Bowflex | TC100 | Owner's Manual | Bowflex TC100 Owner's manual

Bowflex TC100 Owner's manual
TC100
ASSEMBLY / OWNER’S MANUAL
Manual en Español
Latino Americano:
www.support.nautilus.com
Welcome to the Bowflex® TreadClimber® cardio machine!
You’re about to experience an incredible workout that can help you lose weight and reshape your entire body so you’ll look and feel better than ever
EHIRUH:HWKDQN\RXIRUWUXVWLQJLQWKH%RZÀH[EUDQG:H¶UHVRFRQ¿GHQWLQ\RXUSXUFKDVHWKDWZHJXDUDQWHHUHVXOWV,I\RXGRQ¶WVHHUHVXOWVLQWKH
¿UVWVL[ZHHNV\RXFDQJHW\RXUPRQH\EDFN OHVVVKLSSLQJDQGKDQGOLQJ ±JXDUDQWHHG VHH³%X\%DFN*XDUDQWHH´ 8VHWKLV0DQXDODVDJXLGHWRJHWWLQJVWDUWHGRQ\RXU7UHDG&OLPEHU™ workouts and for tips to keep your machine well maintained.
<RXUVLQ+HDOWK
7KH%RZÀH[)DPLO\
Table of Contents
Important Safety Instructions ................................. 3
Safety Warning Labels and Serial Number............. 6
Grounding Instructions ........................................... 7
Emergency Stop Procedure ................................... 7
6SHFL¿FDWLRQV%HIRUH$VVHPEO\ ........................... 8
Parts ...................................................................... 9
+DUGZDUH7RROV.................................................. 10
$VVHPEO\ ..............................................................11
Moving Your Machine ........................................... 24
Leveling Your Machine ......................................... 24
Features ............................................................... 25
)LWQHVV%DVLFV ...................................................... 32
Operations ............................................................ 39
%HIRUH<RX6WDUW .................................................. 39
3RZHU8S,GOH0RGH .......................................... 39
Initial Setup .......................................................... 40
8VHU3UR¿OHV ........................................................ 40
Workout Program ................................................ 41
Fitness Score Display ........................................... 41
Pausing or Stopping ............................................ 43
$ZDUGV................................................................. 43
:RUNRXW&RPSOHWH5HVXOWV ................................ 43
Machine Settings Mode ....................................... 44
Maintenance ......................................................... 45
:DONLQJ%HOW$OLJQPHQW ......................................... 47
7URXEOHVKRRWLQJ .................................................... 50
%RG\:HLJKW/RVV*XLGH ...................................... 52
%X\%DFN*XDUDQWHH ............................................ 62
Warranty ............................................................... 63
To validate warranty support, keep the original proof of purchase and record the following information:
Serial Number __________________________ Date of Purchase ____________________
7RUHJLVWHU\RXUSURGXFWZDUUDQW\JRWRZZZERZÁH[FRPUHJLVWHU
2UFDOO ±
,I\RXKDYHTXHVWLRQVRUSUREOHPVZLWK\RXUSURGXFWSOHDVHFDOO ±
1DXWLOXV,QF ZZZ1DXWLOXV,QFFRP&XVWRPHU6HUYLFH1RUWK$PHULFD FVQOV#QDXWLOXVFRP_RXWVLGH86
ZZZQDXWLOXVLQWHUQDWLRQDOFRP_3ULQWHGLQ&KLQD_‹1DXWLOXV,QF_ŠLQGLFDWHVWUDGHPDUNVUHJLVWHUHGLQWKH8QLWHG6WDWHV7KHVHPDUNVPD\EHUHJLVWHUHGLQ
RWKHUQDWLRQVRURWKHUZLVHSURWHFWHGE\FRPPRQODZ%RZÀH[WKH%ORJR7UHDG&OLPEHU%RZÀH[%RG\(DV\6WHS%RZÀH[7UDLQHU1DXWLOXV6FKZLQQDQG8QLYHUVDO
DUHWUDGHPDUNVRZQHGE\RUOLFHQVHGWR1DXWLOXV,QF0\)LWQHVV3DOŠ:'Š/XEH1:DONŠDQG1XW7KLQVŠ are trademarks of their respective owners.
2
Assembly / Owner’s Manual
Important Safety Instructions
When using an electrical appliance, basic precautions should always be followed, including the following:
This icon means a potentially hazardous situation which, if not avoided, could result in death or serious injury.
Obey the following warnings:
Read and understand all Warnings on this machine.
&DUHIXOO\UHDGDQGXQGHUVWDQGWKH$VVHPEO\2ZQHU·V0DQXDO
&DUHIXOO\UHDGDQGXQGHUVWDQGWKH$VVHPEO\LQVWUXFWLRQV5HDGDQGXQGHUVWDQGWKHFRPSOHWH0DQXDO.HHSWKH0DQXDO
for future reference.
To reduce the risk of electrical shock or unsupervised usage of the equipment, always unplug this machine from the
electrical outlet immediately after using and before cleaning.
7RGHFUHDVHWKHULVNRIEXUQVHOHFWULFVKRFNRULQMXU\WRSHUVRQVUHDGDQGXQGHUVWDQGWKHFRPSOHWH$VVHPEO\2ZQHU·V
0DQXDO)DLOXUHWRIROORZWKHVHJXLGHOLQHVFDQFDXVHDVHULRXVRUSRVVLEO\IDWDOHOHFWULFDOVKRFNRURWKHUVHULRXVLQMXU\
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
•
Keep bystanders and children away from the product you are assembling at all times.
Do not connect power supply to the machine until instructed to do so.
7KHPDFKLQHVKRXOGQHYHUEHOHIWXQDWWHQGHGZKHQSOXJJHGLQ8QSOXJIURPRXWOHWZKHQQRWLQXVHDQGEHIRUHSXWWLQJRQRUWDNLQJRIISDUWV
%HIRUHHDFKXVHH[DPLQHWKHPDFKLQHIRUGDPDJHWRSRZHUFRUGORRVHSDUWVRUVLJQVRIZHDU'RQRWXVHLIIRXQGLQWKLVFRQGLWLRQ&RQWDFW
Nautilus Customer Service for repair information.
Not intended for use by persons with medical conditions where those conditions may impact the safe operation of the machine or pose a risk of
injury to the user.
Do not drop or put objects into any opening of the machine.
1HYHURSHUDWHWKLVPDFKLQHZLWKWKHDLURSHQLQJVEORFNHG.HHSWKHDLURSHQLQJVIUHHRIOLQWKDLUDQGWKHOLNH
Do not assemble this machine outdoors or in a wet or moist location.
Make sure assembly is done in an appropriate work space away from foot traffic and exposure to bystanders.
Some components of the machine can be heavy or awkward. Use a second person when doing the assembly steps involving these parts. Do not
do steps that involve heavy lifting or awkward movements on your own.
6HWXSWKLVPDFKLQHRQDVROLGOHYHOKRUL]RQWDOVXUIDFH
'RQRWWU\WRFKDQJHWKHGHVLJQRUIXQFWLRQDOLW\RIWKLVPDFKLQH7KLVFRXOGFRPSURPLVHWKHVDIHW\RIWKLVPDFKLQHDQGZLOOYRLGWKHZDUUDQW\
,IUHSODFHPHQWSDUWVDUHQHFHVVDU\XVHRQO\JHQXLQHUHSODFHPHQWSDUWVDQGKDUGZDUHVXSSOLHGE\1DXWLOXV)DLOXUHWRXVHJHQXLQHUHSODFHPHQW
SDUWVFDQFDXVHDULVNWRXVHUVNHHSWKHPDFKLQHIURPRSHUDWLQJFRUUHFWO\DQGYRLGWKHZDUUDQW\
Do not use until the machine has been fully assembled and inspected for correct performance in accordance with the Owner’s Manual.
Do all assembly steps in the sequence given. Incorrect assembly can lead to injury or malfunctioning of the machine.
&RQQHFWWKLVPDFKLQHWRDSURSHUO\JURXQGHGRXWOHWRQO\ VHH*URXQGLQJ,QVWUXFWLRQV Keep the power cord away from heat sources and hot surfaces.
Do not operate where aerosol products are being used.
7RGLVFRQQHFWWXUQDOOFRQWUROVWRWKHRIISRVLWLRQWKHQUHPRYHSOXJIURPRXWOHW
7KLVSURGXFWFRQWDLQVPDJQHWV0DJQHWLFILHOGVFDQLQWHUIHUHZLWKWKHQRUPDOXVHRIFHUWDLQPHGLFDOGHYLFHVDWDFORVHUDQJH8VHUVPD\FRPH
LQWRSUR[LPLW\RIWKHPDJQHWVLQWKHDVVHPEO\PDLQWHQDQFHDQGRUXVHRIWKHSURGXFW*LYHQWKHREYLRXVLPSRUWDQFHRIWKHVHGHYLFHVVXFKDV
DSDFHPDNHULWLVLPSRUWDQWWKDW\RXFRQVXOWZLWK\RXUPHGLFDOSURYLGHULQFRQQHFWLRQZLWKWKHXVHRIWKLVHTXLSPHQW3OHDVHFRQVXOWWKH³6DIHW\
:DUQLQJ/DEHOVDQG6HULDO1XPEHU´VHFWLRQWRGHWHUPLQHWKHORFDWLRQRIWKHPDJQHWVRQWKLVSURGXFW
6$9(7+(6(,16758&7,216
3
Assembly / Owner’s Manual
Before using this equipment, obey the following warnings:
5HDGDQGXQGHUVWDQGWKHFRPSOHWH2ZQHU V0DQXDO.HHSWKH2ZQHU·V0DQXDOIRUIXWXUHUHIHUHQFH
Important Safety Instructions
Read and understand all Warnings on this machine. If at any time the Warning stickers become loose, unreadable or dislodged,
contact Nautilus Customer Service for replacement stickers.
To reduce the risk of electrical shock or unsupervised usage of the equipment, always unplug the power cord from the
ZDOORXWOHWDQGRUWKHPDFKLQHDQGZDLWPLQXWHVEHIRUHFOHDQLQJPDLQWDLQLQJRUUHSDLULQJWKHPDFKLQH3ODFHWKH
power cord in a secure location.
• Children must not be let on or near to this machine. Moving parts and other features of the machine can be dangerous to children.
• Not intended for use by anyone under 14 years of age.
• &RQVXOWDSK\VLFLDQEHIRUH\RXVWDUWDQH[HUFLVHSURJUDP6WRSH[HUFLVLQJLI\RXIHHOSDLQRUWLJKWQHVVLQ\RXUFKHVWEHFRPHVKRUWRIEUHDWKRU
feel faint. Contact your doctor before you use the machine again. Use the values calculated or measured by the machine’s computer for reference
purposes only.
• %HIRUHHDFKXVHH[DPLQHWKLVPDFKLQHIRUGDPDJHWRSRZHUFRUGSRZHUUHFHSWDFOHORRVHSDUWVRUVLJQVRIZHDU'RQRWXVHLIIRXQGLQWKLV
condition. Contact Nautilus Customer Service for repair information.
• $OZD\VFRQQHFWWKHSRZHUFRUGWRDFLUFXLWFDSDEOHRIKDQGOLQJDPSHUHVZLWKQRRWKHUORDGVDSSOLHG
• Connect this machine to a correctly grounded outlet; consult a licensed electrician for assistance.
• 'RQRWOHWOLTXLGVWRXFKWKHHOHFWURQLFFRQWUROOHU,ILWGRHVWKHFRQWUROOHUPXVWEHLQVSHFWHGDQGWHVWHGIRUVDIHW\E\DQDSSURYHGWHFKQLFLDQEHIRUH
it can be used again.
• 7KHHOHFWULFDOZLULQJIRUWKHUHVLGHQFHLQZKLFKWKHPDFKLQHZLOOEHXVHGPXVWREH\WKHDSSOLFDEOHORFDODQGSURYLQFLDOUHTXLUHPHQWV
• 0D[LPXPXVHUZHLJKWOLPLWOEV NJ 'RQRWXVHLI\RXDUHRYHUWKLVZHLJKW
• 7KLVPDFKLQHLVIRUKRPHXVHRQO\
• 'RQRWZHDUORRVHFORWKLQJRUMHZHOU\7KLVPDFKLQHFRQWDLQVPRYLQJSDUWV'RQRWSXWILQJHUVIHHWRURWKHUREMHFWVLQWRPRYLQJSDUWVRIWKH
exercise equipment.
• $OZD\VZHDUUXEEHUVROHGDWKOHWLFVKRHVZKHQ\RXXVHWKLVPDFKLQH'RQRWXVHWKHPDFKLQHZLWKEDUHIHHWRURQO\ZHDULQJVRFNV
• %HFDXVHRIKRZWKH7UHDGOHVDQG:DONLQJ%HOWVRSHUDWHLWLVSRVVLEOHIRUH[WUHPHO\OLJKWZHLJKWIOH[LEOHVKRHVRUPLQLPDOLVWVKRHVWREHFDXJKW
2QO\ZHDUDWKOHWLFVKRHVWKDWKDYHPRUHWRHSURWHFWLRQVWUXFWXUHDQGVXSSRUW/LJKWZHLJKWRUPLQLPDOLVWVKRHVVKRXOGQRWEHZRUQ
• 6HWXSDQGRSHUDWHWKLVPDFKLQHRQDVROLGOHYHOKRUL]RQWDOVXUIDFH
• Use caution when you step on and off the machine. Use the supplied foot support platforms for stability before walking on the moving belt.
• 7KHQRUPDOGHVLJQDQGRSHUDWLRQRIWKLVPDFKLQHDOORZVIRUWKHWUHDGOHVWRPRYHLQGHSHQGHQWO\RIHDFKRWKHUZKHQDSHUVRQVWHSVRQRUH[HUWV
IRUFHRUSUHVVXUHRQWKHWUHDGOHV%HDZDUHWKDWWUHDGOHPRYHPHQWFDQRFFXUZKHQWKHPDFKLQHLVXQSOXJJHGRUWKHVDIHW\NH\UHPRYHG$OZD\V
WDNHFDUHWRLQVXUHWKDWILQJHUVGRQRWJHWFDXJKWEHWZHHQWKHWUHDGOHVDQGWRSUHYHQWLQMXU\QHYHUDOORZFKLOGUHQRUSHWVDURXQGWKHPDFKLQH
• Do not operate this machine outdoors or in moist or wet locations.
• .HHSDWOHDVW´ P RQHDFKVLGHRIWKHPDFKLQHDQG´ P EHKLQGWKHPDFKLQHFOHDU7KLVLVWKHUHFRPPHQGHGVDIHGLVWDQFHIRU
access and passage around and emergency dismounts from the machine. Keep third parties out of this space when machine is in use.
• Do not over exert yourself during exercise. Operate the machine in the manner described in this manual.
• Perform all regular and periodic maintenance procedures recommended in the Owner’s Manual.
• 5HDGXQGHUVWDQGDQGWHVWWKH(PHUJHQF\6WRS3URFHGXUHEHIRUHXVH
• Keep the walking belt clean and dry.
• Do not drop or put objects into any opening of the machine.
• 7KLVPDFKLQHLVGHVLJQHGIRUZDONLQJ'RQRWWU\WRUXQRQWKLVPDFKLQH
• Keep your hands on the support Handlebars and stay as near the front of the machine as is comfortable in order to stay in balance on the
7UHDGOHV
• .HHS\RXUIRRWLQWKHFHQWHURIHDFK7UHDGOHGRQRWOHW\RXUIHHWFURVVLQIURQWRI\RXUERG\DV\RXLQFUHDVHWKHVSHHG
4
Assembly / Owner’s Manual
• 7KHHOHFWULFDOZLULQJIRUWKHUHVLGHQFHLQZKLFKWKHPDFKLQHZLOOEHXVHGPXVWREH\WKHDSSOLFDEOHORFDODQGSURYLQFLDOUHTXLUHPHQWV
• ([HUFLVHRQWKLVPDFKLQHUHTXLUHVFRRUGLQDWLRQDQGEDODQFH%HVXUHWRDQWLFLSDWHWKDWFKDQJHVLQVSHHGWKHDQJOHRI:DONLQJ'HFNVDQG
UHVLVWDQFHOHYHOFDQRFFXUGXULQJZRUNRXWVDQGEHDWWHQWLYHLQRUGHUWRDYRLGORVVRIEDODQFHDQGSRVVLEOHLQMXU\
• $PDFKLQHVKRXOGQHYHUEHOHIWXQDWWHQGHGZKHQSOXJJHGLQ8QSOXJIURPRXWOHWZKHQQRWLQXVHDQGEHIRUHSXWWLQJRQRUWDNLQJRIISDUWV
• Use this machine only for its intended use as described in this manual. Do not use attachments not recommended by the manufacturer.
• 7KLVDSSOLDQFHLVQRWLQWHQGHGIRUXVHE\SHUVRQVZLWKUHGXFHGSK\VLFDOVHQVRU\RUPHQWDOFDSDELOLWLHVRUODFNRINQRZOHGJHXQOHVVWKH\KDYH
been given supervision or instruction concerning use of the appliance by a person responsible for their safety. Keep children under the age of 14
away from this machine.
5
Assembly / Owner’s Manual
Safety Warning Labels and Serial Number
CAUTION
5LVNRI,QMXU\WR3HUVRQV7R$YRLGLQMXU\XVHH[WUHPHFDXWLRQ
ZKHQVWHSSLQJRQWRRURIIRIDPRYLQJEHOW5HDGLQVWUXFWLRQ
manual before using.
WARNING!
‡3ULRUWRXVHUHDGDQGXQGHUVWDQGWKH2ZQHU¶V0DQXDOLQFOXGLQJ
all Warnings.
• Inspect product before use. Do not use if any parts are in need
of repair.
• Keep children and pets away from this machine at all times.
• Not intended for use by anyone under 14 years of age.
‡7KLVPDFKLQHLVIRUKRPHXVHRQO\
• Use caution when you use this equipment or serious injury can
occur.
‡7RSUHYHQWLQMXU\VWDQGRQWKH)RRW3ODWIRUPVEHIRUH\RXVWDUW
the machine.
‡7KHPD[LPXPXVHUZHLJKWIRUWKLVPDFKLQHLVNJ OE ‡5HSODFHDQ\³&DXWLRQ´³:DUQLQJ´RU³'DQJHU´ODEHOWKDWLV
LOOHJLEOHGDPDJHGRUUHPRYHG
‡7KHKHDUWUDWHGLVSOD\HGRQWKHFRQVROHLVDQDSSUR[LPDWLRQDQG
should be used for reference only.
‡:KHQWKLVPDFKLQHLVQRWLQRSHUDWLRQUHPRYHWKH6DIHW\.H\
and keep out of the reach of children.
CAUTION
Unplug power cord before you move
the machine.
* Safety Key
Port
WARNING!
+$=$5'28692/7$*(
Contact may cause electrical shock or burn.
7XUQRIIDQGORFNRXWSRZHUEHIRUHVHUYLFLQJ
XQGHU5HDU6WHS
WARNING!
0RYLQJSDUWVFDQFUXVKDQGFXW
.HHSJXDUGVLQSODFH
/RFNRXWSRZHUEHIRUHVHUYLFLQJ
XQGHU5HDU6WHS
* under Motor Cover
Serial Number
3URGXFW6SHFL¿FDWLRQ
WARNING!
.HHSKDQGVDQGIHHWDZD\
RQLQVLGHRI7UHDGOHV
6
Assembly / Owner’s Manual
Grounding Instructions
7KLVSURGXFWPXVWEHHOHFWULFDOO\JURXQGHG,IDPDOIXQFWLRQRFFXUVFRUUHFWJURXQGLQJGHFUHDVHVWKHULVNRIHOHFWULFVKRFN7KHSRZHUFRUGLV
HTXLSSHGZLWKDQHTXLSPHQWJURXQGLQJFRQGXFWRUDQGPXVWEHFRQQHFWHGWRDQRXWOHWWKDWLVSURSHUO\LQVWDOOHGDQGJURXQGHG
The electrical wiring must comply with all applicable local and provincial standards and requirements. Incorrect
connection of the equipment-grounding conductor can result in a risk of electric shock. Consult a licensed electrician if
\RXDUHQRWVXUHWKDWWKHPDFKLQHLVFRUUHFWO\JURXQGHG'RQRWFKDQJHWKHSOXJRQWKHPDFKLQH²LILWGRHVQRWÀWWKH
outlet, have a correct outlet installed by a licensed electrician.
