Apple iPhone 4 4, iPhone 3GS 3GS iPhone User Guide
Below you will find brief information for iPhone iPhone 4, iPhone iPhone 3GS. This guide is for iPhone 4, iPhone 3GS and includes information about setting up your iPhone, making calls, sending and receiving messages, browsing the web, listening to music, and more.
Advertisement
Advertisement
APPLE CONFIDENTIAL — First Draft (1.10.11)
iPhone
User Guide
For iOS 4.2.5 Software
APPLE CONFIDENTIAL — First Draft (1.10.11)
Contents
2
Chapter 1: iPhone at a Glance
Chapter 2: Getting Started
19 Viewing the User Guide on iPhone
21 Disconnecting iPhone from Your Computer
25 Adding Mail, Contacts, and Calendar Accounts
Chapter 3: Basics
33 Customizing the Home Screen
50 Apple Earphones with Remote and Mic
55 Restarting or Resetting iPhone
Chapter 4: Syncing and File Sharing
APPLE CONFIDENTIAL — First Draft (1.10.11)
58 iPhone Settings Panes in iTunes
62 Transferring Purchased Content to Another Computer
Chapter 5: Phone
74 Call Forwarding, Call Waiting, and Caller ID
76 Ringtones and the Ring/Silent Switch
Chapter 6: Mail
82 Using Links and Detected Data
84 Printing Messages and Attachments
Chapter 7: Safari
92 Printing Webpages, PDFs, and Other Documents
Chapter 8: iPod
95 Getting Music, Videos, and More
108 Changing the Browse Buttons
Chapter 9: Messages
110 Sending and Receiving Messages
Contents 3
4
APPLE CONFIDENTIAL — First Draft (1.10.11)
113 Using Contact Information and Links
114 Managing Previews and Alerts
Chapter 10: Calendar
117 Adding and Updating Events on iPhone
118 Responding to Meeting Invitations
120 Importing Calendar Files from Mail
Chapter 11: Photos
121 Syncing Photos and Videos with Your Computer
124 Deleting Photos and Videos
124 Viewing Photos, Videos, and Slideshows on a TV
127 Assigning a Photo to a Contact
Chapter 12: Camera
130 Taking Photos and Recording Videos
131 Viewing and Sharing Photos and Videos
132 Uploading Photos and Videos to Your Computer
Chapter 13: YouTube
133 Finding and Viewing Videos
134 Controlling Video Playback
136 Using YouTube Account Features
137 Changing the Browse Buttons
Contents
APPLE CONFIDENTIAL — First Draft (1.10.11)
Chapter 14: Stocks
Chapter 15: Maps
141 Finding and Viewing Locations
148 Finding and Contacting Businesses
149 Sharing Location Information
Chapter 16: Weather
151 Getting More Weather Information
Chapter 17: Notes
Chapter 18: Clock
Chapter 19: Calculator
Chapter 20: Compass
Chapter 21: Voice Memos
Contents 5
6
APPLE CONFIDENTIAL — First Draft (1.10.11)
Chapter 22: iTunes Store
170 Finding Music, Videos, and More
171 Following Artists and Friends
173 Purchasing Music or Audiobooks
174 Purchasing or Renting Videos
175 Streaming or Downloading Podcasts
176 Changing the Browse Buttons
177 Viewing Account Information
Chapter 23: App Store
Chapter 24: Game Center
191 Your Status and Account Information
Chapter 25: Settings
196 Sounds and the Ring/Silent Switch
Contents
APPLE CONFIDENTIAL — First Draft (1.10.11)
Chapter 26: Contacts
221 Managing Contacts on iPhone
Chapter 27: Nike + iPod
226 Working Out with Nike + iPod
226 Sending Workouts to Nikeplus.com
Chapter 28: iBooks
232 Changing a Book’s Appearance
233 .QQMKPIWRVJG&G°PKVKQPQHC9QT d
233 Printing or Emailing a PDF
Chapter 29: Accessibility
Contents 7
APPLE CONFIDENTIAL — First Draft (1.10.11)
251 Closed Captioning and Other Helpful Features
Appendix A: Support and Other Information
254 Restarting and Resetting iPhone
256 Updating and Restoring iPhone Software
257 Safety, Software, and Service Information
258 Using iPhone in an Enterprise Environment
259 Using iPhone with Other Carriers
259 Disposal and Recycling Information
260 iPhone Operating Temperature
Index
8 Contents
APPLE CONFIDENTIAL — First Draft (1.10.11)
iPhone at a Glance iPhone Overview
iPhone 4
/LHKZL[°QHJR
;VW
TPJYVWOVUL
9PUN:PSLU[
Z^P[JO
=VS\TL
I\[[VUZ
-YVU[JHTLYH
(WWSL9L[PUH
KPZWSH`
/VTL°I\[[VU
)V[[VT
TPJYVWOVUL
6U6MM
:SLLW>HRL
9LJLP]LY
:[H[\Z°IHY
4HPUJHTLYH
3,+MSHZO
(WWPJVUZ
:04°JHYK°[YH`
.:4TVKLSVUS`
+VJR
JVUULJ[VY
:WLHRLY
L3KRQH
1
9
APPLE CONFIDENTIAL — First Draft (1.10.11) iPhone 3GS
/LHKZL[QHJR 6U6MM
:SLLW>HRL
9LJLP]LY
:04JHYK[YH`
9PUN:PSLU[
Z^P[JO
*HTLYH
=VS\TL
I\[[VUZ
:[H[\ZIHY
;V\JOZJYLLU
(WWPJVUZ
/VTLI\[[VU
+VJR
JVUULJ[VY
L3KRQH
:WLHRLY 4PJYVWOVUL
;QWT*QOGUETGGPOC[NQQMFKÒGTGPVFGRGPFKPIQPVJGOQFGNQHK2JQPG[QWJCXG and whether you have rearranged its icons.
Accessories
The following accessories are included with iPhone:
(WWSL,HYWOVULZ
^P[O9LTV[LHUK4PJ
+VJR*VUULJ[VY[V<:)*HISL
<:)WV^LYHKHW[LY :04LQLJ[[VVS
Note: The SIM eject tool is not included in all countries or regions.
10 Chapter 1 iPhone at a Glance
APPLE CONFIDENTIAL — First Draft (1.10.11)
Item
Apple Earphones with Remote and Mic
Dock Connector to USB Cable
USB power adapter
SIM eject tool (not included in all countries or regions)
What you can do with it
Listen to music, videos, and phone calls. Use the built-in microphone to talk. Press the center button to answer or end a call. When listening to iPod, press the button to play or pause a song, or press twice quickly to skip to the next track.
Use the + and – buttons to adjust the volume
(iPhone 3GS or later). Press and hold the center button to use Voice Control (iPhone 3GS or later).
Use the cable to connect iPhone to your computer to sync and charge. The cable can be used with the optional dock or plugged directly into iPhone.
Connect the power adapter to iPhone using the included cable, then plug it into a standard power outlet to charge iPhone.
Eject the SIM card tray.
Buttons
#HGYUKORNGDWVVQPUOCMGKVGCU[VQVWTPK2JQPGQPQTQÒCFLWUVVJGXQNWOGCPF switch between ring and silent modes.
1P1Ò5NGGR9CMG$WVVQP
9JGP[QW¨TGPQVCEVKXGN[WUKPIK2JQPG[QWECPNQEMKVVQVWTPQÒVJGFKURNC[CPFUCXG the battery.
When iPhone is locked, nothing happens if you touch the screen. iPhone can still receive calls, text messages, and other updates. You can also:
listen to music
adjust the volume using the buttons on the side of iPhone (or on the iPhone earphones) while you’re on a phone call or listening to music
use the center button on iPhone earphones to answer or end a call, or to control
audio playback (see “Controlling Audio Playback” on page 96)
By default, iPhone locks if you don’t touch the screen for a minute.
6U6MM:SLLW
>HRLI\[[VU
Chapter 1 iPhone at a Glance 11
12
APPLE CONFIDENTIAL — First Draft (1.10.11)
Lock iPhone
Unlock iPhone
6WTPK2JQPGEQORNGVGN[QÒ
Turn iPhone on
2TGUUVJG1P1Ò5NGGR9CMGDWVVQP
Press the Home DWVVQPQTVJG1P1Ò5NGGR
Wake button, then drag the slider.
2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPHQT a few seconds until the red slider appears, then
FTCIVJGUNKFGT9JGPK2JQPGKUQÒKPEQOKPIECNNU go straight to voicemail.
2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQP until the Apple logo appears.
Home Button
Press the Home button at any time to go to the Home screen, which contains your iPhone apps. Tap any app icon to get started. To see apps you’ve recently used, double-
click the Home button (iPhone 3GS or later). See “Opening and Switching Apps” on page 29.
Volume Buttons
When you’re on the phone or listening to songs, movies, or other media, the buttons on the side of iPhone adjust the audio volume. Otherwise, the buttons control the
XQNWOGHQTVJGTKPIGTCNGTVUCPFQVJGTUQWPFGÒGEVU
WARNING: For important information about avoiding hearing loss, see the Important
Product Information Guide at www.apple.com/support/manuals/iphone.
To adjust the volume, use the buttons on the side of iPhone.
=VS\TL
\W
=VS\TL
KV^U
To set a volume limit for music and videos on iPhone, see “Music” on page 216.
Chapter 1 iPhone at a Glance
APPLE CONFIDENTIAL — First Draft (1.10.11)
Ring/Silent Switch
Flip the Ring/Silent switch to put iPhone in ring mode or silent mode.
9PUN
:PSLU[
In ring mode, iPhone plays all sounds. In silent mode, iPhone doesn’t ring or play alerts
CPFQVJGTUQWPFGÒGEVU
Important: Clock alarms, audio apps such as iPod, and many games still play sounds through the built-in speaker when iPhone is in silent mode.
By default, when you get a call, iPhone vibrates whether it’s in ring mode or silent
OQFG+HK2JQPGKUKPTKPIOQFG[QWECPUKNGPEGCECNND[RTGUUKPIVJG1P1Ò5NGGR
Wake button or one of the volume buttons. Press a second time to send the call to voicemail.
For information about changing sound and vibrate settings, see “Sounds and the Ring/
iPhone Apps
The apps in the following table are included with iPhone.
Note: App functionality and availability may vary, depending on the country or region where you purchase and use iPhone.
Chapter 1 iPhone at a Glance 13
APPLE CONFIDENTIAL — First Draft (1.10.11)
Phone
Safari iPod
Messages
Calendar
Photos
Make calls, with quick access to recent callers, favorites, and all your contacts. Dial manually using the numeric keypad. Or just use voice dialing. Visual voicemail presents a list of your voicemail messages—just tap to listen to any message, in any order. Make
FaceTime video calls to other iPhone 4 or iPod touch (4th generation) users over Wi-Fi.
See Chapter 5, “Phone,” on page 64.
iPhone works with MobileMe, Microsoft Exchange, and many of the most popular email systems—including Yahoo!, Google, and AOL—as well as most industry-standard POP3 and IMAP email systems. View and print PDFs and other attachments. Save attached
photos and graphics to your Camera Roll album. See Chapter 6, “Mail,” on page 79.
Browse websites over a cellular data network or over Wi-Fi. Rotate iPhone sideways
HQTYKFGUETGGPXKGYKPI&QWDNGVCRVQ\QQOKPQTQWV¤5CHCTKCWVQOCVKECNN[°VUVJG webpage column to the iPhone screen for easy reading. Open multiple pages. Sync bookmarks with Safari or Microsoft Internet Explorer on your computer. Add Safari web clips to the Home screen for fast access to favorite websites. Save images from websites to your Photo Library. Print webpages, PDFs, and other documents that open in Quick
Look. See Chapter 7, “Safari,” on page 89.
Listen to your songs, audiobooks, and podcasts. Create playlists, or use Genius to create playlists for you. Listen to Genius Mixes of songs from your library. Watch movies and video podcasts in widescreen. Use AirPlay to stream your music or videos wirelessly to
an Apple TV or compatible audio system. See Chapter 8, “iPod,” on page 95.
Send and receive SMS text messages. View a list of your previous conversations, and tap a conversation to see the messages you sent and received. Send photos, video clips (iPhone 3GS or later), contact information, and voice memos to MMS devices. See
Chapter 9, “Messages,” on page 110.
View and search your MobileMe, iCal, Microsoft Entourage, Microsoft Outlook, or
Microsoft Exchange calendars. Enter events on iPhone and they sync back to the calendar on your computer. Subscribe to calendars. See the birthdays you’ve entered in Contacts. Set alerts to remind you of events, appointments, and deadlines. See
Chapter 10, “Calendar,” on page 115.
View photos and videos you take with iPhone, save them from Mail or MMS messages, or sync them from your computer. View videos (iPhone 3GS or later) in portrait or landscape orientation. Zoom in on photos for a closer look, or print them. Watch a slideshow. Email photos and videos, send them in MMS messages, or publish them to a
MobileMe gallery. Assign images to contacts, and use them as wallpaper. View photos by place, and if you sync with iPhoto 8.0 (part of iLife ‘09) or later, view photos by
events and faces. See Chapter 11, “Photos,” on page 121.
14 Chapter 1 iPhone at a Glance
APPLE CONFIDENTIAL — First Draft (1.10.11)
Camera
YouTube
Stocks
Maps
Take photos, and record videos (iPhone 3GS or later). View them on iPhone, email them, send them in an MMS message, or upload them to your computer. Tap to focus on a
URGEK°EQDLGEVQTCTGC6TKOCPFUCXGXKFGQENKRU7RNQCFXKFGQUFKTGEVN[VQ;QW6WDG
Take a friend’s picture and set iPhone to display it when that person calls you. See
Chapter 12, “Camera,” on page 129.
Play videos from YouTube’s online collection. Search for any video, or browse featured, most viewed, most recently updated, and top-rated videos. Set up and log in to your
YouTube account—then rate videos, sync your favorites, view subscriptions, and more.
Use AirPlay to stream YouTube videos to an Apple TV. Upload your own videos taken
with iPhone. See Chapter 13, “YouTube,” on page 133.
Watch your favorite stocks, updated automatically from the Internet. View company news and current trading information, such as opening or average price, trading volume, or market capitalization. Rotate iPhone to see detailed charts in landscape
QTKGPVCVKQP&TCI[QWT°PIGTCNQPIVJGEJCTVUVQVTCEMRTKEGRQKPVUQTWUGVYQ°PIGTU
to see a range between points. See Chapter 14, “Stocks,” on page 139.
See a street map, satellite view, or hybrid view of locations around the world. Zoom in for a closer look, or check out the Google Street View. Find and track your current
(approximate) location. See which way you’re facing (iPhone 3GS or later, using its builtin compass). Get detailed driving, public transit, or walking directions and see current
JKIJYC[VTCÓEEQPFKVKQPU(KPFDWUKPGUUGUKPVJGCTGCCPFECNNYKVJCUKPINGVCR5GG
Chapter 15, “Maps,” on page 141.
Get current weather conditions and a six-day forecast. Add your favorite cities for a
quick weather report anytime. See Chapter 16, “Weather,” on page 150.
Weather
Notes
Clock
Jot notes on the go—reminders, grocery lists, brilliant ideas. Send them in email. Sync notes to Mail on your Mac, or Microsoft Outlook or Outlook Express on your PC. Sync notes over the air (iPhone 3GS or later) with your MobileMe, Google, Yahoo!, or IMAP
accounts. See Chapter 17, “Notes,” on page 152.
In the Utilities folder. View the time in cities around the world—create clocks for your favorites. Set one or more alarms. Use the stopwatch, or set a countdown timer. See
Chapter 18, “Clock,” on page 155.
In the Utilities folder. Add, subtract, multiply, and divide. Rotate iPhone sideways to use
GZRCPFGFUEKGPVK°EHWPEVKQPU5GG%JCRVGT 19, “Calculator,” on page 158.
Calculator
Chapter 1 iPhone at a Glance 15
16
APPLE CONFIDENTIAL — First Draft (1.10.11)
In the Utilities folder. Use the built-in digital compass (iPhone 3GS or later) to determine your heading. Get your current coordinates. Choose between true north and
magnetic north. See Chapter 20, “Compass,” on page 161.
Compass
In the Utilities folder. Record voice memos on iPhone. Play them back on iPhone or sync them with iTunes to listen to voice memos on your computer. Attach voice
memos to email or MMS messages. See Chapter 21, “Voice Memos,” on page 164.
Voice
Memos iTunes
App Store
Search the iTunes Store for music, movies, TV shows, audiobooks, and more. Browse, preview, and download new releases, or see what’s popular in the top charts. Rent movies and TV shows to view on iPhone. Stream and download podcasts. Follow your
HCXQTKVGCTVKUVUCPFHTKGPFUVQ°PFQWVYJCVOWUKEVJG[¨TGNKUVGPKPIVQCPFVCNMKPICDQWV
See Chapter 22, “iTunes Store,” on page 169.
Search the App Store for iPhone apps you can purchase or download using your Wi-Fi or cellular data network connection. Read reviews or write your own reviews for your
favorite apps. Download and install the app on your Home screen. See Chapter 23, “App
Discover new games and share your game experiences with friends around the world
(iPhone 3GS or later). Invite a friend, or request a match with other worthy opponents.
Check player rankings on the leaderboards. Earn achievements for extras points. See
Chapter 24, “Game Center,” on page 184.
Game
Center
Settings
Contacts
Set up accounts and adjust all iPhone settings in one convenient place. Set your own volume limit for listening comfort. Set your ringtone, wallpaper, screen brightness, and settings for network, phone, mail, web, music, video, photos, and more. Use Location
Services settings to set location privacy options for Maps, Camera, Compass, and applicable third-party apps. Set auto-lock and a passcode for security. Restrict access
to explicit iTunes content and certain apps. Reset iPhone. See Chapter 25, “Settings,” on page 193.
Get contact information synced from MobileMe, Mac OS X Address Book, Yahoo!
Address Book, Google Contacts, Windows Address Book (Outlook Express), Microsoft
Outlook, or Microsoft Exchange. Search, add, change, or delete contacts, which get
synced back to your computer. See Chapter 26, “Contacts,” on page 219.
Nike + iPod
Nike + iPod (which appears when you activate it in Settings) turns iPhone into a workout companion. Track your pace, time, and distance from one workout to the next, and choose a song to power through your routine. (iPhone 3GS or later. Requires select
Nike shoes and a Nike + iPod Sensor, sold separately.) See Chapter 27, “Nike + iPod,” on page 225.
iBooks
Download the free iBooks app from the App Store for a great way to buy and read books. Get everything from classics to best sellers from the built-in iBookstore.
Add ePub books and PDFs to your bookshelf using iTunes. Print PDFs. See
Chapter 28, “iBooks,” on page 229.
Status Icons
The icons in the status bar at the top of the screen give information about iPhone:
Chapter 1 iPhone at a Glance
APPLE CONFIDENTIAL — First Draft (1.10.11)
Status icon
Cell signal*
Airplane mode
3G
EDGE
GPRS
Wi-Fi*
Network activity
Call Forwarding
VPN
Lock
TTY
What it means
Shows whether you’re in range of the cellular network and can make and receive calls. The more bars, the stronger the signal. If there’s no signal, the bars are replaced with “No service.”
Shows that airplane mode is on—you cannot use the phone, access the Internet, or use Bluetooth® devices. Non-wireless
features are available. See “Airplane
Shows that your carrier’s 3G (GSM models) or EV-DO (CDMA model) network is available, and iPhone can connect to the
Internet over that network. See “How iPhone Connects to the Internet” on page 22.
Shows that your carrier’s EDGE network is available, and iPhone can connect to the
Internet over that network. (GSM models
only.) See “How iPhone Connects to the
Shows that your carrier’s GPRS (GSM models) or 1xRTT (CDMA model) network is available, and iPhone can connect to
the Internet over that network. See “How iPhone Connects to the Internet” on page 22.
Shows that iPhone is connected to the
Internet over a Wi-Fi network. The more bars, the stronger the connection. See
“Joining a Wi-Fi Network” on page 22.
Shows over-the-air syncing or other network activity. Some third-party apps may also use the icon to show an active process.
Shows that Call Forwarding is set up
on iPhone (GSM models only). See “Call
Shows that you’re connected to a network
using VPN. See “Network” on page 198.
Shows that iPhone is locked. See “ 1P1Ò
Sleep/Wake Button” on page 11.
Shows that iPhone is set to work with a
TTY machine. See “Using iPhone with a
Teletype (TTY) Machine” on page 213.
Chapter 1 iPhone at a Glance 17
APPLE CONFIDENTIAL — First Draft (1.10.11)
Status icon
Play
Portrait orientation lock
Alarm
Location services
Bluetooth*
Battery
What it means
Shows that a song, audiobook, or podcast
is playing. See “Playing Songs and Other
Shows that the iPhone screen is locked
in portrait orientation. See “Viewing in
Portrait or Landscape Orientation” on page 32.
Shows that an alarm is set. See “Alarms” on page 155.
Shows that some app is using location
services. See “Location Services” on page 200.
Blue or white icon: Bluetooth is on and a device, such as a headset or car kit, is connected. Gray icon: Bluetooth is on, but no device is connected. No icon: Bluetooth
KUVWTPGFQÒ5GG¥
Bluetooth Devices” on page 51.
Shows battery level or charging status. See
6JGWUGQHEGTVCKPCEEGUUQTKGUYKVJK2JQPGOC[CÒGEVYKTGNGUURGTHQTOCPEG
18 Chapter 1 iPhone at a Glance
APPLE CONFIDENTIAL — First Draft (1.10.11)
Getting Started
2
WARNING: To avoid injury, read all operating instructions in this guide and safety information in the iPhone Important Product Information Guide at www.apple.com/ support/manuals/iphone before using iPhone.
Viewing the User Guide on iPhone
The iPhone User Guide, optimized for viewing on iPhone, is available at help.apple.com/ iphone.
View the guide on iPhone: In Safari, tap , then tap the iPhone User Guide bookmark.
Add an icon for the guide to the Home screen: When viewing the guide, tap , then tap “Add to Home Screen.”
The iPhone User Guide is available in many languages.
8KGYVJGIWKFGKPCFKÒGTGPVNCPIWCIG Tap “Change Language” at the bottom of the screen on the main contents page, then choose the language you want.
What You Need
To use iPhone, you need:
A wireless service plan with a carrier that provides iPhone service in your area
A Mac or a PC with a USB 2.0 port and one of the following operating systems:
Mac OS X v10.5.8 or later
Windows 7, Windows Vista, or Windows XP Home or Professional (SP3)
Screen resolution on your computer set to 1024 x 768 or higher iTunes 10.1.2 or later, available at www.itunes.com/download
QuickTime 7.6.2 or later (for playing videos recorded by iPhone 3GS or later on your computer)
An Apple ID (such as an iTunes Store account or MobileMe account) for purchases from the iTunes Store or App Store
19
20
APPLE CONFIDENTIAL — First Draft (1.10.11)
An Internet connection for your computer (broadband is recommended)
Installing the SIM Card
If your SIM card (GSM models only) was not preinstalled, you must install it before you can use iPhone.
Installing the SIM Card in iPhone 4
4PJYV:04
JHYK[YH`
7HWLYJSPW
VY:04
LQLJ[[VVS
4PJYV:04
JHYK
Installing the SIM Card in iPhone 3GS
7HWLYJSPWVY
:04LQLJ[[VVS
:04JHYK[YH`
:04
JHYK
Install the SIM card:
1 Insert the end of a paper clip or SIM eject tool into the hole on the SIM card tray.
2WUJ°TON[UVTCKIJVKPWPVKNVJGVTC[RQRUQWV
2 Pull out the SIM card tray and place the SIM card in the tray as shown.
3 With the tray aligned and the SIM card on top as shown, carefully replace the tray.
Activating iPhone
You must activate iPhone by signing up for a service plan with an iPhone service carrier in your area and registering iPhone with the network.
Your iPhone may have been activated at the time of purchase. If it isn’t activated, contact your iPhone retailer or cellular service provider.
For more information about iPhone, go to www.apple.com/iphone.
Chapter 2 Getting Started
APPLE CONFIDENTIAL — First Draft (1.10.11)
Setting Up iPhone
Before you can use iPhone, you must set it up in iTunes. During setup, you can create a new Apple ID or specify an existing Apple ID for making purchases with iPhone. (The iTunes Store may not be available in all countries or regions.) iTunes also records the serial number of your iPhone in case you need it.
Set up iPhone:
1 Download and install the latest version of iTunes from www.itunes.com/download.
2 Connect iPhone to a USB 2.0 port on your Mac or PC using the cable that came with iPhone.
3 Follow the onscreen instructions.
In the Set Up Your iPhone screen, select “Automatically sync contacts, calendars and
DQQMOCTMU¦VQEQP°IWTGVJQUGKVGOUVQU[PECWVQOCVKECNN[YJGP[QWEQPPGEVK2JQPG
Note: If you have a visual impairment, VoiceOver (iPhone 3GS or later) can help you set up iPhone without a sighted assistant. VoiceOver describes aloud what appears on the screen, so you can use iPhone without seeing it. When you connect iPhone to your computer, iTunes detects whether you’re using a compatible screen reader on your computer, such as VoiceOver (Mac) or GW Micro Window-Eyes (PC), and automatically enables VoiceOver on iPhone. A sighted user can also enable VoiceOver on iPhone using Accessibility settings. (VoiceOver may not be available in all languages.) See
Disconnecting iPhone from Your Computer
You can disconnect iPhone from your computer at any time. However, if you disconnect it while a sync is in progress, some data may not get synced until the next time you connect iPhone to your computer.
When iPhone is syncing with your computer, iPhone shows “Sync in Progress.” If you
FKUEQPPGEVK2JQPGDGHQTGKV°PKUJGUU[PEKPIUQOGFCVCOC[PQVIGVVTCPUHGTTGF9JGP the sync is complete, iTunes shows “iPhone sync is complete.”
Chapter 2 Getting Started 21
22
APPLE CONFIDENTIAL — First Draft (1.10.11)
Cancel a sync: Drag the slider on iPhone.
If you get a call during a sync, the sync is canceled and you can disconnect iPhone to
CPUYGTVJGECNN%QPPGEVK2JQPGCHVGTVJGECNNVQ°PKUJU[PEKPI
Connecting to the Internet
iPhone connects to the Internet whenever you use Mail, Safari, YouTube, Stocks, Maps,
Weather, the App Store, or the iTunes Store.
How iPhone Connects to the Internet
iPhone connects to the Internet using either a Wi-Fi network or a cellular data network. iPhone does the following, in order, until connected:
Connects over the last Wi-Fi network you used that’s available.
If no previously used Wi-Fi networks are available, iPhone shows a list of Wi-Fi networks in range. Tap a network and, if necessary, enter the password to join.
Networks that require a password show the lock icon next to them. You can
prevent iPhone from automatically showing available networks. See “Wi-Fi” on page 194.
If no Wi-Fi networks are available or you choose not to join any, iPhone connects to the Internet over a cellular data network ( , , or ). You can prevent iPhone from
using cellular data in Settings. See “Network” on page 198.
If no Wi-Fi networks are available and a cellular data network isn’t available, iPhone cannot connect to the Internet.
Note: Unless you have a 3G connection on a GSM model, you cannot use the Internet over a cellular data network when you’re on a call. You must have a Wi-Fi connection to use Internet apps while also talking on the phone.
Many Wi-Fi networks can be used free of charge including, in some countries or regions, Wi-Fi hotspots provided by your iPhone carrier. Some Wi-Fi networks require a fee. To join a Wi-Fi network at a hotspot where charges apply, you can usually open
Safari to see a webpage that allows you to sign up for service.
Joining a Wi-Fi Network
The Wi-Fi settings let you turn on Wi-Fi and join Wi-Fi networks.
Turn on Wi-Fi: Choose Settings > Wi-Fi and turn Wi-Fi on.
Join a Wi-Fi network: Choose Settings > Wi-Fi, wait a moment as iPhone detects networks in range, then select a network (fees may apply to join some Wi-Fi networks).
If necessary, enter a password and tap Join (networks that require a password appear with a lock icon).
Chapter 2 Getting Started
APPLE CONFIDENTIAL — First Draft (1.10.11)
Once you join a Wi-Fi network manually, iPhone automatically connects to it whenever the network is in range. If more than one previously used network is in range, iPhone joins the one last used.
When iPhone is connected to a Wi-Fi network, the Wi-Fi icon in the status bar at the top of the screen shows the connection strength. The more bars you see, the stronger the connection.
(QTKPHQTOCVKQPCDQWVEQP°IWTKPI9K(KUGVVKPIUUGG¥
Cellular Data Network Access
3G, EDGE, and GPRS (GSM models) and EV-DO and 1xRTT (CDMA model) allow Internet connectivity over the cellular network available through your iPhone carrier’s wireless service. Check the carrier’s network coverage in your area for availability.
You can tell iPhone is connected to the Internet via the cellular data network if you see the 3G/EV-DO ( ), EDGE ( ), or GPRS/1xRTT ( ) icon in the status bar at the top of the screen.
Note: On EDGE and GPRS connections, you may not be able to receive calls while iPhone is actively transferring data over a cellular network—downloading a webpage, for example. Incoming calls then go directly to voicemail. On EV-DO connections, data transfers are paused during incoming calls. On 1xRTT connections, incoming calls go directly to voicemail during data transfers.
Turn 3G on: (GSM models only.) In Settings, choose General > Network and tap Enable
3G.
If you’re outside your carrier’s network, you may be able to access the Internet through another carrier. To enable email, web browsing, and other data services whenever possible, turn Data Roaming on.
Turn Data Roaming on: In Settings, choose General > Network and turn Data
Roaming on.
Important: Roaming charges may apply. To avoid data roaming charges, make sure
&CVC4QCOKPIKUVWTPGFQÒ
Internet Access on an Airplane
#KTRNCPGOQFGVWTPUQÒVJGK2JQPGEGNNWNCT9K(K$NWGVQQVJCPF)25VTCPUOKVVGTUCPF receivers to avoid interfering with aircraft operation. Airplane mode disables many of the iPhone features. In some countries or regions, where allowed by the aircraft operator and applicable laws and regulations, you can turn on Wi-Fi while airplane mode is on, to:
Send and receive email
Browse the Internet
Chapter 2 Getting Started 23
24
APPLE CONFIDENTIAL — First Draft (1.10.11)
Sync your contacts, calendars, browser bookmarks, and notes (iPhone 3GS or later) over the air
Stream YouTube videos
Get stock quotes
Get map locations
Get weather reports
Purchase music and apps
You may also be allowed to turn on Bluetooth to use Bluetooth devices with iPhone.
For more information, see “Airplane Mode” on page 193.
VPN Access
VPN (virtual private network) provides secure access over the Internet to private networks, such as the network at your company or school. Use Network settings to
EQP°IWTGCPFVWTPQP8205GG¥ Network” on page 198.
Sharing an Internet Connection
You can use iPhone to share an Internet connection for a computer connected to iPhone via Wi-Fi, Bluetooth, or USB. On GSM models this is called tethering; on a CDMA model this is called personal hotspot.
On a CDMA model, you can also share an Internet connection for an iPod, iPad, and even other iPhones connected to iPhone via Wi-Fi.
Note: Internet sharing may not be available in all countries or regions. Additional fees may apply. Contact your carrier for more information.
You need to set up Internet sharing with your carrier before it can be used. If you haven’t done this, the Set Up Internet Tethering button appears in your Network settings in place of the Internet Tethering or Personal Hotspot button. Tap Set Up
Internet Tethering to contact your carrier.
Internet sharing works over the cellular data network. You can’t use Internet sharing if iPhone is connected to the Internet via Wi-Fi. If iPhone is connected to the cellular data network via 3G, you can make and receive phone calls while sharing an Internet connection (GSM models only).
Share an Internet connection:
1 In Settings, choose General > Network > Internet Tethering (GSM models) or Personal
Hotspot (CDMA model).
2 Turn on Internet Tethering or Personal Hotspot.
3 Connect a computer or other device to iPhone:
Wi-Fi: On the device, choose the name of your iPhone from the list of available Wi-Fi networks, then enter the Wi-Fi password for your iPhone when prompted.
Chapter 2 Getting Started
APPLE CONFIDENTIAL — First Draft (1.10.11)
USB: Connect your computer to iPhone, using the Dock Connector to USB Cable. In your computer’s Network services settings, choose iPhone.
1PC/CECRQRWRYKPFQYCRRGCTUVJG°TUVVKOG[QWEQPPGEVUC[KPI¥#PGY
PGVYQTMKPVGTHCEGJCUDGGPFGVGEVGF¦%NKEM0GVYQTM2TGHGTGPEGUEQP°IWTGVJG network settings for iPhone, then click Apply. On a PC, use the Network Control
2CPGNVQEQP°IWTGVJGK2JQPGEQPPGEVKQP
Bluetooth: On iPhone, choose Settings > General > Bluetooth and turn on
Bluetooth. Then refer to the documentation that came with your computer system software to pair and connect iPhone with your device.
When you’re connected, a blue band appears at the top of the screen. Internet sharing remains on when you connect with USB, even when you aren’t actively using the
Internet connection.
Change the Wi-Fi password for iPhone: (CDMA model only.) In Settings, choose
General > Network > Personal Hotspot > Wi-Fi Password, then enter a password of at least 8 characters.
Changing the password disconnects any computers sharing the Internet connection.
Monitor your cellular data network usage: In Settings, choose General > Usage.
Adding Mail, Contacts, and Calendar Accounts
About Accounts
iPhone works with MobileMe, Microsoft Exchange, and many of the most popular
Internet-based email, contacts, and calendar service providers. If you don’t already have an email account, you can get a free account online at www.yahoo.com, www.
google.com, or www.aol.com. You can also try MobileMe, free for 60 days, at www.
me.com.
You can add contacts using an LDAP or CardDAV account if your company or
organization supports it. See “Adding Contacts” on page 219.
You can add a CalDAV calendar account. See “Syncing Calendars” on page 115.
You can subscribe to iCal (.ics) calendars or import them from Mail. See “Subscribing to
Calendars” and “Importing Calendar Files from Mail” on page 120.
Setting Up MobileMe Accounts
To use MobileMe on iPhone, you need to set up a MobileMe Free Account or a
MobileMe Paid Subscription.
A MobileMe Free Account lets you use Find My iPhone (not available in all countries or regions), a feature that helps you locate and protect the information on your iPhone if
it’s lost or stolen. See “Security Features” on page 53.
Chapter 2 Getting Started 25
26
APPLE CONFIDENTIAL — First Draft (1.10.11)
A MobileMe Paid Subscription lets you use Find My iPhone, plus the following features:
Mail account at me.com
Over-the-air syncing for contacts, calendars, bookmarks, and notes
MobileMe Gallery for sharing photos and videos
/QDKNG/GK&KUMHQTUVQTKPICPFUJCTKPI°NGU
You can try out these features with a 60-day free trial at www.apple.com/mobileme.
A MobileMe Free Account is available to any customer with an iPhone 4 running iOS
4.2 or later. If you’ve already created an account for the App Store or Game Center, you can use that Apple ID for your MobileMe Free Account. You can create a new Apple
+&KH[QWFQP¨VCNTGCF[JCXGQPGQTKH[QWYCPVCFKÒGTGPV#RRNG+&HQT[QWT/QDKNG/G account.
Set up a MobileMe Free Account:
1 In Settings, tap “Mail, Contacts, Calendars.”
2 Tap Add Account, then tap MobileMe.
3 Enter your Apple ID and password, or tap Create Free Apple ID.
4 Follow the onscreen instructions.
Verify your email address, if required.
5 Make sure Find My iPhone is turned on.
Only one MobileMe account at a time can be used for Find My iPhone and for syncing contacts, calendars, bookmarks, and notes.
To use Gallery, iDisk, and Find My iPhone on iPhone, download the free MobileMe
Gallery, MobileMe iDisk, and Find My iPhone apps from the App Store.
Setting Up Microsoft Exchange Accounts
To use Microsoft Exchange on iPhone, you need to add an account with your Microsoft
Exchange account settings. See your service provider or system administrator for those settings.
iPhone uses the Exchange ActiveSync protocol to sync email, calendars, and contacts over the air with the following versions of Microsoft Exchange:
Exchange Server 2003 Service Pack 2
Exchange Server 2007 Service Pack 1
Exchange Server 2010
When setting up the account, you can choose which Exchange services you want to use with iPhone:
Contacts
Chapter 2 Getting Started
APPLE CONFIDENTIAL — First Draft (1.10.11)
Calendars
Services you turn on are synced automatically over the air without having to connect
iPhone to your computer. See “Syncing Accounts” on page 56.
You can set up multiple Exchange accounts.
Set up an Exchange account:
1 In Settings, tap “Mail, Contacts, Calendars.”
2 Tap Add Account, then tap Microsoft Exchange.
3 Enter your complete email address, domain (optional), user name, password, and a description. The description can be whatever you like.
iPhone supports Microsoft’s Autodiscovery service, which uses your user name and password to determine the address of the Exchange server. If the server’s address can’t be determined, you’re asked to enter it. (Enter the complete address in the Server
°GNF1PEG[QWEQPPGEVVQVJG'ZEJCPIGUGTXGT[QWOC[DGRTQORVGFVQEJCPIG[QWT passcode to match the policies set on the server.
4 Tap the items you want to use on iPhone (mail, contacts, and calendars) and set how many days of email you want to sync to iPhone.
Setting Up Google, Yahoo!, and AOL Accounts
For many popular accounts (Google, Yahoo!, AOL), iPhone enters most of the settings for you. When setting up the account, you can choose which account services you want to use with iPhone. Services you turn on are synced automatically over the
air without having to connect iPhone to your computer. See “Syncing Accounts” on page 56.
Set up an account:
1 In Settings, tap “Mail, Contacts, Calendars.”
2 Tap Add Account, then tap Google, Yahoo!, or AOL.
3 Enter your name, complete email address, password, and a description. The description can be whatever you like.
4 Tap the items you want to use on iPhone. Available items depend upon the service provider.
Setting Up Other Accounts
Choose Other Accounts to set up other accounts for mail (such as POP), contacts (such as LDAP or CardDAV), or calendars (such as CalDAV). Contact your service provider or system administrator to get the account settings you need.
Set up an account:
1 In Settings, tap “Mail, Contacts, Calendars.”
Chapter 2 Getting Started 27
APPLE CONFIDENTIAL — First Draft (1.10.11)
2 Tap Add Account, then tap Other.
3 Choose the account type you want to add (Mail, Contacts, or Calendars).
4 Enter your account information and tap Save.
28 Chapter 2 Getting Started
APPLE CONFIDENTIAL — First Draft (1.10.11)
Basics
3
Using Apps
6JGJKIJTGUQNWVKQP/WNVK6QWEJUETGGPCPFUKORNG°PIGTIGUVWTGUOCMGKVGCU[VQWUG iPhone apps.
Opening and Switching Apps
You open an app on iPhone by tapping its icon on the Home screen.
Return to the Home screen: Press the Home button below the display.
Switch to another Home screen: Flick left or right, or tap to the left or right of the row of dots.
)QVQVJG°TUV*QOGUETGGP Press the Home button.
On iPhone 3GS or later, you can quickly switch between the apps you’re using; multitasking also allows certain apps to run in the background.
29
APPLE CONFIDENTIAL — First Draft (1.10.11)
View the most recently used apps (iPhone 3GS or later): Double-click the Home button.
The four most recently used app are shown at the bottom of the screen. Flick left to see more apps.
Note: 1PK2JQPG)FQWDNGENKEMKPIVJG*QOGDWVVQPRGTHQTOUVJGCEVKQPURGEK°GF
by the Home Button setting. See “Home Button” on page 200.
Remove an app from the recents list: Touch and hold the app icon until it begins to jiggle, then tap .
The app is added to recent apps again the next time you open it.
Scrolling
Drag up or down to scroll. On some screens such as webpages, you can also scroll side to side.
&TCIIKPI[QWT°PIGTVQUETQNNYQP¨VEJQQUGQTCEVKXCVGCP[VJKPIQPVJGUETGGP
30 Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Flick to scroll quickly.
You can wait for the scrolling to come to a stop, or touch anywhere on the screen to stop it immediately. Touching the screen to stop scrolling won’t choose or activate anything.
To quickly scroll to the top of a list, webpage, or email, just tap the status bar.
Find items in an indexed list: Tap a letter to jump to items starting with that letter.
&TCI[QWT°PIGTCNQPIVJGKPFGZVQUETQNNSWKEMN[VJTQWIJVJGNKUV
0UKL_
Choose an item: Tap an item in the list.
&GRGPFKPIQPVJGNKUVVCRRKPICPKVGOECPFQFKÒGTGPVVJKPIU¤HQTGZCORNGKVOC[ open a new list, play a song, open an email, or show someone’s contact information so you can call that person.
Chapter 3 Basics 31
APPLE CONFIDENTIAL — First Draft (1.10.11)
Zooming In or Out
When viewing photos, webpages, email, or maps, you can zoom in and out. Pinch your
°PIGTUVQIGVJGTQTCRCTV(QTRJQVQUCPFYGDRCIGU[QWECPFQWDNGVCRVCRVYKEG quickly) to zoom in, then double-tap again to zoom out. For maps, double-tap to zoom
KPCPFVCRQPEGYKVJVYQ°PIGTUVQ\QQOQWV
Viewing in Portrait or Landscape Orientation
Many iPhone apps let you view the screen in either portrait or landscape orientation.
4QVCVGK2JQPGCPFVJGFKURNC[TQVCVGUVQQCFLWUVKPICWVQOCVKECNN[VQ°VVJGPGY screen orientation.
32
You may prefer landscape orientation for viewing webpages in Safari, or when entering text, for example. In landscape orientation:
Webpages scale to the wider screen, making the text and images larger.
The onscreen keyboard is larger, which may help increase your typing speed and accuracy.
The following apps support both portrait and landscape orientation:
Safari
Messages
Notes
Contacts
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Stocks iPod
Photos
Camera
Calculator
Movies viewed in iPod and YouTube appear only in landscape orientation. Street views in Maps also appear only in landscape orientation.
Lock the screen in portrait orientation (iPhone 3GS or later): Double-click the Home
DWVVQP±KEMVJGDQVVQOQHVJGUETGGPHTQONGHVVQTKIJVVJGPVCR .
The portrait orientation lock ( ) icon appears in the status bar when the screen orientation is locked.
Customizing the Home Screen
You can customize the layout of icons on the Home screen—including the Dock icons along the bottom of the screen. If you want, arrange them over multiple Home screens. You can also organize apps by grouping them in folders.
Rearranging Icons
You can arrange the icons on your Home screen in any order you want.
Rearrange icons:
1 Touch and hold any icon on the Home screen until it begins to jiggle.
2 Arrange the icons by dragging them.
3 Press the Home button to save your arrangement.
You can also add links to your favorite webpages on the Home screen. See “Web
When iPhone is connected to your computer, you can rearrange icons on the Home screen and the order of the screens. In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen.
Chapter 3 Basics 33
APPLE CONFIDENTIAL — First Draft (1.10.11)
Move an icon to another screen: While arranging icons, drag an icon to the side of the screen.
Create additional Home screens: 9JKNGCTTCPIKPIKEQPU±KEMVQVJGTKIJVOQUV*QOG screen, then drag an icon to the right edge of the screen until a new screen appears.
You can create up to 11 screens. The number of dots above the Dock shows the number of screens you have, and which screen you’re viewing.
Reset your Home screen to the default layout: Choose Settings > General > Reset and tap Reset Home Screen Layout.
Resetting the Home screen removes any folders you’ve created and applies the default wallpaper to your Home screen.
Organizing with Folders
Folders let you organize icons on the Home screen. You can put up to 12 icons in a folder. iPhone automatically names a folder when you create it, based on the icons you use to create the folder, but you can change the name anytime you want. Like icons, folders can be rearranged by dragging them around the Home screen. You can move folders to a new Home screen or to the Dock.
Create a folder: Touch and hold an icon until the Home screen icons begin to jiggle, then drag the icon onto another icon.
34 Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11) iPhone creates a new folder that includes the two icons, and shows the folder’s name.
;QWECPVCRVJGPCOG°GNFCPFGPVGTCFKÒGTGPVPCOG
You can also create folders within iTunes.
Create a folder using iTunes: With iPhone connected to your computer, select iPhone in the Devices list in iTunes. Click Apps at the top of the screen, and on the Home screen near the top of the window, drag an app on top of another.
Add an icon to a folder
Remove an icon from a folder
Open a folder
Close a folder
Delete a folder
Rename a folder
While arranging icons, drag the icon onto the folder.
While arranging icons, tap to open the folder, then drag the icon out of the folder.
Tap the folder. You can then tap an app icon to open that app.
Tap outside the folder, or press the Home button.
Move all icons out of the folder. The folder is deleted automatically when empty.
While arranging icons, tap to open the folder, then tap the name at the top and use the keyboard to enter a new name. Press the Home button to save your changes.
9JGP[QW°PKUJQTICPK\KPI[QWT*QOGUETGGPRTGUUVJG*QOG button to save your changes.
Many apps, such as Phone, Messages, Mail, and the App Store, display a badge on their
Home screen icon with a number (to indicate incoming items) or exclamation mark
(to indicate a problem). If these apps are contained in a folder, the badge appears on the folder. A numbered badge shows the total number of items you haven’t attended to, such as incoming phone calls, email messages, text messages, and updated apps to download. An alert badge indicates a problem with an app in the folder.
Chapter 3 Basics 35
APPLE CONFIDENTIAL — First Draft (1.10.11)
Adding Wallpaper
You can set an image or photo as wallpaper for the Lock screen. On iPhone 3GS or later, you can also set wallpaper for your Home screen. You can choose an image that came with iPhone, a photo from your Camera Roll, or a photo synced to iPhone from your computer.
The Lock screen wallpaper also appears when you’re on a call with someone you don’t have a contact photo for.
Set wallpaper (iPhone 3GS or later):
1 In Settings, choose Wallpaper, tap the image of the Lock and Home screens, then tap
Wallpaper or an album.
36
2 Tap to choose an image or photo. If you chose a photo, drag to position it and pinch to zoom in or out, until it looks the way you want.
3 Tap Set, then choose whether you want to use the photo as wallpaper for your Lock
Screen, Home screen, or both.
Set wallpaper (iPhone 3G):
1 Choose Settings > Wallpaper, then tap Wallpaper or an album.
2 Tap to choose an image or photo. If you choose a photo, drag it to position it and pinch to zoom in or out, until it looks the way you want.
3 Tap Set Wallpaper.
Typing
The onscreen keyboard appears anytime you need to type.
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Entering Text
Use the keyboard to enter text, such as contact information, email, text messages, and web addresses. The keyboard corrects misspellings, predicts what you're typing, and learns as you use it.
Depending on the app you’re using, the intelligent keyboard may suggest corrections as you type, to help prevent mistyped words.
Enter text:
1 6CRCVGZV°GNFUWEJCUKPCPQVGQTPGYEQPVCEVVQDTKPIWRVJGMG[DQCTF
2 Tap keys on the keyboard.
5VCTVD[V[RKPIYKVJLWUV[QWTKPFGZ°PIGT#U[QWIGVOQTGRTQ°EKGPV[QWECPV[RG more quickly using two thumbs.
#U[QWV[RGGCEJNGVVGTCRRGCTUCDQXG[QWTVJWODQT°PIGT+H[QWVQWEJVJGYTQPI
MG[[QWECPUNKFG[QWT°PIGTVQVJGEQTTGEVMG[6JGNGVVGTKUP¨VGPVGTGFWPVKN[QW
TGNGCUG[QWT°PIGTHTQOVJGMG[
Delete the previous character
Type uppercase
Quickly type a period and space
Turn caps lock on
Chapter 3 Basics
Tap .
Tap the Shift key before tapping a letter. Or touch and hold the Shift key, then slide to a letter.
Double-tap the space bar. (You can turn
VJKUHGCVWTGQPQTQÒKP5GVVKPIU )GPGTCN
-G[DQCTF
Double-tap the Shift key. The Shift key turns blue, and all letters you type are uppercase. Tap
VJG5JKHVMG[CICKPVQVWTPECRUNQEMQÒ;QWECP
VWTPVJKUHGCVWTGQPQTQÒKP5GVVKPIU )GPGTCN
-G[DQCTF
37
APPLE CONFIDENTIAL — First Draft (1.10.11)
Show numbers, punctuation, or symbols
Type letters or symbols that aren’t on the keyboard
Tap the Number key. Tap the Symbol key to see additional punctuation and symbols.
Touch and hold the related letter or symbol, then slide to choose a variation.
Dictionary
For many languages, iPhone has dictionaries to help you type. The appropriate dictionary is activated when you select a supported keyboard.
For a list of supported languages, see www.apple.com/iphone/specs.html.
iPhone uses the active dictionary to suggest corrections or complete the word you’re typing. You don’t need to interrupt your typing to accept the suggested word.
:\NNLZ[LK
^VYK
Accept or reject dictionary suggestions:
B To reject the suggested word, °PKUJV[RKPIVJGYQTFCU[QWYCPVKVVJGPVCRVJG¥Z¦VQ dismiss the suggestion before typing anything else. Each time you reject a suggestion for the same word, iPhone becomes more likely to accept your word.
Note: If you’re entering Chinese or Japanese, tap one of the suggested alternatives.
B To use the suggested word, type a space, punctuation mark, or return character.
iPhone also underlines words you’ve already typed that might be misspelled.
Use spell checking to replace a misspelled word: Tap the underlined word, then tap one of the suggested corrections.
38 Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
If none of the suggestions is correct, you can correct the spelling of the selected word by retyping it. To leave the word unchanged, tap somewhere else in the message area.
6WTPCWVQEQTTGEVKQPQPQTQÒ %JQQUG)GPGTCN -G[DQCTFVJGPVWTP#WVQ
%QTTGEVKQPQPQTQÒ#WVQ%QTTGEVKQPKUQPD[FGHCWNV
6WTPURGNNEJGEMKPIQPQTQÒ %JQQUG)GPGTCN -G[DQCTFVJGPVWTP%JGEM5RGNNKPI
QPQTQÒ5RGNNEJGEMKPIKUQPD[FGHCWNV
Editing—Cut, Copy, and Paste
The touchscreen makes it easy to make changes to text you’ve entered. An onscreen magnifying glass helps you position the insertion point precisely where you need it.
Grab points on selected text let you quickly select more or less text. You can also cut, copy, and paste text and photos within apps, or across multiple apps.
Position the insertion point: Touch and hold to bring up the magnifying glass, then drag to position the insertion point.
Select text: Tap the insertion point to display the selection buttons. Tap Select to select the adjacent word or tap Select All to select all text. You can also double-tap to select a word. In read-only documents, such as webpages, or email or text messages you’ve received, touch and hold to select a word.
Drag the grab points to select more or less text.
Chapter 3 Basics 39
APPLE CONFIDENTIAL — First Draft (1.10.11)
Cut or copy text: Select text, then tap Cut or Copy.
40
Paste text: Tap the insertion point and tap Paste. The last text that you cut or copied is inserted. Or select text and tap Paste to replace the text.
Undo the last edit: Shake iPhone and tap Undo.
International Keyboards
+PVGTPCVKQPCNMG[DQCTFUCNNQY[QWVQGPVGTVGZVKPOCP[FKÒGTGPVNCPIWCIGUKPENWFKPI languages that are written from right to left. If you want to enter text in other languages, you can use Settings to make additional keyboards available when you type.
For a list of supported keyboards, go to www.apple.com/iphone/specs.html.
Add a keyboard:
1 +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFU
The number before the arrow indicates the number of keyboards currently enabled.
2 6CR#FF0GY-G[DQCTFVJGPEJQQUGCMG[DQCTFHTQOVJGNKUV
Repeat to add more keyboards. Some languages have multiple keyboards available.
Switch keyboards when you’re typing: Tap . When you tap the symbol, the name of
VJGPGYN[CEVKXCVGFMG[DQCTFCRRGCTUDTKG±[
You can also touch and hold to display a list of available keyboards. To choose a
MG[DQCTFHTQOVJGNKUVUNKFG[QWT°PIGTVQVJGPCOGQHVJGMG[DQCTFVJGPTGNGCUG
;HWVY[V\JOHUK
OVSK[VZ^P[JO
RL`IVHYKZ
Edit your keyboard list: %JQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFUVJGP tap Edit and do one of the following:
To delete a keyboard,
To reorder the list,
tap , then tap Delete.
drag next to a keyboard to a new place in the list.
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Type letters, numbers, or symbols that aren’t on the keyboard
Touch and hold the related letter, number, or symbol, then slide to choose a variation. On the
Thai keyboards, for example, you can choose native numbers by touching and holding the related Arabic number.
