDQGPRUH
3ULQWLQJODEHOVEHJLQQLQJRQSDJHZLWKLQIRUPDWLRQRQKRZWRSULQWPXOWLSOH
FRSLHVRIODEHOVDQGKRZWRFKDQJHWKHSULQWGHQVLW\DQGWKHUPDOHQHUJ\IRUDSULQW
MRE
4-1
Working with supplies
7KLVVHFWLRQSURYLGHVLQIRUPDWLRQRQXVLQJ\RXUV\VWHP·VULEERQDQGWDSHVXSSOLHV
5HIHUWR´6HWWLQJXS\RXUV\VWHPµRQSDJHIRULQIRUPDWLRQRQLQVWDOOLQJULEERQ
DQGWDSHLQWKHV\VWHP
Supply tape
3DUWRIFUHDWLQJDODEHOLQYROYHVFKRRVLQJWKHZLGWKRIWKHWDSHRQZKLFK\RX·OOSULQW
WKHODEHO<RXUV\VWHPVXSSRUWVWDSHZLGWKVIURPWRLQFKHVWRPPLQ
DYDULHW\RIFRORUV7KHV\VWHPGRHVQ·WQHHGWRNQRZWKHWDSHFRORUEXWGRHVQHHGWR
NQRZWKHZLGWK7KHZLGWKLQIRUPDWLRQLVVWRUHGLQWKHPHPRU\FHOOIODJORFDWHGRQ
HDFKWDSHFDUWULGJHDQGWKHV\VWHPUHDGVWKDWLQIRUPDWLRQZKHQ\RXWXUQRQWKH
V\VWHPZKHQ\RXUHWULHYHDILOHVWRUHGLQPHPRU\ZKHQ\RXFKDQJHWKHWDSHDQG
ZKHQ\RXSULQW,QIRUPDWLRQDERXWWKHWDSHZLGWKWKDWZDVXVHGLVVWRUHGZLWKDODEHO
ZKHQ\RXVDYHLWZKHQ\RXUHWULHYHWKHILOHDPHVVDJHDSSHDUVLIWKHLQVWDOOHGWDSH
LVQ·WWKHFRUUHFWZLGWK
:KHQ\RXWXUQRQWKHV\VWHPWKHV\VWHPFKHFNVWKHZLGWKRIWKHLQVWDOOHGWDSH,IQR
WDSHLVLQVWDOOHGWKH´8QNQRZQVXSSO\W\SHµPHVVDJHGLVSOD\VDQG\RX·UHSURPSWHG
WRLQVWDOOWKHWDSH,I\RXSUHVVDNH\WRFRQWLQXHZLWKRXWLQVWDOOLQJDWDSHFDUWULGJHWKH
7DSHZLQGRZGLVSOD\VDVVKRZQEHORZ
Tape
Tape width:
10 in
Press ←→, ENTER or ESC
7KLVZLQGRZDOORZV\RXWRFKRRVHWKHWDSHZLGWK\RXZDQWWRXVHZKHQFUHDWLQJ
ODEHOVZLWKRXWLQVWDOOLQJWKHWDSH3UHVVWKH←RU→NH\WRGLVSOD\WKHZLGWK\RXZDQW
WRXVHWKHQSUHVV(QWHU7KHGHIDXOWLVLQPP7KHXQLWRIPHDVXUHLVWKH
/HQJWKXQLWVVHWWLQJVHOHFWHGLQWKH6HWXSZLQGRZ5HIHUWR´6HWWLQJV\VWHPGHIDXOWVµ
RQSDJH
Note: 7KHVHWWLQJV\RXFKRRVHLQWKLVZLQGRZDUHLQHIIHFWXQWLO\RX
SULQWRUWXUQWKHV\VWHPRII
Note: 8VHWKH6WDWXVNH\WRGLVSOD\WDSHVXSSO\LQIRUPDWLRQVXFKDVWKH
DPRXQWRIWDSHUHPDLQLQJLQWKHLQVWDOOHGVXSSO\5HIHUWR´&KHFNLQJ
V\VWHPVWDWXVµRQSDJH
4-2
Printing
Supply ribbon
$V\RXFUHDWH\RXUODEHOV\RX·OOKDYHWKHRSSRUWXQLW\WRGHFLGHZKLFKULEERQFRORUV
WRXVHIRUSULQWLQJWKHODEHOV<RXKDYHJUHDWIOH[LELOLW\LQFKRRVLQJ\RXUFRORUVVLQFH
DOOFRORUVRQWKHSDOHWWHDUHDYDLODEOHWR\RXDWDOOWLPHVUHJDUGOHVVRIZKDWNLQGRI
ULEERQ\RXLQVWDOO,QIDFW\RXFDQHYHQFRPSRVH\RXUODEHOZLWKRXWLQVWDOOLQJD
ULEERQ6HH´2SHUDWLQJWKHV\VWHPZLWKRXWVXSSOLHVLQVWDOOHGµRQSDJHIRUGHWDLOV
DERXWKRZ\RXFDQXVHWKLVIHDWXUH
<RXUV\VWHPVXSSRUWVERWKSDQHOHGULEERQVZKLFKFRQWDLQPXOWLSOHFRORUVLQWKH
VDPHULEERQFDUWULGJHDQGPRQRFKURPHULEERQVZKLFKFRQWDLQRQHFRORU<RXFDQ
SULQW\RXUODEHO
•
%\XVLQJDVLQJOHULEERQRIHLWKHUW\SHXVLQJRQO\WKHFRORUVRQWKHULEERQIRU
\RXUGHVLJQ
•
%\VZDSSLQJYDULRXVPRQRFKURPHULEERQVLQDQGRXWGXULQJDVLQJOHSULQWMRE
ZKLFKPHDQV\RXFDQXVHPXOWLSOHPRQRFKURPHULEERQVWRSULQWDODEHO\RX
GHVLJQHGZKLOHDSDQHOHGULEERQZDVLQVWDOOHG
•
%\VZDSSLQJPRQRFKURPHDQGRUSDQHOHGULEERQVGXULQJDVLQJOHSULQWMRE
Note: ,I\RXFKDQJHULEERQVRUWDSHGXULQJODEHOFRPSRVLWLRQWKH
V\VWHPNHHSVWKHOHQJWKUHVWULFWLRQVLQSODFHIURPWKHRULJLQDOULEERQ
DQGWDSHLQVWDOOHG,I\RXVWDUWZLWKDLQFKSDQHOHGULEERQDQGGHFLGH
WRLQVWDOODFRQWLQXRXVFRORUPRQRFKURPHULEERQWKHRULJLQDOLQFK
OLPLWDWLRQVWLOOH[LVWVDQGZLOOFRQWLQXHIRUWKDWODEHODQGDOORWKHUODEHOVLQ
WKDWILOH
&RORUOLVWLQJVKRZHYHUDUHXSGDWHGWRVKRZWKHFXUUHQWO\LQVWDOOHG
ULEERQFRORUV
+RZHYHUEHFDXVHWKHV\VWHPORRNVDWWKHLQVWDOOHGVXSSOLHVWRGHWHUPLQHWKHUXOHV
\RXPXVWIROORZWKHSURFHGXUH\RXXVHWRFRPSRVHDQGSULQW\RXUODEHOGLIIHUV
DFFRUGLQJWRWKHULEERQ\RXLQVWDOO
7KHLQIRUPDWLRQ\RXUV\VWHPQHHGVLVVWRUHGLQWKHPHPRU\FHOOIODJORFDWHGRQHDFK
ULEERQFDUWULGJH7KHV\VWHPUHDGVWKDWLQIRUPDWLRQHYHU\WLPH\RX
•
7XUQRQWKHV\VWHP
•
5HWULHYHDILOHVWRUHGLQPHPRU\
•
&KDQJHWKHWDSHRUULEERQ
•
3ULQWDQ\ODEHO
Working with supplies
4-3
7KHV\VWHPXVHVWKHULEERQVXSSOLHVLQVWDOOHGLQ\RXUV\VWHPGXULQJODEHOFRPSRVLWLRQ
WRGHWHUPLQHWKHUXOHV\RXPXVWIROORZIRUVHOHFWLQJFRORUVDQGWRGHWHUPLQHWKH
PD[LPXPODEHOOHQJWKVXSSRUWHG6HH´6HWWLQJODEHOOHQJWKµRQSDJHIRUDWDEOH
RILQIRUPDWLRQDERXWPD[LPXPVXSSRUWHGOHQJWKV
)RUH[DPSOHZKHQ\RXKDYHLQVWDOOHGDSDQHOHGULEERQWKHOHQJWKRIWKHSDQHOV
RQWKHULEERQGHWHUPLQHWKHPD[LPXPOHQJWKRIWKHODEHO\RXDUHFUHDWLQJ,I\RX
FRPSRVHWKHODEHOZLWKWRRPDQ\OLQHVWKHV\VWHPZLOOGLVSOD\DPHVVDJHZDUQLQJ
\RXWKDWWKHODEHOLVWRRORQJ7KLVGRHVQ·WPHDQWKDW\RXFDQQRWSULQWWKDWODEHO
<RXFDQZRUNDURXQGWKHPD[LPXPOHQJWKE\XVLQJDFRPELQDWLRQRIFRQWLQXRXV
FRORUPRQRFKURPHULEERQVZKHQ\RXSULQW,WGRHVPHDQWKDWKRZHYHUWKDWZKLOH
\RXDUHFRPSRVLQJWKHODEHO\RXZRQ·WEHDEOHWRVHHPRUHRIWKHODEHOWKDQWKH
PD[LPXPSDQHOOHQJWKVHWE\WKHLQVWDOOHGULEERQ
%XWZKHQ\RXKDYHLQVWDOOHGDFRQWLQXRXVFRORUPRQRFKURPHULEERQWKH
V\VWHPFDQ·WWHOOZKHWKHU\RXDUHSODQQLQJWRFUHDWHDVLQJOHFRORUMRERUZKHWKHU
\RXDUHSODQQLQJWRVZDSLQYDULRXVULEERQVWRFUHDWHDPXOWLFRORUMRE:KHQWKH
V\VWHPGHWHFWVDFRQWLQXRXVFRORUPRQRFKURPHULEERQLQVWDOOHGLWDVVXPHV\RX
DUHFUHDWLQJDVLQJOHFRORUODEHOXQWLO\RXVHOHFWDVHFRQGFRORUZLWKLQWKHVDPHODEHO
$WWKDWSRLQWWKHV\VWHPFKHFNVWKHODEHOOHQJWKWRVHHLI\RXUODEHOWH[WDOUHDG\
H[FHHGVWKHVXSSRUWHGOHQJWK
‡
,IWKHODEHOOHQJWKLVWRRORQJLWGLVSOD\VDPHVVDJHDQG\RXQHHGWRFRUUHFW
LW6HH´&RUUHFWLQJPXOWLSOHOLQHSUREOHPVµRQSDJHIRULQVWUXFWLRQV
‡
,IWKHODEHOOHQJWKLVZLWKLQWKHVXSSRUWHGOHQJWKZKHQ\RXVHOHFWWKH
VHFRQGFRORUQRPHVVDJHLVGLVSOD\HGDQG\RXFDQFRQWLQXH
<RXVKRXOGNHHSLQPLQGWKDWRWKHUFKDQJHVEHVLGHVFRORUFDQDIIHFWWKHOHQJWKRI
WKHODEHODVZHOO)RUH[DPSOHFKDQJLQJWKHIRQWVL]HRUDGGLQJDQDUHDFRXOG
LQFUHDVHWKHOHQJWKRIWKHWH[W,QWKRVHFDVHVWKHV\VWHPGLVSOD\VDPHVVDJH
LQIRUPLQJ\RXDQG\RXPXVWFRUUHFWWKHODEHOLQRUGHUWRSULQWLW6HH´$GGLQJ
OLQHVODEHOVDQGDUHDVWRIUHHIRUPODEHOVµRQSDJHIRUGHWDLOV
Note: 8VHWKH6WDWXVNH\WRGLVSOD\ULEERQVXSSO\LQIRUPDWLRQVXFKDV
WKHZLGWKRIWKHLQVWDOOHGVXSSO\5HIHUWR´&KHFNLQJV\VWHPVWDWXVµRQ
SDJH
Selecting ribbon type
:KHQ\RXFUHDWHDODEHOWKHV\VWHPXVHVFRORULQIRUPDWLRQIURPWKHLQVWDOOHGULEERQ
$VQRWHGLQWKHSUHYLRXVVHFWLRQZKHQ\RXWXUQRQWKHV\VWHPWKHV\VWHPFKHFNV
ZKLFKW\SHRIULEERQLVLQVWDOOHG,IQRULEERQLVLQVWDOOHGWKH´8QNQRZQVXSSO\W\SHµ
PHVVDJHGLVSOD\VDQG\RX·UHSURPSWHGWRLQVWDOOWKHULEERQ,I\RXSUHVVDNH\WR
FRQWLQXHZLWKRXWLQVWDOOLQJDULEERQFDUWULGJHWKH5LEERQZLQGRZGLVSOD\VDVVKRZQ
4-4
Printing
EHORZVHH´2SHUDWLQJWKHV\VWHPZLWKRXWVXSSOLHVLQVWDOOHGµRQSDJHIRUGHWDLOV
7KLVZLQGRZDOORZV\RXWRFKRRVHWKHW\SHRIULEERQ\RXZDQWWRXVHIRUWKHODEHO
ZLWKRXWLQVWDOOLQJWKHULEERQ
Ribbon
Ribbon type:
Paneled
Press ←→, ENTER or ESC
3UHVVWKH←RU→NH\WRGLVSOD\HLWKHU3DQHOHGRU0RQRFKURPHWKHQSUHVV(QWHU
•
3DQHOHG³,I\RXFKRRVH3DQHOHGWKH3DQHOHG5LEERQZLQGRZGLVSOD\V<RXFDQ
VHOHFWULEERQFRORUVDQGSDQHOOHQJWK:KHQ\RXFUHDWHODEHOV\RXFDQFKRRVHIURP
WKHVHFRORUV<RXFDQDOVRSULQWPRUHFRORUVE\VZDSSLQJULEERQV6HH´6XSSO\
ULEERQµRQSDJHIRUGHWDLOV:KHQ\RXSULQWWKHODEHOV\RXQHHGWRLQVWDOOWKH
SDQHOHGULEERQ\RXVHOHFWHGKHUH
3UHVVWKH↑RU↓NH\WRKLJKOLJKWWKHRSWLRQ\RXZDQWWRVHWWKHQSUHVVWKH←RU
→NH\WRGLVSOD\WKHVHWWLQJ\RXZDQWWRXVH:KHQ\RX·UHGRQHSUHVV(QWHU
Paneled Ribbon
Colors:
Panel length:
00.Black/Red
8"
Press ↑↓←→, ENTER or ESC
Note: 7KHVHWWLQJV\RXFKRRVHLQWKLVZLQGRZDUHLQHIIHFWXQWLO\RX
SULQWRUWXUQWKHV\VWHPRII
•
0RQRFKURPH³,I\RXFKRRVH0RQRFKURPHQRIXUWKHUVHWWLQJVDUHUHTXLUHG
Swapping ribbons during printing
:KHQ\RXFRPSRVH\RXUODEHODQGFKRRVHSULQWWKHV\VWHPDQDO\]HVWKHMREDQG
GHWHUPLQHVZKDWULEERQVDUHQHHGHGWRSULQWWKHODEHO7KLVSURFHVVDSSOLHVWRERWK
SDQHOHGULEERQVDQGFRQWLQXRXVFRORUPRQRFKURPHULEERQV
'XULQJWKHSULQWSURFHVVLIVXEVWLWXWLRQLVQHFHVVDU\WKHV\VWHPSURPSWV\RXWR
LQVWDOOVSHFLILFULEERQFRORUV)RUH[DPSOH
Install ribbon color:
Blue
Then press Enter to continue or to use a
different color, or Escape to quit.