,I\RXFRQQHFWWKHPDFKLQHWRDQRXWOHWZLWK*), JURXQGIDXOWLQWHUUXSW RU$)&, DUFIDXOWFLUFXLWLQWHUUXSW PDFKLQHRSHUDWLRQFDQFDXVHWKHFLUFXLWWR
trip.
,IDQH[WHQVLRQFRUGRUVXUJHSURWHFWRULVXVHGZLWKWKLVPDFKLQHPDNHVXUHWKDWLWLVDKHDY\GXW\PRGHOUDWHGDW$RSHUDWLRQ
DQGDFFHSWVDQHTXLSPHQWJURXQGLQJFRQGXFWRU'RQRWFRQQHFWRWKHUDSSOLDQFHVRUGHYLFHVWRWKHH[WHQVLRQFRUGRUVXUJH
protector in combination with this machine.
7KLVPDFKLQHLVIRUXVHRQDQRPLQDO9FLUFXLWDQGKDVDJURXQGLQJSOXJWKDWORRNVOLNHWKHSOXJLOOXVWUDWHGEHORZ0DNHVXUH
WKDWWKHSURGXFWLVFRQQHFWHGWRDQRXWOHWKDYLQJWKHVDPHFRQÀJXUDWLRQDVWKHSOXJ1RDGDSWHUVKRXOGEHXVHGZLWKWKLVSURGXFW
Grounded
Outlet
Grounded
2XWOHW%R[
Grounding Pin
Emergency Stop Procedure ( Safety Key Port )
7KH7UHDG&OLPEHUŠPDFKLQHLVHTXLSSHGZLWKD6DIHW\.H\WKDWFDQSUHYHQWVHULRXVLQMXU\XQVXSHUYLVHGRSHUDWLRQDVZHOODVSUHYHQWFKLOGUHQIURP
SOD\LQJZLWKDQGRUEHLQJLQMXUHGRQWKHPDFKLQH,IWKH6DIHW\.H\LVUHPRYHGRUQRWFRUUHFWO\LQVHUWHGLQWRWKH6DIHW\.H\3RUWWKHEHOWVZLOOQRW
operate.
$OZD\VDWWDFKWKH6DIHW\.H\&OLSWR\RXUFORWKLQJGXULQJ\RXU
workout.
:KHQ\RXXVHWKHPDFKLQHRQO\UHPRYHWKH6DIHW\.H\LQDQ
emergency. When the key is removed while the machine is in
operation, it will stop quickly, which could cause the loss of
balance and possible injury.
)RUVDIHVWRUDJHRIWKHPDFKLQHDQGWRSUHYHQWXQVXSHUYLVHG
RSHUDWLRQRIWKHPDFKLQHDOZD\VUHPRYHWKH6DIHW\.H\DQG
disconnect the power cord from the wall outlet and machine AC
input. Place the power cord in a secure location.
7KH&RQVROHZLOOGLVSOD\³,16(576$)(7<.(<´ZKHQWKH6DIHW\.H\LVQRW
DWWDFKHG7KH7UHDG&OLPEHUŠ machine will end a workout program when the
Safety Key is removed.
7
Assembly / Owner’s Manual
Specifications / Before Assembly
Maximum User Weight:
OEV NJV
Power Requirements:
2SHUDWLRQDO9ROWDJH
2SHUDWLQJ&XUUHQW 9$&+]
$PD[
Regulatory Approvals:
cULus mark. Evaluated per UL1647 Fifth Edition and
&$1&6$&1R
59”
(149.9 cm)
Maximum Inclined Treadle Height:LQFKHV FP
Assembled Weight:
57” (144.8 cm)
DSSUR[OEV NJ
31.5” (80 cm)
Before Assembly
6HOHFWWKHDUHDZKHUH\RXDUHJRLQJWRVHWXSDQGRSHUDWH\RXUPDFKLQH)RUVDIHRSHUDWLRQWKHORFDWLRQPXVWEHRQDKDUGOHYHOVXUIDFH$OORZD
PLQLPXPZRUNRXWDUHDRI´[´ FP[FP %HVXUHWKDWWKHZRUNRXWVSDFH\RXDUHXWLOL]LQJKDVDGHTXDWHKHLJKWFOHDUDQFHWDNLQJ
into consideration the height of the user and the maximum inclined height of the treadles.
Basic Assembly
)ROORZWKHVHEDVLFSRLQWVZKHQ\RXDVVHPEOH\RXUPDFKLQH
• 5HDGDQGXQGHUVWDQGWKH³,PSRUWDQW6DIHW\,QVWUXFWLRQV´EHIRUHDVVHPEO\
• Collect all the pieces necessary for each assembly step.
• 8VLQJWKHUHFRPPHQGHGZUHQFKHVWXUQWKHEROWVDQGQXWVWRWKHULJKW FORFNZLVH WRWLJKWHQDQGWKHOHIW FRXQWHUFORFNZLVH WRORRVHQXQOHVV
instructed otherwise.
• :KHQDWWDFKLQJSLHFHVOLJKWO\OLIWDQGORRNWKURXJKWKHEROWKROHVWRKHOSLQVHUWWKHEROWWKURXJKWKHKROHV
• 7KHDVVHPEO\UHTXLUHVSHRSOH
• Do not use any power tools for assembly.
Note: 7KH7UHDG&OLPEHUŠ¿WQHVVPDFKLQHLVGHVLJQHGWRSOXJLQWRDJURXQGHGQRQ*),QRQ$)&,RXWOHWRQO\7RGHWHUPLQHLI\RXURXWOHWRU
FLUFXLWEUHDNHULV*),$)&,ORRNIRUDWHVWDQGUHVHWEXWWRQRQWKHP,IWKH\KDYHWKHWHVWDQGUHVHWEXWWRQLWLVD*),$)&,RXWOHWRU
circuit breaker.
Machine Mat
7KH%RZÀH[™7UHDG&OLPEHU™ Machine Mat is an optional accessory that helps keep your workout area clear and adds a layer of protection to
\RXUÀRRU7KHUXEEHUPDFKLQHPDWSURYLGHVDQRQVOLSUXEEHUVXUIDFHZKLFKOLPLWVVWDWLFGLVFKDUJHDQGUHGXFHVWKHSRVVLELOLW\RIGLVSOD\HUURUV,I
SRVVLEOHSXW\RXU%RZÀH[™7UHDG&OLPEHU™ Machine Mat in your selected workout area before you begin assembly.
7RRUGHUWKHRSWLRQDOPDFKLQHPDWJRWRZZZERZÀH[FRPRUFDOO ±
8
Assembly / Owner’s Manual
Parts
( 2 BOXES )
BOX 1
1
2
15
3
14
13
9
10
5
4
8
12
11
6
7
Item
Qty
1
1
2
Description
Item
Qty
Description
&RQVROH$VVHPEO\
9
1
Hardware Card
1
8SULJKW/HIW
10
2
Shock
3
1
Power Cord
11
1
Safety Key
4
1
5HDU&RYHU
12
1
8SULJKW5LJKW
5
1
5HDU6WHS
13
1
-XQFWLRQ&RYHU/HIW
6
1
6LGH0RWRU&RYHU5LJKW
14
1
-XQFWLRQ&RYHU5LJKW
7
1
6LGH0RWRU&RYHU/HIW
15
1
+DQGOHEDU$VVHPEO\
8
1
Document Kit
BOX 2
17
*
16
Item
Qty
Description
16
1
)RRW5DLO&RYHU/HIW
17
1
7UHDGOH$VVHPEO\ *
18
1
)RRW5DLO&RYHU5LJKW
18
DO NOT CUT the Shipping Strap on the Treadle
Assembly until instructed ( * ).
9
Assembly / Owner’s Manual
Hardware / Tools
A
B
C
D
Item
Qty
Description
$
12
E
F
G
H
I
Item
Qty
%XWWRQ+HDG+H[6FUHZ0[
G
4
J
K
L
Description
)ODW:DVKHU0%ODFN
%
14
/RFN:DVKHU0
H
10
)ODW:DVKHU0[%ODFN
C
14
)ODW:DVKHU0
I
10
3KLOOLSV6FUHZ0[%ODFN
D
2
%XWWRQ+HDG+H[6FUHZ0[
J
4
)ODW:DVKHU0:LGH%ODFN
E
8
%XWWRQ+HDG+H[6FUHZ0[%ODFN
K
2
Leveler
F
8
/RFN:DVKHU0%ODFN
L
6
3KLOOLSV6HOI7DSSLQJ6FUHZ0[%ODFN
Note:6HOHFWSLHFHVRI+DUGZDUHKDYHEHHQSURYLGHGDVVSDUHVRQWKH+DUGZDUH&DUG%HDZDUHWKDWWKHUHPD\EHUHPDLQLQJ+DUGZDUH
after the proper assembly of your machine.
Tools
Included
Not Included
5 mm
PP
#2
UHFRPPHQGHG
10
Assembly / Owner’s Manual
Assembly
Some components of the machine can be heavy or awkward. Use a second person when doing the assembly steps involving
these parts. Do not do steps that involve heavy lifting or awkward movements on your own.
Note:7KLVDVVHPEO\XVHVSDUWVRIWKHSDFNDJLQJ'RQRWGLVSRVHRIXQWLODVVHPEO\LVFRPSOHWH
&XWRSHQWKHHQGRI%R[DQGPRYHWKH7UHDGOH$VVHPEO\LQWR\RXUĆWQHVVDUHD
Note:'RQRWFULPSWKH,2&DEOH
&XWWKH6KLSSLQJ6WUDS * RQWKH7UHDGOH$VVHPEO\ZKHQLWKDVEHHQSODFHGIDFHXSLQWKHDSSURSULDWHZRUNVSDFH
17
*
11
Assembly / Owner’s Manual
2. Slide Packaging Boxes under the Base of the Treadle Assembly and the Treadles
Note: 8VHWKHSDFNDJLQJPDWHULDOVIRUWKLVVWHS7KH%DVHRIWKH7UHDGOH$VVHPEO\VKRXOGEHOHYHODQGWKH7UHDGOHVVKRXOGEHVHFXUHO\
raised.
%R[HVVKRXOGQRWEHLQIURQWRIWKHFURVVEDU
The Treadles do not have a locking mechanism and must be supported safely.
,QRUGHUWRDYRLGSRVVLEOHVHULRXVLQMXU\ZKHQVOLGLQJWKH3DFNDJLQJ%R[HVXQGHUWKH7UHDGOH$VVHPEO\EHFDUHIXOWRDYRLG
ÀQJHUVRUKDQGVEHLQJFDXJKWRUSLQFKHG
Be aware that the Drive Belt and the Walking Belts are connected and when either of these parts move the other does as well. In
order to avoid possible serious injury, do not allow anything to be caught or pinched by the Drive Belt when the Walking Belts are
moved.
12
Assembly / Owner’s Manual
3. Attach the Left Upright to the Right Upright
Note: Hand tighten hardware.
2
12
X4
C
B
A
13
Assembly / Owner’s Manual
4. Route the Lower I/O Cable through the Right Upright
Note: Do not crimp the Cable.
14
Assembly / Owner’s Manual
5. Attach the Upright Assembly to the Treadle Assembly
Note: Do not crimp the Cables.
The Treadles do not have a locking mechanism and must be supported safely.
,QRUGHUWRDYRLGSRVVLEOHVHULRXVLQMXU\ZKHQLQVHUWLQJWKHWXEHHQGVRQWRWKH7UHDGOH$VVHPEO\EHFDUHIXOWRDYRLGÀQJHUVRU
KDQGVEHLQJFDXJKWRUSLQFKHG%HVXUHWKHH[FHVVOHQJWKRIWKH,2&DEOHJRHVLQWRWKH8SULJKWDQGGRHVQRWJHWFULPSHG
X2
D
A
B
C
15
Assembly / Owner’s Manual
B
C
6. Route the Cables and Attach the Console Assembly to the Handlebar Assembly
Note:'RQRWFULPSWKH&DEOHV3ODFHDFOHDQWRZHORUEODQNHWXQGHUWKH&RQVROH$VVHPEO\WRSURWHFWLW
,QRUGHUWRDYRLGSRVVLEOHVHULRXVLQMXU\ZKHQLQVHUWLQJWKHWXEHHQGVLQWRWKH&RQVROH$VVHPEO\EHFDUHIXOWRDYRLGÀQJHUVRU
hands being caught or pinched.
5 mm
X4
E
F
G
1
15
16
Assembly / Owner’s Manual
7. Place the Junction Covers on the Uprights, Connect the Cables, and Attach the Console /
Handlebar Assembly
,QRUGHUWRDYRLGSRVVLEOHVHULRXVLQMXU\ZKHQLQVHUWLQJWKHWXEHHQGVRQWRWKH8SULJKWVEHFDUHIXOWRDYRLGÀQJHUVRUKDQGV
EHLQJFDXJKWRUSLQFKHG%HVXUHWKHH[FHVVOHQJWKRIWKH,2&DEOHJRHVLQWRWKH8SULJKWDQGGRHVQRWJHWFULPSHG
Note: Do not crimp the Cables.
+DQGWLJKWHQWKLVKDUGZDUH¿UVWXQWLOLQQHUEROWKROHVDOLJQ
*
13
14
*
X6
*
A
C
17
Assembly / Owner’s Manual
B
8. Attach the Foot Rail Covers to the Treadle Assembly
The Walking Belts can abruptly move. To avoid possible serious injury, keep hands away from the edges of the Walking Belts.
Be aware that the Drive Belt and the Walking Belts are connected and when either of these parts move the other does as well. In
order to avoid possible serious injury, do not allow anything to be caught or pinched by the Drive Belt when the Walking Belts are
moved.
16
18
X10
H
I
18
Assembly / Owner’s Manual
9. Attach the Shocks to Uprights and then Treadles
Note: 7KHVHWWLQJVGHFDORQWKH6KRFNVPXVWEHXSZLWKWKHDUURZVIDFLQJWRWKHUHDURIWKHPDFKLQH$WWDFKWR8SULJKWVEHIRUHWKH
7UHDGOHV)XOO\WLJKWHQALLKDUGZDUHIURPSUHYLRXVVWHSVDQGVDIHO\UHPRYH3DFNDJLQJ%R[HV
The Treadles do not have a locking mechanism and can move freely. Take care not to allow harm or injury to occur when lifting
the Treadles.
Be aware that the Drive Belt and the Walking Belts are connected and when either of these parts move the other does as well. In
order to avoid possible serious injury, do not allow anything to be caught or pinched by the Drive Belt when the Walking Belts are
moved.
10
10
X4
J
19
Assembly / Owner’s Manual
F
E
10. Attach the Rear Cover onto the Treadle Assembly
Note:+DUGZDUHLVSUHLQVWDOOHGDQGQRWRQWKH+DUGZDUH&DUG 4
X2
*
#2
*
20
Assembly / Owner’s Manual
11. Safely Tilt the Treadle Assembly and Attach the Side Motor Covers and Levelers
7KHPDFKLQHPD\EHPRYHGE\RQHRUPRUHSHUVRQVGHSHQGLQJRQWKHLUSK\VLFDODELOLWLHVDQGFDSDFLWLHV0DNHVXUHWKDW\RXDQG
RWKHUVDUHDOOSK\VLFDOO\ÀWDQGDEOHWRPRYHWKHPDFKLQHVDIHO\
Note:+DUGZDUHLVSUHLQVWDOOHGDQGQRWRQWKH+DUGZDUH&DUG
5HWXUQWKHPDFKLQHXSULJKWDQGUHSHDWRQRSSRVLWHVLGH
7
X2
K
6
21
Assembly / Owner’s Manual
12. Attach the Rear Step to the Treadle Assembly
5
X6
L
22
Assembly / Owner’s Manual
13. Connect Power Cord to Treadle Assembly
Note: 7KH7&7UHDG&OLPEHUŠ¿WQHVVPDFKLQHLVGHVLJQHGWRSOXJGLUHFWO\LQWRDSURSHUO\ZLUHGDQGJURXQGHGWKUHHSURQJ9RXWOHW
,I\RXFRQQHFWWKHPDFKLQHWRDQRXWOHWZLWK*), JURXQGIDXOWLQWHUUXSW RU$)&, DUFIDXOWFLUFXLWLQWHUUXSW PDFKLQHRSHUDWLRQFDQ
cause the circuit to trip.
3
14. Final Inspection
Inspect your machine to ensure that all fasteners are tight and components are properly assembled.
'RQRWXVHXQWLOWKHPDFKLQHKDVEHHQIXOO\DVVHPEOHGDQGLQVSHFWHGIRUFRUUHFWSHUIRUPDQFHLQDFFRUGDQFHZLWKWKH2ZQHU·V
0DQXDO
23
Assembly / Owner’s Manual
Adjustments
Moving Your Machine
7KH7UHDG&OLPEHUŠ¿WQHVVPDFKLQHZHLJKVDSSUR[LPDWHO\OEV NJ ZKHQIXOO\DVVHPEOHG
DQGUHTXLUHVFDXWLRQZKHQEHLQJPRYHG8VHWKH7UDQVSRUW+DQG%DUIRXQGXQGHUWKHIURQWRI
WKHPDFKLQHWRPRYHLW7RJHWDFFHVVWRWKH7UDQVSRUW+DQG%DUWXUQWKH/HYHOHUVXQWLO\RXKDYH
VXI¿FLHQWFOHDUDQFHEHWZHHQWKHPDFKLQHDQGÀRRU
Your machine can be rolled on the transport wheels to a new location. Lower your machine slowly into
LWVQHZORFDWLRQZLWKRXWLQMXU\WR\RXUKHDGRU¿QJHUV
Do not use the uprights, handlebars, or the Console to lift or move the machine. Injury
to you or damage to the machine can occur.
The machine may be moved by one or more persons depending on their physical
DELOLWLHVDQGFDSDFLWLHV0DNHVXUHWKDW\RXDQGRWKHUVDUHDOOSK\VLFDOO\ÀWDQGDEOHWR
move the machine safely.
Place the machine on a clean, hard, level surface, free from unwanted material or other
objects that may hamper your ability to move freely. A rubber mat should be used below
WKHPDFKLQHWRSUHYHQWWKHUHOHDVHRIVWDWLFHOHFWULFLW\DQGSURWHFW\RXUÁRRULQJ
)RUVDIHVWRUDJHRIWKHPDFKLQHDQGWRSUHYHQWXQVXSHUYLVHGRSHUDWLRQRIWKHPDFKLQHDOZD\VUHPRYHWKH6DIHW\.H\DQG
disconnect the power cord from the wall outlet and the AC input. Place the power cord in a secure location
Leveling Your Machine
/HYHOHUVDUHIRXQGRQWKHIURQWRIWKH7UHDG&OLPEHUŠPDFKLQH0DNHVXUHWKH7UHDG&OLPEHUŠPDFKLQHLVOHYHODQGVWDEOHEHIRUH\RXH[HUFLVH7R
DGMXVW
1. Loosen the upper locking nut.
7XUQWKHOHYHOHUWRDGMXVWWKHKHLJKW
7LJKWHQWKHXSSHUORFNLQJQXWWRORFNWKHOHYHOHU
Do not adjust the levelers to such a height that they
detach or unscrew from the machine. Injury to you or
damage to the machine can occur.
13 mm
24
Assembly / Owner’s Manual
Features
Safety Key Port
86%3RUW
0HGLD7UD\03SOD\HUKROGHU
Console
%RWWOH+ROGHU
Handlebars
Easy Step™ Shock
:DONLQJ%HOW
$GMXVWPHQW%ROW
7UHDGOH
Side Foot
Support Platform
7UDQVSRUW+DQG
%DU
:DONLQJ%HOW*XLGH
Leveler
:DONLQJ%HOW
5HDU6WHS
7UDQVSRUW:KHHO
Power Switch
25
Assembly / Owner’s Manual
Console Features
$FWLYH8VHUGLVSOD\
ENTER
USER
START
STOP/
PAUSE
.1 mph
.5 mph
User button
3XVKWRFKDQJHWKHVHOHFWHG$FWLYH8VHU
Active User display
7KH$FWLYH8VHUGLVSOD\VKRZVWKHFXUUHQWO\VHOHFWHG8VHU3UR¿OH)URPDSRZHUXSWKHODVW8VHUZLOOEHWKHGHIDXOW8VHU
Increase (c) / Decrease (d) buttons
7KH,QFUHDVH'HFUHDVHEXWWRQVFKDQJHDYDOXHRUPRYHWKURXJKRSWLRQV:KHQDEXWWRQLVDQRSWLRQLWZLOOOLJKWXSWRLQGLFDWHLWLVDYDLODEOH
ENTER button
&RQ¿UPVLQIRUPDWLRQRUDVHOHFWLRQ
Left (e) / Right (f) buttons
3XVKWRVKLIWWKHFXUUHQWO\DFWLYHVHJPHQW:KHQDEXWWRQLVDQRSWLRQLWZLOOOLJKWXSWRLQGLFDWHLWLVDYDLODEOH
START button
Push to start a workout or resume a paused workout.