Enter Japanese Kana
Enter Japanese QWERTY
Enter Emoji picture characters
7UGVJG-CPCMG[RCFVQUGNGEVU[NNCDNGU(QTOQTG syllable options, tap the arrow key and select another syllable or word from the window.
Use the QWERTY keyboard to input code for
Japanese syllables. As you type, suggested syllables appear. Tap the syllable to choose it.
Use the Emoji keyboard. Available only on iPhones purchased and used in Japan.
Enter facemarks
Enter Korean
'PVGT5KORNK°GFQT6TCFKVKQPCN%JKPGUG2KP[KP
Enter Chinese Cangjie
7UKPIVJG,CRCPGUG-CPCMG[DQCTFVCRVJG¥@A@¦ key.
Using the Japanese Romaji keyboard (QWERTY-
Japanese layout), tap the Number key, then
VCRVJG¥@A@¦MG[
7UKPIVJG%JKPGUG5KORNK°GFQT6TCFKVKQPCN
Pinyin or (Traditional) Zhuyin keyboards, tap the
Symbols MG[VJGPVCRVJG¥@A@¦MG[
7UGVJG5GV-QTGCPMG[DQCTFVQV[RG*CPIWN letters. To type double consonants or compound vowels, touch and hold the letter, then slide to choose the double letter.
Use the QWERTY keyboard to enter Pinyin for
Chinese characters. As you type, suggested
Chinese characters appear. Tap a suggestion to choose it, or continue entering Pinyin to see more options.
If you keep entering Pinyin without spaces, sentence suggestions appear.
Use the keyboard to build Chinese characters from the component Cangjie keys. As you type, suggested Chinese characters appear. Tap a character to choose it, or continue typing up
VQ°XGVQVCNEQORQPGPVUVQUGGOQTGEJCTCEVGT options.
Chapter 3 Basics 41
APPLE CONFIDENTIAL — First Draft (1.10.11)
'PVGT5KORNK°GF%JKPGUG5VTQMG9WDK*WC
Enter Traditional Chinese Zhuyin
'PVGTJCPFYTKVVGP5KORNK°GFQT6TCFKVKQPCN
Chinese
Use the keypad to build Chinese characters using
WRVQ°XGUVTQMGUKPVJGEQTTGEVYTKVKPIUGSWGPEG from left to right, top to bottom, outside to inside, and from inside to the closing stroke (for
GZCORNGVJG%JKPGUGEJCTCEVGT EKTENGUJQWNF
DGIKPYKVJVJGXGTVKECNUVTQMG
As you type, suggested Chinese characters appear (the most commonly used characters
CRRGCT°TUV6CRCEJCTCEVGTVQEJQQUGKV
If you’re not sure of the correct stroke, enter an asterisk (*). To see more character options, type another stroke, or scroll through the character list.
6CRVJGOCVEJ MG[VQUJQYQPN[EJCTCEVGTU that match exactly what you typed. For example,
KH[QWV[RG QPGQPGCPFVCRVJGOCVEJ
MG[VJGNGUUEQOOQPN[WUGF VYQCRRGCTUCU an exact match.
Use the keyboard to enter Zhuyin letters. As you type, suggested Chinese characters appear. Tap a suggestion to choose it, or continue entering
Zhuyin letters to see more options. After you type an initial letter, the keyboard changes to show more letters.
If you keep entering Zhuyin without spaces, sentence suggestions appear.
Write Chinese characters directly on the screen
YKVJ[QWT°PIGT#U[QWYTKVGEJCTCEVGTUVTQMGU iPhone recognizes them and shows matching characters in a list, with the closest match at the top. When you choose a character, its likely follow-on characters appear in the list as additional choices.
You can get some complex characters by writing two or more component characters. For example,
GPVGT °UJVJGP DTKUVNGVQIGV RCTVKCN
PCOGQH*QPI-QPI+PVGTPCVKQPCN#KTRQTVYJKEJ appears in the character list with an arrow next to it. Tap the character to replace the characters you entered.
9KVJ5KORNK°GF%JKPGUGJCPFYTKVKPI4QOCP characters are also recognized.
42 Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
%QPXGTVDGVYGGP5KORNK°GFCPF6TCFKVKQPCN
Chinese
Enter Vietnamese
Select the character or characters you want to
convert, then tap Replace. See “Editing—Cut,
Touch and hold a character to see the available diacritical marks, then slide to choose the one you want.
You can also type the following key sequences to enter characters with diacritical marks:
CC¤jCEKTEWO±GZ
CY¤ CECTQP
GG¤qGEKTEWO±GZ
QQ¤zQEKTEWO±GZ
QY¤ QJQQM
Y¤ WJQQM
FF¤ FFCUJ as—á (a acute) af—à (a grave)
CT¤ CSWGUVKQPOCTM ax—ã (a rising accent)
CL¤ CFTQRVQPG
9JGP5KORNK°GFQT6TCFKVKQPCN%JKPGUGJCPFYTKVKPIHQTOCVUCTGVWTPGFQP[QWECP
GPVGT%JKPGUGEJCTCEVGTUYKVJ[QWT°PIGTCUUJQYP
;V\JOWHK
When using certain Chinese or Japanese keyboards, you can create a dictionary of word and input pairs. When you type a word from the dictionary while using a supported keyboard, the associated input is substituted for the word. The dictionary is available for the following keyboards:
%JKPGUG5KORNK°GF2KP[KP
Chinese - Traditional (Pinyin)
Chinese - Traditional (Zhuyin)
Japanese (Romaji)
Chapter 3 Basics 43
44
APPLE CONFIDENTIAL — First Draft (1.10.11)
,CRCPGUG6GP-G[
Add a word to the dictionary: +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF 'FKV7UGT
&KEVKQPCT[6CRVCRVJG9QTF°GNFCPFGPVGTVJGYQTFVJGPVCRVJG;QOK2KP[KPQT
<JW[KP°GNFCPFGPVGTVJGKPRWV
You can have multiple inputs for each word, depending on the keyboards you’ve turned on.
Delete a word from the dictionary: Tap the word in the User Dictionary list, then tap
Delete Word.
Keyboard Layouts
You can use Settings to set the keyboard layouts for software and hardware keyboards.
The available layouts depend on the keyboard language.
Select a keyboard layout: +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN
-G[DQCTFUVJGPUGNGEVCMG[DQCTF(QTGCEJNCPIWCIG[QWECPOCMGUGRCTCVG selections for both the onscreen software and any external hardware keyboards.
The software keyboard layout determines the layout of the keyboard on the iPhone screen. The hardware keyboard layout determines the layout of an Apple Wireless
-G[DQCTFEQPPGEVGFVQK2JQPG .
Using an Apple Wireless Keyboard
(QTGCUGQHV[RKPI[QWECPWUGCP#RRNG9KTGNGUU-G[DQCTFCXCKNCDNGUGRCTCVGN[ iPhone 3GS or later).
6JG#RRNG9KTGNGUU-G[DQCTFEQPPGEVUXKC$NWGVQQVJUQ[QWOWUVRCKTVJGMG[DQCTF
with iPhone. See “Pairing a Bluetooth Device with iPhone” on page 51.
Once the keyboard is paired with iPhone, it connects whenever the keyboard is within range (up to 30 feet). You can tell that the keyboard is connected if the onscreen
MG[DQCTFFQGUP¨VCRRGCTYJGP[QWVCRKPCVGZV°GNF
Switch the language when using a hardware keyboard: Press and hold the
Command key, then tap the space bar to display a list of available languages. Tap the
URCEGDCTCICKPVQEJQQUGCFKÒGTGPVNCPIWCIG
Disconnect a wireless keyboard from iPhone: Press and hold the power button on
VJGMG[DQCTFWPVKNVJGITGGPNKIJVIQGUQÒ iPhone disconnects the keyboard when it’s out of range.
Unpair a wireless keyboard from iPhone: In Settings, choose General > Bluetooth, tap
next to the device name, then tap “Forget this Device.”
;QWECPCRRN[FKÒGTGPVNC[QWVUVQCYKTGNGUUMG[DQCTF5GG¥+PVGTPCVKQPCN-G[DQCTFU ” on page 40 and “
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Printing
About AirPrint
AirPrint lets you print wirelessly to AirPrint-capable printers. You can print from the following iOS apps:
Mail—email messages and attachments that can be viewed in Quick Look
Photos—photos
Safari—webpages, PDFs, and other attachments that can be viewed in Quick Look iBooks—PDFs
Other apps available from the App Store may also support AirPrint.
AirPrint-capable printers don’t require setup; they just need to be connected to the same Wi-Fi network as iPhone. (If you’re not sure whether your printer is AirPrintcapable, refer to its documentation.)
For more information, go to support.apple.com/kb/HT4356.
Printing a Document
AirPrint uses your Wi-Fi network to send print jobs wirelessly to your printer. iPhone must be connected to the same wireless network as the AirPrint printer.
Print a document:
1 Tap or (depending on the app you’re using), then tap Print.
2 Tap Select Printer to select a printer.
3 Set printer options such as number of copies and double-sided output (if the printer supports it). Some apps also let you set a range of pages to print.
4 Tap Print.
Chapter 3 Basics 45
APPLE CONFIDENTIAL — First Draft (1.10.11)
See the status of a print job: Double-click the Home button, then tap Print Center.
The Print Center app appears as the most recent app when a document is printing. A badge on the app icon shows how many documents are queued for printing.
If you’re printing more than one document, select a print job to see its status summary.
Cancel a print job: Double-click the Home button, tap Print Center, select the print job
(if you’re printing more than one document), then tap Cancel Printing.
46 Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Searching
You can search many apps on iPhone, including Mail, Calendar, iPod, Notes, Messages
(iPhone 3GS or later), and Contacts. You can search an individual app, or search all apps at once using Search.
Go to Search: 1PVJGOCKP*QOGUETGGP±KEMNGHVVQTKIJVQTRTGUUVJG*QOG button.
From the Search screen, press the Home button to return to the main Home screen page.
Search iPhone: 1PVJG5GCTEJUETGGPGPVGTVGZVKPVJG5GCTEJ°GNF5GCTEJTGUWNVU appear as you type. Tap an item in the list to open it. Tap Search to dismiss the keyboard and see more results.
Icons next to the search results show which app the results are from. iPhone may display a top hit for you at the top of the list, based on your previous searches. The Safari search results include options to search the web or to search
Wikipedia.
App
Contacts
Calendar iPod
Messages (iPhone 3GS or later)
Notes
What’s searched
First, last, and company names
6Q(TQOCPF5WDLGEV°GNFUQHCNNCEEQWPVUVJG text of messages isn’t searched)
Event titles, invitees, locations, and notes
Music (names of songs, artists, and albums) and the titles of podcasts, videos, and audiobooks
Names and text of messages
Text of notes
Chapter 3 Basics 47
APPLE CONFIDENTIAL — First Draft (1.10.11)
Search also searches the names of the native and installed apps on iPhone, so if you have a lot of apps, you may want to use Search to locate and open apps.
Open apps from Search: Enter the app name, then tap to open the app directly from the search results.
Use the Spotlight Search setting to specify which contents are searched and the order
the results are presented in. See “Spotlight Search” on page 201.
Voice Control
Voice Control (iPhone 3GS or later) lets you make phone calls and control iPod music playback using voice commands.
Note: Voice Control may not be available in all languages.
48
Use Voice Control: Press and hold the Home button until the Voice Control screen appears and you hear a beep. You can also press and hold the center button on the iPhone earphones.
Use the following commands to make calls or play songs.
Call someone in contacts
Make a FaceTime call someone in contacts
(iPhone 4 only)
Dial a number
Control music playback
Say “call” or “dial,” then say the name of the person. If the person has more than one phone number, you can add “home” or “mobile,” for example.
Say “FaceTime,” then say the name of the person.
If the person has more than one phone number, you can add “home” or “mobile,” for example.
Say “call” or “dial,” then say the number.
Say “play” or “play music.” To pause, say “pause” or “pause music.” You can also say “next song” or
“previous song.”
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Play an album, artist, or playlist Say “play,” then say “album,” “artist,” or “playlist” and the name.
5C[¥UJWÔG¦ 5JWÔGVJGEWTTGPVRNC[NKUV
Find out more about the currently playing song Say “what’s playing,” “what song is this,” “who sings this song,” or “who is this song by.”
Use Genius to play similar songs Say “Genius,” “play more like this,” or “play more songs like this.”
Find out the current time
Cancel Voice Control
Say “what time is it?” or “what is the time?”
Say “cancel” or “stop.”
For best results:
Speak into the iPhone microphone as if you were making a phone call. You can also use the microphone on your Bluetooth headset or compatible Bluetooth car kit.
Speak clearly and naturally.
Say only iPhone commands and names, and numbers. Pause slightly between commands.
Use full names.
For more about using Voice Control, including information about using Voice Control
KPFKÒGTGPVNCPIWCIGUIQVQ support.apple.com/kb/HT3597.
Voice Control normally expects you to speak voice commands in the language that’s set for iPhone (the setting in General > International > Language). Voice Control settings let you change the language for speaking voice commands. Some languages
CTGCXCKNCDNGKPFKÒGTGPVFKCNGEVUQTCEEGPVU
Change the language or country: In Settings, choose General > International > Voice
Control and tap the language or country.
Voice Control for the iPod app is always on, but for better security you can prevent voice dialing when iPhone is locked.
Prevent voice dialing when iPhone is locked: In Settings, choose General > Passcode
.QEMCPFVWTP8QKEG&KCNQÒ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI
See “Voice Dialing” on page 65 and “Using Voice Control with iPod” on page 100.
Chapter 3 Basics 49
50
APPLE CONFIDENTIAL — First Draft (1.10.11)
Apple Earphones with Remote and Mic
The Apple Earphones with Remote and Mic included with iPhone feature a microphone, volume buttons, and an integrated button that allows you to answer and end calls easily, and control audio and video playback.
*LU[LYI\[[VU
Plug in the earphones to listen to music or make a phone call. Press the center button to control music playback and answer or end calls, even when iPhone is locked.
Pause a song or video
Skip to the next song
Return to previous song
Fast-forward
Rewind
Adjust the volume (iPhone 3GS or later)
Answer an incoming call
End the current call
Decline an incoming call
Switch to an incoming or on-hold call and put the current call on hold
Switch to an incoming or on-hold call and end the current call
Use Voice Control (iPhone 3GS or later)
Press the center button. Press again to resume playback.
Press the center button twice quickly.
Press the center button three times quickly.
Press the center button twice quickly and hold.
Press the center button three times quickly and hold.
Press the + or – button.
Press the center button.
Press the center button.
Press and hold the center button for about two
UGEQPFUVJGPNGVIQ6YQNQYDGGRUEQP°TO[QW declined the call.
Press the center button. Press again to switch
DCEMVQVJG°TUVECNN
Press and hold the center button for about two
UGEQPFUVJGPNGVIQ6YQNQYDGGRUEQP°TO[QW
GPFGFVJG°TUVECNN
Press and hold the center button. See “Voice
If you get a call while the earphones are plugged in, you can hear the ringtone through both the iPhone speaker and the earphones.
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Bluetooth Devices
;QWECPWUGK2JQPGYKVJVJG#RRNG9KTGNGUU-G[DQCTFCPFQVJGT$NWGVQQVJFGXKEGU such as Bluetooth headsets, car kits, and stereo headphones. Third-party Bluetooth headphones may support volume and playback controls. See the documentation that
ECOGYKVJ[QWT$NWGVQQVJFGXKEG(QTUWRRQTVGF$NWGVQQVJRTQ°NGUIQVQ support.
apple.com/kb/HT3647.
Pairing a Bluetooth Device with iPhone
WARNING: For important information about avoiding hearing loss and about driving safely, see the Important Product Information Guide at www.apple.com/support/ manuals/iphone.
$GHQTG[QWECPWUGC$NWGVQQVJFGXKEGYKVJK2JQPG[QWOWUV°TUVRCKTVJGO
Pair a Bluetooth headset, car kit, or other device with iPhone:
1 Follow the instructions that came with the device to make it discoverable or to set it to search for other Bluetooth devices.
2 In Settings, choose General > Bluetooth and turn Bluetooth on.
3 Choose the device on iPhone, and enter its passkey or PIN number. See the instructions about the passkey or PIN that came with the device.
After you pair a Bluetooth device to work with iPhone, you must make a connection to have iPhone use the device for your calls. See the documentation that came with the device.
When iPhone is connected to a Bluetooth headset or car kit, outgoing calls are routed through the device. Incoming calls are routed through the device if you answer using the device, and through iPhone if you answer using iPhone.
Pair an Apple Wireless Keyboard with iPhone:
1 In Settings, choose General > Bluetooth and turn Bluetooth on.
2 2TGUUVJGRQYGTDWVVQPQPVJG#RRNG9KTGNGUU-G[DQCTFVQVWTPKVQP
3 On iPhone, select the keyboard listed under Devices.
4 Type the passkey on the keyboard as instructed, then press Return.
Note: ;QWECPRCKTQPN[QPG#RRNG9KTGNGUU-G[DQCTFYKVJK2JQPGCVCVKOG6QRCKTC
FKÒGTGPVMG[DQCTF[QWOWUV°TUVWPRCKTVJGEWTTGPVQPG
For more information, see “ 7UKPICP#RRNG9KTGNGUU-G[DQCTF ” on page 44.
Bluetooth Status
The Bluetooth icon appears in the iPhone status bar at the top of the screen:
or : Bluetooth is on and a device is connected to iPhone. (The color depends on the current color of the status bar.)
Chapter 3 Basics 51
APPLE CONFIDENTIAL — First Draft (1.10.11)
: Bluetooth is on but no device is connected. If you’ve paired a device with iPhone,
KVOC[DGQWVQHTCPIGQTVWTPGFQÒ
No Bluetooth icon: $NWGVQQVJKUVWTPGFQÒ
Unpairing a Bluetooth Device from iPhone
You can unpair a Bluetooth device if you don’t want to use it with iPhone any more.
Unpair a Bluetooth device:
1 In Settings, choose General > Bluetooth and turn Bluetooth on.
2 Tap next to the device name, then tap “Forget this Device.”
Battery
iPhone has an internal rechargeable battery.
Charging the Battery
WARNING: For important safety information about charging iPhone, see the
Important Product Information Guide at www.apple.com/support/manuals/iphone.
The battery icon in the upper-right corner shows the battery level or charging status.
You can also display the percentage of the battery charge (iPhone 3GS or later). See
*OHYNPUN *OHYNLK
Charge the battery: Connect iPhone to a power outlet using the included Dock
Connector to USB Cable and USB power adapter.
52
Charge the battery and sync iPhone: Connect iPhone to your computer using the included Dock Connector to USB Cable. Or connect iPhone to your computer using the included cable and the Dock, available separately.
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Unless your keyboard has a high-powered USB 2.0 port, you must connect iPhone to a
USB 2.0 port on your computer.
Important: The iPhone battery may drain instead of charge if iPhone is connected to a
EQORWVGTVJCV¨UVWTPGFQÒQTKUKPUNGGRQTUVCPFD[OQFG
If you charge the battery while syncing or using iPhone, it may take longer to charge.
Important: If iPhone is very low on power, it may display one of the following images, indicating that iPhone needs to charge for up to ten minutes before you can use it.
If iPhone is extremely low on power, the display may be blank for up to two minutes before one of the low-battery images appears.
VY
Maximizing Battery Life
iPhone uses lithium-ion batteries. To learn more about how to maximize the lifespan and battery life of your iPhone, go to www.apple.com/batteries.
Replacing the Battery
Rechargeable batteries have a limited number of charge cycles and may eventually need to be replaced. The iPhone battery isn’t user replaceable; it can only be replaced by an authorized service provider. For more information, go to www.apple.com/ support/iphone/service/battery.
Security Features
Security features help protect the information on iPhone from being accessed by others.
Chapter 3 Basics 53
54
APPLE CONFIDENTIAL — First Draft (1.10.11)
Passcodes and Data Protection
You can set a passcode that you must enter each time you turn on or wake up iPhone.
Set a passcode: Choose Settings > General > Passcode Lock and enter a 4-digit passcode, then enter the passcode again to verify it. iPhone then requires you to enter the passcode to unlock it or to display the passcode lock settings.
Setting a passcode turns on data protection (iPhone 3GS or later). Data protection uses your passcode as the key for encrypting mail messages and their attachments stored on iPhone. (Data protection may also be used by some apps available in the App
Store.) A notice at the bottom of the Passcode Lock screen in Settings indicates when data protection is enabled.
6QKPETGCUGVJGUGEWTKV[QHK2JQPGVWTPQÒ5KORNG2CUUEQFGCPFWUGCNQPIGTRCUUEQFG with a combination of numbers, letters, punctuation, and special characters. See
Important: On an iPhone 3GS that didn’t ship with iOS 4 or later, you must also restore
iOS software to enable data protection. See “Restoring iPhone” on page 256.
Prevent voice dialing when iPhone is locked: In Settings, choose General > Passcode
.QEMCPFVWTP8QKEG&KCNQÒ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI
Find My iPhone
Find My iPhone helps you locate and secure your iPhone using the free Find My iPhone app on another iPhone, iPad, or iPod touch, or using a Mac or PC with a web browser. Find My iPhone includes:
Locate on a map: View the approximate location of your iPhone on a full-screen map
Display a Message or Play a Sound: Lets you compose a message that will appear on your iPhone screen, or play a sound at full volume for two minutes, even if the
Ring/Silent switch is set to silent
Remote Passcode Lock: Lets you remotely lock your iPhone and create a 4-digit passcode, if you haven’t set one previously
Remote Wipe: Lets you protect your privacy by erasing all media and data on iPhone, restoring it to factory settings
Use Find My iPhone: You need to turn on Find My iPhone on iPhone before you can
use these features. See “Setting Up MobileMe Accounts” on page 25.
To locate your missing iPhone and use the other Find My iPhone features, download the free Find My iPhone app from the App Store on another iOS device, or sign in to me.com in a web browser on a Mac or PC.
Chapter 3 Basics
APPLE CONFIDENTIAL — First Draft (1.10.11)
Note: Find My iPhone requires a MobileMe account. MobileMe is Apple’s online service, which provides Find My iPhone for free to iPhone 4 customers, and additional features with a paid subscription. MobileMe may not be available in all countries or
regions. For more information, see “Setting Up MobileMe Accounts” on page 25, or go
to www.apple.com/mobileme.
Cleaning iPhone
Clean iPhone immediately if it comes in contact with any contaminants that may cause stains, such as ink, dyes, makeup, dirt, food, oils, or lotions. To clean iPhone, disconnect
CNNECDNGUCPFVWTPQÒK2JQPGRTGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPVJGP slide the onscreen slider). Then use a soft, slightly damp, lint-free cloth. Avoid getting moisture in openings. Don’t use window cleaners, household cleaners, compressed air, aerosol sprays, solvents, alcohol, ammonia, or abrasives to clean iPhone. The front cover of iPhone 3GS and the front and back covers of iPhone 4 are made of glass and have an oleophobic coating. To clean these surfaces, simply wipe with a soft, lint-free cloth.
The ability of this coating to repel oil will diminish over time with normal usage, and
TWDDKPIVJGUETGGPYKVJCPCDTCUKXGOCVGTKCNYKNNHWTVJGTFKOKPKUJKVUGÒGEVCPFOC[ scratch the glass.
For more information about handling iPhone, see the iPhone Important Product
Information Guide at www.apple.com/support/manuals/iphone.
Restarting or Resetting iPhone
If something isn’t working right, try restarting iPhone, force quitting an app, or resetting iPhone.
Restart iPhone: 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJGTGFUNKFGT
CRRGCTU5NKFG[QWT°PIGTCETQUUVJGUNKFGTVQVWTPQÒK2JQPG6QVWTPK2JQPGDCEMQP
RTGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJG#RRNGNQIQCRRGCTU
+H[QWECP¨VVWTPQÒK2JQPGQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2JQPG
#TGUGVUJQWNFDGFQPGQPN[KHVWTPKPIK2JQPGQÒCPFQPFQGUP¨VTGUQNXGVJGRTQDNGO
Force quit an app: 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPHQTCHGYUGEQPFU until a red slider appears, then press and hold the Home button until the app quits.
On iPhone 3GS or later, you can also remove an app from the recents list to force it to
quit. See “Opening and Switching Apps” on page 29.
Reset iPhone: 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPCPFVJG*QOGDWVVQPCV the same time for at least ten seconds, until the Apple logo appears.
For more troubleshooting suggestions, see Appendix A, “Support and Other
Chapter 3 Basics 55
56
APPLE CONFIDENTIAL — First Draft (1.10.11)
Syncing and File Sharing
4
About Syncing
Syncing copies information from your computer or online account to iPhone, then keeps the information in sync by copying changes made in one location to the other.
You use iTunes on your computer to sync contacts, calendars, and other information; iOS apps; photos and videos; and music and other iTunes content. By default, syncing occurs whenever you connect iPhone to your computer.
;QWECPCNUQEQP°IWTGK2JQPGVQCEEGUUCEEQWPVUYKVJQPNKPGUGTXKEGRTQXKFGTUUWEJCU
MobileMe, Microsoft Exchange, Google, Yahoo!, and others. Your information on those services is synced over the air.
Syncing Accounts
MobileMe, Microsoft Exchange, Google, Yahoo!, and other online service providers sync information—which might include contacts, calendars, browser bookmarks, and notes
(iPhone 3GS or later)—via your Internet connection (over the air), so that you don’t have to connect iPhone to your computer. The Internet connection can be over your cellular network or your local Wi-Fi network.
Some service providers—including MobileMe and Microsoft Exchange— push information updates. This means that syncing happens whenever any information is changed. The Push setting in Fetch New Data must be turned on (it’s on by default).
For iPhone 3G users, iPhone must also be awake or connected to your computer or a power adapter. Other providers sync by periodically “fetching” changes that have
occurred. Use the Fetch setting to determine how frequently this happens. See “Fetch
For information about setting up accounts on iPhone, see “Adding Mail, Contacts, and
Calendar Accounts” on page 25.
Syncing with iTunes
You can set iTunes to sync any or all of the following:
Contacts—names, phone numbers, addresses, email addresses, and more
APPLE CONFIDENTIAL — First Draft (1.10.11)
Calendars—appointments and events
Email account settings
Webpage bookmarks
Notes
Ringtones
Music
Photos and videos (in your computer’s photo application or folder) iTunes U collections
Podcasts
Books and audiobooks
Movies, TV shows, and music videos
Apps downloaded from the App Store
You can adjust sync settings whenever iPhone is connected to your computer.
Ringtones, music, audiobooks, podcasts, books, iTunes U collections, videos, and apps are synced from your iTunes library. If you don’t already have content in iTunes, the iTunes Store (not available in all countries or regions) makes it easy to preview content and download it to iTunes. You can also add music to your iTunes library from your
CDs. To learn about iTunes and the iTunes Store, open iTunes and choose Help > iTunes Help.
Contacts, calendars, notes, and webpage bookmarks are synced with applications on your computer, as described in the following section. New entries or changes you make on iPhone are synced to your computer, and vice versa.
iTunes also lets you sync photos and videos from an application or from a folder.
Email account settings are synced only from your computer’s email application to
K2JQPG6JKUCNNQYU[QWVQEWUVQOK\G[QWTGOCKNCEEQWPVUQPK2JQPGYKVJQWVCÒGEVKPI email account settings on your computer.
Note:
You can also set up email accounts directly on iPhone. See “Adding Mail,
Contacts, and Calendar Accounts” on page 25.
Purchases you make on iPhone in the iTunes Store or the App Store are synced back to your iTunes library. You can also purchase or download content and apps from the iTunes Store on your computer, and then sync them to iPhone.
You can set iPhone to sync with only a portion of what’s on your computer. For example, you might want to sync only a group of contacts from your address book, or only unwatched video podcasts.
Chapter 4 Syncing and File Sharing 57
APPLE CONFIDENTIAL — First Draft (1.10.11)
Important: You should be logged in to your own user account on your computer before connecting iPhone.
Set up iTunes syncing:
1 Connect iPhone to your computer, and open iTunes.
2 In iTunes, select iPhone in the Devices list.
3 %QP°IWTGVJGU[PEUGVVKPIUKPGCEJQHVJGUGVVKPIURCPGU
See the following section for descriptions of the panes.
4 Click Apply in the lower-right corner of the screen.
By default, “Open iTunes when this iPhone is connected” is selected.
iPhone Settings Panes in iTunes
The following sections provide an overview of each of the iPhone settings panes. For more information, open iTunes and choose Help > iTunes Help.
58
Note: Buttons for additional panes may appear in iTunes, depending on the types of content in your iTunes library.
Summary Pane
Select “Open iTunes when this iPhone is connected” to have iTunes open and sync iPhone automatically whenever you connect it to your computer. Deselect this option if you want to sync only by clicking the Sync button in iTunes. For more information,
see “Automatic iTunes Syncing” on page 61.
Select “Sync only checked songs and videos” if you want iTunes to skip unchecked items in your iTunes library when syncing.
5GNGEV¥2TGHGTUVCPFCTFFG°PKVKQPXKFGQU¦KH[QWYCPVK6WPGUVQU[PEUVCPFCTFFG°PKVKQP
KPUVGCFQHJKIJFG°PKVKQPXKFGQUK2JQPGQPN[
Chapter 4 Syncing and File Sharing
APPLE CONFIDENTIAL — First Draft (1.10.11)
Select “Convert higher bit rate songs to 128 kbps AAC” if you want iTunes to convert
NCTIGTCWFKQ°NGUVQVJGUVCPFCTFK6WPGUCWFKQHQTOCVFWTKPIU[PEKPI
5GNGEV¥/CPWCNN[OCPCIGOWUKECPFXKFGQU¦VQVWTPQÒCWVQOCVKEU[PEKPIKPVJG/WUKE
and Video settings panes. See “Manually Managing Content” on page 61.
Select “Encrypt iPhone backup” if you want to encrypt the information stored on your computer when iTunes makes a backup. Encrypted backups are indicated by a lock
%NKEM%QP°IWTG7PKXGTUCN#EEGUUVQVWTPQP#EEGUUKDKNKV[HGCVWTGUK2JQPG)5QTNCVGT
See Chapter 29, “Accessibility,” on page 235.
Info Pane
6JG+PHQRCPGNGVU[QWEQP°IWTGVJGU[PEUGVVKPIUHQT[QWTEQPVCEVUECNGPFCTUGOCKN accounts, and web browser.
Contacts
Sync contacts with applications such as Mac OS X Address Book, Yahoo! Address
Book, and Google Contacts on a Mac, or with Yahoo! Address Book, Google Contacts,
Windows Address Book (Outlook Express), Windows Contacts (Vista and Windows 7), or Microsoft Outlook 2003, 2007, or 2010 on a PC. (On a Mac, you can sync contacts with multiple applications. On a PC, you can sync contacts with one application at a time.)
+H[QWU[PEYKVJ;CJQQ#FFTGUU$QQM[QWQPN[PGGFVQENKEM%QP°IWTGVQGPVGT[QWT new login information when you change your Yahoo! ID or password after you’ve set up syncing.
Calendars
Sync calendars from applications such as iCal on a Mac, or from Microsoft Outlook
2003, 2007, or 2010 on a PC. (On a Mac, you can sync calendars with multiple applications. On a PC, you can sync calendars with only one application at a time.)
Mail Accounts
Sync email account settings from Mail on a Mac, and from Microsoft Outlook 2003,
2007, or 2010 or Outlook Express on a PC. Account settings are transferred only from your computer to iPhone. Changes you make to an email account on iPhone don’t
CÒGEVVJGCEEQWPVQP[QWTEQORWVGT
Note: The password for your Yahoo! email account isn’t saved on your computer, so it can’t be synced and must be entered on iPhone. In Settings, choose “Mail,
Contacts, Calendars,” tap your Yahoo! account, and enter the password.
Web Browser
You can sync bookmarks on iPhone with Safari on a Mac, or with Safari or Microsoft
Internet Explorer on a PC.
Chapter 4 Syncing and File Sharing 59
60
APPLE CONFIDENTIAL — First Draft (1.10.11)
Notes
Sync notes in the Notes app on iPhone with notes in Mail on a Mac or with
Microsoft Outlook 2003, 2007, or 2010 on a PC.
Advanced
These options let you replace the information on iPhone with the information on your computer during the next sync.
Apps Pane
Use the Apps Pane to sync App Store apps, arrange apps on the iPhone Home screen, or copy documents between iPhone and your computer.
Select “Automatically sync new apps” to sync new apps to iPhone that you downloaded or synced from another device. If you delete an app on iPhone, you can reinstall it from the Apps pane as long as it was previously synced.
;QWECPETGCVGFQEWOGPVUQPK2JQPGYKVJCRRUVJCVUWRRQTV°NGUJCTKPICPFVJGP copy those documents to your computer. You can also copy documents from your
EQORWVGTVQK2JQPGCPFWUGVJGOYKVJCRRUVJCVUWRRQTV°NGUJCTKPI5GG¥
Ringtones Pane
Use the Ringtones pane to select the ringtones you want to sync to iPhone.
Music, Movies, TV Shows, Podcasts, iTunes U, and Books Panes
Use these panes to specify the media you want to sync. You can sync all music, movies,
TV shows, podcasts, iTunes U collections, books and audiobooks, or select the content you want.
If you create a playlist folder (collection of playlists) in iTunes, the folder and its playlists will be synced to iPhone. You can’t create playlist folders directly on iPhone.
If you listen to part of a podcast or audiobook, your place in the story is included if you sync the content with iTunes. If you started listening to the story on iPhone, you can
RKEMWRYJGTG[QWNGHVQÒWUKPIK6WPGUQP[QWTEQORWVGT¤QTXKEGXGTUC
If you want to watch a rented movie from your computer on iPhone, sync it to iPhone using the Movies pane in iTunes.
Only songs and videos encoded in formats that iPhone supports are synced to iPhone.
For information about which formats iPhone supports, go to www.apple.com/iphone/ specs.html.
Important: If you delete an item from iTunes, it will also be deleted from iPhone the next time you sync.
Chapter 4 Syncing and File Sharing
APPLE CONFIDENTIAL — First Draft (1.10.11)
Photos Pane
On a Mac, you can sync photos with Aperture or iPhoto 4.0.3 or later, and videos with iPhoto 6.0.6 or later. On a PC, you can sync photos with Adobe Photoshop Elements
8.0 or later. You can also sync photos and videos from any Mac or PC folder that contains images.
Automatic iTunes Syncing
By default, iPhone syncs whenever you connect it to iTunes. You can prevent iPhone from syncing when you connect iPhone to a computer other than the one you usually sync with.
6WTPQÒCWVQOCVKEU[PEKPIHQTK2JQPG
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen.
3 Deselect “Open iTunes when this iPhone is connected.”
9JGPCWVQOCVKEU[PEKPIKUVWTPGFQÒ[QWECPUVKNNU[PED[ENKEMKPIVJG5[PEDWVVQP
Prevent automatic syncing for all iPods, iPhones, and iPads:
1 In iTunes, choose iTunes > Preferences (on a Mac) or Edit > Preferences (on a PC).
2 Click Devices, then select “Prevent iPods, iPhones, and iPads from syncing automatically.”
If this checkbox is selected, iPhone won’t sync, even if “Open iTunes when this iPhone is connected” is selected in the Summary pane.
Prevent automatic syncing one time, without changing settings: Open iTunes, connect iPhone to your computer, then press and hold Command-Option (on a Mac) or Shift-Control (on a PC) until you see iPhone appear in the sidebar.
Sync manually: In iTunes, select iPhone in the sidebar, then click Sync in the bottomright corner of the window. Or, if you’ve changed any sync settings, click Apply.
Manually Managing Content
The manually managing feature lets you choose just the music, videos, and podcasts you want to have on iPhone.
Set up iPhone for manually managing content:
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the sidebar.
3 Click Summary at the top of the screen and select “Manually manage music and videos.”
4 Click Apply.
Chapter 4 Syncing and File Sharing 61
62
APPLE CONFIDENTIAL — First Draft (1.10.11)
Add items to iPhone: Drag a song, video, podcast, or playlist in your iTunes library to iPhone (in the sidebar). Shift-click or Command-click (Mac) or Control-click (Windows) to select multiple items to add at the same time.
iTunes syncs the content immediately. If you deselect “Manually manage music and videos,” the content you added manually is removed from iPhone the next time iTunes syncs content.
Remove items from iPhone: With iPhone connected to your computer, select iPhone in the iTunes sidebar, and click its disclosure triangle to show contents. Select a content area, such as Music or Movies, then select the items you want to delete and press the Delete key on the keyboard.
Removing an item from iPhone doesn’t delete it from your iTunes library.
Note:
Genius does not work if you manually manage content. See “Using Genius on iPhone” on page 102.
Transferring Purchased Content to Another Computer
You can transfer content on iPhone that was purchased using iTunes on one computer to an iTunes library on another authorized computer. The computer must be authorized to play content purchased using your Apple ID.
Authorize a computer: Open iTunes on the computer and choose Store > Authorize
Computer.
Transfer purchased content: Connect iPhone to the other computer. In iTunes, choose
File > Transfer Purchases from iPhone.
File Sharing
(KNG5JCTKPINGVU[QWVTCPUHGT°NGUDGVYGGPK2JQPGCPF[QWTEQORWVGT;QWECPUJCTG
°NGUETGCVGFYKVJCEQORCVKDNGCRRCPFUCXGFKPCUWRRQTVGFHQTOCV
#RRUVJCVUWRRQTV°NGUJCTKPICRRGCTKPVJG(KNG5JCTKPI#RRUNKUVKPK6WPGU(QT each app, the Files list shows the documents that are on iPhone. See the app’s
FQEWOGPVCVKQPHQTJQYKVUJCTGU°NGUPQVCNNCRRUUWRRQTVVJKUHGCVWTG
6TCPUHGTC°NGHTQOK2JQPGVQ[QWTEQORWVGT
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen.
3 In the File Sharing section, select an app from the list on the left.
4 1PVJGTKIJVUGNGEVVJG°NG[QWYCPVVQVTCPUHGTVJGPENKEM¥5CXGVQ¦CPFEJQQUGC destination on your computer.
Chapter 4 Syncing and File Sharing
APPLE CONFIDENTIAL — First Draft (1.10.11)
6TCPUHGTC°NGHTQO[QWTEQORWVGTVQK2JQPG
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list, then click Apps at the top of the screen.
3 In the File Sharing section, click Add.
4 5GNGEVC°NGVJGPENKEM%JQQUG/CEQT1-2%
6JG°NGKUVTCPUHGTTGFVQ[QWTFGXKEGCPFECPDGQRGPGFWUKPICPCRRVJCVUWRRQTVU
VJCV°NGV[RG6QVTCPUHGTOQTGVJCPQPG°NGUGNGEVGCEJCFFKVKQPCN°NG
&GNGVGC°NGHTQOK2JQPG 5GNGEVVJG°NGKPVJG(KNGUNKUVVJGPVCR&GNGVG
Chapter 4 Syncing and File Sharing 63
64
APPLE CONFIDENTIAL — First Draft (1.10.11)
Phone
5
Phone Calls
Making a call on iPhone is as simple as tapping a name and number in your contacts, tapping one of your favorites, or tapping a recent call to return it.
Making Calls
Buttons at the bottom of the Phone screen give you quick access to your favorites, recent calls, your contacts, and a numeric keypad for dialing manually.
WARNING: For important information about driving safely, see the Important Product
Information Guide at www.apple.com/support/manuals/iphone.
5\TILYVM\UOLHYK
]VPJLTHPSTLZZHNLZ
5\TILYVMTPZZLKJHSSZ
Use Contacts to call someone
Call a favorite
Return a recent call
Dial a number
Tap Contacts, choose a contact, then tap a phone number.
Tap Favorites, then choose a contact.
Tap Recents, then tap a name or number in the list. If the call was a FaceTime video call (indicated by video call.
), tap the item to make a new
6CR-G[RCFGPVGTVJGPWODGTVJGPVCR%CNN
APPLE CONFIDENTIAL — First Draft (1.10.11)
If you copy a phone number to the clipboard, you can paste it to the numeric keypad and dial it.
Paste a number to the keypad: Tap the screen above the keyboard, then tap Paste.
If the phone number you copied included letters, iPhone converts them to the appropriate digits.
Redial the last number you dialed: 6CR-G[RCFVJGPVCR%CNN6CR%CNNCICKPVQFKCN the number.
Voice Dialing
You can use Voice Control (iPhone 3GS or later) to call someone in your contacts or
FKCNCURGEK°EPWODGT
Note: Voice Control may not be available in all languages.
Use Voice Control to make a phone call: Press and hold the Home button until the
Voice Control screen appears and you hear a beep. Then use the commands described below to make a call.
You can also press and hold the center button on the iPhone earphones to use Voice
Control.
Call someone in contacts
Dial a number
Say “call” or “dial” then say the name of the person.
If the person has more than one number, specify which one you want to call.
Examples:
Call John Appleseed
Call John Appleseed at home
Call John Appleseed, mobile
Say “call” or “dial,” then say the number.
For best results, speak the full name of the person you’re calling. If you speak only the
°TUVPCOGCPF[QWJCXGOQTGVJCPQPGEQPVCEVYKVJVJCVPCOGK2JQPGCUMUYJKEJQH those contacts you want to call. If there’s more than one number for the person you’re calling, say which number to use. Otherwise, iPhone asks you.
When voice dialing a number, speak each digit separately—for example, say “four one
°XG°XG°XG°XGQPGVYQQPGVYQ¦
Note: For the “800” area code in the U.S., you can say “eight hundred.”
Prevent voice dialing when iPhone is locked: In Settings, choose General > Passcode
.QEMCPFVWTP8QKEG&KCNQÒ7PNQEMK2JQPGVQWUGXQKEGFKCNKPI
Chapter 5 Phone 65
APPLE CONFIDENTIAL — First Draft (1.10.11)
Receiving Calls
When you receive a call, tap Answer. If iPhone is locked, drag the slider. You can also press the center button on your iPhone earphones to answer a call.
*LU[LYI\[[VU
Silence a call: 2TGUUVJG1P1Ò5NGGR9CMGDWVVQPQTGKVJGTXQNWOGDWVVQP;QWECP still answer the call after silencing it, until it goes to voicemail.
Decline a call: Do one of the following to send a call directly to voicemail.
2TGUUVJG1P1Ò5NGGR9CMGDWVVQPVYKEGSWKEMN[
6U6MM:SLLW
>HRLI\[[VU
Press and hold the center button on the iPhone earphones for about two seconds.
6YQNQYDGGRUEQP°TOVJCVVJGECNNYCUFGENKPGF
Tap Decline (if iPhone is awake when a call comes in).
Block calls and maintain Wi-Fi access to the Internet: In Settings, turn on Airplane
Mode, then tap Wi-Fi to turn it on.
While On a Call
When you’re on a call, the screen shows call options.
66
The call options may vary, depending on which iPhone you’re using.
Chapter 5 Phone
APPLE CONFIDENTIAL — First Draft (1.10.11)
Mute your line
Use the numeric keypad to enter information
Use the speakerphone or a Bluetooth device
See contact information
Put a call on hold
Make another call
Tap Mute. You can still hear the caller, but the caller can’t hear you.
6CR-G[RCF
Tap Speaker. The Button is labeled Audio Source when a Bluetooth device is available, which lets you select the Bluetooth device, iPhone, or
Speaker Phone.
Tap Contacts.
iPhone 4: Touch and hold Mute.
iPhone 3G or iPhone 3GS: Tap Hold.
Neither party can hear the other. When a call is on hold, tap Hold again to return to the call.
Tap Add Call.
You can use other apps during a call—to check your schedule in Calendar, for example.
Use another app during a call: Press the Home button, then tap an app icon. To return to the call, tap the green bar at the top of the screen.
Note: Unless you have a 3G connection on a GSM model, you cannot use the Internet over a cellular data network when you’re on a call. You must have a Wi-Fi connection to use Internet apps while also talking on the phone.
End a call: Tap End Call. Or press the center button on your iPhone earphones.
Second Calls
During a call, you can make or receive another call. If you receive a second call, iPhone beeps and shows the caller’s information and a list of options.
Note: Making and receiving a second call may be an optional service in some countries or regions. Contact your carrier for more information.
Respond to a second incoming call:
To ignore the call and send it to voicemail, tap Ignore.
6QJQNFVJG°TUVECNNCPFCPUYGTVJGPGYQPG tap Hold Call + Answer.
6QGPFVJG°TUVECNNCPFCPUYGTVJGPGYQPG tap End Call + Answer (GSM models) or tap End Call and drag the slider when the second call rings back (CDMA model).
If you’re on a FaceTime video call, you can either end the video call and answer the incoming call, or decline the incoming call.
Make a second call: 6CR#FF%CNN6JG°TUVECNNKURWVQPJQNF
Switch between calls: Tap Swap. The active call is put on hold.
Chapter 5 Phone 67
68
APPLE CONFIDENTIAL — First Draft (1.10.11)
On a CDMA model, you can’t switch between calls if the second call was outgoing, but you can merge the calls to create a conference. If you end the second call, or the conference, both calls are terminated.
Create a conference call:
Tap Merge Calls. See “Conference Calls” on page 68 below.
On a CDMA model, you can’t merge calls if the second call was incoming.
Conference Calls
You can talk to more than one person at a time, and merge a second call (on a CDMA
OQFGNQTWRVQ°XGECNNUQP)5/OQFGNUFGRGPFKPIQP[QWTECTTKGT
Note: Conference calling may be an optional service in some countries or regions.
Contact your carrier for information.
Create a conference call:
1 Make a call.
2 6CR#FF%CNNCPFOCMGCPQVJGTECNN6JG°TUVECNNKURWVQPJQNF
3 Tap Merge Calls. The calls are merged on one line and everyone can hear each other.
4 4GRGCVUVGRUVYQCPFVJTGGVQCFFWRVQ°XGECNNU)5/OQFGNUQPN[
Drop one call
Talk privately with a call
Add an incoming call
(GSM models only.) Tap Conference and tap next to a call. Then tap End Call.
(GSM models only.) Tap Conference, then tap
Private next to a call. Tap Merge Calls to resume the conference.
(GSM models only.) Tap Hold Call + Answer, then tap Merge Calls.
If your service includes conference calling, iPhone always has a second line available in addition to the conference call.
Note: You can’t make a FaceTime video call when you’re on a conference call.
FaceTime
FaceTime video calls let you see as well as hear the person you’re talking to. Both the caller and recipient must have an iPhone 4 or an iPod touch (4th generation), and a
Wi-Fi connection. No setup is needed for FaceTime on iPhone 4. By default, FaceTime uses the front camera so the person you’re calling can see your face. Switch to the main camera to share what you see around you.
Note: FaceTime may not be available in all countries or regions.
How you make a FaceTime video call depends on whether you’re calling another iPhone 4 or an iPod touch (4th generation).
Make a FaceTime call:
Chapter 5 Phone
APPLE CONFIDENTIAL — First Draft (1.10.11)
To an iPhone 4: Call the person’s phone number, then tap FaceTime.
Or, in Contacts, tap FaceTime.
To an iPod touch (4th generation): In Contacts, tap FaceTime.
The contact information must include the email address that the person you’re calling uses to sign in to FaceTime.
appears on the FaceTime button in Contacts if you’ve previously had a FaceTime call with that person.
4HRLH
-HJL;PTL
]PKLVJHSS
The person you’re calling must accept the video call by tapping Accept.
Make a FaceTime call using Voice Control: Press and hold the Home button until the
Voice Control screen appears and you hear a beep. Then say “FaceTime,” followed by the name of the person to call.
If you had a previous FaceTime video call with someone, you can make another video call to that person by tapping the entry for that call in Recents. Previous FaceTime video calls are indicated by .
Chapter 5 Phone 69
APPLE CONFIDENTIAL — First Draft (1.10.11)
When the voice call is established, you see the image from the other person’s iPhone.
A picture-in-picture window shows the image from your iPhone that the other person sees. You can drag the window to any corner. You can use FaceTime in portrait or landscape orientation.
70
Video calls use the top microphone on iPhone.
If you move away from your Wi-Fi network, or it otherwise becomes unavailable, you’ll get an option to redial the number for a voice call.
Note: When you make a FaceTime video call, your phone number is displayed even if
[QWTECNNGT+&KUDNQEMGFQTVWTPGFQÒ
Mute a FaceTime video call
Switch between the front and main cameras
Use another app during a FaceTime video call
End a FaceTime video call
Tap at the bottom of the screen. You can still hear and see the caller. The caller can see, but not hear you.
Tap at the bottom of the screen.
Press the Home button, then tap an app icon.
You can still talk, but won’t see each other. To return to the video call, tap the green bar at the top of the screen.
Tap at the bottom of the screen.
6QDNQEM(CEG6KOGXKFGQECNNU[QWECPVWTPQÒ(CEG6KOGKP5GVVKPIU
6WTP(CEG6KOGQPQTQÒ In Settings, choose Phone and tap the FaceTime switch.
FaceTime is on by default.
You can also disable FaceTime in Restrictions. See “Restrictions” on page 202.
Chapter 5 Phone
APPLE CONFIDENTIAL — First Draft (1.10.11)
Using a Bluetooth Device for Calls
You can make and receive calls using a Bluetooth device paired with iPhone. See
“Pairing a Bluetooth Device with iPhone” on page 51.
For information about using a Bluetooth device to make and receive calls, see the documentation that came with the device.
Listen to calls through iPhone when a Bluetooth device is connected: Do one of the following:
Answer a call by tapping the iPhone screen.
During a call, tap Audio on iPhone. Choose iPhone to hear calls through iPhone or
Speaker Phone to use the speakerphone.
6WTPQÒ$NWGVQQVJ+P5GVVKPIUEJQQUG)GPGTCN $NWGVQQVJCPFFTCIVJGUYKVEJVQ
1Ò
6WTPQÒVJG$NWGVQQVJFGXKEGQTOQXGQWVQHTCPIG;QWOWUVDGYKVJKPCDQWV feet of a Bluetooth device for it to be connected to iPhone.
Emergency Calls
If iPhone is locked with a passcode, you may still be able to make an emergency call.
Make an emergency call when iPhone is locked: On the Enter Passcode screen, tap
Emergency Call, then dial the number using the numeric keypad.
In the U.S., location information (if available) is provided to emergency service providers when you dial 911.
On a CDMA model, when an emergency call ends, iPhone enters “Emergency call mode,” to allow a call back from emergency services. While in this mode, data transmission and text messages are blocked. To exit emergency call mode, tap the
DCEMDWVVQPRTGUUVJG1P1Ò5NGGR9CMGDWVVQPQTVJG*QOG button, or use the keypad to dial a non-emergency call. Emergency call mode also ends automatically after a few minutes, as determined by your carrier.
Important: You should not rely on wireless devices for essential communications, such as medical emergencies. Use of any cellular phone to call emergency services may not work in all locations. Emergency numbers and services vary by country or region. Only emergency numbers valid in the country or region where you’re making the call will work, and sometimes an emergency call cannot be placed due to network unavailability or environmental interference. Some cellular networks may not accept an emergency call from iPhone if it doesn’t have a SIM card or if the SIM card is locked
(GSM models), or if you haven’t activated your iPhone. If you’re on a FaceTime video call, you must end that call before you can call an emergency number.
Chapter 5 Phone 71
72
APPLE CONFIDENTIAL — First Draft (1.10.11)
Visual Voicemail
On iPhone, visual voicemail lets you see a list of your messages and choose which ones to listen to or delete, without having to listen to instructions or prior messages.
Note: Visual voicemail may not be available in all countries or regions, or may be an optional service. Contact your carrier for more information. If visual voicemail isn’t available, tap Voicemail and follow the voice prompts to retrieve your messages.
5\TILYVMTPZZLKJHSSZHUK\UOLHYK
]VPJLTHPSTLZZHNLZHWWLHYZVU[OL
/VTLZJYLLU7OVULPJVU
Setting Up Voicemail
6JG°TUVVKOG[QWVCR8QKEGOCKNK2JQPGRTQORVU[QWVQETGCVGCXQKEGOCKNRCUUYQTF and record your voicemail greeting.
Change your greeting:
1 Tap Voicemail, tap Greeting, then tap Custom.
2 Tap Record when you’re ready to start.
3 9JGP[QW°PKUJVCR5VQR6QTGXKGYVCR2NC[
To rerecord, repeat steps 2 and 3.
4 Tap Save.
Use your carrier’s default greeting
Set an alert sound for new voicemail
Change the voicemail password
Tap Voicemail, tap Greeting, then tap Default.