Working with supplies
4-5
<RXFKDQJHWKHULEERQDVVSHFLILHGWKHQSUHVV(QWHUWRFRQWLQXH\RXUSULQWMRE
7KHV\VWHPFKHFNVWRVHHLIWKHQHZULEERQLVLQVWDOOHGDQGWKHQFKHFNVWRPDNH
VXUHWKHQHZULEERQLVDSSURSULDWHIRUWKHSULQWMRE,IWKHUHDUHDQ\SUREOHPV
ZLWKWKHLQVWDOOHGULEERQWKHV\VWHPSURPSWV\RXIRUFRUUHFWLRQVRUIRU
VXEVWLWXWLRQVZKHUHDSSURSULDWH
)RUH[DPSOHLI\RXUFXUUHQWO\LQVWDOOHGULEERQLVDFRQWLQXRXVFRORU
PRQRFKURPHEODFNULEERQDQG\RXDUHVWDUWLQJDPXOWLFRORUSULQWMRE\RX·OO
VHHWKLVPHVVDJH
Current ribbon color:
Black
For this multi-color job, load this
ribbon last. To continue, load another
required ribbon, then press any key.
7KLVLVEHFDXVHWKHV\VWHPNQRZVWKDWIRUEHVWSULQWTXDOLW\EODFNVKRXOGEH
WKHILQDOFRORUSULQWHG
<RXFDQRYHUULGHWKHVHV\VWHPPHVVDJHVVLPSO\E\QRWFKDQJLQJWKHULEERQWKHQ
FRQWLQXLQJWKHSULQWMRE
Operating the system without supplies installed
7KHVXSSOLHV\RXLQVWDOOLQWKHV\VWHPGHWHUPLQHWKHSK\VLFDOFKDUDFWHULVWLFVRI
WKHODEHOV\RXFUHDWHDQGHGLW%XWXQGHUFHUWDLQFLUFXPVWDQFHV\RXPD\ZDQWWR
SRZHURQWKHV\VWHPZLWKRXWLQVWDOOLQJVXSSOLHVILUVW7KHV\VWHPWKHQSURPSWV
\RXIRUWKHVXSSO\DWWULEXWHV\RXZLOOHYHQWXDOO\XVHWRSULQWWKHODEHO\RXFUHDWH
,WILUVWDVNV\RXWRORDGWKHWDSHRUULEERQDVVKRZQLQWKLVH[DPSOH
Unknown supply type. Reload tape.
Press any key to continue.
7KHPHVVDJHGLVSOD\VXQWLO\RXSUHVVDNH\WRFRQWLQXH,I\RXGRQRWLQVWDOOD
WDSHWKHV\VWHPVWDUWVSURPSWLQJ\RXWRSURYLGHWKHVXSSO\DWWULEXWHV³WKDWLV
IRUDWDSHWKHZLGWKIRUDULEERQWKHW\SHDQGFRORUVLIWKHW\SHLVSDQHOHG³IRU
WKHQHZODEHO)RUH[DPSOH
Tape
Tape width:
10 in
Press ←→, ENTER or ESCAPE
7KHFKRLFHV\RXPDNHDUHNHSWZLWKWKHODEHO\RXFUHDWHDQGDUHDFWLYHIRU\RXU
FXUUHQWZRUNVHVVLRQ
4-6
Printing
Changing supplies
:KHQHYHU\RXLQVWDOOQHZWDSHRUULEERQVXSSOLHVWKHV\VWHPFKHFNVWKHVXSSO\·V
ZLGWKW\SHDQGFRORU7KHIROORZLQJPHVVDJHVPD\GLVSOD\
•
8QNQRZQVXSSO\W\SH³'LVSOD\VLI\RXWXUQWKHV\VWHPRQZLWKRXWLQVWDOOLQJ
ULEERQRUWDSH6HH´6HOHFWLQJULEERQW\SHµRQSDJHIRULQIRUPDWLRQRQ
UHVSRQGLQJWRWKHPHVVDJH7KLVPHVVDJHDOVRGLVSOD\VLIDQHUURURFFXUUHGLQ
UHDGLQJWKHVXSSO\PHPRU\FHOO
•
;;;LQFKULEERQQHHGHG³'LVSOD\VLIWKHZLGWKVRIWKHLQVWDOOHGULEERQDQGWDSH
DUHLQFRPSDWLEOHIRUH[DPSOHDULEERQLVLQVWDOOHGZLWKDWDSH$VLPLODU
PHVVDJHDSSHDUVGXULQJSULQWLQJLI\RXLQVWDOOWKHLQFRUUHFWULEERQZLGWK
•
8QNQRZQ5LEERQ7DSH&RORUV³'LVSOD\VLIWKHULEERQRUWDSHFRORUGRHVQRW
PDWFKDQ\RIWKHVWDQGDUGV\VWHPFRORUV7KLVPD\RFFXULIQHZVXSSO\FRORUVDUH
LQWURGXFHGDIWHUWKHV\VWHPLVPDQXIDFWXUHG
,QWKHZLQGRZWKDWGLVSOD\V\RXFDQW\SH\RXURZQFXVWRPWDSHRUFXVWRPULEERQ
FRORUQDPH7KLVFRORUQDPHZLOOWKHQDXWRPDWLFDOO\EHXVHGHDFKWLPH\RXLQVWDOOWKLV
WDSHRUULEERQFRORU<RXFDQODWHUXVHWKH6HWXSNH\WRFKDQJHWKHWDSHDQGULEERQ
FRORUV\RXHQWHUHGDVGHVFULEHGLQ´6HWWLQJV\VWHPGHIDXOWVµRQSDJH
Supply storage and handling
:KHQKDQGOLQJVXSSOLHVDYRLGWRXFKLQJWKHWDSHDQGULEERQDVPXFKDVSRVVLEOH
6WRUHVXSSOLHVLQWKHLURULJLQDOFDUWRQVLQDFRROGU\SODFH,I\RXGRQ·WVWRUHVXSSOLHV
LQWKHFDUWRQVVWDQGWKHPRQHQGZLWKWKHIODJHQGXS)RUIXUWKHULQIRUPDWLRQUHIHU
WR&KDSWHU´&OHDQLQJDQG0DLQWHQDQFHµ
Working with supplies
4-7
Printing labels
3UHVVWKH3ULQWNH\RQWKHODEHOLQJV\VWHPNH\ERDUGWRSULQWDOOWKHODEHOVFXUUHQWO\
HQWHUHGLQWKHWH[WEXIIHU,I\RXKDYHW\SHGPXOWLSOHODEHOVE\XVLQJWKH1HZ/DEHO
NH\DOOODEHOVZLOOSULQWHYHQWKRXJK\RXFDQQRWVHHDOORIWKHPRQWKHVFUHHQ$Q\
ODEHOVWKDWDUHEODQNDUHQRWSULQWHG
$IWHU\RXSUHVV3ULQWWRVWDUWWKHSULQWMRE\RX·OOVHHWKH´&RPSRVLQJµPHVVDJHZLWK
DQDQLPDWHGLFRQFDOOHGD´VSLQQHUµ7KHURWDWLQJVSLQQHUWHOOV\RXWKDWWKHV\VWHPLV
ZRUNLQJRQFRPSRVLQJWKHSULQWMREEHIRUHLWDFWXDOO\VWDUWVSULQWLQJ7KHURWDWLQJ
VSLQQHUDSSHDUVZKHQHYHUWKHV\VWHPGLVSOD\VWKH´3OHDVHZDLWµPHVVDJHDVZHOO7KH
PHVVDJHGLVDSSHDUVZKHQWKHSULQWHULVUHDG\WRVWDUWSULQWLQJ
+HUHDUHVRPHWKLQJVWRQRWHDERXWSULQWLQJ
•
%HIRUHSULQWLQJDODUJHQXPEHURIODEHOVXVHWKH6WDWXVNH\WRFKHFNWKDW\RXKDYH
SOHQW\RIWDSHLQWKHSULQWHU5HIHUWR´&KHFNLQJV\VWHPVWDWXVµRQSDJH
•
%HIRUHSULQWLQJEHJLQVWKHV\VWHPFKHFNVWKDWWKHDSSURSULDWHVXSSOLHVDUH
LQVWDOOHG5HIHUWR´:RUNLQJZLWKVXSSOLHVµRQSDJHIRUIXUWKHULQIRUPDWLRQ
:KHQSULQWLQJVWDUWVWKHIROORZLQJPHVVDJHGLVSOD\V
Printing label xx of xx.
Press Escape to stop printing.
•
7KH1XPEHURIFRSLHVRSWLRQGHWHUPLQHVKRZPDQ\FRSLHVRIHDFKODEHODUH
SULQWHG$OOFRSLHVRIRQHODEHODUHSULQWHGEHIRUHWKHQH[WODEHOSULQWV5HIHUWR
´3ULQWLQJPXOWLSOHFRSLHVµRQSDJH
•
7KH3DXVHEHWZHHQODEHOVRSWLRQGHWHUPLQHVZKHWKHURUQRWWKHV\VWHPSDXVHV
DIWHUSULQWLQJHDFKODEHO5HIHUWR´6HWWLQJV\VWHPGHIDXOWVµRQSDJHIRUGHWDLOV
RQWXUQLQJWKHSDXVHRSWLRQRQDQGRII,IWKHSDXVHRSWLRQLVRQWKLVPHVVDJH
DSSHDUVHDFKWLPHWKHV\VWHPHQFRXQWHUVDQHZODEHOZKHQSULQWLQJ
Printing paused.
Press Enter to continue or Escape
to quit.
7RFRQWLQXHSULQWLQJWKHODEHOVSUHVVWKH(QWHUNH\3ULQWLQJFRQWLQXHVIURP
ZKHUHLWOHIWRII7RVWRSSULQWLQJSUHVVWKH(VFDSHNH\
•
4-8
7RSUHYHQWWDSHMDPVLQ\RXUV\VWHP1(9(5WXUQWKHV\VWHPRIIZKLOHLWLV
SULQWLQJ,IDMDPGRHVRFFXU\RXPD\EHDEOHWRFOHDULWE\RSHQLQJWKHSULQWHU
FRYHUDQGUHZLQGLQJWKHWDSHRQWRWKHWDSHVSRRO'2127WU\WRFOHDUDMDP
Printing
XVLQJVFUHZGULYHUVRUVLPLODUWRROVWKLVFRXOGFDXVHGDPDJHWRWKHFXWWHU
PHFKDQLVP
•
7RVWRSSULQWLQJDWDQ\WLPHSUHVVWKH(VFDSHNH\7KLVPHVVDJHDSSHDUV
Continue printing?