STOP/PAUSE button
3XVKWRSDXVHDZRUNRXWH[LWWKH8VHU3UR¿OHRU0DFKLQH6HWWLQJVPRGHRUHQGDSDXVHGZRUNRXW
Speed buttons (Increase and Decrease)
3XVKWRFKDQJHWKHVSHHGRIWKHEHOWVE\PSKNSKLQFUHPHQWVSXVKDQGKROGWRTXLFNO\FKDQJHWKHEHOWVSHHG
26
Assembly / Owner’s Manual
Quick Speed buttons (Increase and Decrease)
3XVKWRFKDQJHWKHVSHHGRIWKHEHOWVE\PSKNSKLQFUHPHQWVSXVKDQGKROGWRTXLFNO\FKDQJHWKHEHOWVSHHG
Console Display
Workout Segment display
³´LFRQV
USB icon
7KH86%LFRQLVGLVSOD\HGZKHQD86%)ODVK'ULYHRU'HYLFHLVDWWDFKHGWRWKH&RQVROH7KH86%LFRQZLOOÀDVKZKHQWKH&RQVROHLVVDYLQJ
LQIRUPDWLRQWRWKH86%3RUW'RQRWUHPRYHWKH86%)ODVK'ULYH'HYLFHZKHQWKHLFRQLVÀDVKLQJ'DPDJHWRWKH'ULYH'HYLFHPD\RFFXU
Calories display
7KH&DORULHVGLVSOD\FRXQWV\RXUWRWDOFDORULHV7KHPD[LPXPYDOXHIRUFDORULHVGXULQJDZRUNRXWLV
Workout Segment display
7KH:RUNRXW6HJPHQWGLVSOD\VKRZVJUDSKLFDOO\ZKHUHWKHXVHULVLQWKHZRUNRXW(DFKVHJPHQWRIWKHGLVSOD\LVFDORULH
:KHQFDORULHVKDYHEHHQEXUQHGWKH&RQVROHZLOODFWLYDWHWKH³´LFRQDQGUHVHWWKHZRUNRXWVHJPHQWVE\GHDFWLYDWLQJWKHP7ZRFDORULH
roll overs are available for each workout.
“+ 500” icon
*UDSKLFDOO\VKRZVWKDWWKH:RUNRXW6HJPHQWGLVSOD\KDVUROOHGRYHUGXULQJDFDORULHJRDOZRUNRXW7ZRFDORULHUROORYHUVDUHDYDLODEOHIRUHDFK
workout.
Heart Rate display
7KH+HDUW5DWHGLVSOD\VKRZV\RXUKHDUWEHDWVSHUPLQXWH7KHKHDUWLFRQZLOOÀDVKZKHQDFTXLULQJWKHUDWH:LWKDVWDEOHUHDGLQJWKHLFRQZLOOEH
shown as solid.
7KHKHDUWUDWHGLVSOD\HGLVDQDSSUR[LPDWLRQDQGVKRXOGEHXVHGIRUUHIHUHQFHRQO\
Drink display
7KH'ULQNGLVSOD\LVDUHPLQGHUWRVWD\K\GUDWHGGXULQJDQH[WHQGHGZRUNRXW
27
Assembly / Owner’s Manual
Burn display
7KH%XUQGLVSOD\DFWLYDWHVZKHQWKHKHDUWUDWHRIDXVHUUHDFKHVWKHDQDHURELFUDWHRURIWKHLUPD[LPXPKHDUWUDWH7KH&RQVROHZLOO
GLVSOD\³$)7(5%851$&+,(9('´DQGD7URSK\LFRQLVDZDUGHG
Note:2QFHGLVSOD\HGWKH%XUQGLVSOD\ZLOOGHDFWLYDWHZKHQWKHKHDUWUDWHLVQRWLQWKHDQDHURELFUDWH]RQH6LQFHWKH&RQVROHLVXVLQJWKH
DJHYDOXHIRUWKHVHOHFWHG8VHUEHVXUHWRSURJUDPDQGVHOHFWWKHFRUUHFW8VHUSUR¿OH
Fitness Score display
7KHGLVSOD\VKRZVWKHFXUUHQW)LWQHVV6FRUHIRUWKHVHOHFWHG8VHU$WWKHHQGRIDZRUNRXWLIWKH)LWQHVV6FRUHKDVLQFUHDVHGDQXSZDUGDUURZLFRQ
will be displayed to show the increase in the score.
Note: 7KLVGLVSOD\LVEODQNGXULQJWKHZRUNRXWPRGH
Today’s Awards display
6KRZVDOORIWKHHDUQHG$ZDUGLFRQVGXULQJDZRUNRXW:KHQHDUQHGWKH&RQVROHZLOOGLVSOD\WKHQDPHRIWKHDFKLHYHPHQW$VXPPDU\RI$ZDUGVLV
also provided at the end of the workout.
Note:6RPH$ZDUGVFDQRQO\EHHDUQHGRQFHGXULQJDZRUNRXWVXFKDV³6WDUWHGD:RUNRXW´RU³$IWHUEXUQ$FKLHYHG´
Speed display
6KRZV\RXUFOLPELQJUDWHLQPLOHV 0, RUNLORPHWHUV .0 SHUKRXUWRRQHGHFLPDO HJ0, 0,LVWKHGHIDXOWVHWWLQJ
Time display
&RXQWVLQPLQXWHVDQGVHFRQGVWKHWRWDOWLPHRI\RXUZRUNRXW HJPLQXWHV 7KHKRXU¿HOGZLOODFWLYDWHZKHQDZRUNRXWJRHVORQJHUWKDQ
7KHPD[LPXPWLPHIRUDZRUNRXWLV
Distance display
7KH'LVWDQFHGLVSOD\VKRZV\RXUZRUNRXWGLVWDQFHLQPLOHV 0, RUNLORPHWHUV .0 0LOHVLVWKHGHIDXOWVHWWLQJ
Note::KHQ\RXZRUNRXWDGLVWDQFHPRUHWKDQ³´WKHGLVSOD\ZLOODFWLYDWHDQRWKHUVHJPHQWWRGLVSOD\³´
Calories per Minute ( or Burn Rate ) display
7KH&DORULHVSHU0LQXWHRU%XUQ5DWHGLVSOD\VKRZVWKHUDWHRIFDORULHVEXUQHGIRUDPLQXWHDWWKHFXUUHQWZRUNRXWOHYHOV
USB Charging
,ID86%'HYLFHLVDWWDFKHGWRWKH86%3RUWWKH3RUWZLOODWWHPSWWRFKDUJHWKH'HYLFH7KHSRZHUVXSSOLHGIURPWKH86%3RUWPD\QRWEHHQRXJKWR
operate the Device and charge it at the same time.
28
Assembly / Owner’s Manual
Easy Step™ Shocks
<RXU7UHDG&OLPEHU® machine uses Easy Step™6KRFNVWRDEVRUE\RXUVWHSVDQGFXVKLRQ\RXUMRLQWVGHFUHDVLQJ\RXU
RYHUDOOIDWLJXHDQGUHGXFLQJPXVFOHVWUDLQ7KHGLVSODFHPHQWRIWKH7UHDGOHVLVDGMXVWHGE\WKHGLDOVRQWKH(DV\6WHS™
6KRFNV7KH0LQLPXP7UDYHOVHWWLQJLVWKHOHDVWDPRXQWRI7UHDGOHPRYHPHQWWKH0D[LPXP7UDYHOLVWKHJUHDWHVWPRYH
PHQW7KHFORVHUWKHGLDOLVVHWWRWKH0D[LPXP7UDYHOVHWWLQJWKHPRUHWKH7UHDGOHZLOOPRYH7KLVUHVXOWVLQDPRUH
intense workout.
)RUPD[LPXPFXVKLRQLQJWKH7UHDGOHVVKRXOGEHVHWVRWKH\GLVSODFHHQRXJKWRDEVRUEWKHLPSDFWRI\RXUVWHSSLQJ
PRWLRQDSSUR[LPDWHO\LQFKHV%HJLQZLWKHDFK6KRFNVHWZLWKWKHDUURZVDOLJQHG,IWKLVVHWWLQJGRHVQRWPRYHHQRXJK
WRIXOO\FXVKLRQ\RXUVWHSVDGMXVWWKHGLDOVHWWLQJWRZDUGWKH0D[LPXP FRXQWHUFORFNZLVH VHWWLQJDOORZLQJPRUH7UHDGOH
PRYHPHQW,I\RX¿QGWKDWWKH6KRFNVHWWLQJDOORZVWRRPXFK7UHDGOHWUDYHODGMXVWWKHGLDOWRZDUGWKH0LQLPXP FORFN
ZLVH VHWWLQJXQWLO\RXDUHFRPIRUWDEOHZLWKWKHDPRXQWRIWUDYHO$OWKRXJKWKHVHWWLQJVGLDOFDQPRYHFRQWLQXRXVO\LQ
HLWKHUGLUHFWLRQLWLVUHFRPPHQGHGQRWWRWXUQWKHGLDOVWKURXJKWKHUHGUDQJH
A
easy step
TM
Do not change the intensity settings of the Shocks during a workout. Stop the workout and step off the
machine before you adjust the Shocks.
Note:'RQRWDOORZWKH7UHDGOHVWRKLWDJDLQVWWKH%DVHRQWKHGRZQVWHS7RUHGXFH7UHDGOHWUDYHOWXUQWKHVHW
ting dial toward the Minimum setting or increase the belt speed.
It may be helpful to note your dial setting for future reference when there are multiple users of the machine.
0D[LPXP7UDYHO
0LQLPXP7UDYHO
29
Assembly / Owner’s Manual
Contact Heart Rate Sensors
&RQWDFW+HDUW5DWH &+5 VHQVRUVVHQG\RXUKHDUWUDWHVLJQDOVWRWKH&RQVROH7KH&+5VHQVRUVDUHWKHVWDLQOHVVVWHHOSDUWVRIWKH+DQGOHEDUV
7RXVHSXW\RXUKDQGVFRPIRUWDEO\DURXQGWKHVHQVRUV%HVXUHWKDW\RXUKDQGVWRXFKERWKWKHWRSDQGWKHERWWRPRIWKHVHQVRUV+ROG¿UPEXW
QRWWRRWLJKWRUORRVH%RWKKDQGVPXVWPDNHFRQWDFWZLWKWKHVHQVRUVIRUWKH&RQVROHWRGHWHFWDSXOVH$IWHUWKH&RQVROHGHWHFWVIRXUVWDEOHSXOVH
VLJQDOV\RXULQLWLDOSXOVHUDWHZLOOEHVKRZQ
2QFHWKH&RQVROHKDV\RXULQLWLDOKHDUWUDWHGRQRWPRYHRUVKLIW\RXUKDQGVIRUWRVHFRQGV7KH&RQVROHZLOOQRZYDOLGDWHWKHKHDUWUDWH
0DQ\IDFWRUVLQÀXHQFHWKHDELOLW\RIWKHVHQVRUVWRGHWHFW\RXUKHDUWUDWHVLJQDO
• 0RYHPHQWRIWKHXSSHUERG\PXVFOHV LQFOXGLQJDUPV SURGXFHVDQHOHFWULFDOVLJQDO PXVFOHDUWLIDFW WKDWFDQLQWHUIHUHZLWKSXOVHGHWHFWLRQ6OLJKW
hand movement while in contact with the sensors can also produce interference.
• Calluses and hand lotion may act as an insulating layer to reduce the signal strength.
• 6RPH(OHFWURFDUGLRJUDP (.* VLJQDOVJHQHUDWHGE\LQGLYLGXDOVDUHQRWVWURQJHQRXJKWREHGHWHFWHGE\WKHVHQVRUV
• 7KHSUR[LPLW\RIRWKHUHOHFWURQLFPDFKLQHVFDQJHQHUDWHLQWHUIHUHQFH
,I\RXUKHDUWUDWHVLJQDOHYHUVHHPVHUUDWLFDIWHUYDOLGDWLRQZLSHRII\RXUKDQGVDQGWKHVHQVRUVDQGWU\DJDLQ
7KHKHDUWUDWHGLVSOD\HGLVDQDSSUR[LPDWLRQDQGVKRXOGEHXVHGIRUUHIHUHQFHRQO\
30
Assembly / Owner’s Manual
Heart Rate Calculations
<RXUPD[LPXPKHDUWUDWHXVXDOO\GHFUHDVHVIURP%HDWV3HU0LQXWH %30 LQFKLOGKRRGWRDSSUR[LPDWHO\%30E\DJH7KLVIDOOLQKHDUW
UDWHLVXVXDOO\OLQHDUGHFUHDVLQJE\DSSUR[LPDWHO\RQH%30IRUHDFK\HDU7KHUHLVQRLQGLFDWLRQWKDWWUDLQLQJLQÀXHQFHVWKHGHFUHDVHLQPD[LPXP
KHDUWUDWH,QGLYLGXDOVRIWKHVDPHDJHFRXOGKDYHGLIIHUHQWPD[LPXPKHDUWUDWHV,WLVPRUHDFFXUDWHWR¿QGWKLVYDOXHE\JHWWLQJDVWUHVVWHVWWKDQE\
using an age related formula.
<RXUDWUHVWKHDUWUDWHLVLQÀXHQFHGE\HQGXUDQFHWUDLQLQJ7KHW\SLFDODGXOWKDVDQDWUHVWKHDUWUDWHRIDSSUR[LPDWHO\%30ZKHUHDVKLJKO\
WUDLQHGUXQQHUVPD\KDYHUHDGLQJVRI%30RUORZHU
7KH+HDUW5DWHWDEOHLVDQHVWLPDWHRIZKDW+HDUW5DWH=RQH +5= LVHIIHFWLYHWREXUQIDWDQGLPSURYH\RXUFDUGLRYDVFXODUV\VWHP3K\VLFDOFRQGL
WLRQVYDU\WKHUHIRUH\RXULQGLYLGXDO+5=FRXOGEHVHYHUDOEHDWVKLJKHURUORZHUWKDQZKDWLVVKRZQ
7KHPRVWHI¿FLHQWSURFHGXUHWREXUQIDWGXULQJH[HUFLVHLVWRVWDUWDWDVORZSDFHDQGJUDGXDOO\LQFUHDVH\RXULQWHQVLW\XQWLO\RXUKHDUWUDWHUHDFKHV
EHWZHHQ±RI\RXUPD[LPXPKHDUWUDWH&RQWLQXHDWWKDWSDFHNHHSLQJ\RXUKHDUWUDWHLQWKDWWDUJHW]RQHIRURYHUPLQXWHV7KHORQJHU
\RXPDLQWDLQ\RXUWDUJHWKHDUWUDWHWKHPRUHIDW\RXUERG\ZLOOEXUQ
(EART 2ATE "0- BEATS PER MINUTE
Fat-Burning Target Heart Rate
!GE
-AXIMUM (EART 2ATE
4ARGET (EART 2ATE :ONE
KEEP WITHIN THIS RANGE
FOR OPTIMUM FAT BURNING
7KHJUDSKLVDEULHIJXLGHOLQHGHVFULELQJWKHJHQHUDOO\VXJJHVWHGWDUJHWKHDUWUDWHVEDVHGRQDJH$VQRWHGDERYH\RXURSWLPDOWDUJHWUDWHPD\EH
KLJKHURUORZHU&RQVXOW\RXUSK\VLFLDQIRU\RXULQGLYLGXDOWDUJHWKHDUWUDWH]RQH
Note: $VZLWKDOOH[HUFLVHVDQGILWQHVVUHJLPHQVDOZD\VXVH\RXUEHVWMXGJPHQWZKHQ\RXLQFUHDVH\RXUH[HUFLVHWLPHRULQWHQVLW\
31
Assembly / Owner’s Manual
Fitness Basics
Frequency
7RPDLQWDLQJRRGKHDOWKORVHZHLJKWDQGLPSURYH\RXUFDUGLRYDVFXODUHQGXUDQFHWU\DQGXVHWKH7UHDG&OLPEHUŠ¿WQHVVPDFKLQHDPLQLPXPRI
WLPHVSHUZHHNPLQXWHVHDFKGD\
,I\RXDUHQHZWRH[HUFLVH RUUHWXUQLQJWRDUHJXODUH[HUFLVHSURJUDP DQG\RXDUHXQDEOHWRFRPIRUWDEO\FRPSOHWHPLQXWHVRIFRQWLQXRXVH[HU
FLVHDWRQHWLPHMXVWGR±PLQXWHVDQGJUDGXDOO\LQFUHDVH\RXUZRUNRXWWLPHXQWLO\RXFDQUHDFKPLQXWHVWRWDO
,I\RXUVFKHGXOHLVEXV\DQG\RXDUHXQDEOHWR¿WPLQXWHVRIFRQWLQXRXVH[HUFLVHLQWR\RXUGD\WU\DFFXPXODWLQJPLQXWHVE\GRLQJPXOWLSOH
VKRUWHUZRUNRXWVRQWKHVDPHGD\)RUH[DPSOHPLQXWHVLQWKHPRUQLQJDQGPLQXWHVLQWKHHYHQLQJ
)RUEHVWUHVXOWVFRPELQH\RXU7UHDG&OLPEHUŠ¿WQHVVPDFKLQHZRUNRXWVZLWKDVWUHQJWKWUDLQLQJSURJUDPXVLQJD%RZÀH[ŠKRPHJ\PRU%RZÀH[Š
6HOHFW7HFKŠGXPEEHOOVDQGIROORZWKH%RZÀH[™%RG\:HLJKW/RVV*XLGHWKDWLVLQFOXGHGLQWKLVPDQXDO
Consistency
%XV\ZRUNVFKHGXOHVIDPLO\REOLJDWLRQVDQGGDLO\FKRUHVFDQPDNHLWGLI¿FXOWWR¿WUHJXODUH[HUFLVHLQWR\RXUOLIH7U\WKHVHWLSVWRLQFUHDVH\RXU
FKDQFHVRIVXFFHVV
6FKHGXOH\RXUZRUNRXWVWKHVDPHZD\\RXVFKHGXOHPHHWLQJVRUDSSRLQWPHQWV6HOHFWVSHFL¿FGD\VDQGWLPHVHDFKZHHNDQGGRQ¶WFKDQJH\RXU
workout times unless it is absolutely necessary.
0DNHDFRPPLWPHQWWRDIDPLO\PHPEHUIULHQGRUVSRXVHDQGHQFRXUDJHHDFKRWKHUWRVWD\RQWUDFNHDFKZHHN/HDYHPHVVDJHVZLWKIULHQGO\
UHPLQGHUVWREHFRQVLVWHQWDQGNHHSHDFKRWKHUDFFRXQWDEOH
0DNH\RXUZRUNRXWVPRUHLQWHUHVWLQJE\DOWHUQDWLQJEHWZHHQVWHDG\VWDWH VLQJOHVSHHG ZRUNRXWVDQGLQWHUYDOWUDLQLQJ YDULHGVSHHG ZRUNRXWV7KH
7UHDG&OLPEHUŠ¿WQHVVPDFKLQHLVHYHQPRUHIXQZKHQ\RXDGGWKLVNLQGRIYDULHW\
Apparel
,WLVLPSRUWDQWWRZHDUDSSURSULDWHVDIHDQGFRPIRUWDEOHIRRWZHDUDQGFORWKLQJZKHQXVLQJWKH
7UHDG&OLPEHUŠ¿WQHVVPDFKLQHLQFOXGLQJ
• 5XEEHUVROHGDWKOHWLFZDONLQJRUUXQQLQJVKRHV
• ([HUFLVHFORWKLQJWKDWDOORZV\RXWRPRYHIUHHO\DQGNHHSFRPIRUWDEO\FRRO
• $WKOHWLFVXSSRUWWKDWSURYLGHVVWDELOLW\DQGFRPIRUW
Do not wear loose clothing or jewelry. This machine contains moving parts. Do not put fingers, feet, or other objects into moving
SDUWVRIWKHH[HUFLVHHTXLSPHQW
Always wear rubber soled athletic shoes when you use this machine. Do not use the machine with bare feet or only wearing socks.