In Settings, choose Sounds and turn New
Voicemail on. The alert sounds once for each new
XQKEGOCKN+HVJG4KPI5KNGPVUYKVEJKUQÒK2JQPG won’t sound alerts.
In Settings, choose Phone > Change Voicemail
Password.
Checking Voicemail
When you tap Phone, iPhone shows the number of missed calls and unheard voicemail messages.
5\TILYVM\UOLHYK
]VPJLTHPSTLZZHNLZ
5\TILYVMTPZZLKJHSSZ
Chapter 5 Phone
APPLE CONFIDENTIAL — First Draft (1.10.11)
Tap Voicemail to see a list of your messages.
<UOLHYK
TLZZHNLZ 7SH`7H\ZL
:WLHRLYWOVUL(\KPV
^OLUH)S\L[VV[OKL]PJL
PZJVUULJ[LK;HW[V
JOVVZLH\KPVV\[W\[
*VU[HJ[PUMV
:JY\IILYIHY
:RPW[VHU`WVPU[PU
HTLZZHNL!+YHN[OL
WSH`OLHK
9L[\YU[OLJHSS
Listen to a message: Tap the message. (If you’ve already heard the message, tap the message again to replay it.) Use and to pause and resume playback.
Once you listen to a message, it’s saved until your carrier erases it.
Check voicemail from another phone: Dial your own number or your carrier’s remote access number.
Deleting Messages
Select a message, then tap Delete.
Listen to a deleted message
Undelete a message
Delete messages permanently
Tap Deleted Messages (at the end of the list), then tap the message.
Tap Deleted Messages (at the end of the list), then tap the message and tap Undelete.
Tap Deleted Messages (at the end of the list), then tap Clear All.
Note: In some countries or regions, deleted visual voicemail messages may be permanently erased by your carrier.
Getting Contact Information
Visual voicemail saves the date and time of the call, the length of the message, and any available contact information.
See a caller’s contact information: Tap next to a message.
You can use the information to email or text the caller, or update contact info.
Chapter 5 Phone 73
74
APPLE CONFIDENTIAL — First Draft (1.10.11)
Contacts
From a contact’s Info screen, a quick tap lets you make a phone call, create a new email
OGUUCIG°PFVJGNQECVKQPQHVJGKTCFFTGUUCPFOQTG5GG¥
Searching Contacts” on page 220.
Favorites
Favorites gives you quick access to your most-used phone numbers.
Add a contact’s phone number to your favorites list: Tap Contacts and choose a contact. Then tap “Add to Favorites” and choose the phone number or email address you want to add. On iPhone 4, choose whether to save the favorite as a voice call or as a FaceTime call. If you save the contact as a FaceTime call, appears with the name in the favorites list.
If someone already in your contacts calls you, you can add their name to favorites from the recents list.
Add a contact to favorites from the recents list: Tap Recents and tap next to the contact’s name, then tap “Add to Favorites.”
Call a contact from your favorites
Delete a contact from your favorites
Reorder your favorites list
Tap Favorites and choose a contact. If appears next to a name, you can tap the name to make a
FaceTime call.
Tap Favorites and tap Edit. Then tap next to a contact or number and tap Remove.
Tap Favorites and tap Edit. Then drag next to a contact to a new place in the list.
Call Forwarding, Call Waiting, and Caller ID
iPhone supports call forwarding, call waiting, and caller ID.
Call Forwarding
You can set iPhone to forward incoming calls to another number. For example, you may be on vacation and want all calls to go somewhere else. If you’re going to an area with no cellular coverage, you may want to forward calls to a place where you can be reached.
Note: FaceTime calls are not forwarded.
On GSM models, use the Call Forwarding setting to forward incoming calls to another number.
Forward incoming calls (GSM models):
1 In Settings, choose Phone > Call Forwarding, then turn on Call Forwarding.
Chapter 5 Phone
APPLE CONFIDENTIAL — First Draft (1.10.11)
2 On the “Forward to” screen, enter the phone number you want calls forwarded to.
When Call Forwarding is on, the call forwarding ( ) icon appears in the status bar at the top of the screen (GSM models only). You must be in range of the cellular network when you set iPhone to forward calls, or calls won’t be forwarded.
1PC%&/#OQFGN[QWVWTPECNNHQTYCTFKPIQPQTQÒD[FKCNKPIURGEKCNEQFGU
Turn on call forwarding (CDMA model): On the Phone keypad, enter *72, then tap
Call.
6WTPQÒECNNHQTYCTFKPI%&/#OQFGN On the Phone keypad, enter *73, then tap
Call.
Call Waiting
Call waiting lets you know that you’re receiving another call when you’re already on the phone. You can choose to ignore the incoming call, put the current call on hold and answer the incoming call, or end the current call and answer the incoming call.
9JGPECNNYCKVKPIKUQÒKPEQOKPIECNNUIQFKTGEVN[VQXQKEGOCKNKH[QW¨TGQPVJGRJQPG
1P)5/OQFGNUWUGVJG%CNN9CKVKPIUGVVKPIVQVWTPECNNYCKVKPIQPQTQÒ
6WTPECNNYCKVKPIQPQTQÒ)5/OQFGNU In Settings, choose Phone > Call Waiting,
VJGPVWTP%CNN9CKVKPIQPQTQÒ
On a CDMA model, call waiting is on by default. You can disable call waiting for a call you’re making by appending a special code to the number with you dial it.
Disable call waiting for a call (CDMA model): Enter *70 at the end of the number you’re dialing.
To disable call waiting for another call, you must again append *70 to the number when you dial it.
Caller ID
Caller ID displays your name or phone number to the person you call, if the recepient’s equipment has that capability and you haven’t blocked caller ID on your phone service.
Note: When you make a FaceTime call, your phone number is displayed even if your
ECNNGT+&KUVWTPGFQÒQTDNQEMGF
1P)5/OQFGWUGVJG5JQY/[%CNNGT+&VQVWTPECNNGT+&QPQTQÒ
6WTPECNN+&QPQTQÒ)5/OQFGNU In Settings, choose Phone > Show My Caller ID,
VJGPVWTP5JQY/[%CNNGT+&QPQTQÒ
On a CDMA model, caller ID is on by default. You can block your ID for a call you’re making by appending a special code to the number when you dial it.
Chapter 5 Phone 75
76
APPLE CONFIDENTIAL — First Draft (1.10.11)
Disable caller ID for a call (CDMA model): Enter *67 at the end of the number you’re dialing.
Ringtones and the Ring/Silent Switch
iPhone comes with ringtones you can use for incoming calls, Clock alarms, and the
Clock timer. You can also purchase ringtones from songs in iTunes.
Ring/Silent Switch and Vibrate Modes
#UYKVEJQPVJGUKFGQHK2JQPGOCMGUKVGCU[VQVWTPVJGTKPIGTQPQTQÒ
6WTPVJGTKPIGTQPQTQÒ Flip the switch on the side of iPhone.
9PUN
:PSLU[
Important: Clock alarms still sound even if you set the Ring/Silent switch to silent.
Set iPhone to vibrate: In Settings, choose Sounds. Separate controls let you set vibrate for both ring mode and silent mode.
For more information, see “Sounds and the Ring/Silent Switch” on page 196.
Setting Ringtones
You can set the default ringtone for calls, and for Clock alarms and timers. You can also assign individual ringtones to contacts so you know who’s calling.
Set the default ringtone: In Settings, choose Sounds > Ringtone, then choose a ringtone.
Assign a ringtone to a contact: From Phone, tap Contacts and choose a contact. Tap
Edit, then tap Ringtone and choose a ringtone.
Purchasing Ringtones
You can purchase ringtones from the iTunes Store on iPhone. See “Purchasing
Chapter 5 Phone
APPLE CONFIDENTIAL — First Draft (1.10.11)
International Calls
Making International Calls from Your Home Area
For information about making international calls from your home area, including rates and other charges that may apply, contact your carrier or go to your carrier’s website.
Using iPhone Abroad
(GSM models only.) You can use iPhone to make calls in many countries around the world. iPhone 3GS and iPhone 4 are multi-band phones, ensuring broad international coverage.
Enable international roaming: Contact your carrier for information about availability and fees.
5GVK2JQPGVQCFFVJGEQTTGEVRTG°ZYJGPFKCNKPIHTQOCPQVJGTEQWPVT[ In Settings, tap Phone, then turn International Assist on. This lets you make calls to your home country using the numbers in your contacts and favorites, without having to add a
RTG°ZQT[QWTEQWPVT[EQFG+PVGTPCVKQPCN#UUKUVYQTMUHQT75VGNGRJQPGPWODGTUQPN[
When you make a call using International Assist, “International Assist” appears on the iPhone screen, alternating with the “calling …” message, until your call is connected.
Note: International Assist may not be available in all areas.
Set the carrier to use: In Settings, tap Carrier, then select the carrier you prefer. This option is available only when you’re traveling outside your carrier’s network. You can make calls only on carriers that have roaming agreements with your iPhone service
provider. For more information, see “Carrier” on page 196.
Important: Voice and data roaming charges may apply. To avoid data roaming charges,
VWTP&CVC4QCOKPIQÒ
6WTP&CVC4QCOKPIQPQTQÒ In Settings, choose General > Network, then tap to turn
&CVC4QCOKPIQPQTQÒ&CVC4QCOKPIKUVWTPGFQÒD[FGHCWNV
6WTPKPI&CVC4QCOKPIQÒJGNRUVQCXQKFFCVCTQCOKPIEJCTIGUYJGPVTCXGNKPIQWVUKFG your carrier’s network by disabling data transmission over the cellular network. You can still access the Internet if you have a Wi-Fi connection. If Wi-Fi network access isn’t available, however, you cannot:
Make or receive FaceTime video calls
Send or receive email
Browse the Internet
Sync your contacts, calendars, or bookmarks with MobileMe or Exchange
Stream YouTube videos
Get stock quotes
Get map locations
Chapter 5 Phone 77
APPLE CONFIDENTIAL — First Draft (1.10.11)
Get weather reports
Purchase music or apps
Other third-party apps that use data roaming may also be disabled.
+H&CVC4QCOKPIKUVWTPGFQÒ[QWECPUVKNNOCMGCPFTGEGKXGRJQPGECNNUCPFUGPFCPF receive text messages. Voice roaming charges may apply. Visual voicemail is delivered if there’s no charge; if your carrier charges for delivery of visual voicemail when
TQCOKPIVWTPKPI&CVC4QCOKPIQÒRTGXGPVUVJGFGNKXGT[QHXKUWCNXQKEGOCKN
To enable email, web browsing, and other data services, turn Data Roaming on.
Important: If Data Roaming is turned on, you may incur charges when roaming outside your carrier’s network for the use of any of the features listed above, as well as for delivery of visual voicemail. Check with your carrier for information about roaming charges.
;QWECPCNUQVWTPQÒEGNNWNCTFCVCVQRTGXGPVCP[EGNNWNCTFCVCWUCIG
6WTPQÒ%GNNWNCT&CVC In Settings, choose General > Network, then tap the Cellular
&CVCUYKVEJVQVWTPKVQÒ
Get voicemail when visual voicemail isn’t available: Dial your own number, or touch and hold “1” on the numeric keypad.
;QWECPWUG#KTRNCPG/QFGVQVWTPQÒEGNNWNCTUGTXKEGUCPFVJGPVWTP9K(KQPVQIGV access to the Internet, while preventing voice roaming charges.
7UGCKTRNCPGOQFGVQVWTPQÒEGNNWNCTUGTXKEGU In Settings, tap Airplane Mode to turn
it on, then tap Wi-Fi and turn Wi-Fi on. See “Airplane Mode” on page 193.
Incoming phone calls are sent to voicemail. To make and receive calls again and get
[QWTXQKEGOCKNOGUUCIGUVWTPCKTRNCPGOQFGQÒ
78 Chapter 5 Phone
APPLE CONFIDENTIAL — First Draft (1.10.11)
6
Mail works with MobileMe, Microsoft Exchange, and many of the most popular email systems—including Yahoo!, Google, and AOL—as well as other industry-standard
POP3 and IMAP email systems. You can send and receive photos, videos, and graphics, and view PDFs and other attachments. You can also print messages, and attachments that open in Quick Look.
Setting Up Email Accounts
You can set up email accounts on iPhone in either of the following ways:
Set up an account directly on iPhone. See “ Adding Mail, Contacts, and Calendar
In iTunes, use the iPhone settings panes to sync email accounts settings from your
computer. See “iPhone Settings Panes in iTunes” on page 58.
Checking and Reading Email
The Mail icon on the Home screen shows the number of unread messages in your inboxes. You may have other unread messages in other mailboxes.
5\TILYVM\UYLHK
LTHPSZPU`V\YPUIV_LZ
79
80
APPLE CONFIDENTIAL — First Draft (1.10.11)
In Mail, the Mailboxes screen gives you quick access to all your inboxes and other mailboxes. Tap an inbox for an account to see its messages. To see incoming messages for all your accounts, tap All Inboxes. If you have only one mail account set up and turned on, then you’ll see only one inbox on the Mailboxes screen.
0UJVTPUN
TLZZHNLZMVYHSS
HJJV\U[Z
5\TILYVM\UYLHK
TLZZHNLZ
When you open a mailbox, Mail retrieves and displays the most recent messages, and shows the number of unread messages at the top of the screen. Unread messages have a blue dot next to them. The number of messages retrieved is determined by
your Mail settings. See “Mail” on page 210.
If you organize messages by thread, related messages appear as a single entry in the mailbox. Message threads have a number next to the right arrow, showing the number of messages in the thread. A blue dot indicates that one or more messages in the thread are unread. The message displayed is the oldest unread message, or the most recent message if all the messages are read.
5\TILYVM
TLZZHNLZPU
[OYLHK
<UYLHKTLZZHNLZ
See messages in a thread: Tap the thread in the mailbox.
Read a message: Tap a message. Within a message, tap or to see the next or previous message.
6WTP¥1TICPK\G$[6JTGCF¦QPQTQÒ In Settings, choose “Mail, Contacts, Calendars,”
CPFVCRVJGUYKVEJVQVWTP1TICPK\G$[6JTGCFQPQTQÒ5GG¥
Chapter 6 Mail
APPLE CONFIDENTIAL — First Draft (1.10.11)
If you have more than one account set up and turned on, the Accounts section of the
Mailboxes screen provides access to your accounts. Tap an account to see its folders and mailboxes, including its inbox. If you have only one account set up and turned on, the folders and mailboxes for the account appear on the Mailboxes screen.
;HW[VZLLHSS`V\Y
LTHPSHJJV\U[Z
5\TILYVM\UYLHK
TLZZHNLZ
Check for new messages: Choose a mailbox, or tap at any time.
Load additional messages: Scroll to the bottom of the list of messages and tap Load
More Messages.
Zoom in on part of a message
4GUK\GCP[EQNWOPQHVGZVVQ°VVJGUETGGP
See all the recipients of a message
Add an email recipient to your contacts list
Mark a message as unread
Double-tap an area of the message. Double-tap again to zoom out. Or pinch apart or together to zoom in or out.
Double-tap the text.
Tap Details.
Tap a name or email address to see the recipient’s contact information. Then tap a phone number, email address, or text message to contact the person. Tap Hide to hide the recipients.
Tap the message and, if necessary, tap Details to see the recipients. Then tap a name or email address and tap Create New Contact or “Add to
Existing Contact.”
Open the message and tap “Mark as Unread.”
A blue dot appears next to the message in the mailbox list until you open it again.
Open a meeting invitation: Tap the invitation.
You can get contact information for the organizer and other invitees, set an alert, add notes to the event, and add comments that are included in your response emailed to the organizer. You can accept, tentatively accept, or decline the invitation. See
“Responding to Meeting Invitations” on page 118.
Chapter 6 Mail 81
APPLE CONFIDENTIAL — First Draft (1.10.11)
6WTP2WUJQPQTQÒ In Settings, choose “Mail, Contacts, Calendars” > Fetch New Data,
VJGPVWTP2WUJQPQTQÒ5GG¥
Using Links and Detected Data
iPhone detects web links, phone numbers, email addresses, and other types of information that you can use to open a webpage, make a phone call, create a preaddressed email message, create or add information to a contact, or perform some other useful action. Detected data appears as blue underlined text. Tap the data to use its default action, or touch and hold it to see other actions.
Link or image
Phone number
Address
Email address
Day, date, or time
Tracking number (may not be available in all countries or regions)
Tap to open the webpage in Safari.
Touch and hold to:
Open the webpage in Safari
Copy the link
Tap the number, then tap Call to dial the number.
Touch and hold to:
Dial the number
Send a text message
Create a new contact with the number
Add the number to an existing contact
Tap to display the location in Maps.
Touch and hold to:
Display the location in Maps
Create a new contact with the address
Add the address to an existing contact
Copy the address
Tap to create a new preaddressed email message.
Touch and hold to:
Create a new email message
Create a new contact with the address
Add the address to an existing contact
Copy the address
Tap the item, then tap Create Event to create an event in Calendar.
Tap to open the shipper’s webpage for the status of a package.
82 Chapter 6 Mail
APPLE CONFIDENTIAL — First Draft (1.10.11)
Viewing Attachments
iPhone displays image attachments in many commonly used formats (JPEG, GIF, and
TIFF) inline with the text in email messages. iPhone can play many types of audio
CVVCEJOGPVUUWEJCU/2##%9#8CPF#+((;QWECPFQYPNQCFCPFXKGY°NGU
UWEJCU2&(YGDRCIGVGZV2CIGU-G[PQVG0WODGTUCPF/KETQUQHV9QTF'ZEGNCPF
PowerPoint documents) that are attached to messages you receive.
8KGYCPCVVCEJGF°NG Tap the attachment to open it in Quick Look.
;QWOC[PGGFVQFQYPNQCFVJGCVVCEJOGPV°TUVD[VCRRKPI (if it appears at the end of the message in a dotted box with the document name).
;HWH[[HJOTLU[
[VKV^USVHK
You can view attachments in portrait or landscape orientation.
+HVJGHQTOCVQHCPCVVCEJGF°NGKUP¨VUWRRQTVGFD[K2JQPG[QWECPUGGVJGPCOGQHVJG
°NGDWV[QWECP¨VQRGPKVK2JQPGUWRRQTVUVJGHQNNQYKPIFQEWOGPVV[RGU
.doc
.docx
.htm
.html
Microsoft Word
Microsoft Word (XML) webpage webpage
.key
-G[PQVG
.numbers
Numbers
.pages
Pages
Preview, Adobe Acrobat
.ppt
.pptx
.rtf
Microsoft PowerPoint
Microsoft PowerPoint (XML)
Rich Text Format
Chapter 6 Mail 83
84
APPLE CONFIDENTIAL — First Draft (1.10.11)
.txt
.vcf
.xls
.xlsx
text contact information
Microsoft Excel
Microsoft Excel (XML)
1RGPCPCVVCEJGF°NGYKVJCPQVJGTCRR Touch and hold the attachment, then choose an app. If no apps are available, you can choose to open the attachment in
Quick Look.
Save an attached photo to your Camera Roll album: Tap the photo, then tap Save
+OCIG+HVJGRJQVQJCUP¨VDGGPFQYPNQCFGF[GVVCRVJGFQYPNQCFPQVKEG°TUV
Save an attached video to your Camera Roll album: Touch and hold the attachment, then tap Save Video. If the video hasn’t been downloaded yet, tap the download
PQVKEG°TUV
Printing Messages and Attachments
You can print email messages, and attachments that can be viewed in Quick Look.
Print an email message: Tap , then tap Print. Tap Select Printer to select a printer, then set printer options such as number of copies and double-sided output (if the printer supports it). Then tap Print.
To print an inline image without the rest of the email message, save the image (tap the image and tap Save Image), then open Photos or Camera and print the image from your Camera Roll album.
Print an attachment: Tap the attachment to view it in Quick Look, then tap and tap
Print. Tap Select Printer to select a printer, then set printer options such as the range of pages, number of copies, and double-sided output (if the printer supports it). Then tap
Print.
For more information, see “Printing” on page 45.
Sending Email
You can send an email message to anyone who has an email address.
Compose and send a message:
1 Tap .
2 6[RGCPCOGQTGOCKNCFFTGUUKPVJG6Q°GNFQTVCR to add a name from your contacts.
As you type an email address, matching email addresses from your contacts list appear below. Tap an address to add it. To add more names, tap Return or .
Chapter 6 Mail
APPLE CONFIDENTIAL — First Draft (1.10.11)
Note: If you’re composing a message from your Microsoft Exchange account and have access to your enterprise Global Address List (GAL), matching addresses from the
EQPVCEVUQPK2JQPGCRRGCT°TUVHQNNQYGFD[OCVEJKPI)#.CFFTGUUGU
3 Tap Cc/Bcc/From if you want to copy or blind copy the message to others, or change the account you send the message from. If you have more than one email account,
QTKH[QWJCXGGOCKNCNKCUGUHQT[QWT/QDKNG/GCEEQWPV[QWECPVCRVJG(TQO°GNFVQ change the account or alias you’re sending from.
4 Enter a subject, then your message.
;QWECPVCR4GVWTPVQOQXGHTQOQPG°GNFVQCPQVJGT
5 Tap Send.
Send a photo or video (iPhone 3GS or later) in an email message
Paste and send a photo or video in an email message
Save a draft of a message to complete later
Open the most recently saved draft
In Photos, choose a photo or video, tap , then tap Email Photo or Email Video. You can also copy and paste photos and videos.
To send multiple photos or videos at the same time, tap when viewing thumbnails in an album, then tap to select the photos and videos, tap Share, and tap Email.
In Photos, touch and hold a photo or video until the Copy command appears. Tap Copy. Go to
Mail and create a new message. Tap to place the insertion point where you want the video, then tap the insertion point to display the edit commands and tap Paste.
To copy multiple videos, in Photos, open an album, tap , tap to select photos and videos, then tap Copy.
Tap Cancel, then tap Save. The message is saved in the Drafts mailbox.
Touch and hold to open the most recently saved draft from the last account you were working in.
Chapter 6 Mail 85
APPLE CONFIDENTIAL — First Draft (1.10.11)
Reply to a message
Forward a message
Share contact information
Tap . Tap Reply to reply only to the sender or tap Reply All to reply to the sender and all recipients. Type your return message, then tap
Send.
Files or images attached to the initial message aren’t sent back.
Open a message and tap , then tap Forward.
Add one or more email addresses, type your message, then tap Send.
When you forward a message, you can include
VJG°NGUQTKOCIGUCVVCEJGFVQVJGQTKIKPCN message.
In Contacts, choose a contact, tap Share Contact at the bottom of the Info screen, then tap Email.
Organizing Email
You can organize messages in any mailbox, folder, or search results window. You can delete messages one at a time, or select a group to delete all at once. You can also move messages from one mailbox or folder to another in the same account or
DGVYGGPFKÒGTGPVCEEQWPVU
Delete a message: Open the message and tap .
You can also delete a message directly from the mailbox message list by swiping left or right over the message title, then tapping Delete.
;VZOV^[OL
+LSL[LI\[[VU
Z^PWLSLM[VY
YPNO[V]LY
[OLTLZZHNL
Note: For Google accounts, tap Archive. Messages aren’t deleted, but are moved to your account archive.
86 Chapter 6 Mail
APPLE CONFIDENTIAL — First Draft (1.10.11)
Delete multiple messages: When viewing a list of messages, tap Edit, select the messages you want to delete, then tap Delete.
Move a message to another mailbox or folder: When viewing a message, tap , then choose a mailbox or folder.
Tap Accounts to choose a mailbox or folder for another account.
Move multiple messages: When viewing a list of messages, tap Edit, select the messages you want to move, then tap Move and choose a mailbox or folder.
Searching Email
;QWECPUGCTEJVJG6Q(TQOCPF5WDLGEV°GNFUQHGOCKNOGUUCIGU/CKNUGCTEJGUVJG downloaded messages in the currently open mailbox. For MobileMe, Exchange, and some IMAP mail accounts, you can also search messages on the server.
Search email messages: Open a mailbox, scroll to the top, and enter text in the Search
°GNF6CR(TQO6Q5WDLGEVQT#NNVQEJQQUGYJKEJ°GNFU[QWYCPVVQUGCTEJ6QUETQNN
SWKEMN[VQVJGUGCTEJ°GNFCVVJGVQRQHVJGNKUVVCRVJGUVCVWUDCT
Search results for the messages already downloaded to iPhone appear automatically as you type. Tap Search to dismiss the keyboard and see more of the results.
Search messages on the server: Tap “Continue Search on Server” at the end of the search results.
Note: Search results of messages on servers may vary depending on the type of account. Some servers may search only whole words.
Chapter 6 Mail 87
APPLE CONFIDENTIAL — First Draft (1.10.11)
Mail messages are included in searches from the Home screen. See “Searching” on page 47.
88 Chapter 6 Mail
APPLE CONFIDENTIAL — First Draft (1.10.11)
Safari
7
Safari lets you surf the web and view webpages on iPhone as if you were on your computer. Create bookmarks on iPhone and sync them with your computer. Add web clips to quickly access your favorite sites directly from the Home screen. Print webpages, PDFs, and other documents that open in Quick Look.
Viewing Webpages
You can view webpages in either portrait or landscape orientation. Rotate iPhone and
VJGYGDRCIGTQVCVGUVQQCWVQOCVKECNN[CFLWUVKPIVQ°VVJGRCIG
Opening Webpages
Open a webpage: 6CRVJGCFFTGUU°GNFQPVJGNGHVUKFGQHVJGVKVNGDCTVJGPV[RGVJG
YGDCFFTGUUCPFVCR)Q+HVJGCFFTGUU°GNFKUP¨VXKUKDNGVCRVJGUVCVWUDCTCVVJGVQRQH
VJGUETGGPVQSWKEMN[UETQNNVQVJGCFFTGUU°GNFCVVJGVQRQHVJGYGDRCIG
As you type, web addresses that start with those letters appear. These are bookmarked
RCIGUQTTGEGPVRCIGU[QW¨XGQRGPGF6CRCPCFFTGUUVQIQVQVJCVRCIG-GGRV[RKPI if you want to enter a web address that’s not in the list.
'TCUGVJGVGZVKPVJGCFFTGUU°GNF 6CRVJGCFFTGUU°GNFVJGPVCR .
89
APPLE CONFIDENTIAL — First Draft (1.10.11)
Zooming and Scrolling
Zoom in or out: Double-tap a column on a webpage to expand the column. Doubletap again to zoom out.
You can also pinch to zoom in or out manually.
Scroll around a webpage
Scroll within a frame on a webpage
Scroll quickly to the top of a webpage
Drag up, down, or sideways. When scrolling, you can touch and drag anywhere on the page without activating any links.
7UGVYQ°PIGTUVQUETQNNYKVJKPCHTCOGQPC
YGDRCIG7UGQPG°PIGTVQUETQNNVJGGPVKTG webpage.
Tap the status bar at the top of the iPhone screen.
Navigating Webpages
Links on webpages typically take you to another place on the web.
Follow a link on a webpage: Tap the link.
You can also use web links to make a phone call, display a location in Maps, play streaming audio, or create a preaddressed Mail message. To return to Safari after a link opens another app, press the Home button and tap Safari.
See a link’s destination address
Stop a webpage from loading
Reload a webpage
Return to the previous or next page
Touch and hold the link. The address pops up
PGZVVQ[QWT°PIGT;QWECPVQWEJCPFJQNFCP image to see if it has a link.
Tap .
Tap .
Tap or at the bottom of the screen.
90 Chapter 7 Safari
APPLE CONFIDENTIAL — First Draft (1.10.11)
Return to a recently viewed page
Create a preaddressed Mail message
Create a new or add to an existing contact
Send a webpage URL via email
Save an image or photo to your Camera Roll album
Tap and tap History. To clear the history list, tap Clear.
Touch and hold an email web link, then tap New
Message.
Touch and hold a web link containing contact information, then tap Create New Contact or Add to Existing Contact.
Tap and tap “Mail Link to this Page.”
Touch and hold the image, then tap Save Image.
Opening Multiple Pages
You can have up to eight pages open at a time. Some links automatically open a new page instead of replacing the current one.
The number inside the at the bottom of the screen shows how many pages are open. If there’s no number inside, just one page is open. For example:
= one page is open
= three pages are open
Open a new page: Tap and tap New Page.
Go to another page: Tap CPF±KEMNGHVQTTKIJV6CRVJGRCIG[QWYCPVVQXKGY
Close a page: Tap and tap .
Entering Text and Filling Out Forms
5QOGYGDRCIGUJCXGVGZV°GNFUCPFHQTOUVQ°NNQWV;QWECPUGV5CHCTKVQTGOGODGT
PCOGUCPFRCUUYQTFUQHYGDUKVGU[QWXKUKVCPF°NNQWVVGZV°GNFUCWVQOCVKECNN[YKVJ
information from Contacts. See “Safari” on page 214.
Chapter 7 Safari 91
92
APPLE CONFIDENTIAL — First Draft (1.10.11)
Bring up the keyboard
/QXGVQCPQVJGTVGZV°GNF
Submit a form
6CRKPUKFGCVGZV°GNF
6CRCPQVJGTVGZV°GNFQTVCRVJG0GZVQT2TGXKQWU button.
1PEG[QW°PKUJ°NNKPIQWVCHQTOVCR)QQT
Search. Most pages also have a link you can tap to submit the form.
Tap Done.
Close the keyboard without submitting the form
'PCDNG#WVQ(KNNVQJGNR[QW°NNQWVYGDHQTOU In Settings, choose Safari > AutoFill, then do one of the following:
To use information from contacts, turn Use Contact Info on, then choose My Info and select the contact you want to use.
5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFUQPYGDHQTOU
To use information from names and passwords, turn Names & Passwords on.
When this feature is on, Safari remembers names and passwords of websites you
XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG
To remove all AutoFill information, tap Clear All.
Searching
7UGVJGUGCTEJ°GNFVQGPVGTYQTFUCPFRJTCUGUHQTUGCTEJKPIDQVJVJGYGDCPFVJG current webpage. As you type, suggested and recent searches appear.
Search the web:
1 6CRVJGUGCTEJ°GNFQPVJGTKIJVUKFGQHVJGVKVNGDCT
2 Type a word or phrase that describes what you’re looking for, then tap a suggestion from the list or tap Search.
3 Tap a link in the list of search results to open a webpage.
Find the search word or phrase on the current webpage: Scroll to the bottom of the
TGUWNVUNKUVVJGPVCRVJGGPVT[DGNQY1P6JKU2CIGVQ°PFVJG°TUVQEEWTTGPEGQHVJG
UGCTEJYQTFQTRJTCUG6Q°PFUWDUGSWGPVQEEWTTGPEGUVCR0GZV
By default, Safari searches using Google. You can use other search engines.
5GV5CHCTKVQUGCTEJWUKPICFKÒGTGPVUGCTEJGPIKPG In Settings, choose Safari >
5GCTEJ'PIKPGVJGPEJQQUGCFKÒGTGPVUGCTEJGPIKPG
Printing Webpages, PDFs, and Other Documents
You can print webpages, PDFs, and other documents that open in Quick Look from
Safari.
Chapter 7 Safari
APPLE CONFIDENTIAL — First Draft (1.10.11)
Print a webpage, PDF, or Quick Look document: Tap , then tap Print. Tap Select
Printer to select a printer, then set printer options such as number of copies and double-sided output (if the printer supports it). If you’re printing a PDF or other Quick
Look document, you may be able to set the range of pages you want to print. Then tap
Print.
For more information, see “Printing” on page 45.
Bookmarks
You can bookmark webpages you want to return to later.
Bookmark a webpage: Open the page and tap . Then tap Add Bookmark.
When you save a bookmark you can edit its title. By default, bookmarks are saved at the top level of Bookmarks. Tap Bookmarks to choose another folder.
If you use Safari on a Mac, or Safari or Microsoft Internet Explorer on a PC, you can sync bookmarks with the web browser on your computer.
Sync bookmarks with your computer:
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list.
3 Click Info at the top of the screen, select “Sync … bookmarks” under Other, then click
Apply.
See “iPhone Settings Panes in iTunes” on page 58.
Sync bookmarks with MobileMe: In Settings on iPhone, select Bookmarks in your
MobileMe account. See “Setting Up MobileMe Accounts” on page 25.
Open a bookmarked webpage: Tap , then choose a bookmark or tap a folder to see the bookmarks inside.
Edit a bookmark or bookmark folder: Tap , choose the folder that has the bookmark or folder you want to edit, then tap Edit. Then do one of the following:
To make a new folder, tap New Folder.
To delete a bookmark or folder, tap , then tap Delete.
To reposition a bookmark or folder, drag .
6QGFKVVJGPCOGQTCFFTGUUQTVQRWVKVKPCFKÒGTGPVHQNFGT tap the bookmark or folder.
9JGP[QW°PKUJVCR&QPG
Chapter 7 Safari 93
APPLE CONFIDENTIAL — First Draft (1.10.11)
Web Clips
Add web clips to the Home screen for fast access to your favorite webpages. Web clips appear as icons on the Home screen, and you can arrange your web clips along with
the other icons. See “Customizing the Home Screen” on page 33.
Add a web clip: Open the webpage and tap . Then tap “Add to Home Screen.”
When you open a web clip, Safari automatically zooms and scrolls to the area of the webpage that was displayed when you saved the web clip. The displayed area is also used to create the icon for the web clip on your Home screen, unless the webpage comes with its own custom icon.
When you add a web clip, you can edit its name. If the name is too long (more than about 10 characters), it may appear abbreviated on the Home screen.
Web clips aren’t bookmarks, and aren’t synced by MobileMe or iTunes.
Delete a web clip:
1 Touch and hold any icon on the Home screen until the icons start to jiggle.
2 Tap in the corner of the web clip you want to delete.
3 Tap Delete, then press the Home button to save your arrangement.
94 Chapter 7 Safari
APPLE CONFIDENTIAL — First Draft (1.10.11)
iPod
8
Use the iPod app to enjoy your favorite music, widescreen videos, and more. Browse your content on iPhone by playlists, artists, songs, videos, or other categories, or browse your album artwork using Cover Flow. Play your music on AirPlay speakers or sound systems, or watch your videos on a TV using AirPlay and Apple TV.
Getting Music, Videos, and More
There are two ways to get music, videos, and other content onto iPhone:
Transfer music, videos, and more onto iPhone by syncing content from iTunes on
[QWTEQORWVGT;QWECPU[PECNNQH[QWTOGFKCQT[QWECPUGNGEVURGEK°EUQPIU
videos, podcasts, and iTunes U collections. See “Syncing with iTunes” on page 56.
Use the iTunes Store on iPhone to purchase and download songs, albums, TV shows, movies, music videos, ringtones, and audiobooks directly to iPhone. You can also stream and download audio and video podcasts, as well as iTunes U content. After listening to a podcast or watching a TV show, you can tap a built-in link to get more
episodes from the iTunes Store. See Chapter 22, “iTunes Store,” on page 169.
Music and Other Audio
The high-resolution Multi-Touch display makes listening to songs on iPhone as much a visual experience as a musical one. You can scroll through your playlists, or use Cover
Flow to browse your album artwork.
WARNING: For important information about avoiding hearing loss, see the Important
Product Information Guide at www.apple.com/support/manuals/iphone.
95
96
APPLE CONFIDENTIAL — First Draft (1.10.11)
Playing Songs and Other Audio
You can browse content on iPhone by playlists, artists, songs, videos, and other categories, or browse your album artwork using Cover Flow. Playlist folders, which you can sync from iTunes, let you organize playlists into groups.
Browse your collection: Tap Playlists, Artists, or Songs. Tap More to browse Albums,
Audiobooks, Compilations, Composers, Genres, iTunes U, Podcasts, or Videos.
You can replace the browse buttons at the bottom of the screen with buttons you use
more frequently. See “Changing the Browse Buttons” on page 108.
Get more podcast episodes: 6CR2QFECUVUVCR/QTG°TUVKH2QFECUVUKUP¨VXKUKDNGVJGP tap a podcast to see a list of episodes. Tap “Get More Episodes…” to see a list of more episodes in the iTunes Store.
Browse Genius Mixes: 6CR)GPKWUVCR/QTG°TUVKH)GPKWUKUP¨VXKUKDNG+H)GPKWU doesn’t appear, you need to turn on Genius in iTunes, and then sync iPhone with
iTunes. See “Using Genius on iPhone” on page 102.
Play a song: Tap the song.
5JCMGVQUJWÔG 5JCMGK2JQPGVQVWTPUJWÔGQPCPFEJCPIGUQPIU5JCMGCP[VKOGVQ change to another song.
;QWECPVWTP5JCMGVQ5JWÔGQPQTQÒKP5GVVKPIU K2QFKV¨UQPD[FGHCWNV5GG
Controlling Audio Playback
When you play a song, the Now Playing screen appears.
)HJR
;YHJR3PZ[
7YL]PV\Z
9L^PUK
=VS\TL
Chapter 8 iPod
7SH`7H\ZL
5L_[-HZ[MVY^HYK
(PY7SH`
APPLE CONFIDENTIAL — First Draft (1.10.11)
Pause a song
Resume playback
Tap , or press the center button on the iPhone earphones.
Tap , or press the center button on the iPhone earphones.
Raise or lower the volume Drag the volume slider or use the buttons on the side of iPhone. You can also use the volume buttons on the iPhone earphones (iPhone 3GS or later).
Play music on an AirPlay sound system or Apple
TV
Tap and choose a sound system. If doesn’t appear or if you don’t see the AirPlay system you’re looking for, make sure iPhone is on the same wireless network.
Tap and choose iPhone from the list.
Tap .
Switch from AirPlay back to iPhone
Restart a song or a chapter in an audiobook or podcast
Skip to the next song or chapter in an audiobook or podcast
Go to the previous song or chapter in an audiobook or podcast
Rewind or fast-forward
Tap
Tap
, or press the center button on the iPhone earphones twice quickly.
twice, or press the center button on the iPhone earphones three times quickly.
Touch and hold or . The longer you hold the control, the faster the song rewinds or fastforwards. On the iPhone earphones, press the center button twice quickly and hold to fast forward, or three times quickly and hold to rewind.
Return to the iPod browse lists
Return to the Now Playing screen
Display a song’s lyrics
Tap , or swipe to the right over the album artwork.
Tap Now Playing.
Tap the album artwork when playing a song.
(Lyrics appear if you’ve added them to the song using the song’s Info window in iTunes.)
Display audio playback controls from another app or from the Lock screen
(iPhone 3GS or later): Double-click the Home DWVVQPVJGP±KEMHTQONGHVVQTKIJV along the bottom of the screen.
The controls operate the currently playing app, or the most recent app that played, if the audio is paused. The icon for the active app appears on the right. You can tap the icon to open the app.
Chapter 8 iPod 97
98
APPLE CONFIDENTIAL — First Draft (1.10.11)
If iPhone is locked and music is playing, double-click the Home button.
Note: On iPhone 3G, if you’re listening to music while using another app, or if iPhone is locked, you can display the playback controls by double-clicking the Home button.
See “Home Button” on page 200.
Additional Audio Controls
To display additional controls, tap the album artwork on the Now Playing screen.
6JGTGRGCV)GPKWUCPFUJWÔGEQPVTQNUCRRGCTCNQPIYKVJVJGUETWDDGTDCT;QWECP see elapsed time, remaining time, and the song number. The song’s lyrics also appear, if you’ve added them to the song in iTunes.
Use the scrubber bar to skip to any point along the timeline. You can adjust the scrub
TCVGHTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCF along the scrubber bar.
9LWLH[ .LUP\Z :O\MMSL
7SH`OLHK :JY\IILYIHY
Set iPhone to repeat songs
Skip to any point in a song
Make a Genius playlist
5GVK2JQPGVQUJWÔGUQPIU
Tap . Tap again to set iPhone to repeat only the current song.
= iPhone is set to repeat all songs in the current album or list.
= iPhone is set to repeat the current song over and over.
= iPhone isn’t set to repeat songs.
Drag the playhead along the scrubber bar. Slide
[QWT°PIGTFQYPVQCFLWUVVJGUETWDTCVG6JG scrub rate becomes slower the farther down you
UNKFG[QWT°PIGT
Tap . The Genius playlist appears, with buttons that let you create a new Genius playlist, refresh
the current one, or save the playlist. See “Using
Genius on iPhone” on page 102.
Tap . Tap again to set iPhone to play songs in order.
K2JQPGKUUGVVQUJWÔGUQPIU
= iPhone is set to play songs in order.
Chapter 8 iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
5JWÔGVJGVTCEMUKPCP[RNC[NKUVCNDWOQTQVJGT list of songs
6CR5JWÔGCVVJGVQRQHVJGNKUV(QTGZCORNGVQ
UJWÔGCNNVJGUQPIUQPK2JQPGEJQQUG5QPIU
5JWÔG
9JGVJGTQTPQVK2JQPGKUUGVVQUJWÔGKH[QWVCR
5JWÔGCVVJGVQRQHCNKUVQHUQPIUK2JQPGRNC[U the songs from that list in random order.
Hide lyrics In Settings, choose iPod, then turn Lyrics &
2QFECUV+PHQQÒ
Podcast and Audiobook Controls
Additional controls and information appear on the Now Playing screen when you begin playback.
The email, 30-second repeat, and playback speed controls appear along with the scrubber bar. You can see elapsed time, remaining time, and the episode or chapter number.
Use the scrubber bar to skip to any point along the timeline. You can adjust the scrub
TCVGHTQOJKIJURGGFVQ°PGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCF along the scrubber bar.
,THPS ZLJVUKYLWLH[
:JY\IILYIHY 7SH`OLHK
Send an email link to this podcast
Skip to any point
7SH`IHJR
ZWLLK
Play back the last 30 seconds
Set the playback speed
Show or hide the controls
Hide podcast information
Tap .
Drag the playhead along the scrubber bar. Slide
[QWT°PIGTFQYPVQCFLWUVVJGUETWDTCVG6JG scrub rate becomes slower the farther down you
UNKFG[QWT°PIGT
Tap .
Tap . Tap again to change the speed.
= Play at double speed.
= Play at half speed.
= Play at normal speed.
Tap in the center of the screen.
In Settings, choose iPod, then turn Lyrics &
2QFECUV+PHQQÒ
Chapter 8 iPod 99
APPLE CONFIDENTIAL — First Draft (1.10.11)
Using Voice Control with iPod
You can use Voice Control (iPhone 3GS or later) to control music playback on iPhone.
Note: Voice Control may not be available in all languages.
Use Voice Control: Press and hold the Home button until the Voice Control screen appears and you hear a beep. Then use the commands described below to play songs.
You can also press and hold the center button on the iPhone earphones to bring up
Voice Control.
Control music playback Say “play” or “play music.” To pause, say “pause” or “pause music.” You can also say “next song” or
“previous song.”
Play an album, artist, or playlist Say “play,” then say “album,” “artist,” or “playlist” and the name.
5C[¥UJWÔG¦ 5JWÔGVJGEWTTGPVRNC[NKUV
Find out more about the currently playing song Say “what’s playing,” “what song is this,” “who sings this song,” or “who is this song by.”
Use Genius to play similar songs Say “Genius,” “play more like this,” or “play more songs like this.”
Cancel Voice Control Say “cancel” or “stop.”
Browsing Album Artwork in Cover Flow
When you’re browsing music, you can rotate iPhone sideways to see your iTunes content in Cover Flow and browse your music by album artwork.
100 Chapter 8 iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
Browse album artwork
See the tracks on an album
Drag left or right.
Tap the album artwork or .
Play any track
Return to the artwork
Play or pause the current song
Tap the track. Drag up or down to scroll through the tracks.
Tap the title bar. Or tap again.
Tap or . You can also press the center button on the iPhone earphones.
Viewing All Tracks on an Album
See all the tracks on the album that contains the current song: On the Now Playing screen, tap . Tap a track to play it. Tap the album artwork thumbnail to return to the
Now Playing screen.
9H[PUNIHY
)HJR[V5V^
7SH`PUN
ZJYLLU
(SI\T[YHJRZ
In track list view, you can assign ratings to songs. You can use ratings to create smart playlists in iTunes that dynamically update to include, for example, your highest rated songs.
Rate a song: &TCI[QWT°PIGTCETQUUVJGTCVKPIDCTVQIKXGVJGUQPI\GTQVQ°XGUVCTU
Chapter 8 iPod 101
APPLE CONFIDENTIAL — First Draft (1.10.11)
Searching Audio Content
You can search the titles, artists, albums, and composers of songs, podcasts, and other content you’ve synced to iPhone.
Search music: 'PVGTVGZVKPVJGUGCTEJ°GNFCVVJGVQRQHCUQPINKUVRNC[NKUVCTVKUVNKUV or other view of your iPod content. (Tap the status bar to scroll quickly to the top of a
NKUVCPFTGXGCNVJGUGCTEJ°GNF
Search results appear as you type. Tap Search to dismiss the keyboard and see more of the results.
Audio content is included in searches from the Home screen. See “Searching” on page 47.
Using Genius on iPhone
)GPKWU°PFUUQPIUKP[QWTK6WPGUNKDTCT[VJCVIQITGCVVQIGVJGT#)GPKWURNC[NKUVKUC collection of songs that are picked for you to go with a song you choose from your library. A Genius Mix is a selection of songs of the same kind of music. Genius Mixes are recreated each time you listen to them, so they’re always new and fresh.
You can create Genius playlists in iTunes and sync them to iPhone. You can also create and save Genius playlists directly on iPhone.
)GPKWU/KZGUCTGETGCVGFCWVQOCVKECNN[HQT[QWD[K6WPGUK6WPGUETGCVGUFKÒGTGPV mixes depending on the variety of music you have in your iTunes library. For example, you may have Genius Mixes that highlight R&B songs, or Alternative Rock songs.
6QWUG)GPKWUQPK2JQPG°TUVVWTPQP)GPKWUKPK6WPGUVJGPU[PEK2JQPGYKVJK6WPGU
Genius Mixes are synced automatically, unless you manually manage your music and choose which mixes you want to sync in iTunes. Genius is a free service, but it requires an Apple ID.
When you sync a Genius Mix, iTunes may select and sync songs from your library that
[QWJCXGP¨VURGEK°ECNN[EJQUGPVQU[PE
102 Chapter 8 iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
Browse Genius Mixes: 6CR)GPKWUVCR/QTG°TUVKH)GPKWUKUP¨VXKUKDNG6JGPWODGT of dots at the bottom of the screen shows the number of mixes you’ve synced from iTunes, and indicates which mix you’re viewing. Flick left or right to access your other mixes.
Play a Genius Mix: Tap the mix or tap .
Make a Genius playlist on iPhone:
1 6CR2NC[NKUVUVCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNGVJGPVCR)GPKWU2NC[NKUV
2 Tap a song in the list. Genius creates a playlist with additional songs that go great with that song.
You can also make a Genius playlist of songs that go great with the song you’re playing. Tap the album artwork on the Now Playing screen to display additional controls, then tap .
Save a Genius playlist: In the playlist, tap Save. The playlist is saved in Playlists with the title of the song you picked.
You can make and save as many Genius playlists as you want. If you save a Genius playlist created on iPhone, it syncs back to iTunes the next time you connect.
Refresh a Genius playlist: In the playlist, tap Refresh.
4GHTGUJKPICRNC[NKUVETGCVGUCRNC[NKUVQHFKÒGTGPVUQPIUVJCVIQITGCVYKVJVJGUQPI you picked. You can refresh any Genius playlist, whether it was created in iTunes and synced to iPhone, or created directly on iPhone.
/CMGC)GPKWURNC[NKUVWUKPICFKÒGTGPVUQPI Tap Genius Playlist, then tap New and pick a song.
Delete a saved Genius playlist: Tap the Genius playlist, then tap Delete.
Once a Genius playlist is synced back to iTunes, you won’t be able to delete it directly from iPhone. You can use iTunes to edit the playlist name, stop syncing, or delete the playlist.
Chapter 8 iPod 103
104
APPLE CONFIDENTIAL — First Draft (1.10.11)
Creating Playlists
You can create and edit your own playlists on iPhone. You can also edit playlists synced from iTunes on your computer.
Create a playlist:
1 6CR2NC[NKUVUVCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNGVJGPVCR¥#FF2NC[NKUV¦
2 Type a name for your playlist, then tap Save.
3 Browse for songs using the buttons at the bottom of the screen. Tap any song or video to add it to the playlist. Tap Add All Songs at the top of any list of songs to add all the songs in the list.
4 9JGP[QW°PKUJVCR&QPG
When you make a playlist and then sync iPhone to your computer, the playlist is synced to your iTunes library.
Edit a playlist:
1 6CR2NC[NKUVUVCR/QTG°TUVKH2NC[NKUVUKUP¨VXKUKDNGVJGPVCRVJGRNC[NKUV[QWYCPVVQ edit.
2 Tap Edit, then do one of the following:
To move a song higher or lower in the list, drag next to the song.
To delete a song from the playlist, tap next to a song, then tap Delete. Deleting a song from a playlist doesn’t delete it from iPhone.
To add more songs, tap .
3 9JGP[QW°PKUJVCR&QPG
When you edit a playlist and then sync iPhone to your computer, the playlist is synced to your iTunes library.
Delete a playlist: In Playlists, tap the playlist you want to delete, then tap Delete (scroll
VQVJGVQRQHVJGNKUVVQTGXGCNVJG&GNGVGDWVVQP%QP°TOD[VCRRKPI&GNGVG2NC[NKUV
Clear a playlist: In Playlists, tap the playlist you want to clear, then tap Clear (scroll to
VJGVQRQHVJGNKUVVQTGXGCNVJG%NGCTDWVVQP%QP°TOD[VCRRKPI%NGCT2NC[NKUV
Videos
With iPhone, you can view video content such as movies, music videos, and video podcasts. If a video contains chapters, you can skip to the next or previous chapter, or bring up a list and start playing at any chapter that you choose. If a video provides alternate language features, you can choose an audio language or display subtitles.
Playing Videos
Play a video: 6CR8KFGQUVCR/QTG°TUVKH8KFGQUKUP¨VXKUKDNGVJGPVCRVJGXKFGQ
Chapter 8 iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
Display playback controls: Tap the screen to show the controls. Tap again to hide them.
Get more podcast or TV show episodes: 6CR8KFGQUVCR/QTG°TUVKH8KFGQUKUP¨V visible), then tap a podcast or TV show to see a list of episodes. Tap “Get More
Episodes…” to see a list of more episodes in the iTunes Store.
Controlling Video Playback
Videos play in landscape orientation to take full advantage of the widescreen display.
The scrubber bar lets you skip to any point along the timeline. You can adjust the
UETWDTCVGD[UNKFKPI[QWT°PIGTFQYPCU[QWFTCIVJGRNC[JGCFCNQPIVJGUETWDDGT bar.
:JY\IILYIHY 7SH`OLHK
:JHSL
7SH`7H\ZL
(PY7SH`
5L_[-HZ[
MVY^HYK
9LZ[HY[9L^PUK =VS\TL
Pause a video
Resume playback
Raise or lower the volume
Play a video on Apple TV using AirPlay
Switch from AirPlay back to iPhone
Skip to the next chapter (if available)
Tap , or press the center button on the iPhone earphones (iPhone 3GS).
Tap , or press the center button on the iPhone earphones (iPhone 3GS).
Drag the volume slider. You can also use the volume buttons on the iPhone earphones
(iPhone 3GS or later).
Tap and choose an Apple TV. If doesn’t appear or if you don’t see the Apple TV you’re looking for, make sure iPhone is on the same wireless network.
Tap and choose iPhone from the list.
Tap , or press the center button on the iPhone earphones (iPhone 3GS or later) twice quickly.
Go to the previous chapter (if available) Tap , or press the center button on the iPhone earphones (iPhone 3GS or later) three times quickly.
5VCTVRNC[KPICVCURGEK°EEJCRVGTKHCXCKNCDNG Tap , then choose a chapter from the list.
Chapter 8 iPod 105
106
APPLE CONFIDENTIAL — First Draft (1.10.11)
Rewind or fast-forward
Skip to any point in a video
Touch and hold or .
Drag the playhead along the scrubber bar. Slide
[QWT°PIGTFQYPVQCFLWUVVJGUETWDTCVG6JG scrub rate becomes slower the farther down you
UNKFG[QWT°PIGT
5VQRYCVEJKPICXKFGQDGHQTGKV°PKUJGURNC[KPI Tap Done. Or press the Home button.
5ECNGCXKFGQVQ°NNVJGUETGGPQT°VVQVJG screen
Tap VQOCMGVJGXKFGQ°NNVJGUETGGP6CR
VQOCMGKV°VVJGUETGGP;QWECPCNUQFQWDNGVCR
VJGXKFGQVQUYKVEJDGVYGGP°VVKPICPF°NNKPIVJG screen.