No
7RVWRSSULQWLQJFKRRVH1R7KHV\VWHPDGYDQFHVDQGFXWVWKHWDSHIRU\RX7R
FRQWLQXHSULQWLQJFKRRVH<HVLIQHFHVVDU\\RXFDQLQVWDOOQHZVXSSOLHVILUVW
3ULQWLQJFRQWLQXHVIURPZKHUHLWOHIWRII
•
7KHV\VWHPDXWRPDWLFDOO\FXWVWKHWDSHDIWHUSULQWLQJHDFKODEHO
•
<RXFDQDGYDQFHDQGFXWWKHWDSHDWDQ\WLPHE\SUHVVLQJWKH&XWNH\
•
7KH/HDGHUWUDLOHUOHQJWKRSWLRQGHWHUPLQHVKRZPXFKEODQNWDSHWKHUHLVDWWKH
EHJLQQLQJDQGHQGRIHDFKODEHO5HIHUWR´6HWWLQJV\VWHPGHIDXOWVµRQSDJH
1RWHWKDW\RXUV\VWHPZDVGHVLJQHGWRSUHYHQWWDSHIURPEHLQJZDVWHG:KHQ\RX
VWDUWSULQWLQJLIPRUHWDSHLVDGYDQFHGWKDQLVQHHGHGIRUWKHOHDGHUWUDLOHUOHQJWK
WKHV\VWHPZLOOUHZLQGWKHWDSHWRWKHDSSURSULDWHVSRW
Printing multiple copies
:KHQDODEHOLVGLVSOD\HGLQWKHWH[WEXIIHU\RXFDQVHOHFWKRZPDQ\FRSLHVRIWKDW
ODEHOVKRXOGEHSULQWHG7RVHWWKLVRSWLRQSUHVVWKH5HSHDWNH\RQWKHODEHOLQJ
V\VWHPNH\ERDUGW\SHDQXPEHUEHWZHHQ]HURDQGDQGSUHVV(QWHU7KHGHIDXOW
YDOXHLV
Copies
Number of copies
1
Type values, press ENTER or ESC
:KHQHYHU\RXSULQWWKHODEHOWKHV\VWHPZLOOJHQHUDWHWKHQXPEHURIFRSLHV\RX
FKRVHKHUH7RSUHYHQWDVSHFLILFODEHOIURPSULQWLQJW\SHD]HURIRUWKLVRSWLRQ
Note: ,IQHHGHG\RXFDQHQWHUDGLIIHUHQWQXPEHURIFRSLHVIRUHYHU\
ODEHO-XVWGLVSOD\HDFKODEHOSUHVVWKH5HSHDWNH\DQGHQWHUDYDOXH7KH
YDOXH\RXVHOHFWIRUHDFKODEHOZLOOEHVDYHGLI\RXVDYHWKHODEHOVLQDILOH
Printing labels
4-9
Changing print density/thermal energy
8VHWKH'HQVLW\NH\RQWKHODEHOLQJV\VWHPNH\ERDUGWRDGMXVWWKHSULQWGHQVLW\E\
LQFUHDVLQJRUGHFUHDVLQJWKHWKHUPDOSULQWHQHUJ\<RXFDQFKDQJHWKLVVHWWLQJZKLOH
ODEHOVDUHSULQWLQJRUDWDQ\RWKHUWLPH
7RFKDQJHWKHVHWWLQJSUHVVWKH'HQVLW\NH\WRGLVSOD\WKH'HQVLW\(QHUJ\ZLQGRZ
VKRZQEHORZ
Density/Energy
Less
More
t
Press ←→, ENTER or ESC
•
3UHVVWKH→NH\LI\RXDUHVHHLQJLQFRPSOHWHFKDUDFWHUVSRRUO\ILOOHGWH[WRUDSRRU
OHDGLQJHGJHOLQH
•
3UHVVWKH←NH\LIWKHULEERQLVERQGLQJWRWKHWDSH
•
7KHDUURZLQWKHFHQWHURIWKHGHQVLW\LQGLFDWRUUHSUHVHQWVWKHQRUPDOVHWWLQJ
•
:KHQ\RXWXUQWKHV\VWHPRIIWKHVHWWLQJLVVDYHGDQGZLOOEHLQHIIHFWZKHQ\RX
WXUQWKHV\VWHPEDFNRQ+RZHYHUWKHRSWLRQUHWXUQVWRWKHQRUPDOVHWWLQJ
ZKHQHYHU\RXFKDQJHWKHULEERQRUWDSHVXSSO\
4-10
Printing
Chapter 5: Label Storage
<RXUODEHOLQJV\VWHPDOORZV\RXWRVDYHWKHODEHOV\RXFUHDWHVRWKDW\RXRURWKHU
XVHUVFDQXVHWKHPDJDLQZLWKRXWKDYLQJWRUHW\SH<RXFDQVWRUHODEHOVLQILOHVPXFK
DV\RXGRRQDFRPSXWHU7KLVFKDSWHUGHVFULEHVKRZWRVDYHUHWULHYHFRS\DQG
GHOHWHWKRVHILOHV
<RXFDQVDYHODEHOILOHVLQWZRSODFHVUHVLGHQWPHPRU\DQGPHPRU\FDUGVERWKRI
ZKLFKDUHGHVFULEHGLQWKLVFKDSWHU
•
5HVLGHQWPHPRU\LVVWDQGDUGVWRUDJHVSDFHLVDYDLODEOHLQVLGHRIHDFKV\VWHPDQG
LVFRPSDUDEOHWRWKHKDUGGLVNVSDFHRQDFRPSXWHU
•
0HPRU\FDUGVDUHVSHFLDOFDUGVFRPSDUDEOHWRFRPSXWHUIORSS\GLVNV<RXLQVHUW
WKHFDUGVLQRQHRIWKHVORWVRQWKHULJKWVLGHRIWKHV\VWHP7KHVHFDUGVDOORZ
GLIIHUHQWXVHUVWRVWRUHODEHOVRQWKHLURZQFDUGVDQGDOORZ\RXWRFDWHJRUL]H\RXU
ODEHOVDQGVDYHGLIIHUHQWW\SHVRQGLIIHUHQWFDUGV<RXFDQSXUFKDVHPHPRU\FDUGV
IURP\RXUODEHOLQJV\VWHPGLVWULEXWRU
5-1
Installing and removing memory cards
%HIRUH\RXFDQVDYHUHWULHYHRUGHOHWHILOHVIURPDPHPRU\FDUG\RXQHHGWRLQVWDOO
WKHFDUGLQWKHODEHOLQJV\VWHP7KHUHDUHWZRPHPRU\FDUGVORWVORFDWHGRQWKHULJKW
VLGHRIWKHV\VWHPLI\RXDUHIDFLQJWKHGLVSOD\ZLQGRZ
<RXFDQLQVHUWWKHFDUG\RXZDQWWRXVHLQHLWKHUVORW,IWKHUHLVQRFDUGLQWKHWRS
VORWWKHV\VWHPDXWRPDWLFDOO\FKHFNVWKHERWWRPVORW+RZHYHULIWKHUHDUHFDUGVLQ
ERWKVORWVWKHV\VWHPDOZD\VXVHVWKHFDUGLQWKHWRSVORW,I\RXZDQWWRHUDVHD
PHPRU\FDUGDVGHVFULEHGLQ´&OHDULQJDPHPRU\FDUGµRQSDJH\RXPXVWLQVHUW
WKHFDUGLQWKHWRSVORW
Note: <RXGRQ·WQHHGWRWXUQRIIWKHV\VWHPEHIRUHLQVWDOOLQJRU
UHPRYLQJDPHPRU\FDUG
1) If you need to remove a memory card that’s already installed, push in the black
button above the slot to release the card, then pull the card out.
2) Slide the new card firmly into the slot as far as it will go.
:KHQWKHFDUGLVSURSHUO\LQVWDOOHGWKHEODFNUHOHDVHEXWWRQDERYHWKHVORWZLOOSRS
RXW
Memory card slots
5-2
Label Storage
Checking available memory
%HIRUH\RXVDYHODEHOV\RXPD\ZDQWWRFKHFNWKDWWKHUHLVHQRXJKPHPRU\DYDLODEOH
HLWKHULQWHUQDOO\RURQWKHPHPRU\FDUG\RXZDQWWRXVH)ROORZWKHVHVWHSV
1) To check the memory available on a memory card, first install the card as
described in “Installing and removing memory cards” on page 5-2.
2) Press the File key on the labeling system keyboard.
7KH)LOHZLQGRZGLVSOD\V
File
Get:
Save:
Delete:
Location:
Resident memory
Type name, press ↑↓←→, ENTER or ESC
3) Use the ↑ or ↓ key to move the cursor to the Location option. Then use the →
key to display Resident memory or Memory card, depending on which memory
location you want to check.
4) Press the ↓ key to move the cursor to the Available memory option.
7KHYDOXHLQGLFDWHVWKHSHUFHQWDJHRIPHPRU\WKDW·VDYDLODEOH,QWKHH[DPSOH
EHORZRIWKHUHVLGHQWPHPRU\UHPDLQVDYDLODEOH
File
Location:
Available memory:
Copy all files:
Print file list . . .
Resident memory
60%
From memory to card
Press ↑↓←→, ENTER or ESC
Checking available memory
5-3
Saving files
)ROORZWKHVHVWHSVWRVDYH\RXUODEHOVLQDILOHLQWKHV\VWHP·VLQWHUQDOPHPRU\RURQD
PHPRU\FDUG$OOLQIRUPDWLRQFXUUHQWO\LQWKHWH[WEXIIHUZLOOEHVDYHG
1) To save the file on a memory card, first install the card as described in “Installing
and removing memory cards” on page 5-2.
2) Press the File key on the labeling system keyboard.
7KH)LOHZLQGRZGLVSOD\V
File
Get:
Save:
Delete:
Location:
Resident memory
Type name, press ↑↓←→, ENTER or ESC
3) Use the ↑ or ↓ key to move the cursor to the Location option. Then use the →
key to display Resident memory or Memory card, depending on where you want
to save the file.
4) Use the ↑ or ↓ key to move the cursor to the Save option.
5) Type a name for the file (up to eight letters and/or numbers). To use an existing
file name, use the ← or → key to display the name of the file you want to use.
7KHV\VWHPDXWRPDWLFDOO\DGGVDQH[WHQVLRQWRWKHILOHQDPHWKDW\RXFDQQRW
FKDQJH)RUH[DPSOHILOHVQRWFUHDWHGZLWKDVSHFLDOW\DSSOLFDWLRQZLOOKDYHDQ
H[WHQVLRQRI26DVLQP\ODEHORV
6) Press Enter.
5-4
•
,I\RXFKRVHDILOHQDPHWKDWDOUHDG\H[LVWV\RX·UHDVNHGLI\RXZDQWWR
RYHUZULWHLW&KRRVH<HVWRHUDVHWKHROGILOHDQGUHSODFHLWZLWKWKHQHZILOH
FKRRVH1RWRUHWXUQWRVWHSDQGHQWHUDGLIIHUHQWILOHQDPH
•
,IWKHUHLVQRWHQRXJKPHPRU\DYDLODEOHWRVDYHWKHILOHD´0HPRU\IXOOµ
PHVVDJHGLVSOD\V<RXQHHGWRHLWKHUVDYHWRDGLIIHUHQWPHPRU\FDUGRUGHOHWH
VRPHILOHVIURPUHVLGHQWPHPRU\RUWKHFDUG\RX·UHXVLQJ5HIHUWR´'HOHWLQJ
VDYHGILOHVµRQSDJH
•
,IWKHWH[WEXIIHULVHPSW\D´1RWH[WWRVDYHµPHVVDJHGLVSOD\V
•
$´)LOHVDYHGµPHVVDJHGLVSOD\VDIWHUWKHILOHKDVEHHQVXFFHVVIXOO\VDYHG
Label Storage
Getting saved files
)ROORZWKHVHVWHSVWRUHWULHYHDILOHWKDWZDVSUHYLRXVO\VDYHGLQUHVLGHQWPHPRU\RU
RQDPHPRU\FDUG:KHQ\RXUHWULHYHDILOHLWLVSODFHGLQWKHWH[WEXIIHUVR\RXFDQ
SULQWRUHGLWLWDQGDOORIWKHVHWWLQJVWKDWZHUHVHOHFWHGIRUWKDWILOHDUHLQHIIHFW
1) To retrieve a file stored on a memory card, insert the card in a card slot.
,QVWDOOWKHFDUGDVGHVFULEHGLQ´,QVWDOOLQJDQGUHPRYLQJPHPRU\FDUGVµRQSDJH
,IFDUGVDUHLQVWDOOHGLQERWKVORWV\RXFDQUHWULHYHILOHVIURPWKHFDUGLQWKH
WRSVORW
2) Press the File key on the labeling system keyboard.