%HFDXVHRIKRZWKH7UHDGOHVDQG:DONLQJ%HOWVRSHUDWHLWLVSRVVLEOHIRUH[WUHPHO\OLJKWZHLJKWÁH[LEOHVKRHVRUPLQLPDOLVW
shoes, to be caught. Only wear athletic shoes that have more toe protection, structure, and support. Light-weight or minimalist
shoes should not be worn.
Warm-Up *
%HIRUH\RXXVH\RXU7UHDG&OLPEHUŠ¿WQHVVPDFKLQHFRQVLGHUGRLQJWKHVHG\QDPLFZDUPXSVWUHWFKHVZKLFKZLOOKHOSSUHSDUH\RXUERG\IRUWKH
ZRUNRXW
*6RXUFH-D\%ODKQLN¶V)XOO%RG\)OH[LELOLW\6HFRQG(GLWLRQ+XPDQ.LQHWLFVFRP
32
Assembly / Owner’s Manual
'\QDPLF.QHH+XJ
6WDQGZLWKWKHIHHWWRJHWKHU%ULQJRQHNQHHIRUZDUGDQGXS
toward the chest. Place the hands around the shin and pull
WKHNQHHLQWRWKHFKHVW5HOHDVHWKHVWUHWFKE\SXWWLQJWKH
IRRWRQWKHÀRRU(DFKUHSHWLWLRQRIWKHVHTXHQFHVKRXOGWDNH
WRVHFRQGV5HSHDWDVDFRQWLQXRXVFRQWUROOHGÀXLGVH
TXHQFHRUWLPHV5HSHDWWKHVWUHWFKZLWKWKHRWKHUOHJ
'\QDPLF.QHH%HQG
6WDQGZLWKWKHIHHWWRJHWKHU5DLVHWKHKHHORIRQHIRRW
WRZDUGWKHJOXWHDOV5HOHDVHWKHVWUHWFKE\SXWWLQJWKHIRRWRQ
WKHÀRRU(DFKUHSHWLWLRQRIWKHVHTXHQFHVKRXOGWDNHWR
VHFRQGV5HSHDWDVDFRQWLQXRXVFRQWUROOHGÀXLGVHTXHQFH
RUWLPHV5HSHDWWKHVWUHWFKZLWKWKHRWKHUOHJ
'\QDPLF.QHH.LFN
6WDQGWDOODQGKROGRQHOHJXSZLWKWKHKDQGVDWKLSKHLJKW
keeping the knee bent. Hold onto a wall for balance with one
KDQGLIQHFHVVDU\6WUDLJKWHQWKHNQHHDVIDUDVFRPIRUWDEO\
SRVVLEOH5HOHDVHWKHVWUHWFKE\EHQGLQJWKHNQHH(DFKUHS
HWLWLRQRIWKHVHTXHQFHVKRXOGWDNHWRVHFRQGV5HSHDW
DVDFRQWLQXRXVFRQWUROOHGÀXLGVHTXHQFHRUWLPHV
5HSHDWWKHVWUHWFKZLWKWKHRWKHUOHJ
Dynamic Twist
6WDQGZLWKWKHIHHWVKRXOGHUZLGWKDSDUW%HQGWKHHOERZV
KROGWKHDUPVRXWWRWKHVLGHV7ZLVWWKHXSSHUERG\WRRQH
side and then the other side as far as comfortably possible.
Each repetition of the sequence should take 1 to 3 seconds.
5HSHDWDVDFRQWLQXRXVFRQWUROOHGÀXLGVHTXHQFHRU
times
'\QDPLF%HQW.QHH+HHO3UHVV
6WDQGZLWKRQHIRRWIRUZDUGDQGRQHIRRWEDFNKLSZLGWK
DSDUWDQGIHHWIDFLQJIRUZDUG%HQGERWKNQHHVSXWWLQJ
ZHLJKWRQWKHEDFNKHHO5HOHDVHWKHVWUHWFKE\UHWXUQLQJ
to the start position. Each repetition of the sequence should
WDNHWRVHFRQGV5HSHDWDVDFRQWLQXRXVFRQWUROOHG
ÀXLGVHTXHQFHRUWLPHV5HSHDWWKHVWUHWFKZLWKWKH
RWKHUOHJ7RXFKDZDOORUKROGRQWRVRPHWKLQJIRUEDODQFHLI
necessary.
33
Assembly / Owner’s Manual
Dynamic Side Reach
6WDQGZLWKWKHIHHWDSDUWWKHNQHHVVOLJKWO\EHQWDQGWKH
DUPVDWWKHVLGHVRIWKHERG\5HDFKZLWKRQHKDQGDERYH
WKHKHDGDQGOHDQRYHUWRWKHRSSRVLWHVLGH5HOHDVHWKH
VWUHWFKE\UHWXUQLQJWRWKHVWDUWSRVLWLRQ7KHQUHDFKZLWKWKH
other hand to the opposite side. Use the other arm to support
WKHERG\ZHLJKWRQWKHWKLJKLIQHFHVVDU\(DFKUHSHWLWLRQ
RIWKHVHTXHQFHVKRXOGWDNHWRVHFRQGV5HSHDWDVD
FRQWLQXRXVFRQWUROOHGÀXLGVHTXHQFHRUWLPHV
Workouts
)ROORZWKHVHJXLGHOLQHVWRHDVH\RXUVHOILQWRDZHHNO\H[HUFLVHUHJLPHQ8VH\RXUMXGJPHQWDQGRUWKHDGYLFHRI\RXUSK\VLFLDQRUKHDOWKFDUH
SURIHVVLRQDOWR¿QGWKHLQWHQVLW\DQGOHYHORI\RXUZRUNRXWV
&RQVXOWDSK\VLFLDQEHIRUH\RXVWDUWDQH[HUFLVHSURJUDP6WRSH[HUFLVLQJLI\RXIHHOSDLQRUWLJKWQHVVLQ\RXUFKHVWEHFRPHVKRUW
of breath, or feel faint. Contact your doctor before you use the machine again. Use the values calculated or measured by the
PDFKLQH·VFRPSXWHUIRUUHIHUHQFHSXUSRVHVRQO\
6WHDG\6WDWHDQG,QWHUYDO7UDLQLQJDUHW\SHVRIZRUNRXWV\RXFDQGRRQ\RXU7UHDG&OLPEHUŠ¿WQHVVPDFKLQH
Steady State workouts
$6WHDG\6WDWHZRUNRXWLQYROYHVVORZO\LQFUHDVLQJ\RXUZRUNRXWVSHHGWRDFKDOOHQJLQJEXWFRPIRUWDEOHVSHHG\RXFDQKROGIRUPRVWRI\RXUZRUN
RXW)RUH[DPSOHKROGLQJD03+ZDONLQJSDFHIRUWKHHQWLUHZRUNRXWH[FHSWGXULQJWKHZDUPXSDQGFRROGRZQ6WHDG\6WDWHZRUNRXWVKHOS
\RXEXLOGH[HUFLVHFRQ¿GHQFHVWDPLQDDQGHQGXUDQFHDQGDUHHVVHQWLDOWRDZHOOURXQGHGFDUGLRYDVFXODUWUDLQLQJSURJUDP
Interval Training workouts
$Q,QWHUYDO7UDLQLQJZRUNRXWLQYROYHVDGMXVWLQJ\RXUVSHHGIDVWHUDQGVORZHUIRUVSHFL¿FOHQJWKVRIWLPHWRUDLVHDQGORZHU\RXUEUHDWKLQJUDWHKHDUW
UDWHDQGFDORULHEXUQ+HUHLVDVDPSOH,QWHUYDO7UDLQLQJZRUNRXW
‡PLQXWHVZDONLQJDWDVORZHDV\FRPIRUWDEOHVSHHG
‡PLQXWHZDONLQJDWDPRUHFKDOOHQJLQJVSHHGWKDWLVDSSUR[LPDWHO\IDVWHU
‡PLQXWHVZDONLQJDWDVORZHDV\FRPIRUWDEOHVSHHG
• 1 minute walking at a more challenging speed that is approximately 2x faster.
‡PLQXWHVZDONLQJDWDVORZHDV\FRPIRUWDEOHVSHHG
‡PLQXWHZDONLQJDWDPRUHFKDOOHQJLQJVSHHGWKDWLVDSSUR[LPDWHO\IDVWHU
‡PLQXWHVZDONLQJDWDVORZHDV\FRPIRUWDEOHVSHHG
,QWHUYDO7UDLQLQJZRUNRXWVSURYLGHYDULHW\PD[LPL]HFDORULHEXUQDQGLPSURYH¿WQHVV
7KH7UHDG&OLPEHUŠ¿WQHVVPDFKLQHLVGHVLJQHGWRFXVKLRQ\RXUMRLQWVDQGPXVFOHVDQGERWK6WHDG\6WDWHDQG,QWHUYDO7UDLQLQJZRUNRXWVVKRXOGIHHO
more comfortable than walking or running outside on a hard surface or a treadmill.
Afterburn Rate
$WWKHHQGRIDQLQWHQVH,QWHUYDO7UDLQLQJZRUNRXW\RXUERG\ZLOODFWXDOO\QHHGWRH[SHQGDGGLWLRQDOHQHUJ\WRUHSOHQLVK\RXUERG\¶VUHVHUYHV7KLV
DGGLWLRQDODPRXQWRIHQHUJ\WKDW\RXUERG\ZLOOEHXVLQJLVWKH$IWHUEXUQ5DWHRU(32& ([FHVV3RVWH[HUFLVH2[\JHQ&RQVXPSWLRQ 7KHOHYHORI
WKLVDGGLWLRQDOHQHUJ\UHTXLUHPHQWIRU\RXUERG\LVGLUHFWO\UHODWHGWRPDQ\IDFWRUV6RPHIDFWRUVDUH\RXUSK\VLFDO¿WQHVVOHYHOLQWHQVLW\OHYHORIWKH
LQWHUYDOWUDLQLQJZRUNRXWOHQJWKRIR[\JHQGHSULYDWLRQGXULQJWKHZRUNRXWDQGSK\VLFDOGHPDQGVGXULQJWKHUHFRYHU\SKDVH
,QVXPPDU\\RXUERG\ZLOOEHEXUQLQJPRUHFDORULHVIRUKRXUVDIWHU\RXUZRUNRXW6RDIWHUDQLQWHQVH,QWHUYDOZRUNRXW\RXPD\IHHOWKHHIIHFWVIRU
hours afterwards.
34
Assembly / Owner’s Manual
Workout Schedule
+HUHLVDEHJLQQHULQWHUPHGLDWHDQGDGYDQFHGVDPSOHZRUNRXWVFKHGXOH8VHWKHZRUNRXWVFKHGXOHWKDWUHÀHFWV\RXUFXUUHQW¿WQHVVOHYHO:LWK
HDFKRIWKHVHVDPSOHZRUNRXWVFKHGXOHVGRQRWPRYHRQWRWKHQH[WZHHNXQWLOWKHFXUUHQWZHHNIHHOVHDVLHUDQGFRPIRUWDEOH
Beginner
:HHN
:HHN
Week 3
Week 4
:HHN
:RUNRXW
Steady State
Steady State
Steady State
,QWHUYDO7UDLQLQJ
,QWHUYDO7UDLQLQJ
:RUNRXW
Steady State
Steady State
,QWHUYDO7UDLQLQJ
Steady State
Steady State
Workout 3
Steady State
Steady State
Steady State
,QWHUYDO7UDLQLQJ
,QWHUYDO7UDLQLQJ
Week 4
:HHN
Intermediate
:HHN
:HHN
Week 3
:RUNRXW
Steady State
Steady State
,QWHUYDO7UDLQLQJ
Steady State
,QWHUYDO7UDLQLQJ
:RUNRXW
Steady State
,QWHUYDO7UDLQLQJ
Steady State
,QWHUYDO7UDLQLQJ
Steady State
Workout 3
Steady State
Steady State
,QWHUYDO7UDLQLQJ
Steady State
,QWHUYDO7UDLQLQJ
Advanced
:HHN
:HHN
Week 3
Week 4
:HHN
,QWHUYDO7UDLQLQJ
,QWHUYDO7UDLQLQJ
,QWHUYDO7UDLQLQJ
:RUNRXW
Steady State
,QWHUYDO7UDLQLQJ
:RUNRXW
,QWHUYDO7UDLQLQJ
Steady State
Steady State
Steady State
,QWHUYDO7UDLQLQJ
Workout 3
Steady State
,QWHUYDO7UDLQLQJ
,QWHUYDO7UDLQLQJ
,QWHUYDO7UDLQLQJ
,QWHUYDO7UDLQLQJ
35
Assembly / Owner’s Manual
Workout Log
8VHWKLVORJWRWUDFN\RXUZRUNRXWVDQGSURJUHVV7UDFNLQJ\RXUZRUNRXWVKHOSV\RXVWD\PRWLYDWHGDQGDFKLHYH\RXUJRDOV
Date
Shock
Setting
Distance
Time
Calories
Average
Speed
Easy Step™ Shock label
6KRFN6HWWLQJ
(for reference only)
36
Assembly / Owner’s Manual
Cool-Down *
:KHQ\RXDUHGRQHXVLQJ\RXU7UHDG&OLPEHUŠ¿WQHVVPDFKLQHFRQVLGHUGRLQJWKHVHUHOD[LQJVWUHWFKHVZKLFKZLOOKHOS\RXUERG\UHFRYHUIURPWKH
ZRUNRXWDQGPDNH\RXPRUHÀH[LEOH
Lying Leg Raise
/LHRQWKHÀRRUIDFHXSZLWKWKHOHJVVOLJKWO\EHQW/LIWRQHOHJ
XSWRZDUGWKHFHLOLQJNHHSLQJWKHNQHHVWUDLJKW3ODFHWKH
KDQGV RUDVWUDS DURXQGWKHWKLJKDQGPRYHWKHOHJFORVHU
WRWKHKHDG+ROGWKHVWUHWFKIRUWRVHFRQGV5HSHDWWKH
VWUHWFKRQWKHRWKHUOHJ.HHSWKHKHDGRQWKHÀRRUDQGGR
not round the spine.
6LGH/\LQJ.QHH%HQG
/LHRQWKHÀRRURQRQHVLGHRIWKHERG\DQGUHVWWKHKHDGRQ
WKHORZHUDUP%HQGWKHWRSNQHHDQGKROGWKHDQNOHZLWKWKH
VDPHVLGHKDQGWKHQSXOOWKHKHHOWRZDUGWKHJOXWHDOV+ROG
the stretch for 10 to 30 seconds. Lie on the other side and
UHSHDWWKHVWUHWFKZLWKWKHRWKHUOHJ5HPHPEHUWRKROGWKH
knees close together.
/\LQJ)LJXUH)RXU
/LHRQWKHÀRRUIDFHXSZLWKWKHOHJVEHQW3ODFHRQHIRRW
DFURVVWKHWKLJKRIWKHRSSRVLWHOHJLQWKH¿JXUHIRXUSRVLWLRQ
5HDFKIRUWKHOHJRQWKHÀRRUDQGSXOOLWWRZDUGWKHFKHVW
+ROGWKHVWUHWFKIRUWRVHFRQGV5HSHDWWKHVWUHWFKZLWK
WKHRWKHUOHJ.HHSWKHKHDGRQWKHÀRRU
Seated Twist
6LWRQWKHÀRRUDQGH[WHQGWKHOHJVVWUDLJKWRXWLQIURQWRIWKH
ERG\ZLWKWKHNQHHVVOLJKWO\EHQW3ODFHRQHKDQGRQWKHÀRRU
EHKLQGWKHERG\DQGWKHRWKHUKDQGDFURVVWKHWKLJK7ZLVW
the upper body as far as comfortably possible to one side.
+ROGWKHVWUHWFKIRUWRVHFRQGV5HSHDWWKHVWUHWFKRQ
the other side.
6HDWHG)LJXUH)RXU
6LWRQWKHÀRRUDQGH[WHQGRQHOHJVWUDLJKWRXWLQIURQWRIWKH
body. Place the foot of the other leg across the thigh in the
¿JXUHIRXUSRVLWLRQ0RYHWKHFKHVWWRZDUGWKHOHJVSLYRWLQJ
DWWKHKLS+ROGWKHVWUHWFKIRUWRVHFRQGV5HSHDWRQ
the other leg. Use the arms to support the back.
*6RXUFH-D\%ODKQLN¶V)XOO%RG\)OH[LELOLW\6HFRQG(GLWLRQ+XPDQ.LQHWLFVFRP
37
Assembly / Owner’s Manual
'\QDPLF+HHO'URS
Place the ball of one foot on the edge of a step or staircase.
Place the other foot slightly in front. Lower the heel of the
EDFNIRRWDVIDUDVFRPIRUWDEO\SRVVLEOHNHHSLQJWKHNQHH
VWUDLJKW5HOHDVHWKHVWUHWFKE\OLIWLQJWKHKHHODVKLJKDV
comfortably possible. Each repetition of the sequence should
WDNHWRVHFRQGV5HSHDWDVDFRQWLQXRXVFRQWUROOHGÀXLG
VHTXHQFHRUWLPHV5HSHDWWKHVWUHWFKZLWKWKHRWKHU
leg
Operations
38
Assembly / Owner’s Manual
Operations
Before You Start
&RQVXOWDSK\VLFLDQEHIRUH\RXVWDUWDQH[HUFLVHSURJUDP6WRSH[HUFLVLQJLI\RXIHHOSDLQRUWLJKWQHVVLQ\RXUFKHVWEHFRPHVKRUW
of breath, or feel faint. Contact your doctor before you use the machine again. Use the values calculated or measured by the
PDFKLQH·VFRPSXWHUIRUUHIHUHQFHSXUSRVHVRQO\
3ODFHWKH7UHDG&OLPEHUŠ¿WQHVVPDFKLQHLQ\RXUZRUNRXWDUHD
Place the machine on a clean, hard, level surface, free from unwanted material or other objects that may hamper your ability to
PRYHIUHHO\$UXEEHUPDWFDQEHXVHGEHORZWKHPDFKLQHWRSUHYHQWWKHUHOHDVHRIVWDWLFHOHFWULFLW\DQGSURWHFW\RXUÁRRULQJ
7KHPDFKLQHFDQEHPRYHGE\RQHRUPRUHSHUVRQV0DNHVXUHWKDW\RXURZQSK\VLFDOVWUHQJWKLVcapable of safely moving the
machine.
$GMXVWWKHLQWHQVLW\VHWWLQJVRQWKH(DV\6WHS™ Shocks.
Note:,QLWLDOO\WKHVHWWLQJVRQHDFK6KRFNVKRXOGPDWFK%HJLQZLWKHDFK6KRFNVHWZLWKWKHDUURZVDOLJQHG
&RQQHFWWKHSRZHUFRUGWRWKHPDFKLQHDQGLQWRDJURXQGHG$&:DOO2XWOHW
Note: 7KH7UHDG&OLPEHUŠILWQHVVPDFKLQHLVGHVLJQHGWRSOXJGLUHFWO\LQWRDSURSHUO\ZLUHGDQGJURXQGHGWKUHHSURQJ9RXWOHW,IDQH[WHQ
VLRQFRUGPXVWEHXVHGEHVXUHLWLVDKHDY\GXW\PRGHOUDWHGIRU$
Put the power cord alongside the machine, out of your way when you dismount the machine. Avoid stepping on the power cord and
plug.
([DPLQHEHORZWKH7UHDGOHVIRUDQ\REMHFWV%HVXUHLWLVFOHDUEHORZWKHPDFKLQH
5. Switch on the power. Power is now supplied to the machine.
6. Straddle the belts and stand on the Side Foot Support Platforms. Put the Safety Key into the Safety Keyhole and clip the Safety Key cord to your
clothing.