9JGP[QWUECNGCXKFGQVQ°NNVJGUETGGPVJG sides or top may be cropped from view. When
[QWUECNGKVVQ°VVJGUETGGP[QWOC[UGGDNCEM bars on the sides or above and below the video.
Select an alternate audio language (if available) Tap , then choose a language from the Audio list.
Show or hide subtitles (if available) Tap VJGPEJQQUGCNCPIWCIGQT1ÒHTQOVJG
Subtitles list.
Searching for Videos
You can search the titles of movies, TV shows, and video podcasts you’ve synced to iPhone.
Search for a video: 'PVGTVGZVKPVJGUGCTEJ°GNFCVVJGVQRQHVJGNKUVQHXKFGQU
Search results appear as you type. Tap Search to dismiss the keyboard and see more of the results.
Video content is included in searches from the Home screen. See “Searching” on page 47.
Watching Rented Movies and TV Shows
You can rent movies from the iTunes Store and watch them on iPhone. You can download rented movies and TV shows directly to iPhone, or transfer movies from iTunes on your computer to iPhone. (Rented movies and TV shows may not be available in all countries or regions.)
See “Purchasing or Renting Videos” on page 174.
A movie or TV show must be completely downloaded before you can start watching it.
You can pause a download and resume it later.
Chapter 8 iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
Rented movies and TV shows expire after a certain time, and once you start a movie or
68UJQY[QWJCXGCNKOKVGFCOQWPVQHVKOGVQ°PKUJYCVEJKPIKV6JGVKOGTGOCKPKPI appears near the title. Rented items are automatically deleted when they expire. Before renting a movie or TV show, check the iTunes Store for the rental period.
View a rented movie or TV show: 1PK2JQPGEJQQUGK2QF 8KFGQUVCR/QTG°TUVKH
Videos isn’t visible), then select the movie or TV show.
On iPhone 3G and iPhone 3GS, you can transfer rented movies between iPhone and your computer. On iPhone 4, you can transfer rented movies between iPhone and your computer only if they were rented in iTunes on your computer. Movies rented on iPhone 4 cannot be transferred to your computer.
Transfer a rented movie between iPhone and your computer:
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list, then click Movies.
3 Click Move next to the item you want to transfer, then click Apply.
Your computer must be connected to the Internet.
Watching Videos on a TV
You can watch videos on your TV by connecting iPhone to your TV or AV receiver with an AV cable. Or, you can stream videos wirelessly to your TV using AirPlay and Apple
TV.
Connect using an AV cable: Use the Apple Component AV Cable, Apple Composite
AV Cable, or other authorized iPhone-compatible cable. You can also use these cables with the Apple Universal Dock to connect iPhone to your TV. The Apple Universal Dock includes a remote that lets you control playback from a distance.
Stream videos using AirPlay: Start video playback, then tap and choose your
Apple TV from the list. If doesn’t appear or if you don’t see your Apple TV in the list of AirPlay devices, make sure it’s on the same wireless network as iPhone. To return playback to iPhone, tap again and choose iPhone from the list.
Apple cables and docks are available for purchase separately. Go to www.apple.com/ ipodstore (may not be available in all countries or regions) or check with your local
Apple retailer.
Converting Videos for iPhone
You can add videos other than those purchased from the iTunes Store to iPhone, such as videos you create in iMovie on a Mac, or videos you download from the Internet and then add to iTunes.
If you try to add a video from iTunes to iPhone and a message says the video can’t play on iPhone, you can convert the video.
Chapter 8 iPod 107
APPLE CONFIDENTIAL — First Draft (1.10.11)
Convert a video to work with iPhone: Select the video in your iTunes library and choose Advanced > “Create iPod or iPhone Version.” Then add the converted video to iPhone.
Deleting Videos from iPhone
You can delete videos from iPhone to save space.
Delete a video: In the videos list, swipe left or right over the video, then tap Delete.
Deleting a video from iPhone (other than a rented movie or TV show) doesn’t delete the video from your iTunes library. It may reappear on iPhone if the video in iTunes is still set to sync.
Important: If you delete a rented movie or TV show from iPhone, it’s deleted permanently and cannot be transferred back to your computer.
Setting a Sleep Timer
You can set iPhone to stop playing music or videos after a period of time.
Set a sleep timer: (TQOVJG*QOGUETGGPEJQQUG%NQEM 6KOGTVJGP±KEMVQUGVVJG number of hours and minutes. Tap When Timer Ends and choose Sleep iPod, tap Set, then tap Start to start the timer.
When the timer ends, iPhone stops playing music or video, closes any other open app, and then locks itself.
Changing the Browse Buttons
You can replace the browse buttons at the bottom of the screen with buttons you use more frequently. For example, if you often listen to podcasts, you can replace the
Songs button with Podcasts.
108 Chapter 8 iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
Change the browse buttons: Tap More and tap Edit, then drag a button to the bottom of the screen, over the button you want to replace.
You can drag the buttons at the bottom of the screen left or right to rearrange them.
6CR&QPGYJGP[QW°PKUJ6CR/QTGCVCP[VKOGVQCEEGUUVJGDWVVQPU[QWTGRNCEGF
Chapter 8 iPod 109
APPLE CONFIDENTIAL — First Draft (1.10.11)
Messages
9
110
Sending and Receiving Messages
WARNING: For important information about driving safely, see the Important Product
Information Guide at www.apple.com/support/manuals/iphone.
Messages lets you exchange text messages with anyone using an SMS-capable phone.
Messages also supports MMS, so you can send photos, video clips (iPhone 3GS or later), contact information, and voice memos to other MMS-capable devices. You can enter multiple addressees and send a message to several people at the same time.
Note: SMS or MMS support may not be available in all countries or regions. Additional fees may apply for use of Messages. Contact your carrier for more information.
The Messages icon on the Home screen shows the number of unread messages you have.
5\TILYVM
\UYLHKTLZZHNLZ
You can use Messages whenever you’re in range of the cellular network. If you can make a call, you can send a message. Depending on your phone plan, you may be charged for the messages you send or receive.
Send a message: Tap , then enter a phone number or name, or tap and choose a
EQPVCEVHTQO[QWTEQPVCEVUNKUV6CRVJGVGZV°GNFCDQXGVJGMG[DQCTFV[RGCOGUUCIG and tap Send.
Messages longer than 160 characters sent from a CDMA model may be split into
OWNVKRNGOGUUCIGUYJGPTGEGKXGFQPRJQPGUWUKPICFKÒGTGPVECTTKGT5GG¥6WTP
EJCTCEVGTEQWPVKPIQPQTQÒ¦DGNQY
APPLE CONFIDENTIAL — First Draft (1.10.11)
If the message can’t be sent (if you’re out of cellular network range, for example), an alert badge appears on the Messages icon on the Home screen. If Messages is in a folder, the alert badge appears on the folder.
(SLY[IHKNL
Important: Messages containing Emoji or other non-ASCII characters sent from a
CDMA model are not delivered to phones on a GMS network, and no alert appears.
Your conversations are saved in the Messages list. Conversations that contain unread messages have a blue dot next to them. Tap a conversation in the list to see that conversation or add to it.
;L_[TLZZHNLZ
`V\ZLU[
;L_[TLZZHNLZ
MYVT[OLV[OLY
WLYZVU iPhone displays the 50 most recent messages in the conversation. To see earlier messages, scroll to the top and tap Load Earlier Messages.
Send a message to a group of people: Tap , then add recipients. If you enter a phone number manually (instead of selecting it from Contacts), tap Return before entering another entry.
The Group Messaging setting must be turned on (in Settings > Messages).
Replies from any of the recipients are sent only to you, not to the other people you texted.
Reply or send a message to a person (or group) you’ve texted before: Tap an entry in the Messages list, then type a new message in the conversation and tap Send.
Send a message to a favorite or to a recent call:
1 Tap Phone on the Home screen, then tap Favorites or Recents.
2 Tap next to a name or number, then tap Text Message.
Chapter 9 Messages 111
112
APPLE CONFIDENTIAL — First Draft (1.10.11)
3 If multiple phone numbers appear, tap the one you want to text.
When MMS is available, Messages allows you to include a subject in your text
OGUUCIGU;QWECPVWTPVJKUHGCVWTGQPQTQÒKP/GUUCIGUUGVVKPIU+VKUVWTPGFQPD[ default.
+PENWFGQTTGOQXGVJGUWDLGEV°GNF In Settings, tap Messages, then tap Show Subject
Field.
Note: 6JGUWDLGEV°GNFCPFVJG5JQY5WDLGEV(KGNFUGVVKPIFQP¨VCRRGCTKH//5KUP¨V supported by your carrier.
6WTPEJCTCEVGTEQWPVKPIQPQTQÒ In Settings, tap Messages, then tap the Character
Count switch. The character count includes all characters—including spaces, punctuation, and returns—and appears as you type when your message exceeds two lines. You may want to count characters, for example, when carrier fees apply.
Note: 6JGEJCTCEVGTEQWPVFQGUPQVCRRGCTKH[QWGPVGTVGZVKPVJGUWDLGEV°GNFQT attach a photo or video.
6WTP//5OGUUCIKPIQPQTQÒ In Settings, tap Messages, then tap MMS Messaging.
;QWOC[YCPVVQVWTP//5/GUUCIKPIQÒHQTGZCORNGVQRTGXGPVUGPFKPIQTTGEGKXKPI attachments when fees apply.
Note: The MMS Messaging setting doesn’t appear if MMS isn’t supported by your carrier.
Searching Messages
You can search the content of message threads from the Messages list (iPhone 3GS or later).
Search the Messages list: 6CRVJGVQRQHVJGUETGGPVQFKURNC[VJGUGCTEJ°GNFVJGP
VCRVJGUGCTEJ°GNFCPFGPVGTVJGVGZV[QW¨TGNQQMKPIHQT
Messages are included in searches from the Home screen. See “Searching” on page 47.
Sharing Photos and Videos
You can take a photo or make a video (iPhone 3GS or later) from within Messages and include it in your conversation with another MMS-capable device. You can save photos or videos you receive in Messages to your Camera Roll album.
If MMS isn’t supported by your carrier, doesn’t appear and you can’t send photos or videos.
Send a photo or video: Tap and tap “Take Photo or Video” (iPhone 3GS or later; on earlier models, tap “Take Photo”), or “Choose Existing” and select an item from a photo album and tap Choose.
Chapter 9 Messages
APPLE CONFIDENTIAL — First Draft (1.10.11)
The size limit of attachments is determined by your carrier. If necessary, iPhone may compress the photo or video. To learn about taking photos and videos, see
Chapter 12, “Camera,” on page 129.
Save a photo or video attachment to your Camera Roll album: Tap the photo or video in the conversation, tap , then tap Save Image or Save Video.
Copy a photo or video: Touch and hold the attachment, then tap Copy. You can paste the photo or video to an Mail message or another MMS message.
Sending Voice Memos
You can send voice memos in a message to another MMS-capable device.
Send a voice memo: In Voice Memos, tap , tap the voice memo you want to send, then tap Share and tap MMS. Address the message and tap Send.
Editing Conversations
If you want to keep a conversation but not the entire thread, you can delete the parts you don’t want. You can also delete entire conversations from the Messages list.
Edit a conversation: Tap Edit. Tap the circles along the left side to select the parts of
VJGEQPXGTUCVKQP[QWYCPVVQFGNGVGVJGPVCR&GNGVG9JGP[QW¨TG°PKUJGFVCR&QPG
%NGCTCNNVGZVCPF°NGUYKVJQWVFGNGVKPIVJGEQPXGTUCVKQP Tap Edit, then tap Clear All.
6CR%NGCT%QPXGTUCVKQPVQEQP°TO
Forward a conversation: Select a conversation, then tap Edit. Tap the circles on the left side of the screen to select the parts of the conversation you want to include, then tap Forward, enter one or more recipients, and tap Send.
Delete a conversation: Tap Edit, then tap next to the conversation and tap Delete.
You can also swipe left or right over the conversation and tap Delete.
;VZOV^[OL
+LSL[LI\[[VU
Z^PWLSLM[VYYPNO[
V]LY[OLTLZZHNL
Using Contact Information and Links
Call, FaceTime, or email someone you’ve texted: Tap a message in the Text Messages list and scroll to the top of the conversation. (Tap the status bar to scroll quickly to the top of the screen.)
To call the person, tap Call.
Chapter 9 Messages 113
APPLE CONFIDENTIAL — First Draft (1.10.11)
To call the person using FaceTime, tap FaceTime.
To email the person, tap Contact Info, then tap an email address.
Follow a link in a message: Tap the link.
A link may open a webpage in Safari, make a phone call in Phone, open a preaddressed message in Mail, or display a location in Maps. To return to your text messages, press the Home button and tap Messages.
Add someone you’ve texted to your contacts list: Tap a phone number in the
Messages list, then tap “Add to Contacts.”
Send contact information: In Contacts, tap the person whose information you want to share. Tap Share Contact at the bottom of the screen, then tap MMS. Address the message and tap Send.
Save contact information received: Tap the contact bubble in the conversation and tap Create New Contact or “Add to Existing Contact.”
Managing Previews and Alerts
By default, iPhone displays a preview of new messages when iPhone is locked or when
[QWCTGWUKPICPQVJGTCRR;QWECPVWTPVJKURTGXKGYQPQTQÒKP5GVVKPIU;QWECPCNUQ enable alerts for text messages.
6WTPRTGXKGYUQPQTQÒ In Settings, choose Messages and tap Show Preview.
Repeat previews: In Settings, choose Messages and tap Repeat Alert. If you don’t
TGURQPFVQVJG°TUVRTGXKGYQHCPGYOGUUCIGVJGRTGXKGYYKNNDGFKURNC[GFVYKEG more.
Set whether an alert sounds when you get a text message or preview: In Settings, choose Sounds, then tap New Text Message. Tap the alert sound you want, or None if you don’t want an audible alert.
Important: +HVJG4KPI5KNGPVUYKVEJKUQÒVGZVCNGTVUYQP¨VUQWPF
114 Chapter 9 Messages
APPLE CONFIDENTIAL — First Draft (1.10.11)
Calendar
10
About Calendar
Calendar gives you ready access to your calendars and events. You can view individual calendars, or several calendars at once. You can view your events by day, by month, or in a list. You can search the titles, invitees, locations, and notes of events. If you’ve entered birthdays for your contacts, you can view those birthdays in Calendar.
You can sync iPhone with the calendars on your computer, and with services such as
MobileMe, Microsoft Exchange, Yahoo!, and Google. You can also make, edit, or cancel appointments on iPhone and have them sync back to your computer or calendar account. If you have a MobileMe, Microsoft Exchange, Google, Yahoo!, or CalDAV account, your calendars can sync over the air without connecting iPhone to your computer. MobileMe Shared Calendars that you’ve joined from your computer also sync with iPhone.
;QWECPUWDUETKDGVQTGCFQPN[K%CNGPFCTKEUECNGPFCTUQTKORQTVKEU°NGUHTQOGOCKN
If you have a Microsoft Exchange account with Calendars enabled, or a supported
CalDAV account, you can receive and respond to meeting invitations from others, and invite people to events you’ve scheduled.
Syncing Calendars
You can sync Calendar in either of the following ways:
In iTunes, use the iPhone Info pane to sync with iCal or Microsoft Entourage on a
Mac, or Microsoft Outlook 2003, 2007, or 2010 on a PC, when you connect iPhone to
your computer. See “iPhone Settings Panes in iTunes” on page 58.
115
116
APPLE CONFIDENTIAL — First Draft (1.10.11)
In Settings on iPhone, turn on Calendars in your MobileMe, Microsoft Exchange,
Google, or Yahoo! accounts to sync your calendar information over the air, or set
up a CalDAV account if your company or organization supports it. See “Adding Mail,
Contacts, and Calendar Accounts” on page 25.
Viewing Your Calendars
You can view a single calendar, selected calendars, or all calendars at once.
Select calendars to view: Tap Calendars, then tap to select the calendars you want to view. To quickly select or deselect all calendars, tap Show All Calendars or Hide All
Calendars. To view your contacts’ birthdays, tap Birthdays at the bottom of the screen.
Tap Done to view the selected calendars.
The events for all selected calendars appear in a single calendar on iPhone. You can view your calendar events in a list, by day, or by month.
Switch views: Tap List, Day, or Month.
List view:
Day view:
All your appointments and events appear in a scrollable list.
Scroll up or down to see the events in a day. Tap or to see the previous or next day’s events.
Month view: Tap a day to see its events. Tap or to see the previous or next month.
(KKHUL]LU[
+H`Z^P[OKV[Z
OH]LZJOLK\SLK
L]LU[Z
,]LU[ZMVY
ZLSLJ[LKKH`
9LZWVUK[V
JHSLUKHYPU]P[H[PVU
.V[V[VKH` :^P[JO]PL^Z
See the details of an event: Tap the event.
Set iPhone to adjust event times for a selected time zone:
1 In Settings, choose “Mail, Contacts, Calendars.”
2 Under Calendars, tap Time Zone Support, then turn Time Zone Support on.
3 Tap Time Zone, then search for a major city in the time zone you want.
Chapter 10 Calendar
APPLE CONFIDENTIAL — First Draft (1.10.11)
When Time Zone Support is on, Calendar displays event dates and times in the time
\QPGQHVJGEKV[[QWUGNGEVGF9JGP6KOG<QPG5WRRQTVKUQÒ%CNGPFCTFKURNC[UGXGPVU in the time zone of your current location as determined by the network time.
Searching Calendars
;QWECPUGCTEJVJGVKVNGUKPXKVGGUNQECVKQPUCPFPQVGU°GNFUQHVJGGXGPVUKP[QWT calendars. Calendar searches only the events for the calendars you’re currently viewing.
Search for events: +PNKUVXKGYGPVGTVGZVKPVJGUGCTEJ°GNF
Search results appear as you type. Tap Search to dismiss the keyboard and see more results.
Calendar events are included in searches from the Home screen. See “Searching” on page 47.
Adding and Updating Events on iPhone
You can create and update calendar events directly on iPhone.
If you have a Microsoft Exchange account with calendars enabled, or a supported
CalDAV account, you can invite other people to your event or meeting.
Add an event: Tap and enter event information, then tap Done.
You can enter any of the following:
Title
Location
Starting and ending times (or turn on All-day if it’s an all-day event)
Repeat times—none, or every day, week, two weeks, month, or year
Invitees (if supported by your calendar server)
Chapter 10 Calendar 117
APPLE CONFIDENTIAL — First Draft (1.10.11)
#NGTVVKOG¤HTQO°XGOKPWVGUVQVYQFC[UDGHQTGVJGGXGPV
When you set an alert, the option to set a second alert appears. When an alert
IQGUQÒK2JQPGFKURNC[UCOGUUCIG;QWECPCNUQUGVK2JQPGVQRNC[CUQWPFUGG
Important: Some carriers don’t support network time in all locations. If you’re traveling, iPhone may not alert you at the correct local time. To manually set the
correct time, see “Date and Time” on page 204.
Calendar
You can change the default calendar using the Default Calendar setting. See
Notes
You can’t assign an event to a read-only calendar.
Events can also be created by tapping a day, date, or time in a Mail message. See
“Using Links and Detected Data” on page 82.
Update an event: Tap Edit and change event information. Tap Done when you’re
°PKUJGF
Delete an event: Tap the event, tap Edit, then scroll down and tap Delete Event.
Responding to Meeting Invitations
If you have a Microsoft Exchange or MobileMe account with calendars enabled, or a supported CalDAV account, you can receive and respond to meeting invitations from people in your organization. When you receive an invitation, the meeting appears in your calendar with a dotted line around it. appears in the lower-right corner of the screen with a badge that shows the total number of new invitations you have. The number of new invitations also appears on the Calendar icon on the Home screen.
118 Chapter 10 Calendar
5\TILYVM
TLL[PUNPU]P[H[PVUZ
APPLE CONFIDENTIAL — First Draft (1.10.11)
Respond to an invitation in Calendar:
1 Tap a meeting invitation in the calendar, or tap to display the Event screen and tap an invitation.
Tap “Invitation from” to get contact information for the meeting organizer. Tap the email address to send a message to the organizer. If the organizer is in your contacts list, you can also tap to call or send a text message.
Tap Invitees to see the other people invited to the meeting. Tap a name to see an attendee’s contact information. Tap the email address to send a message to the attendee. If the attendee is in your contacts list, you can also tap to call or send a text message.
Tap Alert to set iPhone to sound an alert before the meeting.
Tap Add Comments to add comments in the email response to the meeting organizer. You comments will also appear in your Info screen for the meeting.
Notes are made by the meeting organizer.
2 Tap Accept, Maybe, or Decline.
When you accept, tentatively accept, or decline the invitation, a response email that includes any comments you added is sent to the organizer.
If you accept or tentatively accept the meeting, you can change your response later.
Tap Add Comments if you want to change your comments.
Meeting invitations are also sent in an email message, which lets you open the meeting’s Info screen from Mail.
Open a meeting invitation in an email message: Tap the invitation.
Chapter 10 Calendar 119
APPLE CONFIDENTIAL — First Draft (1.10.11)
Subscribing to Calendars
You can subscribe to calendars that use the iCalendar (.ics) format. Many calendarbased services support calendar subscriptions, including Yahoo!, Google, and the Mac
OS X iCal application.
Subscribed calendars are read-only. You can read events from subscribed calendars on iPhone, but you can’t edit them or create new events.
Subscribe to a calendar:
1 In Settings, choose “Mail, Contacts, Calendars,” then tap Add Account.
2 Choose Other, then choose Add Subscribed Calendar.
3 Enter the server information, then tap Next to verify the subscription.
4 Tap Save.
You can also subscribe to an iCal (or other .ics) calendar published on the web by tapping a link to the calendar you receive in an email or text message on iPhone.
Importing Calendar Files from Mail
;QWECPCFFGXGPVUVQCECNGPFCTD[KORQTVKPICECNGPFCT°NGHTQOCPGOCKNOGUUCIG
;QWECPKORQTVCP[UVCPFCTFKEUECNGPFCT°NG
+ORQTVGXGPVUHTQOCECNGPFCT°NG In Mail, open the message and tap the calendar
°NG9JGPVJGNKUVQHGXGPVUCRRGCTUVCR#FF#NNEJQQUGVJGECNGPFCT[QWYCPVVQCFF the events to, and tap Done.
Alerts
Set calendar alerts: In Settings, choose Sounds, then turn Calendar Alerts on. If
%CNGPFCT#NGTVUKUQÒYJGPCPGXGPVKUCDQWVVQQEEWTK2JQPGFKURNC[UCOGUUCIGDWV makes no sound.
Important: +HVJG4KPI5KNGPVUYKVEJKUQÒECNGPFCTCNGTVUYQP¨VUQWPF
Sound alerts for invitations: In Settings, choose “Mail, Contacts, Calendar.” Under
Calendars, tap New Invitation Alert to turn it on.
120 Chapter 10 Calendar
APPLE CONFIDENTIAL — First Draft (1.10.11)
Photos
11
About Photos
iPhone lets you carry photos and videos with you, so you can share them with your family, friends, and associates. View your photos on iPhone or use AirPlay to view them on a TV with Apple TV. You can sync photos and videos from your computer, view photos and videos taken with iPhone, use photos as wallpaper, and assign photos to identify contacts when they call. You can also send photos and videos in email messages, send photos and videos in MMS messages, upload photos and videos to
MobileMe galleries, and print photos.
Note: Video features are available on iPhone 3GS or later. MMS is available if supported by your carrier.
Syncing Photos and Videos with Your Computer
iTunes can sync your photos and videos with the following applications:
Mac: iPhoto 4.0.3 or later (syncing videos requires iPhoto 6.0.6 or later), or Aperture
(photos only)
PC: Adobe Photoshop Elements 8.0 or later (photos only)
You can also sync photos and videos from any folder on your computer that contains
images. See “Syncing with iTunes” on page 56.
iPhone supports H.264 and MPEG-4 video formats, with AAC audio. If you are having trouble syncing a video to iPhone, you might be able to use iTunes to create an iPhone version of the video.
Create an iPhone version of a video:
1 Copy the video to your iTunes library.
2 In iTunes, select Movies in the Library list and select the video you want to sync.
121
APPLE CONFIDENTIAL — First Draft (1.10.11)
3 Choose Advanced > Create iPod or iPhone Version.
For more information, go to support.apple.com/kb/HT1211.
Viewing Photos and Videos
Photos and videos you take with iPhone, sync from your computer, or save from an email or MMS message can be viewed in Photos. If you sync photos with iPhoto 8.0
(part of iLife ‘09) or later, you can view your photos and videos by the events and faces
[QW¨XGKFGPVK°GF;QWECPCNUQUGGVJGRNCEGUYJGTG[QWTRJQVQUCPFXKFGQUYGTG taken if they’re tagged with location data.
View photos and videos:
1 In Photos, tap a photo album. Tap the buttons at the bottom of the screen to view your photos and videos by albums, events, faces, or places if available.
Photos are sorted by creation date. If you tap Places, a map shows each location that you’ve tagged photos from. Tap a pin, then tap to see your photos and videos from that location.
2 Tap a thumbnail to see the photo or video in full screen.
Show or hide the controls: Tap the full-screen photo or video to show the controls.
Tap again to hide the controls.
Play a video: Tap in the center of the screen.
To replay a video, tap at the bottom of the screen. If you don’t see , tap the screen to show the controls.
122 Chapter 11 Photos
APPLE CONFIDENTIAL — First Draft (1.10.11)
View a photo or video in landscape orientation: Rotate iPhone sideways. The photo
QTXKFGQTQVCVGUCWVQOCVKECNN[CPFKHKV¨UKPYKFGUETGGPHQTOCVGZRCPFUVQ°VVJG screen.
Zoom in on part of a photo: Double-tap where you want to zoom in. Double-tap again to zoom out. You can also pinch to zoom in or out.
8KGYXKFGQKPHWNNUETGGPQT°VXKFGQVQUETGGP Double tap the screen to scale the
XKFGQVQ°NNVJGUETGGP&QWDNGVCRCICKPVQ°VVJGXKFGQVQVJGUETGGP
Pan around a photo: Drag the photo.
See the next or previous photo or video: Flick left or right. Or tap the screen to show the controls, then tap or .
Chapter 11 Photos 123
124
APPLE CONFIDENTIAL — First Draft (1.10.11)
Deleting Photos and Videos
You can delete photos and videos from Camera Roll on iPhone.
Delete photos and videos:
1 Tap in the upper-right corner of the screen.
2 Tap to select the photos and videos you want to delete.
The Delete button indicates the number of items you select.
3 Tap Delete.
Slideshows
You can view a photo album as a slideshow, complete with background music.
View a photo album as a slideshow: Tap an album, then tap .
Videos play automatically when they appear during the slideshow.
Stop a slideshow: Tap the screen.
Set slideshow settings: In Settings, choose Photos and set the following options:
To set the length of time each slide is shown, tap Play Each Slide For and choose a time.
6QUGVVTCPUKVKQPGÒGEVUYJGPOQXKPIHTQORJQVQVQRJQVQ transition type.
tap Transition and choose a
To set whether slideshows repeat, VWTP4GRGCVQPQTQÒ
To set whether photos and videos are shown in random order, VWTP5JWÔGQPQTQÒ
Play music during a slideshow: In iPod, play a song, then choose Photos on the Home screen and start a slideshow.
Viewing Photos, Videos, and Slideshows on a TV
You can view photos, videos, and slideshows on your TV by connecting iPhone to your TV or AV receiver with an AV cable. Or, you can stream photos and slideshows wirelessly to your TV using AirPlay and Apple TV.
Connect using an AV cable: Use the Apple Component AV Cable, Apple Composite
AV Cable, or other authorized iPhone-compatible cable. You can also use these cables with the Apple Universal Dock to connect iPhone to your TV or AV receiver. The Apple
Universal Dock includes a remote that lets you control playback from a distance.
Stream content using AirPlay: View a photo or slideshow, then tap and choose your Apple TV from the list. If doesn’t appear or if you don’t see your Apple TV in the list of AirPlay devices, make sure it’s on the same wireless network as iPhone. To return playback to iPhone, tap again and choose iPhone from the list.
Chapter 11 Photos
APPLE CONFIDENTIAL — First Draft (1.10.11)
Apple cables and docks are available for purchase separately. Go to www.apple.com/ ipodstore (may not be available in all countries or regions) or check with your local
Apple retailer.
Sharing Photos and Videos
You can send photos and videos in email and MMS messages, add photos and videos to MobileMe galleries, and publish videos to YouTube. You can also copy and paste photos and videos, save photos and videos from email messages to Photos, and save images from webpages to Photos.
Sending a Photo or Video in an Email or MMS Message
Send a photo or video (iPhone 3GS or later) in an email message:
1 Choose a photo or video and tap . If you don’t see , tap the screen to show the controls.
2 Tap Email Photo/Video.
The photo or video appears in a new mail message window.
3 Compose your message, then tap Send.
4 If sending a photo, you may be asked if you want to reduce the message size by scaling the image. Tap the size you want to use.
Send multiple photos or videos at the same time: When viewing thumbnails in an album, tap , then tap to select the photos or videos you want to send, tap Share, and tap Email.
Send a photo or video via MMS: Choose a photo or video and tap , then tap MMS.
The size limit of attachments is determined by your carrier. If necessary, iPhone may compress the photo or video. To learn about taking photos and videos, see
Chapter 12, “Camera,” on page 129.
Copying and Pasting Photos and Videos
You can copy a photo or video from Photos and paste it in an email or MMS message.
Some third-party apps may also support copying and pasting photos and videos.
Copy a photo or video: *QNF[QWT°PIGTQPVJGUETGGPWPVKNVJG%QR[DWVVQPCRRGCTU then tap Copy.
Copy multiple photos or videos:
1 Tap in the upper-right corner of the screen.
2 Tap to select the photos and videos you want to copy.
The Copy button indicates the number of items you select.
3 Tap Copy.
Chapter 11 Photos 125
126
APPLE CONFIDENTIAL — First Draft (1.10.11)
Paste a photo or video: Tap to place the insertion point where you want to place the photo or video, then tap the insertion point and tap Paste.
Adding a Photo or Video to a MobileMe Gallery
If you have a MobileMe account, you can add photos and videos directly from iPhone to a gallery you’ve created. You can also add photos and videos to someone else’s
MobileMe gallery if that person has enabled email contributions.
Before you can add photos or videos to a gallery in your MobileMe account, you must:
Set up your MobileMe account on iPhone
Publish a MobileMe gallery, and allow adding photos via email or iPhone
For more information about creating a gallery and adding photos and videos to it, see
MobileMe Help.
Add a photo or video to your gallery: Choose a photo or video and tap , then tap
“Send to MobileMe.” Enter a title and description, if you like, then select the album to add the photo or video to and tap Publish.
If you don’t see , tap the screen to show the controls.
iPhone tells you when the photo or video has been published, and gives you options to view it on MobileMe or email a link to a friend.
Add a photo or video to someone else’s gallery: Choose a photo or video and tap , then tap “Email Photo/Video.” Enter the album’s email address, then click Send.
Publishing Videos to YouTube
If you have a YouTube account, you can publish videos directly from iPhone 3GS or later to YouTube. Some videos may not be transferable, depending on the length of the movie or other factors.
Publish a video to YouTube:
1 While viewing a video, tap , then tap “Send to YouTube.”
2 Sign in to your YouTube account.
3 Enter publishing information such as Title, Description, and Tags.
4 Tap Category to choose a category.
5 Tap Publish.
Saving Photos and Videos from Email Messages, MMS Messages, and
Webpages
Save a photo from an email message to your Camera Roll album: Tap the photo, then tap Save Image. If the photo hasn’t been downloaded yet, tap the download
PQVKEG°TUV
Chapter 11 Photos
APPLE CONFIDENTIAL — First Draft (1.10.11)
Save a video from an email message to your Camera Roll album: Touch and hold the attachment, then tap Save Video. If the video hasn’t been downloaded yet, tap the
FQYPNQCFPQVKEG°TUV
Save a photo from a webpage to your Camera Roll album: Touch and hold the photo, then tap Save Image.
Save a photo or video from an MMS message to your Camera Roll album: Tap the image in the conversation, tap , and tap Save Image or Save Video.
If you don’t see , tap the screen to show the controls.
You can download the photos and videos in your Camera Roll album to your computer’s photo application by connecting iPhone to your computer.
Printing Photos
You can use AirPrint to print photos from iPhone.
Print a photo: Tap , then tap Print. Tap Select Printer to select a printer, set the number of copies, then tap Print.
Print multiple photos: While viewing a photo album, tap . Select the photos you want to print, then tap Print. Tap Select Printer to select a printer, set the number of copies, then tap Print.
For more information, see “Printing” on page 45.
Assigning a Photo to a Contact
You can assign a photo to a contact. When that person calls, iPhone displays the photo.
Assign a photo to a contact:
1 Choose Camera on the Home screen, then take someone’s picture. Or choose any photo already on iPhone, and tap .
2 Tap “Assign to Contact” and choose a contact.
3 Position and size the photo until it looks the way you want.
Drag the photo to pan, and pinch to zoom in or out.
4 Tap Set Photo.
You can also assign a photo to a contact in Contacts by tapping Edit and then tapping
“Add Photo.”
Chapter 11 Photos 127
APPLE CONFIDENTIAL — First Draft (1.10.11)
Wallpaper
You can set a photo as wallpaper for the Lock screen. On iPhone 3GS or later, you can also set wallpaper for your Home screen. The Lock screen wallpaper also appears when you’re on a call with someone you don’t have a contact photo for.
Set a photo as wallpaper (iPhone 3GS or later):
1 Choose any photo and tap , then tap Use As Wallpaper.
2 Drag the photo to position it and pinch to zoom in or out, until it looks the way you want.
3 Tap Set, then choose whether you want to use the photo as wallpaper for your Lock
Screen, Home screen, or both.
You can also choose from several wallpaper pictures included with iPhone by choosing
Settings > Wallpaper from the Home screen. See “Adding Wallpaper” on page 36.
Set a photo as wallpaper (iPhone 3G):
1 Choose any photo and tap , then tap Use As Wallpaper.
2 Drag the photo to position it and pinch to zoom in or out, until it looks the way you want.
3 Tap Set Wallpaper.
You can also choose from several wallpaper pictures included with iPhone by choosing
Settings > Wallpaper from the Home screen.
128 Chapter 11 Photos
APPLE CONFIDENTIAL — First Draft (1.10.11)
Camera
12
About Camera
With iPhone, you have a great still camera and video camera (iPhone 3GS or later)
YJGTGXGT[QWIQK2JQPGJCUCOCKPECOGTCVJCVVCMGURJQVQUCPFJKIJFG°PKVKQP
XKFGQCP.'&±CUJHQTRJQVQUCPFXKFGQUVCMGPYKVJVJGOCKPECOGTCCPFCHTQPV camera that lets you make FaceTime video calls and take photos and videos of yourself.
The main camera is on the back of iPhone. You use the screen to control the camera and to see the photo or video you’re taking. Tap-to-focus lets you tap anywhere on
VJGUETGGPVQHQEWUQPCURGEK°EQDLGEVQTCTGCQH[QWTUJQVCPFCWVQOCVKECNN[CFLWUV the exposure. The macro autofocus feature (about 10 cm) and a 5x digital zoom let you take great close-ups. (The video and tap-to-focus features are available only on iPhone 3GS or later.)
If location services is turned on, photos and videos (iPhone 3GS or later) are tagged with location data—including your current geographical coordinates provided by
GPS, Wi-Fi, or cell-tower information. You can use location data with some apps and photo-sharing websites to track and post where you took the photos. For example, the
Photos app organizes photos by places.
Note: +HNQECVKQPUGTXKEGUKUVWTPGFQÒYJGP[QWQRGP%COGTC[QWOC[DGCUMGFVQ turn it on. If you don’t want to include location data with your photos and videos,
you can use Camera without turning on location services. See “Location Services” on page 200.
129
130
APPLE CONFIDENTIAL — First Draft (1.10.11)
Taking Photos and Recording Videos
Taking photos and recording videos with iPhone is as easy as point and tap.
:L[3,+
MSHZOTVKL
;\YU/+9
VUVYVMM
:^P[JOJHTLYHZ
-VJ\ZHYLH
AVVT
*HTLYH=PKLV
Z^P[JO
;O\TIUHPSVM
SHZ[ZOV[
;HW[V
[HRLWOV[V
Take a photo: Aim iPhone and tap .
Make sure the Camera/Video switch is set to .
When you take a photo or start a video recording, iPhone makes a shutter sound. You can use the volume buttons on the side of the iPhone to control the volume of the shutter sound. You don’t hear a sound if you set the Ring/Silent switch to silent. See
“Sounds and the Ring/Silent Switch” on page 196.
Note: +PUQOGTGIKQPUVJGUQWPFGÒGEVUHQT%COGTCCTGRNC[GFGXGPKHVJG4KPI5KNGPV switch is set to silent.
On iPhone 4, you can turn on HDR to take HDR (high dynamic range) photos. HDR blends the best parts of three separate exposures into a single photo. For best results, iPhone and the subject should be stationary.
6WTP*&4QPQTQÒ Tap the HDR button at the top of the screen. The button indicates
YJGVJGT*&4KUQPQTQÒ*&4KUQÒD[FGHCWNV
Note: 9JGP*&4KUQPVJG±CUJKUVWTPGFQÒ
With HDR, you can save both the normal-exposure version and the HDR version of a photo in the Camera Roll, or save just the HDR version. By default, both are saved.
Choose whether to save both the normal-exposure version and the HDR version of photos: +P5GVVKPIUEJQQUG2JQVQUVJGPVWTP-GGR0QTOCN2JQVQQPQTQÒ+HVJG
UGVVKPIKUVWTPGFQÒQPN[VJG*&4XGTUKQPQHCRJQVQKUUCXGF
Chapter 12 Camera
APPLE CONFIDENTIAL — First Draft (1.10.11)
If you save both versions, appears in the upper-left corner of the HDR photo when you view the photos in Camera Roll (if the controls are visible).
Record a video: Slide the Camera/Video switch to , then tap to start recording.
The record button blinks while Camera is recording. Tap again to stop recording.
You can also press the center button on the iPhone earphones to start or stop recording.
A rectangle on the screen shows the area where the camera is focused and setting the exposure.
Tap the screen to bring up the camera controls.
Change the focus area and set the exposure: Tap anywhere to focus the camera and adjust the exposure for the selected area.
Zoom in or out: Tap the screen, then drag the slider at the bottom of the screen to zoom in or out (main camera, in camera mode only).
5GV.'&±CUJOQFG 6CRVJG±CUJDWVVQPKPVJGWRRGTNGHVEQTPGTQHVJGUETGGPVJGP
VCR1Ò#WVQQT1P
Switch between the main and front cameras: Tap in the upper-right corner of the screen.
Review a photo or video you’ve just taken: Tap the thumbnail of your last shot, in the lower-left corner of the screen.
Use the left and right arrows at the bottom of the screen to review other photos and
XKFGQUKPVJG%COGTC4QNNQTLWUV±KEMNGHVQTTKIJV6CR&QPGVQTGVWTPVQECOGTCQT video mode. If you don’t see the controls, tap the screen to display them.
Delete a photo or video: Tap . If you don’t see , tap the screen to display the controls.
Take a screenshot: 3WKEMN[RTGUUCPFTGNGCUGVJG1P1Ò5NGGR9CMGCPF*QOG
DWVVQPUCVVJGUCOGVKOG#±CUJQHVJGUETGGPNGVU[QWMPQYVJGUETGGPUJQVYCU taken. The screenshot is added to the Camera Roll album.
Viewing and Sharing Photos and Videos
The photos and videos you take with Camera are saved in the Camera Roll album on iPhone. You can view the Camera Roll album from either Camera or Photos.
View photos and videos in the Camera Roll album: In Camera, tap the thumbnail image in the lower-left corner of the screen. In Photos, tap the Camera Roll album. Tap
VJGNGHVQTTKIJVDWVVQPQT±KEMNGHVQTTKIJVVQ±KRVJTQWIJVJGRJQVQUCPFXKFGQU
When viewing a photo or video in the Camera Roll album, tap the screen to display the controls. If you save both the normal and the HDR versions of a photo, appears in the upper-left corner of the HDR photo (when the controls are visible).
Chapter 12 Camera 131
APPLE CONFIDENTIAL — First Draft (1.10.11)
For more information about viewing and sharing photos and videos, see:
“
Viewing Photos and Videos” on page 122
“
Sharing Photos and Videos” on page 125
Trimming Videos
You can trim the frames from the beginning and end of a video that you just recorded, or any other video in the Camera Roll album. You can replace the original video or save the trimmed version as a new video clip.
132
Trim a video:
1 While viewing a video, tap the screen to display the controls.
2 Drag either end of the frame viewer at the top of the video, then tap Trim.
3 Tap Trim Original or “Save as New Clip.”
Important: If you choose Trim Original, the trimmed frames are permanently deleted from the original video. If you choose “Save as New Clip,” a new trimmed video clip is
UCXGFKPVJG%COGTC4QNNCNDWOCPFVJGQTKIKPCNXKFGQKUWPCÒGEVGF
Uploading Photos and Videos to Your Computer
You can upload the photos and videos you take with Camera to photo applications on your computer, such as iPhoto on a Mac.
Upload photos and videos to your computer: Connect iPhone to your computer.
Mac: Select the photos and videos you want and click the Import or Download button in iPhoto or other supported photo application on your computer.
PC: Follow the instructions that came with your photo application.
If you delete the photos and videos from iPhone when you upload them to your computer, they’re removed from the Camera Roll album. You can use the Photos settings pane in iTunes to sync photos and videos (videos can be synced with Macs
only) to the Photos app on iPhone. See “iPhone Settings Panes in iTunes” on page 58.
Chapter 12 Camera
APPLE CONFIDENTIAL — First Draft (1.10.11)
YouTube
13
Finding and Viewing Videos
YouTube features short videos submitted by people from around the world. To use some features on iPhone, you need to sign in to a YouTube account when asked. For information about requirements and how to get a YouTube account, go to www.
youtube.com.
Note: YouTube may not be available in all languages and locations.
Browse videos: Tap Featured, Most Viewed, or Favorites. Or tap More to browse by
Most Recent, Top Rated, History, Subscriptions, or Playlists.
Featured: 8KFGQUTGXKGYGFCPFHGCVWTGFD[;QW6WDGUVCÒ
Most Viewed: Videos most seen by YouTube viewers. Tap All for all-time most viewed videos, or Today or This Week for most-viewed videos of the day or week.
Favorites: Videos you’ve added to Favorites. When you sign in to a YouTube account, account favorites appear and any existing favorites can be synced to your account.
Most Recent:
Top Rated: Videos most highly rated by YouTube viewers. To rate videos, go to www.
youtube.com.
Videos most recently submitted to YouTube.
History: Videos you’ve viewed most recently.
Subscriptions: Videos from YouTube accounts to which you’ve subscribed. You must be signed in to a YouTube account to use this feature.
Playlists: Videos you’ve added to playlists. You must be signed in to a YouTube account to use this feature.
You can replace the browse buttons at the bottom of the screen with buttons you use
more frequently. See “Changing the Browse Buttons” on page 137.
133
134
APPLE CONFIDENTIAL — First Draft (1.10.11)
Search for a video:
1 6CR5GCTEJVCR/QTG°TUVKH5GCTEJKUP¨VXKUKDNGVJGPVCRVJG;QW6WDGUGCTEJ°GNF
2 Type a word or phrase that describes what you’re looking for, then tap Search.
YouTube shows results based on video titles, descriptions, tags, and user names. Listed videos show title, rating, number of views, length, and the account name that posted the video.
Play a video: Tap the video.
The video begins to download to iPhone and a progress bar appears. When enough of the video has downloaded, it begins to play. You can also tap to start the video.
Controlling Video Playback
When a video starts playing, the controls disappear so they don’t obscure the video.
Show or hide the video controls: Tap the screen.
7SH`OLHK +V^USVHKWYVNYLZZ :JY\IILYIHY
:JHSL
7SH`7H\ZL
5L_[
-HZ[MVY^HYK
(PY7SH`
,THPS
)VVRTHYR 7YL]PV\ZYL^PUK
Play or pause a video
Adjust the volume
Play a video on Apple TV using AirPlay
Switch from AirPlay back to iPhone
Restart a video
Skip to the next or previous video in a list
Rewind or fast-forward
=VS\TL
Tap or . You can also press the center button on the iPhone earphones (iPhone 3GS or later).
Drag the volume slider, or use the volume buttons on the side of iPhone. You can also use the volume buttons on the iPhone earphones
(iPhone 3GS or later).
Tap and choose an Apple TV. If doesn’t appear or if you don’t see the Apple TV you’re looking for, make sure it’s on the same wireless network as iPhone.
Tap and choose iPhone from the list.
Tap .
Tap twice to skip to the previous video. Tap
to skip to the next video.
Touch and hold or .
Chapter 13 YouTube
APPLE CONFIDENTIAL — First Draft (1.10.11)
Skip to any point in a video Drag the playhead along the scrubber bar.
5VQRYCVEJKPICXKFGQDGHQTGKV°PKUJGURNC[KPI Tap Done, or press the Home button.
5YKVEJDGVYGGPUECNKPICXKFGQVQ°NNVJGUETGGP
QT°VVQVJGUETGGP
Double-tap the video. You can also tap to
OCMGVJGXKFGQ°NNVJGUETGGPQTVCR to make
KV°VVJGUETGGP
Add a video to Favorites using video controls
Email a link to the video using video controls
Start playing a video and tap .
Start playing a video and tap .
Managing Videos
Tap next to a video to see related videos and more controls for managing videos.
Add the video to Favorites
Add the video to a playlist
Email a link to the video
Browse and view related videos
Tap “Add to Favorites.”
Tap “Add to Playlist,” then select an existing playlist or tap to create a new playlist.
Tap Share Video.
Tap a video in the list of related videos to view, or tap next to a video for more information.
Chapter 13 YouTube 135
APPLE CONFIDENTIAL — First Draft (1.10.11)
Getting More Information
Tap next to the video to show the video’s comments, description, date added, and other information.
136
Rate the video or add a comment
See more videos from this account
Subscribe to this YouTube account
On the More Info screen, tap “Rate, Comment, or
Flag,” then choose “Rate or Comment.” You must be signed in to a YouTube account to use this feature.
On the More Info screen, tap More Videos.
On the More Info screen, tap More Videos, then tap “Subscribe to < account >” at the bottom of the video list. You must be signed in to a YouTube account to use this feature.
Using YouTube Account Features
If you have a YouTube account, you can access account features such as subscriptions, comments and ratings, and playlists. To create a YouTube account, go to www.youtube.
com.
Show favorites you’ve added to your account: In Favorites, tap Sign In, then enter your username and password to see your account favorites. Any existing favorites you’ve added to iPhone can be merged with your account favorites when you sign in.
Delete a favorite: In Favorites, tap Edit, tap next to a video, then tap Delete.
Show subscriptions you’ve added to your account: In Subscriptions, tap Sign In, then enter your username and password to see your account subscriptions. Tap an account in the list to see all videos for that account.
Unsubscribe from a YouTube account: In Subscriptions, tap an account in the list, then tap Unsubscribe.
Chapter 13 YouTube
APPLE CONFIDENTIAL — First Draft (1.10.11)
View playlists: In Playlists, tap a playlist to see the list of videos you’ve added. Tap any video in the playlist to begin playing videos from that point in the playlist.
Edit a playlist: In Playlists, tap Edit, then do one of the following:
To delete the entire playlist,
To create a new playlist, tap next to a playlist, then tap Delete.
tap , then enter a name for the playlist.
Add a video to a playlist: Tap next to a video, then tap “Add to Playlist” and choose a playlist.
Delete a video from a playlist:
1 In Playlists, tap a playlist, then tap Edit.
2 Tap next to a playlist, then tap Delete.
Changing the Browse Buttons
You can replace the Featured, Most Viewed, Bookmarks, and Search buttons at the bottom of the screen with ones you use more frequently. For example, if you watch top-rated videos often but don’t watch many featured videos, you could replace the
Featured button with Top Rated.
Change the browse buttons: Tap More and tap Edit, then drag a button to the bottom of the screen, over the button you want to replace.
You can drag the buttons at the bottom of the screen left or right to rearrange them.
9JGP[QW°PKUJVCR&QPG
When you’re browsing for videos, tap More to access the browse buttons that aren’t visible.
Chapter 13 YouTube 137
APPLE CONFIDENTIAL — First Draft (1.10.11)
Sending Videos to YouTube
If you have a YouTube account, you can send videos directly to YouTube (iPhone 3GS
or later). See “Publishing Videos to YouTube” on page 126.
138 Chapter 13 YouTube
APPLE CONFIDENTIAL — First Draft (1.10.11)
Stocks
14
Viewing Stock Quotes
Stocks lets you see the latest available quotes for your selected stocks, funds, and indexes.
Quotes are updated every time you open Stocks when connected to the Internet.
Quotes may be delayed by up to 20 minutes or more, depending upon the reporting service.
Add a stock, fund, or index to the stock reader:
1 Tap , then tap .
2 Enter a symbol, company name, fund name, or index, then tap Search.
3 Select an item from the search results and tap Done.
View charts in landscape orientation: Rotate iPhone sideways. Flick left or right to view the other charts in your stock reader.
Show the progress of a stock, fund, or index over time: Tap the stock, fund, or index in your list, then tap 1d, 1w, 1m, 3m, 6m, 1y, or 2y. The chart adjusts to show progress over one day, one week, one month, three months, six months, one year, or two years.
When you view a chart in landscape orientation, you can touch the chart to display the
XCNWGHQTCURGEK°ERQKPVKPVKOG
139
APPLE CONFIDENTIAL — First Draft (1.10.11)
7UGVYQ°PIGTUVQUGGVJGEJCPIGKPXCNWGQXGTCURGEK°ERGTKQFQHVKOG
Delete a stock: Tap and tap next to a stock, then tap Delete.
Change the order of the list: Tap . Then drag next to a stock or index to a new place in the list.
Switch the view to percentage change, price change, or market capitalization: Tap any of the values along the right side of the screen. Tap again to switch to another view. Or tap and tap %, Price, or Mkt Cap, then tap Done.
Getting More Information
See the summary, chart, or news page about a stock, fund, or index: Select the stock,
HWPFQTKPFGZKP[QWTNKUVVJGP±KEMVJGRCIGUWPFGTPGCVJVJGUVQEMTGCFGTVQXKGYVJG summary, chart, or recent news page.
On the news page, you can scroll up and down to read headlines, or tap a headline to view the article in Safari.
See more information at Yahoo.com: Select the stock, fund, or index in your list, then tap .
140 Chapter 14 Stocks
APPLE CONFIDENTIAL — First Draft (1.10.11)
Maps
15
WARNING: For important information about driving and navigating safely, see the
Important Product Information Guide at www.apple.com/support/manuals/iphone.
Maps provides street maps, satellite photos, a hybrid view, and street views of
NQECVKQPUKPOCP[QHVJGYQTNF¨UEQWPVTKGUCPFTGIKQPU;QWECPIGVVTCÓEKPHQTOCVKQP and detailed driving, public transit, or walking directions. Find and track your current
(approximate) location, and use your current location to get driving directions to or from another place. The built-in digital compass lets you see which way you’re facing.
(iPhone 3GS or later).
Important: Maps, directions, and location-based apps depend on data services. These data services are subject to change and may not be available in all geographic areas, resulting in maps, directions, or location-based information that may be unavailable, inaccurate, or incomplete. Compare the information provided on iPhone to your surroundings, and defer to posted signs to resolve any discrepancies.
+HNQECVKQPUGTXKEGUKUVWTPGFQÒYJGP[QWQRGP/CRU[QWOC[DGCUMGFVQVWTPKV
on. You can use Maps without turning on location services. See “Location Services” on page 200.
Finding and Viewing Locations
You can search for locations, get your current location, mark a location with the drop pin, and get satellite and Google Street Views.
Searching for Locations
You can search for locations in many ways—by address, intersection, area, landmark, bookmark, contact, or zip code, for example.
141
142
APPLE CONFIDENTIAL — First Draft (1.10.11)
Find a location and see a map:
1 6CRVJGUGCTEJ°GNFVQDTKPIWRVJGMG[DQCTF
2 Type an address or other search information.
3 Tap Search.
A pin marks the location. Tap the pin to see the name or description of the location.