7KH)LOHZLQGRZGLVSOD\V
File
Get:
Save:
Delete:
Location:
Resident memory
Type name, press ↑↓←→, ENTER or ESC
3) Use the ↑ or ↓ key to move the cursor to the Location option. Then use the →
key to display Resident memory or Memory card, depending on where the file
you want to retrieve is stored.
4) Use the ↑ or ↓ key to move the cursor to the Get option.
5) Type the name of the file you want to retrieve (including the extension, such as
.OS), or use the ← or → key to display the name of the file.
•
$V\RXSUHVVWKH← RU→NH\WKHV\VWHPOLVWVWKHQH[WILOHVWRUHGLQWKHVHOHFWHG
ORFDWLRQ&RQWLQXHSUHVVLQJWKHNH\WRVFUROOWKURXJKDOOILOHQDPHV
•
,I\RXW\SHDQDPHWKHV\VWHPGLVSOD\VWKHILUVWILOHQDPHWKDWPDWFKHVZKDW
\RXW\SHGDVDZD\RIKHOSLQJ\RXORFDWHWKHILOHPRUHTXLFNO\)RUH[DPSOHLI
\RXW\SH´DEFµWKHV\VWHPGLVSOD\VWKHQDPHRIWKHILUVWILOHLWILQGVWKDWEHJLQV
ZLWK´DEFµ
6) When the name of the file you want to retrieve is displayed, press Enter.
•
,IWKHILOHZDVIRXQGLWLVSODFHGLQWKHWH[WEXIIHU
,IWKHUHWULHYHGILOHZDVFUHDWHGZLWKDVSHFLDOW\DSSOLFDWLRQWKHV\VWHPODXQFKHV
WKDWDSSOLFDWLRQ)RUH[DPSOHWKH6LJQVDSSOLFDWLRQZLOODXWRPDWLFDOO\RSHQLI
WKHILOHZDVVDYHGXVLQJWKDWDSSOLFDWLRQ
•
,IWKHV\VWHPFRXOGQ·WORFDWHWKHILOHD´)LOHQRWIRXQGµPHVVDJHGLVSOD\V
Getting saved files
5-5
•
,IWKHVSHFLDOW\DSSOLFDWLRQXVHGWRFUHDWHWKHILOHGRHVQ·WH[LVWRQWKHODEHOLQJ
V\VWHPDQ´$SSOLFDWLRQQRWIRXQGµPHVVDJHGLVSOD\VDQGWKHILOHLVQRW
RSHQHG
•
,IWKHUHLVWH[WLQWKHWH[WEXIIHUWKDW\RXKDYHQ·WVDYHGWKLVPHVVDJHGLVSOD\V
Overwrite text?
No
&KRRVH<HVWRHUDVHWKHFRQWHQWRIWKHWH[WEXIIHUDQGRSHQWKHILOH&KRRVH
1RLI\RXGRQRWZDQWWRHUDVHWKHFRQWHQWRIWKHWH[WEXIIHU,I\RXFKRRVH
1R\RXFDQVDYHWKHWH[WEXIIHUFRQWHQWVEHIRUHUHWULHYLQJWKHILOH
•
,IWKHILOHEHLQJUHWULHYHGXVHVDVXSSO\ZLGWKGLIIHUHQWIURPWKHVXSSO\WKDWLV
LQVWDOOHGDPHVVDJHVLPLODUWRWKLVRQHGLVSOD\V
X.XX inch tape needed. Press any key
to continue.
3UHVVDQ\NH\,IWKHILOH·VFRQWHQWZLOOQRWILWRQWKHLQVWDOOHGVXSSO\EHFDXVH
LWFRQWDLQVWRRPDQ\OLQHVRUWRRODUJHDW\SHVL]HWKHILOHLVQRWUHWULHYHG,I
WKHILOH·VFRQWHQWZLOOILWRQWKHLQVWDOOHGVXSSO\WKHPHVVDJHVWLOODSSHDUVEXW
WKHILOHLVUHWULHYHG6HH´+RZLQVWDOOHGULEERQVDIIHFWODEHOFRPSRVLWLRQµRQ
SDJHIRUPRUHLQIRUPDWLRQ
•
5-6
&RORUVHWWLQJVPD\KDYHEHHQVDYHGZLWKWKHILOHGHSHQGLQJRQWKHW\SHRI
ULEERQXVHGWRFUHDWHWKHILOH:KHQ\RXSULQWPHVVDJHVPD\GLVSOD\LIWKH
ULEERQGRHVQ·WPDWFKWKHVHWWLQJXVHGWRFUHDWHWKHILOH5HIHUWR´:RUNLQJ
ZLWKVXSSOLHVµRQSDJH
Label Storage
Copying files to or from a memory card
8VHWKLVSURFHGXUHWRFRS\DOOWKHILOHVVWRUHGLQUHVLGHQWPHPRU\WRDPHPRU\FDUG
RUWRFRS\DOOILOHVVWRUHGRQDPHPRU\FDUGWRUHVLGHQWPHPRU\7RFRS\EHWZHHQ
FDUGVFRS\ILOHVIURPDPHPRU\FDUGWRUHVLGHQWPHPRU\WKHQIURPUHVLGHQW
PHPRU\WRDPHPRU\FDUG
Note: &RS\LQJWRDPHPRU\FDUGRYHUZULWHVDOOH[LVWLQJILOHVRQWKHFDUG
&RS\LQJIURPDPHPRU\FDUGWRUHVLGHQWPHPRU\GRHVQ·WRYHUZULWHILOHV
WKHILOHVDUHDGGHGWRWKHOLVWRIH[LVWLQJILOHV
1) Insert the memory card.
,QVWDOOWKHFDUGDVGHVFULEHGLQ´,QVWDOOLQJDQGUHPRYLQJPHPRU\FDUGVµRQSDJH
,QVHUWWKHPHPRU\FDUG\RXZDQWWRFRS\WRRUIURPLQHLWKHUFDUGVORW,I
WKHUHDUHFDUGVLQERWKVORWVWKHV\VWHPXVHVWKHFDUGLQWKHWRSVORW
2) Press the File key on the labeling system keyboard.
7KH)LOHZLQGRZGLVSOD\V
File
Get:
Save:
Delete:
Location:
Resident memory
Type name, press ↑↓←→, ENTER or ESC
3) Use the ↑ or ↓ key to move the cursor to the Copy all files option as shown below.
Then use the → key to display either From resident memory or From memory to
card. File
Location:
Available memory:
Copy all files:
Print file list . . .
Resident memory
60%
From memory to card
Press ↑↓←→, ENTER or ESC
4) Press Enter.
•
,I\RXDUHFRS\LQJILOHVWRDPHPRU\FDUGWKDWFRQWDLQVILOHV\RX·UHDVNHG
ZKHWKHURUQRW\RXZDQWWRRYHUZULWHWKHILOHVRQWKHFDUG&KRRVH<HVRU1R
•
,I\RXDUHFRS\LQJILOHVWRUHVLGHQWPHPRU\DQGDILOHZLWKWKHVDPHQDPH
DOUHDG\H[LVWV\RXDUHDVNHGLI\RXZDQWWRRYHUZULWHWKHH[LVWLQJILOH&KRRVH
<HVLI\RXZDQWWRRYHUZULWHWKHILOHRU1RLI\RXGRQ·WZDQWWRFRS\WKDWILOH
7KHILOHVDUHFRSLHGWRWKHVSHFLILHGORFDWLRQDQGWKH´$OOILOHVFRSLHGµPHVVDJH
GLVSOD\V
Copying files to or from a memory card
5-7
Printing a list of saved files
8VHWKLVSURFHGXUHWRSULQWDOLVWRIWKHILOHVVWRUHGLQHLWKHUUHVLGHQWPHPRU\RURQD
PHPRU\FDUG
Note: %HIRUHXVLQJWKLVIXQFWLRQ\RXQHHGWRFOHDUDOOWH[WIURPWKHWH[W
EXIIHU6DYHWKHWH[WLI\RXZDQWWKHQSUHVVWKH&OHDUNH\
1) To print a list of the files stored on a memory card, insert the card in a card slot.
,QVWDOOWKHFDUGDVGHVFULEHGLQ´,QVWDOOLQJDQGUHPRYLQJPHPRU\FDUGVµRQSDJH
,IFDUGVDUHLQVWDOOHGLQERWKVORWVWKHOLVWRIILOHVIRUWKHFDUGLQWKHWRSVORW
ZLOOEHSULQWHG
2) Press the File key on the labeling system keyboard.
7KH)LOHZLQGRZGLVSOD\V
File
Get:
Save:
Delete:
Location:
Resident memory
Type name, press ↑↓←→, ENTER or ESC
3) Use the ↑ or ↓ key to move the cursor to the Location option as shown below.
Then use the → key to display either Resident memory or Memory card,
depending on which file list you want to print.
File
Location:
Available memory:
Copy all files:
Print file list . . .
Resident memory
60%
From memory to card
Press ↑↓←→, ENTER or ESC
4) Move the cursor to the Print file list option and press Enter.
7KHOLVWRIILOHVLVSULQWHGRQWKHODEHOLQJV\VWHPXVLQJWKHLQVWDOOHGVXSSO\)LOH
QDPHVDUHSULQWHGLQDOOFDSLWDOOHWWHUVDQGILOHH[WHQVLRQVDUHLQFOXGHG
5-8
Label Storage
Deleting saved files
)ROORZWKHVHVWHSVWRGHOHWHDILOHWKDWZDVSUHYLRXVO\VDYHGLQUHVLGHQWPHPRU\RURQ
DPHPRU\FDUG2QFH\RXGHOHWHDILOHWKHUHLVQRZD\WRJHWLWEDFNDJDLQ
1) To delete a file stored on a memory card, insert the card in a card slot.
,QVWDOOWKHFDUGDVGHVFULEHGLQ´,QVWDOOLQJDQGUHPRYLQJPHPRU\FDUGVµRQSDJH
,IFDUGVDUHLQVWDOOHGLQERWKVORWV\RXFDQGHOHWHILOHVIURPWKHFDUGLQWKH
WRSVORW
2) Press the File key on the labeling system keyboard.
7KH)LOHZLQGRZGLVSOD\V
File
Get:
Save:
Delete:
Location:
Resident memory
Type name, press ↑↓←→, ENTER or ESC
3) Use the ↑ or ↓ key to move the cursor to the Location option as shown below.
Then use the → key to display either Resident memory or Memory card,
depending on where the file you want to delete is stored.
File
Location:
Available memory:
Copy all files:
Print file list . . .
Resident memory
60%
From memory to card
Press ↑↓←→, ENTER or ESC
4) Move the cursor to the Delete option shown below.
File
Get:
Save:
Delete:
Location:
Resident memory
Type name, press ↑↓←→, ENTER or ESC
5) Type the name of the file you want to delete (including the extension, such as
.OS), or use the ← or → key to display the name of the file.
$V\RXSUHVVWKH← RU→NH\WKHV\VWHPOLVWVWKHQH[WILOHVWRUHGLQWKHVHOHFWHG
ORFDWLRQ&RQWLQXHSUHVVLQJWKHNH\WRVFUROOWKURXJKDOOILOHQDPHV
Deleting saved files
5-9
6) When the name of the file you want to delete is displayed, press Enter.
,IWKHV\VWHPFRXOGQ·WORFDWHWKHILOHD´)LOHQRWIRXQGµPHVVDJHGLVSOD\V,IWKH
ILOHZDVIRXQGWKLVPHVVDJHGLVSOD\V
Are you sure?
No
7) Choose Yes to delete the file. Choose No if you decide not to delete.
,I\RXFKRVHWRGHOHWHWKHILOHD´)LOHGHOHWHGµPHVVDJHGLVSOD\VDIWHUWKHILOHKDV
EHHQHUDVHG
5-10
Label Storage
Clearing a memory card
8VHWKLVSURFHGXUHWRGHOHWHDOOILOHVWKDWZHUHSUHYLRXVO\VDYHGRQDPHPRU\FDUG
2QFH\RXGHOHWHWKHILOHVWKHUHLVQRZD\WRJHWWKHPEDFNVREHVXUH\RXZDQWWR
HUDVHWKHILOHV
1) Press the Clear key on the labeling system keyboard.
7KH&OHDUZLQGRZGLVSOD\V
Clear
All labels
All labels, restore defaults
Current label
Current area
Press ↑↓, ENTER or ESC
2) Move the cursor to the Memory card option as shown below and press Enter. Clear
All labels, restore defaults
Current label
Current area
Memory card
Press ↑↓, ENTER or ESC
7KLVPHVVDJHGLVSOD\V
Insert memory card in top slot. Press
Enter to begin or Escape to quit.
3) Insert the memory card in the TOP card slot.
,QVWDOOWKHFDUGDVGHVFULEHGLQ´,QVWDOOLQJDQGUHPRYLQJPHPRU\FDUGVµRQSDJH
4) Press Enter to erase the card.