• 7KH6DIHW\.H\PXVWEHFRUUHFWO\SXWLQWRWKH6DIHW\.H\KROHIRUWKH%HOW0RWRUWRHQJDJH
• $OZD\VDWWDFKWKH6DIHW\.H\&OLSWR\RXUFORWKLQJGXULQJZRUNRXWV
• ,IWKHUHLVDQHPHUJHQF\SXOORXWWKH6DIHW\.H\WRVKXWRIIWKHSRZHUWRWKH%HOW0RWRU7KLVZLOOTXLFNO\VWRSWKHEHOWV EUDFH\RXUVHOIWKLVLVDQ
DEUXSWVWRS 3XVKWKH67$57EXWWRQDQGEHJLQ\RXUZRUNRXWZKHQWKHEHOWVDUHXSWRVSHHG
The belts will only move after a 3 second, audible beep countdown.
,IWKH6RXQGKDVEHHQPXWHGWKH&RQVROHZLOOGLVSOD\WKH´$8',22))µSURPSWEHIRUHD:RUNRXWVWDUWVDVDUHPLQGHU
.HHS\RXUKDQGVRQWKHVXSSRUW+DQGOHEDUVDQGVWD\DVQHDUWKHIURQWRIWKHPDFKLQHDVLVFRPIRUWDEOHLQRUGHUWRVWD\LQEDODQFH
on the Treadles.
.HHS\RXUIRRWLQWKHFHQWHURIHDFK7UHDGOHGRQRWOHW\RXUIHHWFURVVLQIURQWRI\RXUERG\DV\RXLQFUHDVHWKHVSHHG
:KHQ\RXDUHH[SHULHQFHGDQGFRPIRUWDEOHZLWKWKHDFWLRQRIWKHPDFKLQH\RXPD\ZLVKWRDOORZ\RXUDUPVWRVZLQJIUHHO\LQDQDWXUDOZDONLQJPR
WLRQ7KLVZRUNRXWZLOODFWLYDWH\RXUFRUHPXVFOHV,WVKRXOGRQO\EHGRQHE\WKRVHFRPIRUWDEOHZLWKQRWKROGLQJRQWRWKH+DQGOHEDUV
Power Up / Idle Mode
7KH&RQVROHZLOOHQWHU3RZHU8SPRGHZKHQLQLWLDOO\SOXJJHGLQWRDSRZHUVRXUFHDQGWKH2Q2IIEXWWRQLVVZLWFKHGWR2Q
The belts will only move after a 3 second, audible beep countdown.
39
Assembly / Owner’s Manual
Shut Off (Sleep Mode)
,IWKH&RQVROHGRHVQRWUHFHLYHDQ\LQSXWIRU¿YHPLQXWHVLWZLOODXWRPDWLFDOO\VKXWRII
3XVKDQ\EXWWRQWRVWDUW ZDNHXS WKH&RQVROH
Initial Setup
'XULQJWKH¿UVWSRZHUXSWKH&RQVROHZLOOUHTXHVWWKHGDWHDQGWLPHIRUZRUNRXWWUDFNLQJ
7KH&RQVROHGLVSOD\VKRZVWKH6(7'$7(SURPSWZLWKWKHGHIDXOWGDWHVHWWLQJ7KHPRQWKYDOXHZLOOEHWKHFXUUHQWO\DFWLYHYDOHV ÀDVKLQJ 3XVK
WKH,QFUHDVH c RU'HFUHDVH d EXWWRQVWRDGMXVWWKHFXUUHQWO\DFWLYHYDOXH ÀDVKLQJ 3XVKWKH/HIW e RU5LJKW f EXWWRQVWRFKDQJHZKLFK
VHJPHQWLVWKHFXUUHQWO\DFWLYHYDOXH PRQWKGD\\HDU 3XVKWKH5LJKWEXWWRQXQWLOWKHQH[WSURPSWLVGLVSOD\HG
7KH&RQVROHGLVSOD\VKRZVWKH6(77,0(SURPSWZLWKWKHGHIDXOWWLPHVHWWLQJ7KHKRXUYDOXHZLOOEHWKHFXUUHQWO\DFWLYHYDOHV ÀDVKLQJ 3XVK
WKH,QFUHDVH'HFUHDVHEXWWRQVWRDGMXVWWKHFXUUHQWO\DFWLYHYDOXH ÀDVKLQJ 3XVKWKH/HIW5LJKWEXWWRQVWRFKDQJHZKLFKVHJPHQWLVWKHFXUUHQWO\
DFWLYHYDOXH KRXUPLQXWH$0RU30 3XVK(17(5WRVHW
7KH&RQVROHJRHVWRWKH3RZHU8S0RGHVFUHHQ
Note:7RDGMXVWWKHVHVHWWLQJVDIWHUWKH,QLWLDO6HWXSFRQVXOWWKH³&RQVROH6HW8S0RGH´VHFWLRQ
8VHU3URĆOHV
7KH&RQVROHLVHTXLSSHGZLWK8VHU3UR¿OHV(DFK8VHU3UR¿OHKDVYDOXHVDQGRSWLRQVVSHFL¿FWRLW
• Gender
‡<HDURI%LUWK
• Display Units
• Weight
‡6RXQG9ROXPH
• Erase Workouts
6HOHFWD8VHU3URĆOH
(YHU\ZRUNRXWLVVDYHGWRWKH8VHU3UR¿OHDQGFDQEHUHYLHZHGZLWKWKHRQOLQHKHDOWKWUDFNHUDWZZZERZÀH[FRQQHFWFRP%HVXUHWRVHOHFWWKH
SURSHU8VHU3UR¿OHEHIRUHVWDUWLQJDZRUNRXW7KHODVW8VHUWKDWFRPSOHWHGDZRUNRXWZLOOEHWKHGHIDXOW8VHU
8VHU3UR¿OHVDUHDVVLJQHGWKHGHIDXOWYDOXHVXQWLOWKH\DUHFXVWRPL]HGE\HGLWLQJ%HVXUHWRHGLWWKH8VHU3UR¿OHIRUPRUHDFFXUDWHFDORULHDQGKHDUW
rate information.
(GLW8VHU3URĆOH
)URPWKH3RZHU8S0RGHVFUHHQSXVKWKH8VHUEXWWRQWRVHOHFWRQHRIWKH8VHU3UR¿OHV
3XVKDQGKROGGRZQWKH8VHUEXWWRQWRHGLWWKH8VHU3UR¿OH
7KH&RQVROHGLVSOD\VKRZVWKH*HQGHUSURPSWDQGWKHFXUUHQWYDOXH3XVKWKH,QFUHDVHRU'HFUHDVHEXWWRQVWRFKDQJHWKHGLVSOD\HG*HQGHU
YDOXHDQGSXVKWKH(17(5EXWWRQWRDFFHSWWKHGLVSOD\HGYDOXH
Note: 7RH[LWWKH8VHU3URILOHRSWLRQVSXVKWKH67233$86(EXWWRQDQGWKHFRQVROHZLOOJREDFNWRWKH3RZHU8S0RGHVFUHHQ
40
Assembly / Owner’s Manual
7RHGLWWKHRWKHU8VHUGDWD <HDURI%LUWK'LVSOD\8QLWV:HLJKWDQG6RXQG9ROXPH XVHWKH,QFUHDVH c RU'HFUHDVH d EXWWRQVWRDGMXVWDQG
SXVK(17(5WRVHWHDFKRSWLRQ
Note: 7RUHWXUQWRWKHSUHYLRXVSURPSWSXVKWKH/HIWRU%DFNDUURZEXWWRQ
,IWKH6RXQGKDVEHHQPXWHGWKH&RQVROHZLOOGLVSOD\WKH´$8',22))µSURPSWEHIRUHD:RUNRXWVWDUWVDVDUHPLQGHU
7KH&RQVROHGLVSOD\VKRZVWKH(UDVH:RUNRXWVSURPSWDQGWKHFXUUHQWYDOXH ³12´ 7RHUDVHDOOZRUNRXWVIRUWKHVHOHFWHG8VHUSXVKWKH
,QFUHDVH c RU'HFUHDVH d EXWWRQWRFKDQJHWKHYDOXHWR³<(6´DQGSXVK(17(57KH&RQVROHZLOOQRZFRQ¿UPLIWKH8VHUZDQWVWRHUDVH
WKHZRUNRXWV8VHWKH,QFUHDVH c RU'HFUHDVH d EXWWRQWRFKDQJHWKHYDOXHWR³<(6´DQGSXVK(17(57KHZRUNRXWVIRUWKLV8VHUKDYH
been erased.
7KH&RQVROHGLVSOD\VKRZVWKHFRQ¿UPDWLRQVFUHHQIRUWZRVHFRQGVDQGWKHQZLOOJRWRWKH3RZHU8S0RGHVFUHHQ
Workout Program
7KH7UHDG&OLPEHUŠFDUGLRPDFKLQH:RUNRXW3URJUDPLVDQRSHQHQGHGZRUNRXWDOORZLQJIRUGDLO\DGMXVWPHQWVWR\RXUZRUNRXWJRDO7KHZRUNRXW
begins with the Workout Segment Display blank and activates segments as calories are burned. Each segment of the Workout Segment Display
UHSUHVHQWVRQHFDORULH$VHDFKFDORULHLVEXUQHGDVHJPHQWLVDFWLYDWHG
Note::KHQDZRUNRXWH[FHHGVFDORULHVWKH&RQVROHZLOODFWLYDWHD³´LFRQDQGGHDFWLYDWHWKHVHJPHQWVRIWKH:RUNRXW6HJ
ment Display.
7REHJLQD7UHDG&OLPEHUŠZRUNRXW
5HYLHZWKHFXUUHQWO\VHOHFWHG8VHU3UR¿OH3XVKWKH86(5EXWWRQWRFKDQJHWKHDFWLYH8VHU3UR¿OH
2. Straddle the belts and stand on the Side Foot Support Platforms. Put the Safety Key into the Safety Keyhole and clip the Safety Key cord to your
clothing.
3XVKWKH67$57EXWWRQ<RXU7UHDG&OLPEHUŠ:RUNRXWZLOOEHJLQDIWHUWKHWKUHHVHFRQGDXGLEOHEHHSFRXQWGRZQ
Note: %HVXUHWRUHDGWKH³%HIRUH<RX6WDUW´VHFWLRQRI\RXUPDQXDO
Changing the Walking Belt Speed
'XULQJDZRUNRXWWKH:DONLQJ%HOWVWDUWVDWPSKNSK7RDGMXVWWKHVSHHGRIWKH:DONLQJ%HOWSXVKWKH6SHHG,QFUHDVHRU'HFUHDVHEXWWRQWR
DGMXVWE\PSKNSKLQFUHPHQWV3XVKDQGKROGGRZQWKH6SHHG,QFUHDVHRU'HFUHDVHEXWWRQWRDGMXVWWKHLQFUHPHQWVTXLFNO\
8VHWKH4XLFN6SHHGEXWWRQVWRUDSLGO\DGMXVWWKHVSHHGRIWKH:DONLQJ%HOW7KH4XLFN6SHHGEXWWRQVDGMXVWWKH:DONLQJ%HOWE\PSKNSK
increments.
Fitness Score Display
7KH)LWQHVV6FRUHLVEDVHGRQDQHVWLPDWHRIWKH8VHU¶V920D[DQGFDORULHEXUQRYHUWKHLUODVW¿YHZRUNRXWV920D[HVWLPDWHVDUHFDOFXODWHG
XVLQJSHUIRUPDQFHGDWD WLPHGLVWDQFHDQGDYHUDJHKHDUWUDWHRUDQHVWLPDWHRIDYHUDJHKHDUWUDWHLIWKDWGDWDLVXQDYDLODEOH 920D[LVWKH
PD[LPDOR[\JHQFRQVXPSWLRQRIWKHDHURELFSK\VLFDO¿WQHVVRIWKHLQGLYLGXDODQGLVDGHWHUPLQDQWRIWKHHQGXUDQFHFDSDFLW\RIWKH8VHUGXULQJ
SURORQJHGH[HUFLVH 9 9ROXPH2 2[\JHQDQG0D[ PD[LPXPUDWH )RUHYHU\ZRUNRXWFRPSOHWHGWKDWLVORQJHUWKDQPLQXWHVRUDPLOH NP LQGLVWDQFHWKH&RQVROHZLOODSSO\WKRVHZRUNRXWYDOXHVWRZDUG\RXU
)LWQHVV6FRUH7KLVYDOXHLVGLVSOD\HGRQWKH)LWQHVV6FRUH'LVSOD\DUHDRIWKH&RQVROH
Note:8VLQJD+HDUW5DWH&KHVW6WUDSSURYLGHVWKHPRVWDFFXUDWHLQIRUPDWLRQWRFDOFXODWHWKH)LWQHVV6FRUH$)LWQHVV6FRUHLVSURYLGHG
ZKHQDPLQLPXPRIPLQXWHVRUPLOH NP RIGLVWDQFHLVGRQHGXULQJDZRUNRXW,IQRKHDUWUDWHLVVXSSOLHGDQDSSUR[LPDWLRQ
based on the User Profile will be used to calculate the score.
41
Assembly / Owner’s Manual
7KH)LWQHVV6FRUHPD\FKDQJHRQO\VOLJKWO\IRUD8VHUWKDWSHUIRUPVWKHVDPHOHQJWKRIZRUNRXWDWDVLPLODULQWHQVLW\OHYHO+RZHYHULIWKDWVDPH
8VHUZHUHWRLQFUHDVHLQWHQVLW\RYHUWKHVDPHOHQJWKRIDZRUNRXWWKHLUVFRUHZRXOGLQFUHDVH6LQFHWKHVFRUHLVEDVHGRQ920D[ HVWLPDWHG HYHQDVPDOOVFRUHLQFUHDVHVKRZVDVLJQL¿FDQWVKLIWLQWKH8VHU¶V¿WQHVVOHYHO
Note:$8VHU¶VVFRUHPD\GURSVOLJKWO\LIIDWLJXHLVSUHVHQW:LWKWKHSURSHUFRPELQDWLRQRIH[HUFLVHDQGUHVWD8VHU¶V)LWQHVV6FRUHZLOOULVH
LQDVLPLODUZD\WRWKHLU920D[7KLVZLOODOVREHUHIOHFWHGLQWKHLUDELOLW\WRSHUIRUPORQJHURUIDVWHUZRUNRXWV)LWQHVV6FRUHVVKRXOG
only be compared to your previous scores and not to other User Profiles.
User Fitness Level Based on Fitness Score
100
excellent
80
60
good
high average
average
low average
40
Fitness Score
poor
100
excellent
80
60
good
high average
average
40
low average
20
poor
18-25
26-35
36-45
46-55
$JH
42
Assembly / Owner’s Manual
56-65
65+
Potential for Improvement
20
Pausing or Stopping a Workout
:LWKD¿UPKROGRQWKH+DQGOHEDUVVWHSRIIRIWKHEHOWVDQGRQWRWKH6LGH)RRW6XSSRUW3ODWIRUPVRQHLWKHUVLGHRIWKH7UHDGOHV
3XVK67233$86(WRSDXVHWKHZRUNRXW7KHEHOWVZLOOVORZWRDFRPSOHWHVWRS
Note:,IDSDXVHGZRUNRXWLVQRWUHVWDUWHGLQPLQXWHVWKHPDFKLQHZLOOHQGWKHZRUNRXWDQGdisplay the workout results.
7RUHVWDUW\RXUZRUNRXWSXVKWKH67$57EXWWRQ7RHQG\RXUZRUNRXWSXVK67233$86(DJDLQ7KH&RQVROHZLOOGLVSOD\\RXUZRUNRXWUHVXOWV
7RSUHYHQWXQVXSHUYLVHGRSHUDWLRQRIWKHPDFKLQHDOZD\VUHPRYHWKH6DIHW\.H\DQGGLVFRQQHFWWKHSRZHUFRUGIURPWKHZDOO
outlet and machine AC input. Place the power cord in a secure location.
$ZRUNRXWFDQDOVREHVWRSSHGE\FKDQJLQJWKH8VHUGXULQJDZRUNRXW7RVHOHFWDGLIIHUHQW8VHU3UR¿OHSXVKWKH8VHUEXWWRQ7KH&RQVROHZLOO
FRQ¿UPWKHFKDQJHWRWKH8VHUEHIRUHHQGLQJWKHFXUUHQWZRUNRXW2QFHFRQ¿UPHGWKHZRUNRXWLVHQGHG
Awards
$ZDUGVDUHJLYHQWRWKH8VHUGXULQJDZRUNRXW:KHQHDFK$ZDUGLVHDUQHGWKH&RQVROHZLOOPDNHDQ
DXGLEOHVRXQGGLVSOD\WKHQDPHRIWKHDFKLHYHPHQWDQGDFWLYDWHDQ$ZDUGLFRQ7KHUDQJHRI$ZDUGV
varies and can span multiple workouts.
• Started Workout
• For every 100 calories burned
‡$IWHUEXUQDFKLHYHG UHDFKHG$QDHURELFKHDUW]RQH
‡)DVWHVWPLOHNLORPHWHU
‡)DVWHVWPLOHVNLORPHWHUV
‡+LJKHVW&DORULHVSHUPLQXWH &DO0LQ UDWH
‡/RQJHVW WLPHG :RUNRXW
• Completed Workout
• Worked out 3 days in a row
• Worked out 5 days in a row
‡:RUNHGRXWIRUPLQXWHVLQDZHHN DYDLODEOHRQFHHYHU\GD\VWKH¿UVWGD\EHLQJWKH¿UVWZRUNRXW
7RUHYLHZDFKLHYHG$ZDUGVDWDODWHUWLPHH[SRUWDQGXSORDGWKHZRUNRXWWR\RXUDFFRXQWDWERZÀH[FRQQHFWFRP7KHOLVWRIDFKLHYHG$ZDUGVZLOOEH
provided with the workout results..
Workout Complete / Results
:KHQWKHJRDORIDZRUNRXWLVDFKLHYHGWKH&RQVROHZLOOGLVSOD\³:RUNRXW&RPSOHWH´IRUWZRVHFRQGVDQGWKHQEULQJWKH:DONLQJ%HOWVWRDVWRS
7KH&RQVROHZLOOWKHQGLVSOD\WKHZRUNRXWUHVXOWV
Note: ,IDZRUNRXWLVFRPSOHWHGZLWKD86%)ODVK'ULYHDOUHDG\LQVHUWHGWKH&RQVROHZLOOQRWH[SRUWWKHQHZ:RUNRXW5HVXOWVXQWLOWKH
&RQVROHH[LWVWKH5HVXOWVPRGHDQGGLVSOD\VWKH3RZHU8S0RGHVFUHHQIf the Console does not receive any further input after 5
PLQXWHVWKH&RQVROHZLOOVKXWRII
43
Assembly / Owner’s Manual
Machine Settings Mode
7KH0DFKLQH6HWWLQJV0RGHOHWV\RXDGMXVWWKHGDWHDQGWLPHUHYLHZHUURUPHVVDJHVXSGDWHNH\V\VWHPVDQGYLHZWKHWRWDOUXQKRXUVIRUWKH
machine.