;HW[VNL[
PUMVYTH[PVUHIV\[
[OLSVJH[PVUNL[
KPYLJ[PVUZHKK[OL
SVJH[PVU[V`V\Y
IVVRTHYRZVY
JVU[HJ[ZSPZ[VY
LTHPSHSPUR[V
.VVNSL4HWZ
Locations can include places of interest added by Google My Maps users (“Usercreated content”), and sponsored links that appear as special icons (for example, ).
Zoom in to a part of a map
Zoom out
Pan or scroll to another part of the map
2KPEJVJGOCRYKVJVYQ°PIGTU1TFQWDNGVCR the part you want to zoom in on. Double-tap again to zoom in even closer.
2KPEJVJGOCR1TVCRVJGOCRYKVJVYQ°PIGTU
6CRYKVJVYQ°PIGTUCICKPVQ\QQOQWVHWTVJGT
Drag up, down, left, or right.
See the location of a contact’s address: Tap KPVJGUGCTEJ°GNFVJGPVCR%QPVCEVU and choose a contact.
To locate an address in this way, the contact must include at least one address. If the contact has more than one address, choose the one you want to locate. You can also
°PFVJGNQECVKQPQHCPCFFTGUUD[VCRRKPIVJGCFFTGUUFKTGEVN[KP%QPVCEVU
Finding Your Current Location
#SWKEMVCR°PFU[QWTEWTTGPVCRRTQZKOCVGNQECVKQP
Chapter 15 Maps
APPLE CONFIDENTIAL — First Draft (1.10.11)
Find your current location and turn tracking mode on: Tap .
Your current location is indicated by a blue marker. If your location can’t be determined precisely, a blue circle also appears around the marker. The size of the circle depends on how precisely your location can be determined—the smaller the circle, the greater the precision.
As you move around, iPhone updates your location, adjusting the map so that the location indicator remains in the center of the screen. If you tap again until it is no longer highlighted, or if you drag the map, iPhone continues to update your location
DWVUVQRUEGPVGTKPIKVUQVJGNQECVKQPKPHQTOCVKQPOC[OQXGQÒVJGUETGGP iPhone uses location services to determine your location. Location services uses available information from cellular network data, local Wi-Fi networks (if you have Wi-
Fi turned on), and GPS (may not be available in all locations). When an app is using location services, appears in the status bar. Location services may not be available in all countries or regions.
+HNQECVKQPUGTXKEGUKUVWTPGFQÒ[QW¨NNDGRTQORVGFVQVWTPKVQP;QWECP¨V°PFCPF
VTCEM[QWTEWTTGPVNQECVKQPKHNQECVKQPUGTXKEGUKUVWTPGFQÒ5GG¥ Location Services” on page 200.
6QEQPUGTXGDCVVGT[NKHGVWTPNQECVKQPUGTXKEGUQÒYJGP[QW¨TGPQVWUKPIKV+P5GVVKPIU choose General > Location Services.
Get information about your current location: Tap the blue marker, then tap . iPhone displays the address of your current location, if available. You can use this information to:
Get directions
Add the location to contacts
Send the address via email or MMS
Chapter 15 Maps 143
APPLE CONFIDENTIAL — First Draft (1.10.11)
Bookmark the location
Show which way you’re facing (iPhone 3GS or later): Tap again. (The icon changes to .) Maps uses the built-in compass to determine which way you’re facing. The angle shows the accuracy of the compass reading—the smaller the angle, the greater the accuracy.
Maps uses true north to determine your heading, even if you have magnetic north set in Compass. If the compass needs calibrating, iPhone asks you to wave the phone
KPC°IWTGGKIJV+HVJGTG¨UKPVGTHGTGPEG[QWOC[DGCUMGFVQOQXGHTQOVJGUQWTEGQH
interference. See Chapter 20, “Compass,” on page 161.
Marking a Location with the Drop Pin
The drop pin lets you mark a location by hand.
Mark a location: Touch and hold the location on the map.
The drop pin appears where you’re touching the map.
Move the drop pin: Touch and hold, then drag the pin to a new location, or touch and hold a new location until a new pin drops, replacing the previous one.
144 Chapter 15 Maps
APPLE CONFIDENTIAL — First Draft (1.10.11)
Satellite View and Street View
You can see a satellite view of a map, or a combined satellite and street map view. You can also see a Google Street View of a location.
See a satellite view or hybrid view: Tap , then tap Satellite or Hybrid to see just a satellite view or a combined street map and satellite view.
To return to map view, tap Map.
Chapter 15 Maps 145
APPLE CONFIDENTIAL — First Draft (1.10.11)
See the Google Street View of a location: Tap . Flick left or right to pan through the
360° panoramic view. (The inset shows your current view.) Tap an arrow to move down the street. To return to map view, tap the map inset in the lower-right corner.
;HW[VYL[\YU[VTHW]PL^
Street View may not be available in all areas.
Getting Directions
You can get step-by-step directions for driving, taking public transit, or walking to a destination.
Get directions:
1 Tap Directions.
2 'PVGTUVCTVKPICPFGPFKPINQECVKQPUKPVJG5VCTVCPF'PF°GNFU$[FGHCWNVK2JQPGUVCTVU with your current approximate location (if available). Tap KPGKVJGT°GNFVQEJQQUG a location in Bookmarks (including your current location and the dropped pin, if available), Recents, or Contacts. If KUP¨VUJQYKPIFGNGVGVJGEQPVGPVUQHVJG°GNF
For example, if a friend’s address is in your contacts list, you can tap Contacts and tap your friend’s name instead of having to type the address.
To reverse the directions, tap .
3 Tap Route (if you entered locations manually), then select directions by car ( ), directions by public transit ( ), or directions by walking ( ).
The travel options available depend on the route.
4 Do one of the following:
146 Chapter 15 Maps
APPLE CONFIDENTIAL — First Draft (1.10.11)
To view all the directions in a list, tap , then tap List. Tap any item in the list to see a map showing that leg of the trip. Tap Route Overview to return to the overview screen.
To view directions one step at a time, tap Start, then tap to see the next leg of the trip. Tap to go back.
If you’re driving or walking, the approximate distance and travel time appear at the top
QHVJGUETGGP+HVTCÓEFCVCKUCXCKNCDNGVJGFTKXKPIVKOGKUCFLWUVGFCEEQTFKPIN[
If you’re taking public transit, the overview screen shows each leg of the trip and the mode of transportation, including where you need to walk. The top of the screen
UJQYUVJGVKOGQHVJGDWUQTVTCKPCVVJG°TUVUVQRVJGGUVKOCVGFCTTKXCNVKOGCPFVJG total fare. Tap to set your departure or arrival time, and to choose a schedule for the trip. Tap the icon at a stop to see the departure time for that bus or train, and to get a link to the transit provider’s website or contact info. When you tap Start and step through the route, detailed information about each leg of the trip appears at the top of the screen.
;QWECPCNUQIGVFKTGEVKQPUD[°PFKPICNQECVKQPQPVJGOCRVCRRKPIVJGRKPVJCV points to it, tapping , then tapping Directions To Here or Directions From Here.
Switch start and end points, for reverse directions: Tap .
If you don’t see , tap Edit.
See recently viewed directions: Tap KPVJGUGCTEJ°GNFVJGPVCR4GEGPVU
5JQYKPI6TCÓE%QPFKVKQPU
9JGPCXCKNCDNG[QWECPUJQYVTCÓEEQPFKVKQPUHQTOCLQTUVTGGVUCPFJKIJYC[UQPVJG map.
5JQYQTJKFGVTCÓEEQPFKVKQPU Tap VJGPVCR5JQY6TCÓEQT*KFG6TCÓE
Chapter 15 Maps 147
148
APPLE CONFIDENTIAL — First Draft (1.10.11)
5VTGGVUCPFJKIJYC[UCTGEQNQTEQFGFVQKPFKECVGVJG±QYQHVTCÓE
+H[QWFQP¨VUGGVTCÓE[QWOC[PGGFVQ\QQOQWVVQCNGXGNYJGTG[QWECPUGGOCLQT
TQCFU6TCÓEEQPFKVKQPUCTGPQVCXCKNCDNGKPCNNCTGCU
Finding and Contacting Businesses
Find businesses in an area:
1 Find a location—for example, a city and state or country, or a street address—or scroll to a location on a map.
2 6[RGVJGMKPFQHDWUKPGUUKPVJGVGZV°GNFCPFVCR5GCTEJ
Pins appear for matching locations in the area. For example, if you locate your city and then type “movies” and tap Search, pins mark movie theaters in your city.
Tap the pin that marks a business to see its name or description.
(KPFDWUKPGUUGUYKVJQWV°PFKPIVJGNQECVKQP°TUV Type things like:
restaurants san francisco ca apple inc new york
Contact a business or get directions: Tap the pin that marks a business, then tap next to the name.
From there, you can do the following:
Tap a phone number to call, an email address to send email to, or a web address to visit.
For directions, tap Directions To Here or Directions From Here.
To add the business to your contacts list, tap “Add to Contacts” at the bottom of the screen, then tap “Create New Contact” or “Add to Existing Contact.”
Share the location of the business by email or text message.
Chapter 15 Maps
.YH` $UVKH[H
J\YYLU[S`H]HPSHISL
.YLLU
$WVZ[LK
ZWLLKSPTP[
@LSSV^ $ZSV^LY
[OHU[OLWVZ[LK
ZWLLKSPTP[
9LK $Z[VWHUKNV
APPLE CONFIDENTIAL — First Draft (1.10.11)
See a list of the businesses found in the search: From the Map screen, tap List.
Tap a business to see its location. Or tap next to a business to see its information.
*HSS
=PZP[
^LIZP[L
.L[
KPYLJ[PVUZ
;HW[VZOV^
JVU[HJ[PUMV
Sharing Location Information
You can add a location you’ve found to your contacts list. You can also send links to a
Google Maps location using email or MMS.
Add a location to your contacts list: Find a location, tap the pin that points to it, tap
next to the name or description, then tap “Add to Contacts” at the bottom of the screen and tap “Create New Contact” or “Add to Existing Contact.”
Email a link to a Google Maps location: Find a location, tap the pin that points to it, tap next to the name or description, then tap Share Location at the bottom of the screen and tap Email.
Send a link via MMS to a Google Maps location: Find a location, tap the pin that points to it, tap next to the name or description, then tap Share Location at the bottom of the screen and tap MMS.
Bookmarking Locations
;QWECPDQQMOCTMNQECVKQPUVJCV[QWYCPVVQ°PFCICKPNCVGT
Bookmark a location: Find a location, tap the pin that points to it, tap next to the name or description, then tap “Add to Bookmarks” at the bottom of the Info screen.
See a bookmarked location or recently viewed location: Tap KPVJGUGCTEJ°GNF then tap Bookmarks or Recents.
Chapter 15 Maps 149
APPLE CONFIDENTIAL — First Draft (1.10.11)
Weather
16
150
Viewing Weather Summaries
Tap Weather on the Home screen to get the current temperature and six-day forecast for one or more cities around the world.
;VKH`»ZOPNOHUKSV^
*\YYLU[JVUKP[PVUZ
*\YYLU[[LTWLYH[\YL
:P_KH`MVYLJHZ[
(KKHUKKLSL[LJP[PLZ
5\TILYVMJP[PLZZ[VYLK
If the weather board is light blue, it’s daytime in that city—between 6:00 a.m. and 6:00 p.m. If the board is dark purple, it’s nighttime—between 6:00 p.m. and 6:00 a.m.
Add a city:
1 Tap , then tap .
2 Enter a city name or zip code, then tap Search.
3 Choose a city in the search list.
Switch to another city: Flick left or right, or tap to the left or right of the row of dots.
The number of dots below the weather board shows how many cities are stored.
Reorder cities: Tap , then drag next to a city to a new place in the list.
APPLE CONFIDENTIAL — First Draft (1.10.11)
Delete a city: Tap and tap next to a city, then tap Delete.
Display the temperature in Fahrenheit or Celsius: Tap , then tap °F or °C.
Getting More Weather Information
You can see a more detailed weather report, news and websites related to the city, and more.
See information about a city at Yahoo.com: Tap .
Chapter 16 Weather 151
152
APPLE CONFIDENTIAL — First Draft (1.10.11)
Notes
17
About Notes
You can create notes on iPhone and sync notes with supported applications on your computer and online accounts. You can search for text in a list of notes.
Syncing Notes
You can sync Notes in either of the following ways:
In iTunes, use the iPhone settings panes to sync with Mail on a Mac or with
Microsoft Outlook 2003, 2007, or 2010 on a PC when you connect iPhone to your
computer. See “iPhone Settings Panes in iTunes” on page 58.
In Settings, turn on Notes in MobileMe, Google, Yahoo!, AOL, or other IMAP account to sync your notes over the air (iPhone 3GS or later) with those accounts. See
“Adding Mail, Contacts, and Calendar Accounts” on page 25.
Writing and Reading Notes
When you sync Notes with an application on your computer or with online accounts, the Accounts screen shows each those accounts, plus a button to display all notes in a single list.
See all notes: Tap All Notes.
APPLE CONFIDENTIAL — First Draft (1.10.11)
5GGPQVGUHQTCURGEK°ECEEQWPV Tap the account name.
Change the font used to display notes: In Settings, choose Notes, then select the font you want to use.
0QVGUCTGNKUVGFD[NCUVOQFK°GFFCVGYKVJVJGOQUVTGEGPVN[OQFK°GFPQVGCVVJGVQR
;QWECPUGGVJG°TUVHGYYQTFUQHGCEJPQVGKPVJGNKUV4QVCVGK2JQPGVQXKGYPQVGUKP landscape orientation and type using a larger keyboard.
Add a note: Tap , then type your note and tap Done.
0GYPQVGUCTGCFFGFVQVJGFGHCWNVCEEQWPVURGEK°GFKP0QVGUUGVVKPIU5GG¥ Notes” on page 218.
Read a note: Tap the note. Tap or to see the next or previous note.
Edit a note: Tap anywhere on the note to bring up the keyboard.
Delete a note: Tap the note, then tap .
Chapter 17 Notes 153
APPLE CONFIDENTIAL — First Draft (1.10.11)
Searching Notes
You can search the text of notes.
Search for notes:
1 6CRVJGUVCVWUDCTVQUETQNNVQVJGUGCTEJ°GNFCVVJGVQRQHVJGPQVGNKUV
2 'PVGTVGZVKPVJGUGCTEJ°GNF
Search results appear as you type. Tap Search to dismiss the keyboard and see more of the results.
Notes are included in searches from the Home screen. See “Searching” on page 47.
Emailing Notes
Email a note: Tap the note, then tap .
To email a note, iPhone must be set up for email. See “Setting Up Email Accounts” on page 79.
154 Chapter 17 Notes
APPLE CONFIDENTIAL — First Draft (1.10.11)
Clock
18
World Clocks
You can add clocks to show the time in other major cities and time zones around the world.
View clocks: Tap World Clock.
If the clock face is white, it’s daytime in that city. If the clock face is black, it’s nighttime.
+H[QWJCXGOQTGVJCPHQWTENQEMU±KEMVQUETQNNVJTQWIJVJGO
Add a clock:
1 Tap World Clock.
2 Tap , then type the name of a city.
Cities matching what you’ve typed appear below.
3 Tap a city to add a clock for that city.
If you don’t see the city you’re looking for, try a major city in the same time zone.
Delete a clock: Tap World Clock and tap Edit. Then tap next to a clock and tap
Delete.
Rearrange clocks: Tap World Clock and tap Edit. Then drag next to a clock to a new place in the list.
Alarms
You can set multiple alarms. Set each alarm to repeat on days you specify, or to sound only once.
Set an alarm:
1 Tap Alarm and tap .
2 Adjust any of the following settings:
155
156
APPLE CONFIDENTIAL — First Draft (1.10.11)
To set the alarm to repeat on certain days, tap Repeat and choose the days.
6QEJQQUGVJGTKPIVQPGVJCVUQWPFUYJGPVJGCNCTOIQGUQÒ tap Sound.
To set whether the alarm gives you the option to hit snooze, VWTP5PQQ\GQPQTQÒ+H
Snooze is on and you tap Snooze when the alarm sounds, the alarm stops and then sounds again in ten minutes.
To give the alarm a description, tap Label. iPhone displays the label when the alarm sounds.
If at least one alarm is set and turned on, appears in the iPhone status bar at the top of the screen.
Important: Some carriers don’t support network time in all locations. If you’re
traveling, iPhone alerts may not sound at the correct local time. See “Date and Time” on page 204.
6WTPCPCNCTOQPQTQÒ 6CR#NCTOCPFVWTPCP[CNCTOQPQTQÒ+HCPCNCTOKUVWTPGF
QÒKVYQP¨VUQWPFCICKPWPNGUU[QWVWTPKVDCEMQP
+HCPCNCTOKUUGVVQUQWPFQPN[QPEGKVVWTPUQÒCWVQOCVKECNN[CHVGTKVUQWPFU;QWECP turn it on again to reenable it.
Change settings for an alarm: Tap Alarm and tap Edit, then tap next to the alarm you want to change.
Delete an alarm: Tap Alarm and tap Edit, then tap next to the alarm and tap
Delete.
Stopwatch
Use the stopwatch to time an event:
1 Tap Stopwatch.
2 Tap Start to start the stopwatch.
To record lap times, tap Lap after each lap.
To pause the stopwatch, tap Stop. Tap Start to resume.
To reset the stopwatch, tap Reset when the stopwatch is paused.
If you start the stopwatch and switch to another app, the stopwatch keeps running.
Timer
Set the timer: 6CR6KOGTVJGP±KEMVQUGVVJGPWODGTQHJQWTUCPFOKPWVGU6CR5VCTV to start the timer.
Choose the sound: Tap When Timer Ends.
Set a sleep timer: Set the timer, then tap When Timer Ends and choose Sleep iPod.
When you set a sleep timer, iPhone stops playing music or video when the timer ends.
Chapter 18 Clock
APPLE CONFIDENTIAL — First Draft (1.10.11)
If you start the timer and then switch to another iPhone app, the timer keeps running.
Chapter 18 Clock 157
158
APPLE CONFIDENTIAL — First Draft (1.10.11)
Calculator
19
Using the Calculator
Tap numbers and functions in Calculator just as you would with a standard calculator.
When you tap the add, subtract, multiply, or divide button, a white ring appears around the button to let you know the operation to be carried out. Rotate iPhone to
IGVCPGZRCPFGFUEKGPVK°EECNEWNCVQT
Standard Memory Functions
C: Tap to clear the displayed number.
MC: Tap to clear the memory.
M+: Tap to add the displayed number to the number in memory. If no number is in memory, tap to store the displayed number in memory.
M–: Tap to subtract the displayed number from the number in memory.
MR: Tap to replace the displayed number with the number in memory. If the button has a white ring around it, there is a number stored in memory.
The stored number remains in memory when you switch between the standard and
UEKGPVK°EECNEWNCVQTU
APPLE CONFIDENTIAL — First Draft (1.10.11)
5EKGPVK°E%CNEWNCVQT-G[U
4QVCVGK2JQPGVQNCPFUECRGQTKGPVCVKQPVQFKURNC[VJGUEKGPVK°EECNEWNCVQT x 3 y x
1/x x 2 x!
3 x 3 y
2nd
(
)
%
Changes the trigonometric buttons (sin, cos, tan, sinh, cosh, and tanh) to their inverse functions (sin -1 , cos -1 , tan -1 , sinh -1 , cosh -1 , and tanh -1 ). It also changes ln to log2, and e x to
2 x . Tap 2nd again to return the buttons to their original functions.
Opens a parenthetical expression. Expressions can be nested.
Closes a parenthetical expression.
Calculates percentages, adds markups, and subtracts discounts. To calculate a percentage, use it with the multiplication (x) key. For example, to calculate 8% of 500, enter
500 x 8 % = which returns 40.
To add a markup or subtract a discount, use it with the plus (+) or minus (–) key. For example, to compute the total cost of a $500 item with an 8% sales tax, enter
500 + 8 % = which returns 540.
Returns the reciprocal of a value in decimal format.
Squares a value.
Cubes a value.
6CRDGVYGGPXCNWGUVQTCKUGVJG°TUVXCNWGVQVJGRQYGTQHVJGUGEQPFXCNWG(QT example, to compute 3 4 , enter
3 y x 4 = which returns 81.
Calculates the factorial of a value.
Calculates the square root of a value.
Use between values to calculate the x root of y. For example to compute 4 3 81, enter
81 x 3 y 4 = which returns 3.
Chapter 19 Calculator 159
Rad
Deg
EE
APPLE CONFIDENTIAL — First Draft (1.10.11) tan -1 ln log2 sinh sinh -1 log sin sin -1 cos cos -1 tan cosh cosh -1 tanh tanh -1 e x
2 x
Rand
Returns the log base 10 of a value.
Calculates the sine of a value.
Calculates the arc sine of a value. (Available when the 2nd button is tapped.)
Calculates the cosine of a value.
Calculates the arc cosine of a value. (Available when the 2nd button is tapped.)
Calculates the tangent of a value.
Calculates the arc tangent of a value. (Available when the 2nd button is tapped.)
Calculates the natural log of a value.
Calculates the log base 2. (Available when the 2nd button is tapped.)
Calculates the hyperbolic sine of a value.
Calculates the inverse hyperbolic sine of a value. (Available when the 2nd button is tapped.)
Calculates the hyperbolic cosine of a value.
Calculates the inverse hyperbolic cosine of a value. (Available when the 2nd button is tapped.)
Calculates the hyperbolic tangent of a value.
Calculates the inverse hyperbolic tangent of a value. (Available when the 2nd button is tapped.)
Tap after entering a value to raise the constant “e” (2.718281828459045…) to the power of that value.
Calculates 2 to the power of the displayed value. For example, 10 2 x = 1024. (Available when the 2nd button is tapped.)
Changes the mode to express trigonometric functions in radians.
Changes the mode to express trigonometric functions in degrees.
Enters the value of (3.141592653589793…).
An operator that multiplies the currently displayed value by 10 to the power of the next value you enter.
Returns a random number between 0 and 1.
160 Chapter 19 Calculator
APPLE CONFIDENTIAL — First Draft (1.10.11)
Compass
20
Getting Compass Readings
The built-in compass (iPhone 3GS or later) shows which direction you’re facing, along with the geographical coordinates of your current location. You can choose magnetic north, or have Compass adjust the declination to show true north.
Important: 6JGCEEWTCE[QHVJGFKIKVCNEQORCUUOC[DGPGICVKXGN[CÒGEVGFD[ magnetic or other environmental interference, including interference caused by the close proximity of the magnets contained in the iPhone earbuds. The digital compass should only be used for basic navigation assistance and should not be solely relied on to determine precise locations, proximity, distance, or direction.
6JGEQORCUUPGGFUVQDGECNKDTCVGFVJG°TUVVKOG[QWWUGKVCPFOC[PGGFVQDG calibrated occasionally after that. iPhone alerts you whenever calibration is needed.
Note: +HNQECVKQPUGTXKEGUKUVWTPGFQÒYJGP[QWQRGP%QORCUU[QWOC[DGCUMGFVQ
turn it on. You can use Compass without turning on location services. See “Location
161
APPLE CONFIDENTIAL — First Draft (1.10.11)
Calibrate iPhone: 9CXGK2JQPGKPC°IWTGGKIJV;QWOC[DGCUMGFVQOQXGCYC[ from a source of interference.
See the direction you’re facing: Hold iPhone level to the ground. The compass needle rotates to point north. Your current direction appears at the top of the screen. The coordinates of your current location are displayed at the bottom of the screen.
Switch between true north and magnetic north: Tap and tap the setting you want.
Compass and Maps
6JG%QORCUUCRRNGVU[QW°PF[QWTEWTTGPVNQECVKQPKP/CRU/CRUCNUQWUGUVJGDWKNV in compass to show the direction you’re facing.
See your current location in Maps: Tap at the bottom of the Compass screen. Maps opens and indicates your current location with a blue marker.
162 Chapter 20 Compass
APPLE CONFIDENTIAL — First Draft (1.10.11)
Show the direction you’re facing: In Maps, tap twice. The icon changes to . The angle shows the accuracy of the compass reading—the smaller the angle, the greater the accuracy.
See “Finding and Viewing Locations” on page 141.
Chapter 20 Compass 163
164
APPLE CONFIDENTIAL — First Draft (1.10.11)
Voice Memos
21
Recording Voice Memos
Voice Memos lets you use iPhone as a portable recording device using the built-in microphone, iPhone or Bluetooth headset mic, or supported external microphone.
Note: External microphones must be designed to work with the iPhone headset jack or Dock Connector. These include Apple-branded earbuds and authorized third-party accessories marked with the Apple “Made for iPhone” or “Works with iPhone” logo.
You can adjust the recording level by moving the microphone closer to or further away from what you’re recording. For better recording quality, the loudest level on the level meter should be between –3dB and 0 dB.
9LJVYKI\[[VU
(\KPVSL]LSTL[LY
.V[V]VPJLTLTVZ
APPLE CONFIDENTIAL — First Draft (1.10.11)
Record a voice memo:
1 Tap to start recording. You can also press the center button on the iPhone earphones.
2 Tap to pause or to stop recording. You can also press the center button on the iPhone earphones.
Recordings using the built-in microphone are mono, but you can record stereo using an external stereo microphone.
When you start a voice recording, iPhone makes a short ringing sound. The sound isn’t
played if you’ve set the Ring/Silent switch to silent. See “Sounds and the Ring/Silent
Note: +PUQOGEQWPVTKGUQTTGIKQPUVJGUQWPFGÒGEVUHQT8QKEG/GOQUCTGRNC[GFGXGP if the Ring/Silent switch is set to silent.
To use other apps while recording your voice memo, you can lock iPhone or press the
Home button.
Play a voice memo you just recorded: Tap .
Listening to Voice Memos
7SH`OLHK
:JY\IILYIHY
Play a voice memo you’ve previously recorded:
1 Tap .
/GOQUCTGNKUVGFKPEJTQPQNQIKECNQTFGTYKVJVJGOQUVTGEGPVOGOQ°TUV
2 Tap a memo, then tap .
Tap to pause, then tap again to resume playback.
Skip to any point in a voice memo: Drag the playhead along the scrubber bar.
Listen through the built-in speaker: Tap Speaker.
Chapter 21 Voice Memos 165
APPLE CONFIDENTIAL — First Draft (1.10.11)
Managing Voice Memos
Delete a voice memo: Tap a memo in the list, then tap Delete.
See more information: Tap next to the memo. The Info screen displays information about the length, recording time and date, and provides additional editing and sharing functions.
Add a label to a voice memo: On the Info screen tap , then select a label in the list on the Label screen. To create a custom label, choose Custom at the bottom of the list, then type a name for the label.
Trimming Voice Memos
You can trim the beginning or ending of a voice memo to eliminate unwanted pauses or noise.
Trim a voice memo:
1 On the Voice Memos screen, tap next to the memo you want to trim.
2 Tap Trim Memo.
166 Chapter 21 Voice Memos
APPLE CONFIDENTIAL — First Draft (1.10.11)
3 Using the time markers as a guide, drag the edges of the audio region to adjust the beginning and end of the voice memo. To preview your edit, tap .
4 Tap Trim Voice Memo.
Important: Edits you make to voice memos can’t be undone.
Sharing Voice Memos
You can share your voice memos as attachments in email or MMS messages.
Share a voice memo:
1 Select a voice memo on the Voice Memos screen, then tap Share.
You can also tap Share on the Info screen of a voice memo.
2 Choose Email to open a new message in Mail with the memo attached, or choose
MMS to open a new message in Messages.
#OGUUCIGCRRGCTUKHVJG°NG[QW¨TGVT[KPIVQUGPFKUVQQNCTIG
Syncing Voice Memos
iTunes syncs voice memos to your iTunes library when you connect iPhone to your computer. This lets you listen to voice memos on your computer and provides a backup if you delete them from iPhone.
Voice memos are synced to the Voice Memos playlist. iTunes creates the playlist if it doesn’t exist. When you sync voice memos to iTunes, they remain in the Voice Memos app until you delete them. If you delete a voice memo on iPhone, it isn’t deleted from the Voice Memos playlist in iTunes. However, if you delete a voice memo from iTunes, it is deleted from iPhone the next time you sync with iTunes.
You can sync the iTunes Voice Memos playlist to the iPod app on iPhone using the
Music pane in iTunes.
Chapter 21 Voice Memos 167
APPLE CONFIDENTIAL — First Draft (1.10.11)
Sync the Voice Memos playlist to iPhone:
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list.
3 Select Music at the top of the screen.
4 Select the “Include voice memos” checkbox and click Apply.
168 Chapter 21 Voice Memos
APPLE CONFIDENTIAL — First Draft (1.10.11)
iTunes Store
22
About the iTunes Store
You can search for, browse, preview, purchase, and download music, ringtones, audiobooks, TV shows, movies, and music videos from the iTunes Store directly to iPhone. You can listen to audio or watch video podcasts from the iTunes Store, either by streaming them from the Internet or by downloading them directly to iPhone. And,
[QWECPHQNNQY[QWTHCXQTKVGCTVKUVUCPFHTKGPFUVQ°PFQWVYJCVOWUKEVJG[¨TGNKUVGPKPI
VQCPFVCNMKPICDQWV°PFQWVYJGP[QWTHCXQTKVGCTVKUVUCTGQPVQWTPGCT[QWCPF who’s planning to go, and more.
Note: The iTunes Store may not be available in all countries or regions, and iTunes
Store content may vary by country or region.
To purchase items or write reviews, you need an Apple ID. By default, iPhone gets your
Apple ID information from iTunes. If you don’t have an Apple ID, or if you want to make
purchases using another Apple ID, go to Settings > Store. See “Store” on page 218.
You don’t need an Apple ID to play or download podcasts.
169
APPLE CONFIDENTIAL — First Draft (1.10.11)
Finding Music, Videos, and More
Browse content: Tap one of the content categories at the bottom of the screen, such as Music or Videos. Or tap More to browse other content. Choose a sort method at the top of the screen—for example New Releases or Genres (the categories may vary).
Search for content: 6CR5GCTEJVCR/QTG°TUVKH5GCTEJKUP¨VXKUKDNGVCRVJGUGCTEJ
°GNFCPFGPVGTQPGQTOQTGYQTFUVJGPVCR5GCTEJ5GCTEJTGUWNVUCTGITQWRGFD[ category, such as Movies, Albums, or Podcasts.
170
Tap an item in a list to see more details on its Info screen. You can read reviews, write your own review, or email a link about the item to a friend. Depending on the item, you can also buy, download, or rent it.
Note: If you join a Starbucks Wi-Fi network in a select Starbucks location (available in the U.S. only), the Starbucks icon appears at the bottom of the screen. You can preview and purchase the currently playing and other songs from featured Starbucks
Collections.
Chapter 22 iTunes Store
APPLE CONFIDENTIAL — First Draft (1.10.11)
Explore artist and friend recommendations: 6CR2KPIVCR/QTG°TUVKH2KPIKUP¨V
XKUKDNGVQ°PFQWVYJCV¨UPGYHTQO[QWTHCXQTKVGCTVKUVUQTUGGYJCVOWUKE[QWTHTKGPFU
are excited about. For information, see the following section, “Following Artists and
Following Artists and Friends
Use iTunes Ping to connect with the world’s most passionate music fans. Follow favorite artists to learn about new releases and upcoming concerts and tours, get an insider’s perspective through their photos and videos, and learn about their musical
KP±WGPEGU4GCFHTKGPFU¨EQOOGPVUCDQWVVJGOWUKEVJG[¨TGNKUVGPKPIVQCPFUGGYJCV they’re buying and which concerts they plan to attend. Finally, express your musical likes and post comments for your own followers.
6QETGCVGCPFGZRNQTGOWUKECNEQPPGEVKQPU[QWPGGFVQETGCVGCRTQ°NG
%TGCVG[QWTK6WPGU2KPIRTQ°NG Open the iTunes application on your Mac or PC, click
Ping, and follow the onscreen instructions.
Explore iTunes Ping on iPhone: 1RGPVJGK6WPGUCRRVCR2KPIVCR/QTG°TUVKH2KPI isn’t visible), then:
Tap Activity to see the latest from and about the people you follow. Updates include purchases, reviews, likes, comments, and posts.
Tap People to see who you’re following and who’s following you, or to search for artists or friends.
6CR/[2TQ°NGVQTGXKGY[QWTRTQ°NGKPHQTOCVKQP
Follow an artist: 6CR(QNNQYQPVJGKTRTQ°NGRCIG
By searching: 6CR2GQRNGGPVGTVJGCTVKUV¨UPCOGKPVJGUGCTEJ°GNFCVVJGVQRQHVJG page, then tap Search. Tap the artist in the list of results, then tap Follow.
While browsing: 6CR2TQ°NGCVVJGDQVVQOQHCP[CNDWORCIGVJGPVCR(QNNQY
Chapter 22 iTunes Store 171
APPLE CONFIDENTIAL — First Draft (1.10.11)
Follow a friend: %JQQUGCUVCTVKPIITQWRQHHTKGPFUYJGP[QWUGVWR[QWTRTQ°NGWUKPI iTunes on your Mac or PC. After that, you can choose to follow others using Ping on iPhone.
By searching: 6CR2GQRNGGPVGT[QWTHTKGPF¨UPCOGKPVJGUGCTEJ°GNFVJGPVCR
Search. Tap your friend’s name in the list of matches, then tap Follow.
While exploring Ping: Tap a person’s name, then tap Follow.
172
9JGP[QWHQNNQYUQOGQPGVJG[FQP¨VCWVQOCVKECNN[HQNNQY[QW+P[QWTRTQ°NG[QWECP choose to approve or decline requests to be followed as they arrive, or simply accept all new followers without review (the default).
Share your thoughts: As you browse albums and songs, tap Post to comment on a piece of music or tap Like just to say you like it. Your friends will see your thoughts in their iTunes Ping Activity feed.
Share concert plans: 6CR%QPEGTVUQP[QWTRTQ°NGRCIGVQUGGWREQOKPIEQPEGTVUD[ the artists you follow, and see which of your friends are going to a concert. Tap Tickets to buy your own ticket, or tap I’m Going to let others know you’ll be there too. (Not available in all countries or regions.)
Purchasing Ringtones
You can preview and purchase ringtones from the iTunes Store and download them to iPhone.
Note: Ringtones may not be available in all countries or regions.
Browse for ringtones: 6CR4KPIVQPGUVCR/QTG°TUVKH4KPIVQPGUKUP¨VXKUKDNGQTWUG
5GCTEJVQ°PFCURGEK°EUQPIKPVJGK6WPGU5VQTG
Preview a ringtone: Tap the item to preview. Double-tap the item for more information.
Chapter 22 iTunes Store
APPLE CONFIDENTIAL — First Draft (1.10.11)
Purchase and download a ringtone:
1 Tap the price, then tap Buy Now.
2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
When you purchase a ringtone, you can set it as your default ringtone, or assign it to a contact.
If you don’t have an Apple ID, tap Create New Apple ID to set one up.
Your purchase is charged to your Apple ID. For additional purchases made within the
PGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
You can change your default ringtone or assign individual ringtones to contacts in
Settings > Sounds. See “Sounds and the Ring/Silent Switch” on page 196.
Ringtones you purchase on iPhone are synced to your iTunes library when you connect iPhone to your computer. You can sync purchased ringtones to more than one iPhone, if they’re all synced using the Apple ID that you used to purchase the ringtones. You can’t edit ringtones you purchase from the iTunes Store.
You can create custom ringtones in Garage Band. For information, see Garage Band
Help.
Purchasing Music or Audiobooks
9JGP[QW°PFCUQPICNDWOQTCWFKQDQQM[QWNKMGKPVJGK6WPGU5VQTG[QWECP purchase and download it to iPhone. You can preview an item before you purchase it to make sure it’s what you want.
Preview a song or audiobook: Tap the item.
Purchase and download a song, album, or audiobook:
1 Tap the price, then tap Buy Now.
2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
If you don’t have an Apple ID, tap Create New Apple ID to set one up.
Your purchase is charged to your Apple ID. For additional purchases made within the
PGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
An alert appears if you’ve previously purchased one or more songs from an album.
Tap Buy if you want to purchase the entire album including the songs you’ve already purchased, or tap Cancel if you want to purchase any remaining songs individually.
Some albums include bonus content, which is downloaded to your iTunes library on your computer. Not all bonus content is downloaded directly to iPhone.
Once you purchase an item, it begins downloading and appears on the Downloads
screen. See “Checking Download Status” on page 175.
Chapter 22 iTunes Store 173
174
APPLE CONFIDENTIAL — First Draft (1.10.11)
Purchased songs are added to a Purchased playlist on iPhone. If you delete the
Purchased playlist, iTunes creates a new one when you buy an item from the iTunes
Store.
;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When you’re signed in, your remaining store credit appears with your
Apple ID information at the bottom of most iTunes Store screens.
Enter a redemption code: 6CR/WUKEVCR/QTG°TUVKH/WUKEKUP¨VXKUKDNGVJGPVCR
Redeem at the bottom of the screen and follow the onscreen instructions.
Purchasing or Renting Videos
The iTunes Store lets you purchase and download movies, TV shows, and music videos
(may not be available in all countries or regions). Some movies and TV shows can also
DGTGPVGFHQTCNKOKVGFVKOG8KFGQEQPVGPVOC[DGCXCKNCDNGKPUVCPFCTFFG°PKVKQP5&
QTRHQTOCVJKIJFG°PKVKQP*&QTRHQTOCVQTDQVJ
Preview a video: Tap Preview.
Purchase or rent a video:
1 Tap Buy or Rent.
2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
If you don’t have an Apple ID, tap Create New Apple ID to set one up. Your purchase
KUEJCTIGFVQ[QWT#RRNG+&(QTCFFKVKQPCNRWTEJCUGUOCFGYKVJKPVJGPGZV°HVGGP minutes, you don’t have to enter your password again.
Once you purchase an item, it begins downloading and appears on the Downloads
screen. See “Checking Download Status” on page 175.
Rented movies and TV shows don’t begin playing until the download completes. See
“Watching Rented Movies and TV Shows” on page 106.
When the download is complete, purchased videos are added to the Purchased playlist on iPhone. Purchased content is synced to the Purchased playlist for your iPhone in
iTunes the next time you connect iPhone to your computer. See “Syncing Purchased
Note: If you purchase HD video on iPhone 3G or iPhone 3GS, the video is downloaded to iPhone in SD format.
To view or sync videos in the Purchased playlist in iTunes on your computer, you must be signed in using your Apple ID.
Sync purchased videos in iTunes: Connect iPhone to your computer. In iTunes, select iPhone in the Devices list, click the appropriate button (Movies, TV Shows, or Music for music videos), select the items you want to sync, then click Sync.
Chapter 22 iTunes Store
APPLE CONFIDENTIAL — First Draft (1.10.11)
If you purchase a video in HD format, you can choose to sync it in either SD or HD format. You may want to sync an HD video in SD format for a quicker download, or to save room on iPhone.
Select SD or HD format: In iTunes, Control-click or right-click a video marked “HD-SD”
CPFEJQQUG5VCPFCTF&G°PKVKQPQT*KIJ&G°PKVKQPHTQOVJG8GTUKQPOGPW
;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When you’re signed in, your remaining store credit appears with your
Apple ID information at the bottom of most iTunes Store screens.
Enter a redemption code: 6CR/WUKEVCR/QTG°TUVKH/WUKEKUP¨VXKUKDNGVJGPVCR
Redeem at the bottom of the screen and follow the onscreen instructions.
Streaming or Downloading Podcasts
You can listen to audio podcasts or watch video podcasts streamed over the Internet from the iTunes Store. You can also download audio and video podcasts to iPhone.
Podcasts you download to iPhone are synced to your iTunes library when you connect iPhone to your computer.
6CR2QFECUVUVCR/QTG°TUVKH2QFECUVUKUP¨VXKUKDNGVQDTQYUGRQFECUVUKPVJGK6WPGU
Store. To see a list of episodes, tap a podcast. Video podcasts are indicated by the video icon.
Stream a podcast: Tap the podcast title.
Download a podcast: Tap the Free button, then tap Download. Downloaded podcasts appear in the Podcasts list in iPod.
Listen to or watch a podcast you’ve downloaded: In iPod, tap Podcasts (tap More
°TUVKH2QFECUVUKUP¨VXKUKDNGVJGPVCRVJGRQFECUV8KFGQRQFECUVUCNUQCRRGCTKP[QWT list of videos.
Get more episodes of the podcast you’ve downloaded: In the Podcasts list in iPod, tap the podcast, then tap Get More Episodes.
Delete a podcast: In the Podcasts list in iPod, swipe left or right over the podcast, then tap Delete.
Checking Download Status
You can check the Downloads screen to see the status of in-progress and scheduled downloads, including purchases you’ve pre-ordered.
See the status of items being downloaded: 6CR&QYPNQCFUVCR/QTG°TUVKH
Downloads isn’t visible).
To pause a download, tap .
Chapter 22 iTunes Store 175
APPLE CONFIDENTIAL — First Draft (1.10.11)
If a download is interrupted, iPhone starts the download again the next time it has an
Internet connection. Or, if you open iTunes on your computer, iTunes completes the download to your iTunes library (if your computer is connected to the Internet and signed in using the same Apple ID).
See the status of pre-ordered items: 6CR&QYPNQCFUVCR/QTG°TUVKH&QYPNQCFUKUP¨V visible).
Pre-ordered items appear in a list until the item is released. Tap the item for release date information. Once the item is available for download, appears next to the download.
Download a pre-ordered item: Tap the item, then tap .
Pre-ordered items don’t download automatically when they’re released. Return to the
Downloads screen to begin the download.
Syncing Purchased Content
iTunes automatically syncs everything you’ve downloaded or purchased on iPhone to your iTunes library when you connect iPhone to your computer. This lets you access the downloads on your computer and provides a backup if you delete purchased content from iPhone.
Purchased content is synced to the “Purchased on <name of your iPhone>” playlist. iTunes creates the playlist if it doesn’t exist. iTunes also copies your purchases to the
Purchased playlist that iTunes uses for purchases you make on your computer, if that playlist exists and is set to sync with iPhone.
Downloaded podcasts are synced to the Podcast list in your iTunes library.
Changing the Browse Buttons
You can replace the Music, Podcasts, Videos, and Search buttons at the bottom of the screen with ones you use more frequently. For example, if you download audiobooks often but don’t watch many videos, you could replace the Videos button with
Audiobooks.
176 Chapter 22 iTunes Store
APPLE CONFIDENTIAL — First Draft (1.10.11)
Change the browse buttons: Tap More, tap Edit, then drag a button to the bottom of the screen, over the button you want to replace.
You can drag the buttons at the bottom of the screen left or right to rearrange them.
9JGP[QW°PKUJVCR&QPG
When you’re browsing, tap More to access the browse buttons that aren’t visible.
Viewing Account Information
To view iTunes Store information for your Apple ID on iPhone, tap your Apple ID (at the bottom of most iTunes Store screens). Or go to Settings > Store and tap View Apple ID.
You must be signed in to view your account information. See “Store” on page 218.
Verifying Downloads
You can use iTunes on your computer to verify that all the music, videos, apps, and other items you bought from the iTunes Store or App Store are in your iTunes library.
You might want to do this if a download was interrupted.
Verify your purchases:
1 Make sure your computer is connected to the Internet.
2 In iTunes, choose Store > Check for Available Downloads.
3 Enter your Apple ID and password, then click Check.
Purchases not yet on your computer are downloaded.
The Purchased playlist displays your purchases. However, because you can add or remove items in this list, it might not be accurate. To see all of your purchases, sign in using your Apple ID, choose Store > View My Account, and click Purchase History.
Chapter 22 iTunes Store 177
178
APPLE CONFIDENTIAL — First Draft (1.10.11)
App Store
23
About the App Store
You can search for, browse, review, purchase, and download apps from the App
Store directly to iPhone. Apps that you download and install from the App Store on iPhone are backed up to your iTunes library the next time you sync iPhone with your computer. When you sync iPhone, you can also install apps you’ve purchased or downloaded from the iTunes Store on your computer.
Note: The App Store may not be available in all countries or regions, and App Store content may vary by country or region.
be available in all countries or regions). By default, iPhone gets your Apple ID settings from iTunes. If you don’t have an Apple ID, or if you want to make purchases using
another Apple ID, go to Settings > Store. See “Store” on page 218.
Browsing and Searching
Browse the featured selections to see new, notable, or recommended apps, or browse
6QRVQUGGVJGOQUVRQRWNCTCRRU+H[QW¨TGNQQMKPIHQTCURGEK°ECRRWUG5GCTEJ
APPLE CONFIDENTIAL — First Draft (1.10.11)
Browse apps: Tap Featured, Categories, or Top 25. Choose a category, or choose a sort method at the top of the screen to browse by lists such as New, What’s Hot, Genius,
Top Paid, or Top Free.
Browse using Genius: Tap Genius to see a list of recommended apps based on what’s already in your app collection. To turn Genius on, follow the onscreen instructions.
Genius is a free service, but it requires an Apple ID.
Search for apps: 6CR5GCTEJVCRVJGUGCTEJ°GNFCPFGPVGTQPGQTOQTGYQTFUVJGP tap Search.
Chapter 23 App Store 179
APPLE CONFIDENTIAL — First Draft (1.10.11)
Info Screen
Tap any app in a list to see more information, such as the app’s price, screenshots, and ratings.
If you already installed the app, “Installed” appears instead of the price on the Info screen.
180
View screenshots: Scroll to near the bottom of the Info page. Flick left or right to view additional screenshot pages. Double-tap to zoom in.
Get ratings and read reviews: Tap Ratings near the bottom of the Info screen.
Email a link to the app’s Info page in iTunes: Tap “Tell a Friend” near the bottom of the Info screen.
Report a problem: Tap “Report a Problem” near the bottom of the Info screen. Select a problem from the list or type optional comments, then tap Report.
Send the app to someone as a gift: Tap “Gift This App” near the bottom of the Info screen, then follow the onscreen instructions.
Chapter 23 App Store
APPLE CONFIDENTIAL — First Draft (1.10.11)
Downloading Apps
9JGP[QW°PFCPCRR[QWYCPVKPVJG#RR5VQTG[QWECPRWTEJCUGCPFFQYPNQCFKV to iPhone. If the app is free, you can download it without charge.
Once you download an app, it’s immediately installed on iPhone.
Purchase and download an app:
1 Tap the price (or tap Free), then tap Buy Now.
2 5KIPKPWUKPI[QWT#RRNG+&KHTGSWGUVGFVJGPVCR1-
If you don’t have an Apple ID, tap Create New Apple ID to set one up.
Downloads for purchase are charged to your Apple ID. For additional downloads made
YKVJKPVJGPGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
Some apps allow you to make purchases within the app. You can restrict in-app
purchases in Settings. See “Restrictions” on page 202.
5QOGCRRUWUGRWUJPQVK°ECVKQPUVQCNGTV[QWQHPGYKPHQTOCVKQPGXGPYJGPVJG
CRRKUP¨VTWPPKPI0QVK°ECVKQPUXCT[FGRGPFKPIQPVJGCRRDWVOC[KPENWFGVGZV or sound alerts, and a numbered badge on the app icon on the Home screen. See
“
;QWECPTGFGGOK6WPGU5VQTGIKHVECTFUIKHVEGTVK°ECVGUQTQVJGTRTQOQVKQPCNEQFGUVQ make purchases. When you’re signed in, your remaining store credit appears with your
Apple ID information at the bottom of most App Store screens.
Enter a redemption code: Tap Redeem near the bottom of the Featured screen, then follow the onscreen instructions.
See the status of downloading apps: After you begin downloading an app, its icon appears on the Home screen and shows a progress indicator.
If a download is interrupted, iPhone starts the download again the next time it has an
Internet connection. Or, if you open iTunes on your computer, iTunes completes the download to your iTunes library (if your computer is connected to the Internet and signed in using the same Apple ID).
Deleting Apps
You can delete apps you install from the App Store. If you delete an app, data associated with the app is no longer available to iPhone, unless you reinstall the app and restore its data from a backup.
Chapter 23 App Store 181
182
APPLE CONFIDENTIAL — First Draft (1.10.11)
You can reinstall an app and restore its data as long as you backed up iPhone with iTunes on your computer. (If you try to delete an app that hasn’t been backed up to your computer, an alert appears.) To retrieve the app data, you must restore iPhone
from a backup containing the data. See “Restoring from a Backup” on page 257.
Delete an App Store app:
1 Touch and hold any app icon on the Home screen, until the icons start to jiggle.
2 Tap in the corner of the app you want to delete.
3 Tap Delete, then press the Home button.
If you don’t see on the app icon, either the app wasn’t purchased from the App
Store or deleting apps has been restricted. See “Restrictions” on page 202.
When you delete an app, its data is no longer accessible through the iPhone user interface, but it isn’t erased from iPhone. For information about erasing all content and
settings, see “Erase All Content and Settings” on page 207.
You can redownload any app that you’ve purchased from the App Store, free of charge.
Replace a deleted app:
On iPhone:
In iTunes:
Purchase the app again (you won’t be charged).
Connect iPhone to your computer, select iPhone in the Devices list, click
Apps and select the checkbox next to the app, then click Apply.
Writing Reviews
You can write and submit your own app reviews directly on iPhone.
Write a review:
1 Tap Ratings near the bottom of the Info screen.
2 On the Reviews screen, tap “Write a Review.”
3 Select the number of stars (1–5) for your rating of the app, and enter your nickname, a title for the review, and optional review comments. If you’ve written reviews before,
VJGPKEMPCOG°GNFKUCNTGCF[°NNGFKP1VJGTYKUG[QW¨TGCUMGFVQETGCVGCTGXKGYGT nickname.
4 Tap Send.
You must be signed in to your Apple account and have downloaded the item in order to submit reviews.
Chapter 23 App Store
APPLE CONFIDENTIAL — First Draft (1.10.11)
Updating Apps
Whenever you access the App Store, it checks for updates to apps you’ve installed. The
App Store also automatically checks for updates every week. The App Store icon shows the total number of app updates available.
If an update is available and you access the App Store, the Updates screen appears immediately. App updates are downloaded and automatically installed when you choose to update them.
App upgrades are new releases that can be purchased or downloaded through the
App Store on iPhone or the iTunes Store on your computer.
Update an app:
1 At the bottom of the screen, tap Updates.
2 Tap an app to see more information about the update.
3 Tap Update.
Update all apps: At the bottom of the screen, tap Updates, then tap Update All.
+H[QWVT[VQWRFCVGCPCRRRWTEJCUGFHTQOCFKÒGTGPV#RRNGCEEQWPV[QW¨TGCUMGFHQT that account ID and password in order to download the update.
Syncing Purchased Apps
When you connect iPhone to your computer, iTunes syncs apps you download or purchase on iPhone to your iTunes library. This lets you access the downloads on your computer and provides a backup if you delete apps from iPhone.
Downloaded apps are backed up the next time you sync with iTunes. Afterwards, only app data is backed up when you sync with iTunes.
Apps are synced to the Apps list in your iTunes library. iTunes creates the list if it doesn’t exist.
Chapter 23 App Store 183
APPLE CONFIDENTIAL — First Draft (1.10.11)
Game Center
24
184
About Game Center
You can discover new games and share your game experiences with friends around the world in Game Center (iPhone 3GS or later). Invite your friends to play, or use
CWVQOCVEJVQ°PFQVJGTYQTVJ[QRRQPGPVU%JGEMNGCFGTDQCTFUVQUGGYJQVJGDGUV
RNC[GTUCTG'CTPDQPWURQKPVUD[CEJKGXKPIURGEK°ECEEQORNKUJOGPVUKPCICOG
Note: Game Center may not be available in all countries or regions, and the available games may vary by country or region.
To use Game Center, you need an Internet connection and an Apple ID. If you already have an iTunes Store, MobileMe, or other Apple account, you can use that Apple ID with Game Center. If you don’t already have an Apple account, you can create a new one in Game Center, as described below.
Setting Up Game Center
9JGP[QW°TUVQRGP)COG%GPVGT[QW¨TGCUMGFKH[QWYCPVVQCNNQYRWUJPQVK°ECVKQPU
;QWOC[°TUVDGCUMGFKH[QWYCPVVQVWTPQP0QVK°ECVKQPU0QVK°ECVKQPUOC[KPENWFG alerts, sounds, and icon badges that let you know about Game Center events even when you’re not using Game Center. For example, you might receive an alert that a friend has invited you to play a game.