:KHQWKH´$UH\RXVXUHµPHVVDJHGLVSOD\VFKRRVH<HVRU1R,I\RXFKRRVH<HV
WKH´0HPRU\FDUGFOHDUHGµPHVVDJHGLVSOD\VDIWHUWKHFDUGKDVEHHQHUDVHG
Clearing a memory card
5-11
5-12
Label Storage
Chapter 6: Using the
Printer With a PC
,QDGGLWLRQWRIXQFWLRQLQJDVDVWDQGDORQHV\VWHP\RXUODEHOLQJV\VWHPFDQEH
FRQQHFWHGWRD3&DQGXVHGPXFKOLNHDQ\RWKHUSULQWHU7KLVDOORZV\RXWRFUHDWH
ODEHOVDQGVLJQVLQ3&DSSOLFDWLRQVVXFKDVWKH0DUN:DUHDSSOLFDWLRQDQGWRSULQW
WKHPGLUHFWO\WR\RXUODEHOLQJV\VWHP
7RXVH\RXUODEHOLQJV\VWHPZLWKD3&\RXQHHGWRGRWKHIROORZLQJ
•
,QVWDOODQGFRQILJXUHWKHSULQWGULYHURQWKH3&
•
,QVWDOOWKHSULQWHUFRQWUROXWLOLW\RQWKH3&
•
&RQQHFWWKH3&WRWKHODEHOLQJV\VWHP
•
7XUQWKHODEHOLQJV\VWHPRQVRWKDWWKH´2QOLQHµPHVVDJHGLVSOD\VRUSUHVVWKH
2Q/LQHNH\RQWKHODEHOLQJV\VWHPNH\ERDUGWRSXWWKHV\VWHPRQOLQH:KHQ\RX
VWDUW\RXUV\VWHPLWFKHFNVZKHWKHURUQRWDNH\ERDUGLVDWWDFKHG,IDNH\ERDUG
LVQ·WDWWDFKHGWKHV\VWHPDVVXPHVLWZLOOEHFRQQHFWHGWRD3&DQGDXWRPDWLFDOO\
GLVSOD\VWKH´2QOLQHµPHVVDJH
2QFHWKHODEHOLQJV\VWHPLVFRQQHFWHGWRWKH3&\RXFDQODXQFKD3&DSSOLFDWLRQ
FUHDWHDODEHODQGSULQWLWRQWKHSULQWHU<RXFDQXVHWKHSULQWHUFRQWUROXWLOLW\WR
FRQWUROVRPHIXQFWLRQVIURPWKH3&VXFKDVDGYDQFLQJDQGFXWWLQJWKHWDSHRQWKH
ODEHOLQJV\VWHP
6-1
Requirements
7KHLWHPV\RXQHHGLQRUGHUWRXVH\RXUODEHOLQJV\VWHPZLWKD3&DUHOLVWHGEHORZ
&RQWDFW\RXUODEHOLQJV\VWHPGLVWULEXWRUWRSXUFKDVHDNLWFRQWDLQLQJWKHQHFHVVDU\
FDEOHDQGGULYHUV
•
$3&UXQQLQJ:LQGRZV:LQGRZV:LQGRZV17RU:LQGRZV
ZLWKDQDYDLODEOHSDUDOOHOSRUWDQGDIORSS\GULYH
•
7KHSDUDOOHOFDEOHUHTXLUHGWRFRQQHFW\RXUODEHOLQJV\VWHPWRWKH3&
•
7KHSULQWGULYHU
•
7KHSULQWHUFRQWUROXWLOLW\
•
3&VRIWZDUHWKDW\RXFDQXVHWRFUHDWHODEHOVVXFKDVWKH0DUN:DUHDSSOLFDWLRQ
6-2
Using the Printer With a PC
Setting up the print driver
7KLVVHFWLRQGHVFULEHVKRZWRLQVWDOOWKHODEHOLQJV\VWHPSULQWGULYHURQWKH3&DQG
KRZWRFRQILJXUHWKHGULYHURSWLRQVWKDWDSSO\VSHFLILFDOO\WRWKHODEHOLQJV\VWHP
Installing the print driver
)ROORZWKHVHVWHSVWRLQVWDOOWKHODEHOLQJV\VWHPSULQWGULYHURQWKH3&,I\RXDUH
LQVWDOOLQJRQD:LQGRZV17V\VWHPXVHWKLVSURFHGXUHWRLQVWDOOWKHSULQWGULYHURQ
WKH3&WRZKLFKWKHODEHOLQJV\VWHPZLOOEHFRQQHFWHGWKHSULQWVHUYHU7RVHWXS
WKHSULQWGULYHURQRWKHUQHWZRUN3&VWKDWDUHUXQQLQJ:LQGRZV17VHH´6HWWLQJ
XSWKHSULQWGULYHURQRWKHUQHWZRUN3&VUXQQLQJ:LQGRZV17µRQSDJH
1) Turn on your computer and start Windows. Insert the diskette or CD-ROM
containing the print driver into the appropriate drive.
2) Click the Start button on the taskbar and click Run.
3) In the Run dialog box, type a:\setup.exe and click OK.
,I\RX·UHXVLQJDGULYHRWKHUWKDQDVXEVWLWXWHWKHOHWWHUFRUUHVSRQGLQJWRWKDW
GULYH:KHQ\RXFOLFN2.WKHLQVWDOODWLRQSURJUDPLVVHWXSDQGWKHQWKH6HOHFW
3ULQWHUGLDORJER[GLVSOD\V
4) Click the name of your labeling system and click OK.
5) In the Select Language dialog box, choose the language in which you want color
names displayed and click OK. (This language choice is used only by the
MarkWare application.)
6) If you are prompted to insert the other diskette, remove disk #1, insert disk #2
and click OK.
7KHILOHVDUHLQVWDOOHG
7) When you are asked to select the port to which the labeling system will be
connected, choose the port and click OK.
8) When you’re asked if you want the printer you’re installing to be the default, click
Yes or No. If you choose Yes, applications on this PC will automatically print to
the labeling system unless you choose a different printer within an application.
9) If you are asked whether or not you want to restart your PC, click Yes or No. If
you see this message, you must restart before printing with the driver.
10) Click Finish to complete the installation.
,I\RXFKRVH<HVLQVWHS\RXU3&LVUHVWDUWHG$QLFRQIRUWKHODEHOLQJV\VWHPLV
DGGHGWRWKH3ULQWHUVIROGHURQWKH3&<RXFDQQRZFRQILJXUHGULYHURSWLRQVDV
GHVFULEHGRQWKHQH[WSDJH
Setting up the print driver
6-3
Configuring the print driver
7KLVVHFWLRQGHVFULEHVRSWLRQVWKDW\RXPD\QHHGWRVHOHFWRUFKDQJHIRUWKHODEHOLQJ
V\VWHPSULQWGULYHU
7RDFFHVVWKHGULYHUFKRRVH6WDUWIURPWKH:LQGRZVWDVNEDUWKHQFKRRVH6HWWLQJV
DQGFOLFN3ULQWHUV5LJKWFOLFNWKHLFRQIRUWKHODEHOLQJV\VWHPDQGFOLFN3URSHUWLHVWR
GLVSOD\WKHGULYHU·VSURSHUW\VKHHW7RJHWKHOSFOLFNWKHTXHVWLRQPDUNLFRQLQWKH
SURSHUW\VKHHWWLWOHEDUDQGFOLFNWKHILHOGIRUZKLFK\RXZDQWKHOS
7KHWDEVWKDWFRQWDLQLQIRUPDWLRQ\RXPD\ZDQWWRFKDQJHDUHOLVWHGEHORZ1RWH
WKDWWKHWDEVGLIIHUGHSHQGLQJRQWKHYHUVLRQRI:LQGRZV\RXDUHUXQQLQJ
•
'HWDLOVWDE:LQGRZVRU3RUWVWDE:LQGRZV17³7KHGHIDXOWSDUDOOHO
VHWWLQJVVKRZQEHORZFDQEHXVHGIRUWKHODEHOLQJV\VWHPSULQWGULYHU
•
3RUWVWDE:LQGRZV17³7RXVHWKHODEHOLQJV\VWHPZLWKWKH0DUN:DUH
DSSOLFDWLRQRQ3&VUXQQLQJ:LQGRZV17RQDQHWZRUNELGLUHFWLRQDO
FRPPXQLFDWLRQPXVWEHHQDEOHGLQWKHGULYHU2QWKH3&RQZKLFK\RXLQVWDOOHG
WKHODEHOLQJV\VWHPSULQWGULYHUVHOHFWWKH(QDEOHELGLUHFWLRQDOVXSSRUWRSWLRQDV
VKRZQEHORZ
Enable bidirectional
support option
6-4
Using the Printer With a PC
•
'HWDLOVWDE:LQGRZVRU6FKHGXOLQJWDE:LQGRZV17³8VHWKHVHWDEV
WRFRQILJXUHWKHGULYHUWRVWDUWSULQWLQJDIWHUDOOSDJHVKDYHEHHQVSRROHG7KLV
XVXDOO\SURYLGHVWKHEHVWSHUIRUPDQFH
8QGHU:LQGRZVFOLFNWKH6SRRO6HWWLQJVEXWWRQ6HOHFWWKH6SRROSULQWMREV
VRSURJUDPILQLVKHVSULQWLQJIDVWHURSWLRQWKHQVHOHFW6WDUWSULQWLQJDIWHUODVWSDJH
LVVSRROHG8QGHU:LQGRZV17VHOHFWWKH6SRROSULQWGRFXPHQWVVRSURJUDP
ILQLVKHVSULQWLQJIDVWHURSWLRQWKHQVHOHFW6WDUWSULQWLQJDIWHUODVWSDJHLVVSRROHG
•
6KDULQJWDE:LQGRZV17RQO\³,I\RXZDQWWRXVHWKHODEHOLQJV\VWHPZLWK
QHWZRUN3&VUXQQLQJ:LQGRZV17\RXPXVWVHWXSWKHSULQWGULYHUDVDVKDUHG
SULQWHURQWKH3&RQZKLFK\RXLQVWDOOHGWKHODEHOLQJV\VWHPSULQWGULYHU6HOHFW
WKH6KDUHGRSWLRQRQWKH6KDULQJWDEVKRZQEHORZ1RWHWKDWWKHRQO\RSHUDWLQJ
V\VWHPVXSSRUWHGIRUVKDULQJLV:LQGRZV17IRU[EDVHG3&VGRQRWVHOHFW
DQ\RIWKHRWKHURSHUDWLQJV\VWHPRSWLRQV
•
6HFXULW\WDE:LQGRZV17RQO\³7RXVHWKHODEHOLQJV\VWHPZLWKWKH
0DUN:DUHDSSOLFDWLRQRQ3&VUXQQLQJ:LQGRZV17RQDQHWZRUN\RXPXVWVHW
XSGULYHUSHUPLVVLRQVVRWKDW0DUN:DUHXVHUVRQWKHQHWZRUNKDYHIXOOFRQWURO
&OLFNWKH3HUPLVVLRQVEXWWRQRQWKLVWDEWRGLVSOD\WKH3ULQWHU3HUPLVVLRQVGLDORJ
ER[6HOHFWWKHQHWZRUNXVHURUJURXSWRZKLFK\RXZDQWWRDVVLJQWKHSHUPLVVLRQ
DQGFKRRVH)XOO&RQWUROLQWKH7\SHRI$FFHVVOLVW
Setting up the print driver
6-5
,IWKHQHWZRUN3&XVHUVZLOOQRWEHSULQWLQJIURPWKH0DUN:DUHDSSOLFDWLRQ\RX
FDQVHWWKHSHUPLVVLRQWR3ULQW
•
7DSHDQG5LEERQWDEV:LQGRZVRU'HYLFH2SWLRQVWDE:LQGRZV
17³7KHVHWDEVDOORZ\RXWRVHOHFWWKHGHIDXOWSDSHUVL]HDQGRULHQWDWLRQIRUWKH
ODEHOLQJV\VWHP7KH\DOVRDOORZ\RXWRFKRRVHWKHGHIDXOWULEERQDQGVHOHFW
ZKHWKHUWKHGULYHUVKRXOGGLWKHUFRORUVZKHQ\RXSULQWZLWKPRQRFKURPHULEERQV
7KHWDEVIRU:LQGRZVDUHLOOXVWUDWHGRQWKHIROORZLQJSDJHV)LHOGVDUH
GHVFULEHGLQWKHWDEOHEHORZHDFKLOOXVWUDWLRQ
6-6
Using the Printer With a PC
Field
What it does
Tape width
Lets you choose the default tape width for the labeling system.
Document length
Allows you to enter the default label length.
Default color
Lets you select the default tape color for the labeling system.
This information is used to set up a print job if bidirectional
communication cannot be established during printing. If
bidirectional communication has been established, the driver
ignores this setting and sets up the print job according to the
tape actually installed in the system.
Portrait/Landscape
Allows you to choose whether labels will print in the portrait
position (longer than they are wide) or in the landscape
position (wider than they are long).
Setting up the print driver
6-7
Field/Button
What it does
Default ribbon
Lets you choose the default ribbon for the labeling system.