+ROGGRZQWKH67233$86(EXWWRQDQG5LJKWEXWWRQWRJHWKHUIRUVHFRQGVZKLOHLQWKH3RZHU8S0RGHWRDFFHVVWKH0DFKLQH6HWWLQJV0RGH
Note:3XVK67233$86(WRH[LWWKH0DFKLQH6HWWLQJV0RGHDQGUHWXUQWRWKH3RZHU8S0RGHVFUHHQ
7KH&RQVROHGLVSOD\VKRZVWKH6(7'$7(SURPSWZLWKWKHFXUUHQWGDWHVHWWLQJ7KHPRQWKYDOXHZLOOEHWKHFXUUHQWO\DFWLYHYDOHV ÀDVKLQJ 3XVK
WKH,QFUHDVH'HFUHDVHEXWWRQVWRDGMXVWWKHFXUUHQWO\DFWLYHYDOXH ÀDVKLQJ 3XVKWKH/HIW5LJKWEXWWRQVWRFKDQJHZKLFKVHJPHQWLVWKHFXUUHQWO\
DFWLYHYDOXH PRQWKGD\\HDU 3XVKWKH5LJKWEXWWRQXQWLOWKHQH[WSURPSWLVGLVSOD\HG
7KH&RQVROHGLVSOD\VKRZVWKH6(77,0(SURPSWZLWKWKHFXUUHQWWLPHVHWWLQJ7KHKRXUYDOXHZLOOEHWKHFXUUHQWO\DFWLYHYDOHV ÀDVKLQJ 3XVK
WKH,QFUHDVH'HFUHDVHEXWWRQVWRDGMXVWWKHFXUUHQWO\DFWLYHYDOXH ÀDVKLQJ 3XVKWKH/HIW5LJKWEXWWRQVWRFKDQJHZKLFKVHJPHQWLVWKHFXUUHQWO\
DFWLYHYDOXH KRXUPLQXWH$0RU30 3XVKWKH5LJKWEXWWRQXQWLOWKHQH[WSURPSWLVGLVSOD\HG
7KH&RQVROHGLVSOD\VKRZVWKHFXUUHQW6RIWZDUH9HUVLRQ
3XVKWKH5LJKWEXWWRQWRJRWRWKHQH[WRSWLRQ
7KH&RQVROHGLVSOD\VKRZVWKHFXUUHQW0&%9HUVLRQ
3XVKWKH5LJKWEXWWRQWRJRWRWKHQH[WRSWLRQ
7KH&RQVROHGLVSOD\VKRZVWKH9,(:(55250(66$*(6SURPSW3XVKWKH(17(5EXWWRQWRVHOHFWWKLVRSWLRQ7KH&RQVROHGLVSOD\VKRZV
(55259(56,21;3XVKWKH5LJKWDUURZEXWWRQWRYLHZWKHHUURUFRGHV
3XVK67233$86(WRH[LWWKHHUURUORJ
7KH&RQVROHGLVSOD\VWKH581+2856IRUWKHPDFKLQH
3XVKWKH5LJKWEXWWRQ
7KH&RQVROHGLVSOD\VWKH&2162/(5(6(7SURPSW&RQVROH5HVHWHUDVHVWKHVHWWLQJVRIWKH8VHU3UR¿OHVDQGDOO:RUNRXWV
Note:,I\RXZDQWWRUHVHWWKH&RQVROHSXVKWKH(17(5EXWWRQ3XVKWKH,QFUHDVH'HFUHDVHEXWWRQVWRVHOHFWWKH³&2162/(5(6(7
<(6´RSWLRQDQGSXVK(17(57KH&RQVROHZLOOUHVHW3XVK67233$86(WRUHWXUQWRWKH3RZHU8S0RGHVFUHHQ
3XVKWKH5LJKWEXWWRQ
7KH&RQVROHGLVSOD\VWKH6281'83*5$'(SURPSW
Note:,I\RXKDYHDQXSGDWHIRUWKHVRXQGVLQVHUWWKH86%)ODVK'ULYHZLWKWKHXSGDWH¿OHLQWRWKH&RQVROHDQGSXVKWKH(17(5EXWWRQ
3XVKWKH,QFUHDVH'HFUHDVHEXWWRQVWRVHOHFWWKH³6281'83*5$'(<(6´RSWLRQDQGSXVK(17(57KH&RQVROHZLOOGLVSOD\
³6$9,1*´DQGWKHQ³5(029(86%´ZKHQLWLVVDIHWRUHPRYHWKH86%)ODVK'ULYH7KH&RQVROHZLOOH[LWWKH0DFKLQH6HWWLQJV
0RGHDQGUHWXUQWRWKH3RZHU8S0RGHVFUHHQ
3XVKWKH5LJKWEXWWRQWRH[LWWKH0DFKLQH6HWWLQJV0RGHDQGUHWXUQWRWKH3RZHU8S0RGHVFUHHQ
44
Assembly / Owner’s Manual
Maintenance
5HDGDOOPDLQWHQDQFHLQVWUXFWLRQVIXOO\EHIRUH\RXVWDUWDQ\UHSDLUZRUN,QVRPHFRQGLWLRQVDQDVVLVWDQWLVUHTXLUHGWRGRWKHQHFHVVDU\WDVNV
(TXLSPHQWPXVWEHUHJXODUO\H[DPLQHGIRUGDPDJHDQGUHSDLUV7KHRZQHULVUHVSRQVLEOHWRPDNHVXUHWKDWUHJXODUPDLQWHQDQFHLV
done. Worn or damaged components must be repaired or replaced immediately. Only manufacturer supplied components can be
used to maintain and repair the equipment.
To reduce the risk of electrical shock or unsupervised usage of the equipment, always unplug the power cord from
WKHZDOORXWOHWDQGRUWKHPDFKLQHDQGZDLWPLQXWHVEHIRUHFOHDQLQJPDLQWDLQLQJRUUHSDLULQJWKHPDFKLQH3ODFHWKHSRZHUFRUGLQD
secure location.
Daily:
%HIRUHHDFKXVHLQVSHFWIRUORRVHEURNHQGDPDJHGRUZRUQSDUWV'RQRWXVHWKHPDFKLQHLIDQ\RIWKHVHFRQGLWLRQVH[LVW$IWHU
HDFKZRUNRXWXVHDGDPSFORWKWRZLSH\RXUPDFKLQHDQG&RQVROHIUHHRIPRLVWXUH
Note:$YRLGH[FHVVLYHPRLVWXUHRQWKH&RQVROH
Weekly:
&KHFNIRUVPRRWKUROOHURSHUDWLRQ&OHDQWKHPDFKLQHWRUHPRYHGXVWGLUWRUJULPH&OHDQWKHWRSRIWKHEHOWZLWKDVOLJKWO\GDPS
VRDS\FORWKDQGZLSHFDUHIXOO\DQGWKRURXJKO\ZLWKDGU\FORWK'RQRWOHWDQ\OLTXLGJHWEHORZWKHEHOWVRULQWRWKH%DVH)UDPH
0RQWKO\
0DNHVXUHDOOEROWVDQGVFUHZVDUHWLJKW7LJKWHQLIQHFHVVDU\
NOTICE:'RQRWFOHDQZLWKDSHWUROHXPEDVHGVROYHQWRUDQDXWRPRWLYHFOHDQHU%HVXUHWRNHHSWKH&RQVROHIUHHRIPRLVWXUH
Walking Belt and Deck Lubrication
7KH7UHDG&OLPEHUŠPDFKLQHLVHTXLSSHGZLWKDORZPDLQWHQDQFHGHFNDQGEHOWV\VWHP%HOWIULFWLRQFDQDIIHFWWKHIXQFWLRQDQGOLIHRIWKHPDFKLQH
Lubrication Schedule
User Level
7RWDO:RUNRXW+RXUVSHU:HHN
When to Lubricate
Light
less than 3 hours
every 3 months
Moderate
3 to 5 hours
every 2 months
Heavy
5 or more hours
every month
:HUHFRPPHQGWKDW\RXXVHRQHRIWKHIROORZLQJ
• /XEH1:DONŠ7UHDGPLOO/XEULFDWLRQ.LW DYDLODEOHIURPZZZERZIOH[FRPRU\RXUORFDOVSHFLDOW\ILWQHVVGHDOHU
• SXUHVLOLFRQHDYDLODEOHDWPRVWKDUGZDUHDQGDXWRSDUWVVWRUHV
6LOLFRQHOXEULFDQWLVQRWLQWHQGHGIRUKXPDQFRQVXPSWLRQ.HHSRXWRIUHDFKRIFKLOGUHQ6WRUHLQDVDIHSODFH
$V\RXXVH\RXU¿WQHVVPDFKLQHWKH&RQVROHZLOOVKRZ³127(/8%5,&$7(%(/7´IROORZHGE\³5(9,(:86(50$18$/´DWVHWWLPHV7KLVLVRQO\
DUHPLQGHUDQGVKRXOGEHDGGHGWR\RXULQVSHFWLRQVFKHGXOH2QO\DSSO\OXEULFDQWDVQHFHVVDU\3XVKWKH(17(5EXWWRQWRDFFHSWWKHUHPLQGHU
)RUWKHEHVWUHVXOWVOXEULFDWHWKH7UHDGOHVSHULRGLFDOO\ZLWKDVLOLFRQHOXEULFDQWXVLQJWKHIROORZLQJLQVWUXFWLRQV
8QSOXJWKHPDFKLQHIXOO\IURPWKHZDOORXWOHWDQGUHPRYHWKHSRZHUFRUGIURPWKHPDFKLQH3ODFHWKHSRZHUFRUGLQDVHFXUHORFDWLRQ
45
Assembly / Owner’s Manual
&DUHIXOO\OLIWHDFKEHOWDQGDSSO\VLOLFRQHOXEULFDQWLQWKHFHQWHURIWKH7UHDGOHGHFNDORQJWKHHQWLUHUHDFKDEOHOHQJWKRIWKHGHFN$SSO\WR
R]RIWKHOXEULFDQWRQWKHGHFNXQGHUQHDWKHDFKEHOW
NOTICE: $OZD\VXVHDSXUHVLOLFRQHOXEULFDQW'RQRWXVHDGHJUHDVHUOLNH:'Š spray lubricant or a petroleum based product as
this could seriously impact performance.
Note:7KH:DONLQJ%HOWVPD\QHHGWREHORRVHQHGWRDOORZIRUDFFHVVGXULQJOXEULFDWLRQ&RQVXOWWKH³$GMXVWLQJWKH:DONLQJ%HOWV´SURFHGXUH
if necessary.
3. Connect the power cord back into the machine and then into the wall outlet.
4. Stay to one side of your machine.
5. Switch on your machine and start the belts at the slowest speed. Let the belts operate for approximately 15 seconds.
6. Switch off your machine.
7DNHFDUHWRFOHDQXSDQ\H[FHVVOXEULFDQWIURPWKH7UHDGOHV:HDOVRUHFRPPHQGDSHULRGLFLQVSHFWLRQRIWKH7UHDGOHVXUIDFHVEHORZWKHEHOWV
,IWKHGHFNVDSSHDUZRUQFRQWDFWD&XVWRPHU6HUYLFH5HSUHVHQWDWLYH
7RGHFUHDVHWKHSRVVLELOLW\RIVOLSSLQJEHVXUHWKH7UHDGOHDUHDLVIUHHIURPJUHDVHRURLO&OHDQRIIDQ\H[FHVVRLOIURPWKHPDFKLQH
surfaces.
46
Assembly / Owner’s Manual
Walking Belt Alignment
7KHZDONLQJEHOWVQHHGWREHDGMXVWHGLIWKH\DUHRXWRIFHQWHUHQRXJKWRFDXVHDUXEELQJRUVFUDSLQJVRXQG$GMXVWPHQWVFDQEHPDGHDWWKH)URQW
5ROOHURIHDFK7UHDGOH
Adjusting the Walking Belts –:KLOHRSHUDWLQJWKHPDFKLQHQRWLFHZKHUHWKHEHOWVUXQRQHDFK7UHDGOH7KH:DONLQJ%HOW$GMXVWPHQW%ROWVDUHRQ
WKHIURQWHQGRIHDFK5ROOHU,IWKHEHOWLVWUDFNLQJWRRIDUWRWKHULJKWXVHDSURSHUO\VL]HG+H[.H\WRWXUQWKHULJKWDGMXVWPHQWEROWFORFNZLVHRQWKDW
EHOWLQIXOOWXUQLQFUHPHQWV,IWKHEHOWWUDFNVWRRIDUWRWKHOHIWGRWKHVDPHWKLQJRQWKHOHIWDGMXVWPHQWEROW
Note: Do not turn the bolts counterclockwise when you adjust the belt alignment.
Belt Tension Adjustment – &KHFNWKHEHOWWHQVLRQRQO\ZKHQWKHPDFKLQHLVXQSOXJJHG)URPWKHEHOW¶VPLGSRLQWDFRUUHFWO\WHQVLRQHGEHOWVKRXOG
RQO\KDYHDQLQFKRIJLYH7RFKHFNSXOOWKHEHOWXSZDUGDWLWVPLGSRLQWDQGPHDVXUHWKHGLVWDQFHWRWKHGHFN,IWKHGLVWDQFHLVPRUHWKDQDQLQFK
WKHEHOWLVORRVH7RWLJKWHQWXUQERWK:DONLQJ%HOW$GMXVWPHQW%ROWVFORFNZLVHRQHKDOIDWXUQDQGFKHFNWHQVLRQDJDLQ5HSHDWWKLVVWHSLIQHFHVVDU\
Note:%ROWVDUHWXUQHGFRXQWHUFORFNZLVHHTXDOO\WRGHFUHDVHEHOWWHQVLRQ
:DONLQJ%HOW
$GMXVWPHQW%ROWV
47
Assembly / Owner’s Manual
Maintenance Parts
&RQVROH$VVHPEO\
Left Upright
+DQGOHEDU$VVHPEO\
Power Cord
Shocks
5HDU&RYHU
5LJKW8SULJKW
5HDU6WHS
Safety Key
Left Motor Cover
5LJKW0RWRU&RYHU
-XQFWLRQ&RYHU5LJKW
7UHDGOH$VVHPEO\
-XQFWLRQ&RYHU/HIW
Front Motor Cover
48
Assembly / Owner’s Manual
Maintenance Parts (Treadle Assembly)
,*86%XVKLQJ
$&,QOHW
Side Foot Support
Platform
7UHDGOH6WRS
)URQW5ROOHU
:DONLQJ%HOW
Lower Walking
$GMXVWPHQW
%HOW*XLGH
Screw
5HDU5ROOHU
:DONLQJ%HOW
Guide
Motor Control
%RDUG
'ULYH%HOW
Drive Motor
49
Assembly / Owner’s Manual
Troubleshooting
&RQGLWLRQ3UREOHP
Things to Check
8QLWZLOOQRWSRZHUXSWXUQRQVWDUW Outlet
Solution
0DNHVXUHRXWOHWLVIXQFWLRQLQJFRUUHFWO\9HULI\WKLVE\SOXJJLQJDQRWKHU
GHYLFH H[ODPS LQWRWKHRXWOHW,IRXWOHWLVFRQQHFWHGWRDOLJKWVZLWFK
FKHFNWRPDNHVXUHLWLVRQ,IRXWOHWLVQRWIXQFWLRQLQJ¿QGDZRUNLQJ
outlet.
Power cord not plugged in
0DNHVXUHWKHSRZHUFRUGLV¿UPO\VHFXUHGWR$&LQOHWRQWKHXQLWDQG
¿UPO\LQVHUWHGLQWRDQRQ*),$)&,ZDOOVRFNHW
Power switch turned off
0DNHVXUHWKHSRZHUVZLWFKDWWKHULJKWVLGHRIWKHXQLWLVLQWKH³21´
position. Switch will light up red to indicate power is present.
Safety key not plugged in
3OXJ6DIHW\.H\LQWR&RQVROH 6HH(PHUJHQF\6WRS3URFHGXUH If problem persists
Contact Customer Service.
Speed displayed is not accurate
Display set to wrong unit of mea
VXUH (QJOLVK0HWULF
&KDQJHGLVSOD\XQLWVLQWKH8VHU3UR¿OHVHWWLQJV
Walking belt misalignment
5HDUEHOWJXLGHV
%HOWVVKRXOGULGHRQWRSRIWULDQJXODUEODFNEHOWJXLGHVDWUHDURI
treadles.
7UDFNLQJDGMXVWPHQW
%HOWVDUHQRWUHTXLUHGWREHSHUIHFWO\FHQWHUHGDQGDUHW\SLFDOO\IDUWKHU
RXWLQWKHUHDUWKDQWKH\DUHLQWKHIURQW7KLVPD\YDU\GHSHQGLQJRQ
user’s stride. If belt is tracking to one side far enough to cause rubbing
RIEHOWFRQVXOWWKH³$GMXVWLQJWKH:DONLQJ%HOWV´SURFHGXUH
%HOWDOLJQPHQW
&KHFNZDONLQJEHOWDOLJQPHQW%HOWFRQWDFWZLWKPHWDOJXLGHVXQGHU
7UHDGOHFDQPDNHDORXGJULQGLQJVRXQG,IEHOWVDUHPLVDOLJQHGDGMXVW
walking belt.
5ROOHUVRUPRWRU
Contact Customer Care for further assistance.
Hesitation or belt slipping when
walking on unit
Walking belt tension
$GMXVWZDONLQJEHOWWHQVLRQE\IROORZLQJWKH³$GMXVWLQJWKH:DONLQJ%HOW´
procedure.
Knocking noises when unit is
operating
Igus bushing
,INQRFNLQJVRXQGVHHPVWREHFRPLQJGLUHFWO\IURPWKHUHDUUROOHU
FKHFN,JXV ZKLWH³KDW´VKDSHG EXVKLQJVDQGUHSODFHLIFUDFNHG
Shock bolts
Check and tighten both upper and lower bolts that connect the shocks
to the unit.
Safety key
3OXJ6DIHW\.H\LQWR&RQVROH 6HHEmergency Stop Procedure in Safety
:DUQLQJ/DEHOVVHFWLRQ Motor overload
8QLWPD\EHRYHUORDGHGDQGGUDZLQJWRRPXFKFXUUHQWFDXVLQJXQLW
to shut power down to protect motor. Consult belt lubrication schedule
WRGHWHUPLQHLIEHOWVQHHGOXEULFDWLRQFKHFNZDONLQJEHOWWHQVLRQDQG
restart unit.
Outlet
Outlet may not have enough power available for the machine due to
RWKHUGHYLFHVRQVDPHFLUFXLW5HPRYHDQ\GHYLFHVIURPSRZHUFLUFXLW
and restart machine.
&RQVROHGLVSOD\V³,16(57
6$)(7<.(<´
Safety Key
Insert Safety Key into Safety Key Port on Console.
&RQVROHGLVSOD\V³127(
/8%5,&$7(%(/7´IROORZHGE\
³5(9,(:86(50$18$/´
%HOWOXEULFDWLRQ
&RQVXOWOXEULFDWLRQVFKHGXOHDQGDSSO\LIQHFHVVDU\3XVK(17(5EXW
ton to exit the notice.
&RQVROHGLVSOD\V³(5525
&20081,&$7,21´IROORZHGE\
³5(67$570$&+,1(´
,2&DEOHV
5HVWDUWPDFKLQH,IHUURUSHUVLVWVFRQWDFW&XVWRPHU6HUYLFHIRUIXUWKHU
assistance.
&RQVROHGLVSOD\V³(5525
02725%2$5'´IROORZHGE\
³&217$&76833257´
0RWRU&RQWURO%RDUG
Contact Customer Service for further assistance.
Speed dependent grinding or
scraping noise
%HOWVVWRSWXUQLQJZKLOHLQXVH
50
Assembly / Owner’s Manual
&RQVROHGLVSOD\V³(5525
29(5/2$'´IROORZHGE\³&22/
'2:10,1´
Motor Covers
Cycle power off and allow the machine to cool down for at least 20 min
XWHV%HVXUHWKH0RWRU&RYHUYHQWVDUHIUHHRIGHEULV,ILVVXHUHFXUV
contact Customer Service for further assistance.
&RQVROHGLVSOD\V³(552502
725:,5(´IROORZHGE\³&21
7$&76833257´
Motor Connections
Contact Customer Service for further assistance.
&RQVROHGLVSOD\V³(5525
678&.%87721´IROORZHGE\
³1DPHRI%87721´
6SHFL¿HGEXWWRQ
5HOHDVHVSHFL¿HGEXWWRQ,IHUURUSHUVLVWVPDNHQRWHRIWKHVWXFNEXWWRQ
and contact Customer Service for further assistance.
&RQVROHGLVSOD\V³3/($6(
&<&/(32:(5´DQGRQHRIWKH
IROORZLQJ³0&%&200/267´
³0&%5(/<678&.&/6'´
³0&%5(/<678&.23(1´
³0&%7$&+29(563(('´
³0&%7$&+7,0(287³³0&%
&2007,0(287´³0&%29(5
&855(162&´³0&%29(5
&855(&5,7´³0&%29(5
&855('0$*´DQG³0&%+:
29(5663(('´
0RWRU&RQWURO%RDUG
5HVWDUWPDFKLQH,IHUURUSHUVLVWVFRQWDFW&XVWRPHU6HUYLFHIRUIXUWKHU
assistance.