#NNQYPQVK°ECVKQPU 6CR1-
+H[QWVCR&QP¨V#NNQY[QWYQP¨VTGEGKXGPQVK°ECVKQPUHQT)COG%GPVGT;QWECP
VWTPPQVK°ECVKQPUQPCVCNCVGTVKOGKH[QWYCPVCPF[QWECPURGEKH[YJCVMKPFUQH
PQVK°ECVKQPU[QWYCPVVQIGV
6WTPPQVK°ECVKQPUQPQTQÒ +P5GVVKPIUEJQQUG0QVK°ECVKQPU6WTPKPIQÒ0QVK°ECVKQPU
FKUCDNGUCNNPQVK°ECVKQPUHQTCNNCRRU
APPLE CONFIDENTIAL — First Draft (1.10.11)
5RGEKH[YJKEJPQVK°ECVKQPU[QWYCPVHQT)COG%GPVGT In Settings, choose
0QVK°ECVKQPU )COG%GPVGTVJGPEQP°IWTGVJG5QWPFU#NGTVUCPF$CFIGUUGVVKPIU+H
)COG%GPVGTFQGUP¨VCRRGCTVWTPQP0QVK°ECVKQPU
Set up Game Center information for your Apple ID:
1 Enter your Apple ID and password, then tap Sign In.
You may be asked to provide additional information. If you don’t have an Apple ID, you can create one by tapping Create New Account.
2 Tap Agree to accept the Game Center Terms & Conditions.
3 Enter a nickname—the name others will see and know you by.
4 %QP°IWTG[QWT)COG%GPVGTUGVVKPIU
To allow other users to invite you to play a game, leave Allow Game Invites turned
QP1VJGTYKUGVCRVQVWTPKVQÒ
6QCNNQYQVJGTWUGTUVQ°PF[QWD[[QWTGOCKNCFFTGUUNGCXG(KPF/G$['OCKN
VWTPGFQP1VJGTYKUGVCRVQVWTPKVQÒ
8GTKH[[QWTCEEQWPVGOCKN;QWECPGPVGTCFKÒGTGPVCFFTGUUKH[QWFQP¨VYCPVVQ
WUGVJGQPGHTQOVJG#RRNGCEEQWPV[QWWUGFVQUKIPKP6QEQP°TOVJKUCFFTGUUCU yours, you’ll need to respond to the email that is sent to that address.
To add more email addresses that people can use to contact you in Game Center, tap Add Another Email.
5 6CR0GZVYJGP[QWTCEEQWPVKUEQP°IWTGF
Change Game Center settings for your Apple ID:
1 Tap Me at the bottom of the screen, then tap your account banner.
2 Tap View Account.
3 Make your changes, then tap Done.
5KIPKPWUKPICFKÒGTGPV#RRNG+&
1 Tap Me, then tap the account banner at the bottom of the screen.
2 Tap Sign Out.
3 Enter the new Apple ID and password, then tap Sign In.
Games
Purchasing and Downloading Games
Games for Game Center are available from the App Store. If you haven’t entered credit card information for your Apple ID, you’re prompted to enter that information before you can purchase and download games.
Purchase and download games: Tap Games, then tap Find Game Center Games.
Chapter 24 Game Center 185
APPLE CONFIDENTIAL — First Draft (1.10.11)
The Game Center section of App Store displays games that work with Game Center.
You can browse this section, and purchase and download games from it, as you would
for other apps in the App Store. See Chapter 23, “App Store,” on page 178.
If you want to purchase a game that a friend has, tap the game on your friend’s info screen to go directly to that game in the App Store.
Playing Games
The Games screen displays the games you download from the iTunes Store. For each of the games, your number of achievements and your ranking among all the game’s players are displayed.
Get information about a game: Tap Games, then tap a game. If available, you can
FKURNC[VJGICOG¨UNGCFGTDQCTFUUGG[QWTCEJKGXGOGPVUHQTVJGICOGCPF°PFQWV who’s recently played the game.
186
Play a game: Tap Games, choose a game, then tap Play.
Depending on the game, the home screen may provide instructions or other information, and let you view leaderboards and achievements, set game options, and start a single or multiplayer game. To play against others, you can either invite a friend
QTWUGCWVQOCVEJVQJCXG)COG%GPVGT°PFQVJGTRNC[GTUHQT[QW(QTKPHQTOCVKQP
about making friends in Game Center, see “Friends” on page 189.
For multiplayer games, you can also send a game invitation from the Friends screen.
Invite a friend to a multiplayer game from the Friends screen:
1 Tap Friends at the bottom of the screen.
2 Choose a friend.
3 Choose a game and tap Play.
If the game allows or requires additional players, you can choose players to invite, then tap Next.
Chapter 24 Game Center
APPLE CONFIDENTIAL — First Draft (1.10.11)
4 Enter and send your invitation, then wait for the others to accept.
5 Start the game.
If a friend isn’t available or doesn’t respond to your invitation, you can tap Auto-Match
VQJCXG)COG%GPVGT°PFCPQVJGTRNC[GTHQT[QWQTVCR+PXKVG(TKGPFVQVT[KPXKVKPI some other friend.
Other players may invite you to play the game.
Respond to an invitation to play a game: Tap Accept or Decline in the alert that appears.
You can disable multiplayer games in Restrictions. See “Restrictions” on page 202.
;QWECPRTGXGPVQVJGTRNC[GTUHTQOKPXKVKPI[QWVQRNC[ICOGUD[VWTPKPIQÒ#NNQY
Game Invites in Game Center settings. See “Your Status and Account Information” on page 191.
Return to Game Center: Press the Home button, then tap Game Center on the Home screen.
On iPhone 3GS or later, you can also press the Home button twice quickly and choose
Game Center from your recent apps.
Leaderboards
Some games provide one or more leaderboards to show the ranking of the game’s players, with their scores, times, or other measures of the players’ success.
See a game’s leaderboard: Tap Games, then choose the game and tap Leaderboard.
You may also be able to view leaderboards from within a game.
If a game has variations (such as Easy, Normal, and Hard), the Categories screen lets you choose the leaderboard for the game in general, or for one of the variations.
Chapter 24 Game Center 187
APPLE CONFIDENTIAL — First Draft (1.10.11)
The leaderboard shows the ranking of your friends, and of all players. You may be able
VQXKGYNGCFGTDQCTFUVCVUHQTCURGEK°EVKOGRGTKQFUWEJCUVQFC[VJKUYGGMQTCNNVKOG
Rotate iPhone to see a leaderboard in landscape orientation.
Start playing a game from the leaderboard: Tap Play in the upper-right corner.
Achievements
5QOGICOGUTGYCTF[QWYKVJDQPWURQKPVUHQTURGEK°ECEJKGXGOGPVU
See the possible achievements for a game: Tap Games, choose a game, then tap
Achievements.
For each achievement, Game Center shows how many bonus points are awarded, and whether you’ve completed the achievement. The total points awarded for your
CEJKGXGOGPVUCRRGCTCVVJGVQR;QWECPIGVDQPWURQKPVUHQTCURGEK°ECEJKGXGOGPV only once.
You may also be able to view achievements from within a game.
Recently Played
Some games let you see which of your friends have recently played the game.
188 Chapter 24 Game Center
APPLE CONFIDENTIAL — First Draft (1.10.11)
See who’s recently played a game: Tap Games, tap a game, then tap Recently Played.
Get information about a player: Tap a player’s name in the list.
Friends
Game Center puts you in contact with players around the world. You add friends to
Game Center by making a request, or by accepting a request from another player.
Add a friend to Game Center:
1 Tap Friends or Requests.
2 Tap +, then enter a friend’s email address or Game Center nickname.
Matching addresses and names from your contacts appear as you type. Tap a contact to include that person in your request. Tap to browse your contacts.
To add several friends at once, enter additional contacts.
3 Enter a message for your request, then tap Send.
In order to become a friend, a person must accept your request.
Other players might send you a request. If you receive an alert, you can accept the request from there, or close it and respond to the request later from the Request screen. A badge on the Requests button indicates the number of outstanding friend requests.
Respond to a friend request: Tap Requests, tap the name of the person making the request, then tap Accept, Ignore, or Report a Problem.
Chapter 24 Game Center 189
APPLE CONFIDENTIAL — First Draft (1.10.11)
When a player accepts another player’s request, they each become the other’s friend.
Friends’ names appear on the Friends screen.
Get information about a friend: Tap the friend’s name.
Search for a friend: Tap the status bar to scroll to the top of the screen, then tap the
UGCTEJ°GNFCPFUVCTVV[RKPI(TKGPFUYJQOCVEJ[QWTUGCTEJCRRGCTCU[QWV[RG
A friend’s info page shows how many friends (including you) the person has, the
PWODGTQHFKÒGTGPVICOGU[QWTHTKGPFJCURNC[GFCPFJQYOCP[CEJKGXGOGPVU[QWT friend has completed. The info screen may also show:
The games you’ve played together
The games you have in common
Other games your friend has
190
You can tap a game in any of the lists to see your position and your friend’s position on the overall leaderboard, and your respective accomplishments for the game.
Chapter 24 Game Center
APPLE CONFIDENTIAL — First Draft (1.10.11)
Invite a friend to play a game: Tap Friends, tap the friend’s name, tap a game, then
tap Play. See “Playing Games” on page 186.
Remove a friend: Tap Friends, tap a name, then tap Unfriend and tap Remove.
+HCRNC[GTKUQÒGPUKXGQTGZJKDKVUKPCRRTQRTKCVGDGJCXKQT[QWECPTGRQTVVJGRTQDNGO
Report a problem with a friend: Tap Friends, tap the friend’s name, then tap “Report a
Problem.” Describe the problem, then tap Report to send the report.
+H[QWVWTPQÒ/WNVKRNC[GT)COGUKP5GVVKPIU[QWECP¨VUGPFQTTGEGKXGKPXKVCVKQPUVQ
play games. See “Restrictions” on page 202.
Your Status and Account Information
The Me screen summarizes information about your friends, your games, and your achievements.
6JGVGZV°GNFKPVJGEGPVGTQHVJGUETGGPNGVU[QWGPVGT[QWTEWTTGPVUVCVWUOGUUCIG
Your status appears along with your nickname in other players’ Friends screens.
Change your status: 6CRVJGUVCVWU°GNFCPFWUGVJGMG[DQCTFVQGPVGTQTWRFCVG[QWT status.
View your account information: Tap the account banner, then tap View Account.
You can change or update the following settings:
Nickname
Allow game invites
Find Me By Email
Your mail address for Game Center
Additional email addresses
9JGP[QW°PKUJVCR&QPG
Chapter 24 Game Center 191
APPLE CONFIDENTIAL — First Draft (1.10.11)
;QWECPCNUQUKIPQWVCPFUKIPKPVQCFKÒGTGPVCEEQWPVQTETGCVGCPGYCEEQWPV
Sign out: Tap the account banner, then tap Sign Out.
To sign in to another account, enter your username and password, then tap Sign In. To create a new account, tap Create New Account and follow the onscreen instructions.
192 Chapter 24 Game Center
APPLE CONFIDENTIAL — First Draft (1.10.11)
Settings
25
5GVVKPIUCNNQYU[QWVQEWUVQOK\GK2JQPGCRRUUGVVJGFCVGCPFVKOGEQP°IWTG[QWT network connection, and enter other preferences for iPhone.
Airplane Mode
Airplane mode disables the wireless features of iPhone to reduce potential interference with aircraft operation and other electrical equipment.
Turn on airplane mode: Tap Settings and turn airplane mode on.
When airplane mode is on, appears in the status bar at the top of the screen. No phone, radio, Wi-Fi, or Bluetooth signals are emitted from iPhone and GPS reception is
VWTPGFQÒFKUCDNKPIOCP[QHK2JQPG¨UHGCVWTGU;QWYQP¨VDGCDNGVQ
Make or receive phone calls
Make or receive FaceTime video calls
Get visual voicemail
Send or receive email
Browse the Internet
Sync your contacts, calendars, or bookmarks (MobileMe only) with MobileMe or
Microsoft Exchange
Send or receive text or MMS messages
Stream YouTube videos
Get stock quotes
Get map locations
Get weather reports
Use the iTunes Store or the App Store
Use Game Center
193
194
APPLE CONFIDENTIAL — First Draft (1.10.11)
If allowed by the aircraft operator and applicable laws and regulations, you can continue to use iPhone to:
Listen to music and watch videos
Listen to visual voicemail previously received
Check your calendar
Take or view photos or video (iPhone 4 or later)
Hear alarms
Use the stopwatch or timer
Use the calculator
Take notes
Record voice memos
Use Compass
Read text messages and email messages stored on iPhone
If Wi-Fi is available and allowed by the aircraft operator and applicable laws and regulations, you can turn Wi-Fi back on and:
Make or receive FaceTime video calls
Send and receive email
Browse the Internet
Sync your contacts, calendars, and bookmarks (MobileMe only) with MobileMe and
Microsoft Exchange
Stream YouTube videos
Get stock quotes
Get map locations
Get weather reports
Use the iTunes Store or the App Store
Use Game Center
You may also be allowed to turn on Bluetooth and use Bluetooth devices with iPhone.
Wi-Fi
Wi-Fi settings determine whether iPhone uses local Wi-Fi networks to connect to the
+PVGTPGV+HPQ9K(KPGVYQTMUCTGCXCKNCDNGQT[QW¨XGVWTPGF9K(KQÒVJGPK2JQPG connects to the Internet via your cellular data network, when available.
6WTP9K(KQPQTQÒ %JQQUG9K(KCPFVWTP9K(KQPQTQÒ
Join a Wi-Fi network: Choose Wi-Fi, wait a moment as iPhone detects networks in range, then select a network. If necessary, enter a password and tap Join (networks that require a password appear with a lock icon).
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Once you join a Wi-Fi network manually, iPhone automatically joins it whenever the network is in range. If more than one previously used network is in range, iPhone joins the one last used.
When iPhone is joined to a Wi-Fi network, the Wi-Fi icon in the status bar at the top of the screen shows signal strength. The more bars you see, the stronger the signal.
Set iPhone to ask if you want to join a new network: Choose Wi-Fi and turn “Ask to
,QKP0GVYQTMU¦QPQTQÒ
When you’re trying to access the Internet, by using Safari or Mail for example, and you aren’t in range of a Wi-Fi network you‘ve previously used, this option tells iPhone to look for another network. iPhone displays a list of all available Wi-Fi networks that you can choose from. (Networks that require a password appear with a lock icon.) If “Ask
VQ,QKP0GVYQTMU¦KUVWTPGFQÒ[QWOWUVOCPWCNN[LQKPCPGVYQTMVQEQPPGEVVQVJG
Internet when a previously used network or a cellular data network isn’t available.
Forget a network, so iPhone doesn’t join it: Choose Wi-Fi and tap next to a network you’ve joined before. Then tap “Forget this Network.”
Join a closed Wi-Fi network: To join a Wi-Fi network that isn’t shown in the list of scanned networks, choose Wi-Fi > Other, then enter the network name. If the network requires a password, tap Security, tap the type of security the network uses, and enter the password.
You must already know the network name, password, and security type to connect to a closed network.
Some Wi-Fi networks may require you to enter or adjust additional settings, such as a client ID or static IP address. Ask the network administrator which settings to use.
Adjust settings for connecting to a Wi-Fi network: Choose Wi-Fi, then tap next to a network.
VPN
6JKUUGVVKPICRRGCTUYJGP[QWJCXG820EQP°IWTGFQPK2JQPGCNNQYKPI[QWVQVWTP
820QPQTQÒ5GG¥
Personal Hotspot
On a CDMA model, Personal Hotspot settings are available at the top level of Settings,
and at General > Network settings. See “Network” on page 198.
0QVK°ECVKQPU
This setting appears when you open an application (such as Game Center) that uses
VJG#RRNG2WUJ0QVK°ECVKQPUGTXKEG
Chapter 25 Settings 195
196
APPLE CONFIDENTIAL — First Draft (1.10.11)
2WUJPQVK°ECVKQPUCNGTV[QWVQPGYKPHQTOCVKQPGXGPYJGPVJGCRRKUP¨VTWPPKPI
0QVK°ECVKQPUXCT[D[CRRDWVOC[KPENWFGVGZVQTUQWPFCNGTVUCPFCPWODGTGFDCFIG on the app icon on the Home screen.
;QWECPVWTPPQVK°ECVKQPUQÒKH[QWFQP¨VYCPVVQDGPQVK°GFQTKH[QWYCPVVQ conserve battery life.
6WTPCNNPQVK°ECVKQPUQPQTQÒ 6CR0QVK°ECVKQPUVJGPVWTPPQVK°ECVKQPUQPQTQÒ
6WTPUQWPFUCNGTVUQTDCFIGUQPQTQÒHQTCPCRR 6CR0QVK°ECVKQPUEJQQUGCPCRR
HTQOVJGNKUVVJGPEJQQUGVJGV[RGUQHPQVK°ECVKQP[QWYCPVVQVWTPQPQTQÒ
Carrier
This setting appears when you’re outside of your carrier’s network and other local carrier data networks are available to use for your phone calls, visual voicemail, and cellular network Internet connections. You can make calls only on carriers that have roaming agreements with your carrier. Additional fees may apply. Roaming charges may be billed to you by the carrier of the selected network, through your carrier.
For information about out-of-network coverage and how to enable roaming, contact your carrier or go to your carrier’s website.
Select a carrier: Choose Carrier and select the network you want to use.
Once you select a network, iPhone uses only that network. If the network is unavailable, “No service” appears on the iPhone screen and you can’t make or receive calls or visual voicemail, or connect to the Internet via cellular data network. Set
Network Settings to Automatic to have iPhone select a network for you.
Sounds and the Ring/Silent Switch
Switch between ring and silent mode: Flip the Ring/Silent switch on the side of iPhone.
9JGPUGVVQUKNGPVK2JQPGFQGUP¨VRNC[CP[TKPICNGTVQTGÒGEVUUQWPFU+VFQGU however, play alarms set using Clock.
Note: +PUQOGEQWPVTKGUQTTGIKQPUVJGUQWPFGÒGEVUHQT%COGTCCPF8QKEG/GOQUCTG played even if the Ring/Silent switch is set to silent.
Set whether iPhone vibrates when you get a call: Choose Sounds. To set whether iPhone vibrates in silent mode, turn Vibrate under Silent QPQTQÒ6QUGVYJGVJGT iPhone vibrates in ring mode, turn Vibrate under Ring QPQTQÒ
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Adjust the ringer and alerts volume: Choose Sounds and drag the slider. Or, if
“Change with Buttons” is turned on, use the volume buttons on the side of iPhone. The volume buttons don’t change the ringer and alerts volume if a song or video is playing or if you’re on a call.
Allow the volume buttons to change the ringer or alerts volume: Choose Sounds and turn on “Change with Buttons.”
Set the ringtone: Choose Sounds > Ringtone.
5GVVJGCNGTVCPFGÒGEVUUQWPFU %JQQUG5QWPFUCPFVWTPKVGOUQPQTQÒWPFGT4KPI
9JGPVJG4KPI5KNGPVUYKVEJKUUGVVQTKPIK2JQPGRNC[UUQWPFUHQTCNGTVUCPFGÒGEVU that are turned on.
You can set iPhone to play a sound whenever you:
Get a call
Get a text message
Get a voicemail message
Get an email message
Send an email message
Have an appointment that you’ve set to alert you
Lock iPhone
Type using the keyboard
Brightness
5ETGGPDTKIJVPGUUCÒGEVUDCVVGT[NKHG&KOVJGUETGGPVQGZVGPFVJGVKOGDGHQTG[QW need to recharge iPhone, or use Auto-Brightness.
Adjust the screen brightness: Choose Brightness and drag the slider.
Set whether iPhone adjusts screen brightness automatically: Choose Brightness
CPFVWTP#WVQ$TKIJVPGUUQPQTQÒ+H#WVQ$TKIJVPGUUKUQPK2JQPGCFLWUVUVJGUETGGP brightness for current light conditions using the built-in ambient light sensor.
Wallpaper
Wallpaper settings let you set an image or photo as wallpaper for the Lock screen.
On iPhone 3GS or later, you can also set wallpaper for your Home screen. See “Adding
General
General settings include network, sharing, security, and other iOS settings. You can also
°PFKPHQTOCVKQPCDQWV[QWTK2JQPGCPFTGUGVXCTKQWUK2JQPGUGVVKPIU
Chapter 25 Settings 197
198
APPLE CONFIDENTIAL — First Draft (1.10.11)
About
Choose General > About to get information about iPhone, including:
Name of your phone network
Number of songs, videos, photos, and apps
Total storage capacity
Space available
Software version
Carrier
Model and serial numbers
Wi-Fi and Bluetooth addresses
GSM Models: IMEI (International Mobile Equipment Identity) and ICCID (Integrated
%KTEWKV%CTF+FGPVK°GTQT5OCTV%CTF
CDMA Model: /'+&/QDKNG'SWKROGPV+FGPVK°GT
/QFGO°TOYCTGXGTUKQPQHVJGEGNNWNCTVTCPUOKVVGT
Legal information
Regulatory information
Usage
Show battery percentage (iPhone 3GS or later): Choose General > Usage and turn
Battery Percentage on.
See your usage statistics: Choose General > Usage. There, you can see:
Usage—Amount of time iPhone has been awake and in use since the last full charge. iPhone is awake whenever you’re using it—including making or receiving phone calls, using email, sending or receiving text messages, listening to music, browsing the web, or using any other iPhone features. iPhone is also awake while performing background tasks, such as fetching email messages.
Standby—Amount of time iPhone has been powered on since its last full charge, including the time iPhone has been asleep.
Current period call time and lifetime call time.
Amount of data sent and received over the cellular data network.
Reset your usage statistics: Choose General > Usage, then tap Reset Statistics to clear the data and cumulative time statistics. The statistics for the amount of time iPhone has been unlocked and in standby mode aren’t reset.
Network
7UG0GVYQTMUGVVKPIUVQEQP°IWTGC820XKTVWCNRTKXCVGPGVYQTMEQPPGEVKQPCEEGUU
9K(KUGVVKPIUQTVWTP&CVC4QCOKPIQPQTQÒ
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
6WTP)QPQTQÒ (GSM models only.) Choose General > Network, then tap to turn 3G
QPQTQÒ
Using 3G loads Internet data faster in some cases, but may decrease battery
RGTHQTOCPEG+H[QW¨TGOCMKPICNQVQHRJQPGECNNU[QWOC[YCPVVQVWTP)QÒVQ extend battery performance.
6WTP%GNNWNCT&CVCQPQTQÒ Choose General > Network, then turn Cellular Data on or
QÒ
+H%GNNWNCT&CVCKUVWTPGFQÒ[QWYQP¨VDGCDNGVQCEEGUUVJG+PVGTPGVWPNGUU[QWLQKPC
Wi-Fi network. By default, Cellular Data is turned on.
6WTP&CVC4QCOKPIQPQTQÒ Choose General > Network, then turn Data Roaming on
QTQÒ
Data Roaming turns on Internet and visual voicemail access over a cellular data network when you’re in an area not covered by your carrier’s network. For example,
YJGP[QW¨TGVTCXGNKPI[QWECPVWTPQÒ&CVC4QCOKPIVQCXQKFRQVGPVKCNTQCOKPI
EJCTIGU$[FGHCWNV&CVC4QCOKPIKUVWTPGFQÒ
6WTP+PVGTPGV6GVJGTKPIQPQTQÒ (GSM models only.) Choose General > Network >
+PVGTPGV6GVJGTKPIVJGPVWTP+PVGTPGV6GVJGTKPIQPQTQÒ
See “Sharing an Internet Connection” on page 24.
6WTP2GTUQPCN*QVURQVQPQTQÒ (CDMA model only.) Choose General > Network >
2GTUQPCN*QVURQVVJGPVWTP2GTUQPCN*QVURQVQPQTQÒ
See “Sharing an Internet Connection” on page 24.
#FFCPGY820EQP°IWTCVKQP Choose General > Network > VPN > Add VPN
%QP°IWTCVKQP
VPNs used within organizations allow you to communicate private information
UGEWTGN[QXGTCPQPRTKXCVGPGVYQTM;QWOC[PGGFVQEQP°IWTG820HQTGZCORNGVQ access your work email on iPhone.
iPhone can connect to VPNs that use the L2TP, PPTP, or Cisco IPSec protocols. VPN works over both Wi-Fi and cellular data network connections.
Ask your network administrator which settings to use. In most cases, if you’ve set up
VPN on your computer, you can use the same VPN settings for iPhone.
Once you enter VPN settings, a VPN switch appears in the Settings menu that you can
WUGVQVWTP820QPQTQÒ
820OC[CNUQDGCWVQOCVKECNN[UGVWRD[CEQP°IWTCVKQPRTQ°NG5GG¥ Connecting to the Internet” on page 22.
%JCPIGC820EQP°IWTCVKQP Choose General > Network > VPN and tap the
EQP°IWTCVKQP[QWYCPVVQWRFCVG
6WTP820QPQTQÒ %JQQUG820VJGPVCRVQVWTP820QPQTQÒ
Chapter 25 Settings 199
200
APPLE CONFIDENTIAL — First Draft (1.10.11)
&GNGVGC820EQP°IWTCVKQP Choose General > Network > VPN, tap the blue
CTTQYPGZVVQVJGEQP°IWTCVKQPPCOGVJGPVCR&GNGVG820CVVJGDQVVQOQHVJG
EQP°IWTCVKQPUETGGP
Bluetooth
iPhone can connect wirelessly to Bluetooth devices such as headsets, headphones, and
car kits for music listening and hands-free talking. See “Using a Bluetooth Device for
;QWECPCNUQEQPPGEVVJG#RRNG9KTGNGUU-G[DQCTFXKC$NWGVQQVJ5GG¥ Using an Apple
9KTGNGUU-G[DQCTF ” on page 44.
6WTP$NWGVQQVJQPQTQÒ %JQQUG)GPGTCN $NWGVQQVJCPFVWTP$NWGVQQVJQPQTQÒ
Location Services
Location services lets apps such as Maps, Camera, Compass, and third-party locationbased apps gather and use data indicating your location. The location data collected
D[#RRNGKUPQVEQNNGEVGFKPCHQTOVJCVRGTUQPCNN[KFGPVK°GU[QW;QWTCRRTQZKOCVG location is determined using available information from cellular network data, local
Wi-Fi networks (if you have Wi-Fi turned on), and GPS (may not be available in all locations).
When an app is using location services, appears in the status bar.
Every app that uses location services appears in the Location Services settings screen,
UJQYKPIYJGVJGTNQECVKQPUGTXKEGUKUVWTPGFQPQTQÒHQTVJCVCRR appears for each app that has requested your location within the last 24 hours. You can turn location
UGTXKEGUQÒHQTUQOGQTHQTCNNCRRUKH[QWFQP¨VYCPVVQWUGVJKUHGCVWTG+H[QWVWTP
NQECVKQPUGTXKEGUQÒ[QW¨TGRTQORVGFVQVWTPKVQPCICKPVJGPGZVVKOGCPCRRVTKGUVQ use this feature.
6WTPNQECVKQPUGTXKEGUQPQTQÒHQTCNNCRRU Choose General > Location Services and
VWTPNQECVKQPUGTXKEGUQPQTQÒ
6WTPNQECVKQPUGTXKEGUQPQTQÒHQTUQOGCRRU 6WTPNQECVKQPUGTXKEGUQPQTQÒHQTVJG individual apps.
If you have third-party apps on iPhone that use location services, review the third party’s terms and privacy policy to understand how that app uses your location data.
6QEQPUGTXGDCVVGT[NKHGVWTPNQECVKQPUGTXKEGUQÒYJGP[QW¨TGPQVWUKPIKV
Home Button
Home Button settings (iPhone 3G only) let you specify what happens when you
double-click the Home button. The “Spotlight Search” settings, described below, are
also available under Home Button on iPhone 3G.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Set the action performed when you double-click the Home button: Choose General
> Home Button and set the action. You can set double-clicking the Home button to go to:
Home screen
Search screen
Phone Favorites
Camera app iPod app
Set whether double-clicking the Home button shows iPod controls when playing music: Choose General > Home Button, then tap the switch to turn iPod controls on
QTQÒ6JKUHGCVWTGQXGTTKFGUVJGCEVKQPHQTFQWDNGENKEMKPIVJG*QOGDWVVQPCPFYQTMU
GXGPKHVJGFKURNC[KUVWTPGFQÒQTK2JQPGKUNQEMGF
Spotlight Search
The Spotlight Search setting lets you specify the content areas searched by Search, and rearrange the order of the results.
Set which content areas are searched by Search:
1 Choose General > Spotlight Search (on iPhone 3G, choose General > Home > Spotlight
Search).
2 Tap an item to select or deselect it.
All search categories are selected by default.
Set the order of search result categories:
1 Choose General > Spotlight Search (on iPhone 3G, choose General > Home > Spotlight
Search).
2 Touch next to an item, then drag up or down.
Auto-Lock
.QEMKPIK2JQPGVWTPUQÒVJGFKURNC[VQUCXG[QWTDCVVGT[CPFVQRTGXGPVWPKPVGPFGF operation of iPhone. You can still receive calls and text messages, and you can adjust the volume and use the mic button on the iPhone earphones when listening to music or on a call.
Set the amount of time before iPhone locks: Choose General > Auto-Lock, then choose a time.
Passcode Lock
By default, iPhone doesn’t require you to enter a passcode to unlock it.
On iPhone 3GS or later, setting a passcode enables data protection. See “Security
Chapter 25 Settings 201
202
APPLE CONFIDENTIAL — First Draft (1.10.11)
Important: On iPhone 3GS, you must also restore iOS software to enable data
protection. See “Restoring iPhone” on page 256.
Set a passcode: Choose General > Passcode Lock and enter a 4-digit passcode, then enter the passcode again to verify it. iPhone then requires you to enter the passcode to unlock it or to display the passcode lock settings.
6WTPRCUUEQFGNQEMQÒ Choose General > Passcode Lock, enter your passcode, and
VCR6WTP2CUUEQFG1ÒVJGPGPVGT[QWTRCUUEQFGCICKP
Change the passcode: Choose General > Passcode Lock, enter your passcode, and tap Change Passcode. Enter your passcode again, then enter and reenter your new passcode.
If you forget your passcode, you must restore the iPhone software. See “Updating and
Restoring iPhone Software” on page 256.
Set how long before your passcode is required: Choose General > Passcode Lock and enter your passcode. Tap Require Passcode, then select how long iPhone can be locked before you need to enter a passcode to unlock it.
6WTP5KORNG2CUUEQFGQPQTQÒ Choose General > Passcode Lock, then turn Simple
2CUUEQFGQPQTQÒ
#UKORNGRCUUEQFGKUCHQWTFKIKVPWODGT6QKPETGCUGUGEWTKV[VWTPQÒ5KORNG2CUUEQFG and use a longer passcode with a combination of numbers, letters, punctuation, and special characters.
6WTP8QKEG&KCNQPQTQÒK2JQPG)5QTNCVGT Choose General > Passcode Lock, then
VWTP8QKEG&KCNQPQTQÒ
Erase data after ten failed passcode attempts: Choose General > Passcode Lock, enter your passcode, and tap Erase Data to turn it on.
After ten failed passcode attempts, your settings are reset to their defaults and all your information and media are erased:
On iPhone 3GS or later: by removing the encryption key to the data (which is encrypted using 256-bit AES encryption)
On iPhone 3G: by overwriting the data
Important: You can’t use iPhone while data is being overwritten. This can take up to two hours or more, depending on the model and storage capacity of your iPhone. (On iPhone 3GS or later, the encryption key is removed immediately.)
Restrictions
You can set restrictions for the use of some apps and for iPod content on iPhone. For
GZCORNGRCTGPVUECPTGUVTKEVGZRNKEKVOWUKEHTQODGKPIUGGPQPRNC[NKUVUQTVWTPQÒ
YouTube access entirely.
Turn on restrictions:
1 Choose General > Restrictions, then tap Enable Restrictions.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
2 Enter a four-digit passcode.
3 Reenter the passcode.
6WTPQÒTGUVTKEVKQPU Choose General > Restrictions, then enter the passcode. Tap
Disable Restrictions, then reenter the passcode.
Important: If you forget your passcode, you must restore the iPhone software from
iTunes. See “Updating and Restoring iPhone Software” on page 256.
Set app restrictions: Set the restrictions you want by tapping individual controls on or
QÒ$[FGHCWNVCNNEQPVTQNUCTGQPPQVTGUVTKEVGF6CRCPKVGOVQVWTPKVQÒCPFTGUVTKEV its use.
Safari
Safari is disabled and its icon is removed from the Home screen. You cannot use
Safari to browse the web or access web clips. Other third-party apps may allow web browsing even if Safari is disabled.
YouTube is disabled and its icon is removed from the Home screen.
YouTube
Camera is disabled and its icon is removed from the Home screen. You cannot take photos.
Camera
You cannot make or receive FaceTime video calls (iPhone 4 only).
FaceTime
The iTunes Store is disabled and its icon is removed from the Home screen. You cannot preview, purchase, or download content.
iTunes
The App Store is disabled and its icon is removed from the Home screen. You cannot install apps on iPhone.
Installing
Apps
You cannot delete apps from iPhone. doesn’t appear on app icons when you’re customizing the Home screen.
Deleting
Apps
The current Location Services settings and the Find My iPhone setting (in MobileMe accounts in ”Mail, Contacts, Calendars”) are locked and cannot be changed.
Location
The current Mail, Contacts, Calendar settings are locked and you cannot add, modify, or delete accounts.
Accounts
Chapter 25 Settings 203
204
APPLE CONFIDENTIAL — First Draft (1.10.11)
Restrict purchases within apps: 6WTPQÒ+P#RR2WTEJCUGU9JGPGPCDNGFVJKUHGCVWTG allows you to purchase additional content or functionality within apps downloaded from the App Store.
Set content restrictions: Tap Ratings For, then select a country from the list. You can then set restrictions using that country’s ratings system for the following categories of content:
Music & Podcasts
Movies
TV Shows
Apps
In the United States for example, to allow only movies rated PG or below, tap Movies, then select PG from the list.
Content that you restrict won’t appear on iPhone.
Note: Not all countries or regions have rating systems.
Restrict multiplayer games: 6WTPQÒ/WNVKRNC[GT)COGU
9JGP/WNVKRNC[GT)COGUKUVWTPGFQÒ[QWECP¨VTGSWGUVCOCVEJUGPFQTTGEGKXG invitations to play games, or add friends in Game Center.
Restrict adding friends: 6WTPQÒ#FFKPI(TKGPFU
9JGP#FFKPI(TKGPFUKUQÒ[QWECP¨VOCMGQTTGEGKXGHTKGPFTGSWGUVUKP)COG%GPVGT
If Multiplayer Games is turned on, you can continue to play with existing friends.
Date and Time
These settings apply to the time shown in the status bar at the top of the screen, and in world clocks and calendars.
Set whether iPhone shows 24-hour time or 12-hour time: Choose General > Date
6KOGVJGPVWTP*QWT6KOGQPQTQÒ*QWT6KOGOC[PQVDGCXCKNCDNGKPCNN countries or regions.)
Set whether iPhone updates the date and time automatically: Choose General >
&CVG6KOGVJGPVWTP5GV#WVQOCVKECNN[QPQTQÒ
If iPhone is set to update the time automatically, it gets the correct time over the cellular network and updates it for the time zone you’re in.
Some carriers don’t support network time in all locations. If you’re traveling, iPhone may not be able to automatically set the local time.
Set the date and time manually: Choose General > Date & Time, then turn Set
#WVQOCVKECNN[QÒ6CR6KOG<QPGCPFGPVGTVJGPCOGQHCOCLQTEKV[KP[QWTVKOG\QPG
Tap the “Date & Time” button, then tap “Set Date & Time” and enter the date and time.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Keyboard
6WTPCWVQECRKVCNK\CVKQPQPQTQÒ %JQQUG)GPGTCN -G[DQCTFCPFVWTP#WVQ
%CRKVCNK\CVKQPQPQTQÒ
By default, iPhone capitalizes words after you type sentence-ending punctuation or a return character.
6WTPCWVQEQTTGEVKQPQPQTQÒ %JQQUG)GPGTCN -G[DQCTFCPFVWTP#WVQ%QTTGEVKQP
QPQTQÒ
Normally, if the default keyboard for the language you select has a dictionary, iPhone suggests corrections or completed words as you type.
6WTPURGNNEJGEMKPIQPQTQÒ %JQQUG)GPGTCN -G[DQCTFCPFVWTP%JGEM5RGNNKPIQP
QTQÒ
Spell checking underlines misspelled words in text you type. Tap the underlined word to see suggested corrections. Spell checking is on by default.
Set whether caps lock is enabled: %JQQUG)GPGTCN -G[DQCTFCPFVWTP'PCDNG%CRU
.QEMQPQTQÒ
If caps lock is enabled and you double-tap the Shift key on the keyboard, all letters you type are uppercase. The Shift key turns blue when caps lock is on.
6WTPVJG¥¦UJQTVEWVQPQTQÒ %JQQUG)GPGTCN -G[DQCTFCPFVWTP¥¦5JQTVEWVQPQT
QÒ
The “.” shortcut lets you double-tap the space bar to enter a period followed by a space when you’re typing. It’s on by default.
Add international keyboards:
1 %JQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFU
The number of active keyboards appears before the right arrow.
2 6CR¥#FF0GY-G[DQCTF¦VJGPEJQQUGCMG[DQCTF
You can add as many keyboards as you want. To learn about using international keyboards, see “
+PVGTPCVKQPCN-G[DQCTFU ” on page 40.
Edit your keyboard list: %JQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN-G[DQCTFUVJGP tap Edit and do one of the following:
To delete a keyboard,
To reorder the list,
tap , then tap Delete.
drag next to a keyboard to a new place in the list.
Change a keyboard’s layout: +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF +PVGTPCVKQPCN
-G[DQCTFUCPFUGNGEVCMG[DQCTF;QWECPOCMGUGRCTCVGUGNGEVKQPUHQTDQVJVJGQP screen software and external hardware keyboards for each language.
The software keyboard layout determines the layout of the keyboard that appears on the iPhone screen. The hardware keyboard layout determines the layout of an Apple
9KTGNGUU-G[DQCTFEQPPGEVGFVQK2JQPG
Chapter 25 Settings 205
206
APPLE CONFIDENTIAL — First Draft (1.10.11)
The Edit User Dictionary setting appears when you have any of the following keyboards turned on:
%JKPGUG5KORNK°GF2KP[KP
Chinese - Traditional (Pinyin)
Chinese - Traditional (Zhuyin)
Japanese (Romaji)
,CRCPGUG6GP-G[
Add a word to the dictionary: +P5GVVKPIUEJQQUG)GPGTCN -G[DQCTF 'FKV7UGT
&KEVKQPCT[6CRVCRVJG9QTF°GNFCPFGPVGTVJGYQTFVJGPVCRVJG;QOK2KP[KPQT
<JW[KP°GNFCPFGPVGTVJGKPRWV
You can have multiple inputs for each word, depending on the keyboards that are turned on.
See “
+PVGTPCVKQPCN-G[DQCTFU ” on page 40.
International
7UG+PVGTPCVKQPCNUGVVKPIUVQUGVVJGNCPIWCIGHQTK2JQPGVWTPMG[DQCTFUHQTFKÒGTGPV
NCPIWCIGUQPQTQÒCPFUGVVJGFCVGVKOGCPFVGNGRJQPGPWODGTHQTOCVUHQT[QWT country or region.
Set the language for iPhone: Choose General > International > Language, choose the language you want to use, then tap Done.
Set the Voice Control language for iPhone: Choose General > International > Voice
Control, then choose the language you want to use (iPhone 3GS or later).
Add international keyboards:
1 %JQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFU
The number of active keyboards appears next to the right arrow.
2 6CR¥#FF0GY-G[DQCTF¦VJGPEJQQUGCMG[DQCTF
You can add as many keyboards as you want. To learn about using international keyboards, see “
+PVGTPCVKQPCN-G[DQCTFU ” on page 40.
Edit your keyboard list: %JQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFUVJGPVCR'FKV and do one of the following:
To delete a keyboard,
To reorder the list,
tap , then tap Delete.
drag next to a keyboard to a new place in the list.
Change a keyboard layout: +P5GVVKPIUEJQQUG)GPGTCN +PVGTPCVKQPCN -G[DQCTFU and select a keyboard. You can make separate selections for both the on-screen software and external hardware keyboards for each language.
The software keyboard layout determines the layout of the keyboard that appears on the iPhone screen. The hardware keyboard layout determines the virtual layout of an
#RRNG9KTGNGUU-G[DQCTFEQPPGEVGFVQK2JQPG
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Set the date, time, and telephone number formats: Choose General > International >
Region Format, and choose your region.
The Region Format also determines the language used for the days and months that appear in native iPhone apps.
Set the calendar format: Choose General > International > Calendar, and choose the format.
Accessibility
To turn on accessibility features (iPhone 3GS or later), choose Accessibility and choose
the features you want. See Chapter 29, “Accessibility,” on page 235.
2TQ°NGU
6JKUUGVVKPICRRGCTUKH[QWKPUVCNNQPGQTOQTGRTQ°NGUQPK2JQPG6CR2TQ°NGUVQUGG
KPHQTOCVKQPCDQWVVJGRTQ°NGU[QW¨XGKPUVCNNGF
Resetting iPhone
Reset all settings: Choose General > Reset and tap Reset All Settings.
All your preferences and settings are reset. Information (such as contacts and
ECNGPFCTUCPFOGFKCUWEJCUUQPIUCPFXKFGQUCTGP¨VCÒGEVGF
Erase all content and settings: Connect iPhone to your computer or a power adapter.
Choose General > Reset and tap “Erase All Content and Settings.”
This resets all settings to their defaults and erases all your information and media:
On iPhone 3GS or later: by removing the encryption key to the data (which is encrypted using 256-bit AES encryption)
On iPhone 3G: by overwriting the data
Important: You can’t use iPhone while data is being overwritten. This can take up to two hours or more, depending on the model and storage capacity of your iPhone. (On iPhone 3GS or later, the encryption key is removed immediately.)
Reset network settings: Choose General > Reset and tap Reset Network Settings.
When you reset network settings, your list of previously used networks and VPN
UGVVKPIUPQVKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGCTGTGOQXGF9K(KKUVWTPGFQÒCPF then back on, disconnecting you from any network you’re on. The Wi-Fi and “Ask to
Join Networks” settings are left turned on.
6QTGOQXG820UGVVKPIUKPUVCNNGFD[CEQP°IWTCVKQPRTQ°NGEJQQUG5GVVKPIU )GPGTCN
2TQ°NGVJGPUGNGEVVJGRTQ°NGCPFVCR4GOQXG
Reset the keyboard dictionary: %JQQUG)GPGTCN 4GUGVCPFVCR4GUGV-G[DQCTF
Dictionary.
You add words to the keyboard dictionary by rejecting words iPhone suggests as you type. Tap a word to reject the correction and add the word to the keyboard dictionary.
Resetting the keyboard dictionary erases all words you’ve added.
Chapter 25 Settings 207
208
APPLE CONFIDENTIAL — First Draft (1.10.11)
Reset the Home screen layout: Choose General > Reset and tap Reset Home Screen
Layout.
Reset location warnings: Choose General > Reset and tap Reset Location Warnings.
Location warnings are requests made by apps (such as Camera, Compass, and Maps)
VQWUGNQECVKQPUGTXKEGUK2JQPGRTGUGPVUCNQECVKQPYCTPKPIHQTCPCRRVJG°TUVVKOG the app makes a request to use location services. If you tap Cancel in response to the request, the request isn’t presented again. To reset the location warnings so that you get a request for each app again, tap Reset Location Warnings.
Mail, Contacts, Calendars
7UG/CKN%QPVCEVU%CNGPFCTUUGVVKPIUVQUGVWRCEEQWPVUCPFVWTPQPURGEK°ECEEQWPV services (such as mail, contacts, calendars, bookmarks, and notes) for iPhone:
Microsoft Exchange (mail, contacts, and calendars)
MobileMe (mail, contacts, calendars, bookmarks, notes, and Find My iPhone)
Google (mail, calendars, and notes)
Yahoo! (mail, calendars, and notes)
AOL (mail and notes)
Other POP and IMAP mail systems
LDAP or CardDAV accounts for Contacts
CalDAV or iCalendar (.ics) accounts for Calendars
Accounts
6JG#EEQWPVUUGEVKQPNGVU[QWUGVWRCEEQWPVUQPK2JQPG6JGURGEK°EUGVVKPIUVJCV appear depend on the type of account you’re setting up. Your service provider or system administrator should be able to provide the information you need to enter.
For more information, see:
“ Adding Mail, Contacts, and Calendar Accounts” on page 25
“
“ Adding Contacts” on page 219
Subscribing to Calendars” on page 120
Change an account’s settings: Choose “Mail, Contacts, Calendars,” choose an account, then make the changes you want.
Changes you make to an account’s settings on iPhone are not synced to your
EQORWVGTUQ[QWECPEQP°IWTG[QWTCEEQWPVUVQYQTMYKVJK2JQPGYKVJQWVCÒGEVKPI the account settings on your computer.
Stop using an account service: Choose “Mail, Contacts, Calendars,” choose an account,
VJGPVWTPCPCEEQWPVUGTXKEGUWEJCU/CKN%CNGPFCTUQT0QVGUQÒ
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
+HCPCEEQWPVUGTXKEGKUQÒK2JQPGFQGUP¨VFKURNC[QTU[PEKPHQTOCVKQPYKVJVJCV account service until you turn it back on.
Adjust advanced settings: Choose “Mail, Contacts, Calendars,” choose an account, then do one of the following:
To set whether drafts, sent messages, and deleted messages are stored on iPhone or remotely on your email server (IMAP accounts only), tap Advanced and choose Drafts
Mailbox, Sent Mailbox, or Deleted Mailbox.
If you store messages on iPhone, you can see them even when iPhone isn’t connected to the Internet.
To set how long before messages are removed permanently from Mail on iPhone, tap
Advanced and tap Remove, then choose a time: Never, or after one day, one week, or one month.
To adjust email server settings, tap Host Name, User Name, or Password under
Incoming Mail Server or Outgoing Mail Server. Ask your network administrator or
Internet service provider for the correct settings.
To adjust SSL and password settings, tap Advanced. Ask your network administrator or
Internet service provider for the correct settings.
Delete an account from iPhone: Choose “Mail, Contacts, Calendars,” choose an account, then scroll down and tap Delete Account.
Deleting an account means you can no longer access the account with your iPhone.
All email and the contacts, calendar, and bookmark information synced with the account are removed from iPhone. However, deleting an account doesn’t remove the account or its associated information from your computer.
Fetch New Data
6JKUUGVVKPINGVU[QWVWTP2WUJQPQTQÒHQT/QDKNG/G/KETQUQHV'ZEJCPIG;CJQQ and any other push accounts on iPhone. Push accounts deliver new information to iPhone whenever new information appears on the server (some delays may occur).
;QWOKIJVYCPVVQVWTP2WUJQÒVQUWURGPFFGNKXGT[QHGOCKNCPFQVJGTKPHQTOCVKQPQT to conserve battery life.
9JGP2WUJKUQÒCPFYKVJCEEQWPVUVJCVFQP¨VUWRRQTVRWUJFCVCECPUVKNNDG fetched—that is, iPhone can check with the server and see if new information is available. Use the Fetch New Data setting to determine how often data is requested.
For optimal battery life, don’t fetch too often.
Turn Push on: Choose “Mail, Contacts, Calendars” > Fetch New Data, then tap to turn
Push on.
Set the interval to fetch data: Choose “Mail, Contacts, Calendars” > Fetch New Data, then choose how often you want to fetch data for all accounts.
To conserve battery life, fetch less frequently.
Chapter 25 Settings 209
210
APPLE CONFIDENTIAL — First Draft (1.10.11)
Setting Push to OFF (or setting Fetch to Manually on the Fetch New Data screen) overrides individual account settings.
Mail settings, except where noted, apply to all accounts you’ve set up on iPhone.
6QVWTPCNGTVUUQWPFUHQTPGYQTUGPVOCKNQPQTQÒWUGVJG5QWPFUUGVVKPIU
Set the number of messages shown on iPhone: Choose “Mail, Contacts, Calendars” >
Show, then choose a setting.
Choose to see the most recent 25, 50, 75, 100, or 200 messages. To download additional messages when you’re in Mail, scroll to the bottom of your inbox and tap Load More
Messages.
Note: For Microsoft Exchange accounts, choose “Mail, Contacts, Calendars” and choose the Exchange account. Tap “Mail days to sync” and choose the number of days of mail you want to sync with the server.
Set how many lines of each message are shown in the message list: Choose “Mail,
Contacts, Calendars” > Preview, then choose a setting.
;QWECPEJQQUGVQUGGWRVQ°XGNKPGUQHGCEJOGUUCIG6JCVYC[[QWECPUECPCNKUVQH messages in a mailbox and get an idea of what each message is about.
Set a minimum font size for messages: Choose “Mail, Contacts, Calendars” > Minimum
Font Size, then choose Small, Medium, Large, Extra Large, or Giant.
Set whether iPhone shows To and Cc labels in message lists: Choose “Mail, Contacts,
%CNGPFCTU¦VJGPVWTP5JQY6Q%E.CDGNQPQTQÒ
If Show To/Cc Label is on, or next to each message in a list indicates whether the message was sent directly to you or you received a copy.
5GVYJGVJGTK2JQPGEQP°TOUVJCV[QWYCPVVQFGNGVGCOGUUCIG Choose “Mail,
%QPVCEVU%CNGPFCTU¦CPFKPVJG/CKNUGVVKPIUVWTP#UM$GHQTG&GNGVKPIQPQTQÒ
Set whether iPhone automatically loads remote images: Choose “Mail, Contacts,
%CNGPFCTU¦VJGPVWTP.QCF4GOQVG+OCIGUQPQTQÒ
Set whether mail messages are organized by thread: Choose “Mail, Contacts,
%CNGPFCTU¦VJGPVWTP1TICPK\G$[6JTGCFQPQTQÒ
Set whether iPhone sends you a copy of every message you send: Choose “Mail,
%QPVCEVU%CNGPFCTU¦VJGPVWTP#NYC[U$EE/[UGNHQPQTQÒ
Add a signature to your messages: Choose “Mail, Contacts, Calendars” > Signature, then type a signature.
You can set iPhone to add a signature—your favorite quote, or your name, title, and phone number, for example—to the bottom of every message you send.
Set the default email account: Choose “Mail, Contacts, Calendars” > Default Account, then choose an account.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
This setting determines which of your accounts an email message is sent from when you create a message from another iPhone app—for example, when you send a photo from Photos or tap the email address of a business in Maps. To send the message from
CFKÒGTGPVCEEQWPVVCRVJG(TQO°GNFKPVJGOGUUCIGCPFEJQQUGCPQVJGTCEEQWPV
Contacts
Set how contacts are sorted: Choose “Mail Contacts, Calendars,” then under Contacts tap Sort Order and do one of the following:
6QUQTVD[°TUVPCOG°TUV tap First, Last.
6QUQTVD[NCUVPCOG°TUV tap Last, First.
Set how contacts are displayed: Choose “Mail Contacts, Calendars,” then under
Contacts tap Display Order and do one of the following:
6QUJQY°TUVPCOG°TUV
6QUJQYNCUVPCOG°TUV tap First, Last.
tap Last, First.
Import contacts from a SIM card (GSM models only): Choose “Mail, Contacts,
Calendars,” then tap Import SIM Contacts.
The contact information on the SIM card is imported to iPhone. If you have Contacts enabled for MobileMe, Microsoft Exchange, or a CardDAV account, you’re asked to choose which account you want to add the SIM contacts to.
Calendars
Set alerts to sound when you receive a meeting invitation: Choose “Mail, Contacts,
Calendars,” and under Calendar, tap “New Invitation Alerts” to turn it on.
Set how far back in the past to show your calendar events on iPhone: Choose “Mail,
Contacts, Calendars” > Sync, then choose a period of time.
Turn on Calendar time zone support: Choose “Mail, Contacts, Calendars” > Time Zone
Support, then turn Time Zone Support on. Select a time zone for calendars by tapping
Time Zone and entering the name of a major city.
When Time Zone Support is on, Calendar displays event dates and times in the time
\QPGQHVJGEKV[[QWUGNGEVGF9JGP6KOG<QPG5WRRQTVKUQÒ%CNGPFCTFKURNC[UGXGPVU in the time zone of your current location as determined by the network time.
Set a default calendar: Choose “Mail, Contacts, Calendars,” and under Calendar, tap
Default Calendar to choose the default calendar for new events. This setting appears when more than one calendar is synced to iPhone.
Important: Some carriers don’t support network time in all locations. If you’re traveling, iPhone may not display events or sound alerts at the correct local time. To manually
set the correct time, see “Date and Time” on page 204.