This ribbon is used to set up a print job if bidirectional
communication cannot be established during printing. If
bidirectional communication has been established, the driver
ignores this setting and sets up the print job according to the
ribbon actually installed in the printer. RGB color values for
the colors on the selected ribbon are listed for information only
and cannot be changed.
Add New Ribbon
Allows you to add the names of new ribbon colors to the list of
available ribbons. (This is similar to adding color names on the
labeling system itself; however, names you enter on the
labeling system are not transferred to the PC.) To use this
feature, turn the labeling system on and install the new ribbon.
Click the Refresh button if you installed the new ribbon after
you turned the labeling system on. Colors that are already set
up in the system are displayed in the dialog box. If a color
hasn’t been set up, its Name field is blank and you can type a
name of your choice.
Print colors
Lets you select whether the driver should print colors as
Monochrome (dithered) or Spot color (no dithering). Spot color
(no dithering) is the default and allows multiple-color printing
with both paneled and monochrome ribbons. The
Monochrome (dithered) option allows you to print all colors in
the print job with a single monochrome ribbon; if the job
contains multiple colors, colors that don’t match the installed
ribbon color print as dithered shades of the installed ribbon.
6-8
Using the Printer With a PC
Setting up the print driver on other network PCs running
Windows NT
)ROORZWKHVHVWHSVWRVHWXSWKHSULQWGULYHURQD:LQGRZV173&WRZKLFKWKH
ODEHOLQJV\VWHPLVQRWFRQQHFWHG7KLV3&ZLOODFFHVVWKHODEHOLQJV\VWHPWKURXJKWKH
:LQGRZV17SULQWVHUYHURQZKLFK\RXLQVWDOOHGWKHSULQWGULYHUDVGHVFULEHGLQ
´,QVWDOOLQJWKHSULQWGULYHUµRQSDJH
1) Click the Start button on the taskbar. Point to Settings, then click Printers.
7KH3ULQWHUVIROGHURSHQVDQGGLVSOD\VLFRQVIRUWKHSULQWGULYHUVDOUHDG\LQVWDOOHG
RQWKHV\VWHP
2) Double-click the Add Printer icon.
<RXDUHDVNHGWRFKRRVHZKHWKHUWKHODEHOLQJV\VWHPZLOOEHFRQQHFWHGWRWKLV3&
RUWRDQRWKHU3&RQWKHQHWZRUN
3) Click the Network printer server option, then click Next.
<RXQHHGWRVHOHFWWKH3&WRZKLFKWKHSULQWHULVDWWDFKHG7KHSULQWHUPXVWEH
VHWXSDVDVKDUHGGHYLFHDVGHVFULEHGLQ´&RQILJXULQJWKHSULQWGULYHUµRQSDJH
4) Select the name of the labeling system for which you installed the print driver
and click OK.
5) Click Yes or No to choose whether the labeling system should be the default
printer on this PC. If you choose Yes, applications on this PC will automatically
print to the labeling system unless you choose a different printer within an
application. Click Next.
6) Click Finish.
$QLFRQIRUWKHSULQWHU\RXLQVWDOOHGDSSHDUVLQWKH3ULQWHUVIROGHUZLQGRZ
Setting up the print driver
6-9
Setting up and using the printer control utility
7KLVVHFWLRQGHVFULEHVKRZWRLQVWDOODQGXVHWKHSULQWHUFRQWUROXWLOLW\ZKLFKDOORZV
\RXWRFRQWUROVRPHODEHOLQJV\VWHPIXQFWLRQVIURPWKH3&
Installing the printer control utility
)ROORZWKHVHVWHSVWRLQVWDOOWKHSULQWHUFRQWUROXWLOLW\
1) Turn on your computer and start Windows. Insert the printer control utility
diskette or CD-ROM into the appropriate drive.
2) Click the Start button on the taskbar and click Run.
3) In the Run dialog box, type a:\setup.exe and click OK.
,I\RX·UHXVLQJDGULYHRWKHUWKDQDVXEVWLWXWHWKHOHWWHUFRUUHVSRQGLQJWRWKDW
GULYH:KHQ\RXFOLFN2.WKHSURJUDPLVVHWXSDQGWKH:HOFRPHVFUHHQGLVSOD\V
4) In the Welcome screen, click Next to continue.
5) Click Next to accept the default location for the printer control utility. (Click
Browse if you need to first select a different location.)
6) Click Next to accept the default program folder in which to install the program
icons.
7KHILOHVDUHFRSLHGWR\RXUKDUGGULYH
7) When asked if you want to place an icon for the printer control utility on your
PC’s desktop, click Yes or No.
8) Click Finish to exit the installation program.
Using the printer control utility
7RUXQWKHSULQWHUFRQWUROXWLOLW\FKRRVH3RZHU0DUN3ULQWHU&RQWUROIURPWKH
3URJUDPVIROGHURQWKH3&·V6WDUWPHQX7KHXWLOLW\FKHFNVLIWKHODEHOLQJV\VWHPLV
RQOLQH,ILWLVQRWDQHUURUPHVVDJHGLVSOD\VDQGWKHDSSOLFDWLRQGRHVQRWRSHQ
:KHQWKHSULQWHULVRQOLQHWKHPDLQXWLOLW\ZLQGRZGLVSOD\VDVVKRZQLQWKH
IROORZLQJLOOXVWUDWLRQ7KH3&UHDGVLQIRUPDWLRQIURPWKHODEHOLQJV\VWHPDQG
GLVSOD\VLW7KHILHOGVDQGEXWWRQVDUHGHVFULEHGLQWKHWDEOHRQWKHQH[WSDJH&KRRVH
([LWWRFORVHWKHXWLOLW\
Note: &KDQJHV\RXPDNHWRVHWWLQJVLQWKHXWLOLW\RYHUZULWHWKHVHWWLQJV
VHOHFWHGRQWKHODEHOLQJV\VWHP/LNHZLVHVHWWLQJFKDQJHVWKDW\RXPDNH
RQWKHODEHOLQJV\VWHPLQWKHIXWXUHZLOORYHUZULWHWKHXWLOLW\VHWWLQJV
6-10
Using the Printer With a PC
Field/Button
What it does
Get status
Displays the Printer Status dialog box, which lists current
labeling system information. This includes tape information
(color, width, amount remaining and type), ribbon information
(colors and width) and operating system version number.
Details are provided for information only, and values cannot be
changed here. Click OK to close the dialog box.
Cut
Advances the supply 2.25 inches (57.12 mm), cuts and
retracts it. This function ignores the Leader/Trailer Length
value set on the labeling system.
Density
Lets you adjust the print density by increasing or decreasing
the thermal print energy. Drag the slider to the right if you are
seeing incomplete characters, poorly filled text or a poor
leading edge line. Drag the slider to the left if the ribbon is
bonding to the tape.
Unit of measure
Sets the unit of measure for displaying label length or other
length values (such as amount of tape remaining). Choose
inches or millimeters, then click the Apply button.
Language
Sets the language in which labeling system menus, prompts
and messages display. (Note that this setting does not affect
the text in the utility itself.) Choose a language, then click the
Apply button.
Setting up and using the printer control utility
6-11
Connecting the system to a PC
7RFRQQHFWWKHODEHOLQJV\VWHPWRD3&IROORZWKHVWHSVEHORZ
1) Turn off the PC, the labeling system and any devices connected to the PC.
2) Plug the parallel cable into the port on the back of the labeling system. Parallel plug
3) Plug the other end of the cable into a parallel port on the back of the PC.
%HVXUHWRXVHWKHSDUDOOHOSRUW\RXFKRVHZKHQ\RXLQVWDOOHGWKHGULYHUDVGHVFULEHG
LQ´,QVWDOOLQJWKHSULQWGULYHUµRQSDJH
4) Turn on the PC.
5) Disconnect the keyboard from the labeling system and turn the labeling system
power switch on.
7KHODEHOLQJV\VWHPGLVSOD\VWKH´2QOLQHµPHVVDJHWRLQGLFDWHWKDWLWLVUHDG\WR
UHFHLYHLQIRUPDWLRQIURPWKH3&<RXFDQDOVRSXWWKHODEHOLQJV\VWHPRQOLQHZLWK