51
Assembly / Owner’s Manual
Bowflex™ Body Weight Loss Guide
Introduction and Overview
:HOFRPHWRWKH%RZÀH[Œ%RG\:HLJKW/RVV*XLGH7KLVJXLGHLVGHVLJQHGWREHXVHGZLWK\RXU%RZÀH[ŠHTXLSPHQWDQGZLOOKHOS\RX
• Lose weight and get lean
• Improve your health and wellness
• Increase your energy and vitality
&RQVXOWDSK\VLFLDQEHIRUH\RXVWDUWDQH[HUFLVHSURJUDPRUDQHZKHDOWKDQGGLHWSODQ6WRSH[HUFLVLQJLI\RXIHHOSDLQRUWLJKWQHVV
in your chest, become short of breath, or feel faint. Contact your doctor before you use the machine again. Use the values calcuODWHGRUPHDVXUHGE\WKHPDFKLQH·VFRPSXWHUIRUUHIHUHQFHSXUSRVHVRQO\7KHKHDUWUDWHGLVSOD\HGRQWKHFRQVROHLVDQDSSUR[Lmation and should be used for reference only.
%\IRFXVLQJRQWKHPDLQWKUHHHOHPHQWVRIWKH%RZÀH[Œ%RG\:HLJKW/RVV*XLGHTXDOLW\EDODQFHDQGFRQVLVWHQF\\RX¶OOEHDEOHWRUHDFKDQG
PDLQWDLQ\RXUZHLJKWORVVDQG¿WQHVVJRDOVIRUWKHQH[WVL[ZHHNVDQGEH\RQG
• Quality±7KHHPSKDVLVRIWKLVSODQLVRQHDWLQJPRUHZKROHIRRGVDQGJHWWLQJWKHPRVWQXWULHQWVIURP\RXUFDORULHVDVSRVVLEOH0DNLQJWKH
PDMRULW\RI\RXUGLHWIURPIRRGVWKDWKDYHDVLQJOHLQJUHGLHQW IRUH[DPSOHIUXLWVYHJHWDEOHV¿VKOHDQSURWHLQHJJVEHDQVQXWVDQGZKROH
JUDLQV SURYLGHVWKHYLWDPLQVPLQHUDOV¿EHUSURWHLQDQGKHDOWK\IDWV\RXUERG\QHHGV
• Balance±(DFKRIWKHPHDOVDQGVQDFNVLQWKLVJXLGHKDYHDVRXUFHRI¿EHURUVPDUWFDUERK\GUDWHSURWHLQDQGKHDOWK\IDWWRNHHS\RXU
HQHUJ\OHYHOVFRQVLVWHQWWKURXJKRXWWKHGD\WRIXHO\RXUZRUNRXWV%\KDYLQJWKLVEDODQFH\RX¶OOIHHOIXOOHUORQJHUZKLFKLVFULWLFDOWRZHLJKWORVV
success.
• Consistency±*HWWLQJDERXWWKHVDPHQXPEHURIFDORULHVHDFKGD\LVLPSRUWDQWIRU\RXUPHWDEROLVPDQG\RXUPLQGVHW,I\RXRYHUGRLWRQH
GD\GRQ¶WWU\WRPDNHXSIRULWWKHQH[WGD\E\QRWHDWLQJRUFXWWLQJ\RXUFDORULHVGUDVWLFDOO\*HWULJKWEDFNRQWUDFNE\IROORZLQJWKLVJXLGH
Results & Expectations
5HVXOWVZLOOYDU\GHSHQGLQJRQ\RXUDJHVWDUWLQJZHLJKWDQGH[HUFLVHOHYHO%\DGKHULQJWRDGLHWDQGH[HUFLVHURXWLQH\RXPD\ORVHOEVSHU
week and experience increased energy levels.
5 Tips for Long-Term Success
.HHSDIRRGORJLQFOXGLQJKXQJHUOHYHOVDQGZDWHULQWDNH)UHHRQOLQHIRRGORJVDQGPRELOHDSSVDUHDYDLODEOHDWZZZP\¿WQHVVSDOFRPDQG
www.loseit.com
:HLJKDQGRUWDNHPHDVXUHPHQWVZHHNO\±QRPRUHDQGQROHVV:HLJKLQJZHHNO\UDWKHUWKDQGDLO\RUHYHU\RWKHUGD\LVEHVW<RX¶OOWUDFN
\RXUSURJUHVVDQGNHHS\RXUVHOILQFKHFNZLWKRXWJHWWLQJGLVFRXUDJHGLIWKHVFDOHGRHVQ¶WPRYHIRUDIHZGD\V$QGUHPHPEHUZHLJKWLVMXVW
DQXPEHUDQGLW¶VLQÀXHQFHGE\PXVFOHJDLQDVZHOODVIDWORVV)HHOLQJKRZ\RXUFORWKHV¿WFDQRIWHQEHDEHWWHULQGLFDWRURISURJUHVVDV\RXU
body adapts to exercise and nutrition changes.
3. 0HDVXUHSRUWLRQV±7RDYRLGSRUWLRQFUHHSXVHPHDVXULQJFXSVDQGVSRRQVIRUJUDLQV ULFHSDVWDFHUHDO EHDQVQXWVRLOVDQGGDLU\8VH
WKH3RUWLRQ6L]HV*XLGHIRURWKHUIRRGV
4. Plan ahead±0DNHDPHDOSODQIRUWKHZHHNRUORJ\RXUIRRGDGD\LQDGYDQFH3ODQQLQJVHWV\RXXSIRUVXFFHVVHVSHFLDOO\IRUVRFLDOHYHQWV
and eating out.
Practice your desired long-term habits±,W¶VHDV\WRMXVWLI\SRRUHDWLQJFKRLFHVZKHQ\RX¶UHRQO\IRFXVHGRQWKHVKRUWWHUP)RFXVRQWKH
ORQJWHUPVDWLVIDFWLRQRIDVOLPPHUKHDOWKLHU\RXUDWKHUWKDQWKHWHPSRUDU\JUDWL¿FDWLRQ\RX¶OOJHWIURPVSOXUJLQJ
How to Use this Guide
• (DWEUHDNIDVWZLWKLQPLQXWHVRIZDNLQJXSDQGEDODQFH\RXUPHDOVDQGVQDFNVWKURXJKRXWWKHGD\
±'RQ¶WJRORQJHUWKDQKRXUVZLWKRXWHDWLQJ
±,I\RX¶UHQRWXVHGWRHDWLQJEUHDNIDVWVWDUWRXWVPDOOZLWKDSLHFHRIIUXLWDQGKDYHVRPHWKLQJHOVHKRXUVODWHU<RXUERG\DGDSWVWR
QRWHDWLQJEUHDNIDVWEXWDVVRRQDV\RXVWDUWHDWLQJHDUO\LQWKHGD\DQGFXWWLQJEDFNRQGLQQHUSRUWLRQV\RX¶OOQRWLFH\RXUKXQJHUZLOO
LQFUHDVH7KLVLVDJRRGVLJQ\RXUPHWDEROLVPLVZRUNLQJ
• 0L[DQGPDWFKPHDORSWLRQV
±6HOHFWRSWLRQIURPWKHDSSURSULDWHPHDOSODQ PDOHRUIHPDOH IRUEUHDNIDVWOXQFKDQGGLQQHUSD\LQJFORVHDWWHQWLRQWRSRUWLRQVL]HV
±6HOHFWVQDFNRSWLRQVSHUGD\
±<RXKDYHWKHRSWLRQWRVXEVWLWXWHRQHVQDFNIRURQHWUHDWXQGHUFDORULHV
±8VHWKHPHDOSODQVDPSOHRSWLRQVDQGJURFHU\OLVWWRFUHDWH\RXURZQPHDOVIRUPRUHYDULHW\
52
Assembly / Owner’s Manual
±<RXFDQVZDSRXWDQ\W\SHRISURWHLQYHJHWDEOHVRUVPDUWFDUEVIRUWKHVXJJHVWHGPHDORSWLRQV)RUH[DPSOH
•
7XUNH\IRUWXQD
•
$Q\¿VKRUVHDIRRGIRUFKLFNHQ
•
Cooked vegetables instead of salad
• Eat your calories
±&XWRXWKLJKFDORULHEHYHUDJHVOLNHVRGDMXLFHVFRIIHHGULQNVDQGDOFRKRO
±6WLFNZLWKZDWHUXQVZHHWHQHGWHDDQGFRIIHH$LPIRUDPLQLPXPRIR] OLWHUV RIZDWHUSHUGD\WRVWD\ZHOOK\GUDWHG
• ,I\RX·UHVWLOOKXQJU\DIWHURULQEHWZHHQPHDOV
±+DYHDJODVVRIZDWHUDQGZDLWPLQXWHV0DQ\WLPHVZHPLVWDNHWKLUVW RUHYHQERUHGRP IRUKXQJHU:DLWRXWWKHLQLWLDOXUJHWRHDW
and sometimes it will pass.
±,I\RX¶UHVWLOOKXQJU\DIWHUZDLWLQJPLQXWHVKDYHDVQDFNRUPLQLPHDOZLWKIUXLWYHJHWDEOHVDQGSURWHLQ
If your goal is muscle gain or strength:
• 8VHWKHVDPHPHDOSODQEXWLQFUHDVHSRUWLRQVL]HVLQWKHVDPHUDWLRVWRLQFUHDVHWKHWRWDOQXPEHURIFDORULHV\RXHDWHYHU\GD\)RUH[DPSOH
LQFUHDVHSRUWLRQVL]HVRISURWHLQDQGVPDUWFDUEVDWPHDOVE\$GGLQJDVQDFNLVDQRWKHURSWLRQWRPHHW\RXUERG\¶VLQFUHDVHGFDORULH
needs in order to gain muscle and strength.
• )RFXVRQSRVWZRUNRXWQXWULWLRQE\KDYLQJRQHRI\RXUVQDFNVZLWKLQPLQXWHVDIWHU\RXFRPSOHWH\RXUZRUNRXW0DNHVXUHWRKDYHDFRP
ELQDWLRQRIFDUERK\GUDWHVVXFKDVIUXLWZLWKSURWHLQ \RJXUWPLONRUSURWHLQSRZGHU WRSURPRWHPXVFOHJURZWKDQGUHFRYHU\&KRFRODWHPLONLV
also a great option.
Meal Plan Overview
7KHIHPDOHPHDOSODQSURYLGHVDERXWFDORULHVDQGWKHPDOHSODQSURYLGHVDERXWFDORULHVRIKLJKTXDOLW\QXWULWLRQWRQRWRQO\KHOS\RX
ORVHZHLJKWDQGIHHOJUHDWEXWJHWWKHPRVWRXWRI\RXUFDORULHV7KHYLWDPLQVPLQHUDOVDQGDQWLR[LGDQWVIURPHDWLQJPRVWO\ZKROHIRRGVKHOSVXS
SRUWRSWLPDOKHDOWK7KHVHFDORULHOHYHOVZLOOUHVXOWLQKHDOWK\ZHLJKWORVVIRUWKHPDMRULW\RISHRSOH.HHSLQPLQGWKDWHYHU\RQH¶VPHWDEROLVPLVYHU\
GLIIHUHQWGHSHQGLQJRQDJHKHLJKWZHLJKWDFWLYLW\OHYHODQGJHQHWLFV3D\FORVHDWWHQWLRQWR\RXUZHLJKWKXQJHUOHYHOVDQGHQHUJ\DQGDGMXVW\RXU
calories if needed.
)ROORZWKHVHJXLGHOLQHVLI\RX·UHRYHU
• ,I\RX¶UHRYHU\RXQHHGIHZHUFDORULHVEHFDXVH\RXUPHWDEROLVPVORZVDV\RXDJH6WLFNZLWKWKUHHPHDOVZLWKRQHRSWLRQDOVQDFNSHUGD\
)ROORZWKHVHJXLGHOLQHVLI\RX·UHXQGHU
• ,I\RX¶UHXQGHU\RXPD\QHHGPRUHFDORULHV$GGDQRWKHUVQDFNLI\RXIHHOORZRQHQHUJ\RUDUHH[WUHPHO\KXQJU\
Breakfast
%UHDNIDVWLQFOXGHVDVPDUWFDUEIUXLWDQGDVRXUFHRISURWHLQZKLFKZLOODOVRKDYHIDW:LWKDEDODQFHRIFDUERK\GUDWHVDQG¿EHUIURPWKHVPDUWFDUE
DQGIUXLWFRPELQHGZLWKSURWHLQDQGIDW\RX¶OOHQHUJL]H\RXUGD\DQGKHOSFRQWUROKXQJHUOHYHOVWKURXJKRXWWKHGD\
Snacks
(DFKVQDFNLVDEDODQFHRIFDUERK\GUDWHVDQGSURWHLQWRNHHS\RXUEORRGVXJDUPRUHFRQVLVWHQWZKLFKPHDQV\RXZRQ¶WH[SHULHQFHKXQJHUDQG
energy level spikes and drops.
7KLVKDSSHQVZKHQ\RXKDYHDKLJKFDUERQO\VQDFNOLNHFKLSVFDQG\VRGDFUDFNHUVRUSUHW]HOV
Lunch and Dinner
/XQFKFRPELQHV¿OOLQJ¿EHUIURPYHJHWDEOHVDQGVPDUWFDUEVZLWKDOHDQRUORZIDWSURWHLQ7KHKHDOWK\IDWFDQFRPHHLWKHUIURPWKHSURWHLQDGGHG
GXULQJFRRNLQJ QXWVRQDVDODG RUDVDGUHVVLQJRUVDXFH VXFKDVRLODQGYLQHJDUVDODGGUHVVLQJ 53
Assembly / Owner’s Manual
+HUH¶VDQRYHUYLHZRIZKDWDQLGHDOGD\ORRNVOLNH
6HH3RUWLRQ6L]H*XLGHIRUSURSHUVHUYLQJVL]HV
Breakfast
Snack #1
smart
rich
carbs
carb
protein
fruit
smart
carb
protein
veggies
SURWHLQIDW
Snack #2
Lunch
smart
carb
protein
healthy
fat
smart
carb
veggies
Dinner
smart
carb
protein
healthy
fat
veggies
54
Assembly / Owner’s Manual
protein
Breakfast Options
)UXLW
Smart Carb
3URWHLQ)DW
%HUULHVRUEDQDQD
)UXLWDQG1XW2DWPHDO Cook
SODLQRDWVLQZDWHU7RSZLWKIUXLW
QXWVPLONFLQQDPRQDQGKRQH\
Plain oats
5HJXODURUTXLFNFRRN
Nuts and milk
(JJ0XIÀQ&RRNHJJV7RDVW
bread and top with 1 slice of
FKHHVHVOLFHRIKDPDQG
tomato.
(QJOLVKPXI¿QRUVDQGZLFKWKLQ
(JJKDPDQGFKHHVH
2DWVZKHDWJHUPDQGJURXQG
ÀD[VHHG
3ODLQQRQIDW*UHHN\RJXUWDQG
nuts
7RPDWR
Yogurt Power Parfait7RS\RJXUW Chopped fruit of your choice
with fruit. Sprinkle with 1 serving
RIQXWVWEVSZKHDWJHUPRU
JURXQGÀD[VHHGWEVSRDWVDQG
cinnamon.
On the Go PB & Apple Sandwich7RDVWEUHDG6SUHDGRQ
SHDQXWEXWWHUWKLQVOLFHVRIòDQ
DSSOHDQGWHDVSRRQRIKRQH\
Sliced apple
6DQGZLFKWKLQEUHDGRUEDJHO
thin
Peanut butter
Lunch & Dinner Options
Lean Protein
Smart Carb
9HJJLHV
Pork Loin, Sweet Potato &
Green Beans
Grilled or baked pork loin
%DNHG6ZHHW3RWDWR
*UHHQ%HDQV
&KLFNHQ6WLU)U\
Flavor with 2 tablespoon teriyaki
sauce
Chicken breast or boneless skin
less thigh
%URZQRUZLOGULFH
Mixed stir fry vegetables
IUHVKRUIUR]HQ
Steak Tacos with Side Salad Flank or sirloin steak
IRUPDOHVIRUIHPDOHV 7RSZLWK
VDOVDFLODQWURDQGVSULQNOHRI
shredded cheese
Corn tortillas
Salad
Whole Wheat Pasta with
Shrimp or Cannellini Beans &
0DULQDUD6DXFH
6KULPS IUR]HQRUIUHVK RUFDQ
nellini beans
Whole wheat pasta
Steamed broccoli
Bunless Burgers with Oven
)ULHV&RUQ 6DODG
*ULOOEXUJHUV%DNHVOLFHGSRWD
toes on sprayed cookie sheet for
PLQXWHV#ƒ)
OHDQJURXQGEHHIRUWXUNH\
Oven baked fries
&RUQRQWKHFREVLGHVDODG
Tuna & Avocado Wrap with
9HJHWDEOH6RXS
8VHR]RIWXQD FDQ 7RSZLWK
OHWWXFHWRPDWRDYRFDGRDQG
mustard.
7XQD
+LJK¿EHUZUDS
9HJHWDEOHVRXS
KRPHPDGHRUORZVRGLXP
FDQQHG
55
Assembly / Owner’s Manual
Snack Options
Smart Carb
Protein
1 medium apple
DOPRQGV
%DE\FDUURWV
2 tbsp hummus
1 serving of crackers*
1 string cheese
Energy or protein bar with <200 calories*
6HHZZZ%RZÀH[FRP5HVRXUFHVIRUEUDQGUHFRPPHQGDWLRQV
Optional Treats
<RXKDYHWKHFKRLFHRIUHSODFLQJ6QDFNZLWKDFDORULHWUHDW<RXFDQKDYHDQRSWLRQDOWUHDWHYHU\GD\EXWIRURSWLPDOKHDOWKLWLVUHFRP
PHQGHGWROLPLWVPDOOVSOXUJHVWRWLPHVSHUZHHN8VHWKHDSSURDFKWKDWZRUNVEHVWIRU\RX+HUHDUHDIHZH[DPSOHV
• òFXSORZIDWLFHFUHDP
• 1 small bag of baked potato chips
• R]RIZLQHRUR]OLJKWEHHU
• FXSVRIDLUSRSSHGRUOLJKWSRSFRUQ
Sample 3 Day Plan
%DVHGRQHDFKRIWKHPHDORSWLRQVOLVWHGDERYHDW\SLFDOGD\SODQFRXOGORRNOLNHWKLV
'D\
'D\
Day 3
Breakfast
(JJPXI¿Q
Power yogurt parfait
)UXLWQXWRDWPHDO
6QDFN
$SSOHZLWKDOPRQGV
1XW7KLQV®VWULQJFKHHVH
%DE\FDUURWVDQGKXPPXV
Lunch
7XQD DYRFDGRZUDSZLWKVRXS
/HIWRYHUVIURPGLQQHUGD\
/HIWRYHUVIURPGLQQHUGD\
2SWLRQDO6QDFNRU7UHDW
òFXSLFHFUHDPEDU
Energy bar
100 calorie bag of light popcorn
Dinner
Shrimp pasta
Chicken stir fry
%XQOHVVEXUJHUV
56
Assembly / Owner’s Manual
Portion Size Guide
Each of the items listed are for one serving
MALE
FEMALE
PROTEIN
2 eggs
R]FKLFNHQ¿VKOHDQPHDWRUWRIX
FXSEHDQVRUOHQWLOV
1 cup greek yogurt*
R]FKHHVH
1 cup = baseball
1 egg
R]FKLFNHQ¿VKRUOHDQPHDW
FXSEHDQVRUOHQWLOV
FXSJUHHN\RJXUW R]FKHHVH
+($/7+<)$7
7EOVSQSHDQXWRUQXWEXWWHU WVSQROLYHÀD[RUZDOQXWRLO
FXSRIQXWV
PHGLXPDYRFDGR
1 tblspn peanut or nut butter*
WVSQROLYHÀD[RUZDOQXWRLO
FXSRUWDEOHVSRRQVRIQXWV DSSUR[DOPRQGV
PHGLXPDYRFDGR
60$57&$5%
FXSFRRNHGJUDLQV FXSUDZ RDWVEURZQULFH
TXLQRDSDVWD
1 medium sweet or regular potato
2 corn tortillas
VOLFHRIEUHDG RUOLJKWVOLFHVHTXDOLQJFDORULHV
RUOHVV
HQJOLVKPXI¿QVDQGZLFKWKLQRUKLJK¿EHUZUDS
FXSFRRNHG FXSUDZ JUDLQV
PHGLXPVZHHWSRWDWRRU
regular potato
2 corn tortillas
VOLFHRIEUHDG RUOLJKWVOLFHVHTXDOLQJFDORULHVRU
OHVV
HQJOLVKPXI¿QVDQGZLFKWKLQRUKLJK¿EHUZUDS
)58,7
1/2 cup = lightbulb
1 oz or 2 tbsp
= golf ball
1/4 cup nuts
= Altoids tin
PHGLXPDSSOHRUDQJHRUSHDU
VPDOOEDQDQD OHQJWKRI\RXUKDQG
1 cup berries or chopped fruit
FXSGULHGIUXLW IUHVKRUIUR]HQLVRSWLPDO
9HJHWDEOHV <RXFDQKDYHXQOLPLWHGYHJHWDEOHVH[FHSWIRUSHDVDQGFRUQVWLFNZLWKFXSVHUYLQJ
FXSVVSLQDFKRUOHWWXFH FXSSHGKDQGV
1 cup raw vegetables
FXSFRRNHGYHJHWDEOHV
R]ORZVRGLXPYHJHWDEOHMXLFH
3 oz chicken or meat
= deck of cards
OPTIONAL TREATS
FXSORZIDWLFHFUHDP
1 small bag of baked potato chips
R]GDUNFKRFRODWH
R]RIZLQHRUR]OLJKWEHHU
FXSVDLUSRSSHGRUOLJKWSRSFRUQ
1 medium potato
= computer mouse
* some foods are a combination of protein and carbs or protein and fat
1 medium piece of
fruit = tennis ball
1 -1/2 oz cheese
= 3 dice
57
Assembly / Owner’s Manual
Grocery List
BREAD & GRAINS
ZKROHZKHDWEUHDG
Sprouted grain breads
/LJKWRUZKROHZKHDWHQJOLVKPXI¿QV
Sandwich or bagel thins
&RUQRUORZFDUEZKROHZKHDWWRUWLOODV
+LJK¿EHUZUDSV
3ODLQRDWVPLQXWHRUROGIDVKLRQHG
:KROHJUDLQVEURZQULFHEXOJDUEDUOH\TXLQRDFRXVFRXV
7LSV/RRNIRUZKROHZKHDWDVWKH¿UVWLQJUHGLHQW/RRNIRUJRI
¿EHUSHUVOLFHRUJSHUVOLFHVRIOLJKWRUGLHWEUHDG$LPIRUEUHDGZLWK
less than 100 calories per slice.