Chapter 25 Settings 211
212
APPLE CONFIDENTIAL — First Draft (1.10.11)
Notes
The Default Account setting appears when you set up more than one account that syncs notes.
Set which account a new note is assigned to: Choose “Mail, Contacts, Calendars,” and under Notes, tap Default Account and choose an account.
Phone
7UG2JQPGUGVVKPIUVQHQTYCTFKPEQOKPIECNNUVWTPECNNYCKVKPIQPQTQÒEJCPIG[QWT password, and other things. Some settings are available only on GSM models, as noted.
Additional fees may apply. Contact your carrier for pricing and availability.
FaceTime
The FaceTime setting appears on iPhone 4 only.
Activate or deactivate FaceTime: 6WTP(CEG6KOGQPQTQÒ+H(CEG6KOGKUQP[QWT phone number will be shared with people you call.
Call Forwarding
Set iPhone to forward your calls (GSM models only):
1 Choose Phone > Call Forwarding and turn Call Forwarding on.
2 On the “Forward to” screen, enter the phone number you want calls forwarded to.
FaceTime calls are not forwarded.
For more information about call forwarding, including how to forward calls on a CDMA
model, see “Call Forwarding” on page 74.
Call Waiting
Activate or deactivate call waiting: (GSM models only.) Choose Phone > Call Waiting,
VJGPVWTP%CNN9CKVKPIQPQTQÒ+H[QWVWTPECNNYCKVKPIQÒCPFUQOGQPGECNNU[QW when you’re already on the phone, the call goes to voicemail.
For more information about call waiting, including how to activate or deactivate call
waiting on a CDMA model, see “Call Waiting” on page 75.
Show My Caller ID
Show or hide your caller ID: (GSM models only.) Choose Phone > Show My Caller ID,
VJGPVWTP5JQY/[%CNNGT+&QPQTQÒ
For more information about caller ID, including how to show or hide your caller ID on a
CDMA model, see “Caller ID” on page 75.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Using iPhone with a Teletype (TTY) Machine
In some countries or regions, Teletype (TTY) machines are used by deaf or hearingimpaired people to communicate by typing and reading text. You can use iPhone with a TTY machine if you have the iPhone TTY Adapter cable, available for purchase separately in many countries. Go to www.apple.com/store (may not be available in all countries or regions) or check with your local Apple retailer.
Connect iPhone to a TTY machine: Choose Phone, then turn TTY on. Then connect iPhone to your TTY machine using the iPhone TTY Adapter.
For information about using a TTY machine, see the documentation that came with the machine.
For information about other accessibility features of iPhone, see
Chapter 29, “Accessibility,” on page 235.
Calling from Abroad
5GVK2JQPGVQCFFVJGEQTTGEVRTG°ZYJGPFKCNKPIHTQOCPQVJGTEQWPVT[ In Settings, tap Phone, then turn International Assist on. This lets you make calls to your home country using the numbers in your contacts and favorites lists, without having to add a
RTG°ZQT[QWTEQWPVT[EQFG+PVGTPCVKQPCN#UUKUVYQTMUHQT75VGNGRJQPGPWODGTUQPN[
For more information, see “Using iPhone Abroad” on page 77.
Changing Your Voicemail Password
A voicemail password helps prevent others from access your voicemail. You need to enter the password only when you’re calling in to get your messages from another phone. You won’t need to enter the password when using voicemail on iPhone.
Change your voicemail password: Choose Phone > Change Voicemail Password.
Locking Your SIM Card
You can lock your SIM card (GSM models only), so it can’t be used without a Personal
+FGPVK°ECVKQP0WODGT2+0;QWOWUVGPVGTVJG2+0GCEJVKOG[QWVWTPK2JQPGQÒCPF turn it back on again. Some carriers require a SIM PIN in order to use iPhone.
Important: If you enter the PIN incorrectly three times, you may need to enter a
2GTUQPCN7PNQEMKPI-G[27-VQGPCDNG[QWT5+/ECTFCICKP4GHGTVQVJG5+/ECTF documentation or contact your carrier. Some cellular networks may not accept an emergency call from iPhone if the SIM card is locked.
6WTPVJG5+/2+0QPQTQÒ
1 %JQQUG2JQPG 5+/2+0VJGPVWTP5+/2+0QPQTQÒ
2 'PVGT[QWT2+0VQEQP°TO7UGVJG2+0CUUKIPGFD[[QWTECTTKGTQT[QWTECTTKGT¨UFGHCWNV
PIN.
Change the PIN for your SIM card:
1 Choose Phone > SIM PIN.
Chapter 25 Settings 213
214
APPLE CONFIDENTIAL — First Draft (1.10.11)
2 Turn SIM PIN on, then tap Change PIN.
3 Enter your current PIN, then enter your new PIN.
4 'PVGT[QWTPGY2+0CICKPVQEQP°TOVJGPVCR&QPG
Accessing Your Carrier’s Services
Depending on your carrier, you may be able to access some of your carrier’s services directly from iPhone. For example, you may be able to check your bill balance, call directory assistance, or view how many minutes you have left.
Access your carrier’s services: Choose Phone. Then scroll down and tap the button for your carrier’s services.
When you request information such as your bill balance, your carrier may provide the
KPHQTOCVKQPKPCVGZVOGUUCIG%QPVCEV[QWTECTTKGTVQ°PFQWVKHVJGTGCTGCP[EJCTIGU for these services.
Safari
Safari settings let you select your Internet search engine, set security options, and for developers, turn on debugging.
General
Select a search engine: Choose Safari > Search Engine and select the search engine you want to use.
;QWECPUGV5CHCTKVQCWVQOCVKECNN[°NNQWVYGDHQTOUWUKPIEQPVCEVKPHQTOCVKQPPCOGU and passwords you previously entered, or both.
Enable AutoFill: Choose Safari > AutoFill, then do one of the following:
To use information from contacts, turn Use Contact Info on, then choose My Info and select the contact you want to use.
5CHCTKWUGUKPHQTOCVKQPHTQO%QPVCEVUVQ°NNKPEQPVCEV°GNFUQPYGDHQTOU
To use information from names and passwords, turn Names & Passwords on.
When this feature is on, Safari remembers names and passwords of websites you
XKUKVCPFCWVQOCVKECNN[°NNUKPVJGKPHQTOCVKQPYJGP[QWTGXKUKVVJGYGDUKVG
To remove all AutoFill information, tap Clear All.
Security
By default, Safari is set to show features of the web, such as some movies, animation, and web apps. You may wish to change security settings to help protect iPhone from possible security risks on the Internet.
Change security settings: Choose Safari, then do one of the following:
To be warned when visiting potentially fraudulent websites, turn Fraud Warning on.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Fraud warning protects you from potentially fraudulent Internet sites. When you visit a suspicious site, Safari warns you about its suspect nature and doesn’t load the page.
To enable or disable JavaScript, VWTP,CXC5ETKRVQPQTQÒ
JavaScript lets web programmers control elements of the page—for example, a page that uses JavaScript might display the current date and time or cause a linked page to appear in a pop-up.
To block or allow pop-ups, VWTP$NQEM2QRWRUQPQTQÒ$NQEMKPIRQRWRUUVQRUQPN[ pop-ups that appear when you close a page or open a page by typing its address. It doesn’t block pop-ups that open when you tap a link.
To set whether Safari accepts cookies, tap Accept Cookies and choose Never, “From visited,” or Always.
A cookie is a piece of information that a website puts on iPhone so the website can remember you when you visit again. That way, webpages can be customized for you based on information you may have provided.
Some pages won’t work correctly unless iPhone is set to accept cookies.
To clear a database, tap Databases, then tap Edit. Tap next to a database, then tap
Delete.
Some web apps use databases to store app information on iPhone.
To clear the history of webpages you’ve visited, tap Clear History.
To clear all cookies from Safari,
To clear the browser cache, tap Clear Cookies.
tap Clear Cache.
The browser cache stores the content of pages so the pages open faster the next time you visit them. If a page you open doesn’t show new content, clearing the cache may help.
Developer
The debug console can help you resolve webpage errors. If it’s turned on, the console appears when a webpage error occurs.
6WTPVJGFGDWIEQPUQNGQPQTQÒ Choose Safari > Developer, and turn Debug
%QPUQNGQPQTQÒ
Messages
Use Messages settings to adjust settings for SMS and MMS messages.
Note: The MMS Messaging and Show Subject Field settings don’t appear if MMS isn’t supported by your carrier.
Choose whether or not to see a preview of messages on the Home screen: Choose
/GUUCIGUCPFVWTP5JQY2TGXKGYQPQTQÒ
Chapter 25 Settings 215
216
APPLE CONFIDENTIAL — First Draft (1.10.11)
Choose whether or not to repeat message alerts: Choose Messages and turn Repeat
#NGTVQPQTQÒ+H[QWKIPQTGCOGUUCIGCNGTV[QW¨NNDGCNGTVGFVYQOQTGVKOGU
6WTP//5OGUUCIKPIQPQTQÒ Choose Messages and turn MMS Messaging on or
QÒ+H//5OGUUCIKPIKUQÒ[QWYQP¨VDGCDNGVQTGEGKXG//5°NGCVVCEJOGPVUUWEJCU images or audio.
Group messaging (may not be available in all countries and regions) maintains the thread of the group when sending texts to multiple recipients.
6WTP)TQWR/GUUCIKPIQPQTQÒ Choose Messages and turn Group Messaging on or
QÒ
Show a subject line for messages you send or receive: Choose Messages and turn
Show Subject Field on.
Show a character count for messages you send or receive: Choose Messages and turn Character Count on. The character count includes all characters—including spaces, punctuation, and returns—and appears as you type when your message exceeds two lines.
iPod
Use iPod Settings to adjust settings for music and video playback on your iPod.
Music
Music settings apply to songs, podcasts, and audiobooks.
6WTP5JCMGVQ5JWÔGQPQTQÒ %JQQUGK2QFVJGPVWTP5JCMGVQ5JWÔGQPQTQÒ
9JGP5JCMGVQ5JWÔGKUQP[QWECPUJCMGK2JQPGVQUJWÔGCPFKOOGFKCVGN[EJCPIG the currently playing song.
Set iTunes to play songs at the same sound level: In iTunes, choose iTunes >
Preferences if you’re using a Mac, or Edit > Preferences if you’re using a PC. Then click
Playback and select Sound Check.
Set iPhone to use the iTunes volume settings (Sound Check): Choose iPod and turn
Sound Check on.
Use the equalizer to customize the sound on iPhone: Choose iPod > EQ and choose a setting.
Set a volume limit for music and videos: Choose iPod > Volume Limit and drag the slider to adjust the maximum volume.
Tap Lock Volume Limit to assign a code to prevent the setting from being changed.
Setting a volume limit only limits the volume for music (including podcasts and audiobooks) and videos (including rented movies and TV shows), and only when headphones, earphones, or speakers are connected to the headset jack on iPhone.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
WARNING: For important information about avoiding hearing loss, see the Important
Product Information Guide at www.apple.com/support/manuals/iphone.
Show song lyrics and podcast information: Choose iPod and turn Lyrics & Podcast
Info on.
Video
Video settings apply to video content, including rented movies and TV shows. You can set where to resume playing videos that you previously started, turn closed captioning
QPQTQÒCPFUGVWRK2JQPGVQRNC[XKFGQUQP[QWT68
Set where to resume playing videos: Choose iPod > Start Playing, then select whether you want videos that you previously started watching to resume playing from
VJGDGIKPPKPIQTYJGTG[QWNGHVQÒ
6WTPENQUGFECRVKQPKPIQPQTQÒ %JQQUGK2QFCPFVWTP%NQUGF%CRVKQPKPIQPQTQÒ
Note: Not all video content is encoded for closed captioning.
TV Out
Use these settings to control how iPhone plays videos on your TV.
6WTPYKFGUETGGPQPQTQÒ %JQQUGK2QFCPFVWTP9KFGUETGGPQPQTQÒ
Set TV signal to NTSC or PAL: Choose iPod > TV Signal and select NTSC or PAL.
NTSC and PAL are TV broadcast standards. iPhone displays NTSC 480p/PAL 576p when attached to a TV using a Component AV Cable, or NTSC 480i/PAL 576i using a
Composite AV Cable. Your TV might use NTSC or PAL, depending on where you bought it. If you’re not sure which to use, check the documentation that came with your TV.
For more information about using iPhone to play videos on your TV, see “Watching
Photos
Slideshow
Use the Slideshow settings to specify how slideshows display your photos.
Set the length of time each slide is shown: Choose Photos > Play Each Slide For and select the length of time.
5GVCVTCPUKVKQPGÒGEV %JQQUG2JQVQU 6TCPUKVKQPCPFUGNGEVCVTCPUKVKQPGÒGEV
Set whether to repeat slideshows: %JQQUG2JQVQUCPFVWTP4GRGCVQPQTQÒ
Set photos to appear randomly or in order: %JQQUG2JQVQUCPFVWTP5JWÔGQPQTQÒ
Chapter 25 Settings 217
218
APPLE CONFIDENTIAL — First Draft (1.10.11)
HDR
The HDR setting (iPhone 4 only) lets you choose whether to save the normal-exposure
photo in addition to the HDR version of a photo when HDR is turned on. See “Taking
Photos and Recording Videos” on page 130.
Choose whether to save both the normal-exposure version and the HDR version of photos: +P5GVVKPIUEJQQUG2JQVQUVJGPVWTP-GGR0QTOCN2JQVQQPQTQÒ+HVJG
UGVVKPIKUQÒQPN[VJG*&4XGTUKQPQHCRJQVQKUUCXGF
If you save both versions, when the controls are visible.
appears in the upper-left corner of the HDR photo
Notes
Use Notes settings to change the font used to display your notes, and to set the default account for notes you add on iPhone.
Change the font: Choose Notes, then select the font you want to use.
Set the default account for new notes: Choose Notes and tap Default Account. Then select an account, or tap On My iPhone if you don’t want notes you add on iPhone to be synced with an account.
Store
Use Store settings to change or create an Apple ID. By default, the Apple ID you’re signed in to when you sync iPhone with your computer appears in Store settings. You can change Apple IDs on iPhone to purchase music or apps using another Apple ID. If you don’t have an Apple ID, you can create one in Store settings.
Sign in: Choose Store and tap Sign In, then enter your Apple ID and password.
View your account information: Choose Store and tap View Apple ID, then type your password and follow the onscreen instructions.
5KIPKPWUKPICFKÒGTGPV#RRNG+& Choose Store and tap Sign Out, then tap Sign In and enter the Apple ID and password.
Create a new Apple ID: Choose Store and tap Create New Apple ID, then follow the onscreen instructions.
Nike + iPod
Use Nike + iPod settings to activate and adjust settings for the Nike + iPod app
(iPhone 3GS or later). See Chapter 27, “Nike + iPod,” on page 225.
Chapter 25 Settings
APPLE CONFIDENTIAL — First Draft (1.10.11)
Contacts
26
About Contacts
Contacts makes it easy to call, email, or text your friends and associates. You can add contacts directly on iPhone, or sync contacts from applications on your computer.
If you have a MobileMe or Microsoft Exchange account with Contacts enabled, or a supported CardDAV account, you can sync your contacts over the air without connecting iPhone to your computer.
You can open Contacts from the Home screen, or from the Phone app.
Adding Contacts
You can add contacts to iPhone in the following ways:
In iTunes, sync contacts from Google or Yahoo!, or sync with applications on your
computer (see “iPhone Settings Panes in iTunes” on page 58)
Set up a MobileMe or Microsoft Exchange account on iPhone, with Contacts
enabled (see “Setting Up MobileMe Accounts” on page 25 or “Setting Up Microsoft
Exchange Accounts” on page 26)
+PUVCNNCRTQ°NGVJCVUGVUWRCP'ZEJCPIGCEEQWPVYKVJ%QPVCEVUGPCDNGFIQVQ www.apple.com/iphone/business)
Set up an LDAP or CardDAV account on iPhone
Enter contacts directly on iPhone
Import contacts from a SIM card
The number of contacts you can add is limited only by the amount of memory on iPhone.
Set up an LDAP or CardDAV account:
1 In Settings, tap “Mail Contacts, Calendars,” then tap Add Account.
219
220
APPLE CONFIDENTIAL — First Draft (1.10.11)
2 Tap Other, then tap Add LDAP Account or Add CardDAV Account.
3 Enter your account information and tap Next to verify the account.
4 Tap Save.
When you set up an LDAP account, you can view and search for contacts on your company or organization’s LDAP server. The server appears as a new group in Contacts.
Since LDAP contacts aren’t downloaded to iPhone, you must have an Internet
EQPPGEVKQPVQXKGYVJGO%JGEMYKVJ[QWTU[UVGOCFOKPKUVTCVQTHQTURGEK°ECEEQWPV settings and other requirements (such as VPN).
When you set up a CardDAV account, your account contacts are synced with iPhone over the air. If it’s supported, you can also search for contacts on your company or organization’s CardDAV server.
Import contacts from another phone’s SIM card: In Settings, tap “Mail, Contacts,
Calendars,” then tap Import SIM Contacts.
The contact information on the SIM card is imported to iPhone. If you have Contacts enabled for both MobileMe and Microsoft Exchange, you’re asked to choose which account you want to add the SIM contacts to.
Important: iPhone doesn’t store contacts on its SIM card.
Searching Contacts
;QWECPUGCTEJ°TUVNCUVCPFEQORCP[PCOGUKP[QWTEQPVCEVUQPK2JQPG+H[QWJCXG a Microsoft Exchange account set up on iPhone, you may also be able to search your enterprise Global Address List (GAL) for contacts in your organization. If you have an
LDAP account set up on iPhone, you can search contacts on your organization’s LDAP server. If you have a CardDAV account, you can search contacts synced to iPhone, or searchable contacts on a supported CardDAV server.
;QWECPUGCTEJVJG°TUVNCUVCPFEQORCP[PCOG°GNFU#U[QWV[RGKPVJGUGCTEJ°GNF contacts with matching information appear immediately.
Search contacts: +P%QPVCEVUVCRVJGUGCTEJ°GNFCVVJGVQRQHCP[NKUVQHEQPVCEVUCPF enter your search. (To scroll quickly to the top of the list, tap the status bar.)
Search a GAL: Tap Groups, tap Directories at the bottom of the list, then enter your search.
You can’t edit GAL contacts or save them to iPhone.
Search an LDAP server: Tap Groups, tap the LDAP server name, then enter your search.
You can’t edit LDAP contacts or save them to iPhone.
Search a CardDAV server: Tap Groups, tap the searchable CardDAV group at the bottom of the list, then enter your search.
Chapter 26 Contacts
APPLE CONFIDENTIAL — First Draft (1.10.11)
You can’t edit searchable CardDAV contacts from the server, but you can edit synced
CardDAV contacts on iPhone.
Contacts are included in searches from the Home screen. See “Searching” on page 47.
Managing Contacts on iPhone
Add a contact on iPhone: Tap Contacts and tap .
Delete a contact
Add a contact from the numeric keypad
Enter a pause in a number
Enter a hard pause in a number
Add a recent caller’s phone number to your contacts
In Contacts, choose a contact, than tap Edit. Scroll down and tap Delete Contact.
6CR-G[RCFGPVGTCPWODGTVJGPVCR .
Tap Create New Contact and enter the caller’s information, or tap “Add to Existing Contact” and choose a contact.
Tap , then tap Pause. One or more pauses may be required by a phone system before dialing an extension, for example. Pauses appear as commas when the number is saved.
(CDMA model only.) Tap , then tap Wait. A hard pause appears as a semicolon when the number is saved. When dialing, iPhone pauses when it reaches the semicolon, waiting until you tap the Dial button to continue.
Tap Recents and tap next to the number. Then tap Create New Contact, or tap “Add to Existing
Contact” and choose a contact.
Edit contact information: Choose a contact, then tap Edit.
Add information:
Add an address:
(KNNKPCDNCPM°GNF
Tap Add New Address.
#FFC°GNFVJCV¨UPQVUJQYKPI Tap Add Field.
Change the ringtone for the contact: 6CRVJGTKPIVQPG°GNFVJGPEJQQUGCTKPIVQPG
6QWUGVJGFGHCWNVTKPIVQPGURGEK°GFKPVJG5QWPFUUGVVKPIUEJQQUG&GHCWNV
Delete an item: Tap , then tap Delete.
;QWECPEJCPIG°GNFNCDGNUD[VCRRKPIVJGNCDGNCPFEJQQUKPICFKÒGTGPVQPG6Q create a custom label, scroll to the bottom of the list and tap Add Custom Label.
If you sync contacts from your computer and also over the air, you can link contacts to
ETGCVGCUKPINGWPK°GFEQPVCEV
Link a contact: In edit mode, tap Link Contact, then choose a contact.
See “
Chapter 26 Contacts 221
222
APPLE CONFIDENTIAL — First Draft (1.10.11)
Assign a photo to a contact:
1 Tap Contacts, then choose a contact.
2 Tap Edit and tap Add Photo, or tap the existing photo.
3 Tap Take Photo and take a photo with the camera. Or tap Choose Existing Photo and choose a photo.
4 Drag and scale the photo as desired.
5 Tap Use Photo (new photo) or Choose (existing photo).
Using Contact Information
You can use the information on a contact’s Info screen to:
Call the contact
Create an email message in Mail, addressed to the contact
Open the contact’s home page in Safari
Find the location of the contact’s address in Maps, and get directions
Send a text message to the contact
Share the contact information with others
Add a phone number for the contact to your favorites list
Make a FaceTime video call
Use a contact’s info screen: Tap Contacts and choose a contact. Then tap an item.
*HSS
:LUKHULTHPS
=PZP[[OL^LIZP[L
:LLHTHWHUK
NL[KPYLJ[PVUZ
4HRLH
-HJL;PTL
]PKLVJHSS
(KKHWOVUL
U\TILY[V`V\Y
MH]VYP[LZSPZ[ :LUKH[L_[TLZZHNL
A star next to a phone number means the number is in your favorites list. appears on the FaceTime button if you’ve ever had a FaceTime call with the contact.
See your own phone number: Tap Contacts and scroll to the top of the list. (Not available in all countries or regions.)
Chapter 26 Contacts
APPLE CONFIDENTIAL — First Draft (1.10.11)
7PK°GF%QPVCEVU
When you sync contacts with multiple accounts, you might have entries for the same person in more than one account. To help keep redundant contacts from appearing
KPVJG#NN%QPVCEVUNKUVQPK2JQPGEQPVCEVUHTQOFKÒGTGPVCEEQWPVUVJCVJCXGVJGUCOG
°TUVCPFNCUVPCOGUCTGNKPMGFCPFFKURNC[GFCUCUKPING WPK°GFEQPVCEV (unless they
JCXGFKÒGTGPVOKFFNGPCOGU9JGP[QWXKGYCWPK°GFEQPVCEVVJGVKVNG7PK°GF+PHQ
CRRGCTUCVVJGVQRQHVJGUETGGP7PK°GFEQPVCEVUCRRGCTQPN[KPVJG#NN%QPVCEVUNKUV
6JGUQWTEGCEEQWPVUQHCWPK°GFEQPVCEVCRRGCTCVVJGDQVVQOQHVJGUETGGPWPFGT
Linked Cards.
View contact information from a source account: Tap one of the source accounts.
Unlink a contact: Tap Edit, tap , then tap Unlink.
Link a contact: Tap Edit, then tap and choose a contact.
Chapter 26 Contacts 223
APPLE CONFIDENTIAL — First Draft (1.10.11)
+H[QWNKPMEQPVCEVUYKVJFKÒGTGPV°TUVQTNCUVPCOGUVJGPCOGUQPVJGKPFKXKFWCN
EQPVCEVUYQP¨VEJCPIGDWVQPN[QPGPCOGCRRGCTUQPVJGWPK°GFECTF6QEJQQUG
YJKEJPCOGCRRGCTUYJGPXKGYKPIVJGWPK°GFECTFVCRVJGNKPMGFECTFYKVJVJG
PCOG[QWRTGHGTVJGPVCR7UG6JKU0COG(QT7PK°GF%CTF
.KPMGFEQPVCEVUCTGP¨VOGTIGF7PNGUU[QWGFKVCWPK°GFEQPVCEVVJGEQPVCEVKP the source account remains separate and unchanged. If you change information
KPCWPK°GFEQPVCEVVJGEJCPIGUCTGEQRKGFVQGCEJUQWTEGCEEQWPVKPYJKEJVJCV
KPHQTOCVKQPCNTGCF[GZKUVU+H[QWCFFKPHQTOCVKQPVQCWPK°GFEQPVCEVVJCVKPHQTOCVKQP is added to the contact in each source account.
Linked contact information also appears at the bottom of an individual contact’s Info
UETGGPYJGPKV¨UXKGYGFKPCURGEK°EUQWTEGCEEQWPVVJCVKUPQVKPVJG#NN%QPVCEVU
NKUVYJKEJNGVU[QWUGGVJG7PK°GF+PHQUETGGPCPFVJGNKPMGFEQPVCEVHTQOGCEJQHVJG other source accounts.
224 Chapter 26 Contacts
APPLE CONFIDENTIAL — First Draft (1.10.11)
Nike + iPod
27
Activating Nike + iPod
When turned on in Settings, the Nike + iPod app appears on the Home screen
(iPhone 3GS or later). With a Nike + iPod Sensor (sold separately), the Nike + iPod app provides audible feedback on your speed, distance, time elapsed, and calories burned during a run or walk. You can send your workout information to nikeplus.com, where you can track your progress, set goals, and participate in challenges.
6WTP0KMGK2QFQPQTQÒ In Settings, choose Nike + iPod and turn Nike + iPod on or
QÒ9JGP0KMGK2QFKUVWTPGFQPKVUCRRKEQPCRRGCTUQPVJG*QOGUETGGP
See the Nike + iPod documentation for information about setting up and using
Nike + iPod.
225
226
APPLE CONFIDENTIAL — First Draft (1.10.11)
Linking a Sensor
6JG°TUVVKOG[QWUVCTVCYQTMQWV[QW¨TGRTQORVGFVQCEVKXCVG[QWTUGPUQTYJKEJ automatically links the sensor with iPhone. You can also use Nike + iPod settings to link a sensor with iPhone.
0KMGK2QFECPNKPMVQQPN[QPGUGPUQTCVCVKOG6QWUGCFKÒGTGPVUGPUQTWUG0KMG iPod settings to link the new sensor.
Link a sensor to iPhone:
1 Put the Nike + iPod sensor in your shoe.
2 In Settings on iPhone, choose Nike + iPod > Sensor.
3 Tap Link New, then walk around as instructed.
4 Tap Done when the sensor is linked.
Working Out with Nike + iPod
After activating Nike + iPod and inserting the Nike + iPod Sensor in your Nike+ ready shoe, you can use Nike + iPod for your workouts.
Work out using Nike + iPod:
1 In Nike + iPod on iPhone, tap Workouts, then choose a type of workout.
2 Depending on the workout, you may need to set a time, distance, or calorie goal.
3 Choose a playlist or other audio selection, then start your workout.
4 9JGP[QW°PKUJ[QWTYQTMQWVVCR'PF9QTMQWV
To turn on spoken feedback or set other options, see “Nike + iPod Settings” on page 227.
Sending Workouts to Nikeplus.com
6JG°TUVVKOG[QWEQPPGEVK2JQPGVQK6WPGUCHVGTCYQTMQWV[QW¨TGCUMGFKH[QWYCPV to automatically send your workouts to Nike+ when you sync iPhone. Click Send to send your current workout to nikeplus.com and set iTunes to automatically send future workouts when you sync iPhone with iTunes.
If you click Don’t Send, you can set iTunes to do this later.
Set iTunes to automatically send workouts to nikeplus.com when you sync iPhone with iTunes:
1 Connect iPhone to your computer.
Make sure your computer is connected to the Internet.
2 In iTunes, click Nike + iPod at the top of the screen, then select “Automatically send workout data to nikeplus.com.”
Chapter 27 Nike + iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
3 Click “Visit nikeplus.com” or click Visit in the dialog that appears.
4 Click Save Your Runs and log in, or register if you haven’t already done so.
Send workout data wirelessly to nikeplus.com from iPhone:
1 In Nike + iPod on iPhone, tap History.
Make sure iPhone is connected to the Internet.
2 Tap “Send to Nike+.”
3 Enter your email address and nikeplus.com account password, then tap “Login to
Nike +.”
If you don’t already have a nikeplus.com account, tap Join Nike+ to set one up.
To see your workouts on nikeplus.com, log in to your account and follow the onscreen instructions.
Calibrating Nike + iPod
You calibrate Nike + iPod using a workout you just completed. You can only calibrate workouts of a quarter mile or more.
Calibrate iPhone:
1 Run or walk a known distance, then tap End Workout.
2 Tap Calibrate, then enter the distance and tap Done.
Reset Nike + iPod to the default calibration: In Settings, choose Nike + iPod, then tap
Reset Calibration.
Nike + iPod Settings
In Settings, choose Nike + iPod to activate and adjust settings for the Nike + iPod app.
Choose a PowerSong: Choose PowerSong and select a song from your music library.
6WTPURQMGPHGGFDCEMQPQTQÒ Choose Spoken Feedback and select a male or
HGOCNGXQKEGVQCEEQORCP[[QWTYQTMQWVQT1ÒVQVWTPQÒURQMGPHGGFDCEM
Set a distance preference: %JQQUG&KUVCPEGVJGPUGNGEV/KNGUQT-KNQOGVGTUVQ measure your workout distance.
Set your weight: %JQQUG9GKIJVVJGP±KEMVQGPVGT[QWTYGKIJV
Set the screen orientation: Choose Lock Screen, then select a screen orientation preference.
Set up the Nike + iPod Sensor: Choose Sensor, then follow the onscreen instructions to set up your sensor (sold separately).
You can use a Nike+ compatible remote (sold separately) to control Nike + iPod
YKTGNGUUN[$GHQTGWUKPICTGOQVGHQTVJG°TUVVKOG[QWOWUVUGVKVWRQPK2JQPG
Chapter 27 Nike + iPod 227
APPLE CONFIDENTIAL — First Draft (1.10.11)
Set up the Nike + iPod remote: Choose Remote, then follow the onscreen instructions to set up your remote (third-party product sold separately).
Reset Nike + iPod to the default calibration: Tap Reset Calibration.
228 Chapter 27 Nike + iPod
APPLE CONFIDENTIAL — First Draft (1.10.11)
iBooks
28
About iBooks
iBooks is a great way to read and buy books. Download the free iBooks app from the App Store, and then get everything from classics to best sellers from the built-in iBookstore. Once you download a book, it’s displayed on your bookshelf.
Add ePub books and PDFs to your bookshelf using iTunes. Then tap a book or PDF to start reading. iBooks remembers your location, so you can easily return to where you
NGHVQÒ#YKFGTCPIGQHFKURNC[QRVKQPUOCMGUVJGDQQMUGCU[VQTGCF
Note: The iBooks app and the iBookstore may not be available in all languages or locations.
(]HPSHISLVU[OLP)VVRZ[VYL;P[SLH]HPSHIPSP[`PZ
Z\IQLJ[[VJOHUNL
To download the iBooks app and use the iBookstore, you need an Internet connection and an Apple account. If you don’t have an Apple account, or if you want to make
purchases from another Apple account, go to Settings > Store. See “Store” on page 218.
229
APPLE CONFIDENTIAL — First Draft (1.10.11)
Syncing Books and PDFs
Use iTunes to sync your books and PDFs between iPhone and your computer. When iPhone is connected to your computer, the Books pane lets you select which items to sync.
You can sync books that you download or purchase from the iBookstore. You can also add DRM-free ePub books and PDFs to your iTunes library. There are several websites
VJCVQÒGTDQQMUKPG2WDCPF2&(HQTOCV
Sync an ePub book or PDF to iPhone: Download the book or PDF using your
EQORWVGT6JGPKPK6WPGUEJQQUG(KNG #FFVQ.KDTCT[CPFUGNGEVVJG°NG%QPPGEV iPhone to your computer, select the book or PDF in the Books pane in iTunes, and then sync iPhone.
If a PDF doesn’t appear in the Books pane, you need to change its type in iTunes.
5GCTEJ[QWTK6WPGUNKDTCT[VQ°PFVJG2&(UGNGEVKVVJGPEJQQUG(KNG )GV+PHQ+PVJG
1RVKQPUUGEVKQPQHVJG°NGKPHQTOCVKQPYKPFQYEJQQUG$QQMHTQOVJG/GFKC-KPF
RQRWROGPWVJGPENKEM1-
Using the iBookstore
In the iBooks app, tap Store to open the iBookstore. From there, you can browse
HGCVWTGFDQQMUQTDGUVUGNNGTUCPFDTQYUGHQTDQQMUD[CWVJQTQTVQRKE9JGP[QW°PF a book you like, you can purchase and download it.
Note: Some features of the iBookstore may not be available in all locations.
Get more information: In the iBookstore, you can read a summary of the book, read or write a review, and download a sample of the book before buying it.
Purchase a book: Find a book you want, tap the price, then tap Buy Now. Sign in to
[QWT#RRNGCEEQWPVVJGPVCR1-5QOGDQQMUOC[DGHTGGHQTFQYPNQCFKPI
The purchase is charged to your Apple account. If you make additional purchases
YKVJKPVJGPGZV°HVGGPOKPWVGU[QWFQP¨VJCXGVQGPVGT[QWTRCUUYQTFCICKP
If you’ve already purchased a book and want to download it again, tap Purchases in
VJGK$QQMUVQTGCPF°PFVJGDQQMKPVJGNKUV6JGPVCR4GFQYPNQCF
Books that you purchase are synced to your iTunes library the next time you sync iPhone with your computer. This provides a backup in case you delete the book from iPhone.
230 Chapter 28 iBooks
APPLE CONFIDENTIAL — First Draft (1.10.11)
Reading Books
Reading a book is easy. Go to the bookshelf and tap the book you want to read. If you don’t see the book you’re looking for, tap the name of the current collection at the top of the screen to go to other collections.
Turn pages: 6CRPGCTVJGTKIJVQTNGHVOCTIKPQHCRCIGQT±KEMNGHVQTTKIJV6QEJCPIG the direction the page turns when you tap the left margin, go to Settings > iBooks.
)QVQCURGEK°ERCIG Tap near the center of the current page to show the controls.
Drag the page navigation control at the bottom of the screen to the desired page, then let go.
Go to the table of contents: Tap near the center of the current page to show the controls, then tap . Tap an entry to jump to that location, or tap Resume to return to the current page.
Add or remove a bookmark: Tap the ribbon button to set a bookmark. You can have multiple bookmarks. To remove a bookmark, tap it. You don’t need to set a bookmark
YJGP[QWENQUGCDQQMDGECWUGK$QQMUTGOGODGTUYJGTG[QWNGHVQÒCPFTGVWTPU there when you open the book again.
Add, remove, or edit a highlight: Touch and hold any word until it’s selected. Use the grab points to adjust the selection, then tap Highlight. To remove a highlight, tap the highlighted text, then tap Remove Highlight. To change the color of a highlight, tap the highlighted text, then tap Colors and select a color from the menu.
Add, remove, or edit a note: Touch and hold any word until it’s selected. Use the grab points to adjust the selection, then tap Note. Type some text, then tap Done. To view a note, tap the indicator in the margin near the highlighted text. To remove a note, tap the highlighted text, then tap Delete Note. To change the color of a note, tap the highlighted text, then tap Colors and select a color from the menu.
See all your bookmarks, highlights and notes: To see the bookmarks, highlights, and notes you’ve added, tap , then tap Bookmarks. To view a note, tap its indicator.
Chapter 28 iBooks 231
232
APPLE CONFIDENTIAL — First Draft (1.10.11)
Enlarge an image: Double-tap the image.
To read a book while lying down, use the portrait orientation lock to prevent
iPhone from rotating the screen when you rotate iPhone. See “Viewing in Portrait or
Landscape Orientation” on page 32.
Reading PDFs
You can use iBooks to read PDFs. Go to the bookshelf and tap Collections, select a collection, then tap the PDF you want to read.
Turn pages: Flick left or right.
Enlarge a page: Pinch to zoom in on the page, then scroll to see the portion you want.
)QVQCURGEK°ERCIG Tap near the center of the current page to show the controls.
Then, in the page navigation controls at the bottom of the page, drag until the desired page number appears, or tap a thumbnail to jump to that page.
Add or remove a bookmark: Tap the ribbon button to set a bookmark. You can have multiple bookmarks. To remove a bookmark, tap it.
You don’t need to set a bookmark when you close a PDF, because iBooks remembers
YJGTG[QWNGHVQÒCPFTGVWTPUVJGTGYJGP[QWQRGPKVCICKP
Go to the table of contents: Tap near the center of the current page to show the controls, then tap . Tap an entry to jump to that location, or tap Resume to return to
VJGEWTTGPVRCIG+HVJGCWVJQTJCUP¨VFG°PGFCVCDNGQHEQPVGPVU[QWECPVCRCRCIG icon instead to go to that page.
Changing a Book’s Appearance
To change the appearance of a book, access the controls by tapping near the center of a page.
Change the font or type size: Tap , then in the list that appears, tap or to reduce or enlarge the type size. To change the font, tap Fonts, then select one from the list. Changing the font and size also changes text formatting.
Change the brightness: Tap , then adjust the brightness. This setting applies only in iBooks.
Change the page and type color: Tap , then turn the Sepia option on to change the color of the page and type. This setting applies to all books.
;QWECPEJCPIGVJGYC[VJCVK$QQMULWUVK°GUVJGVGZVQHRCTCITCRJUKP5GVVKPIU iBooks.
Chapter 28 iBooks
APPLE CONFIDENTIAL — First Draft (1.10.11)
Searching Books and PDFs
You can search for the title or author of a book to quickly locate it on the bookshelf.
;QWECPCNUQUGCTEJVJGEQPVGPVUQHCDQQMVQ°PFCNNVJGTGHGTGPEGUVQCYQTFQT
RJTCUG[QW¨TGKPVGTGUVGFKP;QWECPCNUQUGPFCUGCTEJVQ9KMKRGFKCQT)QQINGVQ°PF other related resources.
Search for a book: Go to the bookshelf. If necessary, change to the collection that you want to search. Tap the status bar to scroll to the top of the screen, then tap the magnifying glass. Enter a word that’s in the title of a book, or the author’s name, then tap Search. Matching books appear on the bookshelf.
Search in a book: Open a book and tap near the center of the page to show the controls. Tap the magnifying glass, then enter a search phrase and tap Search. Tap a search result to go to that page in the book.
To send your search to Google or Wikipedia, tap Search Google or Search Wikipedia.
Safari opens and displays the result.
To quickly search for a word in a book, touch and hold the word, then tap Search.
.QQMKPIWRVJG&G°PKVKQPQHC9QTF
;QWECPNQQMWRVJGFG°PKVKQPQHCYQTFWUKPIVJGFKEVKQPCT[
Look up a word: Select a word in a book, then tap Dictionary in the menu that appears. Dictionaries may not be available for all languages.
Having a Book Read to You
If you have a visual impairment, you can use VoiceOver to read a book aloud. See
Some books may not be compatible with VoiceOver.
Printing or Emailing a PDF
You can use iBooks to send a copy of a PDF via email, or to print all or a portion of the
PDF to a supported printer.
Email a PDF: Open the PDF, then tap and choose Email Document. A new message
CRRGCTUYKVJVJG2&(CVVCEJGF9JGP[QW°PKUJCFFTGUUKPICPFYTKVKPI[QWTOGUUCIG tap Send.
Print a PDF: Open the PDF, then tap and choose Print. Select a printer and the page
range and number of copies, then tap Print. For more information, see “Printing” on page 45.
You can only email or print PDFs. These options aren’t available for ePub books.
Chapter 28 iBooks 233
234
APPLE CONFIDENTIAL — First Draft (1.10.11)
Organizing the Bookshelf
Use the bookshelf to browse your books and PDFs. You can also organize items into collections.
Sort the bookshelf: Go to the bookshelf and tap the status bar to scroll to the top of the screen, then tap and select a sort method from the choices at the bottom of the screen.
Rearrange items on the bookshelf: Touch and hold a book or PDF, then drag it to a new location on the bookshelf.
Delete an item from the bookshelf: Go to the bookshelf and tap Edit. Tap each book or PDF that you want to delete so that a checkmark appears, then tap Delete. When
[QW°PKUJFGNGVKPIVCR&QPG+H[QWFGNGVGCDQQM[QWRWTEJCUGF[QWECPFQYPNQCF it again from Purchases in the iBookstore. If you’ve synced your device with your computer, the book also remains in your iTunes Library.
Create, rename, or delete a collection: Tap the name of the current collection you’re viewing, such as Books or PDFs, to display the collections list. Tap New to add a new collection. To delete a collection, tap Edit, then tap and tap Delete. You can’t edit or remove the built-in Books and PDFs collections. To edit the name of a collection, tap its
PCOG9JGP[QW°PKUJVCR&QPG
Move a book or PDF to a collection: Go to the bookshelf and tap Edit. Tap each book or PDF that you want to move so that a checkmark appears, then tap Move and select a collection. Items can be in only one collection at a time. When you add a book or
2&(VQ[QWTDQQMUJGNHHQTVJG°TUVVKOGKV¨URWVKPVQVJG$QQMUQT2&(EQNNGEVKQP(TQO
VJGTG[QWECPOQXGKVVQCFKÒGTGPVEQNNGEVKQP;QWOKIJVYCPVVQETGCVGEQNNGEVKQPUHQT work and school, for example, or for reference and leisure reading.
View a collection: Tap the name of the current collection at the top of the screen, then pick a new one from the list that appears.
Bookmark and Note Syncing
iBooks saves your bookmarks, notes, and current page information in your Apple account, so they’re always up to date and you can read a book seamlessly across multiple devices. For PDFs, the bookmarks and current page information are synced.
6WTPDQQMOCTMU[PEKPIQPQTQÒ Go to Settings > iBooks, then turn Sync Bookmarks
QPQTQÒ
You must have an Internet connection to sync your settings. iBooks syncs information for all of your books when you open or quit the app. Information for individual books is also synced when you open or close the book.
Chapter 28 iBooks
APPLE CONFIDENTIAL — First Draft (1.10.11)
Accessibility
29
Universal Access Features
In addition to the many features that make iPhone easy to use for everyone, accessibility features (iPhone 3GS or later) are designed to make it easier for users with visual, auditory, or other physical disabilities to use iPhone. These accessibility features include:
VoiceOver
Zoom
Large Text
White on Black
Mono Audio
Speak Auto-text
Support for braille displays
With the exception of VoiceOver, these accessibility features work with all iPhone apps, including third-party apps you download from the App Store. VoiceOver works with all apps that come preinstalled on iPhone, and with many third-party apps.
For more information about iPhone accessibility features, go to www.apple.com/ accessibility.
'CEJCEEGUUKDKNKV[HGCVWTGECPDGVWTPGFQPQTQÒKP#EEGUUKDKNKV[UGVVKPIUQPK2JQPG
;QWECPCNUQVWTPCEEGUUKDKNKV[HGCVWTGUQPQTQÒKPK6WPGUYJGPK2JQPGKUEQPPGEVGFVQ your computer.
6WTPCEEGUUKDKNKV[HGCVWTGUQPQTQÒKPK6WPGU
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list.
3 +PVJG5WOOCT[RCPGENKEM%QP°IWTG7PKXGTUCN#EEGUUKPVJG1RVKQPUUGEVKQP
235
APPLE CONFIDENTIAL — First Draft (1.10.11)
4 5GNGEVVJGCEEGUUKDKNKV[HGCVWTGUVJCV[QWYCPVVQWUGCPFENKEM1-
236
.CTIG6GZVECPQPN[DGVWTPGFQPQTQÒWUKPIK2JQPGUGVVKPIU5GG¥
;QWECPVWTPENQUGFECRVKQPKPIQPQTQÒKPK2QFUGVVKPIU5GG¥
VoiceOver
VoiceOver describes aloud what appears onscreen, so that you can use iPhone without
UGGKPIKV8QKEG1XGTURGCMUKPVJGNCPIWCIGURGEK°GFKP+PVGTPCVKQPCNUGVVKPIUYJKEJ
OC[DGKP±WGPEGFD[VJG4GIKQP.QECNGUGVVKPI
Note: VoiceOver is available in many languages, but not all.
VoiceOver tells you about each element on the screen as it’s selected. When an
GNGOGPVKUUGNGEVGFKV¨UGPENQUGFD[CDNCEMTGEVCPINGHQTVJGDGPG°VQHVJQUGYJQECP see the screen) and VoiceOver speaks the name or describes the item. The enclosing rectangle is referred to as the VoiceOver cursor. If text is selected, VoiceOver reads the text. If a control (such as a button or switch) is selected and Speak Hints is turned on,
VoiceOver may tell you the action of the item or provide instructions for you—for example, “double-tap to open.”
When you go to a new screen, VoiceOver plays a sound and then selects and speaks
VJG°TUVGNGOGPVQHVJGUETGGPV[RKECNN[VJGKVGOKPVJGWRRGTNGHVEQTPGT8QKEG1XGT also lets you know when the screen changes to landscape or portrait, and when it is locked or unlocked.
Setting Up VoiceOver
Important: VoiceOver changes the gestures used to control iPhone. Once VoiceOver is turned on, you have to use VoiceOver gestures to operate iPhone—even to turn
8QKEG1XGTQÒCICKPVQTGUWOGUVCPFCTFQRGTCVKQP
Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
6WTP8QKEG1XGTQPQTQÒ In Settings, choose General > Accessibility > VoiceOver and
VCRVJG8QKEG1XGT1P1ÒUYKVEJ
;QWECPCNUQUGV6TKRNGENKEM*QOGVQVWTP8QKEG1XGTQPQTQÒ5GG¥
Note: You cannot use VoiceOver and Zoom at the same time.
6WTPURQMGPJKPVUQPQTQÒ In Settings, choose General > Accessibility > VoiceOver,
CPFVCRVJG5RGCM*KPVU1P1ÒUYKVEJ9JGP5RGCM*KPVUKUVWTPGFQP8QKEG1XGTOC[ tell you the action of the item or provide instructions for you—for example, “doubletap to open.” Speak Hints is turned on by default.
Set the VoiceOver speaking rate: In Settings, choose General > Accessibility >
VoiceOver, and adjust the Speaking Rate slider.
Add speaking rate to the rotor: In Settings, choose General > Accessibility and tap to turn on “Include in Rotor.”
You can choose the kind of feedback you get when you type. You can set VoiceOver to speak characters, words, both, or nothing. If you choose to hear both characters and words, VoiceOver speaks each character as you type it, then speaks the whole word
YJGP[QW°PKUJKVD[GPVGTKPICURCEGQTRWPEVWCVKQP
Choose typing feedback: In Settings, choose General > Accessibility > VoiceOver >
Typing Feedback. You can choose Characters, Words, Characters and Words, or Nothing
HQTUQHVYCTGMG[DQCTFUCPFHQTCP#RRNG9KTGNGUU-G[DQCTFUGG¥ Using an Apple
9KTGNGUU-G[DQCTF ” on page 44).
Use phonetics
Use pitch change
In Settings, choose General > Accessibility >
VoiceOver, then tap the Use Phonetics switch to turn it on.
Use this feature when you type or read characterby-character, to help make clear which characters were spoken. When Use Phonetics is turned on,
8QKEGQXGT°TUVURGCMUVJGEJCTCEVGTVJGPURGCMUC word beginning with the character. For example, if you type the character “f,” VoiceOver speaks “f,” and then a moment later, “foxtrot.”
In Settings, choose General > Accessibility >
VoiceOver, then tap the Use Pitch Change switch to turn it on.
VoiceOver uses a higher pitch when entering a letter, and a lower pitch when deleting a letter. VoiceOver also uses a higher pitch when
URGCMKPIVJG°TUVKVGOQHCITQWRUWEJCUCNKUV or table) and a lower pitch when speaking the last item of a group.
$[FGHCWNV8QKEG1XGTWUGUVJGNCPIWCIGVJCV¨UUGVHQTK2JQPG;QWECPUGVCFKÒGTGPV language for VoiceOver.
Chapter 29 Accessibility 237
238
APPLE CONFIDENTIAL — First Draft (1.10.11)
Set the language for iPhone: In Settings, choose General > International > Language,
VJGPUGNGEVCNCPIWCIGCPFVCR1-5QOGNCPIWCIGUOC[DGKP±WGPEGFD[VJG4GIKQP
Local setting. In Settings, choose General > International > Region Format and select the format.
Set the language for VoiceOver: In Settings, choose General > International > Voice
Control, then choose the language.
If you change the language for iPhone, you may need to reset the language for
VoiceOver.
Set the rotor options for web browsing: In Settings, choose General > Accessibility >
VoiceOver > Web Rotor. Tap to select or deselect options. To change the position of an item in the list, touch next to the item, then drag up or down.
Select the languages available in the Language rotor: In Settings, choose General
> Accessibility > VoiceOver > Language Rotor and tap to select the language or languages you want to appear in the Language rotor. To change the position of a language in the list, touch next to the language and drag up or down.
The Language rotor is always available when you’ve selected more than one language.
VoiceOver Gestures
9JGP8QKEG1XGTKUVWTPGFQPVJGUVCPFCTFVQWEJUETGGPIGUVWTGUJCXGFKÒGTGPVGÒGEVU
These and some additional gestures let you move around the screen and control individual elements when they’re selected. VoiceOver gestures include two- and
VJTGG°PIGTUIGUVWTGUVQVCRQT±KEM(QTDGUVTGUWNVUYJGPWUKPIVYQCPFVJTGG°PIGT
IGUVWTGUTGNCZCPFNGV[QWT°PIGTUVQWEJVJGUETGGPYKVJUQOGURCEGDGVYGGPVJGO
You can use standard gestures when VoiceOver is turned on, by double-tapping and
JQNFKPI[QWT°PIGTQPVJGUETGGP#UGTKGUQHVQPGUKPFKECVGUVJCVPQTOCNIGUVWTGU
CTGKPHQTEG6JG[TGOCKPKPGÒGEVWPVKN[QWNKHV[QWT°PIGT6JGP8QKEG1XGTIGUVWTGU resume.
;QWECPWUGFKÒGTGPVVGEJPKSWGUVQGPVGT8QKEG1XGTIGUVWTGU(QTGZCORNG[QWECP
GPVGTCVYQ°PIGTVCRWUKPIVYQ°PIGTUHTQOQPGJCPFQTQPG°PIGTHTQOGCEJJCPF
;QWECPCNUQWUG[QWTVJWODU/CP[°PFVJG¥URNKVVCR¦IGUVWTGGURGEKCNN[GÒGEVKXG instead of selecting an item and double-tapping, you can touch and hold an item with
QPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGT°PIGT6T[FKÒGTGPVVGEJPKSWGUVQFKUEQXGT which works best for you.
If your gestures don’t work, try quicker movements, especially for double-tapping and
±KEMKPIIGUVWTGU6Q±KEMVT[SWKEMN[DTWUJKPIVJGUETGGPYKVJ[QWT°PIGTQT°PIGTU
When VoiceOver is turned on, the VoiceOver Practice button appears, which gives you a chance to practice VoiceOver gestures before proceeding.
Practice gestures: In Settings, choose General > Accessibility > VoiceOver, then tap
8QKEG1XGT2TCEVKEG9JGP[QW°PKUJRTCEVKEKPIVCR&QPG
Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
If you don’t see the VoiceOver Practice button, make sure VoiceOver is turned on.
Here’s a summary of key VoiceOver gestures:
Navigating and Reading
Tap: Speak item.
Flick right or left:
Flick up or down:
Select the next or previous item.
Depends on the Rotor Control setting. See “Rotor Control” on
6YQ°PIGTVCR Stop speaking the current item.
6YQ°PIGT±KEMWR Read all from the top of the screen.
6YQ°PIGT±KEMFQYP Read all from the current position.
6YQ°PIGT¥UETWD¦ /QXGVYQ°PIGTUDCEMCPFHQTVJVJTGGVKOGUSWKEMN[OCMKPIC
“z”) to dismiss an alert or go back to the previous screen.
6JTGG°PIGT±KEMWRQTFQYP Scroll one page at a time.
6JTGG°PIGT±KEMTKIJVQTNGHV Go to the next or previous page (such as the Home screen, Stocks, or Safari).
6JTGG°PIGTVCR Speak the scroll status (which page or rows are visible).
(QWT°PIGT±KEMWR 5GNGEVVJG°TUVGNGOGPVQPVJGUETGGP
(QWT°PIGT±KEMFQYP Select the last element on the screen.
Activating
Double-tap: Activate the selected item.