WKHNH\ERDUGDWWDFKHGDIWHUWKHODEHOLQJV\VWHPLVWXUQHGRQWRGRWKLVSUHVVWKH
2Q/LQHNH\RQWKHODEHOLQJV\VWHPNH\ERDUG
6-12
Using the Printer With a PC
Printing from a PC
%HIRUHSULQWLQJODEHOVIURPD3&DSSOLFDWLRQEHVXUH\RXKDYHLQVWDOOHGDQG
FRQILJXUHGWKHSULQWGULYHUDQGSULQWHUFRQWUROXWLOLW\DVGHVFULEHGHDUOLHULQWKLV
FKDSWHU&UHDWH\RXUODEHOVLQD:LQGRZVDSSOLFDWLRQVXFKDVWKH0DUN:DUH
DSSOLFDWLRQFKRRVHWKH3ULQWFRPPDQGDV\RXQRUPDOO\ZRXOGDQGVHOHFW\RXU
ODEHOLQJV\VWHPDVWKHSULQWHU
7KHSULQWLQJSURFHVVZRUNVDVGHVFULEHGLQ&KDSWHU´3ULQWLQJµ7KHGLIIHUHQFHVDUH
OLVWHGEHORZ
•
:KHQ\RXDUHSULQWLQJZLWKPXOWLSOHFRORUV\RXDUHSURPSWHGWRLQVHUWDQHZFRORU
ZKHQQHFHVVDU\7KHPHVVDJHOLVWVDOOFRORUVUHPDLQLQJWREHSULQWHGDQG\RXFDQ
LQVWDOODQ\RIWKHFRORUVLQWKHOLVW
•
7KHPD[LPXPVXSSRUWHGODEHOOHQJWKLVLQFKHVPPZKHQWKHSULQWMRE
FRQWDLQVPXOWLSOHFRORUVIRUVLQJOHFRORUMREVWKHPD[LPXPOHQJWKLVLQFKHV
PP,I\RXUODEHOLVORQJHUWKDQWKLVWKH´3DJHOHQJWKLVWRRORQJµPHVVDJH
DSSHDUV
•
,IWKH3&LVXQDEOHWRHVWDEOLVKELGLUHFWLRQDOFRPPXQLFDWLRQZLWKWKHSULQWHUD
PHVVDJHSURPSWV\RXWRVHOHFWWKHULEERQDQGWDSHFRORUVWKDWDUHFXUUHQWO\
LQVWDOOHG&KRRVHWKHFRORUVDQGFOLFN2.1RWHWKDWWKHFRORUV\RXVHOHFWZLOOEH
XVHGDVWKHGHIDXOWVDVGHVFULEHGLQ´&RQILJXULQJWKHSULQWGULYHUµRQSDJH
•
7RFXWWKHWDSHFKDQJHSULQWGHQVLW\RUSHUIRUPRWKHUODEHOLQJV\VWHPIXQFWLRQV
RQWKH3&UHIHUWR´8VLQJWKHSULQWHUFRQWUROXWLOLW\µRQSDJH
Printing from a PC
6-13
6-14
Using the Printer With a PC
Chapter 7: Cleaning and
Maintenance
7KLVFKDSWHUSURYLGHVLQIRUPDWLRQRQSURFHGXUHV\RXVKRXOGIROORZWRNHHS\RXU
V\VWHPUXQQLQJDWLWVEHVW
7-1
Cleaning the system
7RNHHS\RXUV\VWHPRSHUDWLQJDWLWVEHVWZHUHFRPPHQGWKDW\RXFOHDQWKHSULQWKHDG
HDFKWLPH\RXXVHXSDULEERQFDUWULGJH<RXVKRXOGDOVRFOHDQWKHSULQWKHDGLI\RX
H[SHULHQFHSULQWTXDOLW\SUREOHPVVXFKDVOLQHVRQ\RXUODEHOV
CAUTION!$OZD\VUHPRYHWKHSRZHUSOXJIURPWKH
HOHFWULFDORXWOHWEHIRUHFOHDQLQJWKHV\VWHP'RQRW
XVHVKDUSLQVWUXPHQWVIRUFOHDQLQJ
•
&OHDQWKHRXWVLGHVXUIDFHRIWKHV\VWHPXVLQJPLOGGHWHUJHQWDQGDVRIWFORWK
$YRLGVWURQJFOHDQHUVVXFKDVVROYHQWVRUKDUVKFOHDQHUVDVWKH\PD\GDPDJHWKH
V\VWHP·VILQLVK'RQRWDOORZOLTXLGWRUXQEHWZHHQWKHNH\ERDUGNH\V
•
8VHWKHOLQWIUHHIRDPWLSVZDEVLQFOXGHGLQWKHFOHDQLQJNLWSURYLGHGZLWK\RXU
V\VWHPDQGDPLQLPXPLVRSURS\ODOFRKROVROXWLRQWRFOHDQWKHSULQWKHDGDQG
SODWHQUROOHU<RXQHHGWRUHPRYHWKHULEERQFDUWULGJHLQRUGHUWRGRWKLV
•
<RXUV\VWHPLVHTXLSSHGZLWKVSHFLDOZLSHUVGHVLJQHGWRNHHSWKHULEERQDQGWDSH
VXSSOLHVDVFOHDQDVSRVVLEOHWRHQVXUHKLJKTXDOLW\RXWSXW7KHZLSHUSDGVQHHG
WREHUHSODFHGSHULRGLFDOO\DVWKH\EHFRPHGLUW\:HUHFRPPHQGUHSODFLQJWKH
SDGVDIWHU\RXXVHXSDSSUR[LPDWHO\ILYHUROOVRIULEERQRUWDSH6RPHUHSODFHPHQW
SDGVDUHSURYLGHGZLWK\RXUV\VWHPDQG\RXFDQSXUFKDVHDGGLWLRQDOSDGVIURP
\RXUODEHOLQJV\VWHPGLVWULEXWRU
,OOXVWUDWLRQVLQ´6HWWLQJXS\RXUV\VWHPµRQSDJHVKRZZKHUHWKHZLSHUSDGV
DUHORFDWHG5HPRYHWKHULEERQFDUWULGJHWRUHSODFHWKHULEERQZLSHUSDG7R
UHSODFHDSDGMXVWOLIWDQGSHHOLWRIIWKHPHWDOSODWH&OHDQWKHSODWHZLWKLVRSURS\O
DOFRKROWRUHPRYHDQ\UHPDLQLQJDGKHVLYH7KHQUHPRYHWKHEDFNLQJIURPDQHZ
ZLSHUSDGDQGSODFHLWRQWKHPHWDOSODWH3ODFHWKHSDGFDUHIXOO\VRWKDWLWOLHVIODW
Maintaining the system
)ROORZWKHVHVXJJHVWLRQVWRPDLQWDLQ\RXUV\VWHP
•
7XUQ\RXUV\VWHPRIIZKHQ\RXDUHQRWXVLQJLW
•
6WRUHVXSSOLHVLQWKHLURULJLQDOFDUWRQVLQDFRROGU\SODFH,I\RXGRQ·WVWRUH
VXSSOLHVLQWKHFDUWRQVVWDQGWKHPRQHQGZLWKWKHIODJHQGXS
•
.HHSDULEERQVXSSO\FDUWULGJHORDGHGLQ\RXUV\VWHPWRSURWHFWWKHSULQWKHDG
•
:KHQKDQGOLQJVXSSOLHVDYRLGWRXFKLQJWKHWDSHDQGULEERQDVPXFKDVSRVVLEOH
7-2
Cleaning and Maintenance
Index
A
DFFHQWHGFKDUDFWHUV
OLQHVSDFLQJ
$030RSWLRQ
$SSNH\
$SSOLFDWLRQZLQGRZ
)UHHIRUPRSWLRQ
6HWXSNH\DYDLODEOH
VSHFLDOW\DSSOLFDWLRQV
$UHDIUDPHFRORURSWLRQ
$UHDOLQHZLGWKRSWLRQ
$UHDRSWLRQIUDPHV
DUHDV
DGGLQJ
FOHDULQJ
IUDPLQJ
LQVWDQGDUGOD\RXWV
PRYLQJEHWZHHQ
QXPEHULQQDYLJDWLRQDUHD
VWDQGDUGOD\RXWV
DUURZNH\V
LQVHOHFWLRQZLQGRZV
$YDLODEOHPHPRU\RSWLRQ
B
%DFNJURXQGFRORURSWLRQ
LQEDUFRGHV
%DFNVSDFHNH\
%DU&RGH$WWULEXWHVZLQGRZ
%DU&RGHNH\
EDUFRGHPDUNHU
EDUFRGHV
DWWULEXWHV
EDFNJURXQGFRORU
&KHFNFKDUDFWHURSWLRQ
'HQVLW\RSWLRQ
IRQW
KHLJKW
+XPDQUHDGDEOHWH[WRSWLRQ
+XPDQUHDGDEOHWH[WVL]HRSWLRQ
LQVHUWLQJ
OLQHVSDFLQJ
RSWLRQV
TXLHW]RQH
VSHFLDOFKDUDFWHUV
6WDUW6WRSLQ+5WH[WRSWLRQ
V\PERORJ\
W\SHVL]H
%DVHOLQHRSWLRQ
ELGLUHFWLRQDOFRPPXQLFDWLRQ
C
&DSV/RFNNH\
&DWHJRU\RSWLRQ
FHQWHULQJWH[W
&KDQJHE\RSWLRQ
FKDQJHPDUNHU
PD[LPXPQXPEHULQWH[WEXIIHU
VWRULQJPXOWLSOHFKDQJHVLQ
ZKHQDGGLQJDUHDV
ZKHQDGGLQJODEHOV
&KDUDFWHUSRVLWLRQRSWLRQ
&KHFNFKDUDFWHURSWLRQ
FOHDQLQJWKHV\VWHP
&OHDUNH\
&OHDUZLQGRZ
Index
I-3
FRORU
DGGLQJRQ3&
DUHDIUDPHV
EDFNJURXQG
FKHFNLQJULEERQFRORU
FKHFNLQJWDSHFRORU
GHIDXOWRQ3&
GLWKHULQJRQ3&
HQWHULQJULEERQFRORUQDPHV
HQWHULQJWDSHFRORUQDPHV
IRUPXOWLSDUWV\PEROV
LQSUHYLHZDUHD
ODEHOIUDPHV
PXOWLSOHFRORUVRQ3&
V\PEROV
WH[W
&RQGHQVHWRILWRSWLRQ
ZLWK([SDQG&RQGHQVHRSWLRQ
ZLWKVWDQGDUGOD\RXWV
FRQGHQVLQJODEHOV
FRQGHQVLQJWH[W
FRQILJXULQJSULQWGULYHU
FRQWLQXRXVFRORUPRQRFKURPHULEERQ
&RSLHVZLQGRZ
&RS\DOOILOHVRSWLRQ
FRYHUUHOHDVHEXWWRQ
FXUVRU
PRYLQJLQQDYLJDWLRQDUHD
PRYLQJLQWH[WHQWU\DUHD
FXVWRPFRORUQDPLQJ
FXVWRPULEERQFRORU
FXVWRPWDSH
&XWNH\
FXWWLQJWKHWDSH
D
'DWHDQG7LPHZLQGRZ
'DWHIRUPDWRSWLRQ
GDWHRQODEHOV
'DWHIRUPDWRSWLRQ
'D\RSWLRQ
0RQWKRSWLRQ
3ULQWRSWLRQ
VHWWLQJ
<HDURSWLRQ
'DWH7LPHNH\
I-4
Index
'DWHWLPHPDUNHU
GDWHWLPHPDUNHU
GDWHVRQODEHOV
IRUPDW
'D\RSWLRQ
GHIDXOWVHWWLQJV
'HOHWHNH\
'HOHWHRSWLRQ
GHOHWLQJILOHV
'HQVLW\NH\
'HQVLW\RSWLRQEDUFRGHV
'HQVLW\(QHUJ\ZLQGRZ
GLVSOD\VFUHHQ
GLVSOD\LQJRWKHUDUHDV
GLVSOD\LQJRWKHUODEHOV
LQVSHFLDOW\DSSOLFDWLRQV
VFUROOLQJ
E
(QGLQJSRLQWRSWLRQ
(QWHU$6&,,6SHFLDO&KDUVZLQGRZ
(QWHUNH\
WRVWDUWQHZOLQH
HUDVLQJPHPRU\FDUGV
([SDQG&RQGHQVHRSWLRQ
ZLWKV\PEROV
F
)LOHNH\1-215-35-45-55-75-85-9
)LOHZLQGRZ
ILOHV
FRS\LQJ
GHOHWLQJ
JHWWLQJ
QDPLQJ
RYHUZULWLQJ
SULQWLQJOLVW
UHWULHYLQJ
IRQW
FKDQJHPDUNHU
FKDQJLQJVL]H
GHIDXOW
GHIDXOWVL]H
LQEDUFRGHV
VHOHFWLQJ
VL]HXQLWV
)RQWNH\
)RQWRSWLRQ
)RQWZLQGRZ
)RUPDWVHWXSRSWLRQ
)RUPDW6HWXSZLQGRZ
)UDPHNH\
)UDPH2SWLRQVZLQGRZ
IUDPHV
$UHDIUDPHFRORU
$UHDOLQHZLGWKRSWLRQ
$UHDRSWLRQ
/DEHOIUDPHFRORU
/DEHOIUDPHVKDSHRSWLRQ
/DEHOOLQHZLGWKRSWLRQ
/DEHORSWLRQ
VL]H
IUHHIRUPODEHOV
IXQFWLRQNH\V
G
*HWRSWLRQ
JHWWLQJILOHV
JUDSKLFV
*UDSKLFVNH\3-10
H
+DUGZDUHYHUVLRQ
+D]DUGRXV:DVWH/DEHOVDSSOLFDWLRQ
+HLJKWRSWLRQEDUFRGHV
KHOSOLQH
LQVSHFLDOW\DSSOLFDWLRQV
+RXUVRSWLRQ
+XPDQUHDGDEOHWH[WRSWLRQ
+XPDQUHDGDEOHWH[WVL]HRSWLRQ
I
,QVHUWNH\
LQVHUWLQJWH[W
LQVWDOOLQJSULQWGULYHU
LQVWDOOLQJSULQWHUFRQWUROXWLOLW\
,WDOLFVRSWLRQ
ZLWKV\PEROV
J
MDPV4-8
MXVWLILFDWLRQ
VHWWLQJGHIDXOW1-24
-XVWLILFDWLRQRSWLRQ1-243-163-17
K
NH\ERDUG
DFFHQWHGFKDUDFWHUV
IXQFWLRQNH\V
SOXJ
VHOHFWLQJVW\OH
VSHFLDOFKDUDFWHUV
.H\ERDUGVW\OHRSWLRQ
L
ODEHO
RSWLRQV
/DEHOIUDPHFRORURSWLRQ
/DEHOIUDPHVKDSHRSWLRQ
/DEHO/D\RXWNH\
/DEHO/D\RXWZLQGRZ
/DEHO/HQJWKNH\
LQVWDQGDUGOD\RXWV
/DEHO/HQJWKZLQGRZ
ODEHOOHQJWKV
/DEHOOLQHZLGWKRSWLRQ
/DEHORSWLRQIUDPHV
/DEHO2SWLRQVNH\
/DEHO2SWLRQVZLQGRZ