'$,5< '$,5<$/7(51$7,9(6
&5$&.(5661$&.6 (1(5*<%$56
3ODLQQRQIDWJUHHN\RJXUW
.H¿U \RJXUWOLNHGULQN
2UJDQLFORZIDWPLON
Enriched almond or soy milk
&KHHVHIHWDSDUPHVDQPR]]DUHOODOLJKWKDYDUWLSURYRORQHVZLVV
VWULQJFKHHVHRUVLQJOHVHUYLQJSDFNDJHV
$Q\XQVDOWHGQXWVRUVHHGV
$LUSRSSHGRUOLJKWSRSFRUQ
Edamame in the pod
Energy bars
Crackers
Hummus
7LSV/LPLWFUDFNHUVSUHW]HOVDQGFKLSVWRVHUYLQJVSHUZHHN
$OZD\VSDLUZLWKSURWHLQVXFKDVKXPPXVFKHHVHRUQXWV/RRNIRU
energy bars with less than 200 calories and 20g of sugar and at least 3g
RISURWHLQDQGJRI¿EHU/RRNIRUFUDFNHUVZLWKOHVVWKDQFDORULHV
and 4g or less of fat per serving.
0($7),6+328/75< 3527(,1
Wild game
6DOPRQKDOLEXWWXQDWLODSLDVKULPS
FDW¿VKVFDOORSVRUFUDE
3RUNORLQSRUNFKRSVRUSRUNURDVW
&KLFNHQRUWXUNH\EUHDVWRUWKLJKV QRVNLQ
(JJVDQGHJJZKLWHV
/HDQEHHIVLUORLQFKXFNURXQGWHQGHUORLQOHDQ RUJDQLFDQG
JUDVVIHGLVEHVW
&DQQHGVDOPRQRUWXQD LQZDWHU
1LWUDWHIUHHUHGXFHGVRGLXPKDPWXUNH\FKLFNHQRUURDVWEHHIOXQFK
meat
$Q\W\SHRIEHDQGU\RUFDQQHGORZVRGLXPYDULHWLHV
7RIXDQGWHPSHK
)$76 2,/6
$YRFDGR
2OLYHJUDSHVHHGZDOQXWVHVDPHRUÀD[VHHGRLO
%XWWHUVSUHDGVORRNIRUSURGXFWVIUHHRIWUDQVIDWVDQGSDUWLDOO\
hydrogenated oils on the ingredient list.
7LSV/LJKWROLYHRLOUHIHUVWRWKHÀDYRUQRWWKHFDORULHFRQWHQW$OZD\V
PHDVXUHRLODQGEXWWHU(YHQLIDIDWLVFRQVLGHUHGKHDOWK\LW¶VVWLOOYHU\
high in calories and portions need to be controlled.
'5(66,1*6&21',0(176 6$8&(6
9LQHJDUVULFHZLQHEDOVDPLF
$OOIUHVKRUGULHGKHUEVDQGVSLFHV
Mustard
7LSV/RRNIRU³&KRLFH´RU³6HOHFW´FXWVRIPHDWUDWKHUWKDQ³3ULPH´
Salsa and chili sauce
Prime cuts are fattier. Limit intake of highly processed meat and
LPLWDWLRQPHDWSURGXFWVOLNHVDXVDJHEDFRQSHSSHURQLDQGKRWGRJVWR 0DULQDUDVDXFHZLWKQRKLJKIUXFWRVHFRUQV\UXS
Lemon and lime juice
once a week or less.
%RWWOHGPLQFHGJDUOLFDQGJLQJHU
)52=(1)22'6
/RZVRGLXPVR\VDXFH
$OOYHJHWDEOHVZLWKRXWVDXFH
7LSV/RRNIRUSURGXFWVIUHHRI06*DGGHGFRORUVDQGKLJKIUXFWRVH
$OOIUXLW
FRUQV\UXS/RRNIRUVDXFHVXQGHUFDORULHVSHUVHUYLQJ$YRLGFUHDP
Grains and grain medleys
EDVHGVDXFHVDQGGUHVVLQJVOLNHUDQFKEOHXFKHHVHDQGDOIUHGR
$OOIUXLWVDQGYHJHWDEOHVIUHVKDQGIUR]HQDUHJUHDWFKRLFHV6LQFHHYHU\PHDOKDVRQHRUERWK\RXUVKRSSLQJFDUWVKRXOGUHÀHFWWKLV
58
Assembly / Owner’s Manual
Keep It Going
Tips for continued weight loss and maintaining changes
• .HHSZHLJKLQJ\RXUVHOIZHHNO\HYHQDIWHU\RX¶YHUHDFKHG\RXUJRDOZHLJKW
• Continue keeping a food log.,I\RXKDYH\RXUPHDOSODQZHOOHVWDEOLVKHGORJ\RXUIRRGHYHU\RWKHUZHHNWRNHHS\RXUVHOIRQWUDFN'RQ¶W
feel like you have to do it every day.
• Prepare for plateaus.7KHVFDOHPLJKWQRWEXGJHIRUDIHZZHHNVRUHYHQPRQWKVDIWHUVRPHLQLWLDOZHLJKWORVV7KLVLVQRUPDODQGWREHH[
SHFWHG,W¶VWKHERG\¶VQDWXUDOSURFHVVIRUDGMXVWLQJWR\RXUQHZORZHUZHLJKW6WD\IRFXVHGRQ\RXUORQJWHUPJRDOFHOHEUDWH\RXUVXFFHVVHV
DQGFKDQJHVDQGPL[XS\RXUZRUNRXWVWRKHOSRYHUFRPHWKHSODWHDX
• Calorie adjustments for maintaining weight loss.2QFH\RX¶YHUHDFKHG\RXUJRDOZHLJKW\RXFDQLQFUHDVH\RXUFDORULHVSHUGD\
as long as your activity level stays the same
• Treat yourself.+DYHDQRQIRRGUHZDUGIRUHDFKJRDO\RXKLWVXFKDVDPDVVDJHDQHZRXW¿WRUDQRXWLQJZLWKIULHQGVDQGIDPLO\
• Use the resources belowWR¿QGQHZUHFLSHVJHWH[SHUWDGYLFHDQGVXSSRUWWRVWD\PRWLYDWHG
Resources
'RZQORDGDEOH5HVRXUFHVIURP%RZÁH[Œ:HEVLWH ZZZ%RZÀH[FRP5HVRXUFHV
• *URFHU\6KRSSLQJ/LVWIRU)ULGJH %ODQN)RUP
• 7 Day Meal Planning Form
• $GGLWLRQDO'LQQHU2SWLRQV
• Pre and Post Workout Fueling Guide
Questions & Support
• $VNTXHVWLRQVSRVWVXJJHVWLRQVDQGFRQQHFWZLWKRXURQOLQH%RZÀH[Œ'LHWLWLDQRQWKH%RZÀH[)DFHERRNSDJH
Recipes
• www.wholeliving.com
• www.eatingwell.com
• www.whfoods.org
• www.livebetteramerica.org
Online food logs
• ZZZP\¿WQHVVSDOFRP
• www.loseit.com
59
Assembly / Owner’s Manual
60
Assembly / Owner’s Manual
61
Assembly / Owner’s Manual
Buy Back Guarantee
:HZDQW\RXWRNQRZWKDW\RXU7UHDG&OLPEHUŠPDFKLQHLVDVXSHULRUSURGXFW<RXUVDWLVIDFWLRQLVJXDUDQWHHG,IIRUDQ\UHDVRQ\RXDUHQRW
VDWLV¿HGZLWK\RXU7UHDG&OLPEHUŠPDFKLQHSOHDVHIROORZWKHLQVWUXFWLRQVEHORZWRUHWXUQ\RXUPHUFKDQGLVHDQGUHFHLYHDUHIXQGRIWKHSXUFKDVH
SULFHOHVVVKLSSLQJDQGKDQGOLQJ
7KLV7UHDG&OLPEHUŠ%X\%DFN*XDUDQWHHDSSOLHVRQO\WRPHUFKDQGLVHSXUFKDVHGE\FRQVXPHUVGLUHFWO\IURP1DXWLOXV,QF7KLVJXDUDQWHHGRHVQRW
apply to sales made by dealers or distributors.
&DOOD7UHDG&OLPEHU5HSUHVHQWDWLYHDWIRUD5HWXUQ$XWKRUL]DWLRQ1XPEHU 50$ $Q50$ZLOOEHJUDQWHGLI
D7KH7UHDG&OLPEHUŠH[HUFLVHPDFKLQHZDVSXUFKDVHGGLUHFWO\IURP1DXWLOXV,QF
E7KHUHTXHVWWRUHWXUQWKHSURGXFWLVZLWKLQZHHNVRIWKHGHOLYHU\GDWHRI\RXUPHUFKDQGLVH
,IDQ50$LVJUDQWHGWKHIROORZLQJLQVWUXFWLRQVZLOOSUHYHQWGHOD\VLQWKHSURFHVVLQJRI\RXUUHIXQG
D7KHPHUFKDQGLVHPXVWEHUHWXUQHGWRWKHDGGUHVVJLYHQWR\RXDWWKHWLPHRIWKH5HWXUQ$XWKRUL]DWLRQ&DOO
E$OOUHWXUQHGPHUFKDQGLVHPXVWEHSURSHUO\SDFNDJHGLQJRRGFRQGLWLRQSUHIHUDEO\LQWKHRULJLQDOER[HV
F7KHH[WHULRURIWKHER[HVVKRXOGEHPDUNHGFOHDUO\ZLWK
5HWXUQ$XWKRUL]DWLRQ1XPEHU
Your Name
<RXU$GGUHVV
Your Phone Number
G$GGLWLRQDOO\DSLHFHRISDSHUZLWK\RXUQDPHDGGUHVVDQGSKRQHQXPEHURUFRSLHVRI\RXURULJLQDOLQYRLFHVKRXOGEHSODFHGLQHDFKER[
of merchandise.
e. <RXU50$QXPEHULVWLPHVHQVLWLYH<RXUVKLSPHQWPXVWEHSRVWPDUNHGZLWKLQWZRZHHNVIURPWKHGDWHWKH7UHDG&OLPEHU
5HSUHVHQWDWLYHLVVXHGWKH5HWXUQ$XWKRUL]DWLRQ1XPEHU
Note: You are responsible for return shipping and for any damage or loss to merchandise that occur during return shipment. Nautilus
recommends that you obtain tracking numbers and insure your shipment.
Unauthorized Returns
1DXWLOXV,QFGH¿QHVDQXQDXWKRUL]HGUHWXUQDVDQ\PHUFKDQGLVHUHWXUQHGWRRXUIDFLOLWLHVZLWKRXWDYDOLGDQGFXUUHQW5HWXUQ0HUFKDQGLVH
$XWKRUL]DWLRQ 50$ QXPEHULVVXHGE\1DXWLOXV)DLOXUHWRSURSHUO\PDUNSDFNDJHVZLWKDYDOLG50$QXPEHURUDOORZLQJDQ50$QXPEHUWRH[SLUH
ZLOOFDXVH1DXWLOXV,QFWRFRQVLGHUDUHWXUQXQDXWKRUL]HG$Q\PHUFKDQGLVHUHWXUQHGZLWKRXWD50$QXPEHUZLOOQRWEHVXEMHFWWRDUHIXQGRUFUHGLW
DQG1DXWLOXVZLOOGLVFDUGWKHSURGXFW7KHFXVWRPHUDVVXPHVDOOVKLSSLQJDQGKDQGOLQJFKDUJHVIRUDQ\XQDXWKRUL]HGUHWXUQ
62
Assembly / Owner’s Manual
Warranty
Who Is Covered
This warranty is valid only to the original purchaser and is not transferable or applicable to any other person(s).
What Is Covered
Nautilus, Inc. warrants that this product is free from defects in materials and workmanship, when used for the purpose intended, under normal conditions, and provided it receives
proper care and maintenance as described in the Product’s Assembly and Owner’s manual. This warranty is good only for authentic, original, legitimate machines manufactured by
Nautilus, Inc. and sold through an authorized agent and used in the United States or Canada.
Terms
•
Frame
2 years
•
Mechanical parts
2 years
•
Electronics
2 years
•
Shocks
2 years
•
Motor
2 years
•
All other components
2 years
•
Labor
90 days
(Labor support does not include the installation of replacement parts involved in the initial product assembly and preventative maintenance services. All repairs covered
under the labor portion of the warranty must be preauthorized by Nautilus.)
How Nautilus Will Support the Warranty
Throughout the terms of the warranty coverage, Nautilus, Inc. will repair any machine that proves to be defective in materials or workmanship. Nautilus reserves the right to replace
the product in the event a repair is not possible. When Nautilus determines replacement is the correct remedy, Nautilus may apply a limited credit reimbursement toward another
Nautilus, Inc. brand Product, at our discretion. This reimbursement may be prorated based on length of ownership. Nautilus, Inc. provides repair service within major metropolitan
areas. Nautilus, Inc. reserves the right to charge the consumer for travel outside these areas. Nautilus, Inc. is not responsible for dealer labor or maintenance charges beyond the
applicable warranty period(s) stated herein. Nautilus, Inc. reserves the right to substitute material, parts or products of equal or better quality if identical materials or products are
not available at the time of service under this warranty. Any replacement of the product under the terms of the Warranty in no way extends the original Warranty period. Any limited
credit reimbursement may be prorated based on length of ownership. THESE REMEDIES ARE THE EXCLUSIVE AND SOLE REMEDIES FOR ANY BREACH OF WARRANTY.
What You Must Do
•
Retain appropriate and acceptable Proof of Purchase.
•
Operate, maintain, and inspect the Product as specified in the Product Documentation (Assembly, Owner’s Manuals, etc.).
•
Product must be used exclusively for the purpose intended.
•
Notify Nautilus within 30 days after detecting an issue with the Product.
•
Install replacement parts or components in accordance with any Nautilus instructions.
•
Perform diagnostic procedures with a trained Nautilus, Inc representative if requested.
What Is Not Covered
•
Damage due to abuse, tampering or modification of the Product, failure to properly follow assembly instructions, maintenance instructions, or safety warnings as stated in the
Product Documentation (Assembly, Owner’s Manuals, etc), damage due to improper storage or the effect of environmental conditions such as moisture or weather, misuse,
mishandling, accident, natural disasters, power surges.
•
A machine placed or used in a commercial or institutional setting. This includes gyms, corporations, work places, clubs, fitness centers and any public or private entity that
has a machine for use by its members, customers, employees or affiliates.
•
Damage caused by exceeding maximum user weights as defined in the Product’s Owner’s manual or warning label.
•
Damage due to normal usage and wear and tear.
•
This warranty does not extend to any territories or countries outside the United States and Canada.
How to Obtain Service
For Products purchased directly from Nautilus, Inc. contact the Nautilus office listed on the Contacts page of the products Owner’s manual. You may be required to return the
defective component to a specified address for repair or inspection, at your expense. Standard ground shipping of any warranty replacement parts will be paid by Nautilus, Inc. For
products purchased from a retailer, you may be asked to contact your retailer for warranty support.
Exclusions
The preceding warranties are the sole and exclusive express warranties made by Nautilus, Inc. They supersede any prior, contrary or additional representations, whether oral or
written. No agent, representative, dealer, person or employee has the authority to alter or increase the obligations or limitations of this warranty. Any implied warranties, including
the WARRANTY OF MERCHANTABILITY and any WARRANTY OF FITNESS FOR A PARTICULAR PURPOSE, are limited in duration to the term of the applicable express warranty
provided above, whichever is longer. Some states do not allow limitations on how long an implied warranty lasts, so the above limitation may not apply to you.
Limitation of Remedies
EXCEPT AS OTHERWISE REQUIRED BY APPLICABLE LAW, THE PURCHASER’S EXCLUSIVE REMEDY IS LIMITED TO REPAIR OR REPLACEMENT OF ANY COMPONENT DEEMED BY
NAUTILUS, INC. TO BE DEFECTIVE UNDER THE TERMS AND CONDITIONS STATED HEREIN. IN NO EVENT WILL NAUTILUS, INC. BE LIABLE FOR ANY SPECIAL, CONSEQUENTIAL,
INCIDENTAL, INDIRECT OR ECONOMIC DAMAGES, REGARDLESS OF THE THEORY OF LIABILITY (INCLUDING, WITHOUT LIMITATION, PRODUCT LIABILITY, NEGLIGENCE OR OTHER
TORT) OR FOR ANY LOST REVENUE, PROFIT, DATA, PRIVACY OR FOR ANY PUNITIVE DAMAGES ARISING OUT OF OR RELATED TO THE USE OF THE FITNESS MACHINE EVEN IF
NAUTILUS, INC. HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. THIS EXCLUSION AND LIMITATION SHALL APPLY EVEN IF ANY REMEDY FAILS OF ITS ESSENTIAL
PURPOSE. SOME STATES DO NOT ALLOW THE EXCLUSION OR LIMITATION OF CONSEQUENTIAL OR INCIDENTAL TYPE DAMAGES SO THE ABOVE LIMITATION MAY NOT APPLY TO
YOU.
State Laws
This warranty gives you specific legal rights. You may also have other rights, which vary from state to state.
Expirations
If the warranty has expired, Nautilus, Inc. may assist with replacements or repairs to parts and labor, but there will be a charge for these services. Contact a Nautilus office for
information on post-warranty parts and services. Nautilus does not guarantee availability of spare parts after expiration of warranty period.
International Purchases
If you purchased your machine outside of the United States consult your local distributor or dealer for warranty coverage.
63
Assembly / Owner’s Manual
EN
8007947. 061518.E
Was this manual useful for you? yes no
Thank you for your participation!

* Your assessment is very important for improving the work of artificial intelligence, which forms the content of this project

Download PDF

advertising