Triple-tap: Double-tap an item.
Split-tap: An alternative to selecting an item and double-tapping is to touch an item
YKVJQPG°PIGTVJGPVCRVJGUETGGPYKVJCPQVJGTVQCEVKXCVGCPKVGO
6QWEJCPKVGOYKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT°PIGT¥URNKVVCRRKPI¦
Activate the item.
Double-tap and hold (1 second) + standard gesture: Use a standard gesture.
The double-tap and hold gesture tells iPhone to interpret the subsequent gesture as
UVCPFCTF(QTGZCORNG[QWECPFQWDNGVCRCPFJQNFVJGPYKVJQWVNKHVKPI[QWT°PIGT
FTCI[QWT°PIGTVQUNKFGCUYKVEJ
6YQ°PIGTFQWDNGVCR Answer or end a call. Play or pause in iPod, YouTube, Voice
Memos, or Photos. Take a photo (Camera). Start or pause recording in Camera or
Voice Memos. Start or stop the stopwatch.
6JTGG°PIGTFQWDNGVCR Mute or unmute VoiceOver.
6JTGG°PIGTVTKRNGVCR 6WTPVJGUETGGPEWTVCKPQPQTQÒ
Chapter 29 Accessibility 239
240
APPLE CONFIDENTIAL — First Draft (1.10.11)
Rotor Control
The rotor control is a virtual dial that you can use to change the results of up and
FQYP±KEMIGUVWTGUYJGP8QKEG1XGTKUVWTPGFQP
Operate the rotor: 4QVCVGVYQ°PIGTUQPVJGK2JQPGUETGGPVQ¥VWTP¦VJGFKCNVQ choose between options.
The current setting appears on the screen and is spoken aloud.
6JGGÒGEVQHVJGTQVQTFGRGPFUQPYJCV[QW¨TGFQKPI(QTGZCORNGKH[QW¨TGTGCFKPI text in an email you received, you can use the rotor to switch between hearing text
URQMGPYQTFD[YQTFQTEJCTCEVGTD[EJCTCEVGTYJGP[QW±KEMWRQTFQYP+H[QW¨TG browsing a webpage, you can use the rotor setting to hear all the text (either word-byword or character-by-character), or to jump from one element to another of a certain type, such as headers or links.
The following lists show the available rotor options, depending on the context of what you’re doing.
Reading text
Select and hear text by:
Character
Word
Line
Browsing a webpage
Select and hear text by:
Character
Word
Line
Heading
Link
Visited link
Non-visited link
In-page link
Form control
Table
Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
Row (when navigating a table)
List
Landmark
Image
Static text
Zoom in or out
Entering text
Move insertion point and hear text by:
Character
Word
Line
Select edit function
Select language
Using a control (such as the spinner for setting the time in Clock)
Select and hear values by:
Character
Word
Line
Adjust the value of the control object
Speaking (available only with the Apple Wireless Keyboard)
Adjust VoiceOver speaking by:
Volume
Rate
Typing echo
Use pitch change
Use Phonetics
See “ %QPVTQNNKPI8QKEG1XGT7UKPICP#RRNG9KTGNGUU-G[DQCTF ” on page 246.
You can select which rotor options appear for web browsing, and arrange their order.
See “Setting Up VoiceOver” on page 236.
Chapter 29 Accessibility 241
APPLE CONFIDENTIAL — First Draft (1.10.11)
Using VoiceOver
Select items on the screen: &TCI[QWT°PIGTQXGTVJGUETGGP8QKEG1XGTKFGPVK°GU each element as you touch it. You can move systematically from one element to the
PGZVD[±KEMKPINGHVQTTKIJVYKVJCUKPING°PIGT'NGOGPVUCTGUGNGEVGFHTQONGHVVQ
TKIJVVQRVQDQVVQO(NKEMTKIJVVQIQVQVJGPGZVGNGOGPVQT±KEMNGHVVQIQVQVJG previous element.
7UGHQWT°PIGTIGUVWTGUVQUGNGEVVJG°TUVQTNCUVGNGOGPVQPCUETGGP
5GNGEVVJG°TUVGNGOGPVQPCUETGGP
Select the last element on a screen:
(NKEMWRYKVJHQWT°PIGTU
(NKEMFQYPYKVJHQWT°PIGTU
“Tap” a selected item when VoiceOver is turned on: Double-tap anywhere on the screen.
“Double-tap” a selected item when VoiceOver is turned on: Triple-tap anywhere on the screen.
Speak the text of an element, character-by-character or word-by-word: With
VJGGNGOGPVUGNGEVGF±KEMWRQTFQYPYKVJQPG°PIGT(NKEMFQYPVQTGCFVJGPGZV
EJCTCEVGTQT±KEMWRVQTGCFVJGRTGXKQWUEJCTCEVGT7UGRJQPGVKEUVQJCXG8QKEG1XGT
also speak a word beginning with the character being spoken. See “Setting Up
Twist the rotor control to have VoiceOver read word-by-word.
Adjust a slider: 9KVJCUKPING°PIGT±KEMWRVQKPETGCUGVJGUGVVKPIQTFQYPVQ decrease the setting. VoiceOver announces the setting as you adjust it.
242 Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
Scroll a list or area of the screen
Use a list index
Reorder a list
(NKEMWRQTFQYPYKVJVJTGG°PIGTU(NKEMFQYP to page down through the list or screen, or
±KEMWRVQRCIGWR9JGPRCIKPIVJTQWIJCNKUV
VoiceOver speaks the range of items displayed
(for example, “showing rows 5 through 10”).
You can also scroll continuously through a list, instead of paging through it. Double-tap and hold. When you hear a series of tones, you can
OQXG[QWT°PIGTWRQTFQYPVQUETQNNVJGNKUV
Continuous scrolling stops when you lift your
°PIGT
Some lists have an alphabetical index along the right side. The index cannot be selected by
±KEMKPIDGVYGGPGNGOGPVU[QWOWUVVQWEJVJG index directly to select it. With the index selected,
±KEMWRQTFQYPVQOQXGCNQPIVJGKPFGZ;QW
ECPCNUQFQWDNGVCRVJGPUNKFG[QWT°PIGTWRQT down.
Some lists, such as Favorites in Phone, and
Web Rotor and Language Rotor in Accessibility settings can be reordered. Select on the right side of an item, double-tap and hold until you hear a sound, then drag up or down. VoiceOver speaks the item you’ve moved above or below, depending on the direction you’re dragging.
Unlock iPhone: Select the Unlock switch, then double-tap the screen.
Rearrange the Home screen: On the Home screen, select the icon you want to move.
Double-tap and hold the icon, then drag it. VoiceOver speaks the row and column position as you drag the icon. Release the icon when it’s in the location you want. You can drag additional icons. Drag an item to the left or right edge of the screen to move
KVVQCFKÒGTGPVRCIGQHVJG*QOGUETGGP9JGP[QW°PKUJRTGUUVJG*QOG button.
Mute VoiceOver
Stop speaking an item
6WTPVJGUETGGPEWTVCKPQPQTQÒ
&QWDNGVCRYKVJVJTGG°PIGTU&QWDNGVCRCICKP
YKVJVJTGG°PIGTUVQVWTPURGCMKPIDCEMQP6Q
VWTPQÒQPN[8QKEG1XGTUQWPFUUGVVJG4KPI
Silent switch to Silent.
If you have an external keyboard connected, you can also press the Control key on the keyboard to mute or unmute VoiceOver.
6CRQPEGYKVJVYQ°PIGTU6CRCICKPYKVJ
VYQ°PIGTUVQTGUWOGURGCMKPI5RGCMKPI automatically resumes when you select another item.
6TKRNGVCRYKVJVJTGG°PIGTU9JGPUETGGPEWTVCKP is on, the screen contents are active even though
VJGFKURNC[KUVWTPGFQÒ
Chapter 29 Accessibility 243
244
APPLE CONFIDENTIAL — First Draft (1.10.11)
Speak the entire screen from the top
Speak from the current item to the bottom of the screen
(NKEMWRYKVJVYQ°PIGTU
(NKEMFQYPYKVJVYQ°PIGTU
You can hear iPhone status information by touching the top of the screen. This information can include the time, battery life, Wi-Fi signal strength, and more.
Making Phone Calls with VoiceOver
&QWDNGVCRVJGUETGGPYKVJVYQ°PIGTUVQCPUYGTQTGPFCECNN9JGPCRJQPGECNN is established with VoiceOver on, the screen displays the numeric keypad by default, instead of showing call options. This makes it easier to use the keypad to respond to a menu of options when you reach an automated system.
Display call options: 5GNGEVVJG*KFG-G[RCFDWVVQPKPVJGNQYGTTKIJVEQTPGTCPF double-tap.
Display the numeric keypad again: 5GNGEVVJG-G[RCFDWVVQPPGCTVJGEGPVGTQHVJG screen and double-tap.
Entering and Editing Text
9JGP[QWGPVGTCPGFKVCDNGVGZV°GNF[QWECPWUGVJGQPUETGGPMG[DQCTFQTCP external keyboard connected to iPhone to enter text.
There are two ways to enter text in VoiceOver—standard typing and “touch” typing.
With standard typing, you select a key, then double-tap the screen to enter the character. With touch typing, you touch to select a key and the character is entered
CWVQOCVKECNN[YJGP[QWNKHV[QWT°PIGT6QWEJV[RKPIECPDGSWKEMGTDWVOC[TGSWKTG more practice than standard typing.
VoiceOver also lets you use the editing features of iPhone to cut, copy, or paste in a
VGZV°GNF
Enter text:
1 5GNGEVCVGZV°GNFVQDTKPIWRVJGQPUETGGPMG[DQCTF
You may need to double-tap to bring up the keyboard, if it doesn’t appear
CWVQOCVKECNN[8QKEG1XGTYKNNVGNN[QWKHVJGVGZV°GNF¥KUGFKVKPI¦QTKH[QWPGGFVQ
“double-tap to edit.”
+HVJG°GNFCNTGCF[EQPVCKPUVGZVVJGKPUGTVKQPRQKPVKURNCEGFGKVJGTCVVJGDGIKPPKPI or at the end of the text. Double-tap to move the insertion point to the opposite end.
VoiceOver tells you the position of the insertion point.
2 Use the keyboard to type characters:
Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
Standard typing: 5GNGEVCMG[QPVJGMG[DQCTFD[±KEMKPINGHVQTTKIJVVJGPFQWDNG
VCRVQGPVGTVJGEJCTCEVGT1TOQXG[QW°PIGTCTQWPFVJGMG[DQCTFVQUGNGEVCMG[
CPFYJKNGEQPVKPWKPIVQVQWEJVJGMG[YKVJQPG°PIGTVCRVJGUETGGPYKVJCPQVJGT
°PIGTVQGPVGTVJGEJCTCEVGT8QKEG1XGTURGCMUVJGMG[YJGPKV¨UUGNGEVGFCPFCICKP when the character is entered.
Touch typing: 6QWEJCMG[QPVJGMG[DQCTFVQUGNGEVKVVJGPNKHV[QWT°PIGTVQGPVGT
VJGEJCTCEVGT+H[QWVQWEJVJGYTQPIMG[OQXG[QWT°PIGTQPVJGMG[DQCTFWPVKN you select the key you want. VoiceOver speaks the character for each key as you
VQWEJKVDWVFQGUP¨VGPVGTCEJCTCEVGTWPVKN[QWNKHV[QWT°PIGT
Note: Touch typing works only for the keys that actually enter text. Use standard typing for other keys such as Shift, Delete, and Return.
VoiceOver tells you when it thinks you’ve misspelled a word.
Choose standard or touch typing: With VoiceOver turned on and a key selected on
VJGMG[DQCTFWUGVJGTQVQTVQUGNGEV6[RKPI/QFGVJGP±KEMWRQTFQYP
Move the insertion point: Use the rotor to choose whether you want to move the insertion point by character, by word, or by line. By default, VoiceOver moves the insertion point character-by-character.
Flick up or down to move the insertion point forward or backward in the text.
VoiceOver makes a sound when the insertion point moves, and speaks the character that the insertion point moves across.
When moving the insertion point by word, VoiceOver speaks each word as you move across it. When moving forward, the insertion point is placed at the end of the traversed word, before the space or punctuation that follows it. When moving backward, the insertion point is placed the end of the word preceding the traversed word, before the space or punctuation that follows it. To move the insertion point past the punctuation at the end of a word or sentence, use the rotor to switch back to character mode.
When moving the insertion point by line, VoiceOver speaks each line as you move across it. When moving forward, the insertion point is placed at the beginning of the next line (except when you reach the last line of a paragraph, when the insertion point is moved to the end of the line just spoken). When moving backward, the insertion point is placed at the beginning of the line that’s spoken.
Delete a character: Select the , then double-tap or split-tap. You must do this even when touch typing. To delete multiple characters, touch and hold the Delete key,
VJGPVCRVJGUETGGPYKVJCPQVJGT°PIGTQPEGHQTGCEJEJCTCEVGT[QWTYCPVVQFGNGVG
VoiceOver speaks the character as it’s deleted. If you have Use Pitch Change turned on,
VoiceOver speaks deleted characters in a lower pitch.
Select text: 5GVVJGTQVQTVQ'FKV±KEMWRQTFQYPVQEJQQUG5GNGEVQT5GNGEV#NNVJGP double tap. If you chose Select, the word closest to the insertion point is selected when you double-tap. If you chose Select All, the entire text is selected.
Chapter 29 Accessibility 245
246
APPLE CONFIDENTIAL — First Draft (1.10.11)
Pinch apart or together to increase or decrease the selection.
Cut, copy, or paste: /CMGUWTGVJGTQVQTKUUGVVQGFKV9KVJVGZVUGNGEVGF±KEMWRQT down to choose Cut, Copy, or Paste, then double-tap.
Undo: 5JCMGK2JQPG±KEMNGHVQTTKIJVVQEJQQUGVJGCEVKQPVQWPFQVJGPFQWDNGVCR
Enter an accented character: In standard typing mode, select the plain character, then double-tap and hold until you hear a sound indicating alternate characters have
CRRGCTGF&TCINGHVQTTKIJVVQUGNGEVCPFJGCTVJGEJQKEGU4GNGCUG[QWT°PIGTVQGPVGT the current selection.
Change the language you’re typing in: 5GVVJGTQVQTVQ.CPIWCIGVJGP±KEMWR
QTFQYP%JQQUG¥FGHCWNVNCPIWCIG¦VQWUGVJGNCPIWCIGURGEK°GFKP+PVGTPCVKQPCN settings.
Note: The Language rotor appears only if you select more than one language in the
VoiceOver Language Rotor setting. See “Setting Up VoiceOver” on page 236.
Controlling VoiceOver Using an Apple Wireless Keyboard
;QWECPEQPVTQN8QKEG1XGTWUKPICP#RRNG9KTGNGUU-G[DQCTFRCKTGFYKVJK2JQPG5GG
“
7UKPICP#RRNG9KTGNGUU-G[DQCTF ” on page 44.
The VoiceOver keyboard commands let you navigate the screen, select items, read screen contents, adjust the rotor, and perform other VoiceOver actions. All the keyboard commands (except one) include Control-Option, abbreviated in the table below as “VO.”
VoiceOver Help speaks keys or keyboard commands as you type them. You can use
VoiceOver Help to learn the keyboard layout and the actions associated with key combinations.
VoiceOver Keyboard Commands
VO = Control-Option
Read all, starting from the current position
Read from the top
Move to the status bar
Press the Home button
Select the next or previous item
Tap an item
&QWDNGVCRYKVJVYQ°PIGTU
Choose the next or previous rotor item
VO–A
VO–B
VO–M
VO–H
VO–Right Arrow or VO–Left Arrow
VO–Space bar
VO–”-”
VO–Up Arrow or VO–Down Arrow
Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
Choose the next or previous speech rotor item VO–Command–Left Arrow or VO–Command–
Right Arrow
Adjust speech rotor item VO–Command–Up Arrow or VO–Command–
Down Arrow
Mute or unmute VoiceOver
6WTPVJGUETGGPEWTVCKPQPQTQÒ
Turn on VoiceOver help
4GVWTPVQVJGRTGXKQWUUETGGPQTVWTPQÒ
VoiceOver help
VO–S
VO–Shift-S
81£-
Escape
Quick Nav
6WTPQP3WKEM0CXVQEQPVTQN8QKEG1XGTWUKPIVJGCTTQYMG[U3WKEM0CXKUQÒD[ default.
6WTP3WKEM0CXQPQTQÒ
Select the next or previous item
5GNGEVVJGPGZVQTRTGXKQWUKVGOURGEK°GFD[ the rotor setting
5GNGEVVJG°TUVQTNCUVKVGO
"Tap” an item
Scroll up, down, left, or right
Change the rotor
Left Arrow–Right Arrow
Right Arrow or Left Arrow
Up Arrow or Down Arrow
Control–Up Arrow or Control–Down Arrow
Up Arrow–Down Arrow
Option–Up Arrow, Option–Down Arrow, Option–
Left Arrow, or Option–Right Arrow
Up Arrow–Left Arrow or Up Arrow–Right Arrow
Using Maps
With VoiceOver, you can zoom in or out, select pins, and get information about locations.
Zoom in or out: 7UGVJGTQVQTVQEJQQUG\QQOOQFGVJGP±KEMWRQTFQYPVQ\QQO in or out.
Select a pin: 6QWEJCRKPQT±KEMNGHVQTTKIJVVQOQXGHTQOQPGKVGOVQCPQVJGT
Get information about a location: With a pin selected, double-tap to display the
KPHQTOCVKQP±CI(NKEMNGHVQTTKIJVVQUGNGEVVJG±CIVJGPFQWDNGVCRVQFKURNC[VJG information page.
Editing Videos and Voice Memos
You can use VoiceOver gestures to trim Camera videos and Voice Memo recordings.
Chapter 29 Accessibility 247
248
APPLE CONFIDENTIAL — First Draft (1.10.11)
Trim a voice memo: On the Voice Memos screen, select the button to the right of the memo you want to trim, then double-tap. Then select Trim Memo and double-tap.
5GNGEVVJGDGIKPPKPIQTGPFQHVJGVTKOVQQN(NKEMWRVQFTCIVQVJGTKIJVQT±KEMFQYP to drag to the left. VoiceOver announces the amount of time the current position will trim from the recording. To execute the trim, select Trim Voice Memo and double-tap.
Trim a video: While viewing a video, double-tap the screen to display the video
EQPVTQNU5GNGEVVJGDGIKPPKPIQTGPFQHVJGVTKOVQQN6JGP±KEMWRVQFTCIVQVJGTKIJV
QT±KEMFQYPVQFTCIVQVJGNGHV8QKEG1XGTCPPQWPEGUVJGCOQWPVQHVKOGVJGEWTTGPV position will trim from the recording. To execute the trim, select Trim and double-tap.
Using a Braille Display with VoiceOver
Setting Up a Braille Display
You can use a refreshable Bluetooth braille display to read VoiceOver output in braille.
In addition, braille displays with input keys and other controls can be used to control iPhone when VoiceOver is turned on. iPhone works with many wireless braille displays.
For a list of supported displays, go to www.apple.com/accessibility.
Set up a braille display:
1 Turn on the braille display.
2 On iPhone, turn on Bluetooth.
In Settings, choose General > Bluetooth, then tap the Bluetooth switch.
3 In Settings, choose General > Accessibility > VoiceOver > Braille, then choose the braille display.
6WTPEQPVTCEVGFDTCKNNGQPQTQÒ In Settings, choose General > Accessibility >
VoiceOver > Braille, then tap the Contracted Braille switch.
Choosing a Language
The braille display uses the language that’s set for Voice Control. By default, this is the language set for iPhone in Settings > International > Language. You can use
VJG8QKEG1XGTNCPIWCIGUGVVKPIVQUGVCFKÒGTGPVNCPIWCIGHQT8QKEG1XGTCPFDTCKNNG displays.
Set the language for VoiceOver: In Settings, choose General > International > Voice
Control, then choose the language.
If you change the language for iPhone, you may need to reset the language for
VoiceOver and your braille display.
Controlling VoiceOver with Your Braille Display
You can set the leftmost or rightmost cell of your braille display to provide system status and other information:
Announcement History contains an unread message
The current Announcement History message has not been read
Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
VoiceOver speech is muted
The iPhone battery is low (less than 20% charge) iPhone is in landscape orientation
6JGUETGGPFKURNC[KUVWTPGFQÒ
The current line contains additional text to the left
The current line contains additional text to the right
Set the leftmost or rightmost cell to display status information: In Settings, choose
General > Accessibility > VoiceOver > Braille > Status Cell, then tap Left or Right.
See an expanded description of the status cell: On your braille display, press the status cell’s router button.
Zoom
/CP[K2JQPGCRRUNGV[QW\QQOKPQTQWVQPURGEK°EGNGOGPVU(QTGZCORNG[QWECP double-tap or use the pinch gesture to expand webpage columns in Safari.
Zoom is also a special accessibility feature that lets you magnify the entire screen of any app you’re using, to help you see what’s on the display.
6WTP<QQOQPQTQÒ In Settings, choose General > Accessibility > Zoom and tap the
<QQO1P1ÒUYKVEJ
Note: You cannot use VoiceOver and Zoom at the same time.
Zoom in or out: &QWDNGVCRVJGUETGGPYKVJVJTGG°PIGTU$[FGHCWNVVJGUETGGPKU
OCIPK°GFRGTEGPV+H[QWOCPWCNN[EJCPIGVJGOCIPK°ECVKQPD[WUKPIVJGVCR
CPFFTCIIGUVWTGFGUETKDGFDGNQYK2JQPGCWVQOCVKECNN[TGVWTPUVQVJCVOCIPK°ECVKQP
YJGP[QW\QQOKPD[FQWDNGVCRRKPIYKVJVJTGG°PIGTU
+PETGCUGOCIPK°ECVKQP 9KVJVJTGG°PIGTUVCRCPFFTCIVQYCTFVJGVQRQHVJG
UETGGPVQKPETGCUGOCIPK°ECVKQPQTVQYCTFVJGDQVVQOQHVJGUETGGPVQFGETGCUG
OCIPK°ECVKQP6JGVCRCPFFTCIIGUVWTGKUUKOKNCTVQCFQWDNGVCRGZEGRV[QWFQP¨V
NKHV[QWT°PIGTUQPVJGUGEQPFVCR¤KPUVGCFFTCI[QWT°PIGTUQPVJGUETGGP1PEG[QW
UVCTVFTCIIKPI[QWECPFTCIYKVJCUKPING°PIGT
Move around the screen: 9JGP\QQOGFKPFTCIQT±KEMVJGUETGGPYKVJVJTGG°PIGTU
1PEG[QWUVCTVFTCIIKPI[QWECPFTCIYKVJCUKPING°PIGTUQVJCV[QWECPUGGOQTG
QHVJGUETGGP*QNFCUKPING°PIGTPGCTVJGGFIGQHVJGFKURNC[VQRCPVQVJCVUKFGQH
VJGUETGGPKOCIG/QXG[QWT°PIGTENQUGTVQVJGGFIGVQRCPOQTGSWKEMN[9JGP[QW open a new screen, Zoom always goes to the top-middle of the screen.
9JKNGWUKPI<QQOYKVJCP#RRNG9KTGNGUU-G[DQCTFUGG¥
-G[DQCTF ” on page 44), the screen image follows the insertion point, keeping it in the
center of the display.
Chapter 29 Accessibility 249
APPLE CONFIDENTIAL — First Draft (1.10.11)
Large Text
Large Text lets you make the text larger in alerts, and in Calendar, Contacts, Mail,
Messages, and Notes. You can choose 20-point, 24-point, 32-point, 40-point, 48-point, or 56-point text.
Set the text size: In Settings, choose General > Accessibility, tap Large Text, then tap the text size you want.
White on Black
Use White on Black to invert the colors on the iPhone screen, which may make it easier to read the screen. When White on Black is turned on, the screen looks like a photographic negative.
Invert the screen’s colors: In Settings, choose General > Accessibility and tap the
“White on Black” switch.
250
Mono Audio
Mono Audio combines the sound of the left and right channels into a mono signal played on both sides. This enables users with hearing impairment in one ear to hear the entire sound signal with the other ear.
6WTP/QPQ#WFKQQPQTQÒ In Settings, choose General > Accessibility and tap the
Mono Audio switch.
Speak Auto-text
Speak Auto-text speaks the text corrections and suggestions iPhone makes when you’re typing.
Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
6WTP5RGCM#WVQVGZVQPQTQÒ In Settings, choose General > Accessibility and tap the Speak Auto-text switch.
Speak Auto-text also works with VoiceOver or Zoom.
Triple-Click Home
Triple-click Home provides an easy way to turn some of the Accessibility features on
QTQÒYJGP[QWRTGUUVJG*QOG button quickly three times. You can set Triple-click
*QOGVQVWTP8QKEG1XGTQPQTQÒVWTP9JKVGQP$NCEMQPQTQÒQTRTGUGPVVJGQRVKQPU to:
6WTP8QKEG1XGTQPQTQÒ
6WTP<QQOQPQTQÒ
6WTP9JKVGQP$NCEMQPQTQÒ
6TKRNGENKEM*QOGKUVWTPGFQÒD[FGHCWNV
Set the Triple-click Home function: In Settings, choose General > Accessibility >
Triple-click Home and choose the function you want.
Closed Captioning and Other Helpful Features
Many iPhone features help make iPhone accessible to all users, including those with visual or auditory impairments.
Closed Captioning
You can turn on closed captioning for videos in iPod settings. See “Video” on page 217.
Note: Not all video content is encoded for closed captioning.
Voice Control
Voice Control (iPhone 3GS or later) lets you make phone calls and control iPod music
playback by using voice commands. See “Voice Dialing” on page 65, and “Using Voice
Control with iPod” on page 100.
Large Phone Keypad
Make phone calls simply by tapping entries in your contacts and favorites lists. When
you need to dial a number, iPhone’s large numeric keypad makes it easy. See “Phone
Widescreen Keyboards
Several apps let you rotate iPhone when you’re typing, so you can use a larger keyboard:
Chapter 29 Accessibility 251
APPLE CONFIDENTIAL — First Draft (1.10.11)
Safari
Messages
Notes
Contacts
Visual Voicemail
The play and pause controls in visual voicemail let you control the playback of messages. Drag the playhead on the scrubber bar to repeat a portion of the message
that’s hard to understand. See “Checking Voicemail” on page 72.
Assignable Ringtones
You can assign distinctive ringtones to individuals in your contacts list for audible
caller ID. You can purchase ringtones from the iTunes Store on iPhone. See “Purchasing
Instant Messaging (IM) Chat
The App Store features many Internet Messaging (IM) apps, such as AIM, BeejiveIM,
ICQ, and Yahoo! Messenger, that are optimized for iPhone.
Minimum Font Size for Mail Messages
To increase readability, set a minimum font size for Mail message text to Large, Extra
Large, or Giant. See “Mail” on page 210.
TTY Support (Available in Some Areas)
Use iPhone in TTY mode with the iPhone TTY Adapter (available separately) to use
a Teletype (TTY) machine. See “Using iPhone with a Teletype (TTY) Machine” on page 213.
Universal Access in Mac OS X
Take advantage of the Universal Access features in Mac OS X when you use iTunes to sync information and content from your iTunes library to iPhone. In the Finder, choose
Help > Mac Help, then search for “universal access.”
For more information about iPhone and Mac OS X accessibility features, go to www.
apple.com/accessibility.
252 Chapter 29 Accessibility
APPLE CONFIDENTIAL — First Draft (1.10.11)
Hearing Aid Compatibility
The FCC has adopted hearing aid compatibility rules for digital wireless phones. These rules require certain phones to be tested and rated under the American National
Standard Institute (ANSI) C63.19 hearing aid compatibility standards. The ANSI standard for hearing aid compatibility contains two types of ratings: an “M” rating for reduced radio frequency interference to enable acoustic coupling with hearing aids that do not operate in telecoil mode, and a “T” rating for inductive coupling with hearing aids operating in telecoil mode. These ratings are given on a scale from one to four, where four is the most compatible. A phone is considered hearing aid compatible under FCC rules if it is rated M3 or M4 for acoustic coupling and T3 or T4 for inductive coupling.
Please check www.apple.com/iphone/specs.html for current iPhone hearing aid compatibility ratings.
Hearing aid compatibility ratings are not a guarantee that a particular hearing aid will work with a particular phone. And some hearing aids may work well with phones that do not meet particular ratings. The best way to ensure interoperability between a hearing aid and a phone is to use them together before making a purchase.
This phone has been tested and rated for use with hearing aids for some of the wireless technologies that it uses. However, there may be some newer wireless technologies used in this phone that have not been tested yet for use with hearing
CKFU+VKUKORQTVCPVVQVT[VJGFKÒGTGPVHGCVWTGUQHVJKURJQPGVJQTQWIJN[CPFKP
FKÒGTGPVNQECVKQPUWUKPI[QWTJGCTKPICKFQTEQEJNGCTKORNCPVVQFGVGTOKPGKH[QWJGCT any interfering noise. Consult your service provider or the manufacturer of this phone for information on hearing aid compatibility. If you have questions about return or exchange policies, consult your service provider or phone retailer.
Chapter 29 Accessibility 253
254
APPLE CONFIDENTIAL — First Draft (1.10.11)
Support and Other Information
A
Apple iPhone Support Site
Comprehensive support information is available online at www.apple.com/support/ iphone. You can also use Express Lane for personalized support (not available in all countries or regions). Go to expresslane.apple.com.
Restarting and Resetting iPhone
If something isn’t working right, try restarting iPhone, force quitting an app, or resetting iPhone.
Restart iPhone: 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJGTGFUNKFGT
CRRGCTU5NKFG[QWT°PIGTCETQUUVJGUNKFGTVQVWTPQÒK2JQPG6QVWTPK2JQPGDCEMQP
RTGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPWPVKNVJG#RRNGNQIQCRRGCTU
+H[QWECP¨VVWTPQÒK2JQPGQTKHVJGRTQDNGOEQPVKPWGU[QWOC[PGGFVQTGUGVK2JQPG
#TGUGVUJQWNFDGFQPGQPN[KHVWTPKPIK2JQPGQÒCPFQPFQGUP¨VTGUQNXGVJGRTQDNGO
Force quit an app: 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPHQTCHGYUGEQPFU until a red slider appears, then press and hold the Home button until the app quits. On iPhone 3GS or later, you can also remove an app from the recents list to force it to quit.
See “Opening and Switching Apps” on page 29.
Reset iPhone: 2TGUUCPFJQNFVJG1P1Ò5NGGR9CMGDWVVQPCPFVJG*QOGDWVVQPCV the same time for at least ten seconds, until the Apple logo appears.
Backing Up iPhone
iTunes creates backups of settings, downloaded apps and data, and other information on iPhone. You can use a backup to restore these items to your iPhone after a software
APPLE CONFIDENTIAL — First Draft (1.10.11)
Backing up iPhone or restoring from a backup isn’t the same as syncing content and other items (such as music, podcasts, ringtones, photos, videos, and apps that you download via iTunes) with your iTunes library. Backups include settings, downloaded apps and data, and other information on iPhone. After you restore iPhone, you need to sync again to get your music, videos, photos, apps, and other content back on iPhone.
See “Restoring from a Backup” on page 257.
Apps downloaded from the App Store are backed up the next time you sync with iTunes. Afterwards, only app data is backed up when you sync with iTunes.
Creating a Backup
iTunes creates a backup of iPhone when you:
Sync with iTunes
By default, iTunes syncs iPhone each time you connect iPhone to your computer.
See “Syncing with iTunes” on page 56. iTunes won’t automatically back up an iPhone
VJCVKUP¨VEQP°IWTGFVQU[PEYKVJVJCVEQORWVGT;QWECPCNUQU[PEOCPWCNN[D[ clicking Sync in iTunes. Note that iTunes creates a backup only once each time
K2JQPGKUEQPPGEVGFVQ[QWTEQORWVGTDGHQTGVJG°TUVU[PEVJCVQEEWTU+H[QWU[PE again, iTunes doesn’t create another backup.
Update iPhone
K6WPGUDCEMUWRK2JQPGDGHQTGWRFCVKPIK2JQPGGXGPKHKVKUP¨VEQP°IWTGFVQU[PE with iTunes on that computer.
Restore iPhone (if you choose to back up) iTunes asks if you want to back up iPhone before restoring it.
For more information about backups, including the settings and information stored in a backup, go to support.apple.com/kb/HT1766.
Removing a Backup
You can remove a backup of iPhone from the list of backups in iTunes. You may want to do this, for example, if a backup was created on someone else’s computer.
Remove a backup:
1 In iTunes, open iTunes Preferences.
Mac: Choose iTunes > Preferences.
Windows: Choose Edit > Preferences.
2 Click Devices (iPhone doesn’t need to be connected).
3 Select the backup you want to remove, then click Delete Backup.
4 %QP°TO[QWYKUJVQTGOQXGVJGUGNGEVGFDCEMWRD[ENKEMKPI&GNGVG$CEMWR
5 %NKEM1-VQENQUGVJGK6WPGU2TGHGTGPEGU9KPFQY
Appendix A Support and Other Information 255
256
APPLE CONFIDENTIAL — First Draft (1.10.11)
Updating and Restoring iPhone Software
You can use iTunes to update or restore iPhone software.
If you update, the iPhone software is updated. Your downloaded apps, settings, and
FCVCCTGP¨VCÒGEVGF
Note: In some cases, an update may also involve restoring iPhone.
If you restore, the latest version of iPhone software is reinstalled, settings are restored to their default, and all data stored on iPhone is deleted, including downloaded apps, songs, videos, contacts, photos, calendar information, and any other data. If you’ve backed up iPhone with iTunes on your computer, you can restore data from the backup at the end of the restore process.
Deleted data is no longer accessible via the iPhone user interface, but it isn’t erased
If you use a Bluetooth headset or car kit with iPhone and you restore settings, you must pair the Bluetooth device with iPhone again to use it.
For more information about updating and restoring iPhone software, go to support.
apple.com/kb/HT1414.
Updating iPhone
Make sure you have an Internet connection and have installed the latest version of iTunes from www.apple.com/itunes.
Update iPhone:
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen.
3 Click “Check for Update.” iTunes tells you if there’s a newer version of the iPhone software available.
4 Click Update to install the latest version of the software.
Restoring iPhone
Make sure you have an Internet connection and have installed the latest version of iTunes from www.apple.com/itunes.
Restore iPhone:
1 Connect iPhone to your computer.
2 In iTunes, select iPhone in the Devices list, then click Summary at the top of the screen.
3 Click “Check for Update.” iTunes tells you if there’s a newer version of the iPhone software available.
Appendix A Support and Other Information
APPLE CONFIDENTIAL — First Draft (1.10.11)
4 Click Restore. Follow the onscreen instructions to complete the restore process. When restoring, it is recommended that you back up iPhone when prompted.
When the iPhone software has been restored, you can either set it up as a new iPhone, or restore your music, videos, app data, and other content from a backup.
After you restore from a backup, previous data is no longer accessible through the iPhone user interface, but it isn’t erased from iPhone. For information about erasing all
content and settings, see “Resetting iPhone” on page 207.
Restoring from a Backup
You can restore the settings, app data, and other information from a backup, or use this feature to transfer these items to another iPhone. Make sure you have an Internet connection and have installed the latest version of iTunes from www.apple.com/itunes.
Important: Restoring from a backup is not the same as restoring iPhone from the
Summary pane in iTunes. See “Restoring iPhone” on page 256. Restoring from a backup
does not fully restore iPhone software. Also, restoring iPhone from a backup restores all data in the backup, including data for apps. If you choose an old backup, restoring from it could replace the app data with data that is not current.
If you restore iPhone from a backup of some other iPhone or iPod touch, some passwords and settings may not be restored. (Additional, but still not all, passwords and settings may be restored if the backup is encrypted.) For more information about the settings and information stored in a backup, go to support.apple.com/kb/HT1766.
Restore iPhone from a backup:
1 Connect iPhone to the computer you normally sync with.
2 In iTunes, Control-click iPhone in the Devices list and choose “Restore from Backup” from the menu that appears.
3 Choose the backup that you want to restore from the pop-up menu, then click Restore.
If your backup is encrypted, enter your password.
Safety, Software, and Service Information
This table describes where to get more iPhone-related safety, software, and service information.
Appendix A Support and Other Information 257
258
APPLE CONFIDENTIAL — First Draft (1.10.11)
To learn about
Using iPhone safely
Do this
See the Important Product Information Guide at www.apple.com/support/manuals/iphone for the latest safety and regulatory information.
Go to www.apple.com/support/iphone.
iPhone service and support, tips, forums, and
Apple software downloads
Service and support from your carrier
The latest information about iPhone
Using iTunes
Contact your carrier or go to your carrier’s website.
Go to www.apple.com/iphone.
Open iTunes and choose Help > iTunes Help. For an online iTunes tutorial (may not be available in all countries and regions), go to www.apple.com/ support/itunes.
Go to appleid.apple.com.
Go to www.me.com.
Creating an Apple ID
MobileMe
Using iPhoto on Mac OS X
Using Address Book on Mac OS X
Open iPhoto and choose Help > iPhoto Help.
Open Address Book and choose Help > Address
Book Help.
Using iCal on Mac OS X
Microsoft Outlook, Windows Address Book, or
Adobe Photoshop Elements
Finding your iPhone serial number,
International Mobile Equipment Identity (IMEI),
QT/QDKNG'SWKROGPV+FGPVK°GT/'+&
Obtaining warranty service
Battery replacement service
Open iCal and choose Help > iCal Help.
See the documentation that came with those apps.
;QWECP°PF[QWTK2JQPGUGTKCNPWODGTCPF+/'+
(GSM models) or MEID (CDMA model) on the iPhone packaging. Or, on iPhone, choose Settings
> General > About. In iTunes on your computer, hold down the Control key and choose Help
> About iTunes (Windows) or iTunes > About iTunes (Mac), then release the Control key. (Press the Space bar to pause the scrolling.)
First follow the advice in this guide and online resources. Then go to www.apple.com/support or see the Important Product Information Guide at www.apple.com/support/manuals/iphone.
Go to www.apple.com/support/iphone/service/ battery.
Using iPhone in an Enterprise Environment
Go to www.apple.com/iphone/business to learn more about enterprise features of iPhone, including:
Microsoft Exchange
+PUVCNNKPIEQP°IWTCVKQPRTQ°NGU
Appendix A Support and Other Information
APPLE CONFIDENTIAL — First Draft (1.10.11)
CalDAV
CardDAV
IMAP
LDAP
VPN
Using iPhone with Other Carriers
Some carriers let you unlock iPhone for use with their network. To determine if your
ECTTKGTQÒGTUVJKUQRVKQPIQVQ support.apple.com/kb/HT1937.
Contact your carrier for authorization and setup information. You’ll need to connect iPhone to iTunes to complete the process. Additional fees may apply.
For troubleshooting information, go to support.apple.com/kb/TS3198.
Disposal and Recycling Information
Apple Used Mobile Phone Recycling Program (available in some areas): For free recycling of your old mobile phone, a prepaid shipping label, and instructions, see: www.apple.com/recycling iPhone Disposal and Recycling: You must dispose of iPhone properly according to local laws and regulations. Because iPhone contains electronic components and a battery, iPhone must be disposed of separately from household waste. When iPhone reaches its end of life, contact local authorities to learn about disposal and recycling
QRVKQPUQTUKORN[FTQRKVQÒCV[QWTNQECN#RRNGTGVCKNUVQTGQTTGVWTPKVVQ#RRNG6JG battery will be removed and recycled in an environmentally friendly manner. For more information, see: www.apple.com/recycling
European Union—Electronics and Battery Disposal Information:
This symbol means that according to local laws and regulations your product and its battery should be recycled separately from household waste. When this product reaches its end of life, take it to a collection point designated by local authorities for the recycling of electronic equipment. The improper disposal of waste electronic
GSWKROGPVHTQOVJGEQPUWOGTOC[DGUWDLGEVVQ°PGU6JGUGRCTCVGEQNNGEVKQPCPF recycling of your product and its battery at the time of disposal will help conserve natural resources and ensure that it is recycled in a manner that protects human health and the environment.
Appendix A Support and Other Information 259
260
APPLE CONFIDENTIAL — First Draft (1.10.11)
For collection and recycling services for iPhone, go to: www.apple.com/recycling/ nationalservices/europe.html
Battery Replacement for iPhone: The rechargeable battery in iPhone should be replaced only by an authorized service provider. For battery replacement services go to: www.apple.com/support/iphone/service/battery
Deutschland: Dieses Gerät enthält Batterien. Bitte nicht in den Hausmüll werfen.
Entsorgen Sie dieses Gerätes am Ende seines Lebenszyklus entsprechend der maßgeblichen gesetzlichen Regelungen.
Nederlands: Gebruikte batterijen kunnen worden ingeleverd bij de chemokar of in een speciale batterijcontainer voor klein chemisch afval (kca) worden gedeponeerd.
Türkiye: '''[{PGVOGNKI KPG'NGMVTKMNKXG'NGMVTQPKM'U [CNCTFC$C\Æ<CTCTNÆ/CFFGNGTKP
-WNNCPÆOÆPÆP5ÆPÆTNCPFÆTÆNOCUÆPC&CKT;{PGVOGNKMW[IWPFWT
Taiwan:
Brazil—Disposal Information:
Brasil—Informações sobre descarte e reciclagem: O símbolo indica que este produto e/ou sua bateria não devem ser descartadas no lixo doméstico. Quando decidir descartar este produto e/ou sua bateria, faça-o de acordo com as leis e diretrizes ambientais locais. Para informações sobre o programa de reciclagem da Apple, pontos de coleta e telefone de informações, visite www.apple.com/br/environment.
Apple and the Environment
At Apple, we recognize our responsibility to minimize the environmental impacts of our operations and products. For more information, go to: www.apple.com/ environment
iPhone Operating Temperature
If the interior temperature of iPhone exceeds normal operating temperatures, you may experience the following as it attempts to regulate its temperature: iPhone stops charging the screen dims
Appendix A Support and Other Information
APPLE CONFIDENTIAL — First Draft (1.10.11)
the cellular signal is weak a temperature warning screen appears
Important: You cannot use iPhone while the temperature warning screen is displayed, except to make an emergency call. If iPhone can’t regulate its internal temperature, it goes into a deep sleep mode until it cools. You cannot make an emergency call when iPhone is in this mode. Move iPhone to a cooler location and wait a few minutes before trying to use iPhone again.
Appendix A Support and Other Information 261
262
APPLE CONFIDENTIAL — First Draft (1.10.11)
Index
A accessibility
setting up iPhone using VoiceOver 21
airplane mode
AirPlay
See also printing alarms
album artwork 101 album tracks 101
alerts
VWTPKPIQPQTQÒ
anti-phishing. See Safari fraud warning
App Store
syncing purchased content 183 updating applications 183
Apple ID, creating 21, 26, 173, 174, 181, 185, 218, 258
#RRNG9KTGNGUU-G[DQCTF
audio
auto-lock, setting time for 201
B
backups
battery
low on power 53 maximizing life 53
birthdays, viewing in Calendar 116
Bluetooth
°PFKPICFFTGUU
bookmarking
books
°PFKPI
braille, display using VoiceOver 248
brightness
setting to adjust automatically 197
browsing
DWUKPGUUGU°PFKPI
C
cable, Dock Connector to USB 11, 21
Calendar
Index
calendars, syncing 57, 59, 115
ECNNYCKVKPIVWTPKPIQPQTQÒ
75, 212 caller ID, hiding or showing 212
Camera
deleting photos 131 exposure 131
±CUJUGVVKPIU
131 focus 131 front camera 70, 131
seeing photos and videos you’ve taken 131
upload photos to your computer 132
ENQUGFECRVKQPKPIVWTPKPIQPQTQÒ
Compass
current coordinates 162 heading 162
contacts
263
264
GAL (Global Address List) 85, 220
LDAP (Lightweight Directory Access
setting how displayed 211 setting how sorted 211
using to make a FaceTime video call 69
copying
photos and videos in MMS messages 112
current approximate location 146, 162
D
data, erasing 25, 54, 202, 207
deleting
all content and settings 54, 207
YouTube videos from a playlist 137
disconnecting iPhone from computer 21
Dock Connector to USB cable 11, 21
Index downloading
E earphones
center button 11, 65, 66, 67, 97, 100, 105
See also headset
editing
GÒGEVUUQWPFUVWTPKPIQPQTQÒ
enterprise, using iPhone in 258
Exchange. See Microsoft Exchange
F
calling someone you've texted 113
VWTPKPIQPQTQÒ
calling a contact from 64, 74 managing 74
°NGUJCTKPI
±CUJUGVVKPIUHQT%COGTC
force quitting an application 55, 254
formats
date, time, and telephone number 207
G
GAL (Global Address List) 85, 220
Game Center
restricting friend requests 204 restricting multiplayer games 204
H
hands-free phone calls 67, 200
headset
See also earphones headset button. See mic button
Home button, double-click settings 200
I
icons
images
IMAP
Index
installing, applications from the App Store 181
international keyboards 40, 205, 206
iPod
converting videos for iPhone 107
playing songs using Voice Control 100
5JCMGVQ5JWÔG
iTunes Store
account 19, 169, 174, 178, 218
purchasing songs and albums 173
streaming or downloading podcasts 175
iTunes
J
K
-CPC 41 kaomoji (facemarks) 41
keyboards
keypad
265
266
displaying by default with VoiceOver 244
entering information during a call 67
-QTGCMG[DQCTF
L
languages, switching keyboard 44
LDAP (Lightweight Directory Access Protocol) 220
.'&±CUJ
links
location. See Maps location services
resetting location warnings 208
Lock screen wallpaper 36, 128, 197
M
checking for new messages 79, 86
deleting messages 86 forwarding messages 86
load additional messages 81 marking messages as unread 81
printing messages and attachments 84
sending email to someone you’ve texted 113
sending webpage URL via email 91
sending YouTube video links 135
sharing contact information 86
storing email on iPhone or server 209
syncing email account settings 57
Maps
adding location to a contact 149 bookmarking location 149
current approximate location 143, 146
hybrid view 145 satellite view 145
seeing location of a contact 142
VTCÓEEQPFKVKQPU
Messages
contacting someone you’ve texted 113 editing conversations 113
following links in messages 114 previews 114
saving a photo or video clip 112
sending a photo or video clip 112, 113
sending messages to a group 111
microphone
Microsoft Internet Explorer 59, 93
missed calls
MMS 110, 121, 143, 149, 167, 215
Index
See also Messages
sending photos to a gallery 126
movies
music
See also iPod
N navigating. See panning, scrolling network activity
Nike + iPod
linking a sensor 226 sending workouts to nikeplus.com 226
working out with 226 nikeplus.com 226
numeric keypad
displaying by default with VoiceOver 244
entering information during a call 67
O
Index
Outlook Express. See Windows Address Book
Outlook. See Microsoft Outlook
overview, iPhone applications 13
P
pairing with Bluetooth headset 51
panning
parental controls. See Restrictions
password, changing voicemail 213
pasting
photos and videos in MMS messages 112
Phone
adding and editing contacts 221
calling someone you’ve texted 113
changing voicemail password 213
hiding or showing caller ID 212
switching between calls 50, 67
267
268
voicemail 72 voicemail alerts 72
photos
using as wallpaper 36, 128, 197
Photos
playing music during slideshow 124
See also Camera pictures. See Camera, Photos
podcasts
previewing
printing
email messages and attachments 84
purchased content, syncing 176, 183
purchasing
Index
R
renting,movies and TV shows 60, 106, 108, 174
requirements for using iPhone 19
restoring settings and information 257
ringer
VWTPKPIQPQTQÒ
ringtones
S
Safari
clearing cache 215 cookies 215
creating a new or adding to an existing
contact 91 creating a preaddressed Mail message 91
Debug Console 215 developer settings 215 fraud warning 215
TGUK\KPIEQNWOPUVQ°VUETGGP
saving images to your Photo Library 91
stopping webpages from loading 90
screen 197 setting to adjust automatically 197
scrolling
searching
security
erase data after ten failed passcode attempts 202
setting passcode for iPhone 201
sending
198, 258 service and support information 258
settings
auto-capitalization 205 auto-correction 39, 205
PQVK°ECVKQPU
5JCMGVQ5JWÔG
sharing photos and videos
UJWÔKPIUQPIU
sleep. See locking iPhone
See also Messages software
Index 269
270
sound
adjusting ringer and alerts volume 197
star next to a phone number 222
Starbucks, browsing and purchasing music 170
Stocks, adding and deleting quotes 139
switching between cameras 70, 131
syncing
T
telephone. See Phone
text
entering and editing using VoiceOver 244
Index
text messaging. See Messages
time zone support 116, 120, 204, 211
timer
transferring
°NGU
purchased content 62, 176, 183
settings and information 254, 257
troubleshooting
backing up 254 restarting 55, 254
software update and restore 256
TV shows
TV, viewing content on 107, 124
typing
KPYGDRCIGVGZV°GNFU
U
usage statistics
battery percentage 198 resetting 198 seeing 198
USB
V
videos
See also iPod, Music, YouTube
virtual private network. See VPN
Voice Control
Voice Memos
attaching to MMS messages 167 emailing 167
voicemail
checking and managing 72 greeting 72 setting up 72
VoiceOver
volume
adjusting for ringer and alerts 197
VPN
Index
W
weather information, Yahoo! 151
Weather
deleting cities 151 temperature settings 151
web. See Safari
web clips, adding to Home screen 94
webpages
Wi-Fi
joining networks 22, 194 settings 194
VWTPKPIQPQTQÒ
Windows system requirements 19
Y
YouTube
Z
Zoom (accessibility feature) 249
zooming
271
APPLE CONFIDENTIAL — First Draft (1.10.11)
%
Apple Inc.
© 2010 Apple Inc. All rights reserved.
Apple, the Apple logo, AirPlay, Apple TV, Cover Flow,
FaceTime, iBooks, iCal, iPhone, iPhoto, iPod, iTunes,
-G[PQVG/CE/CEKPVQUJ/CE150WODGTU2CIGU
QuickTime, Safari, Spotlight, and the Works with iPhone logo are trademarks of Apple Inc., registered in the U.S. and other countries.
AirPrint, Finder, iPad, the Made for iPhone logo, Multi-
6QWEJ4GVKPCCPF5JWÔGCTGVTCFGOCTMUQH#RRNG+PE
Apple Store and iTunes Store are service marks of Apple
Inc., registered in the U.S. and other countries.
App Store and MobileMe are service marks of Apple Inc.
IOS is a trademark or registered trademark of Cisco in the U.S. and other countries and is used under license.
6JG0KMGK2QF5RQTV-KVKUEQXGTGFD[QPGQTOQTG of U.S. patent numbers 6,018,705, 6,052,654, 6,493,652,
6,298,314, 6,611,789, 6,876,947, and 6,882,955, either alone or when used in combination with a Nike + iPod enabled iPod media player or iPhone 3GS or later.
The Bluetooth® word mark and logos are registered trademarks owned by Bluetooth SIG, Inc. and any use of such marks by Apple Inc. is under license.
Adobe and Photoshop are trademarks or registered trademarks of Adobe Systems Incorporated in the U.S. and/or other countries.
Other company and product names mentioned herein may be trademarks of their respective companies.
Mention of third-party products is for informational purposes only and constitutes neither an endorsement nor a recommendation. Apple assumes no responsibility with regard to the performance or use of these products. All understandings, agreements, or warranties, if any, take place directly between the vendors and the
RTQURGEVKXGWUGTU'XGT[GÒQTVJCUDGGPOCFGVQGPUWTG that the information in this manual is accurate. Apple is not responsible for printing or clerical errors.
019-1930/2010-11
Download
Advertisement
Key features
Touchscreen interface
Built-in camera
Wi-Fi and cellular data connectivity
App Store for downloading apps
Music and video playback
Email, calendar, and contacts
GPS navigation
Voice control
FaceTime video calling (iPhone 4 only)
Frequently asked questions
iPhone can connect to the internet using either a Wi-Fi network or a cellular data network, and it will automatically connect to the last Wi-Fi network you used that’s available, or you can join a Wi-Fi network or connect to the internet over a cellular data network (3G, EDGE, or GPRS).
iPhone works with MobileMe, Microsoft Exchange, and many of the most popular Internet-based email, contacts, and calendar service providers. You can add contacts using an LDAP or CardDAV account; you can add a CalDAV calendar account. You can also subscribe to iCal (.ics) calendars or import them from Mail.
You can take photos, and record videos (iPhone 3GS or later) with the camera, view them on iPhone, email them, send them in an MMS message, or upload them to your computer.