LQVWDQGDUGOD\RXWV
ODEHOV
DGGLQJDUHDV
DGGLQJEDUFRGHV
WH[W
EDUFRGHV
DGGLQJGDWHWLPH
EDFNJURXQGFRORU
FOHDULQJ
FRQGHQVLQJ
FRS\LQJ
FUHDWLQJ
FUHDWLQJVHTXHQFHV
FUHDWLRQPHWKRGV
GDWHWLPHIRUPDW
GHOHWLQJILOHV
IUDPLQJ
IUHHIRUP
JHWWLQJ5-5
Index
I-5
LQVHUWLQJEODQNOLQHV
MXVWLILFDWLRQ
PD[LPXPOHQJWK
PLUURULPDJH
PRYLQJEHWZHHQ
QXPEHULQQDYLJDWLRQDUHD
QXPEHURIFRSLHV
RSWLRQV
RSWLRQVLQVWDQGDUGOD\RXWV
SDXVLQJZKHQSULQWLQJ
SUHIRUPDWWHG
SULQWLQJ
SULQWLQJOLVW
SULQWLQJPXOWLSOHFRSLHV
UHWULHYLQJ
VDYLQJ
VHOHFWLQJRSWLRQV
VHWWLQJGDWH
VHWWLQJOHQJWK
VHWWLQJWLPH
VWDQGDUGOD\RXWV
VWRULQJ
WH[WGLUHFWLRQ
WH[WSRVLWLRQ
/DQJXDJHRSWLRQ
RQ3&
OD\RXWV
OHDGHU
VHOHFWLQJGHIDXOWOHQJWK
/HDGHUWUDLOHUOHQJWKRSWLRQ
OHQJWK
&RQGHQVHWRILWRSWLRQ
GHIDXOWRQ3&
GLVSOD\HGLQQDYLJDWLRQDUHD
H[FHHGLQJ
LQVWDQGDUGOD\RXWV
OHDGHU
PD[LPXPRQ3&
RQ3&
VHWWLQJ
WUDLOHU
XQLWV
ZLWKH[SDQGFRQGHQVHRSWLRQ
/HQJWKRSWLRQ
/HQJWKXQLWVRSWLRQ
/LQHVSDFLQJRSWLRQ
OLQHV
DGGLQJ
EODQN
I-6
Index
FRQGHQVLQJ
HQWHULQJWRRPDQ\
IRUIUDPHV
PD[LPXPQXPEHU
PRYLQJEHWZHHQ
QXPEHULQQDYLJDWLRQDUHD
VSOLWWLQJ
VWDUWLQJQHZRQH
/RFDWLRQRSWLRQ
M
PDLQWHQDQFH
0DNH&KDQJHZLQGRZ
LQVWDQGDUGOD\RXWV
PDUNHUV
EDUFRGHPDUNHU
FKDQJHPDUNHU
GDWHWLPHPDUNHU
GHOHWLQJ
VHTXHQFHPDUNHU
VSHFLDOEDUFRGHFKDUDFWHUPDUNHU
V\PEROPDUNHU
0DUN:DUHDSSOLFDWLRQ
0DUN:DUHÆDSSOLFDWLRQ
PHPRU\
FKHFNLQJDYDLODEOHVSDFH
FRS\LQJILOHV
GHOHWLQJILOHV
JHWWLQJILOHV
PHPRU\FDUGV
SULQWLQJILOHOLVW
UHVLGHQW
UHWULHYLQJILOHV
VDYLQJILOHV
WHPSRUDU\
PHPRU\FDUG
FDUGVORWV
FKHFNLQJDYDLODEOHVSDFH
FOHDULQJ
FRS\LQJILOHV
GHOHWLQJILOHV
HUDVLQJ
LQVWDOOLQJ
SULQWLQJILOHOLVW
UHPRYLQJ
0HPRU\FDUGRSWLRQ
PHPRU\FHOOIODJ
0HVVDJH
$OOILOHVFRSLHG
$SSOLFDWLRQQRWIRXQG
&DSVRQO\
&RPSRVLQJ
&RQWLQXHSULQWLQJ
)LOHGHOHWHG
)LOHQRWIRXQG
)LOHVDYHG
/DEHOGRHVQRWH[LVW
0HPRU\FDUGFOHDUHG
0HPRU\IXOO
1RWH[WWRVDYH
2QOLQH
2YHUZULWHWH[W"
3DJHOHQJWKLVWRRORQJ
3ULQWLQJSDXVHG
6DYHDQGFOHDUWH[WWRXVHWKLVIXQFWLRQ
7H[WWRRORQJ
7KLVFKDQJHDIIHFWVDOOODEHOV
7RRPDQ\W\SHFKDQJHV
7\SHWRRODUJHRUWRRPDQ\OLQHV
7\SHWRRODUJH
8QNQRZQVXSSO\W\SH
PHVVDJHZLQGRZ
PHVVDJHV
RYHUZULWH
UHVSRQGLQJWR
\HVQRUHVSRQVH
0LQXWHVRSWLRQ
0LUURURSWLRQ
LQVWDQGDUGOD\RXWV
PRQRFKURPHULEERQ
0RQWKRSWLRQ
PXOWLFRORUSULQW
N
QDYLJDWLRQDUHD
DUHDQXPEHU
ODEHOOHQJWK
ODEHOQXPEHU
OLQHQXPEHU
7DENH\
1HZ$UHDNH\
1HZ/DEHONH\
1H[W$UHDNH\
1H[W/DEHONH\
1H[W6WHSNH\
1XPEHURIFRSLHVRSWLRQ
1XPEHURIODEHOVRSWLRQ
1XP/RFNNH\
O
2Q/LQHNH\
RQRIIVZLWFK
RSHUDWLQJV\VWHP
XSGDWLQJ
YHUVLRQ
26H[WHQVLRQ
26YHUVLRQRSWLRQ
RYHUW\SLQJWH[W
P
SDQHOHGULEERQ
3DQHOHG5LEERQZLQGRZ
SDUDOOHOFDEOH
3DXVHEHWZHHQODEHOVRSWLRQ
3&
ELGLUHFWLRQDOVXSSRUW
FRQILJXULQJSULQWGULYHU
FRQQHFWLQJWRSULQWHU
FXWWLQJWKHWDSH
SDUDOOHOFDEOH
SULQWLQJ
UHTXLUHPHQWV
VHOHFWLQJSRUW
YLHZLQJVWDWXV
3LSH0DUNHUVDSSOLFDWLRQ
SRUW
VHOHFWLQJ
3RUWUDLW/DQGVFDSHRSWLRQ
SRZHUFRUG
RXWVLGHRI1RUWK$PHULFD
SRZHURXWOHW
SRZHUVZLWFK
3UHY$UHDNH\
3UHY/DEHONH\
3UHY6WHSNH\
SUHYLHZDUHD
Index
I-7
FRORU
V\PEROV
SULQWGULYHU
FRQILJXULQJ
LQVWDOOLQJ
5LEERQWDE
VHWWLQJXS
7DSHWDE
:LQGRZV17
3ULQWILOHOLVWRSWLRQ
3ULQWNH\
3ULQWRSWLRQGDWHWLPH
3ULQW6SHFLDONH\
SULQWHUFRQWUROXWLOLW\
LQVWDOOLQJ
XVLQJ
SULQWKHDG
FOHDQLQJ
SURWHFWLQJ
SULQWLQJ
FRQQHFWLQJWR3&
FXWWLQJWKHWDSH
GDWH
GHIDXOWQXPEHURIFRSLHV
GHQVLW\
ILOHOLVW
IURP3&
LPSURYLQJSULQWTXDOLW\
PXOWLSOHFRSLHV
1XPEHURIFRSLHVRSWLRQ
3DXVHEHWZHHQODEHOVRSWLRQ
SDXVLQJEHWZHHQODEHOV
WLPH
R
5HSHDWNH\
UHVLGHQWPHPRU\
FKHFNLQJDYDLODEOHVSDFH
FRS\LQJILOHV
GHOHWLQJILOHV
SULQWLQJILOHOLVW
UHWULHYLQJILOHV
5HYHUVHFRORU
UHYHUVHGWH[W
ULEERQ
DGGLQJFRORUVRQ3&
FKDQJLQJFRORUQDPHV
I-8
Index
FKHFNLQJFRORU
FKHFNLQJZLGWK
FXVWRP
GHIDXOWRQ3&
LQFRPSDWLEOHZLWKWDSH
LQVHUWLQJ
PHPRU\FHOOIODJ
PRQRFKURPH
QRWLQVWDOOHGDWVWDUWXS
SDQHOHG
SULQWGULYHUWDE
UHPRYLQJ
VHOHFWLQJW\SH
XQNQRZQFRORUV
XVLQJPXOWLSOHFRORUV
XVLQJVLQJOHFRORU
ZLSHU
ULEERQFDUWULGJHFDVH
LQVHUWLQJ
UHPRYLQJ
5LEERQFRORUQDPHVRSWLRQ
5LEERQFRORURSWLRQ
5LEERQZLGWKRSWLRQ
5LEERQZLQGRZ
URWDWLQJWH[W
S
VDPSOHDUHD
6DYHRSWLRQ
VDYLQJODEHOV
ILOHQDPHV
6HFRQGVRSWLRQ
VHOHFWLRQZLQGRZ
DUURZNH\V
FORVLQJ
HQWHULQJYDOXHV
KHOSOLQH
VDPSOHDUHD
6HTXHQFHNH\
VHTXHQFHPDUNHU
6HTXHQFHZLQGRZ
VHTXHQFHV
&KDQJHE\RSWLRQ
(QGLQJSRLQWRSWLRQ
1XPEHURIODEHOVRSWLRQ
6WDUWLQJSRLQWRSWLRQ
6HWGDWHRSWLRQ
6HW'DWHZLQGRZ
6HWWLPHRSWLRQ
6HW7LPHZLQGRZ
6HWXSNH\
6HWXSRSWLRQV
UHVWRULQJGHIDXOWVHWWLQJV
6HWXSZLQGRZ
VKDSH
ODEHOIUDPHV
6LJQVDSSOLFDWLRQ
VRIWZDUH
XSGDWLQJ
YHUVLRQ
VSHFLDOEDUFRGHFKDUDFWHUPDUNHU
VSHFLDOFKDUDFWHUV
VSHFLDOW\DSSOLFDWLRQV
RSHQLQJ
VSLQQHU
VWDQGDUGOD\RXWV
&RQGHQVHWRILWRSWLRQ
HQWHULQJWH[W
ODEHOOHQJWK
ODEHORSWLRQV
OHQJWK
0DNH&KDQJHZLQGRZ
0LUURURSWLRQ
VHOHFWLQJ
W\SHVL]H
6WDUW6WRSLQ+5WH[WRSWLRQ
6WDUWLQJSRLQWRSWLRQ
VWDWXV
YLHZLQJRQ3&
6WDWXVNH\
6WDWXVZLQGRZ
VXEVFULSW
VXEVWLWXWLQJULEERQV
VXSHUVFULSW
VXSSOLHV
FKDQJLQJ
LQVWDOOLQJ
VWRUDJHDQGKDQGOLQJ
6ZDSSLQJULERQV
V\PEROPDUNHU
6\PERORSWLRQ
6\PERO5HIHUHQFH
6\PEROZLQGRZ
V\PERORJ\EDUFRGH
6\PERORJ\RSWLRQ
V\PEROV
DGGLQJ
FRORU
GHOHWLQJ
([SDQG&RQGHQVHRSWLRQ
LQSUHYLHZDUHD
LWDOLFV
PXOWLSDUW
V\VWHPGHIDXOWV
T
7DENH\
XVLQJLQQDYLJDWLRQDUHD
WDSH
DGYDQFLQJ
FKDQJLQJFRORUQDPHV
FKHFNLQJFRORU
FKHFNLQJWDSHUHPDLQLQJ
FKHFNLQJW\SH
FKHFNLQJZLGWK
FXVWRP
FXWWLQJ
GHIDXOWZLGWKRQ3&
LQFRPSDWLEOHZLWKULEERQ
LQVHUWLQJ
PHPRU\FHOOIODJ
QRWLQVWDOOHGDWVWDUWXS
SUHYHQWLQJMDPV
SULQWGULYHUWDE
UHPRYLQJ
XQNQRZQFRORU
ZLGWK
ZLSHU
7DSHFRORUQDPHVRSWLRQ
7DSHFRORURSWLRQ
7DSHUHPDLQLQJRSWLRQ
7DSHW\SHRSWLRQ
7DSHZLGWKRSWLRQ
7DSHZLQGRZ
WH[W
DFFHQWHGFKDUDFWHUV
EDFNJURXQGFRORU
EDUFRGHV
FHQWHULQJ
FKDQJLQJVL]H
Index
I-9
FKDUDFWHUSRVLWLRQ
FOHDULQJ
FRORU
FRQGHQVLQJ
GDWH
GHIDXOWIRQW
GHIDXOWVL]H
GHOHWLQJ
GLUHFWLRQ
HQWHULQJLQVWDQGDUGOD\RXWV
HQWHULQJWRRPDQ\OLQHV
H[SDQGLQJ
ILWWLQJRQODEHO
LQVHUWLQJ
LWDOLFV
MXVWLI\LQJ
OLQHVSDFLQJ
PLUURULPDJH
RYHUW\SLQJ
SRVLWLRQ
UHYHUVHG
URWDWLQJ
VHOHFWLQJIRQW
VHOHFWLQJRSWLRQV
VHWWLQJEDVHOLQH
VXEVFULSW
VXSHUVFULSW
WLPH
W\SHVL]HXQLWV
W\SLQJDOOFDSLWDOOHWWHUV
W\SLQJVSHFLDOFKDUDFWHUV
XQGHUOLQLQJ
YHUWLFDO
WH[WEXIIHU
FOHDULQJ
PRYLQJEHWZHHQODEHOV
7H[WGLUHFWLRQRSWLRQ
WH[WHQWU\DUHD
PDUNHUV
7H[WSRVLWLRQRSWLRQ
WKHUPDOSULQWHQHUJ\
DGMXVWLQJRQ3&
7LPHIRUPDWRSWLRQ
WLPHRQODEHOV
$030RSWLRQ
IRUPDW
+RXUVRSWLRQ
0LQXWHVRSWLRQ
I-10
Index
3ULQWRSWLRQ
6HFRQGVRSWLRQ
VHWWLQJ
7LPHIRUPDWRSWLRQ
WUDLOHU
VHOHFWLQJGHIDXOWOHQJWK
W\SHRSWLRQV
FKDQJHPDUNHU
7\SH2SWLRQVNH\
7\SH2SWLRQVZLQGRZ
W\SHVL]H
EDUFRGHV
FDSLWDOOHWWHUVRQO\
FKDQJHPDUNHU
FKDQJLQJ
LQEDUFRGHV
LQVWDQGDUGOD\RXWV
VHWWLQJEDVHOLQH
VHWWLQJGHIDXOW
XQLWV
YDOLGYDOXHV
7\SH6L]HNH\
7\SHVL]HRSWLRQ
7\SHVL]HXQLWVRSWLRQ
7\SH6L]HZLQGRZ
W\SHVW\OH
VHOHFWLQJ
U
8QGHUOLQHRSWLRQ
8QNQRZQ5LEERQ&RORUVZLQGRZ
8QNQRZQ7DSH&RORUVZLQGRZ
XQSDFNLQJ
8SJUDGHRSWLRQ
XSSHUFDVHOHWWHUV
8VLQJVSHFLDOW\DSSOLFDWLRQV
V
9HUWLFDOSULQWRSWLRQ
W
ZLGWK
ULEERQ
WDSH
ZLSHU
UHSODFLQJSDGV
ULEERQ
WDSH
Y
<HDURSWLRQ
Index
I-11
I-12
Index
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertisement